data_4A3E
# 
_entry.id   4A3E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4A3E         
PDBE  EBI-49856    
WWPDB D_1290049856 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1TWC unspecified 'RNA POLYMERASE II COMPLEXED WITH GTP'                                                                 
PDB 4A3K unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 7NT DNA-RNA HYBRID'                             
PDB 1Y77 unspecified 'COMPLETE RNA POLYMERASE II ELONGATION COMPLEX WITHSUBSTRATE ANALOGUE GMPCPP'                          
PDB 1R9S unspecified 'RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MATCHED NUCLEOTIDE'                            
PDB 1TWG unspecified 'RNA POLYMERASE II COMPLEXED WITH CTP'                                                                 
PDB 1SFO unspecified 'RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX'                                                
PDB 4A3F unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 6NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 1I50 unspecified 'RNA POLYMERASE II CRYSTAL FORM II AT 2.8 A RESOLUTION'                                                
PDB 4A3D unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 6NT DNA-RNA HYBRID'                             
PDB 1R5U unspecified 'RNA POLYMERASE II TFIIB COMPLEX'                                                                      
PDB 1DZF unspecified 'RPB5 FROM S.CEREVISIAE'                                                                               
PDB 1Y14 unspecified 'CRYSTAL STRUCTURE OF YEAST SUBCOMPLEX OF RPB4 AND RPB7'                                               
PDB 1Y1W unspecified 'COMPLETE RNA POLYMERASE II ELONGATION COMPLEX'                                                        
PDB 1NT9 unspecified 'COMPLETE 12-SUBUNIT RNA POLYMERASE II'                                                                
PDB 1I3Q unspecified 'RNA POLYMERASE II CRYSTAL FORM I AT 3.1 A RESOLUTION'                                                 
PDB 1PQV unspecified 'RNA POLYMERASE II-TFIIS COMPLEX'                                                                      
PDB 1TWF unspecified 'RNA POLYMERASE II COMPLEXED WITH UTP AT 2.3 A RESOLUTION'                                             
PDB 4A3G unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 2NT DNA-RNA HYBRID'                             
PDB 4A3C unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 5NT DNA-RNA HYBRID'                             
PDB 4A3I unspecified 'RNA POLYMERASE II BINARY COMPLEX WITH DNA'                                                            
PDB 4A3B unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 4NT DNA-RNA HYBRID'                             
PDB 1I6H unspecified 'RNA POLYMERASE II ELONGATION COMPLEX'                                                                 
PDB 1Y1V unspecified 'REFINED RNA POLYMERASE II-TFIIS COMPLEX'                                                              
PDB 1Y1Y unspecified 'RNA POLYMERASE II-TFIIS-DNA/RNA COMPLEX'                                                              
PDB 1WCM unspecified 'COMPLETE 12-SUBUNIT RNA POLYMERASE II AT 3.8 A'                                                       
PDB 4A3M unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 4NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 1TWA unspecified 'RNA POLYMERASE II COMPLEXED WITH ATP'                                                                 
PDB 1NIK unspecified 'WILD TYPE RNA POLYMERASE II'                                                                          
PDB 2VUM unspecified 'ALPHA-AMANITIN INHIBITED COMPLETE RNA POLYMERASE II ELONGATION COMPLEX'                               
PDB 1TWH unspecified 
;RNA POLYMERASE II COMPLEXED WITH 2'DATP
;
PDB 1R9T unspecified 'RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MISMATCHED NUCLEOTIDE'                         
PDB 2JA7 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX C'                                         
PDB 2JA6 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX B'                                         
PDB 4A3L unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 7NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 1A1D unspecified 'YEAST RIBONUCLEIC ACID POLYMERASE SUBUNIT RPB8, NMR, MINIMIZED AVERAGE STRUCTURE, ALPHA CARBONS ONLY' 
PDB 1K83 unspecified 'CRYSTAL STRUCTURE OF YEAST RNA POLYMERASE II COMPLEXED WITHTHE INHIBITOR ALPHA AMANITIN'              
PDB 2B63 unspecified 'COMPLETE RNA POLYMERASE II-RNA INHIBITOR COMPLEX'                                                     
PDB 2B8K unspecified '12-SUBUNIT RNA POLYMERASE II'                                                                         
PDB 2JA8 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX D'                                         
PDB 2JA5 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX A'                                         
PDB 4A3J unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 2NT DNA-RNA HYBRID AND SOAKED WITH GMPCPP'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A3E 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-09-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheung, A.C.M.' 1 
'Sainsbury, S.'  2 
'Cramer, P.'     3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of initial RNA polymerase II transcription.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            30 
_citation.page_first                4755 
_citation.page_last                 4763 
_citation.year                      2011 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           1460-2075 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22056778 
_citation.pdbx_database_id_DOI      10.1038/emboj.2011.396 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cheung, A.C.'  1 ? 
primary 'Sainsbury, S.' 2 ? 
primary 'Cramer, P.'    3 ? 
# 
_cell.entry_id           4A3E 
_cell.length_a           223.680 
_cell.length_b           394.170 
_cell.length_c           283.290 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A3E 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1'                                                            
191664.391 1 2.7.7.6 ? 'RESIDUES 1-1732' ? 
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2'                                                            
138937.297 1 2.7.7.6 ? ?                 ? 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3'                                                            
35330.457  1 ?       ? ?                 ? 
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4'                                                            
25451.191  1 ?       ? ?                 ? 
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1'                                            
25117.094  1 ?       ? ?                 ? 
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2'                                            
17931.834  1 ?       ? ?                 ? 
7  polymer     nat 'RPB7, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7'                                                      
19081.053  1 ?       ? ?                 ? 
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3'                                            
16525.363  1 ?       ? ?                 ? 
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9'                                                            
14308.161  1 ?       ? ?                 ? 
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5'                                            
8290.732   1 ?       ? ?                 ? 
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11'                                                           
13633.493  1 ?       ? ?                 ? 
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4'                                            
7729.969   1 ?       ? ?                 ? 
13 polymer     syn 
;NON TEMPLATE DNA 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP*AP *GP*CP*TP)-3'
;
4294.814   1 ?       ? ?                 ? 
14 polymer     syn 
;TRANSCRIPT RNA 5'-R(*CP*AP*GP*GP*AP)-3'
;
1609.047   1 ?       ? ?                 ? 
15 polymer     syn 
;TEMPLATE DNA 5'-D(*AP*GP*CP*TP*CP*AP*AP*GP*TP*AP*CP*TP*TP *TP*TP*TP*CP*CP*BRU*GP*GP*TP*CP*AP*TP*TP)-3'
;
7983.981   1 ?       ? ?                 ? 
16 non-polymer syn 'ZINC ION'                                                                                               65.409 
8 ?       ? ?                 ? 
17 non-polymer syn 'MAGNESIUM ION'                                                                                          24.305 
1 ?       ? ?                 ? 
18 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER'                                                          
505.208    1 ?       ? ?                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RPB1, RNA POLYMERASE II SUBUNIT 1, RNA POLYMERASE II SUBUNIT B1, DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT, RNA POLYMERASE II SUBUNIT B220
;
2  'RPB2, RNA POLYMERASE II SUBUNIT 2, B150, DNA-DIRECTED RNA POLYMERASE II 140 KDA POLYPEPTIDE' 
3  'RPB3, RNA POLYMERASE II SUBUNIT 3, RNA POLYMERASE II SUBUNIT B3, B44.5, DNA-DIRECTED RNA POLYMERASE II 45 KDA POLYPEPTIDE' 
4  'RPB4, RNA POLYMERASE II SUBUNIT B4, B32, DNA-DIRECTED RNA POLYMERASE II 32 KDA POLYPEPTIDE' 
5  'RPB5, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC1, ABC27, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 27 KDA POLYPEPTIDE' 
6  'RPB6, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC2, ABC23, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 23 KDA POLYPEPTIDE' 
7  'RNA POLYMERASE II SUBUNIT B7, B16' 
8  
;RPB8, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC3, ABC14.4, ABC14.5, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 14.5 KDA POLYPEPTIDE
;
9  
;RBP9, RNA POLYMERASE II SUBUNIT B9, B12.6, DNA-DIRECTED RNA POLYMERASE II 14.2 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE II SUBUNIT 9
;
10 
;RPB10, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC5, ABC10-BETA, ABC8, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 8.3 KDA POLYPEPTIDE
;
11 'RPB11, RNA POLYMERASE II SUBUNIT B11, B13.6, DNA-DIRECTED RNA POLYMERASE II 13.6 KDA POLYPEPTIDE' 
12 'RPB12, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC4, ABC10-ALPHA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENS
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENS
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D ? 
5  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G ? 
8  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 polydeoxyribonucleotide no no  '(DT)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DG)(DA)(DG)(DC)(DT)' TAAGTACTTGAGCT N ? 
14 polyribonucleotide      no no  CAGGA CAGGA P ? 
15 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DC)(BRU)
(DG)(DG)(DT)(DC)(DA)(DT)(DT)
;
AGCTCAAGTACTTTTTCCUGGTCATT T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    DT  n 
13 2    DA  n 
13 3    DA  n 
13 4    DG  n 
13 5    DT  n 
13 6    DA  n 
13 7    DC  n 
13 8    DT  n 
13 9    DT  n 
13 10   DG  n 
13 11   DA  n 
13 12   DG  n 
13 13   DC  n 
13 14   DT  n 
14 1    C   n 
14 2    A   n 
14 3    G   n 
14 4    G   n 
14 5    A   n 
15 1    DA  n 
15 2    DG  n 
15 3    DC  n 
15 4    DT  n 
15 5    DC  n 
15 6    DA  n 
15 7    DA  n 
15 8    DG  n 
15 9    DT  n 
15 10   DA  n 
15 11   DC  n 
15 12   DT  n 
15 13   DT  n 
15 14   DT  n 
15 15   DT  n 
15 16   DT  n 
15 17   DC  n 
15 18   DC  n 
15 19   BRU n 
15 20   DG  n 
15 21   DG  n 
15 22   DT  n 
15 23   DC  n 
15 24   DA  n 
15 25   DT  n 
15 26   DT  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
13 1 sample ? ? 'SACCHAROMYCES CEREVISIAE' 
;BAKER'S YEAST
;
4932 ? 
14 1 sample ? ? 'SACCHAROMYCES CEREVISIAE' 
;BAKER'S YEAST
;
4932 ? 
15 1 sample ? ? 'SACCHAROMYCES CEREVISIAE' 
;BAKER'S YEAST
;
4932 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  1  ? ? P04050 ? 
2  UNP RPB2_YEAST  2  ? ? P08518 ? 
3  UNP RPB3_YEAST  3  ? ? P16370 ? 
4  UNP RPB4_YEAST  4  ? ? P20433 ? 
5  UNP RPAB1_YEAST 5  ? ? P20434 ? 
6  UNP RPAB2_YEAST 6  ? ? P20435 ? 
7  UNP RPB7_YEAST  7  ? ? P34087 ? 
8  UNP RPAB3_YEAST 8  ? ? P20436 ? 
9  UNP RPB9_YEAST  9  ? ? P27999 ? 
10 UNP RPAB5_YEAST 10 ? ? P22139 ? 
11 UNP RPB11_YEAST 11 ? ? P38902 ? 
12 UNP RPAB4_YEAST 12 ? ? P40422 ? 
13 PDB 4A3E        13 ? ? 4A3E   ? 
14 PDB 4A3E        14 ? ? 4A3E   ? 
15 PDB 4A3E        15 ? ? 4A3E   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4A3E A 1 ? 1732 ? P04050 1 ? 1732 ? 1 1732 
2  2  4A3E B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  4A3E C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  4A3E D 1 ? 221  ? P20433 1 ? 221  ? 1 221  
5  5  4A3E E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
6  6  4A3E F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
7  7  4A3E G 1 ? 171  ? P34087 1 ? 171  ? 1 171  
8  8  4A3E H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
9  9  4A3E I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
10 10 4A3E J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
11 11 4A3E K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
12 12 4A3E L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
13 13 4A3E N 1 ? 14   ? 4A3E   1 ? 14   ? 1 14   
14 14 4A3E P 1 ? 5    ? 4A3E   6 ? 10   ? 6 10   
15 15 4A3E T 1 ? 26   ? 4A3E   4 ? 29   ? 4 29   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE"      ?                                               
'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ?                                               
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"             ?                                               
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ?                                               'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                      ?                                               'Zn 2' 
65.409  
# 
_exptl.entry_id          4A3E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      7.00 
_exptl_crystal.density_percent_sol   82.29 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   . 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9188 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.9188 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4A3E 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.40 
_reflns.number_obs                   167046 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.0 
_reflns.pdbx_Rmerge_I_obs            0.63 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.60 
_reflns.B_iso_Wilson_estimate        122.89 
_reflns.pdbx_redundancy              3.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4A3E 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     167011 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             54.61 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    97.77 
_refine.ls_R_factor_obs                          0.1603 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1597 
_refine.ls_R_factor_R_free                       0.1878 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.99 
_refine.ls_number_reflns_R_free                  3319 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9473 
_refine.correlation_coeff_Fo_to_Fc_free          0.9208 
_refine.B_iso_mean                               125.78 
_refine.aniso_B[1][1]                            -4.5594 
_refine.aniso_B[2][2]                            20.0388 
_refine.aniso_B[3][3]                            -15.4795 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;IDEAL-DIST CONTACT TERM CONTACT SETUP. RESIDUE TYPES WITHOUT CCP4 ATOM TYPE IN LIBRARY=ZN MG BRU APC. NUMBER OF ATOMS WITH PROPER CCP4 ATOM TYPE=31795. NUMBER WITH APPROX DEFAULT CCP4 ATOM TYPE=51. NUMBER TREATED BY BAD NON- BONDED CONTACTS=9.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.489 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.280 
_refine.pdbx_overall_SU_R_Blow_DPI               0.444 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.270 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4A3E 
_refine_analyze.Luzzati_coordinate_error_obs    0.749 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31195 
_refine_hist.pdbx_number_atoms_nucleic_acid   620 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               31855 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        54.61 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  32478 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.33  ? 2.00  43978 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  11640 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  857   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  4561  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 32478 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  1     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           2.86  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           23.88 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  4278  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? 1.00  66    'X-RAY DIFFRACTION' HARMONIC     
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  37247 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.40 
_refine_ls_shell.d_res_low                        3.49 
_refine_ls_shell.number_reflns_R_work             12261 
_refine_ls_shell.R_factor_R_work                  0.2289 
_refine_ls_shell.percent_reflns_obs               97.77 
_refine_ls_shell.R_factor_R_free                  0.2628 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            2.05 
_refine_ls_shell.number_reflns_R_free             256 
_refine_ls_shell.number_reflns_all                12517 
_refine_ls_shell.R_factor_all                     0.2296 
# 
_struct.entry_id                  4A3E 
_struct.title                     'RNA Polymerase II initial transcribing complex with a 5nt DNA-RNA hybrid and soaked with AMPCPP' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2, RPB7, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A3E 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, TRANSCRIPTION INITIATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 16 ? 
Q N N 16 ? 
R N N 17 ? 
S N N 16 ? 
T N N 16 ? 
U N N 16 ? 
V N N 16 ? 
W N N 16 ? 
X N N 16 ? 
Y N N 18 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? VAL A 106  ? PHE A 95   VAL A 106  1 ? 12 
HELX_P HELX_P3   3   ASN A 119  ? ILE A 128  ? ASN A 119  ILE A 128  1 ? 10 
HELX_P HELX_P4   4   ASP A 130  ? LYS A 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P5   5   SER A 203  ? HIS A 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? TRP A 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   8   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   9   ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  10  HIS A 286  ? ASP A 305  ? HIS A 286  ASP A 305  1 ? 20 
HELX_P HELX_P11  11  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P12  12  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P13  13  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P14  14  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P15  15  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P16  16  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  17  SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P18  18  PRO A 508  ? GLN A 510  ? PRO A 508  GLN A 510  5 ? 3  
HELX_P HELX_P19  19  VAL A 524  ? THR A 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P20  20  LEU A 543  ? TRP A 552  ? LEU A 543  TRP A 552  1 ? 10 
HELX_P HELX_P21  21  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P22  22  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P23  23  GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P24  24  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P25  25  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P26  26  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P27  27  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P28  28  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P29  29  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P30  30  SER A 793  ? GLY A 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P31  31  THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P32  32  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P33  33  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P34  34  ASP A 884  ? GLY A 887  ? ASP A 884  GLY A 887  5 ? 4  
HELX_P HELX_P35  35  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P36  36  GLU A 914  ? SER A 917  ? GLU A 914  SER A 917  5 ? 4  
HELX_P HELX_P37  37  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P38  38  ASN A 959  ? HIS A 972  ? ASN A 959  HIS A 972  1 ? 14 
HELX_P HELX_P39  39  THR A 982  ? GLU A 995  ? THR A 982  GLU A 995  1 ? 14 
HELX_P HELX_P40  40  ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P41  41  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P42  42  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P43  43  MET A 1063 ? MET A 1079 ? MET A 1063 MET A 1079 1 ? 17 
HELX_P HELX_P44  44  SER A 1096 ? ASN A 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P45  45  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P46  46  LEU A 1143 ? VAL A 1146 ? LEU A 1143 VAL A 1146 1 ? 4  
HELX_P HELX_P47  47  ASP A 1166 ? HIS A 1173 ? ASP A 1166 HIS A 1173 1 ? 8  
HELX_P HELX_P48  48  ALA A 1200 ? LYS A 1205 ? ALA A 1200 LYS A 1205 1 ? 6  
HELX_P HELX_P49  49  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P50  50  GLU A 1256 ? GLU A 1269 ? GLU A 1256 GLU A 1269 1 ? 14 
HELX_P HELX_P51  51  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P52  52  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P53  53  GLY A 1340 ? GLY A 1360 ? GLY A 1340 GLY A 1360 1 ? 21 
HELX_P HELX_P54  54  ASN A 1364 ? GLN A 1378 ? ASN A 1364 GLN A 1378 1 ? 15 
HELX_P HELX_P55  55  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P56  56  GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P57  57  GLU A 1404 ? ALA A 1416 ? GLU A 1404 ALA A 1416 1 ? 13 
HELX_P HELX_P58  58  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P59  59  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P60  60  ASP A 1446 ? TYR A 1453 ? ASP A 1446 TYR A 1453 1 ? 8  
HELX_P HELX_P61  61  ASP B 29   ? GLY B 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P62  62  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P63  63  TYR B 57   ? CYS B 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P64  64  TYR B 113  ? ASN B 121  ? TYR B 113  ASN B 121  1 ? 9  
HELX_P HELX_P65  65  CYS B 179  ? ALA B 184  ? CYS B 179  ALA B 184  5 ? 6  
HELX_P HELX_P66  66  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P67  67  ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P68  68  GLY B 295  ? CYS B 302  ? GLY B 295  CYS B 302  1 ? 8  
HELX_P HELX_P69  69  ASP B 307  ? MET B 313  ? ASP B 307  MET B 313  1 ? 7  
HELX_P HELX_P70  70  LEU B 314  ? GLY B 321  ? LEU B 314  GLY B 321  1 ? 8  
HELX_P HELX_P71  71  ASP B 326  ? ARG B 337  ? ASP B 326  ARG B 337  1 ? 12 
HELX_P HELX_P72  72  LYS B 344  ? TYR B 351  ? LYS B 344  TYR B 351  1 ? 8  
HELX_P HELX_P73  73  ALA B 352  ? GLU B 359  ? ALA B 352  GLU B 359  1 ? 8  
HELX_P HELX_P74  74  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P75  75  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P76  76  LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P77  77  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P78  78  THR B 487  ? ARG B 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P79  79  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P80  80  GLU B 529  ? ALA B 532  ? GLU B 529  ALA B 532  5 ? 4  
HELX_P HELX_P81  81  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P82  82  ASN B 592  ? GLY B 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P83  83  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P84  84  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P85  85  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P86  86  PRO B 707  ? GLU B 711  ? PRO B 707  GLU B 711  5 ? 5  
HELX_P HELX_P87  87  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P88  88  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P89  89  PHE B 758  ? HIS B 761  ? PHE B 758  HIS B 761  5 ? 4  
HELX_P HELX_P90  90  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P91  91  LEU B 782  ? VAL B 787  ? LEU B 782  VAL B 787  5 ? 6  
HELX_P HELX_P92  92  ALA B 808  ? LYS B 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P93  93  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P94  94  ASN B 1013 ? ILE B 1017 ? ASN B 1013 ILE B 1017 5 ? 5  
HELX_P HELX_P95  95  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P96  96  THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P97  97  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P98  98  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P99  99  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P100 100 TYR B 1198 ? MET B 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P101 101 ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P102 102 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P103 103 ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P104 104 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P105 105 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P106 106 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P107 107 PRO C 239  ? GLN C 267  ? PRO C 239  GLN C 267  1 ? 29 
HELX_P HELX_P108 108 ASN D 51   ? SER D 73   ? ASN D 51   SER D 73   1 ? 23 
HELX_P HELX_P109 109 ARG D 119  ? THR D 134  ? ARG D 119  THR D 134  1 ? 16 
HELX_P HELX_P110 110 ASN D 138  ? SER D 152  ? ASN D 138  SER D 152  1 ? 15 
HELX_P HELX_P111 111 ASP D 156  ? LYS D 168  ? ASP D 156  LYS D 168  1 ? 13 
HELX_P HELX_P112 112 HIS D 173  ? LEU D 183  ? HIS D 173  LEU D 183  1 ? 11 
HELX_P HELX_P113 113 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P114 114 PRO D 196  ? LYS D 201  ? PRO D 196  LYS D 201  5 ? 6  
HELX_P HELX_P115 115 SER D 203  ? GLU D 218  ? SER D 203  GLU D 218  1 ? 16 
HELX_P HELX_P116 116 GLU E 4    ? TYR E 28   ? GLU E 4    TYR E 28   1 ? 25 
HELX_P HELX_P117 117 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P118 118 PRO E 38   ? CYS E 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P119 119 GLN E 54   ? SER E 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P120 120 GLU E 67   ? PHE E 72   ? GLU E 67   PHE E 72   1 ? 6  
HELX_P HELX_P121 121 GLY E 89   ? LYS E 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P122 122 THR E 117  ? LYS E 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P123 123 GLU E 137  ? VAL E 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P124 124 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P125 125 SER E 157  ? ARG E 169  ? SER E 157  ARG E 169  1 ? 13 
HELX_P HELX_P126 126 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P127 127 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P128 128 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P129 129 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P130 130 ARG G 21   ? GLU G 35   ? ARG G 21   GLU G 35   1 ? 15 
HELX_P HELX_P131 131 ASP G 50   ? ILE G 54   ? ASP G 50   ILE G 54   5 ? 5  
HELX_P HELX_P132 132 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P133 133 TYR H 129  ? ASN H 133  ? TYR H 129  ASN H 133  5 ? 5  
HELX_P HELX_P134 134 VAL I 59   ? SER I 64   ? VAL I 59   SER I 64   5 ? 6  
HELX_P HELX_P135 135 ASP J 16   ? GLU J 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P136 136 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P137 137 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P138 138 LEU J 56   ? LEU J 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P139 139 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P140 140 ASP K 39   ? ASP K 53   ? ASP K 39   ASP K 53   1 ? 15 
HELX_P HELX_P141 141 ASP K 82   ? LEU K 111  ? ASP K 82   LEU K 111  1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 167  SG    ? ? A ZN  2456 A CYS 167  1_555 ? ? ? ? ? ? ?            2.402 
? 
metalc2  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 110  SG    ? ? A ZN  2456 A CYS 110  1_555 ? ? ? ? ? ? ?            2.384 
? 
metalc3  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 148  SG    ? ? A ZN  2456 A CYS 148  1_555 ? ? ? ? ? ? ?            2.285 
? 
metalc4  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 107  SG    ? ? A ZN  2456 A CYS 107  1_555 ? ? ? ? ? ? ?            2.338 
? 
metalc5  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 67   SG    ? ? A ZN  2457 A CYS 67   1_555 ? ? ? ? ? ? ?            2.465 
? 
metalc6  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 70   SG    ? ? A ZN  2457 A CYS 70   1_555 ? ? ? ? ? ? ?            2.486 
? 
metalc7  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A HIS 80   NE2   ? ? A ZN  2457 A HIS 80   1_555 ? ? ? ? ? ? ?            2.184 
? 
metalc8  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 77   SG    ? ? A ZN  2457 A CYS 77   1_555 ? ? ? ? ? ? ?            2.356 
? 
metalc9  metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 481  OD2   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            2.744 
? 
metalc10 metalc ?    ? R MG  .  MG    ? ? ? 1_555 N A   5    "O2'" ? ? A MG  2458 P A   10   1_555 ? ? ? ? ? ? ?            2.979 
? 
metalc11 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 481  OD1   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            1.960 
? 
metalc12 metalc ?    ? R MG  .  MG    ? ? ? 1_555 N A   5    "O3'" ? ? A MG  2458 P A   10   1_555 ? ? ? ? ? ? ?            1.913 
? 
metalc13 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 485  OD1   ? ? A MG  2458 A ASP 485  1_555 ? ? ? ? ? ? ?            2.278 
? 
metalc14 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 483  OD2   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            2.472 
? 
metalc15 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 483  OD1   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            2.180 
? 
metalc16 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1182 SG    ? ? B ZN  2225 B CYS 1182 1_555 ? ? ? ? ? ? ?            2.260 
? 
metalc17 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1166 SG    ? ? B ZN  2225 B CYS 1166 1_555 ? ? ? ? ? ? ?            2.271 
? 
metalc18 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1163 SG    ? ? B ZN  2225 B CYS 1163 1_555 ? ? ? ? ? ? ?            2.308 
? 
metalc19 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1185 SG    ? ? B ZN  2225 B CYS 1185 1_555 ? ? ? ? ? ? ?            2.302 
? 
metalc20 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 88   SG    ? ? C ZN  1269 C CYS 88   1_555 ? ? ? ? ? ? ?            2.315 
? 
metalc21 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 86   SG    ? ? C ZN  1269 C CYS 86   1_555 ? ? ? ? ? ? ?            2.307 
? 
metalc22 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 95   SG    ? ? C ZN  1269 C CYS 95   1_555 ? ? ? ? ? ? ?            2.232 
? 
metalc23 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 92   SG    ? ? C ZN  1269 C CYS 92   1_555 ? ? ? ? ? ? ?            2.210 
? 
metalc24 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 7    SG    ? ? I ZN  1121 I CYS 7    1_555 ? ? ? ? ? ? ?            2.223 
? 
metalc25 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 29   SG    ? ? I ZN  1121 I CYS 29   1_555 ? ? ? ? ? ? ?            2.277 
? 
metalc26 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 32   SG    ? ? I ZN  1121 I CYS 32   1_555 ? ? ? ? ? ? ?            2.274 
? 
metalc27 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 10   SG    ? ? I ZN  1121 I CYS 10   1_555 ? ? ? ? ? ? ?            2.279 
? 
metalc28 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 78   SG    ? ? I ZN  1122 I CYS 78   1_555 ? ? ? ? ? ? ?            2.357 
? 
metalc29 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 103  SG    ? ? I ZN  1122 I CYS 103  1_555 ? ? ? ? ? ? ?            2.447 
? 
metalc30 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 75   SG    ? ? I ZN  1122 I CYS 75   1_555 ? ? ? ? ? ? ?            2.367 
? 
metalc31 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 106  SG    ? ? I ZN  1122 I CYS 106  1_555 ? ? ? ? ? ? ?            2.317 
? 
metalc32 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 45   SG    ? ? J ZN  1066 J CYS 45   1_555 ? ? ? ? ? ? ?            2.335 
? 
metalc33 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 10   SG    ? ? J ZN  1066 J CYS 10   1_555 ? ? ? ? ? ? ?            2.186 
? 
metalc34 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 46   SG    ? ? J ZN  1066 J CYS 46   1_555 ? ? ? ? ? ? ?            2.389 
? 
metalc35 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 7    SG    ? ? J ZN  1066 J CYS 7    1_555 ? ? ? ? ? ? ?            2.296 
? 
metalc36 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 34   SG    ? ? L ZN  1071 L CYS 34   1_555 ? ? ? ? ? ? ?            2.427 
? 
metalc37 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 51   SG    ? ? L ZN  1071 L CYS 51   1_555 ? ? ? ? ? ? ?            2.306 
? 
metalc38 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 48   SG    ? ? L ZN  1071 L CYS 48   1_555 ? ? ? ? ? ? ?            2.341 
? 
metalc39 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 31   SG    ? ? L ZN  1071 L CYS 31   1_555 ? ? ? ? ? ? ?            2.436 
? 
covale1  covale both ? O BRU 19 P     ? ? ? 1_555 O DC  18   "O3'" ? ? T BRU 22   T DC  21   1_555 ? ? ? ? ? ? ?            1.597 
? 
covale2  covale both ? O BRU 19 "O3'" ? ? ? 1_555 O DG  20   P     ? ? T BRU 22   T DG  23   1_555 ? ? ? ? ? ? ?            1.600 
? 
hydrog1  hydrog ?    ? M DA  3  N1    ? ? ? 1_555 O DT  12   N3    ? ? N DA  3    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog2  hydrog ?    ? M DA  3  N6    ? ? ? 1_555 O DT  12   O4    ? ? N DA  3    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog3  hydrog ?    ? M DG  4  N1    ? ? ? 1_555 O DC  11   N3    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog4  hydrog ?    ? M DG  4  N2    ? ? ? 1_555 O DC  11   O2    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog5  hydrog ?    ? M DG  4  O6    ? ? ? 1_555 O DC  11   N4    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog6  hydrog ?    ? M DT  5  N3    ? ? ? 1_555 O DA  10   N1    ? ? N DT  5    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog7  hydrog ?    ? M DT  5  O4    ? ? ? 1_555 O DA  10   N6    ? ? N DT  5    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog8  hydrog ?    ? M DA  6  N1    ? ? ? 1_555 O DT  9    N3    ? ? N DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog9  hydrog ?    ? M DA  6  N6    ? ? ? 1_555 O DT  9    O4    ? ? N DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog10 hydrog ?    ? M DC  7  N3    ? ? ? 1_555 O DG  8    N1    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog11 hydrog ?    ? M DC  7  N4    ? ? ? 1_555 O DG  8    O6    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog12 hydrog ?    ? M DC  7  O2    ? ? ? 1_555 O DG  8    N2    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog13 hydrog ?    ? M DT  8  N3    ? ? ? 1_555 O DA  7    N1    ? ? N DT  8    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog14 hydrog ?    ? M DT  8  O4    ? ? ? 1_555 O DA  7    N6    ? ? N DT  8    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog15 hydrog ?    ? M DT  9  N3    ? ? ? 1_555 O DA  6    N1    ? ? N DT  9    T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog16 hydrog ?    ? M DT  9  O4    ? ? ? 1_555 O DA  6    N6    ? ? N DT  9    T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog17 hydrog ?    ? M DG  10 N1    ? ? ? 1_555 O DC  5    N3    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog18 hydrog ?    ? M DG  10 N2    ? ? ? 1_555 O DC  5    O2    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog19 hydrog ?    ? M DG  10 O6    ? ? ? 1_555 O DC  5    N4    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog20 hydrog ?    ? N A   2  N1    ? ? ? 1_555 O BRU 19   N3    ? ? P A   7    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog21 hydrog ?    ? N A   2  N6    ? ? ? 1_555 O BRU 19   O4    ? ? P A   7    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog22 hydrog ?    ? N G   3  N1    ? ? ? 1_555 O DC  18   N3    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog23 hydrog ?    ? N G   3  N2    ? ? ? 1_555 O DC  18   O2    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog24 hydrog ?    ? N G   3  O6    ? ? ? 1_555 O DC  18   N4    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog25 hydrog ?    ? N G   4  N1    ? ? ? 1_555 O DC  17   N3    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog26 hydrog ?    ? N G   4  N2    ? ? ? 1_555 O DC  17   O2    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog27 hydrog ?    ? N G   4  O6    ? ? ? 1_555 O DC  17   N4    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog28 hydrog ?    ? N A   5  N1    ? ? ? 1_555 O DT  16   N3    ? ? P A   10   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog29 hydrog ?    ? N A   5  N6    ? ? ? 1_555 O DT  16   O4    ? ? P A   10   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 193 A . ? ASP 193 A ALA 194 A ? ALA 194 A 1 3.16  
2  ALA 194 A . ? ALA 194 A ASP 195 A ? ASP 195 A 1 -0.50 
3  GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 11.79 
4  LYS 567 A . ? LYS 567 A PRO 568 A ? PRO 568 A 1 -0.88 
5  GLY 338 B . ? GLY 338 B THR 339 B ? THR 339 B 1 0.68  
6  GLU 468 B . ? GLU 468 B GLN 469 B ? GLN 469 B 1 -5.56 
7  MET 473 B . ? MET 473 B SER 474 B ? SER 474 B 1 3.59  
8  VAL 18  D . ? VAL 18  D GLU 19  D ? GLU 19  D 1 5.85  
9  PRO 128 E . ? PRO 128 E PRO 129 E ? PRO 129 E 1 3.26  
10 ASN 126 G . ? ASN 126 G PRO 127 G ? PRO 127 G 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 2  ? 
AC ? 2  ? 
AD ? 3  ? 
AE ? 2  ? 
AF ? 14 ? 
AG ? 4  ? 
AH ? 2  ? 
AI ? 2  ? 
AJ ? 3  ? 
AK ? 2  ? 
AL ? 3  ? 
AM ? 2  ? 
AN ? 4  ? 
AO ? 2  ? 
AP ? 5  ? 
AQ ? 2  ? 
DA ? 7  ? 
DB ? 5  ? 
BA ? 3  ? 
BB ? 2  ? 
BC ? 3  ? 
BD ? 4  ? 
BE ? 5  ? 
BF ? 2  ? 
BG ? 2  ? 
BH ? 2  ? 
BI ? 4  ? 
BJ ? 4  ? 
BK ? 5  ? 
BL ? 5  ? 
BM ? 2  ? 
BN ? 14 ? 
BO ? 2  ? 
BP ? 2  ? 
BQ ? 2  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
DC ? 2  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 4  ? 
GA ? 12 ? 
GB ? 3  ? 
HA ? 9  ? 
IA ? 3  ? 
IB ? 4  ? 
KA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DA 5 6 ? anti-parallel 
DA 6 7 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DB 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? parallel      
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? parallel      
BH 1 2 ? anti-parallel 
BI 1 2 ? parallel      
BI 2 3 ? anti-parallel 
BI 3 4 ? parallel      
BJ 1 2 ? parallel      
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? parallel      
BK 4 5 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BM 1 2 ? parallel      
BN 1 2 ? anti-parallel 
BN 3 4 ? parallel      
BN 4 5 ? anti-parallel 
BN 5 6 ? anti-parallel 
BN 7 8 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? parallel      
GA 1 2 ? anti-parallel 
GA 6 7 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
HA 1 2 ? anti-parallel 
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HA 4 5 ? anti-parallel 
HA 5 6 ? anti-parallel 
HA 6 7 ? anti-parallel 
HA 7 8 ? anti-parallel 
HA 8 9 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA 2 GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
AA 3 ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
AB 1 GLY A 82   ? PHE A 91   ? GLY A 82   PHE A 91   
AB 2 ILE A 235  ? VAL A 241  ? ILE A 235  VAL A 241  
AC 1 VAL A 152  ? PRO A 153  ? VAL A 152  PRO A 153  
AC 2 LEU A 161  ? VAL A 162  ? LEU A 161  VAL A 162  
AD 1 ARG A 175  ? LYS A 176  ? ARG A 175  LYS A 176  
AD 2 LEU A 181  ? TRP A 185  ? LEU A 181  TRP A 185  
AD 3 GLU A 198  ? LEU A 202  ? GLU A 198  LEU A 202  
AE 1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AE 2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AF 1 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AF 2 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
AF 3 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AF 4 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AF 5 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AF 6 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
AF 7 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AF 8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AG 1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AG 2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AG 3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AG 4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AH 1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AH 2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AI 1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
AI 2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
AJ 1 LEU A 588  ? ARG A 590  ? LEU A 588  ARG A 590  
AJ 2 MET A 605  ? ILE A 607  ? MET A 605  ILE A 607  
AJ 3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
AK 1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AK 2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AL 1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AL 2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AL 3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AM 1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
AM 2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
AN 1 VAL A 1283 ? TYR A 1287 ? VAL A 1283 TYR A 1287 
AN 2 GLU A 1303 ? GLU A 1307 ? GLU A 1303 GLU A 1307 
AN 3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
AN 4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AO 1 THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
AO 2 THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
AP 1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AP 2 ILE A 1237 ? VAL A 1242 ? ILE A 1237 VAL A 1242 
AP 3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AP 4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AP 5 LEU I 42   ? ARG I 45   ? LEU I 42   ARG I 45   
AQ 1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
AQ 2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
DA 1 ILE D 48   ? ALA D 49   ? ILE D 48   ALA D 49   
DA 2 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
DA 3 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
DA 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
DA 5 ASP A 1442 ? ILE A 1445 ? ASP A 1442 ILE A 1445 
DA 6 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
DA 7 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
DB 1 ILE D 48   ? ALA D 49   ? ILE D 48   ALA D 49   
DB 2 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
DB 3 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
DB 4 GLY G 43   ? VAL G 48   ? GLY G 43   VAL G 48   
DB 5 CYS G 38   ? THR G 39   ? CYS G 38   THR G 39   
BA 1 PHE B 92   ? VAL B 97   ? PHE B 92   VAL B 97   
BA 2 SER B 125  ? VAL B 132  ? SER B 125  VAL B 132  
BA 3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
BB 1 MET B 101  ? ASN B 103  ? MET B 101  ASN B 103  
BB 2 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
BC 1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
BC 2 SER B 208  ? LEU B 212  ? SER B 208  LEU B 212  
BC 3 SER B 480  ? VAL B 482  ? SER B 480  VAL B 482  
BD 1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
BD 2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
BD 3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
BD 4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
BE 1 VAL B 223  ? PHE B 226  ? VAL B 223  PHE B 226  
BE 2 HIS B 236  ? ARG B 241  ? HIS B 236  ARG B 241  
BE 3 THR B 253  ? LEU B 258  ? THR B 253  LEU B 258  
BE 4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
BE 5 ILE B 280  ? PRO B 281  ? ILE B 280  PRO B 281  
BF 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
BF 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BG 1 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BG 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BH 1 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BH 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BI 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BI 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 4 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BJ 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BJ 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BJ 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BJ 4 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BK 1 GLU B 564  ? PRO B 565  ? GLU B 564  PRO B 565  
BK 2 TRP B 586  ? HIS B 590  ? TRP B 586  HIS B 590  
BK 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
BK 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
BK 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
BL 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
BL 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
BL 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
BL 4 GLY B 947  ? THR B 956  ? GLY B 947  THR B 956  
BL 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
BM 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
BM 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
BN 1 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BN 2 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
BN 3 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
BN 4 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
BN 5 LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
BN 6 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
BN 7 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
BN 8 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BO 1 LYS B 865  ? TYR B 866  ? LYS B 865  TYR B 866  
BO 2 ILE B 870  ? THR B 871  ? ILE B 870  THR B 871  
BP 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
BP 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
BQ 1 ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
BQ 2 ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
CA 1 GLN C 7    ? GLU C 12   ? GLN C 7    GLU C 12   
CA 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
CA 3 PHE C 228  ? SER C 234  ? PHE C 228  SER C 234  
CA 4 ALA C 173  ? GLU C 179  ? ALA C 173  GLU C 179  
CB 1 LEU C 118  ? ILE C 120  ? LEU C 118  ILE C 120  
CB 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
CB 3 GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
CB 4 THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
CB 5 VAL L 65   ? PHE L 67   ? VAL L 65   PHE L 67   
CC 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
CC 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
DC 1 LYS D 36   ? ILE D 38   ? LYS D 36   ILE D 38   
DC 2 GLU D 44   ? GLU D 46   ? GLU D 44   GLU D 46   
EA 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
EA 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
EA 3 THR E 107  ? TYR E 112  ? THR E 107  TYR E 112  
EA 4 THR E 131  ? ASN E 136  ? THR E 131  ASN E 136  
EB 1 SER E 87   ? VAL E 88   ? SER E 87   VAL E 88   
EB 2 ASN E 115  ? ILE E 116  ? ASN E 115  ILE E 116  
EC 1 LYS E 152  ? ARG E 155  ? LYS E 152  ARG E 155  
EC 2 VAL E 195  ? ARG E 200  ? VAL E 195  ARG E 200  
EC 3 TYR E 208  ? CYS E 214  ? TYR E 208  CYS E 214  
EC 4 ARG E 177  ? ILE E 178  ? ARG E 177  ILE E 178  
GA 1 VAL G 86   ? SER G 95   ? VAL G 86   SER G 95   
GA 2 ARG G 142  ? GLN G 153  ? ARG G 142  GLN G 153  
GA 3 GLY G 98   ? VAL G 103  ? GLY G 98   VAL G 103  
GA 4 MET G 106  ? THR G 111  ? MET G 106  THR G 111  
GA 5 SER G 156  ? SER G 162  ? SER G 156  SER G 162  
GA 6 GLY G 169  ? ALA G 170  ? GLY G 169  ALA G 170  
GA 7 ARG G 142  ? GLN G 153  ? ARG G 142  GLN G 153  
GB 1 THR G 120  ? ASN G 122  ? THR G 120  ASN G 122  
GB 2 SER G 129  ? GLN G 131  ? SER G 129  GLN G 131  
GB 3 VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
HA 1 TYR H 95   ? TYR H 98   ? TYR H 95   TYR H 98   
HA 2 TYR H 141  ? ARG H 145  ? TYR H 141  ARG H 145  
HA 3 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
HA 4 ASP H 7    ? ASP H 16   ? ASP H 7    ASP H 16   
HA 5 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
HA 6 LYS H 37   ? ASN H 43   ? LYS H 37   ASN H 43   
HA 7 LEU H 121  ? GLY H 127  ? LEU H 121  GLY H 127  
HA 8 ILE H 112  ? PHE H 118  ? ILE H 112  PHE H 118  
HA 9 THR H 100  ? GLU H 106  ? THR H 100  GLU H 106  
IA 1 TYR I 15   ? ASP I 19   ? TYR I 15   ASP I 19   
IA 2 ARG I 24   ? GLU I 28   ? ARG I 24   GLU I 28   
IA 3 VAL I 35   ? GLU I 37   ? VAL I 35   GLU I 37   
IB 1 ARG I 70   ? SER I 71   ? ARG I 70   SER I 71   
IB 2 ASN I 83   ? GLN I 87   ? ASN I 83   GLN I 87   
IB 3 LEU I 99   ? CYS I 103  ? LEU I 99   CYS I 103  
IB 4 ILE I 109  ? THR I 111  ? ILE I 109  THR I 111  
KA 1 LEU K 19   ? PRO K 23   ? LEU K 19   PRO K 23   
KA 2 ALA K 30   ? GLU K 36   ? ALA K 30   GLU K 36   
KA 3 ARG K 70   ? THR K 77   ? ARG K 70   THR K 77   
KA 4 VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ASP A 1419 ? N ASP A 1419 O VAL A 17   ? O VAL A 17   
AA 2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
AB 1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
AC 1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
AD 1 2 N ARG A 175  ? N ARG A 175  O VAL A 182  ? O VAL A 182  
AD 2 3 N TRP A 185  ? N TRP A 185  O GLU A 198  ? O GLU A 198  
AE 1 2 N VAL A 345  ? N VAL A 345  O LEU B 1128 ? O LEU B 1128 
AF 1 2 N ARG A 350  ? N ARG A 350  O HIS B 1104 ? O HIS B 1104 
AF 3 4 N VAL A 364  ? N VAL A 364  O ARG A 459  ? O ARG A 459  
AF 4 5 N HIS A 458  ? N HIS A 458  O VAL A 442  ? O VAL A 442  
AF 5 6 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AF 6 7 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
AF 7 8 N ARG B 1106 ? N ARG B 1106 O SER A 348  ? O SER A 348  
AG 1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AG 2 3 O GLU A 433  ? O GLU A 433  N LYS A 403  ? N LYS A 403  
AG 3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AH 1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AI 1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AJ 1 2 N ARG A 590  ? N ARG A 590  O MET A 605  ? O MET A 605  
AJ 2 3 O LEU A 606  ? O LEU A 606  N ILE A 613  ? N ILE A 613  
AK 1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AL 1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AL 2 3 O THR A 856  ? O THR A 856  N ILE A 864  ? N ILE A 864  
AM 1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
AN 1 2 N TYR A 1287 ? N TYR A 1287 O GLU A 1303 ? O GLU A 1303 
AN 2 3 N LEU A 1306 ? N LEU A 1306 O VAL A 1118 ? O VAL A 1118 
AN 3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AO 1 2 O THR A 1141 ? O THR A 1141 N LEU A 1273 ? N LEU A 1273 
AP 1 2 N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
AP 2 3 N CYS A 1240 ? N CYS A 1240 O LEU A 1193 ? O LEU A 1193 
AP 3 4 O GLU A 1196 ? O GLU A 1196 N ILE A 1148 ? N ILE A 1148 
AP 4 5 O ILE A 1152 ? O ILE A 1152 N VAL I 43   ? N VAL I 43   
AQ 1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
DA 1 2 N ILE D 48   ? N ILE D 48   O ILE G 4    ? O ILE G 4    
DA 2 3 N LEU G 13   ? N LEU G 13   O ALA G 68   ? O ALA G 68   
DA 3 4 N GLU G 69   ? N GLU G 69   O ARG G 60   ? O ARG G 60   
DA 4 5 N ILE G 61   ? N ILE G 61   O VAL A 1443 ? O VAL A 1443 
DA 5 6 N MET A 1444 ? N MET A 1444 O VAL F 133  ? O VAL F 133  
DA 6 7 N ARG F 136  ? N ARG F 136  O GLU F 144  ? O GLU F 144  
DB 1 2 N ILE D 48   ? N ILE D 48   O ILE G 4    ? O ILE G 4    
DB 2 3 N LEU G 13   ? N LEU G 13   O ALA G 68   ? O ALA G 68   
DB 3 4 N PHE G 79   ? N PHE G 79   O TYR G 44   ? O TYR G 44   
DB 4 5 N GLY G 43   ? N GLY G 43   O THR G 39   ? O THR G 39   
BA 1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
BA 2 3 N VAL B 130  ? N VAL B 130  O VAL B 165  ? O VAL B 165  
BB 1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
BC 1 2 N ILE B 205  ? N ILE B 205  O SER B 208  ? O SER B 208  
BC 2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
BD 1 2 N ASP B 407  ? N ASP B 407  O GLN B 215  ? O GLN B 215  
BD 2 3 N ALA B 214  ? N ALA B 214  O ARG B 497  ? O ARG B 497  
BD 3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
BE 1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
BE 2 3 N ILE B 240  ? N ILE B 240  O LEU B 254  ? O LEU B 254  
BE 3 4 N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
BE 4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
BF 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
BG 1 2 N GLU B 650  ? N GLU B 650  O GLU B 641  ? O GLU B 641  
BH 1 2 N ILE B 693  ? N ILE B 693  O ARG B 635  ? O ARG B 635  
BI 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BI 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BI 3 4 N GLU B 641  ? N GLU B 641  O GLU B 650  ? O GLU B 650  
BJ 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BJ 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BJ 3 4 N LEU B 637  ? N LEU B 637  O GLU B 691  ? O GLU B 691  
BK 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
BK 2 3 N HIS B 590  ? N HIS B 590  O THR B 578  ? O THR B 578  
BK 3 4 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
BK 4 5 N PHE B 627  ? N PHE B 627  O SER B 614  ? O SER B 614  
BL 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
BL 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
BL 3 4 N ARG B 969  ? N ARG B 969  O ILE B 948  ? O ILE B 948  
BL 4 5 N GLY B 947  ? N GLY B 947  O VAL B 905  ? O VAL B 905  
BM 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
BN 1 2 N ILE B 827  ? N ILE B 827  O PHE B 1086 ? O PHE B 1086 
BN 3 4 N MET B 839  ? N MET B 839  O THR B 989  ? O THR B 989  
BN 4 5 N GLY B 988  ? N GLY B 988  O PHE B 980  ? O PHE B 980  
BN 5 6 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
BN 7 8 N TYR B 1092 ? N TYR B 1092 O GLN B 821  ? O GLN B 821  
BO 1 2 N TYR B 866  ? N TYR B 866  O ILE B 870  ? O ILE B 870  
BP 1 2 N ILE B 911  ? N ILE B 911  O THR B 939  ? O THR B 939  
BQ 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
CA 1 2 N ARG C 11   ? N ARG C 11   O ASP C 19   ? O ASP C 19   
CA 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
CA 3 4 O GLU C 233  ? O GLU C 233  N ALA C 174  ? N ALA C 174  
CB 1 2 N VAL C 119  ? N VAL C 119  O THR C 100  ? O THR C 100  
CB 2 3 N ALA C 103  ? N ALA C 103  O LEU C 153  ? O LEU C 153  
CB 3 4 N GLY C 162  ? N GLY C 162  O THR C 43   ? O THR C 43   
CB 4 5 N VAL C 51   ? N VAL C 51   O VAL L 65   ? O VAL L 65   
CC 1 2 O VAL C 113  ? O VAL C 113  N ILE C 144  ? N ILE C 144  
DC 1 2 N GLN D 37   ? N GLN D 37   O GLU D 45   ? O GLU D 45   
EA 1 2 N ALA E 62   ? N ALA E 62   O LEU E 78   ? O LEU E 78   
EA 2 3 N TRP E 79   ? N TRP E 79   O THR E 107  ? O THR E 107  
EA 3 4 N GLY E 108  ? N GLY E 108  O THR E 131  ? O THR E 131  
EB 1 2 N VAL E 88   ? N VAL E 88   O ASN E 115  ? O ASN E 115  
EC 1 2 N ILE E 154  ? N ILE E 154  O LYS E 197  ? O LYS E 197  
EC 2 3 N ARG E 200  ? N ARG E 200  O TYR E 208  ? O TYR E 208  
EC 3 4 O ILE E 213  ? O ILE E 213  N ILE E 178  ? N ILE E 178  
GA 1 2 N GLY G 89   ? N GLY G 89   O ILE G 143  ? O ILE G 143  
GA 6 7 N GLY G 169  ? N GLY G 169  O ARG G 144  ? O ARG G 144  
GB 1 2 N ASN G 122  ? N ASN G 122  O SER G 129  ? O SER G 129  
GB 2 3 N TYR G 130  ? N TYR G 130  O ILE G 137  ? O ILE G 137  
HA 1 2 N MET H 97   ? N MET H 97   O LEU H 142  ? O LEU H 142  
HA 2 3 N ARG H 145  ? N ARG H 145  O THR H 56   ? O THR H 56   
HA 3 4 N VAL H 57   ? N VAL H 57   O ASP H 8    ? O ASP H 8    
HA 4 5 N ASP H 16   ? N ASP H 16   O ARG H 25   ? O ARG H 25   
HA 5 6 N ALA H 28   ? N ALA H 28   O LEU H 38   ? O LEU H 38   
HA 6 7 N ASP H 41   ? N ASP H 41   O LEU H 122  ? O LEU H 122  
HA 7 8 N GLY H 127  ? N GLY H 127  O ILE H 112  ? O ILE H 112  
HA 8 9 N SER H 117  ? N SER H 117  O THR H 100  ? O THR H 100  
IA 1 2 N ASP I 19   ? N ASP I 19   O ARG I 24   ? O ARG I 24   
IA 2 3 N PHE I 27   ? N PHE I 27   O GLU I 36   ? O GLU I 36   
IB 1 2 N SER I 71   ? N SER I 71   O ASN I 83   ? O ASN I 83   
IB 2 3 N PHE I 86   ? N PHE I 86   O PHE I 100  ? O PHE I 100  
IB 3 4 N PHE I 101  ? N PHE I 101  O PHE I 110  ? O PHE I 110  
KA 1 2 N ASP K 22   ? N ASP K 22   O VAL K 32   ? O VAL K 32   
KA 2 3 N PHE K 35   ? N PHE K 35   O PHE K 71   ? O PHE K 71   
KA 3 4 O GLN K 76   ? O GLN K 76   N LEU K 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2456'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 2457'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 2458'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 2225'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1269'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1121'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1122'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 1066'  
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 1071'  
BC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE APC P 1011' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 5 CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 5 THR A 69   ? THR A 69   . ? 1_555 ? 
7  AC2 5 CYS A 70   ? CYS A 70   . ? 1_555 ? 
8  AC2 5 CYS A 77   ? CYS A 77   . ? 1_555 ? 
9  AC2 5 HIS A 80   ? HIS A 80   . ? 1_555 ? 
10 AC3 4 ASP A 481  ? ASP A 481  . ? 1_555 ? 
11 AC3 4 ASP A 483  ? ASP A 483  . ? 1_555 ? 
12 AC3 4 ASP A 485  ? ASP A 485  . ? 1_555 ? 
13 AC3 4 A   N 5    ? A   P 10   . ? 1_555 ? 
14 AC4 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
15 AC4 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
16 AC4 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
17 AC4 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
18 AC5 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
19 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
20 AC5 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
21 AC5 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
22 AC6 4 CYS I 7    ? CYS I 7    . ? 1_555 ? 
23 AC6 4 CYS I 10   ? CYS I 10   . ? 1_555 ? 
24 AC6 4 CYS I 29   ? CYS I 29   . ? 1_555 ? 
25 AC6 4 CYS I 32   ? CYS I 32   . ? 1_555 ? 
26 AC7 4 CYS I 75   ? CYS I 75   . ? 1_555 ? 
27 AC7 4 CYS I 78   ? CYS I 78   . ? 1_555 ? 
28 AC7 4 CYS I 103  ? CYS I 103  . ? 1_555 ? 
29 AC7 4 CYS I 106  ? CYS I 106  . ? 1_555 ? 
30 AC8 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
31 AC8 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
32 AC8 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
33 AC8 4 CYS J 46   ? CYS J 46   . ? 1_555 ? 
34 AC9 4 CYS L 31   ? CYS L 31   . ? 1_555 ? 
35 AC9 4 CYS L 34   ? CYS L 34   . ? 1_555 ? 
36 AC9 4 CYS L 48   ? CYS L 48   . ? 1_555 ? 
37 AC9 4 CYS L 51   ? CYS L 51   . ? 1_555 ? 
38 BC1 8 ARG A 446  ? ARG A 446  . ? 1_555 ? 
39 BC1 8 PRO A 448  ? PRO A 448  . ? 1_555 ? 
40 BC1 8 ASN A 479  ? ASN A 479  . ? 1_555 ? 
41 BC1 8 ARG B 766  ? ARG B 766  . ? 1_555 ? 
42 BC1 8 ARG B 1020 ? ARG B 1020 . ? 1_555 ? 
43 BC1 8 A   N 5    ? A   P 10   . ? 1_555 ? 
44 BC1 8 DT  O 15   ? DT  T 18   . ? 1_555 ? 
45 BC1 8 DT  O 16   ? DT  T 19   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4A3E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4A3E 
_atom_sites.fract_transf_matrix[1][1]   0.004471 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002537 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003530 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 110.174 22.152  -24.900 1.00 102.69 ? 3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 111.302 22.862  -25.501 1.00 101.80 ? 3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 111.203 22.992  -27.009 1.00 102.57 ? 3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 110.629 22.114  -27.667 1.00 103.91 ? 3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 111.764 24.083  -27.573 1.00 93.96  ? 4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 111.725 24.320  -29.019 1.00 91.90  ? 4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 112.810 23.534  -29.762 1.00 93.12  ? 4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 113.886 23.347  -29.206 1.00 92.04  ? 4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 111.766 25.816  -29.331 1.00 92.44  ? 4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 110.429 26.498  -29.099 1.00 89.62  ? 4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 110.525 27.971  -29.355 1.00 100.94 ? 4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 110.912 28.754  -28.483 1.00 102.72 ? 4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 110.198 28.379  -30.560 1.00 80.61  ? 4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 112.525 23.066  -31.004 1.00 88.77  ? 5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 113.448 22.247  -31.806 1.00 88.75  ? 5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 114.533 22.953  -32.602 1.00 89.82  ? 5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 114.401 24.142  -32.865 1.00 89.00  ? 5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 112.687 21.231  -32.667 1.00 91.57  ? 5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 112.153 20.014  -31.860 1.00 123.80 ? 5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 112.904 19.613  -30.579 1.00 134.13 ? 5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 112.338 19.617  -29.475 1.00 125.79 ? 5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 114.168 19.200  -30.698 1.00 121.14 ? 5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 115.615 22.232  -32.987 1.00 85.68  ? 6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 116.715 22.848  -33.743 1.00 85.92  ? 6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 116.304 23.438  -35.091 1.00 89.10  ? 6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 115.721 22.729  -35.920 1.00 89.27  ? 6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 117.918 21.889  -33.937 1.00 87.74  ? 6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 118.930 22.382  -34.966 1.00 89.81  ? 6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 119.897 23.323  -34.629 1.00 92.28  ? 6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 118.888 21.937  -36.282 1.00 90.99  ? 6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 120.788 23.816  -35.579 1.00 94.72  ? 6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 119.757 22.441  -37.245 1.00 92.67  ? 6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 120.710 23.378  -36.890 1.00 101.48 ? 6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 121.581 23.861  -37.840 1.00 103.66 ? 6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 116.678 24.701  -35.334 1.00 84.08  ? 7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 116.428 25.319  -36.624 1.00 84.32  ? 7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 117.732 25.777  -37.252 1.00 88.78  ? 7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 118.522 26.480  -36.616 1.00 88.71  ? 7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 115.440 26.472  -36.507 1.00 87.60  ? 7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 115.591 27.397  -37.573 1.00 93.52  ? 7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 117.937 25.403  -38.516 1.00 85.59  ? 8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 119.121 25.769  -39.288 1.00 86.17  ? 8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 119.251 27.296  -39.591 1.00 89.81  ? 8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 120.291 27.739  -40.108 1.00 89.47  ? 8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 119.121 24.992  -40.593 1.00 91.96  ? 8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 118.026 25.394  -41.399 1.00 104.29 ? 8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 118.187 28.088  -39.307 1.00 85.40  ? 9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 118.207 29.535  -39.542 1.00 84.88  ? 9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 119.240 30.225  -38.647 1.00 87.56  ? 9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 119.348 29.916  -37.450 1.00 88.57  ? 9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 116.826 30.139  -39.327 1.00 85.29  ? 9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 120.062 31.100  -39.224 1.00 81.44  ? 10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 121.080 31.789  -38.431 1.00 81.03  ? 10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 120.498 32.584  -37.278 1.00 83.77  ? 10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 119.513 33.308  -37.469 1.00 84.50  ? 10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 121.730 32.724  -39.449 1.00 83.46  ? 10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 120.715 32.898  -40.477 1.00 88.40  ? 10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 120.097 31.559  -40.611 1.00 83.84  ? 10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 121.093 32.429  -36.084 1.00 77.63  ? 11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 120.637 33.169  -34.911 1.00 76.43  ? 11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 121.200 34.559  -34.966 1.00 81.36  ? 11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 122.361 34.706  -35.314 1.00 84.48  ? 11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 121.093 32.505  -33.619 1.00 75.50  ? 11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 120.498 33.090  -32.370 1.00 79.19  ? 11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 119.103 32.597  -32.160 1.00 78.92  ? 11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 121.333 32.765  -31.196 1.00 83.36  ? 11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 120.411 35.574  -34.627 1.00 74.64  ? 12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 120.895 36.950  -34.635 1.00 73.81  ? 12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 120.158 37.740  -33.569 1.00 75.72  ? 12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 119.268 37.175  -32.923 1.00 75.56  ? 12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 120.738 37.571  -36.035 1.00 75.11  ? 12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 122.049 37.925  -36.706 1.00 84.74  ? 12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 122.285 37.055  -37.925 1.00 97.73  ? 12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 123.193 37.667  -38.906 1.00 114.39 ? 12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 122.871 38.670  -39.728 1.00 128.49 ? 12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 121.666 39.228  -39.669 1.00 107.36 ? 12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 123.762 39.141  -40.592 1.00 119.12 ? 12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 120.567 39.004  -33.316 1.00 70.83  ? 13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 119.902 39.833  -32.303 1.00 69.96  ? 13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 119.297 41.043  -32.910 1.00 76.53  ? 13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 119.740 41.459  -33.979 1.00 78.86  ? 13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 120.759 40.110  -31.069 1.00 74.11  ? 13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 121.976 40.765  -31.416 1.00 68.24  ? 13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 121.038 38.846  -30.270 1.00 77.34  ? 13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 118.248 41.586  -32.282 1.00 73.00  ? 14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 117.567 42.751  -32.827 1.00 73.86  ? 14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 118.439 43.969  -32.596 1.00 77.87  ? 14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 118.862 44.230  -31.469 1.00 77.12  ? 14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 116.105 42.938  -32.353 1.00 78.46  ? 14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 115.422 44.046  -33.150 1.00 79.34  ? 14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 115.303 41.644  -32.473 1.00 78.15  ? 14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 118.787 44.640  -33.699 1.00 74.60  ? 15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 119.654 45.800  -33.712 1.00 74.29  ? 15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 118.842 47.056  -33.829 1.00 78.80  ? 15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 119.174 48.040  -33.178 1.00 79.04  ? 15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 120.689 45.681  -34.851 1.00 76.84  ? 15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 122.109 45.304  -34.383 1.00 89.41  ? 15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 122.220 43.925  -33.686 1.00 99.77  ? 15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 123.217 42.987  -34.334 1.00 114.93 ? 15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 122.632 41.641  -34.646 1.00 123.74 ? 15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 117.791 47.044  -34.664 1.00 75.77  ? 16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 116.928 48.211  -34.870 1.00 76.19  ? 16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 115.466 47.801  -34.961 1.00 79.89  ? 16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 115.158 46.714  -35.459 1.00 79.86  ? 16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 117.283 48.950  -36.179 1.00 78.79  ? 16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 118.721 49.422  -36.366 1.00 93.40  ? 16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 119.062 49.983  -37.739 1.00 118.25 ? 16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 118.484 49.529  -38.759 1.00 111.54 ? 16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 119.937 50.877  -37.786 1.00 110.12 ? 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 114.559 48.679  -34.516 1.00 76.27  ? 17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 113.126 48.439  -34.675 1.00 76.12  ? 17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 112.654 49.550  -35.608 1.00 82.42  ? 17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 112.765 50.737  -35.270 1.00 82.86  ? 17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 112.269 48.295  -33.383 1.00 78.88  ? 17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 110.852 47.838  -33.728 1.00 78.70  ? 17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 112.900 47.310  -32.413 1.00 77.97  ? 17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 112.232 49.163  -36.820 1.00 78.96  ? 18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 111.785 50.088  -37.844 1.00 79.19  ? 18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 110.268 50.220  -37.791 1.00 85.39  ? 18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 109.550 49.401  -38.367 1.00 85.96  ? 18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 112.304 49.630  -39.226 1.00 80.69  ? 18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 111.939 50.521  -40.426 1.00 86.06  ? 18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 112.154 51.998  -40.219 1.00 91.34  ? 18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 111.404 52.677  -39.518 1.00 81.05  ? 18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 113.150 52.536  -40.878 1.00 88.65  ? 18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 109.774 51.245  -37.084 1.00 83.30  ? 19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 108.328 51.479  -36.961 1.00 83.93  ? 19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 107.698 51.897  -38.289 1.00 91.33  ? 19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 108.415 52.336  -39.190 1.00 93.17  ? 19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 108.019 52.463  -35.818 1.00 85.03  ? 19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 108.270 51.809  -34.488 1.00 85.42  ? 19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 107.321 50.970  -33.921 1.00 87.96  ? 19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 109.498 51.940  -33.854 1.00 87.39  ? 19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 107.579 50.307  -32.720 1.00 88.27  ? 19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 109.759 51.271  -32.652 1.00 89.50  ? 19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 108.792 50.473  -32.086 1.00 87.24  ? 19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 106.392 51.713  -38.426 1.00 87.87  ? 20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 105.698 52.064  -39.658 1.00 88.74  ? 20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 104.232 51.706  -39.646 1.00 93.29  ? 20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 103.705 51.296  -38.611 1.00 94.08  ? 20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 103.564 51.854  -40.796 1.00 88.84  ? 21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 102.144 51.526  -40.971 1.00 87.91  ? 21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 101.981 50.454  -42.043 1.00 92.49  ? 21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 102.831 50.308  -42.933 1.00 93.50  ? 21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 101.303 52.784  -41.294 1.00 88.21  ? 21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 101.301 53.896  -40.224 1.00 91.73  ? 21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 100.895 55.226  -40.800 1.00 92.06  ? 21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 100.437 53.531  -39.032 1.00 92.47  ? 21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 100.921 49.676  -41.941 1.00 88.70  ? 22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 100.701 48.615  -42.910 1.00 89.36  ? 22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 99.973  49.129  -44.137 1.00 97.52  ? 22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 98.885  49.730  -44.030 1.00 98.06  ? 22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 99.845  47.504  -42.306 1.00 90.22  ? 22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 100.518 46.240  -41.848 1.00 90.27  ? 22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 101.062 45.356  -42.765 1.00 92.21  ? 22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 100.471 45.858  -40.514 1.00 91.58  ? 22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 101.629 44.160  -42.345 1.00 92.09  ? 22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 101.042 44.660  -40.095 1.00 93.38  ? 22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 101.613 43.819  -41.014 1.00 91.10  ? 22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 100.542 48.836  -45.314 1.00 95.14  ? 23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 99.875  49.124  -46.573 1.00 95.74  ? 23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 98.835  47.995  -46.713 1.00 97.93  ? 23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 99.126  46.866  -46.270 1.00 96.70  ? 23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 100.866 49.064  -47.724 1.00 101.01 ? 23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 101.439 47.777  -47.866 1.00 113.21 ? 23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 97.623  48.258  -47.269 1.00 93.54  ? 24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 96.615  47.187  -47.373 1.00 93.05  ? 24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 97.153  45.977  -48.120 1.00 98.23  ? 24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 96.891  44.833  -47.740 1.00 98.25  ? 24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 95.466  47.846  -48.140 1.00 95.54  ? 24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 95.633  49.267  -47.920 1.00 100.55 ? 24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 97.109  49.520  -47.824 1.00 95.82  ? 24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 97.970  46.250  -49.148 1.00 94.78  ? 25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 98.610  45.270  -50.013 1.00 94.47  ? 25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 99.485  44.316  -49.193 1.00 95.64  ? 25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 99.479  43.114  -49.473 1.00 94.94  ? 25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 99.424  45.988  -51.107 1.00 96.91  ? 25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 98.643  47.021  -51.925 1.00 109.93 ? 25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 98.546  48.437  -51.377 1.00 134.37 ? 25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 99.157  48.719  -50.321 1.00 128.37 ? 25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 97.858  49.271  -52.009 1.00 133.14 ? 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 100.192 44.855  -48.151 1.00 90.45  ? 26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 101.070 44.097  -47.254 1.00 88.63  ? 26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 100.239 43.150  -46.440 1.00 91.99  ? 26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 100.534 41.952  -46.436 1.00 91.46  ? 26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 101.906 45.007  -46.337 1.00 89.20  ? 26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 103.099 44.281  -45.718 1.00 101.10 ? 26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 104.160 45.080  -44.972 1.00 126.11 ? 26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 104.092 46.335  -44.952 1.00 126.32 ? 26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 105.076 44.430  -44.413 1.00 111.67 ? 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 99.164  43.684  -45.787 1.00 87.54  ? 27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 98.209  42.925  -44.972 1.00 85.85  ? 27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 97.741  41.710  -45.772 1.00 91.74  ? 27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 97.841  40.588  -45.276 1.00 91.70  ? 27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 97.026  43.802  -44.519 1.00 88.45  ? 27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 96.028  42.997  -43.703 1.00 87.50  ? 27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 97.505  45.026  -43.750 1.00 87.71  ? 27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 97.317  41.940  -47.040 1.00 89.44  ? 28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 96.861  40.914  -47.967 1.00 90.30  ? 28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 97.989  39.950  -48.270 1.00 96.78  ? 28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 97.763  38.741  -48.289 1.00 98.79  ? 28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 96.340  41.544  -49.272 1.00 92.32  ? 28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 94.825  41.398  -49.482 1.00 107.61 ? 28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 94.355  41.551  -50.929 1.00 122.96 ? 28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 94.970  40.582  -51.860 1.00 134.46 ? 28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 94.415  39.436  -52.265 1.00 141.24 ? 28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 93.230  39.062  -51.797 1.00 134.20 ? 28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 95.055  38.646  -53.124 1.00 109.14 ? 28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 99.208  40.470  -48.476 1.00 92.50  ? 29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 100.358 39.646  -48.823 1.00 91.57  ? 29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 100.803 38.706  -47.704 1.00 93.16  ? 29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 100.916 37.497  -47.952 1.00 92.66  ? 29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 101.500 40.521  -49.282 1.00 92.54  ? 29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 101.009 39.249  -46.475 1.00 88.67  ? 30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 101.433 38.485  -45.282 1.00 87.59  ? 30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 100.369 37.430  -44.872 1.00 92.97  ? 30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 100.739 36.346  -44.379 1.00 93.67  ? 30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 101.897 39.363  -44.047 1.00 89.07  ? 30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 100.755 40.211  -43.452 1.00 89.21  ? 30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 103.156 40.205  -44.320 1.00 88.92  ? 30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 100.835 40.430  -41.960 1.00 94.38  ? 30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 99.055  37.766  -45.089 1.00 87.70  ? 31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 97.870  36.958  -44.766 1.00 86.53  ? 31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 97.947  35.505  -45.218 1.00 89.67  ? 31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 98.414  35.255  -46.326 1.00 92.59  ? 31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 96.624  37.598  -45.358 1.00 90.61  ? 31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 95.462  36.850  -45.044 1.00 100.52 ? 31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 97.490  34.555  -44.362 1.00 82.66  ? 32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 97.462  33.102  -44.632 1.00 81.02  ? 32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 96.063  32.640  -44.956 1.00 83.42  ? 32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 95.890  31.475  -45.329 1.00 83.29  ? 32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 98.105  32.196  -43.549 1.00 83.61  ? 32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 99.530  32.640  -43.245 1.00 83.72  ? 32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 97.251  32.116  -42.281 1.00 82.16  ? 32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 95.067  33.546  -44.768 1.00 79.02  ? 33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 93.639  33.369  -45.035 1.00 79.18  ? 33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 92.839  34.663  -44.830 1.00 87.90  ? 33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 93.278  35.588  -44.139 1.00 88.10  ? 33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 93.065  32.273  -44.155 1.00 78.57  ? 33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 91.687  34.733  -45.495 1.00 87.10  ? 34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 90.620  35.715  -45.346 1.00 88.30  ? 34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 89.457  34.749  -45.273 1.00 98.35  ? 34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 89.455  33.845  -46.115 1.00 100.07 ? 34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 90.511  36.692  -46.538 1.00 90.24  ? 34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 90.104  36.147  -47.920 1.00 88.70  ? 34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 88.724  36.662  -48.412 1.00 87.67  ? 34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 88.789  37.996  -49.128 1.00 93.35  ? 34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 87.707  38.922  -48.682 1.00 102.09 ? 34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 88.703  34.625  -44.165 1.00 96.28  ? 35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 88.203  35.429  -43.049 1.00 95.38  ? 35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 86.960  36.073  -43.581 1.00 103.13 ? 35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 86.990  37.191  -44.077 1.00 103.13 ? 35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 89.124  36.157  -42.023 1.00 95.95  ? 35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 89.915  35.113  -41.240 1.00 94.16  ? 35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 88.299  36.900  -40.989 1.00 95.91  ? 35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 91.167  34.866  -41.723 1.00 99.53  ? 35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 85.925  35.208  -43.699 1.00 102.31 ? 36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 84.641  35.470  -44.337 1.00 103.90 ? 36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 83.444  35.246  -43.406 1.00 108.63 ? 36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 82.396  35.878  -43.600 1.00 108.62 ? 36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 84.502  34.547  -45.577 1.00 104.27 ? 36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 85.607  34.712  -46.625 1.00 112.27 ? 36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 85.566  33.708  -47.769 1.00 117.07 ? 36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 86.888  33.582  -48.388 1.00 124.29 ? 36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 87.683  32.521  -48.257 1.00 146.39 ? 36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 87.278  31.460  -47.569 1.00 131.57 ? 36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 88.890  32.513  -48.816 1.00 143.45 ? 36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 83.572  34.313  -42.441 1.00 104.46 ? 37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 82.454  33.955  -41.572 1.00 104.30 ? 37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 82.658  34.329  -40.137 1.00 108.20 ? 37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 83.592  33.808  -39.545 1.00 108.11 ? 37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 82.129  32.459  -41.689 1.00 106.24 ? 37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 82.248  31.969  -43.104 1.00 109.27 ? 37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 81.529  32.574  -44.130 1.00 113.81 ? 37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 83.087  30.916  -43.419 1.00 112.15 ? 37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 81.685  32.157  -45.447 1.00 115.88 ? 37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 83.251  30.502  -44.739 1.00 116.04 ? 37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 82.546  31.124  -45.744 1.00 115.17 ? 37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 81.761  35.140  -39.517 1.00 104.62 ? 38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 81.917  35.471  -38.089 1.00 104.19 ? 38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 81.913  34.247  -37.164 1.00 111.02 ? 38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 82.499  34.298  -36.076 1.00 111.65 ? 38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 80.731  36.396  -37.812 1.00 106.06 ? 38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 79.758  36.084  -38.867 1.00 111.13 ? 38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 80.576  35.810  -40.076 1.00 106.87 ? 38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 81.288  33.142  -37.615 1.00 108.12 ? 39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 81.230  31.864  -36.912 1.00 107.55 ? 39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 82.665  31.404  -36.644 1.00 111.52 ? 39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 83.518  31.540  -37.513 1.00 110.13 ? 39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 80.449  30.836  -37.750 1.00 109.78 ? 39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 78.976  31.190  -37.960 1.00 124.50 ? 39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 78.594  32.067  -39.147 1.00 154.60 ? 39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 79.465  32.811  -39.653 1.00 152.01 ? 39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 77.415  32.019  -39.567 1.00 154.06 ? 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 82.951  30.982  -35.410 1.00 110.72 ? 40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 84.284  30.564  -34.974 1.00 111.45 ? 40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 84.639  29.248  -35.584 1.00 121.03 ? 40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 85.722  29.105  -36.176 1.00 120.29 ? 40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 84.343  30.529  -33.443 1.00 115.87 ? 40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 84.320  31.873  -32.978 1.00 123.09 ? 40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 85.558  29.797  -32.889 1.00 106.81 ? 40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 83.733  28.271  -35.427 1.00 122.90 ? 41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 83.998  26.934  -35.926 1.00 125.36 ? 41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 82.799  26.078  -36.318 1.00 134.36 ? 41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 82.187  26.335  -37.355 1.00 132.90 ? 41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 84.984  26.195  -35.008 1.00 126.88 ? 41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 84.770  26.425  -33.553 1.00 129.36 ? 41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 85.001  24.831  -32.838 1.00 133.02 ? 41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 83.475  24.708  -31.941 1.00 130.68 ? 41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 82.520  25.029  -35.511 1.00 136.66 ? 42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 81.474  24.011  -35.647 1.00 139.77 ? 42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 81.132  23.785  -37.116 1.00 148.56 ? 42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 80.437  24.605  -37.717 1.00 148.22 ? 42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 80.218  24.327  -34.760 1.00 142.09 ? 42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 80.093  23.698  -33.345 1.00 145.70 ? 42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 80.820  22.712  -33.050 1.00 144.39 ? 42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 79.195  24.126  -32.582 1.00 146.51 ? 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 81.689  22.718  -37.710 1.00 149.54 ? 43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 81.456  22.334  -39.110 1.00 152.65 ? 43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 79.957  21.962  -39.237 1.00 160.88 ? 43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 79.597  20.822  -39.567 1.00 161.65 ? 43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 82.373  21.151  -39.508 1.00 154.41 ? 43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 83.853  21.363  -39.221 1.00 168.00 ? 43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 84.767  20.198  -39.553 1.00 194.82 ? 43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 84.509  19.073  -39.065 1.00 194.36 ? 43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 85.798  20.437  -40.223 1.00 188.80 ? 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 79.093  22.980  -38.968 1.00 158.83 ? 44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 77.631  22.962  -38.831 1.00 159.34 ? 44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 77.349  22.072  -37.592 1.00 162.16 ? 44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 76.935  20.915  -37.738 1.00 162.99 ? 44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 76.878  22.653  -40.170 1.00 166.42 ? 44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 77.566  23.239  -41.281 1.00 163.90 ? 44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 75.432  23.144  -40.155 1.00 164.68 ? 44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 77.697  22.599  -36.376 1.00 156.00 ? 45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 77.596  21.957  -35.038 1.00 154.54 ? 45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 78.734  20.956  -34.730 1.00 152.68 ? 45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 79.019  20.672  -33.560 1.00 151.56 ? 45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 76.198  21.343  -34.746 1.00 157.25 ? 45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 75.370  22.097  -33.692 1.00 176.79 ? 45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 74.112  21.353  -33.282 1.00 194.86 ? 45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 74.004  20.843  -32.159 1.00 189.77 ? 45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 73.121  21.294  -34.172 1.00 185.32 ? 45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 79.380  20.441  -35.782 1.00 145.08 ? 46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 80.459  19.471  -35.695 1.00 142.59 ? 46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 81.722  20.156  -35.189 1.00 141.85 ? 46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 82.447  20.751  -35.995 1.00 142.40 ? 46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 80.641  18.817  -37.070 1.00 150.17 ? 46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 79.376  18.354  -37.547 1.00 149.66 ? 46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 81.664  17.693  -37.063 1.00 149.06 ? 46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 81.981  20.082  -33.857 1.00 133.26 ? 47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 83.157  20.685  -33.213 1.00 130.16 ? 47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 84.530  20.307  -33.858 1.00 128.70 ? 47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 85.070  19.205  -33.652 1.00 126.71 ? 47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 83.097  20.560  -31.676 1.00 130.72 ? 47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 84.269  21.189  -30.900 1.00 144.92 ? 47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 85.250  20.138  -30.377 1.00 158.10 ? 47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 86.490  20.720  -29.852 1.00 163.49 ? 47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 87.500  20.014  -29.349 1.00 173.54 ? 47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 87.430  18.688  -29.288 1.00 155.63 ? 47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 88.584  20.629  -28.894 1.00 159.92 ? 47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 85.023  21.269  -34.700 1.00 121.96 ? 48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 86.252  21.366  -35.511 1.00 119.24 ? 48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 86.201  22.748  -36.190 1.00 118.51 ? 48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 85.139  23.126  -36.689 1.00 118.53 ? 48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 86.296  20.263  -36.563 1.00 120.34 ? 48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 87.321  23.509  -36.168 1.00 111.52 ? 49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 87.460  24.885  -36.706 1.00 110.54 ? 49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 86.929  25.069  -38.121 1.00 112.19 ? 49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 87.096  24.164  -38.937 1.00 112.84 ? 49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 88.915  25.393  -36.632 1.00 113.94 ? 49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 89.704  25.037  -35.353 1.00 136.58 ? 49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 91.209  25.354  -35.498 1.00 145.31 ? 49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 92.099  24.271  -34.930 1.00 145.64 ? 49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 93.488  24.363  -35.455 1.00 145.28 ? 49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 86.326  26.239  -38.430 1.00 106.61 ? 50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 85.745  26.523  -39.768 1.00 106.95 ? 50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 86.764  27.125  -40.763 1.00 109.46 ? 50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 87.656  27.851  -40.313 1.00 109.62 ? 50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 84.470  27.438  -39.633 1.00 110.43 ? 50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 83.494  27.354  -40.869 1.00 110.93 ? 50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 84.844  28.887  -39.254 1.00 111.67 ? 50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 82.173  28.280  -40.861 1.00 106.15 ? 50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 86.569  26.895  -42.083 1.00 103.67 ? 51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 87.357  27.517  -43.145 1.00 102.28 ? 51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 86.981  28.993  -43.312 1.00 104.91 ? 51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 87.261  29.592  -44.338 1.00 104.72 ? 51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 86.396  29.602  -42.279 1.00 101.32 ? 52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 85.907  30.982  -42.244 1.00 100.79 ? 52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 86.563  31.916  -41.252 1.00 102.71 ? 52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 87.215  32.825  -41.741 1.00 103.52 ? 52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 86.356  31.779  -39.863 1.00 96.24  ? 53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 87.072  32.582  -38.807 1.00 94.26  ? 53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 88.194  31.731  -38.229 1.00 98.38  ? 53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 88.666  30.852  -38.959 1.00 99.96  ? 53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 86.236  33.286  -37.684 1.00 93.34  ? 53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 86.894  34.591  -37.077 1.00 95.94  ? 53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 85.876  35.668  -36.686 1.00 95.02  ? 53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 87.722  34.287  -35.881 1.00 96.98  ? 53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 88.625  31.942  -36.955 1.00 92.11  ? 54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 89.764  31.207  -36.405 1.00 91.26  ? 54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 90.096  29.761  -37.017 1.00 95.37  ? 54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 89.443  28.738  -36.744 1.00 93.72  ? 54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 89.982  31.403  -34.893 1.00 88.55  ? 54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 89.198  30.571  -33.923 1.00 108.11 ? 54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 88.550  29.593  -34.273 1.00 115.75 ? 54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 89.313  30.902  -32.647 1.00 89.92  ? 54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 91.074  29.826  -37.981 1.00 91.46  ? 55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 91.765  28.878  -38.841 1.00 91.34  ? 55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 91.168  28.513  -40.160 1.00 102.99 ? 55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 90.908  27.335  -40.419 1.00 104.02 ? 55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 92.438  27.672  -38.159 1.00 91.44  ? 55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 92.990  26.623  -39.159 1.00 82.85  ? 55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 94.133  26.857  -39.735 1.00 76.81  ? 55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 92.244  25.611  -39.439 1.00 73.08  ? 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 91.176  29.452  -41.109 1.00 105.45 ? 56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 90.880  29.105  -42.523 1.00 108.00 ? 56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 92.254  28.869  -43.279 1.00 113.99 ? 56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 92.372  28.999  -44.538 1.00 112.16 ? 56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 90.135  30.348  -43.024 1.00 110.53 ? 56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 90.364  31.426  -41.906 1.00 114.63 ? 56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 91.423  30.891  -40.986 1.00 108.48 ? 56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 93.314  28.519  -42.410 1.00 111.50 ? 57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 94.770  28.226  -42.524 1.00 110.44 ? 57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 95.635  28.936  -41.350 1.00 109.58 ? 57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 96.867  28.844  -41.405 1.00 108.45 ? 57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 95.348  28.543  -43.955 1.00 113.99 ? 57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 94.904  27.642  -45.139 1.00 130.90 ? 57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 95.457  28.087  -46.514 1.00 154.35 ? 57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 95.151  27.121  -47.594 1.00 166.10 ? 57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 95.707  27.094  -48.814 1.00 165.70 ? 57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 96.628  27.990  -49.156 1.00 148.40 ? 57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 95.351  26.164  -49.693 1.00 136.96 ? 57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 94.999  29.647  -40.315 1.00 103.15 ? 58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 95.708  30.440  -39.238 1.00 100.47 ? 58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 96.469  29.558  -38.354 1.00 104.52 ? 58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 96.772  28.436  -38.756 1.00 106.37 ? 58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 94.778  31.252  -38.303 1.00 99.12  ? 58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 93.823  32.306  -38.832 1.00 103.11 ? 58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 93.289  33.136  -37.702 1.00 102.22 ? 58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 94.457  33.211  -39.902 1.00 104.67 ? 58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 96.667  29.989  -37.109 1.00 99.29  ? 59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 97.273  29.110  -36.109 1.00 99.45  ? 59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 96.434  27.886  -35.683 1.00 104.54 ? 59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 95.363  27.604  -36.235 1.00 102.70 ? 59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 96.898  27.145  -34.672 1.00 104.46 ? 60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 96.142  25.983  -34.201 1.00 106.58 ? 60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 95.472  26.109  -32.803 1.00 113.80 ? 60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 95.856  26.945  -31.974 1.00 114.28 ? 60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 97.003  24.724  -34.258 1.00 111.11 ? 60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 96.270  23.571  -33.868 1.00 122.44 ? 60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 94.446  25.267  -32.585 1.00 111.00 ? 61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 93.722  25.052  -31.336 1.00 110.64 ? 61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 93.972  23.531  -31.029 1.00 121.52 ? 61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 94.992  22.967  -31.473 1.00 121.71 ? 61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 92.211  25.442  -31.429 1.00 112.29 ? 61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 92.027  26.829  -32.019 1.00 111.39 ? 61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 91.510  25.340  -30.061 1.00 112.40 ? 61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 90.641  27.102  -32.419 1.00 115.33 ? 61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 93.064  22.884  -30.267 1.00 122.05 ? 62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 93.104  21.477  -29.859 1.00 123.75 ? 62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 94.309  21.047  -28.985 1.00 129.52 ? 62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 94.115  20.233  -28.068 1.00 131.16 ? 62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 92.900  20.530  -31.060 1.00 126.78 ? 62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 91.817  19.475  -30.895 1.00 145.07 ? 62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 92.013  18.533  -30.071 1.00 146.03 ? 62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 90.800  19.549  -31.629 1.00 154.16 ? 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 95.527  21.604  -29.248 1.00 124.03 ? 63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 96.839  21.264  -28.656 1.00 122.47 ? 63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 97.272  19.919  -29.232 1.00 124.73 ? 63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 98.444  19.713  -29.553 1.00 124.85 ? 63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 96.968  21.404  -27.112 1.00 121.49 ? 63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 98.440  21.322  -26.656 1.00 131.76 ? 63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 98.778  21.946  -25.303 1.00 146.75 ? 63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 99.359  23.299  -25.391 1.00 156.77 ? 63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 100.635 23.586  -25.668 1.00 164.60 ? 63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 101.504 22.612  -25.926 1.00 155.55 ? 63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 101.046 24.851  -25.706 1.00 135.49 ? 63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 96.274  19.039  -29.434 1.00 119.53 ? 64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 96.316  17.797  -30.184 1.00 119.09 ? 64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 96.132  18.386  -31.584 1.00 121.21 ? 64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 95.581  19.500  -31.677 1.00 121.74 ? 64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 95.076  16.942  -29.850 1.00 120.83 ? 64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 95.350  15.679  -29.068 1.00 150.20 ? 64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 95.991  14.736  -29.554 1.00 144.29 ? 64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 94.811  15.609  -27.857 1.00 145.11 ? 64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 96.603  17.710  -32.657 1.00 114.11 ? 65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 96.403  18.239  -34.017 1.00 112.75 ? 65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 97.210  19.567  -34.311 1.00 112.06 ? 65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 97.008  20.606  -33.660 1.00 110.49 ? 65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 94.871  18.264  -34.319 1.00 113.17 ? 65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 94.220  19.336  -35.155 1.00 118.57 ? 65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 92.987  18.786  -35.824 1.00 119.76 ? 65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 93.816  20.513  -34.314 1.00 120.84 ? 65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 98.176  19.466  -35.264 1.00 105.74 ? 66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 99.152  20.498  -35.655 1.00 103.45 ? 66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 98.552  21.609  -36.483 1.00 103.21 ? 66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 97.377  21.531  -36.825 1.00 103.52 ? 66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 100.347 19.868  -36.394 1.00 106.50 ? 66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 101.100 18.752  -35.631 1.00 122.62 ? 66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 102.227 18.070  -36.451 1.00 135.48 ? 66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 101.798 17.481  -37.791 1.00 150.57 ? 66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 102.942 17.308  -38.731 1.00 158.11 ? 66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 99.356  22.648  -36.799 1.00 96.81  ? 67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 98.955  23.833  -37.590 1.00 95.98  ? 67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 98.955  23.532  -39.111 1.00 100.13 ? 67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 99.873  22.861  -39.575 1.00 100.57 ? 67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 99.876  25.008  -37.237 1.00 95.04  ? 67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 99.866  26.390  -38.415 1.00 98.65  ? 67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 97.930  23.973  -39.877 1.00 96.31  ? 68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 97.945  23.768  -41.342 1.00 96.74  ? 68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 98.536  25.085  -41.892 1.00 101.99 ? 68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 97.923  26.127  -41.654 1.00 104.83 ? 68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 96.533  23.452  -41.890 1.00 98.20  ? 68   GLN A CB    1 
ATOM   514   N  N     . THR A 1  69   ? 99.756  25.058  -42.520 1.00 95.70  ? 69   THR A N     1 
ATOM   515   C  CA    . THR A 1  69   ? 100.630 26.180  -43.003 1.00 95.30  ? 69   THR A CA    1 
ATOM   516   C  C     . THR A 1  69   ? 101.623 26.374  -41.880 1.00 97.34  ? 69   THR A C     1 
ATOM   517   O  O     . THR A 1  69   ? 101.334 27.152  -40.976 1.00 97.16  ? 69   THR A O     1 
ATOM   518   C  CB    . THR A 1  69   ? 99.929  27.573  -43.435 1.00 103.95 ? 69   THR A CB    1 
ATOM   519   O  OG1   . THR A 1  69   ? 99.498  28.396  -42.330 1.00 92.50  ? 69   THR A OG1   1 
ATOM   520   C  CG2   . THR A 1  69   ? 98.876  27.458  -44.600 1.00 105.13 ? 69   THR A CG2   1 
ATOM   521   N  N     . CYS A 1  70   ? 102.780 25.656  -41.932 1.00 93.13  ? 70   CYS A N     1 
ATOM   522   C  CA    . CYS A 1  70   ? 103.860 25.400  -40.922 1.00 92.04  ? 70   CYS A CA    1 
ATOM   523   C  C     . CYS A 1  70   ? 103.306 24.176  -40.260 1.00 97.73  ? 70   CYS A C     1 
ATOM   524   O  O     . CYS A 1  70   ? 102.135 24.195  -39.891 1.00 98.91  ? 70   CYS A O     1 
ATOM   525   C  CB    . CYS A 1  70   ? 104.102 26.548  -39.923 1.00 91.16  ? 70   CYS A CB    1 
ATOM   526   S  SG    . CYS A 1  70   ? 103.696 26.204  -38.168 1.00 93.55  ? 70   CYS A SG    1 
ATOM   527   N  N     . GLN A 1  71   ? 104.025 23.076  -40.212 1.00 94.06  ? 71   GLN A N     1 
ATOM   528   C  CA    . GLN A 1  71   ? 103.302 21.969  -39.619 1.00 94.77  ? 71   GLN A CA    1 
ATOM   529   C  C     . GLN A 1  71   ? 103.565 21.806  -38.156 1.00 100.40 ? 71   GLN A C     1 
ATOM   530   O  O     . GLN A 1  71   ? 103.044 20.897  -37.542 1.00 99.62  ? 71   GLN A O     1 
ATOM   531   C  CB    . GLN A 1  71   ? 103.476 20.687  -40.426 1.00 97.47  ? 71   GLN A CB    1 
ATOM   532   C  CG    . GLN A 1  71   ? 103.049 20.823  -41.903 1.00 121.68 ? 71   GLN A CG    1 
ATOM   533   C  CD    . GLN A 1  71   ? 101.647 21.360  -42.106 1.00 142.71 ? 71   GLN A CD    1 
ATOM   534   O  OE1   . GLN A 1  71   ? 101.440 22.397  -42.763 1.00 140.68 ? 71   GLN A OE1   1 
ATOM   535   N  NE2   . GLN A 1  71   ? 100.657 20.671  -41.536 1.00 132.19 ? 71   GLN A NE2   1 
ATOM   536   N  N     . GLU A 1  72   ? 104.259 22.782  -37.579 1.00 99.52  ? 72   GLU A N     1 
ATOM   537   C  CA    . GLU A 1  72   ? 104.764 22.834  -36.213 1.00 99.61  ? 72   GLU A CA    1 
ATOM   538   C  C     . GLU A 1  72   ? 103.872 22.501  -35.023 1.00 103.14 ? 72   GLU A C     1 
ATOM   539   O  O     . GLU A 1  72   ? 104.325 21.728  -34.175 1.00 103.59 ? 72   GLU A O     1 
ATOM   540   C  CB    . GLU A 1  72   ? 105.630 24.088  -35.949 1.00 100.98 ? 72   GLU A CB    1 
ATOM   541   C  CG    . GLU A 1  72   ? 106.850 24.266  -36.855 1.00 111.39 ? 72   GLU A CG    1 
ATOM   542   C  CD    . GLU A 1  72   ? 107.764 23.067  -37.038 1.00 126.44 ? 72   GLU A CD    1 
ATOM   543   O  OE1   . GLU A 1  72   ? 108.080 22.400  -36.025 1.00 113.63 ? 72   GLU A OE1   1 
ATOM   544   O  OE2   . GLU A 1  72   ? 108.149 22.787  -38.199 1.00 117.45 ? 72   GLU A OE2   1 
ATOM   545   N  N     . GLY A 1  73   ? 102.699 23.105  -34.893 1.00 98.51  ? 73   GLY A N     1 
ATOM   546   C  CA    . GLY A 1  73   ? 101.898 22.826  -33.701 1.00 98.72  ? 73   GLY A CA    1 
ATOM   547   C  C     . GLY A 1  73   ? 102.340 23.475  -32.374 1.00 103.25 ? 73   GLY A C     1 
ATOM   548   O  O     . GLY A 1  73   ? 103.523 23.470  -31.994 1.00 101.82 ? 73   GLY A O     1 
ATOM   549   N  N     . MET A 1  74   ? 101.322 24.008  -31.645 1.00 99.85  ? 74   MET A N     1 
ATOM   550   C  CA    . MET A 1  74   ? 101.249 24.754  -30.378 1.00 98.11  ? 74   MET A CA    1 
ATOM   551   C  C     . MET A 1  74   ? 102.461 25.467  -29.821 1.00 100.48 ? 74   MET A C     1 
ATOM   552   O  O     . MET A 1  74   ? 102.484 26.694  -29.827 1.00 98.08  ? 74   MET A O     1 
ATOM   553   C  CB    . MET A 1  74   ? 100.484 23.980  -29.310 1.00 100.32 ? 74   MET A CB    1 
ATOM   554   C  CG    . MET A 1  74   ? 99.009  23.709  -29.685 1.00 104.33 ? 74   MET A CG    1 
ATOM   555   S  SD    . MET A 1  74   ? 97.699  24.953  -29.330 1.00 107.54 ? 74   MET A SD    1 
ATOM   556   C  CE    . MET A 1  74   ? 98.037  25.336  -27.643 1.00 103.46 ? 74   MET A CE    1 
ATOM   557   N  N     . ASN A 1  75   ? 103.424 24.733  -29.268 1.00 100.15 ? 75   ASN A N     1 
ATOM   558   C  CA    . ASN A 1  75   ? 104.612 25.375  -28.692 1.00 101.46 ? 75   ASN A CA    1 
ATOM   559   C  C     . ASN A 1  75   ? 105.726 25.279  -29.701 1.00 104.16 ? 75   ASN A C     1 
ATOM   560   O  O     . ASN A 1  75   ? 106.505 24.307  -29.694 1.00 105.05 ? 75   ASN A O     1 
ATOM   561   C  CB    . ASN A 1  75   ? 105.012 24.773  -27.307 1.00 111.36 ? 75   ASN A CB    1 
ATOM   562   C  CG    . ASN A 1  75   ? 106.326 25.305  -26.726 1.00 155.48 ? 75   ASN A CG    1 
ATOM   563   O  OD1   . ASN A 1  75   ? 106.546 26.527  -26.587 1.00 155.54 ? 75   ASN A OD1   1 
ATOM   564   N  ND2   . ASN A 1  75   ? 107.237 24.390  -26.383 1.00 147.12 ? 75   ASN A ND2   1 
ATOM   565   N  N     . GLU A 1  76   ? 105.734 26.262  -30.619 1.00 97.18  ? 76   GLU A N     1 
ATOM   566   C  CA    . GLU A 1  76   ? 106.654 26.428  -31.750 1.00 95.69  ? 76   GLU A CA    1 
ATOM   567   C  C     . GLU A 1  76   ? 105.993 27.345  -32.728 1.00 96.44  ? 76   GLU A C     1 
ATOM   568   O  O     . GLU A 1  76   ? 106.659 28.229  -33.285 1.00 98.30  ? 76   GLU A O     1 
ATOM   569   C  CB    . GLU A 1  76   ? 106.968 25.109  -32.485 1.00 97.30  ? 76   GLU A CB    1 
ATOM   570   C  CG    . GLU A 1  76   ? 108.207 25.180  -33.366 1.00 107.27 ? 76   GLU A CG    1 
ATOM   571   C  CD    . GLU A 1  76   ? 109.522 25.290  -32.621 1.00 119.55 ? 76   GLU A CD    1 
ATOM   572   O  OE1   . GLU A 1  76   ? 110.032 24.252  -32.133 1.00 97.87  ? 76   GLU A OE1   1 
ATOM   573   O  OE2   . GLU A 1  76   ? 110.040 26.426  -32.526 1.00 112.60 ? 76   GLU A OE2   1 
ATOM   574   N  N     . CYS A 1  77   ? 104.694 27.105  -32.974 1.00 87.46  ? 77   CYS A N     1 
ATOM   575   C  CA    . CYS A 1  77   ? 103.910 27.895  -33.899 1.00 85.71  ? 77   CYS A CA    1 
ATOM   576   C  C     . CYS A 1  77   ? 103.538 29.298  -33.367 1.00 89.21  ? 77   CYS A C     1 
ATOM   577   O  O     . CYS A 1  77   ? 102.680 29.429  -32.471 1.00 88.79  ? 77   CYS A O     1 
ATOM   578   C  CB    . CYS A 1  77   ? 102.687 27.117  -34.378 1.00 85.64  ? 77   CYS A CB    1 
ATOM   579   S  SG    . CYS A 1  77   ? 101.652 28.010  -35.563 1.00 89.95  ? 77   CYS A SG    1 
ATOM   580   N  N     . PRO A 1  78   ? 104.159 30.384  -33.913 1.00 85.80  ? 78   PRO A N     1 
ATOM   581   C  CA    . PRO A 1  78   ? 103.676 31.726  -33.564 1.00 85.45  ? 78   PRO A CA    1 
ATOM   582   C  C     . PRO A 1  78   ? 102.403 31.815  -34.368 1.00 92.37  ? 78   PRO A C     1 
ATOM   583   O  O     . PRO A 1  78   ? 102.252 31.083  -35.353 1.00 93.52  ? 78   PRO A O     1 
ATOM   584   C  CB    . PRO A 1  78   ? 104.737 32.658  -34.137 1.00 86.86  ? 78   PRO A CB    1 
ATOM   585   C  CG    . PRO A 1  78   ? 105.343 31.921  -35.247 1.00 91.83  ? 78   PRO A CG    1 
ATOM   586   C  CD    . PRO A 1  78   ? 105.153 30.442  -35.008 1.00 87.52  ? 78   PRO A CD    1 
ATOM   587   N  N     . GLY A 1  79   ? 101.468 32.631  -33.984 1.00 89.62  ? 79   GLY A N     1 
ATOM   588   C  CA    . GLY A 1  79   ? 100.264 32.594  -34.807 1.00 90.47  ? 79   GLY A CA    1 
ATOM   589   C  C     . GLY A 1  79   ? 100.479 33.020  -36.243 1.00 95.52  ? 79   GLY A C     1 
ATOM   590   O  O     . GLY A 1  79   ? 101.521 33.605  -36.572 1.00 95.35  ? 79   GLY A O     1 
ATOM   591   N  N     . HIS A 1  80   ? 99.515  32.730  -37.111 1.00 93.04  ? 80   HIS A N     1 
ATOM   592   C  CA    . HIS A 1  80   ? 99.646  33.229  -38.485 1.00 93.67  ? 80   HIS A CA    1 
ATOM   593   C  C     . HIS A 1  80   ? 98.547  34.249  -38.760 1.00 97.24  ? 80   HIS A C     1 
ATOM   594   O  O     . HIS A 1  80   ? 97.395  33.970  -38.425 1.00 99.45  ? 80   HIS A O     1 
ATOM   595   C  CB    . HIS A 1  80   ? 99.632  32.095  -39.512 1.00 94.88  ? 80   HIS A CB    1 
ATOM   596   C  CG    . HIS A 1  80   ? 100.825 31.209  -39.431 1.00 97.50  ? 80   HIS A CG    1 
ATOM   597   N  ND1   . HIS A 1  80   ? 102.090 31.682  -39.710 1.00 98.73  ? 80   HIS A ND1   1 
ATOM   598   C  CD2   . HIS A 1  80   ? 100.899 29.893  -39.112 1.00 98.77  ? 80   HIS A CD2   1 
ATOM   599   C  CE1   . HIS A 1  80   ? 102.895 30.646  -39.535 1.00 98.06  ? 80   HIS A CE1   1 
ATOM   600   N  NE2   . HIS A 1  80   ? 102.222 29.551  -39.159 1.00 98.20  ? 80   HIS A NE2   1 
ATOM   601   N  N     . PHE A 1  81   ? 98.886  35.427  -39.330 1.00 90.27  ? 81   PHE A N     1 
ATOM   602   C  CA    . PHE A 1  81   ? 97.886  36.458  -39.604 1.00 89.37  ? 81   PHE A CA    1 
ATOM   603   C  C     . PHE A 1  81   ? 97.012  36.142  -40.825 1.00 93.94  ? 81   PHE A C     1 
ATOM   604   O  O     . PHE A 1  81   ? 97.463  35.469  -41.752 1.00 94.42  ? 81   PHE A O     1 
ATOM   605   C  CB    . PHE A 1  81   ? 98.549  37.830  -39.772 1.00 90.73  ? 81   PHE A CB    1 
ATOM   606   C  CG    . PHE A 1  81   ? 98.667  38.640  -38.507 1.00 91.33  ? 81   PHE A CG    1 
ATOM   607   C  CD1   . PHE A 1  81   ? 99.716  38.423  -37.616 1.00 93.71  ? 81   PHE A CD1   1 
ATOM   608   C  CD2   . PHE A 1  81   ? 97.760  39.650  -38.223 1.00 93.65  ? 81   PHE A CD2   1 
ATOM   609   C  CE1   . PHE A 1  81   ? 99.828  39.176  -36.437 1.00 93.82  ? 81   PHE A CE1   1 
ATOM   610   C  CE2   . PHE A 1  81   ? 97.890  40.424  -37.057 1.00 95.91  ? 81   PHE A CE2   1 
ATOM   611   C  CZ    . PHE A 1  81   ? 98.912  40.169  -36.166 1.00 93.04  ? 81   PHE A CZ    1 
ATOM   612   N  N     . GLY A 1  82   ? 95.769  36.632  -40.785 1.00 88.98  ? 82   GLY A N     1 
ATOM   613   C  CA    . GLY A 1  82   ? 94.769  36.576  -41.846 1.00 88.13  ? 82   GLY A CA    1 
ATOM   614   C  C     . GLY A 1  82   ? 94.357  37.992  -42.227 1.00 91.12  ? 82   GLY A C     1 
ATOM   615   O  O     . GLY A 1  82   ? 95.096  38.954  -41.943 1.00 91.10  ? 82   GLY A O     1 
ATOM   616   N  N     . HIS A 1  83   ? 93.177  38.154  -42.866 1.00 86.84  ? 83   HIS A N     1 
ATOM   617   C  CA    . HIS A 1  83   ? 92.688  39.492  -43.242 1.00 86.50  ? 83   HIS A CA    1 
ATOM   618   C  C     . HIS A 1  83   ? 91.197  39.603  -43.516 1.00 92.94  ? 83   HIS A C     1 
ATOM   619   O  O     . HIS A 1  83   ? 90.544  38.602  -43.811 1.00 91.95  ? 83   HIS A O     1 
ATOM   620   C  CB    . HIS A 1  83   ? 93.497  40.100  -44.406 1.00 86.85  ? 83   HIS A CB    1 
ATOM   621   C  CG    . HIS A 1  83   ? 93.079  39.640  -45.766 1.00 90.26  ? 83   HIS A CG    1 
ATOM   622   N  ND1   . HIS A 1  83   ? 93.560  38.473  -46.305 1.00 91.58  ? 83   HIS A ND1   1 
ATOM   623   C  CD2   . HIS A 1  83   ? 92.250  40.227  -46.662 1.00 92.68  ? 83   HIS A CD2   1 
ATOM   624   C  CE1   . HIS A 1  83   ? 93.025  38.386  -47.513 1.00 92.06  ? 83   HIS A CE1   1 
ATOM   625   N  NE2   . HIS A 1  83   ? 92.220  39.414  -47.770 1.00 93.03  ? 83   HIS A NE2   1 
ATOM   626   N  N     . ILE A 1  84   ? 90.672  40.845  -43.439 1.00 93.14  ? 84   ILE A N     1 
ATOM   627   C  CA    . ILE A 1  84   ? 89.277  41.217  -43.764 1.00 95.52  ? 84   ILE A CA    1 
ATOM   628   C  C     . ILE A 1  84   ? 89.179  42.452  -44.648 1.00 100.99 ? 84   ILE A C     1 
ATOM   629   O  O     . ILE A 1  84   ? 89.457  43.581  -44.213 1.00 99.40  ? 84   ILE A O     1 
ATOM   630   C  CB    . ILE A 1  84   ? 88.218  41.195  -42.627 1.00 99.07  ? 84   ILE A CB    1 
ATOM   631   C  CG1   . ILE A 1  84   ? 88.703  41.911  -41.369 1.00 99.96  ? 84   ILE A CG1   1 
ATOM   632   C  CG2   . ILE A 1  84   ? 87.808  39.786  -42.324 1.00 99.36  ? 84   ILE A CG2   1 
ATOM   633   C  CD1   . ILE A 1  84   ? 87.737  41.926  -40.242 1.00 113.40 ? 84   ILE A CD1   1 
ATOM   634   N  N     . ASP A 1  85   ? 88.820  42.207  -45.920 1.00 99.68  ? 85   ASP A N     1 
ATOM   635   C  CA    . ASP A 1  85   ? 88.687  43.250  -46.922 1.00 100.72 ? 85   ASP A CA    1 
ATOM   636   C  C     . ASP A 1  85   ? 87.380  43.980  -46.568 1.00 103.65 ? 85   ASP A C     1 
ATOM   637   O  O     . ASP A 1  85   ? 86.291  43.402  -46.693 1.00 103.57 ? 85   ASP A O     1 
ATOM   638   C  CB    . ASP A 1  85   ? 88.729  42.649  -48.364 1.00 104.15 ? 85   ASP A CB    1 
ATOM   639   C  CG    . ASP A 1  85   ? 90.125  42.321  -48.936 1.00 116.34 ? 85   ASP A CG    1 
ATOM   640   O  OD1   . ASP A 1  85   ? 90.950  43.261  -49.078 1.00 118.93 ? 85   ASP A OD1   1 
ATOM   641   O  OD2   . ASP A 1  85   ? 90.364  41.133  -49.313 1.00 116.76 ? 85   ASP A OD2   1 
ATOM   642   N  N     . LEU A 1  86   ? 87.520  45.191  -45.973 1.00 99.04  ? 86   LEU A N     1 
ATOM   643   C  CA    . LEU A 1  86   ? 86.411  46.041  -45.521 1.00 98.63  ? 86   LEU A CA    1 
ATOM   644   C  C     . LEU A 1  86   ? 85.657  46.581  -46.705 1.00 106.36 ? 86   LEU A C     1 
ATOM   645   O  O     . LEU A 1  86   ? 86.274  47.079  -47.655 1.00 105.62 ? 86   LEU A O     1 
ATOM   646   C  CB    . LEU A 1  86   ? 86.868  47.229  -44.647 1.00 97.43  ? 86   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1  86   ? 87.817  46.974  -43.481 1.00 99.72  ? 86   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1  86   ? 88.416  48.278  -42.993 1.00 99.22  ? 86   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1  86   ? 87.127  46.232  -42.349 1.00 100.15 ? 86   LEU A CD2   1 
ATOM   650   N  N     . ALA A 1  87   ? 84.312  46.505  -46.632 1.00 106.52 ? 87   ALA A N     1 
ATOM   651   C  CA    . ALA A 1  87   ? 83.380  46.973  -47.665 1.00 108.37 ? 87   ALA A CA    1 
ATOM   652   C  C     . ALA A 1  87   ? 83.595  48.453  -48.042 1.00 113.15 ? 87   ALA A C     1 
ATOM   653   O  O     . ALA A 1  87   ? 83.516  48.792  -49.229 1.00 114.69 ? 87   ALA A O     1 
ATOM   654   C  CB    . ALA A 1  87   ? 81.946  46.735  -47.219 1.00 109.50 ? 87   ALA A CB    1 
ATOM   655   N  N     . LYS A 1  88   ? 83.910  49.310  -47.034 1.00 107.42 ? 88   LYS A N     1 
ATOM   656   C  CA    . LYS A 1  88   ? 84.184  50.742  -47.183 1.00 106.59 ? 88   LYS A CA    1 
ATOM   657   C  C     . LYS A 1  88   ? 85.334  51.168  -46.278 1.00 108.66 ? 88   LYS A C     1 
ATOM   658   O  O     . LYS A 1  88   ? 85.540  50.518  -45.251 1.00 107.79 ? 88   LYS A O     1 
ATOM   659   C  CB    . LYS A 1  88   ? 82.926  51.570  -46.886 1.00 109.10 ? 88   LYS A CB    1 
ATOM   660   C  CG    . LYS A 1  88   ? 82.155  51.912  -48.160 1.00 128.23 ? 88   LYS A CG    1 
ATOM   661   C  CD    . LYS A 1  88   ? 80.714  52.302  -47.888 1.00 140.87 ? 88   LYS A CD    1 
ATOM   662   C  CE    . LYS A 1  88   ? 80.092  53.021  -49.055 1.00 152.01 ? 88   LYS A CE    1 
ATOM   663   N  NZ    . LYS A 1  88   ? 80.407  54.475  -49.033 1.00 162.85 ? 88   LYS A NZ    1 
ATOM   664   N  N     . PRO A 1  89   ? 86.107  52.229  -46.617 1.00 104.94 ? 89   PRO A N     1 
ATOM   665   C  CA    . PRO A 1  89   ? 87.198  52.653  -45.726 1.00 104.23 ? 89   PRO A CA    1 
ATOM   666   C  C     . PRO A 1  89   ? 86.701  53.231  -44.396 1.00 108.38 ? 89   PRO A C     1 
ATOM   667   O  O     . PRO A 1  89   ? 85.598  53.785  -44.301 1.00 109.37 ? 89   PRO A O     1 
ATOM   668   C  CB    . PRO A 1  89   ? 87.950  53.694  -46.556 1.00 106.47 ? 89   PRO A CB    1 
ATOM   669   C  CG    . PRO A 1  89   ? 86.933  54.259  -47.435 1.00 111.93 ? 89   PRO A CG    1 
ATOM   670   C  CD    . PRO A 1  89   ? 86.033  53.106  -47.798 1.00 107.70 ? 89   PRO A CD    1 
ATOM   671   N  N     . VAL A 1  90   ? 87.530  53.079  -43.367 1.00 103.08 ? 90   VAL A N     1 
ATOM   672   C  CA    . VAL A 1  90   ? 87.252  53.470  -41.994 1.00 102.14 ? 90   VAL A CA    1 
ATOM   673   C  C     . VAL A 1  90   ? 88.504  54.149  -41.428 1.00 104.31 ? 90   VAL A C     1 
ATOM   674   O  O     . VAL A 1  90   ? 89.615  53.818  -41.842 1.00 104.30 ? 90   VAL A O     1 
ATOM   675   C  CB    . VAL A 1  90   ? 86.845  52.170  -41.234 1.00 105.95 ? 90   VAL A CB    1 
ATOM   676   C  CG1   . VAL A 1  90   ? 87.195  52.210  -39.754 1.00 104.95 ? 90   VAL A CG1   1 
ATOM   677   C  CG2   . VAL A 1  90   ? 85.361  51.852  -41.436 1.00 106.56 ? 90   VAL A CG2   1 
ATOM   678   N  N     . PHE A 1  91   ? 88.338  55.112  -40.517 1.00 99.33  ? 91   PHE A N     1 
ATOM   679   C  CA    . PHE A 1  91   ? 89.487  55.771  -39.910 1.00 98.55  ? 91   PHE A CA    1 
ATOM   680   C  C     . PHE A 1  91   ? 90.133  54.847  -38.906 1.00 103.15 ? 91   PHE A C     1 
ATOM   681   O  O     . PHE A 1  91   ? 89.423  54.064  -38.283 1.00 104.22 ? 91   PHE A O     1 
ATOM   682   C  CB    . PHE A 1  91   ? 89.032  57.013  -39.138 1.00 100.35 ? 91   PHE A CB    1 
ATOM   683   C  CG    . PHE A 1  91   ? 88.572  58.174  -39.972 1.00 103.20 ? 91   PHE A CG    1 
ATOM   684   C  CD1   . PHE A 1  91   ? 89.249  58.531  -41.136 1.00 107.00 ? 91   PHE A CD1   1 
ATOM   685   C  CD2   . PHE A 1  91   ? 87.497  58.951  -39.570 1.00 105.96 ? 91   PHE A CD2   1 
ATOM   686   C  CE1   . PHE A 1  91   ? 88.839  59.630  -41.895 1.00 108.90 ? 91   PHE A CE1   1 
ATOM   687   C  CE2   . PHE A 1  91   ? 87.106  60.067  -40.315 1.00 110.02 ? 91   PHE A CE2   1 
ATOM   688   C  CZ    . PHE A 1  91   ? 87.775  60.395  -41.476 1.00 108.47 ? 91   PHE A CZ    1 
ATOM   689   N  N     . HIS A 1  92   ? 91.454  54.953  -38.693 1.00 98.81  ? 92   HIS A N     1 
ATOM   690   C  CA    . HIS A 1  92   ? 92.094  54.208  -37.607 1.00 97.78  ? 92   HIS A CA    1 
ATOM   691   C  C     . HIS A 1  92   ? 91.810  55.113  -36.400 1.00 100.94 ? 92   HIS A C     1 
ATOM   692   O  O     . HIS A 1  92   ? 92.102  56.315  -36.486 1.00 101.90 ? 92   HIS A O     1 
ATOM   693   C  CB    . HIS A 1  92   ? 93.612  54.076  -37.834 1.00 98.38  ? 92   HIS A CB    1 
ATOM   694   C  CG    . HIS A 1  92   ? 94.361  53.328  -36.767 1.00 101.19 ? 92   HIS A CG    1 
ATOM   695   N  ND1   . HIS A 1  92   ? 94.168  53.589  -35.413 1.00 102.66 ? 92   HIS A ND1   1 
ATOM   696   C  CD2   . HIS A 1  92   ? 95.347  52.410  -36.892 1.00 102.66 ? 92   HIS A CD2   1 
ATOM   697   C  CE1   . HIS A 1  92   ? 95.014  52.803  -34.768 1.00 101.25 ? 92   HIS A CE1   1 
ATOM   698   N  NE2   . HIS A 1  92   ? 95.750  52.080  -35.613 1.00 101.56 ? 92   HIS A NE2   1 
ATOM   699   N  N     . VAL A 1  93   ? 91.199  54.568  -35.309 1.00 94.54  ? 93   VAL A N     1 
ATOM   700   C  CA    . VAL A 1  93   ? 90.859  55.346  -34.102 1.00 93.27  ? 93   VAL A CA    1 
ATOM   701   C  C     . VAL A 1  93   ? 91.999  56.195  -33.664 1.00 95.45  ? 93   VAL A C     1 
ATOM   702   O  O     . VAL A 1  93   ? 91.778  57.361  -33.350 1.00 96.16  ? 93   VAL A O     1 
ATOM   703   C  CB    . VAL A 1  93   ? 90.410  54.521  -32.891 1.00 97.00  ? 93   VAL A CB    1 
ATOM   704   C  CG1   . VAL A 1  93   ? 89.101  55.043  -32.314 1.00 97.03  ? 93   VAL A CG1   1 
ATOM   705   C  CG2   . VAL A 1  93   ? 90.355  53.042  -33.208 1.00 96.96  ? 93   VAL A CG2   1 
ATOM   706   N  N     . GLY A 1  94   ? 93.194  55.591  -33.619 1.00 89.71  ? 94   GLY A N     1 
ATOM   707   C  CA    . GLY A 1  94   ? 94.435  56.232  -33.205 1.00 88.81  ? 94   GLY A CA    1 
ATOM   708   C  C     . GLY A 1  94   ? 94.824  57.442  -34.026 1.00 93.55  ? 94   GLY A C     1 
ATOM   709   O  O     . GLY A 1  94   ? 95.168  58.484  -33.466 1.00 93.96  ? 94   GLY A O     1 
ATOM   710   N  N     . PHE A 1  95   ? 94.739  57.328  -35.351 1.00 90.77  ? 95   PHE A N     1 
ATOM   711   C  CA    . PHE A 1  95   ? 95.179  58.384  -36.257 1.00 91.94  ? 95   PHE A CA    1 
ATOM   712   C  C     . PHE A 1  95   ? 94.237  59.522  -36.589 1.00 97.92  ? 95   PHE A C     1 
ATOM   713   O  O     . PHE A 1  95   ? 94.665  60.516  -37.190 1.00 97.20  ? 95   PHE A O     1 
ATOM   714   C  CB    . PHE A 1  95   ? 95.855  57.784  -37.488 1.00 93.84  ? 95   PHE A CB    1 
ATOM   715   C  CG    . PHE A 1  95   ? 97.027  56.959  -37.047 1.00 94.05  ? 95   PHE A CG    1 
ATOM   716   C  CD1   . PHE A 1  95   ? 98.112  57.551  -36.412 1.00 95.92  ? 95   PHE A CD1   1 
ATOM   717   C  CD2   . PHE A 1  95   ? 96.998  55.577  -37.157 1.00 96.71  ? 95   PHE A CD2   1 
ATOM   718   C  CE1   . PHE A 1  95   ? 99.166  56.782  -35.934 1.00 96.79  ? 95   PHE A CE1   1 
ATOM   719   C  CE2   . PHE A 1  95   ? 98.049  54.800  -36.664 1.00 99.27  ? 95   PHE A CE2   1 
ATOM   720   C  CZ    . PHE A 1  95   ? 99.132  55.409  -36.065 1.00 96.87  ? 95   PHE A CZ    1 
ATOM   721   N  N     . ILE A 1  96   ? 92.981  59.396  -36.144 1.00 96.48  ? 96   ILE A N     1 
ATOM   722   C  CA    . ILE A 1  96   ? 91.883  60.346  -36.329 1.00 98.19  ? 96   ILE A CA    1 
ATOM   723   C  C     . ILE A 1  96   ? 92.277  61.835  -36.263 1.00 101.35 ? 96   ILE A C     1 
ATOM   724   O  O     . ILE A 1  96   ? 91.881  62.605  -37.142 1.00 101.50 ? 96   ILE A O     1 
ATOM   725   C  CB    . ILE A 1  96   ? 90.694  59.984  -35.392 1.00 101.96 ? 96   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1  96   ? 89.355  60.549  -35.899 1.00 102.68 ? 96   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1  96   ? 90.967  60.267  -33.882 1.00 103.86 ? 96   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1  96   ? 88.449  59.462  -36.310 1.00 106.12 ? 96   ILE A CD1   1 
ATOM   729   N  N     . ALA A 1  97   ? 93.066  62.228  -35.246 1.00 96.23  ? 97   ALA A N     1 
ATOM   730   C  CA    . ALA A 1  97   ? 93.467  63.618  -35.116 1.00 96.30  ? 97   ALA A CA    1 
ATOM   731   C  C     . ALA A 1  97   ? 94.571  64.008  -36.085 1.00 99.71  ? 97   ALA A C     1 
ATOM   732   O  O     . ALA A 1  97   ? 94.525  65.136  -36.595 1.00 99.23  ? 97   ALA A O     1 
ATOM   733   C  CB    . ALA A 1  97   ? 93.856  63.924  -33.699 1.00 96.65  ? 97   ALA A CB    1 
ATOM   734   N  N     . LYS A 1  98   ? 95.550  63.077  -36.364 1.00 95.56  ? 98   LYS A N     1 
ATOM   735   C  CA    . LYS A 1  98   ? 96.627  63.322  -37.345 1.00 95.08  ? 98   LYS A CA    1 
ATOM   736   C  C     . LYS A 1  98   ? 96.001  63.443  -38.733 1.00 99.92  ? 98   LYS A C     1 
ATOM   737   O  O     . LYS A 1  98   ? 96.398  64.332  -39.488 1.00 100.90 ? 98   LYS A O     1 
ATOM   738   C  CB    . LYS A 1  98   ? 97.727  62.243  -37.325 1.00 95.36  ? 98   LYS A CB    1 
ATOM   739   C  CG    . LYS A 1  98   ? 98.983  62.599  -38.151 1.00 98.51  ? 98   LYS A CG    1 
ATOM   740   C  CD    . LYS A 1  98   ? 100.291 62.545  -37.323 1.00 109.41 ? 98   LYS A CD    1 
ATOM   741   C  CE    . LYS A 1  98   ? 101.535 62.744  -38.170 1.00 125.04 ? 98   LYS A CE    1 
ATOM   742   N  NZ    . LYS A 1  98   ? 102.800 62.700  -37.377 1.00 129.57 ? 98   LYS A NZ    1 
ATOM   743   N  N     . ILE A 1  99   ? 94.976  62.597  -39.037 1.00 94.83  ? 99   ILE A N     1 
ATOM   744   C  CA    . ILE A 1  99   ? 94.228  62.656  -40.294 1.00 94.63  ? 99   ILE A CA    1 
ATOM   745   C  C     . ILE A 1  99   ? 93.694  64.080  -40.414 1.00 100.08 ? 99   ILE A C     1 
ATOM   746   O  O     . ILE A 1  99   ? 94.045  64.771  -41.374 1.00 100.21 ? 99   ILE A O     1 
ATOM   747   C  CB    . ILE A 1  99   ? 93.092  61.598  -40.369 1.00 97.12  ? 99   ILE A CB    1 
ATOM   748   C  CG1   . ILE A 1  99   ? 93.636  60.154  -40.334 1.00 96.32  ? 99   ILE A CG1   1 
ATOM   749   C  CG2   . ILE A 1  99   ? 92.263  61.814  -41.623 1.00 99.19  ? 99   ILE A CG2   1 
ATOM   750   C  CD1   . ILE A 1  99   ? 92.604  59.093  -40.111 1.00 97.09  ? 99   ILE A CD1   1 
ATOM   751   N  N     . LYS A 1  100  ? 92.928  64.541  -39.382 1.00 97.53  ? 100  LYS A N     1 
ATOM   752   C  CA    . LYS A 1  100  ? 92.351  65.892  -39.283 1.00 97.95  ? 100  LYS A CA    1 
ATOM   753   C  C     . LYS A 1  100  ? 93.423  66.943  -39.513 1.00 101.21 ? 100  LYS A C     1 
ATOM   754   O  O     . LYS A 1  100  ? 93.276  67.726  -40.446 1.00 101.05 ? 100  LYS A O     1 
ATOM   755   C  CB    . LYS A 1  100  ? 91.632  66.119  -37.934 1.00 99.78  ? 100  LYS A CB    1 
ATOM   756   C  CG    . LYS A 1  100  ? 91.119  67.546  -37.745 1.00 109.91 ? 100  LYS A CG    1 
ATOM   757   C  CD    . LYS A 1  100  ? 90.410  67.758  -36.422 1.00 115.55 ? 100  LYS A CD    1 
ATOM   758   C  CE    . LYS A 1  100  ? 89.939  69.186  -36.282 1.00 122.51 ? 100  LYS A CE    1 
ATOM   759   N  NZ    . LYS A 1  100  ? 88.947  69.341  -35.188 1.00 127.79 ? 100  LYS A NZ    1 
ATOM   760   N  N     . LYS A 1  101  ? 94.524  66.919  -38.717 1.00 97.59  ? 101  LYS A N     1 
ATOM   761   C  CA    . LYS A 1  101  ? 95.625  67.878  -38.870 1.00 98.20  ? 101  LYS A CA    1 
ATOM   762   C  C     . LYS A 1  101  ? 96.208  67.902  -40.273 1.00 105.44 ? 101  LYS A C     1 
ATOM   763   O  O     . LYS A 1  101  ? 96.478  68.994  -40.773 1.00 106.32 ? 101  LYS A O     1 
ATOM   764   C  CB    . LYS A 1  101  ? 96.700  67.768  -37.777 1.00 98.97  ? 101  LYS A CB    1 
ATOM   765   C  CG    . LYS A 1  101  ? 96.190  68.297  -36.437 1.00 115.31 ? 101  LYS A CG    1 
ATOM   766   C  CD    . LYS A 1  101  ? 97.281  68.589  -35.407 1.00 121.87 ? 101  LYS A CD    1 
ATOM   767   C  CE    . LYS A 1  101  ? 96.680  68.823  -34.035 1.00 126.05 ? 101  LYS A CE    1 
ATOM   768   N  NZ    . LYS A 1  101  ? 97.610  69.533  -33.113 1.00 132.32 ? 101  LYS A NZ    1 
ATOM   769   N  N     . VAL A 1  102  ? 96.300  66.730  -40.949 1.00 102.83 ? 102  VAL A N     1 
ATOM   770   C  CA    . VAL A 1  102  ? 96.795  66.662  -42.325 1.00 103.94 ? 102  VAL A CA    1 
ATOM   771   C  C     . VAL A 1  102  ? 95.810  67.381  -43.275 1.00 113.51 ? 102  VAL A C     1 
ATOM   772   O  O     . VAL A 1  102  ? 96.235  68.256  -44.035 1.00 113.81 ? 102  VAL A O     1 
ATOM   773   C  CB    . VAL A 1  102  ? 97.214  65.234  -42.779 1.00 106.28 ? 102  VAL A CB    1 
ATOM   774   C  CG1   . VAL A 1  102  ? 97.638  65.215  -44.244 1.00 106.55 ? 102  VAL A CG1   1 
ATOM   775   C  CG2   . VAL A 1  102  ? 98.347  64.700  -41.911 1.00 104.85 ? 102  VAL A CG2   1 
ATOM   776   N  N     . CYS A 1  103  ? 94.495  67.094  -43.156 1.00 113.87 ? 103  CYS A N     1 
ATOM   777   C  CA    . CYS A 1  103  ? 93.450  67.763  -43.952 1.00 116.50 ? 103  CYS A CA    1 
ATOM   778   C  C     . CYS A 1  103  ? 93.541  69.278  -43.771 1.00 121.67 ? 103  CYS A C     1 
ATOM   779   O  O     . CYS A 1  103  ? 93.474  70.021  -44.754 1.00 123.43 ? 103  CYS A O     1 
ATOM   780   C  CB    . CYS A 1  103  ? 92.065  67.250  -43.576 1.00 117.66 ? 103  CYS A CB    1 
ATOM   781   S  SG    . CYS A 1  103  ? 91.807  65.494  -43.918 1.00 121.51 ? 103  CYS A SG    1 
ATOM   782   N  N     . GLU A 1  104  ? 93.763  69.719  -42.515 1.00 116.36 ? 104  GLU A N     1 
ATOM   783   C  CA    . GLU A 1  104  ? 93.930  71.117  -42.136 1.00 116.18 ? 104  GLU A CA    1 
ATOM   784   C  C     . GLU A 1  104  ? 95.179  71.770  -42.805 1.00 121.76 ? 104  GLU A C     1 
ATOM   785   O  O     . GLU A 1  104  ? 95.239  72.995  -42.908 1.00 122.30 ? 104  GLU A O     1 
ATOM   786   C  CB    . GLU A 1  104  ? 93.939  71.258  -40.595 1.00 116.32 ? 104  GLU A CB    1 
ATOM   787   C  CG    . GLU A 1  104  ? 92.584  70.964  -39.954 1.00 125.67 ? 104  GLU A CG    1 
ATOM   788   C  CD    . GLU A 1  104  ? 92.457  70.949  -38.436 1.00 147.53 ? 104  GLU A CD    1 
ATOM   789   O  OE1   . GLU A 1  104  ? 93.294  70.309  -37.757 1.00 141.46 ? 104  GLU A OE1   1 
ATOM   790   O  OE2   . GLU A 1  104  ? 91.460  71.514  -37.929 1.00 141.53 ? 104  GLU A OE2   1 
ATOM   791   N  N     . CYS A 1  105  ? 96.121  70.954  -43.321 1.00 118.89 ? 105  CYS A N     1 
ATOM   792   C  CA    . CYS A 1  105  ? 97.372  71.417  -43.939 1.00 120.02 ? 105  CYS A CA    1 
ATOM   793   C  C     . CYS A 1  105  ? 97.425  71.344  -45.445 1.00 125.12 ? 105  CYS A C     1 
ATOM   794   O  O     . CYS A 1  105  ? 98.273  71.988  -46.075 1.00 124.35 ? 105  CYS A O     1 
ATOM   795   C  CB    . CYS A 1  105  ? 98.552  70.665  -43.338 1.00 119.84 ? 105  CYS A CB    1 
ATOM   796   S  SG    . CYS A 1  105  ? 98.867  71.046  -41.602 1.00 123.16 ? 105  CYS A SG    1 
ATOM   797   N  N     . VAL A 1  106  ? 96.610  70.479  -46.010 1.00 123.51 ? 106  VAL A N     1 
ATOM   798   C  CA    . VAL A 1  106  ? 96.626  70.228  -47.436 1.00 125.30 ? 106  VAL A CA    1 
ATOM   799   C  C     . VAL A 1  106  ? 95.316  70.701  -48.128 1.00 132.06 ? 106  VAL A C     1 
ATOM   800   O  O     . VAL A 1  106  ? 94.315  70.982  -47.448 1.00 131.03 ? 106  VAL A O     1 
ATOM   801   C  CB    . VAL A 1  106  ? 96.982  68.723  -47.628 1.00 128.91 ? 106  VAL A CB    1 
ATOM   802   C  CG1   . VAL A 1  106  ? 95.773  67.811  -47.436 1.00 128.67 ? 106  VAL A CG1   1 
ATOM   803   C  CG2   . VAL A 1  106  ? 97.697  68.449  -48.944 1.00 129.48 ? 106  VAL A CG2   1 
ATOM   804   N  N     . CYS A 1  107  ? 95.348  70.838  -49.471 1.00 131.27 ? 107  CYS A N     1 
ATOM   805   C  CA    . CYS A 1  107  ? 94.170  71.230  -50.234 1.00 132.97 ? 107  CYS A CA    1 
ATOM   806   C  C     . CYS A 1  107  ? 93.220  70.059  -50.304 1.00 136.42 ? 107  CYS A C     1 
ATOM   807   O  O     . CYS A 1  107  ? 93.591  69.001  -50.822 1.00 135.71 ? 107  CYS A O     1 
ATOM   808   C  CB    . CYS A 1  107  ? 94.536  71.728  -51.629 1.00 134.97 ? 107  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1  107  ? 93.103  72.033  -52.701 1.00 140.50 ? 107  CYS A SG    1 
ATOM   810   N  N     . MET A 1  108  ? 91.987  70.257  -49.814 1.00 132.89 ? 108  MET A N     1 
ATOM   811   C  CA    . MET A 1  108  ? 90.956  69.223  -49.821 1.00 132.52 ? 108  MET A CA    1 
ATOM   812   C  C     . MET A 1  108  ? 90.367  68.927  -51.210 1.00 136.67 ? 108  MET A C     1 
ATOM   813   O  O     . MET A 1  108  ? 89.322  68.286  -51.321 1.00 136.06 ? 108  MET A O     1 
ATOM   814   C  CB    . MET A 1  108  ? 89.885  69.496  -48.753 1.00 134.88 ? 108  MET A CB    1 
ATOM   815   C  CG    . MET A 1  108  ? 90.356  69.222  -47.336 1.00 137.78 ? 108  MET A CG    1 
ATOM   816   S  SD    . MET A 1  108  ? 91.341  67.700  -47.118 1.00 141.54 ? 108  MET A SD    1 
ATOM   817   C  CE    . MET A 1  108  ? 90.091  66.426  -47.360 1.00 138.23 ? 108  MET A CE    1 
ATOM   818   N  N     . HIS A 1  109  ? 91.072  69.354  -52.267 1.00 133.98 ? 109  HIS A N     1 
ATOM   819   C  CA    . HIS A 1  109  ? 90.665  69.124  -53.639 1.00 135.06 ? 109  HIS A CA    1 
ATOM   820   C  C     . HIS A 1  109  ? 91.832  68.681  -54.536 1.00 139.25 ? 109  HIS A C     1 
ATOM   821   O  O     . HIS A 1  109  ? 91.708  67.636  -55.180 1.00 138.91 ? 109  HIS A O     1 
ATOM   822   C  CB    . HIS A 1  109  ? 89.918  70.337  -54.204 1.00 137.43 ? 109  HIS A CB    1 
ATOM   823   C  CG    . HIS A 1  109  ? 89.587  70.194  -55.652 1.00 142.37 ? 109  HIS A CG    1 
ATOM   824   N  ND1   . HIS A 1  109  ? 88.535  69.404  -56.074 1.00 144.63 ? 109  HIS A ND1   1 
ATOM   825   C  CD2   . HIS A 1  109  ? 90.216  70.707  -56.736 1.00 145.28 ? 109  HIS A CD2   1 
ATOM   826   C  CE1   . HIS A 1  109  ? 88.547  69.472  -57.395 1.00 145.37 ? 109  HIS A CE1   1 
ATOM   827   N  NE2   . HIS A 1  109  ? 89.541  70.246  -57.839 1.00 146.10 ? 109  HIS A NE2   1 
ATOM   828   N  N     . CYS A 1  110  ? 92.945  69.464  -54.602 1.00 135.74 ? 110  CYS A N     1 
ATOM   829   C  CA    . CYS A 1  110  ? 94.093  69.099  -55.451 1.00 135.56 ? 110  CYS A CA    1 
ATOM   830   C  C     . CYS A 1  110  ? 95.175  68.251  -54.768 1.00 137.54 ? 110  CYS A C     1 
ATOM   831   O  O     . CYS A 1  110  ? 95.863  67.469  -55.437 1.00 135.98 ? 110  CYS A O     1 
ATOM   832   C  CB    . CYS A 1  110  ? 94.664  70.290  -56.226 1.00 137.01 ? 110  CYS A CB    1 
ATOM   833   S  SG    . CYS A 1  110  ? 95.740  71.391  -55.267 1.00 140.26 ? 110  CYS A SG    1 
ATOM   834   N  N     . GLY A 1  111  ? 95.258  68.372  -53.442 1.00 134.09 ? 111  GLY A N     1 
ATOM   835   C  CA    . GLY A 1  111  ? 96.196  67.626  -52.612 1.00 133.02 ? 111  GLY A CA    1 
ATOM   836   C  C     . GLY A 1  111  ? 97.570  68.253  -52.533 1.00 137.97 ? 111  GLY A C     1 
ATOM   837   O  O     . GLY A 1  111  ? 98.576  67.542  -52.454 1.00 137.27 ? 111  GLY A O     1 
ATOM   838   N  N     . LYS A 1  112  ? 97.619  69.593  -52.571 1.00 135.89 ? 112  LYS A N     1 
ATOM   839   C  CA    . LYS A 1  112  ? 98.864  70.359  -52.477 1.00 136.14 ? 112  LYS A CA    1 
ATOM   840   C  C     . LYS A 1  112  ? 98.892  71.033  -51.126 1.00 137.80 ? 112  LYS A C     1 
ATOM   841   O  O     . LYS A 1  112  ? 97.831  71.392  -50.597 1.00 136.94 ? 112  LYS A O     1 
ATOM   842   C  CB    . LYS A 1  112  ? 98.983  71.447  -53.594 1.00 141.46 ? 112  LYS A CB    1 
ATOM   843   C  CG    . LYS A 1  112  ? 99.384  70.986  -55.021 1.00 164.04 ? 112  LYS A CG    1 
ATOM   844   C  CD    . LYS A 1  112  ? 100.488 69.890  -55.097 1.00 179.57 ? 112  LYS A CD    1 
ATOM   845   C  CE    . LYS A 1  112  ? 101.902 70.355  -54.811 1.00 191.83 ? 112  LYS A CE    1 
ATOM   846   N  NZ    . LYS A 1  112  ? 102.816 69.206  -54.545 1.00 195.94 ? 112  LYS A NZ    1 
ATOM   847   N  N     . LEU A 1  113  ? 100.104 71.224  -50.572 1.00 133.20 ? 113  LEU A N     1 
ATOM   848   C  CA    . LEU A 1  113  ? 100.291 71.922  -49.299 1.00 132.04 ? 113  LEU A CA    1 
ATOM   849   C  C     . LEU A 1  113  ? 99.739  73.361  -49.422 1.00 136.99 ? 113  LEU A C     1 
ATOM   850   O  O     . LEU A 1  113  ? 100.052 74.063  -50.397 1.00 137.49 ? 113  LEU A O     1 
ATOM   851   C  CB    . LEU A 1  113  ? 101.779 71.956  -48.920 1.00 130.97 ? 113  LEU A CB    1 
ATOM   852   C  CG    . LEU A 1  113  ? 102.289 70.846  -48.034 1.00 132.93 ? 113  LEU A CG    1 
ATOM   853   C  CD1   . LEU A 1  113  ? 103.781 70.709  -48.181 1.00 132.78 ? 113  LEU A CD1   1 
ATOM   854   C  CD2   . LEU A 1  113  ? 101.954 71.113  -46.590 1.00 133.02 ? 113  LEU A CD2   1 
ATOM   855   N  N     . LEU A 1  114  ? 98.896  73.775  -48.450 1.00 132.54 ? 114  LEU A N     1 
ATOM   856   C  CA    . LEU A 1  114  ? 98.258  75.098  -48.425 1.00 132.84 ? 114  LEU A CA    1 
ATOM   857   C  C     . LEU A 1  114  ? 99.231  76.288  -48.444 1.00 136.74 ? 114  LEU A C     1 
ATOM   858   O  O     . LEU A 1  114  ? 98.841  77.393  -48.827 1.00 138.22 ? 114  LEU A O     1 
ATOM   859   C  CB    . LEU A 1  114  ? 97.215  75.214  -47.295 1.00 132.28 ? 114  LEU A CB    1 
ATOM   860   C  CG    . LEU A 1  114  ? 96.059  74.205  -47.330 1.00 136.35 ? 114  LEU A CG    1 
ATOM   861   C  CD1   . LEU A 1  114  ? 95.194  74.313  -46.088 1.00 135.91 ? 114  LEU A CD1   1 
ATOM   862   C  CD2   . LEU A 1  114  ? 95.229  74.346  -48.587 1.00 139.08 ? 114  LEU A CD2   1 
ATOM   863   N  N     . LEU A 1  115  ? 100.497 76.047  -48.075 1.00 131.26 ? 115  LEU A N     1 
ATOM   864   C  CA    . LEU A 1  115  ? 101.582 77.025  -48.102 1.00 131.41 ? 115  LEU A CA    1 
ATOM   865   C  C     . LEU A 1  115  ? 102.841 76.361  -48.680 1.00 137.32 ? 115  LEU A C     1 
ATOM   866   O  O     . LEU A 1  115  ? 102.885 75.129  -48.755 1.00 136.59 ? 115  LEU A O     1 
ATOM   867   C  CB    . LEU A 1  115  ? 101.847 77.583  -46.702 1.00 130.42 ? 115  LEU A CB    1 
ATOM   868   C  CG    . LEU A 1  115  ? 100.837 78.589  -46.183 1.00 135.24 ? 115  LEU A CG    1 
ATOM   869   C  CD1   . LEU A 1  115  ? 100.878 78.668  -44.680 1.00 134.32 ? 115  LEU A CD1   1 
ATOM   870   C  CD2   . LEU A 1  115  ? 101.070 79.954  -46.786 1.00 139.20 ? 115  LEU A CD2   1 
ATOM   871   N  N     . ASP A 1  116  ? 103.845 77.157  -49.125 1.00 135.67 ? 116  ASP A N     1 
ATOM   872   C  CA    . ASP A 1  116  ? 105.077 76.603  -49.706 1.00 135.82 ? 116  ASP A CA    1 
ATOM   873   C  C     . ASP A 1  116  ? 106.320 77.491  -49.559 1.00 142.16 ? 116  ASP A C     1 
ATOM   874   O  O     . ASP A 1  116  ? 106.323 78.438  -48.766 1.00 141.36 ? 116  ASP A O     1 
ATOM   875   C  CB    . ASP A 1  116  ? 104.858 76.162  -51.175 1.00 138.22 ? 116  ASP A CB    1 
ATOM   876   C  CG    . ASP A 1  116  ? 104.465 77.248  -52.165 1.00 146.96 ? 116  ASP A CG    1 
ATOM   877   O  OD1   . ASP A 1  116  ? 103.963 78.312  -51.724 1.00 147.50 ? 116  ASP A OD1   1 
ATOM   878   O  OD2   . ASP A 1  116  ? 104.599 77.009  -53.384 1.00 152.18 ? 116  ASP A OD2   1 
ATOM   879   N  N     . GLU A 1  117  ? 107.372 77.173  -50.350 1.00 141.49 ? 117  GLU A N     1 
ATOM   880   C  CA    . GLU A 1  117  ? 108.687 77.836  -50.453 1.00 142.99 ? 117  GLU A CA    1 
ATOM   881   C  C     . GLU A 1  117  ? 108.568 79.354  -50.674 1.00 149.87 ? 117  GLU A C     1 
ATOM   882   O  O     . GLU A 1  117  ? 109.550 80.088  -50.499 1.00 149.77 ? 117  GLU A O     1 
ATOM   883   C  CB    . GLU A 1  117  ? 109.518 77.224  -51.606 1.00 145.00 ? 117  GLU A CB    1 
ATOM   884   C  CG    . GLU A 1  117  ? 109.546 75.700  -51.668 1.00 156.44 ? 117  GLU A CG    1 
ATOM   885   C  CD    . GLU A 1  117  ? 108.334 75.044  -52.311 1.00 178.88 ? 117  GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1  117  ? 107.878 75.522  -53.377 1.00 173.76 ? 117  GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1  117  ? 107.815 74.074  -51.714 1.00 169.69 ? 117  GLU A OE2   1 
ATOM   888   N  N     . HIS A 1  118  ? 107.360 79.805  -51.074 1.00 147.91 ? 118  HIS A N     1 
ATOM   889   C  CA    . HIS A 1  118  ? 107.016 81.198  -51.329 1.00 148.93 ? 118  HIS A CA    1 
ATOM   890   C  C     . HIS A 1  118  ? 106.696 81.968  -50.043 1.00 151.55 ? 118  HIS A C     1 
ATOM   891   O  O     . HIS A 1  118  ? 107.110 83.124  -49.920 1.00 152.38 ? 118  HIS A O     1 
ATOM   892   C  CB    . HIS A 1  118  ? 105.955 81.314  -52.436 1.00 150.83 ? 118  HIS A CB    1 
ATOM   893   C  CG    . HIS A 1  118  ? 106.433 80.746  -53.741 1.00 154.81 ? 118  HIS A CG    1 
ATOM   894   N  ND1   . HIS A 1  118  ? 107.282 81.460  -54.572 1.00 157.54 ? 118  HIS A ND1   1 
ATOM   895   C  CD2   . HIS A 1  118  ? 106.236 79.516  -54.273 1.00 156.21 ? 118  HIS A CD2   1 
ATOM   896   C  CE1   . HIS A 1  118  ? 107.546 80.655  -55.590 1.00 157.22 ? 118  HIS A CE1   1 
ATOM   897   N  NE2   . HIS A 1  118  ? 106.935 79.476  -55.456 1.00 156.76 ? 118  HIS A NE2   1 
ATOM   898   N  N     . ASN A 1  119  ? 106.044 81.327  -49.054 1.00 145.60 ? 119  ASN A N     1 
ATOM   899   C  CA    . ASN A 1  119  ? 105.856 82.015  -47.785 1.00 144.64 ? 119  ASN A CA    1 
ATOM   900   C  C     . ASN A 1  119  ? 107.155 81.873  -46.995 1.00 147.90 ? 119  ASN A C     1 
ATOM   901   O  O     . ASN A 1  119  ? 107.747 80.789  -46.963 1.00 146.37 ? 119  ASN A O     1 
ATOM   902   C  CB    . ASN A 1  119  ? 104.656 81.502  -46.993 1.00 142.99 ? 119  ASN A CB    1 
ATOM   903   C  CG    . ASN A 1  119  ? 104.334 82.351  -45.769 1.00 158.60 ? 119  ASN A CG    1 
ATOM   904   O  OD1   . ASN A 1  119  ? 105.130 82.478  -44.821 1.00 148.36 ? 119  ASN A OD1   1 
ATOM   905   N  ND2   . ASN A 1  119  ? 103.146 82.944  -45.750 1.00 149.28 ? 119  ASN A ND2   1 
ATOM   906   N  N     . GLU A 1  120  ? 107.602 82.991  -46.395 1.00 145.44 ? 120  GLU A N     1 
ATOM   907   C  CA    . GLU A 1  120  ? 108.825 83.144  -45.597 1.00 144.91 ? 120  GLU A CA    1 
ATOM   908   C  C     . GLU A 1  120  ? 108.836 82.223  -44.372 1.00 146.80 ? 120  GLU A C     1 
ATOM   909   O  O     . GLU A 1  120  ? 109.743 81.393  -44.225 1.00 145.34 ? 120  GLU A O     1 
ATOM   910   C  CB    . GLU A 1  120  ? 108.977 84.621  -45.186 1.00 147.27 ? 120  GLU A CB    1 
ATOM   911   C  CG    . GLU A 1  120  ? 110.325 85.015  -44.603 1.00 159.62 ? 120  GLU A CG    1 
ATOM   912   C  CD    . GLU A 1  120  ? 110.528 86.507  -44.384 1.00 188.59 ? 120  GLU A CD    1 
ATOM   913   O  OE1   . GLU A 1  120  ? 109.526 87.249  -44.252 1.00 179.01 ? 120  GLU A OE1   1 
ATOM   914   O  OE2   . GLU A 1  120  ? 111.704 86.936  -44.354 1.00 195.34 ? 120  GLU A OE2   1 
ATOM   915   N  N     . LEU A 1  121  ? 107.801 82.357  -43.519 1.00 142.33 ? 121  LEU A N     1 
ATOM   916   C  CA    . LEU A 1  121  ? 107.612 81.579  -42.295 1.00 140.41 ? 121  LEU A CA    1 
ATOM   917   C  C     . LEU A 1  121  ? 107.521 80.082  -42.597 1.00 142.82 ? 121  LEU A C     1 
ATOM   918   O  O     . LEU A 1  121  ? 107.915 79.258  -41.769 1.00 141.29 ? 121  LEU A O     1 
ATOM   919   C  CB    . LEU A 1  121  ? 106.354 82.056  -41.555 1.00 140.27 ? 121  LEU A CB    1 
ATOM   920   C  CG    . LEU A 1  121  ? 106.407 83.470  -40.991 1.00 145.23 ? 121  LEU A CG    1 
ATOM   921   C  CD1   . LEU A 1  121  ? 105.653 84.435  -41.878 1.00 146.76 ? 121  LEU A CD1   1 
ATOM   922   C  CD2   . LEU A 1  121  ? 105.830 83.512  -39.603 1.00 146.90 ? 121  LEU A CD2   1 
ATOM   923   N  N     . MET A 1  122  ? 107.015 79.744  -43.795 1.00 139.16 ? 122  MET A N     1 
ATOM   924   C  CA    . MET A 1  122  ? 106.865 78.379  -44.270 1.00 138.01 ? 122  MET A CA    1 
ATOM   925   C  C     . MET A 1  122  ? 108.204 77.755  -44.611 1.00 140.85 ? 122  MET A C     1 
ATOM   926   O  O     . MET A 1  122  ? 108.462 76.655  -44.130 1.00 139.90 ? 122  MET A O     1 
ATOM   927   C  CB    . MET A 1  122  ? 105.898 78.313  -45.456 1.00 141.20 ? 122  MET A CB    1 
ATOM   928   C  CG    . MET A 1  122  ? 105.621 76.910  -45.943 1.00 144.11 ? 122  MET A CG    1 
ATOM   929   S  SD    . MET A 1  122  ? 104.615 75.927  -44.824 1.00 146.86 ? 122  MET A SD    1 
ATOM   930   C  CE    . MET A 1  122  ? 104.641 74.375  -45.694 1.00 143.26 ? 122  MET A CE    1 
ATOM   931   N  N     . ARG A 1  123  ? 109.061 78.431  -45.422 1.00 137.20 ? 123  ARG A N     1 
ATOM   932   C  CA    . ARG A 1  123  ? 110.379 77.872  -45.770 1.00 136.44 ? 123  ARG A CA    1 
ATOM   933   C  C     . ARG A 1  123  ? 111.310 77.798  -44.538 1.00 137.87 ? 123  ARG A C     1 
ATOM   934   O  O     . ARG A 1  123  ? 112.231 76.972  -44.469 1.00 135.33 ? 123  ARG A O     1 
ATOM   935   C  CB    . ARG A 1  123  ? 111.004 78.561  -46.995 1.00 137.81 ? 123  ARG A CB    1 
ATOM   936   C  CG    . ARG A 1  123  ? 111.445 79.997  -46.785 1.00 149.29 ? 123  ARG A CG    1 
ATOM   937   C  CD    . ARG A 1  123  ? 111.933 80.611  -48.082 1.00 158.27 ? 123  ARG A CD    1 
ATOM   938   N  NE    . ARG A 1  123  ? 110.956 81.552  -48.626 1.00 163.32 ? 123  ARG A NE    1 
ATOM   939   C  CZ    . ARG A 1  123  ? 110.912 82.844  -48.319 1.00 177.14 ? 123  ARG A CZ    1 
ATOM   940   N  NH1   . ARG A 1  123  ? 111.784 83.360  -47.459 1.00 162.48 ? 123  ARG A NH1   1 
ATOM   941   N  NH2   . ARG A 1  123  ? 109.980 83.625  -48.846 1.00 167.41 ? 123  ARG A NH2   1 
ATOM   942   N  N     . GLN A 1  124  ? 110.978 78.638  -43.548 1.00 134.63 ? 124  GLN A N     1 
ATOM   943   C  CA    . GLN A 1  124  ? 111.572 78.748  -42.226 1.00 133.96 ? 124  GLN A CA    1 
ATOM   944   C  C     . GLN A 1  124  ? 111.190 77.468  -41.427 1.00 135.25 ? 124  GLN A C     1 
ATOM   945   O  O     . GLN A 1  124  ? 112.064 76.819  -40.841 1.00 133.71 ? 124  GLN A O     1 
ATOM   946   C  CB    . GLN A 1  124  ? 111.021 80.037  -41.574 1.00 136.20 ? 124  GLN A CB    1 
ATOM   947   C  CG    . GLN A 1  124  ? 111.368 80.291  -40.114 1.00 160.41 ? 124  GLN A CG    1 
ATOM   948   C  CD    . GLN A 1  124  ? 110.529 81.421  -39.562 1.00 183.59 ? 124  GLN A CD    1 
ATOM   949   O  OE1   . GLN A 1  124  ? 109.358 81.239  -39.197 1.00 179.61 ? 124  GLN A OE1   1 
ATOM   950   N  NE2   . GLN A 1  124  ? 111.106 82.618  -39.500 1.00 175.67 ? 124  GLN A NE2   1 
ATOM   951   N  N     . ALA A 1  125  ? 109.885 77.103  -41.438 1.00 130.68 ? 125  ALA A N     1 
ATOM   952   C  CA    . ALA A 1  125  ? 109.353 75.904  -40.778 1.00 128.53 ? 125  ALA A CA    1 
ATOM   953   C  C     . ALA A 1  125  ? 109.791 74.638  -41.523 1.00 129.92 ? 125  ALA A C     1 
ATOM   954   O  O     . ALA A 1  125  ? 110.081 73.628  -40.889 1.00 128.86 ? 125  ALA A O     1 
ATOM   955   C  CB    . ALA A 1  125  ? 107.833 75.970  -40.698 1.00 129.24 ? 125  ALA A CB    1 
ATOM   956   N  N     . LEU A 1  126  ? 109.877 74.706  -42.861 1.00 125.55 ? 126  LEU A N     1 
ATOM   957   C  CA    . LEU A 1  126  ? 110.308 73.589  -43.692 1.00 124.64 ? 126  LEU A CA    1 
ATOM   958   C  C     . LEU A 1  126  ? 111.740 73.195  -43.381 1.00 128.61 ? 126  LEU A C     1 
ATOM   959   O  O     . LEU A 1  126  ? 112.083 72.023  -43.511 1.00 127.53 ? 126  LEU A O     1 
ATOM   960   C  CB    . LEU A 1  126  ? 110.146 73.920  -45.181 1.00 125.60 ? 126  LEU A CB    1 
ATOM   961   C  CG    . LEU A 1  126  ? 108.785 73.558  -45.775 1.00 130.17 ? 126  LEU A CG    1 
ATOM   962   C  CD1   . LEU A 1  126  ? 108.340 74.573  -46.778 1.00 131.32 ? 126  LEU A CD1   1 
ATOM   963   C  CD2   . LEU A 1  126  ? 108.807 72.186  -46.414 1.00 132.37 ? 126  LEU A CD2   1 
ATOM   964   N  N     . ALA A 1  127  ? 112.557 74.164  -42.921 1.00 126.28 ? 127  ALA A N     1 
ATOM   965   C  CA    . ALA A 1  127  ? 113.963 73.975  -42.554 1.00 125.93 ? 127  ALA A CA    1 
ATOM   966   C  C     . ALA A 1  127  ? 114.177 72.964  -41.429 1.00 128.36 ? 127  ALA A C     1 
ATOM   967   O  O     . ALA A 1  127  ? 115.083 72.127  -41.548 1.00 127.12 ? 127  ALA A O     1 
ATOM   968   C  CB    . ALA A 1  127  ? 114.582 75.306  -42.175 1.00 127.34 ? 127  ALA A CB    1 
ATOM   969   N  N     . ILE A 1  128  ? 113.343 73.046  -40.346 1.00 124.46 ? 128  ILE A N     1 
ATOM   970   C  CA    . ILE A 1  128  ? 113.366 72.188  -39.140 1.00 122.89 ? 128  ILE A CA    1 
ATOM   971   C  C     . ILE A 1  128  ? 113.716 70.733  -39.468 1.00 127.43 ? 128  ILE A C     1 
ATOM   972   O  O     . ILE A 1  128  ? 113.075 70.114  -40.327 1.00 127.38 ? 128  ILE A O     1 
ATOM   973   C  CB    . ILE A 1  128  ? 112.062 72.289  -38.301 1.00 124.86 ? 128  ILE A CB    1 
ATOM   974   C  CG1   . ILE A 1  128  ? 111.700 73.745  -37.980 1.00 125.43 ? 128  ILE A CG1   1 
ATOM   975   C  CG2   . ILE A 1  128  ? 112.150 71.428  -37.025 1.00 124.19 ? 128  ILE A CG2   1 
ATOM   976   C  CD1   . ILE A 1  128  ? 110.285 73.936  -37.567 1.00 130.79 ? 128  ILE A CD1   1 
ATOM   977   N  N     . LYS A 1  129  ? 114.757 70.212  -38.810 1.00 123.44 ? 129  LYS A N     1 
ATOM   978   C  CA    . LYS A 1  129  ? 115.221 68.849  -39.052 1.00 122.56 ? 129  LYS A CA    1 
ATOM   979   C  C     . LYS A 1  129  ? 114.282 67.823  -38.419 1.00 125.00 ? 129  LYS A C     1 
ATOM   980   O  O     . LYS A 1  129  ? 113.959 66.816  -39.059 1.00 123.82 ? 129  LYS A O     1 
ATOM   981   C  CB    . LYS A 1  129  ? 116.672 68.670  -38.567 1.00 124.74 ? 129  LYS A CB    1 
ATOM   982   C  CG    . LYS A 1  129  ? 117.674 69.662  -39.172 1.00 139.31 ? 129  LYS A CG    1 
ATOM   983   C  CD    . LYS A 1  129  ? 118.312 69.156  -40.469 1.00 150.04 ? 129  LYS A CD    1 
ATOM   984   C  CE    . LYS A 1  129  ? 119.190 70.192  -41.134 1.00 164.47 ? 129  LYS A CE    1 
ATOM   985   N  NZ    . LYS A 1  129  ? 120.495 70.373  -40.438 1.00 174.35 ? 129  LYS A NZ    1 
ATOM   986   N  N     . ASP A 1  130  ? 113.813 68.114  -37.183 1.00 121.26 ? 130  ASP A N     1 
ATOM   987   C  CA    . ASP A 1  130  ? 112.927 67.260  -36.387 1.00 120.39 ? 130  ASP A CA    1 
ATOM   988   C  C     . ASP A 1  130  ? 111.519 67.140  -36.976 1.00 122.87 ? 130  ASP A C     1 
ATOM   989   O  O     . ASP A 1  130  ? 110.718 68.069  -36.818 1.00 122.91 ? 130  ASP A O     1 
ATOM   990   C  CB    . ASP A 1  130  ? 112.859 67.775  -34.933 1.00 122.47 ? 130  ASP A CB    1 
ATOM   991   C  CG    . ASP A 1  130  ? 112.346 66.775  -33.899 1.00 137.70 ? 130  ASP A CG    1 
ATOM   992   O  OD1   . ASP A 1  130  ? 111.387 66.016  -34.212 1.00 137.61 ? 130  ASP A OD1   1 
ATOM   993   O  OD2   . ASP A 1  130  ? 112.865 66.784  -32.764 1.00 147.91 ? 130  ASP A OD2   1 
ATOM   994   N  N     . SER A 1  131  ? 111.198 65.967  -37.588 1.00 117.66 ? 131  SER A N     1 
ATOM   995   C  CA    . SER A 1  131  ? 109.889 65.669  -38.200 1.00 117.08 ? 131  SER A CA    1 
ATOM   996   C  C     . SER A 1  131  ? 108.670 66.047  -37.323 1.00 119.13 ? 131  SER A C     1 
ATOM   997   O  O     . SER A 1  131  ? 107.724 66.665  -37.814 1.00 119.63 ? 131  SER A O     1 
ATOM   998   C  CB    . SER A 1  131  ? 109.810 64.210  -38.642 1.00 120.30 ? 131  SER A CB    1 
ATOM   999   O  OG    . SER A 1  131  ? 109.769 63.319  -37.539 1.00 130.59 ? 131  SER A OG    1 
ATOM   1000  N  N     . LYS A 1  132  ? 108.730 65.715  -36.026 1.00 113.22 ? 132  LYS A N     1 
ATOM   1001  C  CA    . LYS A 1  132  ? 107.687 65.990  -35.040 1.00 111.93 ? 132  LYS A CA    1 
ATOM   1002  C  C     . LYS A 1  132  ? 107.468 67.500  -34.840 1.00 115.34 ? 132  LYS A C     1 
ATOM   1003  O  O     . LYS A 1  132  ? 106.324 67.967  -34.840 1.00 114.99 ? 132  LYS A O     1 
ATOM   1004  C  CB    . LYS A 1  132  ? 108.081 65.324  -33.711 1.00 113.02 ? 132  LYS A CB    1 
ATOM   1005  C  CG    . LYS A 1  132  ? 107.069 64.308  -33.158 1.00 119.97 ? 132  LYS A CG    1 
ATOM   1006  C  CD    . LYS A 1  132  ? 107.110 62.914  -33.817 1.00 120.87 ? 132  LYS A CD    1 
ATOM   1007  C  CE    . LYS A 1  132  ? 108.229 62.005  -33.383 1.00 116.81 ? 132  LYS A CE    1 
ATOM   1008  N  NZ    . LYS A 1  132  ? 109.093 61.666  -34.541 1.00 125.79 ? 132  LYS A NZ    1 
ATOM   1009  N  N     . LYS A 1  133  ? 108.578 68.250  -34.688 1.00 111.24 ? 133  LYS A N     1 
ATOM   1010  C  CA    . LYS A 1  133  ? 108.602 69.695  -34.452 1.00 111.18 ? 133  LYS A CA    1 
ATOM   1011  C  C     . LYS A 1  133  ? 108.278 70.506  -35.702 1.00 115.08 ? 133  LYS A C     1 
ATOM   1012  O  O     . LYS A 1  133  ? 107.668 71.576  -35.596 1.00 115.39 ? 133  LYS A O     1 
ATOM   1013  C  CB    . LYS A 1  133  ? 109.952 70.120  -33.841 1.00 113.12 ? 133  LYS A CB    1 
ATOM   1014  C  CG    . LYS A 1  133  ? 110.015 69.907  -32.328 1.00 121.21 ? 133  LYS A CG    1 
ATOM   1015  C  CD    . LYS A 1  133  ? 111.440 69.767  -31.792 1.00 128.22 ? 133  LYS A CD    1 
ATOM   1016  C  CE    . LYS A 1  133  ? 111.450 69.717  -30.278 1.00 138.13 ? 133  LYS A CE    1 
ATOM   1017  N  NZ    . LYS A 1  133  ? 112.719 69.160  -29.730 1.00 146.88 ? 133  LYS A NZ    1 
ATOM   1018  N  N     . ARG A 1  134  ? 108.705 70.001  -36.879 1.00 110.20 ? 134  ARG A N     1 
ATOM   1019  C  CA    . ARG A 1  134  ? 108.473 70.626  -38.182 1.00 109.63 ? 134  ARG A CA    1 
ATOM   1020  C  C     . ARG A 1  134  ? 107.022 70.463  -38.589 1.00 114.37 ? 134  ARG A C     1 
ATOM   1021  O  O     . ARG A 1  134  ? 106.437 71.443  -39.050 1.00 115.60 ? 134  ARG A O     1 
ATOM   1022  C  CB    . ARG A 1  134  ? 109.463 70.101  -39.232 1.00 104.49 ? 134  ARG A CB    1 
ATOM   1023  C  CG    . ARG A 1  134  ? 108.933 69.800  -40.614 1.00 100.00 ? 134  ARG A CG    1 
ATOM   1024  C  CD    . ARG A 1  134  ? 110.083 69.591  -41.570 1.00 107.08 ? 134  ARG A CD    1 
ATOM   1025  N  NE    . ARG A 1  134  ? 110.947 68.464  -41.200 1.00 116.95 ? 134  ARG A NE    1 
ATOM   1026  C  CZ    . ARG A 1  134  ? 110.821 67.226  -41.679 1.00 134.16 ? 134  ARG A CZ    1 
ATOM   1027  N  NH1   . ARG A 1  134  ? 109.866 66.940  -42.557 1.00 116.50 ? 134  ARG A NH1   1 
ATOM   1028  N  NH2   . ARG A 1  134  ? 111.651 66.265  -41.284 1.00 123.62 ? 134  ARG A NH2   1 
ATOM   1029  N  N     . PHE A 1  135  ? 106.416 69.266  -38.372 1.00 109.53 ? 135  PHE A N     1 
ATOM   1030  C  CA    . PHE A 1  135  ? 105.003 69.068  -38.681 1.00 109.67 ? 135  PHE A CA    1 
ATOM   1031  C  C     . PHE A 1  135  ? 104.179 70.012  -37.805 1.00 116.37 ? 135  PHE A C     1 
ATOM   1032  O  O     . PHE A 1  135  ? 103.216 70.619  -38.286 1.00 117.42 ? 135  PHE A O     1 
ATOM   1033  C  CB    . PHE A 1  135  ? 104.573 67.621  -38.454 1.00 110.20 ? 135  PHE A CB    1 
ATOM   1034  C  CG    . PHE A 1  135  ? 103.109 67.337  -38.714 1.00 111.31 ? 135  PHE A CG    1 
ATOM   1035  C  CD1   . PHE A 1  135  ? 102.146 67.601  -37.745 1.00 113.28 ? 135  PHE A CD1   1 
ATOM   1036  C  CD2   . PHE A 1  135  ? 102.703 66.737  -39.894 1.00 113.50 ? 135  PHE A CD2   1 
ATOM   1037  C  CE1   . PHE A 1  135  ? 100.799 67.333  -37.981 1.00 114.08 ? 135  PHE A CE1   1 
ATOM   1038  C  CE2   . PHE A 1  135  ? 101.357 66.443  -40.118 1.00 116.24 ? 135  PHE A CE2   1 
ATOM   1039  C  CZ    . PHE A 1  135  ? 100.415 66.743  -39.159 1.00 113.78 ? 135  PHE A CZ    1 
ATOM   1040  N  N     . ALA A 1  136  ? 104.583 70.157  -36.532 1.00 113.51 ? 136  ALA A N     1 
ATOM   1041  C  CA    . ALA A 1  136  ? 103.927 71.046  -35.573 1.00 114.41 ? 136  ALA A CA    1 
ATOM   1042  C  C     . ALA A 1  136  ? 103.859 72.475  -36.106 1.00 120.22 ? 136  ALA A C     1 
ATOM   1043  O  O     . ALA A 1  136  ? 102.822 73.127  -35.995 1.00 119.90 ? 136  ALA A O     1 
ATOM   1044  C  CB    . ALA A 1  136  ? 104.683 71.024  -34.254 1.00 114.73 ? 136  ALA A CB    1 
ATOM   1045  N  N     . ALA A 1  137  ? 104.970 72.937  -36.709 1.00 118.44 ? 137  ALA A N     1 
ATOM   1046  C  CA    . ALA A 1  137  ? 105.114 74.265  -37.294 1.00 119.61 ? 137  ALA A CA    1 
ATOM   1047  C  C     . ALA A 1  137  ? 104.278 74.387  -38.557 1.00 123.34 ? 137  ALA A C     1 
ATOM   1048  O  O     . ALA A 1  137  ? 103.485 75.335  -38.656 1.00 124.23 ? 137  ALA A O     1 
ATOM   1049  C  CB    . ALA A 1  137  ? 106.577 74.550  -37.595 1.00 120.62 ? 137  ALA A CB    1 
ATOM   1050  N  N     . ILE A 1  138  ? 104.418 73.406  -39.497 1.00 117.66 ? 138  ILE A N     1 
ATOM   1051  C  CA    . ILE A 1  138  ? 103.666 73.374  -40.756 1.00 117.33 ? 138  ILE A CA    1 
ATOM   1052  C  C     . ILE A 1  138  ? 102.164 73.524  -40.480 1.00 122.68 ? 138  ILE A C     1 
ATOM   1053  O  O     . ILE A 1  138  ? 101.520 74.407  -41.060 1.00 123.49 ? 138  ILE A O     1 
ATOM   1054  C  CB    . ILE A 1  138  ? 104.006 72.153  -41.658 1.00 118.97 ? 138  ILE A CB    1 
ATOM   1055  C  CG1   . ILE A 1  138  ? 105.501 72.151  -42.032 1.00 119.01 ? 138  ILE A CG1   1 
ATOM   1056  C  CG2   . ILE A 1  138  ? 103.134 72.152  -42.922 1.00 119.48 ? 138  ILE A CG2   1 
ATOM   1057  C  CD1   . ILE A 1  138  ? 106.010 70.920  -42.778 1.00 124.95 ? 138  ILE A CD1   1 
ATOM   1058  N  N     . TRP A 1  139  ? 101.636 72.730  -39.536 1.00 118.39 ? 139  TRP A N     1 
ATOM   1059  C  CA    . TRP A 1  139  ? 100.225 72.792  -39.188 1.00 118.54 ? 139  TRP A CA    1 
ATOM   1060  C  C     . TRP A 1  139  ? 99.733  74.165  -38.751 1.00 124.30 ? 139  TRP A C     1 
ATOM   1061  O  O     . TRP A 1  139  ? 98.818  74.698  -39.371 1.00 125.18 ? 139  TRP A O     1 
ATOM   1062  C  CB    . TRP A 1  139  ? 99.826  71.682  -38.215 1.00 115.98 ? 139  TRP A CB    1 
ATOM   1063  C  CG    . TRP A 1  139  ? 98.391  71.750  -37.781 1.00 116.80 ? 139  TRP A CG    1 
ATOM   1064  C  CD1   . TRP A 1  139  ? 97.290  71.362  -38.491 1.00 120.05 ? 139  TRP A CD1   1 
ATOM   1065  C  CD2   . TRP A 1  139  ? 97.911  72.226  -36.523 1.00 116.27 ? 139  TRP A CD2   1 
ATOM   1066  N  NE1   . TRP A 1  139  ? 96.154  71.558  -37.746 1.00 119.43 ? 139  TRP A NE1   1 
ATOM   1067  C  CE2   . TRP A 1  139  ? 96.508  72.069  -36.523 1.00 120.55 ? 139  TRP A CE2   1 
ATOM   1068  C  CE3   . TRP A 1  139  ? 98.538  72.729  -35.371 1.00 116.94 ? 139  TRP A CE3   1 
ATOM   1069  C  CZ2   . TRP A 1  139  ? 95.721  72.409  -35.417 1.00 119.87 ? 139  TRP A CZ2   1 
ATOM   1070  C  CZ3   . TRP A 1  139  ? 97.760  73.080  -34.284 1.00 118.40 ? 139  TRP A CZ3   1 
ATOM   1071  C  CH2   . TRP A 1  139  ? 96.368  72.919  -34.311 1.00 119.45 ? 139  TRP A CH2   1 
ATOM   1072  N  N     . THR A 1  140  ? 100.365 74.753  -37.740 1.00 121.22 ? 140  THR A N     1 
ATOM   1073  C  CA    . THR A 1  140  ? 99.996  76.063  -37.212 1.00 122.41 ? 140  THR A CA    1 
ATOM   1074  C  C     . THR A 1  140  ? 99.949  77.167  -38.274 1.00 128.22 ? 140  THR A C     1 
ATOM   1075  O  O     . THR A 1  140  ? 99.114  78.073  -38.179 1.00 128.86 ? 140  THR A O     1 
ATOM   1076  C  CB    . THR A 1  140  ? 100.855 76.409  -36.013 1.00 133.54 ? 140  THR A CB    1 
ATOM   1077  O  OG1   . THR A 1  140  ? 102.196 75.993  -36.290 1.00 135.43 ? 140  THR A OG1   1 
ATOM   1078  C  CG2   . THR A 1  140  ? 100.344 75.760  -34.721 1.00 130.97 ? 140  THR A CG2   1 
ATOM   1079  N  N     . LEU A 1  141  ? 100.810 77.074  -39.302 1.00 124.77 ? 141  LEU A N     1 
ATOM   1080  C  CA    . LEU A 1  141  ? 100.803 78.055  -40.382 1.00 125.75 ? 141  LEU A CA    1 
ATOM   1081  C  C     . LEU A 1  141  ? 99.702  77.743  -41.379 1.00 130.83 ? 141  LEU A C     1 
ATOM   1082  O  O     . LEU A 1  141  ? 98.985  78.655  -41.782 1.00 132.25 ? 141  LEU A O     1 
ATOM   1083  C  CB    . LEU A 1  141  ? 102.144 78.096  -41.132 1.00 125.85 ? 141  LEU A CB    1 
ATOM   1084  C  CG    . LEU A 1  141  ? 103.354 78.664  -40.418 1.00 130.19 ? 141  LEU A CG    1 
ATOM   1085  C  CD1   . LEU A 1  141  ? 104.577 78.474  -41.260 1.00 130.54 ? 141  LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A 1  141  ? 103.182 80.143  -40.105 1.00 133.19 ? 141  LEU A CD2   1 
ATOM   1087  N  N     . CYS A 1  142  ? 99.594  76.465  -41.802 1.00 126.15 ? 142  CYS A N     1 
ATOM   1088  C  CA    . CYS A 1  142  ? 98.656  76.000  -42.825 1.00 126.29 ? 142  CYS A CA    1 
ATOM   1089  C  C     . CYS A 1  142  ? 97.189  75.880  -42.425 1.00 129.59 ? 142  CYS A C     1 
ATOM   1090  O  O     . CYS A 1  142  ? 96.328  75.930  -43.313 1.00 130.38 ? 142  CYS A O     1 
ATOM   1091  C  CB    . CYS A 1  142  ? 99.164  74.727  -43.493 1.00 126.29 ? 142  CYS A CB    1 
ATOM   1092  S  SG    . CYS A 1  142  ? 100.739 74.925  -44.364 1.00 130.66 ? 142  CYS A SG    1 
ATOM   1093  N  N     . LYS A 1  143  ? 96.895  75.714  -41.112 1.00 124.17 ? 143  LYS A N     1 
ATOM   1094  C  CA    . LYS A 1  143  ? 95.522  75.594  -40.598 1.00 123.58 ? 143  LYS A CA    1 
ATOM   1095  C  C     . LYS A 1  143  ? 94.659  76.824  -40.949 1.00 132.37 ? 143  LYS A C     1 
ATOM   1096  O  O     . LYS A 1  143  ? 93.496  76.679  -41.336 1.00 132.38 ? 143  LYS A O     1 
ATOM   1097  C  CB    . LYS A 1  143  ? 95.498  75.266  -39.088 1.00 122.75 ? 143  LYS A CB    1 
ATOM   1098  C  CG    . LYS A 1  143  ? 96.242  76.231  -38.167 1.00 114.65 ? 143  LYS A CG    1 
ATOM   1099  C  CD    . LYS A 1  143  ? 95.878  75.980  -36.716 1.00 114.83 ? 143  LYS A CD    1 
ATOM   1100  C  CE    . LYS A 1  143  ? 96.720  76.764  -35.740 1.00 118.25 ? 143  LYS A CE    1 
ATOM   1101  N  NZ    . LYS A 1  143  ? 96.498  76.322  -34.334 1.00 122.69 ? 143  LYS A NZ    1 
ATOM   1102  N  N     . THR A 1  144  ? 95.288  78.022  -40.863 1.00 132.05 ? 144  THR A N     1 
ATOM   1103  C  CA    . THR A 1  144  ? 94.800  79.374  -41.148 1.00 133.74 ? 144  THR A CA    1 
ATOM   1104  C  C     . THR A 1  144  ? 94.439  79.538  -42.634 1.00 140.68 ? 144  THR A C     1 
ATOM   1105  O  O     . THR A 1  144  ? 93.331  79.992  -42.926 1.00 141.14 ? 144  THR A O     1 
ATOM   1106  C  CB    . THR A 1  144  ? 95.891  80.371  -40.699 1.00 141.80 ? 144  THR A CB    1 
ATOM   1107  O  OG1   . THR A 1  144  ? 96.020  80.310  -39.277 1.00 139.83 ? 144  THR A OG1   1 
ATOM   1108  C  CG2   . THR A 1  144  ? 95.638  81.806  -41.164 1.00 142.59 ? 144  THR A CG2   1 
ATOM   1109  N  N     . LYS A 1  145  ? 95.382  79.202  -43.560 1.00 138.83 ? 145  LYS A N     1 
ATOM   1110  C  CA    . LYS A 1  145  ? 95.200  79.295  -45.017 1.00 140.49 ? 145  LYS A CA    1 
ATOM   1111  C  C     . LYS A 1  145  ? 93.921  78.571  -45.432 1.00 146.42 ? 145  LYS A C     1 
ATOM   1112  O  O     . LYS A 1  145  ? 93.840  77.343  -45.326 1.00 145.25 ? 145  LYS A O     1 
ATOM   1113  C  CB    . LYS A 1  145  ? 96.428  78.752  -45.773 1.00 142.58 ? 145  LYS A CB    1 
ATOM   1114  C  CG    . LYS A 1  145  ? 97.237  79.832  -46.486 1.00 155.51 ? 145  LYS A CG    1 
ATOM   1115  C  CD    . LYS A 1  145  ? 96.884  79.975  -47.972 1.00 164.23 ? 145  LYS A CD    1 
ATOM   1116  C  CE    . LYS A 1  145  ? 97.769  80.994  -48.662 1.00 169.78 ? 145  LYS A CE    1 
ATOM   1117  N  NZ    . LYS A 1  145  ? 97.679  80.904  -50.143 1.00 173.78 ? 145  LYS A NZ    1 
ATOM   1118  N  N     . MET A 1  146  ? 92.893  79.353  -45.812 1.00 144.97 ? 146  MET A N     1 
ATOM   1119  C  CA    . MET A 1  146  ? 91.579  78.823  -46.166 1.00 145.40 ? 146  MET A CA    1 
ATOM   1120  C  C     . MET A 1  146  ? 91.284  78.798  -47.661 1.00 151.52 ? 146  MET A C     1 
ATOM   1121  O  O     . MET A 1  146  ? 90.130  78.606  -48.057 1.00 151.56 ? 146  MET A O     1 
ATOM   1122  C  CB    . MET A 1  146  ? 90.477  79.544  -45.379 1.00 148.00 ? 146  MET A CB    1 
ATOM   1123  C  CG    . MET A 1  146  ? 89.661  78.618  -44.512 1.00 150.48 ? 146  MET A CG    1 
ATOM   1124  S  SD    . MET A 1  146  ? 90.580  78.044  -43.070 1.00 152.83 ? 146  MET A SD    1 
ATOM   1125  C  CE    . MET A 1  146  ? 90.217  79.329  -41.907 1.00 149.85 ? 146  MET A CE    1 
ATOM   1126  N  N     . VAL A 1  147  ? 92.326  78.962  -48.489 1.00 149.42 ? 147  VAL A N     1 
ATOM   1127  C  CA    . VAL A 1  147  ? 92.202  78.934  -49.947 1.00 151.08 ? 147  VAL A CA    1 
ATOM   1128  C  C     . VAL A 1  147  ? 93.432  78.378  -50.613 1.00 156.43 ? 147  VAL A C     1 
ATOM   1129  O  O     . VAL A 1  147  ? 94.553  78.784  -50.288 1.00 155.87 ? 147  VAL A O     1 
ATOM   1130  C  CB    . VAL A 1  147  ? 91.807  80.285  -50.586 1.00 156.69 ? 147  VAL A CB    1 
ATOM   1131  C  CG1   . VAL A 1  147  ? 90.292  80.445  -50.662 1.00 157.33 ? 147  VAL A CG1   1 
ATOM   1132  C  CG2   . VAL A 1  147  ? 92.473  81.471  -49.885 1.00 156.59 ? 147  VAL A CG2   1 
ATOM   1133  N  N     . CYS A 1  148  ? 93.225  77.460  -51.568 1.00 154.34 ? 148  CYS A N     1 
ATOM   1134  C  CA    . CYS A 1  148  ? 94.332  76.906  -52.333 1.00 154.67 ? 148  CYS A CA    1 
ATOM   1135  C  C     . CYS A 1  148  ? 94.726  77.996  -53.311 1.00 162.38 ? 148  CYS A C     1 
ATOM   1136  O  O     . CYS A 1  148  ? 93.861  78.494  -54.028 1.00 163.38 ? 148  CYS A O     1 
ATOM   1137  C  CB    . CYS A 1  148  ? 93.922  75.624  -53.052 1.00 154.54 ? 148  CYS A CB    1 
ATOM   1138  S  SG    . CYS A 1  148  ? 95.274  74.829  -53.962 1.00 158.09 ? 148  CYS A SG    1 
ATOM   1139  N  N     . GLU A 1  149  ? 95.987  78.432  -53.292 1.00 160.69 ? 149  GLU A N     1 
ATOM   1140  C  CA    . GLU A 1  149  ? 96.399  79.511  -54.185 1.00 162.79 ? 149  GLU A CA    1 
ATOM   1141  C  C     . GLU A 1  149  ? 96.900  79.039  -55.549 1.00 169.08 ? 149  GLU A C     1 
ATOM   1142  O  O     . GLU A 1  149  ? 97.721  78.127  -55.614 1.00 167.77 ? 149  GLU A O     1 
ATOM   1143  C  CB    . GLU A 1  149  ? 97.389  80.457  -53.497 1.00 164.07 ? 149  GLU A CB    1 
ATOM   1144  C  CG    . GLU A 1  149  ? 97.038  81.926  -53.670 1.00 176.48 ? 149  GLU A CG    1 
ATOM   1145  C  CD    . GLU A 1  149  ? 95.682  82.381  -53.157 1.00 194.39 ? 149  GLU A CD    1 
ATOM   1146  O  OE1   . GLU A 1  149  ? 95.324  82.030  -52.008 1.00 170.72 ? 149  GLU A OE1   1 
ATOM   1147  O  OE2   . GLU A 1  149  ? 94.993  83.120  -53.900 1.00 192.82 ? 149  GLU A OE2   1 
ATOM   1148  N  N     . THR A 1  150  ? 96.378  79.661  -56.633 1.00 168.52 ? 150  THR A N     1 
ATOM   1149  C  CA    . THR A 1  150  ? 96.723  79.398  -58.041 1.00 169.74 ? 150  THR A CA    1 
ATOM   1150  C  C     . THR A 1  150  ? 98.027  80.097  -58.412 1.00 175.69 ? 150  THR A C     1 
ATOM   1151  O  O     . THR A 1  150  ? 98.921  79.487  -59.009 1.00 174.64 ? 150  THR A O     1 
ATOM   1152  C  CB    . THR A 1  150  ? 95.608  79.899  -58.972 1.00 176.72 ? 150  THR A CB    1 
ATOM   1153  O  OG1   . THR A 1  150  ? 95.040  81.115  -58.457 1.00 173.04 ? 150  THR A OG1   1 
ATOM   1154  C  CG2   . THR A 1  150  ? 94.547  78.854  -59.210 1.00 176.02 ? 150  THR A CG2   1 
ATOM   1155  N  N     . ASP A 1  151  ? 98.092  81.405  -58.088 1.00 174.49 ? 151  ASP A N     1 
ATOM   1156  C  CA    . ASP A 1  151  ? 99.212  82.310  -58.316 1.00 175.45 ? 151  ASP A CA    1 
ATOM   1157  C  C     . ASP A 1  151  ? 99.465  83.089  -57.022 1.00 178.93 ? 151  ASP A C     1 
ATOM   1158  O  O     . ASP A 1  151  ? 98.517  83.420  -56.303 1.00 177.92 ? 151  ASP A O     1 
ATOM   1159  C  CB    . ASP A 1  151  ? 98.911  83.267  -59.489 1.00 179.57 ? 151  ASP A CB    1 
ATOM   1160  C  CG    . ASP A 1  151  ? 98.820  82.634  -60.878 1.00 192.56 ? 151  ASP A CG    1 
ATOM   1161  O  OD1   . ASP A 1  151  ? 97.965  81.736  -61.073 1.00 193.37 ? 151  ASP A OD1   1 
ATOM   1162  O  OD2   . ASP A 1  151  ? 99.541  83.099  -61.791 1.00 199.30 ? 151  ASP A OD2   1 
ATOM   1163  N  N     . VAL A 1  152  ? 100.742 83.363  -56.724 1.00 176.38 ? 152  VAL A N     1 
ATOM   1164  C  CA    . VAL A 1  152  ? 101.181 84.040  -55.500 1.00 176.61 ? 152  VAL A CA    1 
ATOM   1165  C  C     . VAL A 1  152  ? 102.318 85.065  -55.791 1.00 183.84 ? 152  VAL A C     1 
ATOM   1166  O  O     . VAL A 1  152  ? 102.998 84.890  -56.806 1.00 183.83 ? 152  VAL A O     1 
ATOM   1167  C  CB    . VAL A 1  152  ? 101.551 82.946  -54.451 1.00 178.88 ? 152  VAL A CB    1 
ATOM   1168  C  CG1   . VAL A 1  152  ? 103.031 82.948  -54.065 1.00 178.05 ? 152  VAL A CG1   1 
ATOM   1169  C  CG2   . VAL A 1  152  ? 100.652 83.024  -53.225 1.00 178.05 ? 152  VAL A CG2   1 
ATOM   1170  N  N     . PRO A 1  153  ? 102.554 86.127  -54.957 1.00 182.62 ? 153  PRO A N     1 
ATOM   1171  C  CA    . PRO A 1  153  ? 103.637 87.081  -55.276 1.00 184.28 ? 153  PRO A CA    1 
ATOM   1172  C  C     . PRO A 1  153  ? 105.027 86.451  -55.337 1.00 191.17 ? 153  PRO A C     1 
ATOM   1173  O  O     . PRO A 1  153  ? 105.426 85.734  -54.412 1.00 189.20 ? 153  PRO A O     1 
ATOM   1174  C  CB    . PRO A 1  153  ? 103.527 88.136  -54.170 1.00 185.63 ? 153  PRO A CB    1 
ATOM   1175  C  CG    . PRO A 1  153  ? 102.827 87.448  -53.055 1.00 188.16 ? 153  PRO A CG    1 
ATOM   1176  C  CD    . PRO A 1  153  ? 101.856 86.521  -53.715 1.00 183.54 ? 153  PRO A CD    1 
ATOM   1177  N  N     . SER A 1  154  ? 105.748 86.711  -56.455 1.00 191.75 ? 154  SER A N     1 
ATOM   1178  C  CA    . SER A 1  154  ? 107.098 86.205  -56.745 1.00 192.53 ? 154  SER A CA    1 
ATOM   1179  C  C     . SER A 1  154  ? 108.123 86.546  -55.661 1.00 198.51 ? 154  SER A C     1 
ATOM   1180  O  O     . SER A 1  154  ? 107.921 87.490  -54.889 1.00 198.06 ? 154  SER A O     1 
ATOM   1181  C  CB    . SER A 1  154  ? 107.578 86.689  -58.112 1.00 197.73 ? 154  SER A CB    1 
ATOM   1182  O  OG    . SER A 1  154  ? 107.418 88.088  -58.284 1.00 208.74 ? 154  SER A OG    1 
ATOM   1183  N  N     . GLU A 1  155  ? 109.230 85.782  -55.612 1.00 196.62 ? 155  GLU A N     1 
ATOM   1184  C  CA    . GLU A 1  155  ? 110.303 85.954  -54.626 1.00 196.78 ? 155  GLU A CA    1 
ATOM   1185  C  C     . GLU A 1  155  ? 111.118 87.264  -54.794 1.00 204.79 ? 155  GLU A C     1 
ATOM   1186  O  O     . GLU A 1  155  ? 112.217 87.379  -54.238 1.00 203.79 ? 155  GLU A O     1 
ATOM   1187  C  CB    . GLU A 1  155  ? 111.217 84.718  -54.600 1.00 196.99 ? 155  GLU A CB    1 
ATOM   1188  C  CG    . GLU A 1  155  ? 110.523 83.442  -54.151 1.00 205.50 ? 155  GLU A CG    1 
ATOM   1189  C  CD    . GLU A 1  155  ? 111.373 82.187  -54.215 1.00 226.80 ? 155  GLU A CD    1 
ATOM   1190  O  OE1   . GLU A 1  155  ? 112.331 82.150  -55.022 1.00 226.23 ? 155  GLU A OE1   1 
ATOM   1191  O  OE2   . GLU A 1  155  ? 111.068 81.229  -53.469 1.00 217.04 ? 155  GLU A OE2   1 
ATOM   1192  N  N     . ASP A 1  156  ? 110.555 88.258  -55.527 1.00 204.96 ? 156  ASP A N     1 
ATOM   1193  C  CA    . ASP A 1  156  ? 111.172 89.566  -55.782 1.00 207.17 ? 156  ASP A CA    1 
ATOM   1194  C  C     . ASP A 1  156  ? 110.214 90.774  -55.670 1.00 213.93 ? 156  ASP A C     1 
ATOM   1195  O  O     . ASP A 1  156  ? 110.568 91.757  -55.014 1.00 213.80 ? 156  ASP A O     1 
ATOM   1196  C  CB    . ASP A 1  156  ? 111.944 89.582  -57.124 1.00 210.26 ? 156  ASP A CB    1 
ATOM   1197  C  CG    . ASP A 1  156  ? 111.100 89.297  -58.356 1.00 220.39 ? 156  ASP A CG    1 
ATOM   1198  O  OD1   . ASP A 1  156  ? 110.425 90.233  -58.846 1.00 221.26 ? 156  ASP A OD1   1 
ATOM   1199  O  OD2   . ASP A 1  156  ? 111.126 88.144  -58.837 1.00 226.13 ? 156  ASP A OD2   1 
ATOM   1200  N  N     . ASP A 1  157  ? 109.020 90.711  -56.310 1.00 211.65 ? 157  ASP A N     1 
ATOM   1201  C  CA    . ASP A 1  157  ? 108.080 91.836  -56.323 1.00 212.34 ? 157  ASP A CA    1 
ATOM   1202  C  C     . ASP A 1  157  ? 106.590 91.455  -56.231 1.00 217.02 ? 157  ASP A C     1 
ATOM   1203  O  O     . ASP A 1  157  ? 106.184 90.467  -56.850 1.00 216.15 ? 157  ASP A O     1 
ATOM   1204  C  CB    . ASP A 1  157  ? 108.322 92.685  -57.580 1.00 215.27 ? 157  ASP A CB    1 
ATOM   1205  C  CG    . ASP A 1  157  ? 108.085 94.158  -57.360 1.00 222.62 ? 157  ASP A CG    1 
ATOM   1206  O  OD1   . ASP A 1  157  ? 108.981 94.823  -56.803 1.00 223.13 ? 157  ASP A OD1   1 
ATOM   1207  O  OD2   . ASP A 1  157  ? 106.982 94.634  -57.691 1.00 227.05 ? 157  ASP A OD2   1 
ATOM   1208  N  N     . PRO A 1  158  ? 105.743 92.263  -55.532 1.00 214.98 ? 158  PRO A N     1 
ATOM   1209  C  CA    . PRO A 1  158  ? 104.305 91.938  -55.472 1.00 214.79 ? 158  PRO A CA    1 
ATOM   1210  C  C     . PRO A 1  158  ? 103.506 92.316  -56.732 1.00 219.18 ? 158  PRO A C     1 
ATOM   1211  O  O     . PRO A 1  158  ? 102.382 91.829  -56.879 1.00 218.90 ? 158  PRO A O     1 
ATOM   1212  C  CB    . PRO A 1  158  ? 103.825 92.727  -54.251 1.00 216.45 ? 158  PRO A CB    1 
ATOM   1213  C  CG    . PRO A 1  158  ? 104.698 93.932  -54.233 1.00 221.81 ? 158  PRO A CG    1 
ATOM   1214  C  CD    . PRO A 1  158  ? 106.047 93.472  -54.732 1.00 217.25 ? 158  PRO A CD    1 
ATOM   1215  N  N     . THR A 1  159  ? 104.063 93.194  -57.620 1.00 215.58 ? 159  THR A N     1 
ATOM   1216  C  CA    . THR A 1  159  ? 103.423 93.664  -58.874 1.00 216.34 ? 159  THR A CA    1 
ATOM   1217  C  C     . THR A 1  159  ? 103.209 92.513  -59.885 1.00 216.97 ? 159  THR A C     1 
ATOM   1218  O  O     . THR A 1  159  ? 102.173 92.461  -60.561 1.00 217.09 ? 159  THR A O     1 
ATOM   1219  C  CB    . THR A 1  159  ? 104.200 94.856  -59.487 1.00 226.13 ? 159  THR A CB    1 
ATOM   1220  O  OG1   . THR A 1  159  ? 104.668 95.720  -58.446 1.00 225.93 ? 159  THR A OG1   1 
ATOM   1221  C  CG2   . THR A 1  159  ? 103.371 95.652  -60.501 1.00 225.28 ? 159  THR A CG2   1 
ATOM   1222  N  N     . GLN A 1  160  ? 104.202 91.606  -59.981 1.00 210.00 ? 160  GLN A N     1 
ATOM   1223  C  CA    . GLN A 1  160  ? 104.179 90.415  -60.834 1.00 207.96 ? 160  GLN A CA    1 
ATOM   1224  C  C     . GLN A 1  160  ? 104.107 89.191  -59.906 1.00 206.19 ? 160  GLN A C     1 
ATOM   1225  O  O     . GLN A 1  160  ? 105.009 88.960  -59.091 1.00 204.15 ? 160  GLN A O     1 
ATOM   1226  C  CB    . GLN A 1  160  ? 105.402 90.326  -61.784 1.00 209.58 ? 160  GLN A CB    1 
ATOM   1227  C  CG    . GLN A 1  160  ? 106.082 91.648  -62.148 1.00 218.51 ? 160  GLN A CG    1 
ATOM   1228  C  CD    . GLN A 1  160  ? 107.091 92.082  -61.108 1.00 230.88 ? 160  GLN A CD    1 
ATOM   1229  O  OE1   . GLN A 1  160  ? 107.891 91.286  -60.593 1.00 224.51 ? 160  GLN A OE1   1 
ATOM   1230  N  NE2   . GLN A 1  160  ? 107.072 93.362  -60.773 1.00 222.14 ? 160  GLN A NE2   1 
ATOM   1231  N  N     . LEU A 1  161  ? 103.000 88.447  -60.001 1.00 199.21 ? 161  LEU A N     1 
ATOM   1232  C  CA    . LEU A 1  161  ? 102.728 87.269  -59.182 1.00 195.91 ? 161  LEU A CA    1 
ATOM   1233  C  C     . LEU A 1  161  ? 102.942 85.988  -60.005 1.00 196.63 ? 161  LEU A C     1 
ATOM   1234  O  O     . LEU A 1  161  ? 102.442 85.892  -61.133 1.00 197.03 ? 161  LEU A O     1 
ATOM   1235  C  CB    . LEU A 1  161  ? 101.292 87.332  -58.612 1.00 195.60 ? 161  LEU A CB    1 
ATOM   1236  C  CG    . LEU A 1  161  ? 100.967 88.472  -57.631 1.00 199.77 ? 161  LEU A CG    1 
ATOM   1237  C  CD1   . LEU A 1  161  ? 100.350 89.661  -58.347 1.00 201.64 ? 161  LEU A CD1   1 
ATOM   1238  C  CD2   . LEU A 1  161  ? 99.984  88.013  -56.591 1.00 200.27 ? 161  LEU A CD2   1 
ATOM   1239  N  N     . VAL A 1  162  ? 103.704 85.018  -59.443 1.00 189.29 ? 162  VAL A N     1 
ATOM   1240  C  CA    . VAL A 1  162  ? 104.035 83.727  -60.072 1.00 187.27 ? 162  VAL A CA    1 
ATOM   1241  C  C     . VAL A 1  162  ? 103.015 82.634  -59.711 1.00 186.42 ? 162  VAL A C     1 
ATOM   1242  O  O     . VAL A 1  162  ? 102.539 82.588  -58.578 1.00 184.39 ? 162  VAL A O     1 
ATOM   1243  C  CB    . VAL A 1  162  ? 105.514 83.310  -59.780 1.00 190.33 ? 162  VAL A CB    1 
ATOM   1244  C  CG1   . VAL A 1  162  ? 105.778 81.830  -60.072 1.00 189.13 ? 162  VAL A CG1   1 
ATOM   1245  C  CG2   . VAL A 1  162  ? 106.491 84.186  -60.557 1.00 191.48 ? 162  VAL A CG2   1 
ATOM   1246  N  N     . SER A 1  163  ? 102.681 81.764  -60.690 1.00 181.13 ? 163  SER A N     1 
ATOM   1247  C  CA    . SER A 1  163  ? 101.776 80.634  -60.503 1.00 179.10 ? 163  SER A CA    1 
ATOM   1248  C  C     . SER A 1  163  ? 102.523 79.546  -59.743 1.00 178.87 ? 163  SER A C     1 
ATOM   1249  O  O     . SER A 1  163  ? 103.493 78.983  -60.269 1.00 178.82 ? 163  SER A O     1 
ATOM   1250  C  CB    . SER A 1  163  ? 101.265 80.117  -61.848 1.00 183.59 ? 163  SER A CB    1 
ATOM   1251  O  OG    . SER A 1  163  ? 101.191 78.700  -61.888 1.00 191.66 ? 163  SER A OG    1 
ATOM   1252  N  N     . ARG A 1  164  ? 102.102 79.288  -58.490 1.00 171.18 ? 164  ARG A N     1 
ATOM   1253  C  CA    . ARG A 1  164  ? 102.724 78.279  -57.629 1.00 167.79 ? 164  ARG A CA    1 
ATOM   1254  C  C     . ARG A 1  164  ? 102.272 76.871  -58.007 1.00 168.39 ? 164  ARG A C     1 
ATOM   1255  O  O     . ARG A 1  164  ? 103.097 75.967  -58.153 1.00 167.08 ? 164  ARG A O     1 
ATOM   1256  C  CB    . ARG A 1  164  ? 102.508 78.583  -56.127 1.00 164.89 ? 164  ARG A CB    1 
ATOM   1257  C  CG    . ARG A 1  164  ? 101.094 78.994  -55.725 1.00 168.98 ? 164  ARG A CG    1 
ATOM   1258  C  CD    . ARG A 1  164  ? 100.993 79.208  -54.230 1.00 172.32 ? 164  ARG A CD    1 
ATOM   1259  N  NE    . ARG A 1  164  ? 100.501 78.019  -53.533 1.00 173.48 ? 164  ARG A NE    1 
ATOM   1260  C  CZ    . ARG A 1  164  ? 100.258 77.957  -52.227 1.00 180.24 ? 164  ARG A CZ    1 
ATOM   1261  N  NH1   . ARG A 1  164  ? 100.472 79.015  -51.451 1.00 162.89 ? 164  ARG A NH1   1 
ATOM   1262  N  NH2   . ARG A 1  164  ? 99.800  76.837  -51.685 1.00 163.63 ? 164  ARG A NH2   1 
ATOM   1263  N  N     . GLY A 1  165  ? 100.970 76.732  -58.208 1.00 163.63 ? 165  GLY A N     1 
ATOM   1264  C  CA    . GLY A 1  165  ? 100.294 75.494  -58.556 1.00 162.59 ? 165  GLY A CA    1 
ATOM   1265  C  C     . GLY A 1  165  ? 98.809  75.750  -58.503 1.00 166.14 ? 165  GLY A C     1 
ATOM   1266  O  O     . GLY A 1  165  ? 98.342  76.450  -57.605 1.00 165.12 ? 165  GLY A O     1 
ATOM   1267  N  N     . GLY A 1  166  ? 98.088  75.198  -59.474 1.00 163.53 ? 166  GLY A N     1 
ATOM   1268  C  CA    . GLY A 1  166  ? 96.650  75.371  -59.681 1.00 163.96 ? 166  GLY A CA    1 
ATOM   1269  C  C     . GLY A 1  166  ? 95.696  75.165  -58.518 1.00 165.56 ? 166  GLY A C     1 
ATOM   1270  O  O     . GLY A 1  166  ? 96.116  75.002  -57.367 1.00 163.42 ? 166  GLY A O     1 
ATOM   1271  N  N     . CYS A 1  167  ? 94.376  75.180  -58.842 1.00 161.97 ? 167  CYS A N     1 
ATOM   1272  C  CA    . CYS A 1  167  ? 93.234  75.040  -57.931 1.00 160.56 ? 167  CYS A CA    1 
ATOM   1273  C  C     . CYS A 1  167  ? 93.080  76.295  -57.065 1.00 160.75 ? 167  CYS A C     1 
ATOM   1274  O  O     . CYS A 1  167  ? 94.062  76.816  -56.527 1.00 159.26 ? 167  CYS A O     1 
ATOM   1275  C  CB    . CYS A 1  167  ? 93.322  73.756  -57.100 1.00 159.84 ? 167  CYS A CB    1 
ATOM   1276  S  SG    . CYS A 1  167  ? 92.097  73.623  -55.766 1.00 163.18 ? 167  CYS A SG    1 
ATOM   1277  N  N     . GLY A 1  168  ? 91.851  76.790  -56.986 1.00 155.98 ? 168  GLY A N     1 
ATOM   1278  C  CA    . GLY A 1  168  ? 91.522  77.981  -56.213 1.00 155.43 ? 168  GLY A CA    1 
ATOM   1279  C  C     . GLY A 1  168  ? 90.710  77.700  -54.966 1.00 157.36 ? 168  GLY A C     1 
ATOM   1280  O  O     . GLY A 1  168  ? 90.805  78.429  -53.974 1.00 156.74 ? 168  GLY A O     1 
ATOM   1281  N  N     . ASN A 1  169  ? 89.909  76.629  -55.028 1.00 152.45 ? 169  ASN A N     1 
ATOM   1282  C  CA    . ASN A 1  169  ? 88.973  76.119  -54.031 1.00 150.83 ? 169  ASN A CA    1 
ATOM   1283  C  C     . ASN A 1  169  ? 89.169  76.523  -52.578 1.00 152.08 ? 169  ASN A C     1 
ATOM   1284  O  O     . ASN A 1  169  ? 90.284  76.443  -52.054 1.00 150.30 ? 169  ASN A O     1 
ATOM   1285  C  CB    . ASN A 1  169  ? 88.802  74.616  -54.187 1.00 150.92 ? 169  ASN A CB    1 
ATOM   1286  C  CG    . ASN A 1  169  ? 88.197  74.244  -55.521 1.00 180.30 ? 169  ASN A CG    1 
ATOM   1287  O  OD1   . ASN A 1  169  ? 86.976  74.299  -55.712 1.00 179.51 ? 169  ASN A OD1   1 
ATOM   1288  N  ND2   . ASN A 1  169  ? 89.041  73.911  -56.492 1.00 170.98 ? 169  ASN A ND2   1 
ATOM   1289  N  N     . THR A 1  170  ? 88.061  76.975  -51.943 1.00 148.43 ? 170  THR A N     1 
ATOM   1290  C  CA    . THR A 1  170  ? 87.984  77.376  -50.533 1.00 147.13 ? 170  THR A CA    1 
ATOM   1291  C  C     . THR A 1  170  ? 88.047  76.113  -49.672 1.00 147.67 ? 170  THR A C     1 
ATOM   1292  O  O     . THR A 1  170  ? 87.410  75.098  -49.977 1.00 146.72 ? 170  THR A O     1 
ATOM   1293  C  CB    . THR A 1  170  ? 86.733  78.239  -50.238 1.00 158.79 ? 170  THR A CB    1 
ATOM   1294  O  OG1   . THR A 1  170  ? 86.513  79.176  -51.297 1.00 162.86 ? 170  THR A OG1   1 
ATOM   1295  C  CG2   . THR A 1  170  ? 86.837  78.992  -48.910 1.00 156.22 ? 170  THR A CG2   1 
ATOM   1296  N  N     . GLN A 1  171  ? 88.846  76.177  -48.614 1.00 141.83 ? 171  GLN A N     1 
ATOM   1297  C  CA    . GLN A 1  171  ? 89.074  75.047  -47.733 1.00 139.24 ? 171  GLN A CA    1 
ATOM   1298  C  C     . GLN A 1  171  ? 88.089  74.995  -46.565 1.00 141.30 ? 171  GLN A C     1 
ATOM   1299  O  O     . GLN A 1  171  ? 87.816  76.033  -45.945 1.00 140.72 ? 171  GLN A O     1 
ATOM   1300  C  CB    . GLN A 1  171  ? 90.530  75.042  -47.239 1.00 139.46 ? 171  GLN A CB    1 
ATOM   1301  C  CG    . GLN A 1  171  ? 91.578  74.980  -48.356 1.00 147.16 ? 171  GLN A CG    1 
ATOM   1302  C  CD    . GLN A 1  171  ? 91.608  73.667  -49.107 1.00 163.02 ? 171  GLN A CD    1 
ATOM   1303  O  OE1   . GLN A 1  171  ? 91.524  72.571  -48.528 1.00 159.45 ? 171  GLN A OE1   1 
ATOM   1304  N  NE2   . GLN A 1  171  ? 91.771  73.759  -50.418 1.00 150.70 ? 171  GLN A NE2   1 
ATOM   1305  N  N     . PRO A 1  172  ? 87.566  73.780  -46.242 1.00 136.33 ? 172  PRO A N     1 
ATOM   1306  C  CA    . PRO A 1  172  ? 86.641  73.655  -45.103 1.00 134.85 ? 172  PRO A CA    1 
ATOM   1307  C  C     . PRO A 1  172  ? 87.308  73.894  -43.763 1.00 134.98 ? 172  PRO A C     1 
ATOM   1308  O  O     . PRO A 1  172  ? 88.504  73.650  -43.598 1.00 133.58 ? 172  PRO A O     1 
ATOM   1309  C  CB    . PRO A 1  172  ? 86.175  72.198  -45.177 1.00 135.98 ? 172  PRO A CB    1 
ATOM   1310  C  CG    . PRO A 1  172  ? 87.257  71.488  -45.884 1.00 140.38 ? 172  PRO A CG    1 
ATOM   1311  C  CD    . PRO A 1  172  ? 87.798  72.469  -46.884 1.00 137.36 ? 172  PRO A CD    1 
ATOM   1312  N  N     . THR A 1  173  ? 86.516  74.351  -42.808 1.00 129.93 ? 173  THR A N     1 
ATOM   1313  C  CA    . THR A 1  173  ? 86.964  74.552  -41.451 1.00 128.37 ? 173  THR A CA    1 
ATOM   1314  C  C     . THR A 1  173  ? 86.489  73.303  -40.726 1.00 131.79 ? 173  THR A C     1 
ATOM   1315  O  O     . THR A 1  173  ? 85.325  73.215  -40.308 1.00 132.35 ? 173  THR A O     1 
ATOM   1316  C  CB    . THR A 1  173  ? 86.501  75.905  -40.946 1.00 133.36 ? 173  THR A CB    1 
ATOM   1317  O  OG1   . THR A 1  173  ? 87.087  76.880  -41.804 1.00 135.84 ? 173  THR A OG1   1 
ATOM   1318  C  CG2   . THR A 1  173  ? 86.922  76.173  -39.515 1.00 129.04 ? 173  THR A CG2   1 
ATOM   1319  N  N     . ILE A 1  174  ? 87.386  72.293  -40.687 1.00 126.18 ? 174  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1  174  ? 87.141  70.970  -40.114 1.00 124.22 ? 174  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1  174  ? 87.052  70.963  -38.588 1.00 126.98 ? 174  ILE A C     1 
ATOM   1322  O  O     . ILE A 1  174  ? 87.866  71.578  -37.890 1.00 126.64 ? 174  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1  174  ? 88.134  69.896  -40.640 1.00 125.88 ? 174  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1  174  ? 88.512  70.122  -42.111 1.00 126.25 ? 174  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1  174  ? 87.576  68.490  -40.433 1.00 125.93 ? 174  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1  174  ? 89.949  69.923  -42.387 1.00 127.06 ? 174  ILE A CD1   1 
ATOM   1327  N  N     . ARG A 1  175  ? 86.048  70.244  -38.094 1.00 122.34 ? 175  ARG A N     1 
ATOM   1328  C  CA    . ARG A 1  175  ? 85.784  70.004  -36.687 1.00 121.58 ? 175  ARG A CA    1 
ATOM   1329  C  C     . ARG A 1  175  ? 85.358  68.549  -36.567 1.00 123.81 ? 175  ARG A C     1 
ATOM   1330  O  O     . ARG A 1  175  ? 84.755  68.014  -37.504 1.00 123.05 ? 175  ARG A O     1 
ATOM   1331  C  CB    . ARG A 1  175  ? 84.718  70.964  -36.124 1.00 125.82 ? 175  ARG A CB    1 
ATOM   1332  C  CG    . ARG A 1  175  ? 83.538  71.272  -37.061 1.00 151.24 ? 175  ARG A CG    1 
ATOM   1333  C  CD    . ARG A 1  175  ? 82.261  71.675  -36.323 1.00 175.77 ? 175  ARG A CD    1 
ATOM   1334  N  NE    . ARG A 1  175  ? 81.584  70.532  -35.690 1.00 189.17 ? 175  ARG A NE    1 
ATOM   1335  C  CZ    . ARG A 1  175  ? 80.505  69.921  -36.179 1.00 200.41 ? 175  ARG A CZ    1 
ATOM   1336  N  NH1   . ARG A 1  175  ? 79.955  70.335  -37.317 1.00 189.83 ? 175  ARG A NH1   1 
ATOM   1337  N  NH2   . ARG A 1  175  ? 79.969  68.891  -35.534 1.00 178.57 ? 175  ARG A NH2   1 
ATOM   1338  N  N     . LYS A 1  176  ? 85.717  67.884  -35.457 1.00 119.43 ? 176  LYS A N     1 
ATOM   1339  C  CA    . LYS A 1  176  ? 85.347  66.485  -35.294 1.00 118.49 ? 176  LYS A CA    1 
ATOM   1340  C  C     . LYS A 1  176  ? 84.085  66.296  -34.476 1.00 123.92 ? 176  LYS A C     1 
ATOM   1341  O  O     . LYS A 1  176  ? 83.871  66.995  -33.486 1.00 123.06 ? 176  LYS A O     1 
ATOM   1342  C  CB    . LYS A 1  176  ? 86.523  65.590  -34.824 1.00 119.11 ? 176  LYS A CB    1 
ATOM   1343  C  CG    . LYS A 1  176  ? 86.747  65.461  -33.301 1.00 122.13 ? 176  LYS A CG    1 
ATOM   1344  C  CD    . LYS A 1  176  ? 87.672  64.289  -32.924 1.00 122.94 ? 176  LYS A CD    1 
ATOM   1345  C  CE    . LYS A 1  176  ? 86.973  62.947  -32.872 1.00 135.37 ? 176  LYS A CE    1 
ATOM   1346  N  NZ    . LYS A 1  176  ? 86.506  62.602  -31.498 1.00 145.68 ? 176  LYS A NZ    1 
ATOM   1347  N  N     . ASP A 1  177  ? 83.241  65.364  -34.918 1.00 122.79 ? 177  ASP A N     1 
ATOM   1348  C  CA    . ASP A 1  177  ? 82.012  64.982  -34.233 1.00 123.73 ? 177  ASP A CA    1 
ATOM   1349  C  C     . ASP A 1  177  ? 82.121  63.483  -33.929 1.00 125.00 ? 177  ASP A C     1 
ATOM   1350  O  O     . ASP A 1  177  ? 81.392  62.685  -34.523 1.00 125.22 ? 177  ASP A O     1 
ATOM   1351  C  CB    . ASP A 1  177  ? 80.766  65.303  -35.091 1.00 128.15 ? 177  ASP A CB    1 
ATOM   1352  C  CG    . ASP A 1  177  ? 79.478  65.405  -34.285 1.00 148.40 ? 177  ASP A CG    1 
ATOM   1353  O  OD1   . ASP A 1  177  ? 78.868  64.343  -33.991 1.00 148.22 ? 177  ASP A OD1   1 
ATOM   1354  O  OD2   . ASP A 1  177  ? 79.073  66.546  -33.953 1.00 160.94 ? 177  ASP A OD2   1 
ATOM   1355  N  N     . GLY A 1  178  ? 83.080  63.138  -33.056 1.00 118.42 ? 178  GLY A N     1 
ATOM   1356  C  CA    . GLY A 1  178  ? 83.387  61.788  -32.591 1.00 116.38 ? 178  GLY A CA    1 
ATOM   1357  C  C     . GLY A 1  178  ? 83.324  60.714  -33.654 1.00 118.85 ? 178  GLY A C     1 
ATOM   1358  O  O     . GLY A 1  178  ? 82.247  60.165  -33.911 1.00 119.49 ? 178  GLY A O     1 
ATOM   1359  N  N     . LEU A 1  179  ? 84.481  60.397  -34.264 1.00 113.04 ? 179  LEU A N     1 
ATOM   1360  C  CA    . LEU A 1  179  ? 84.677  59.403  -35.342 1.00 111.82 ? 179  LEU A CA    1 
ATOM   1361  C  C     . LEU A 1  179  ? 84.381  59.947  -36.754 1.00 117.57 ? 179  LEU A C     1 
ATOM   1362  O  O     . LEU A 1  179  ? 84.583  59.223  -37.745 1.00 116.82 ? 179  LEU A O     1 
ATOM   1363  C  CB    . LEU A 1  179  ? 83.962  58.035  -35.107 1.00 110.56 ? 179  LEU A CB    1 
ATOM   1364  C  CG    . LEU A 1  179  ? 84.253  57.229  -33.837 1.00 112.38 ? 179  LEU A CG    1 
ATOM   1365  C  CD1   . LEU A 1  179  ? 83.687  55.826  -33.952 1.00 111.83 ? 179  LEU A CD1   1 
ATOM   1366  C  CD2   . LEU A 1  179  ? 85.718  57.109  -33.586 1.00 112.95 ? 179  LEU A CD2   1 
ATOM   1367  N  N     . LYS A 1  180  ? 83.910  61.216  -36.838 1.00 115.89 ? 180  LYS A N     1 
ATOM   1368  C  CA    . LYS A 1  180  ? 83.551  61.871  -38.095 1.00 117.76 ? 180  LYS A CA    1 
ATOM   1369  C  C     . LYS A 1  180  ? 84.170  63.232  -38.215 1.00 125.92 ? 180  LYS A C     1 
ATOM   1370  O  O     . LYS A 1  180  ? 84.172  64.000  -37.253 1.00 125.98 ? 180  LYS A O     1 
ATOM   1371  C  CB    . LYS A 1  180  ? 82.025  61.971  -38.277 1.00 120.76 ? 180  LYS A CB    1 
ATOM   1372  C  CG    . LYS A 1  180  ? 81.396  60.673  -38.768 1.00 136.43 ? 180  LYS A CG    1 
ATOM   1373  C  CD    . LYS A 1  180  ? 79.967  60.830  -39.283 1.00 146.73 ? 180  LYS A CD    1 
ATOM   1374  C  CE    . LYS A 1  180  ? 79.501  59.518  -39.882 1.00 156.38 ? 180  LYS A CE    1 
ATOM   1375  N  NZ    . LYS A 1  180  ? 78.153  59.595  -40.513 1.00 163.55 ? 180  LYS A NZ    1 
ATOM   1376  N  N     . LEU A 1  181  ? 84.701  63.531  -39.406 1.00 125.37 ? 181  LEU A N     1 
ATOM   1377  C  CA    . LEU A 1  181  ? 85.302  64.824  -39.705 1.00 126.68 ? 181  LEU A CA    1 
ATOM   1378  C  C     . LEU A 1  181  ? 84.325  65.618  -40.574 1.00 137.15 ? 181  LEU A C     1 
ATOM   1379  O  O     . LEU A 1  181  ? 84.105  65.262  -41.738 1.00 138.21 ? 181  LEU A O     1 
ATOM   1380  C  CB    . LEU A 1  181  ? 86.671  64.671  -40.402 1.00 125.72 ? 181  LEU A CB    1 
ATOM   1381  C  CG    . LEU A 1  181  ? 87.852  64.148  -39.578 1.00 128.03 ? 181  LEU A CG    1 
ATOM   1382  C  CD1   . LEU A 1  181  ? 89.116  64.176  -40.398 1.00 127.67 ? 181  LEU A CD1   1 
ATOM   1383  C  CD2   . LEU A 1  181  ? 88.073  64.965  -38.325 1.00 129.04 ? 181  LEU A CD2   1 
ATOM   1384  N  N     . VAL A 1  182  ? 83.702  66.661  -39.990 1.00 136.61 ? 182  VAL A N     1 
ATOM   1385  C  CA    . VAL A 1  182  ? 82.741  67.523  -40.680 1.00 138.82 ? 182  VAL A CA    1 
ATOM   1386  C  C     . VAL A 1  182  ? 83.277  68.963  -40.783 1.00 146.35 ? 182  VAL A C     1 
ATOM   1387  O  O     . VAL A 1  182  ? 83.625  69.568  -39.772 1.00 145.73 ? 182  VAL A O     1 
ATOM   1388  C  CB    . VAL A 1  182  ? 81.286  67.385  -40.136 1.00 142.98 ? 182  VAL A CB    1 
ATOM   1389  C  CG1   . VAL A 1  182  ? 81.239  67.307  -38.614 1.00 141.90 ? 182  VAL A CG1   1 
ATOM   1390  C  CG2   . VAL A 1  182  ? 80.357  68.470  -40.674 1.00 144.23 ? 182  VAL A CG2   1 
ATOM   1391  N  N     . GLY A 1  183  ? 83.394  69.456  -42.014 1.00 145.95 ? 183  GLY A N     1 
ATOM   1392  C  CA    . GLY A 1  183  ? 83.920  70.786  -42.303 1.00 147.40 ? 183  GLY A CA    1 
ATOM   1393  C  C     . GLY A 1  183  ? 82.880  71.823  -42.669 1.00 154.77 ? 183  GLY A C     1 
ATOM   1394  O  O     . GLY A 1  183  ? 81.726  71.486  -42.943 1.00 154.61 ? 183  GLY A O     1 
ATOM   1395  N  N     . SER A 1  184  ? 83.308  73.100  -42.694 1.00 154.05 ? 184  SER A N     1 
ATOM   1396  C  CA    . SER A 1  184  ? 82.479  74.263  -43.014 1.00 156.03 ? 184  SER A CA    1 
ATOM   1397  C  C     . SER A 1  184  ? 83.205  75.229  -43.960 1.00 163.81 ? 184  SER A C     1 
ATOM   1398  O  O     . SER A 1  184  ? 84.030  76.043  -43.529 1.00 162.85 ? 184  SER A O     1 
ATOM   1399  C  CB    . SER A 1  184  ? 82.047  74.979  -41.736 1.00 158.58 ? 184  SER A CB    1 
ATOM   1400  O  OG    . SER A 1  184  ? 81.142  76.036  -42.007 1.00 165.15 ? 184  SER A OG    1 
ATOM   1401  N  N     . TRP A 1  185  ? 82.886  75.126  -45.254 1.00 164.49 ? 185  TRP A N     1 
ATOM   1402  C  CA    . TRP A 1  185  ? 83.446  75.952  -46.318 1.00 167.27 ? 185  TRP A CA    1 
ATOM   1403  C  C     . TRP A 1  185  ? 82.838  77.350  -46.223 1.00 178.06 ? 185  TRP A C     1 
ATOM   1404  O  O     . TRP A 1  185  ? 81.616  77.492  -46.323 1.00 178.41 ? 185  TRP A O     1 
ATOM   1405  C  CB    . TRP A 1  185  ? 83.110  75.349  -47.688 1.00 166.61 ? 185  TRP A CB    1 
ATOM   1406  C  CG    . TRP A 1  185  ? 83.765  74.041  -47.992 1.00 166.57 ? 185  TRP A CG    1 
ATOM   1407  C  CD1   . TRP A 1  185  ? 84.709  73.806  -48.945 1.00 169.56 ? 185  TRP A CD1   1 
ATOM   1408  C  CD2   . TRP A 1  185  ? 83.449  72.769  -47.417 1.00 165.45 ? 185  TRP A CD2   1 
ATOM   1409  N  NE1   . TRP A 1  185  ? 85.034  72.473  -48.972 1.00 168.15 ? 185  TRP A NE1   1 
ATOM   1410  C  CE2   . TRP A 1  185  ? 84.267  71.809  -48.051 1.00 168.94 ? 185  TRP A CE2   1 
ATOM   1411  C  CE3   . TRP A 1  185  ? 82.579  72.349  -46.397 1.00 166.26 ? 185  TRP A CE3   1 
ATOM   1412  C  CZ2   . TRP A 1  185  ? 84.245  70.457  -47.695 1.00 167.27 ? 185  TRP A CZ2   1 
ATOM   1413  C  CZ3   . TRP A 1  185  ? 82.574  71.014  -46.032 1.00 166.75 ? 185  TRP A CZ3   1 
ATOM   1414  C  CH2   . TRP A 1  185  ? 83.392  70.083  -46.682 1.00 166.90 ? 185  TRP A CH2   1 
ATOM   1415  N  N     . LYS A 1  186  ? 83.688  78.379  -46.042 1.00 179.08 ? 186  LYS A N     1 
ATOM   1416  C  CA    . LYS A 1  186  ? 83.265  79.776  -45.917 1.00 181.83 ? 186  LYS A CA    1 
ATOM   1417  C  C     . LYS A 1  186  ? 82.412  80.274  -47.077 1.00 192.52 ? 186  LYS A C     1 
ATOM   1418  O  O     . LYS A 1  186  ? 81.509  81.064  -46.824 1.00 193.49 ? 186  LYS A O     1 
ATOM   1419  C  CB    . LYS A 1  186  ? 84.467  80.702  -45.697 1.00 184.05 ? 186  LYS A CB    1 
ATOM   1420  N  N     . LYS A 1  187  ? 82.662  79.777  -48.328 1.00 193.00 ? 187  LYS A N     1 
ATOM   1421  C  CA    . LYS A 1  187  ? 81.985  80.144  -49.598 1.00 196.08 ? 187  LYS A CA    1 
ATOM   1422  C  C     . LYS A 1  187  ? 82.366  81.582  -50.038 1.00 205.12 ? 187  LYS A C     1 
ATOM   1423  O  O     . LYS A 1  187  ? 83.420  82.074  -49.619 1.00 204.70 ? 187  LYS A O     1 
ATOM   1424  C  CB    . LYS A 1  187  ? 80.445  79.939  -49.541 1.00 199.11 ? 187  LYS A CB    1 
ATOM   1425  C  CG    . LYS A 1  187  ? 79.955  78.535  -49.893 1.00 206.67 ? 187  LYS A CG    1 
ATOM   1426  C  CD    . LYS A 1  187  ? 78.467  78.381  -49.577 1.00 209.42 ? 187  LYS A CD    1 
ATOM   1427  C  CE    . LYS A 1  187  ? 77.855  77.165  -50.214 1.00 208.94 ? 187  LYS A CE    1 
ATOM   1428  N  NZ    . LYS A 1  187  ? 76.549  76.835  -49.592 1.00 211.84 ? 187  LYS A NZ    1 
ATOM   1429  N  N     . ASP A 1  188  ? 81.533  82.243  -50.886 1.00 205.34 ? 188  ASP A N     1 
ATOM   1430  C  CA    . ASP A 1  188  ? 81.776  83.614  -51.348 1.00 207.54 ? 188  ASP A CA    1 
ATOM   1431  C  C     . ASP A 1  188  ? 80.517  84.424  -51.637 1.00 216.16 ? 188  ASP A C     1 
ATOM   1432  O  O     . ASP A 1  188  ? 80.431  85.552  -51.157 1.00 216.48 ? 188  ASP A O     1 
ATOM   1433  C  CB    . ASP A 1  188  ? 82.776  83.677  -52.512 1.00 209.75 ? 188  ASP A CB    1 
ATOM   1434  C  CG    . ASP A 1  188  ? 84.184  83.992  -52.052 1.00 217.50 ? 188  ASP A CG    1 
ATOM   1435  O  OD1   . ASP A 1  188  ? 84.450  85.168  -51.720 1.00 218.20 ? 188  ASP A OD1   1 
ATOM   1436  O  OD2   . ASP A 1  188  ? 85.011  83.056  -51.987 1.00 221.66 ? 188  ASP A OD2   1 
ATOM   1437  N  N     . ARG A 1  189  ? 79.556  83.851  -52.415 1.00 215.69 ? 189  ARG A N     1 
ATOM   1438  C  CA    . ARG A 1  189  ? 78.252  84.407  -52.853 1.00 218.17 ? 189  ARG A CA    1 
ATOM   1439  C  C     . ARG A 1  189  ? 77.979  85.922  -52.624 1.00 226.23 ? 189  ARG A C     1 
ATOM   1440  O  O     . ARG A 1  189  ? 77.583  86.319  -51.518 1.00 225.60 ? 189  ARG A O     1 
ATOM   1441  C  CB    . ARG A 1  189  ? 77.069  83.540  -52.369 1.00 217.30 ? 189  ARG A CB    1 
ATOM   1442  C  CG    . ARG A 1  189  ? 76.897  82.214  -53.105 1.00 225.63 ? 189  ARG A CG    1 
ATOM   1443  C  CD    . ARG A 1  189  ? 75.507  81.638  -52.888 1.00 233.81 ? 189  ARG A CD    1 
ATOM   1444  N  NE    . ARG A 1  189  ? 75.336  81.069  -51.547 1.00 240.28 ? 189  ARG A NE    1 
ATOM   1445  C  CZ    . ARG A 1  189  ? 74.161  80.842  -50.967 1.00 249.63 ? 189  ARG A CZ    1 
ATOM   1446  N  NH1   . ARG A 1  189  ? 73.031  81.148  -51.595 1.00 237.74 ? 189  ARG A NH1   1 
ATOM   1447  N  NH2   . ARG A 1  189  ? 74.106  80.316  -49.750 1.00 237.08 ? 189  ARG A NH2   1 
ATOM   1448  N  N     . ALA A 1  190  ? 78.166  86.748  -53.698 1.00 225.64 ? 190  ALA A N     1 
ATOM   1449  C  CA    . ALA A 1  190  ? 78.005  88.218  -53.751 1.00 227.28 ? 190  ALA A CA    1 
ATOM   1450  C  C     . ALA A 1  190  ? 78.875  88.964  -52.703 1.00 231.56 ? 190  ALA A C     1 
ATOM   1451  O  O     . ALA A 1  190  ? 78.426  89.939  -52.086 1.00 231.81 ? 190  ALA A O     1 
ATOM   1452  C  CB    . ALA A 1  190  ? 76.528  88.613  -53.647 1.00 229.10 ? 190  ALA A CB    1 
ATOM   1453  N  N     . THR A 1  191  ? 80.144  88.488  -52.536 1.00 227.13 ? 191  THR A N     1 
ATOM   1454  C  CA    . THR A 1  191  ? 81.200  88.929  -51.596 1.00 225.93 ? 191  THR A CA    1 
ATOM   1455  C  C     . THR A 1  191  ? 80.976  88.512  -50.125 1.00 228.59 ? 191  THR A C     1 
ATOM   1456  O  O     . THR A 1  191  ? 81.947  88.244  -49.413 1.00 226.77 ? 191  THR A O     1 
ATOM   1457  C  CB    . THR A 1  191  ? 81.700  90.384  -51.817 1.00 233.22 ? 191  THR A CB    1 
ATOM   1458  O  OG1   . THR A 1  191  ? 80.663  91.323  -51.532 1.00 233.74 ? 191  THR A OG1   1 
ATOM   1459  C  CG2   . THR A 1  191  ? 82.269  90.616  -53.215 1.00 231.81 ? 191  THR A CG2   1 
ATOM   1460  N  N     . GLY A 1  192  ? 79.705  88.419  -49.720 1.00 226.35 ? 192  GLY A N     1 
ATOM   1461  C  CA    . GLY A 1  192  ? 79.265  88.052  -48.377 1.00 225.47 ? 192  GLY A CA    1 
ATOM   1462  C  C     . GLY A 1  192  ? 79.521  86.615  -47.962 1.00 227.09 ? 192  GLY A C     1 
ATOM   1463  O  O     . GLY A 1  192  ? 80.640  86.295  -47.546 1.00 225.47 ? 192  GLY A O     1 
ATOM   1464  N  N     . ASP A 1  193  ? 78.456  85.757  -48.040 1.00 223.48 ? 193  ASP A N     1 
ATOM   1465  C  CA    . ASP A 1  193  ? 78.373  84.318  -47.681 1.00 221.93 ? 193  ASP A CA    1 
ATOM   1466  C  C     . ASP A 1  193  ? 79.727  83.637  -47.345 1.00 223.25 ? 193  ASP A C     1 
ATOM   1467  O  O     . ASP A 1  193  ? 80.576  83.551  -48.235 1.00 222.66 ? 193  ASP A O     1 
ATOM   1468  C  CB    . ASP A 1  193  ? 77.594  83.523  -48.760 1.00 224.35 ? 193  ASP A CB    1 
ATOM   1469  C  CG    . ASP A 1  193  ? 77.002  82.187  -48.319 1.00 231.96 ? 193  ASP A CG    1 
ATOM   1470  O  OD1   . ASP A 1  193  ? 77.783  81.246  -48.050 1.00 230.56 ? 193  ASP A OD1   1 
ATOM   1471  O  OD2   . ASP A 1  193  ? 75.759  82.059  -48.326 1.00 239.06 ? 193  ASP A OD2   1 
ATOM   1472  N  N     . ALA A 1  194  ? 79.974  83.184  -46.077 1.00 217.37 ? 194  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1  194  ? 79.102  83.168  -44.882 1.00 216.23 ? 194  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1  194  ? 78.957  84.537  -44.157 1.00 218.37 ? 194  ALA A C     1 
ATOM   1475  O  O     . ALA A 1  194  ? 79.928  85.298  -44.175 1.00 218.12 ? 194  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1  194  ? 79.596  82.115  -43.900 1.00 215.34 ? 194  ALA A CB    1 
ATOM   1477  N  N     . ASP A 1  195  ? 77.800  84.893  -43.502 1.00 213.03 ? 195  ASP A N     1 
ATOM   1478  C  CA    . ASP A 1  195  ? 76.468  84.274  -43.258 1.00 211.62 ? 195  ASP A CA    1 
ATOM   1479  C  C     . ASP A 1  195  ? 76.057  82.973  -43.982 1.00 212.12 ? 195  ASP A C     1 
ATOM   1480  O  O     . ASP A 1  195  ? 75.990  82.951  -45.213 1.00 212.94 ? 195  ASP A O     1 
ATOM   1481  C  CB    . ASP A 1  195  ? 75.343  85.325  -43.405 1.00 214.90 ? 195  ASP A CB    1 
ATOM   1482  C  CG    . ASP A 1  195  ? 75.750  86.760  -43.127 1.00 223.75 ? 195  ASP A CG    1 
ATOM   1483  O  OD1   . ASP A 1  195  ? 76.044  87.077  -41.953 1.00 223.74 ? 195  ASP A OD1   1 
ATOM   1484  O  OD2   . ASP A 1  195  ? 75.762  87.567  -44.081 1.00 229.12 ? 195  ASP A OD2   1 
ATOM   1485  N  N     . GLU A 1  196  ? 75.686  81.930  -43.200 1.00 204.60 ? 196  GLU A N     1 
ATOM   1486  C  CA    . GLU A 1  196  ? 75.256  80.589  -43.650 1.00 202.47 ? 196  GLU A CA    1 
ATOM   1487  C  C     . GLU A 1  196  ? 76.193  79.839  -44.646 1.00 201.50 ? 196  GLU A C     1 
ATOM   1488  O  O     . GLU A 1  196  ? 76.005  79.905  -45.868 1.00 202.02 ? 196  GLU A O     1 
ATOM   1489  C  CB    . GLU A 1  196  ? 73.737  80.452  -43.971 1.00 204.93 ? 196  GLU A CB    1 
ATOM   1490  C  CG    . GLU A 1  196  ? 73.048  81.582  -44.738 1.00 216.86 ? 196  GLU A CG    1 
ATOM   1491  C  CD    . GLU A 1  196  ? 73.273  81.703  -46.238 1.00 233.67 ? 196  GLU A CD    1 
ATOM   1492  O  OE1   . GLU A 1  196  ? 73.299  80.664  -46.938 1.00 225.20 ? 196  GLU A OE1   1 
ATOM   1493  O  OE2   . GLU A 1  196  ? 73.375  82.854  -46.721 1.00 222.78 ? 196  GLU A OE2   1 
ATOM   1494  N  N     . PRO A 1  197  ? 77.200  79.100  -44.121 1.00 192.82 ? 197  PRO A N     1 
ATOM   1495  C  CA    . PRO A 1  197  ? 78.124  78.380  -45.011 1.00 190.67 ? 197  PRO A CA    1 
ATOM   1496  C  C     . PRO A 1  197  ? 77.709  76.930  -45.300 1.00 190.24 ? 197  PRO A C     1 
ATOM   1497  O  O     . PRO A 1  197  ? 76.780  76.411  -44.672 1.00 189.70 ? 197  PRO A O     1 
ATOM   1498  C  CB    . PRO A 1  197  ? 79.444  78.447  -44.245 1.00 191.25 ? 197  PRO A CB    1 
ATOM   1499  C  CG    . PRO A 1  197  ? 79.047  78.567  -42.794 1.00 195.57 ? 197  PRO A CG    1 
ATOM   1500  C  CD    . PRO A 1  197  ? 77.587  78.923  -42.707 1.00 192.50 ? 197  PRO A CD    1 
ATOM   1501  N  N     . GLU A 1  198  ? 78.416  76.276  -46.251 1.00 183.28 ? 198  GLU A N     1 
ATOM   1502  C  CA    . GLU A 1  198  ? 78.198  74.879  -46.655 1.00 180.76 ? 198  GLU A CA    1 
ATOM   1503  C  C     . GLU A 1  198  ? 78.646  73.935  -45.523 1.00 176.88 ? 198  GLU A C     1 
ATOM   1504  O  O     . GLU A 1  198  ? 79.822  73.914  -45.147 1.00 175.50 ? 198  GLU A O     1 
ATOM   1505  C  CB    . GLU A 1  198  ? 78.952  74.579  -47.972 1.00 182.66 ? 198  GLU A CB    1 
ATOM   1506  C  CG    . GLU A 1  198  ? 78.630  73.247  -48.644 1.00 194.03 ? 198  GLU A CG    1 
ATOM   1507  C  CD    . GLU A 1  198  ? 79.418  72.971  -49.917 1.00 214.16 ? 198  GLU A CD    1 
ATOM   1508  O  OE1   . GLU A 1  198  ? 79.322  73.790  -50.861 1.00 214.16 ? 198  GLU A OE1   1 
ATOM   1509  O  OE2   . GLU A 1  198  ? 80.135  71.943  -49.970 1.00 191.85 ? 198  GLU A OE2   1 
ATOM   1510  N  N     . LEU A 1  199  ? 77.693  73.182  -44.971 1.00 168.23 ? 199  LEU A N     1 
ATOM   1511  C  CA    . LEU A 1  199  ? 77.947  72.246  -43.885 1.00 164.23 ? 199  LEU A CA    1 
ATOM   1512  C  C     . LEU A 1  199  ? 77.742  70.809  -44.355 1.00 162.82 ? 199  LEU A C     1 
ATOM   1513  O  O     . LEU A 1  199  ? 76.602  70.357  -44.507 1.00 162.94 ? 199  LEU A O     1 
ATOM   1514  C  CB    . LEU A 1  199  ? 77.028  72.568  -42.688 1.00 164.09 ? 199  LEU A CB    1 
ATOM   1515  C  CG    . LEU A 1  199  ? 77.662  72.832  -41.313 1.00 167.37 ? 199  LEU A CG    1 
ATOM   1516  C  CD1   . LEU A 1  199  ? 78.241  71.565  -40.678 1.00 166.03 ? 199  LEU A CD1   1 
ATOM   1517  C  CD2   . LEU A 1  199  ? 78.615  74.009  -41.337 1.00 169.02 ? 199  LEU A CD2   1 
ATOM   1518  N  N     . ARG A 1  200  ? 78.852  70.100  -44.613 1.00 154.77 ? 200  ARG A N     1 
ATOM   1519  C  CA    . ARG A 1  200  ? 78.832  68.699  -45.049 1.00 152.23 ? 200  ARG A CA    1 
ATOM   1520  C  C     . ARG A 1  200  ? 79.966  67.876  -44.461 1.00 149.71 ? 200  ARG A C     1 
ATOM   1521  O  O     . ARG A 1  200  ? 81.094  68.366  -44.333 1.00 149.05 ? 200  ARG A O     1 
ATOM   1522  C  CB    . ARG A 1  200  ? 78.765  68.546  -46.581 1.00 153.33 ? 200  ARG A CB    1 
ATOM   1523  C  CG    . ARG A 1  200  ? 79.863  69.271  -47.366 1.00 161.55 ? 200  ARG A CG    1 
ATOM   1524  C  CD    . ARG A 1  200  ? 79.970  68.789  -48.796 1.00 163.37 ? 200  ARG A CD    1 
ATOM   1525  N  NE    . ARG A 1  200  ? 80.452  67.415  -48.834 1.00 161.18 ? 200  ARG A NE    1 
ATOM   1526  C  CZ    . ARG A 1  200  ? 81.723  67.076  -48.988 1.00 171.37 ? 200  ARG A CZ    1 
ATOM   1527  N  NH1   . ARG A 1  200  ? 82.650  68.010  -49.160 1.00 151.84 ? 200  ARG A NH1   1 
ATOM   1528  N  NH2   . ARG A 1  200  ? 82.076  65.801  -48.997 1.00 161.10 ? 200  ARG A NH2   1 
ATOM   1529  N  N     . VAL A 1  201  ? 79.652  66.622  -44.097 1.00 140.90 ? 201  VAL A N     1 
ATOM   1530  C  CA    . VAL A 1  201  ? 80.615  65.694  -43.526 1.00 136.91 ? 201  VAL A CA    1 
ATOM   1531  C  C     . VAL A 1  201  ? 81.566  65.169  -44.604 1.00 136.06 ? 201  VAL A C     1 
ATOM   1532  O  O     . VAL A 1  201  ? 81.134  64.832  -45.710 1.00 136.60 ? 201  VAL A O     1 
ATOM   1533  C  CB    . VAL A 1  201  ? 79.928  64.584  -42.692 1.00 139.70 ? 201  VAL A CB    1 
ATOM   1534  C  CG1   . VAL A 1  201  ? 79.307  63.496  -43.569 1.00 139.75 ? 201  VAL A CG1   1 
ATOM   1535  C  CG2   . VAL A 1  201  ? 80.885  63.987  -41.673 1.00 138.23 ? 201  VAL A CG2   1 
ATOM   1536  N  N     . LEU A 1  202  ? 82.862  65.168  -44.298 1.00 128.23 ? 202  LEU A N     1 
ATOM   1537  C  CA    . LEU A 1  202  ? 83.886  64.677  -45.215 1.00 126.63 ? 202  LEU A CA    1 
ATOM   1538  C  C     . LEU A 1  202  ? 83.974  63.157  -45.046 1.00 127.81 ? 202  LEU A C     1 
ATOM   1539  O  O     . LEU A 1  202  ? 84.160  62.674  -43.920 1.00 127.19 ? 202  LEU A O     1 
ATOM   1540  C  CB    . LEU A 1  202  ? 85.247  65.329  -44.916 1.00 125.97 ? 202  LEU A CB    1 
ATOM   1541  C  CG    . LEU A 1  202  ? 85.301  66.844  -44.973 1.00 130.88 ? 202  LEU A CG    1 
ATOM   1542  C  CD1   . LEU A 1  202  ? 86.071  67.403  -43.794 1.00 130.13 ? 202  LEU A CD1   1 
ATOM   1543  C  CD2   . LEU A 1  202  ? 85.896  67.313  -46.278 1.00 133.42 ? 202  LEU A CD2   1 
ATOM   1544  N  N     . SER A 1  203  ? 83.811  62.407  -46.154 1.00 122.06 ? 203  SER A N     1 
ATOM   1545  C  CA    . SER A 1  203  ? 83.849  60.942  -46.169 1.00 120.13 ? 203  SER A CA    1 
ATOM   1546  C  C     . SER A 1  203  ? 85.257  60.384  -45.990 1.00 122.50 ? 203  SER A C     1 
ATOM   1547  O  O     . SER A 1  203  ? 86.240  61.070  -46.289 1.00 122.46 ? 203  SER A O     1 
ATOM   1548  C  CB    . SER A 1  203  ? 83.265  60.412  -47.473 1.00 123.21 ? 203  SER A CB    1 
ATOM   1549  O  OG    . SER A 1  203  ? 84.183  60.538  -48.547 1.00 128.53 ? 203  SER A OG    1 
ATOM   1550  N  N     . THR A 1  204  ? 85.353  59.115  -45.554 1.00 117.32 ? 204  THR A N     1 
ATOM   1551  C  CA    . THR A 1  204  ? 86.637  58.436  -45.405 1.00 115.90 ? 204  THR A CA    1 
ATOM   1552  C  C     . THR A 1  204  ? 87.277  58.354  -46.788 1.00 120.34 ? 204  THR A C     1 
ATOM   1553  O  O     . THR A 1  204  ? 88.432  58.750  -46.965 1.00 120.53 ? 204  THR A O     1 
ATOM   1554  C  CB    . THR A 1  204  ? 86.458  57.030  -44.842 1.00 121.55 ? 204  THR A CB    1 
ATOM   1555  O  OG1   . THR A 1  204  ? 85.158  56.881  -44.270 1.00 122.43 ? 204  THR A OG1   1 
ATOM   1556  C  CG2   . THR A 1  204  ? 87.535  56.676  -43.852 1.00 118.49 ? 204  THR A CG2   1 
ATOM   1557  N  N     . GLU A 1  205  ? 86.475  57.919  -47.778 1.00 116.34 ? 205  GLU A N     1 
ATOM   1558  C  CA    . GLU A 1  205  ? 86.840  57.757  -49.184 1.00 116.02 ? 205  GLU A CA    1 
ATOM   1559  C  C     . GLU A 1  205  ? 87.352  59.026  -49.862 1.00 117.51 ? 205  GLU A C     1 
ATOM   1560  O  O     . GLU A 1  205  ? 88.233  58.923  -50.720 1.00 116.57 ? 205  GLU A O     1 
ATOM   1561  C  CB    . GLU A 1  205  ? 85.746  57.030  -49.998 1.00 118.41 ? 205  GLU A CB    1 
ATOM   1562  C  CG    . GLU A 1  205  ? 84.304  57.350  -49.610 1.00 135.35 ? 205  GLU A CG    1 
ATOM   1563  C  CD    . GLU A 1  205  ? 83.690  56.539  -48.478 1.00 166.30 ? 205  GLU A CD    1 
ATOM   1564  O  OE1   . GLU A 1  205  ? 83.928  56.877  -47.294 1.00 163.83 ? 205  GLU A OE1   1 
ATOM   1565  O  OE2   . GLU A 1  205  ? 82.921  55.597  -48.779 1.00 162.59 ? 205  GLU A OE2   1 
ATOM   1566  N  N     . GLU A 1  206  ? 86.855  60.218  -49.455 1.00 113.60 ? 206  GLU A N     1 
ATOM   1567  C  CA    . GLU A 1  206  ? 87.346  61.469  -50.046 1.00 114.17 ? 206  GLU A CA    1 
ATOM   1568  C  C     . GLU A 1  206  ? 88.675  61.870  -49.448 1.00 114.82 ? 206  GLU A C     1 
ATOM   1569  O  O     . GLU A 1  206  ? 89.580  62.247  -50.198 1.00 115.19 ? 206  GLU A O     1 
ATOM   1570  C  CB    . GLU A 1  206  ? 86.300  62.613  -50.083 1.00 117.01 ? 206  GLU A CB    1 
ATOM   1571  C  CG    . GLU A 1  206  ? 86.011  63.355  -48.783 1.00 131.42 ? 206  GLU A CG    1 
ATOM   1572  C  CD    . GLU A 1  206  ? 84.780  64.248  -48.806 1.00 158.32 ? 206  GLU A CD    1 
ATOM   1573  O  OE1   . GLU A 1  206  ? 83.665  63.719  -48.597 1.00 163.83 ? 206  GLU A OE1   1 
ATOM   1574  O  OE2   . GLU A 1  206  ? 84.925  65.476  -49.014 1.00 145.67 ? 206  GLU A OE2   1 
ATOM   1575  N  N     . ILE A 1  207  ? 88.817  61.700  -48.108 1.00 107.76 ? 207  ILE A N     1 
ATOM   1576  C  CA    . ILE A 1  207  ? 90.052  61.981  -47.368 1.00 105.36 ? 207  ILE A CA    1 
ATOM   1577  C  C     . ILE A 1  207  ? 91.130  61.013  -47.864 1.00 108.44 ? 207  ILE A C     1 
ATOM   1578  O  O     . ILE A 1  207  ? 92.276  61.426  -48.012 1.00 108.77 ? 207  ILE A O     1 
ATOM   1579  C  CB    . ILE A 1  207  ? 89.860  61.972  -45.820 1.00 106.19 ? 207  ILE A CB    1 
ATOM   1580  C  CG1   . ILE A 1  207  ? 88.851  63.056  -45.386 1.00 106.45 ? 207  ILE A CG1   1 
ATOM   1581  C  CG2   . ILE A 1  207  ? 91.197  62.178  -45.110 1.00 104.42 ? 207  ILE A CG2   1 
ATOM   1582  C  CD1   . ILE A 1  207  ? 88.190  62.841  -44.086 1.00 107.77 ? 207  ILE A CD1   1 
ATOM   1583  N  N     . LEU A 1  208  ? 90.742  59.761  -48.197 1.00 103.53 ? 208  LEU A N     1 
ATOM   1584  C  CA    . LEU A 1  208  ? 91.646  58.772  -48.771 1.00 102.82 ? 208  LEU A CA    1 
ATOM   1585  C  C     . LEU A 1  208  ? 92.158  59.288  -50.120 1.00 111.97 ? 208  LEU A C     1 
ATOM   1586  O  O     . LEU A 1  208  ? 93.376  59.316  -50.329 1.00 112.06 ? 208  LEU A O     1 
ATOM   1587  C  CB    . LEU A 1  208  ? 90.933  57.434  -48.984 1.00 101.96 ? 208  LEU A CB    1 
ATOM   1588  C  CG    . LEU A 1  208  ? 91.700  56.157  -48.639 1.00 104.83 ? 208  LEU A CG    1 
ATOM   1589  C  CD1   . LEU A 1  208  ? 91.024  54.953  -49.217 1.00 104.93 ? 208  LEU A CD1   1 
ATOM   1590  C  CD2   . LEU A 1  208  ? 93.136  56.177  -49.127 1.00 106.75 ? 208  LEU A CD2   1 
ATOM   1591  N  N     . ASN A 1  209  ? 91.235  59.732  -51.018 1.00 111.47 ? 209  ASN A N     1 
ATOM   1592  C  CA    . ASN A 1  209  ? 91.621  60.242  -52.332 1.00 112.99 ? 209  ASN A CA    1 
ATOM   1593  C  C     . ASN A 1  209  ? 92.474  61.498  -52.305 1.00 118.89 ? 209  ASN A C     1 
ATOM   1594  O  O     . ASN A 1  209  ? 93.307  61.674  -53.192 1.00 119.42 ? 209  ASN A O     1 
ATOM   1595  C  CB    . ASN A 1  209  ? 90.455  60.374  -53.289 1.00 114.50 ? 209  ASN A CB    1 
ATOM   1596  C  CG    . ASN A 1  209  ? 90.924  60.314  -54.727 1.00 138.17 ? 209  ASN A CG    1 
ATOM   1597  O  OD1   . ASN A 1  209  ? 90.900  61.314  -55.454 1.00 133.69 ? 209  ASN A OD1   1 
ATOM   1598  N  ND2   . ASN A 1  209  ? 91.476  59.168  -55.135 1.00 127.64 ? 209  ASN A ND2   1 
ATOM   1599  N  N     . ILE A 1  210  ? 92.306  62.345  -51.284 1.00 116.02 ? 210  ILE A N     1 
ATOM   1600  C  CA    . ILE A 1  210  ? 93.135  63.539  -51.138 1.00 116.69 ? 210  ILE A CA    1 
ATOM   1601  C  C     . ILE A 1  210  ? 94.536  63.122  -50.683 1.00 120.42 ? 210  ILE A C     1 
ATOM   1602  O  O     . ILE A 1  210  ? 95.531  63.580  -51.253 1.00 121.03 ? 210  ILE A O     1 
ATOM   1603  C  CB    . ILE A 1  210  ? 92.474  64.596  -50.212 1.00 120.16 ? 210  ILE A CB    1 
ATOM   1604  C  CG1   . ILE A 1  210  ? 91.099  65.059  -50.764 1.00 122.51 ? 210  ILE A CG1   1 
ATOM   1605  C  CG2   . ILE A 1  210  ? 93.395  65.792  -49.941 1.00 120.46 ? 210  ILE A CG2   1 
ATOM   1606  C  CD1   . ILE A 1  210  ? 90.978  65.417  -52.327 1.00 132.17 ? 210  ILE A CD1   1 
ATOM   1607  N  N     . PHE A 1  211  ? 94.602  62.207  -49.701 1.00 115.45 ? 211  PHE A N     1 
ATOM   1608  C  CA    . PHE A 1  211  ? 95.849  61.687  -49.151 1.00 114.05 ? 211  PHE A CA    1 
ATOM   1609  C  C     . PHE A 1  211  ? 96.610  60.920  -50.198 1.00 119.77 ? 211  PHE A C     1 
ATOM   1610  O  O     . PHE A 1  211  ? 97.835  61.051  -50.278 1.00 120.02 ? 211  PHE A O     1 
ATOM   1611  C  CB    . PHE A 1  211  ? 95.598  60.827  -47.899 1.00 114.13 ? 211  PHE A CB    1 
ATOM   1612  C  CG    . PHE A 1  211  ? 95.281  61.593  -46.632 1.00 114.90 ? 211  PHE A CG    1 
ATOM   1613  C  CD1   . PHE A 1  211  ? 94.981  62.952  -46.671 1.00 118.23 ? 211  PHE A CD1   1 
ATOM   1614  C  CD2   . PHE A 1  211  ? 95.273  60.957  -45.402 1.00 116.31 ? 211  PHE A CD2   1 
ATOM   1615  C  CE1   . PHE A 1  211  ? 94.682  63.656  -45.504 1.00 118.67 ? 211  PHE A CE1   1 
ATOM   1616  C  CE2   . PHE A 1  211  ? 94.975  61.667  -44.231 1.00 118.75 ? 211  PHE A CE2   1 
ATOM   1617  C  CZ    . PHE A 1  211  ? 94.680  63.010  -44.292 1.00 117.10 ? 211  PHE A CZ    1 
ATOM   1618  N  N     . LYS A 1  212  ? 95.880  60.170  -51.049 1.00 117.07 ? 212  LYS A N     1 
ATOM   1619  C  CA    . LYS A 1  212  ? 96.477  59.393  -52.131 1.00 117.91 ? 212  LYS A CA    1 
ATOM   1620  C  C     . LYS A 1  212  ? 97.198  60.302  -53.142 1.00 126.55 ? 212  LYS A C     1 
ATOM   1621  O  O     . LYS A 1  212  ? 98.215  59.906  -53.723 1.00 126.76 ? 212  LYS A O     1 
ATOM   1622  C  CB    . LYS A 1  212  ? 95.422  58.504  -52.798 1.00 119.67 ? 212  LYS A CB    1 
ATOM   1623  C  CG    . LYS A 1  212  ? 95.330  57.126  -52.148 1.00 120.48 ? 212  LYS A CG    1 
ATOM   1624  C  CD    . LYS A 1  212  ? 94.226  56.271  -52.747 1.00 123.87 ? 212  LYS A CD    1 
ATOM   1625  C  CE    . LYS A 1  212  ? 94.395  54.807  -52.418 1.00 123.13 ? 212  LYS A CE    1 
ATOM   1626  N  NZ    . LYS A 1  212  ? 93.161  54.030  -52.713 1.00 128.41 ? 212  LYS A NZ    1 
ATOM   1627  N  N     . HIS A 1  213  ? 96.702  61.550  -53.267 1.00 125.40 ? 213  HIS A N     1 
ATOM   1628  C  CA    . HIS A 1  213  ? 97.192  62.600  -54.149 1.00 126.49 ? 213  HIS A CA    1 
ATOM   1629  C  C     . HIS A 1  213  ? 98.201  63.534  -53.502 1.00 128.08 ? 213  HIS A C     1 
ATOM   1630  O  O     . HIS A 1  213  ? 98.663  64.468  -54.163 1.00 128.84 ? 213  HIS A O     1 
ATOM   1631  C  CB    . HIS A 1  213  ? 96.003  63.383  -54.725 1.00 129.20 ? 213  HIS A CB    1 
ATOM   1632  C  CG    . HIS A 1  213  ? 95.270  62.655  -55.809 1.00 134.07 ? 213  HIS A CG    1 
ATOM   1633  N  ND1   . HIS A 1  213  ? 95.351  61.275  -55.946 1.00 135.60 ? 213  HIS A ND1   1 
ATOM   1634  C  CD2   . HIS A 1  213  ? 94.458  63.143  -56.776 1.00 137.83 ? 213  HIS A CD2   1 
ATOM   1635  C  CE1   . HIS A 1  213  ? 94.595  60.975  -56.987 1.00 136.50 ? 213  HIS A CE1   1 
ATOM   1636  N  NE2   . HIS A 1  213  ? 94.032  62.066  -57.516 1.00 138.09 ? 213  HIS A NE2   1 
ATOM   1637  N  N     . ILE A 1  214  ? 98.561  63.294  -52.228 1.00 122.38 ? 214  ILE A N     1 
ATOM   1638  C  CA    . ILE A 1  214  ? 99.581  64.115  -51.566 1.00 121.42 ? 214  ILE A CA    1 
ATOM   1639  C  C     . ILE A 1  214  ? 100.977 63.704  -52.105 1.00 125.75 ? 214  ILE A C     1 
ATOM   1640  O  O     . ILE A 1  214  ? 101.339 62.514  -52.063 1.00 124.85 ? 214  ILE A O     1 
ATOM   1641  C  CB    . ILE A 1  214  ? 99.482  64.134  -50.009 1.00 122.54 ? 214  ILE A CB    1 
ATOM   1642  C  CG1   . ILE A 1  214  ? 98.098  64.626  -49.544 1.00 122.05 ? 214  ILE A CG1   1 
ATOM   1643  C  CG2   . ILE A 1  214  ? 100.594 65.010  -49.411 1.00 123.28 ? 214  ILE A CG2   1 
ATOM   1644  C  CD1   . ILE A 1  214  ? 97.871  64.634  -48.068 1.00 121.91 ? 214  ILE A CD1   1 
ATOM   1645  N  N     . SER A 1  215  ? 101.717 64.698  -52.663 1.00 122.26 ? 215  SER A N     1 
ATOM   1646  C  CA    . SER A 1  215  ? 103.051 64.544  -53.257 1.00 121.92 ? 215  SER A CA    1 
ATOM   1647  C  C     . SER A 1  215  ? 104.020 63.902  -52.291 1.00 121.84 ? 215  SER A C     1 
ATOM   1648  O  O     . SER A 1  215  ? 103.933 64.182  -51.094 1.00 120.03 ? 215  SER A O     1 
ATOM   1649  C  CB    . SER A 1  215  ? 103.587 65.905  -53.701 1.00 128.26 ? 215  SER A CB    1 
ATOM   1650  O  OG    . SER A 1  215  ? 105.002 65.997  -53.612 1.00 140.16 ? 215  SER A OG    1 
ATOM   1651  N  N     . VAL A 1  216  ? 104.958 63.067  -52.796 1.00 117.44 ? 216  VAL A N     1 
ATOM   1652  C  CA    . VAL A 1  216  ? 105.934 62.409  -51.910 1.00 116.06 ? 216  VAL A CA    1 
ATOM   1653  C  C     . VAL A 1  216  ? 106.716 63.446  -51.111 1.00 120.19 ? 216  VAL A C     1 
ATOM   1654  O  O     . VAL A 1  216  ? 106.793 63.324  -49.891 1.00 118.68 ? 216  VAL A O     1 
ATOM   1655  C  CB    . VAL A 1  216  ? 106.835 61.341  -52.587 1.00 119.31 ? 216  VAL A CB    1 
ATOM   1656  C  CG1   . VAL A 1  216  ? 107.944 60.859  -51.647 1.00 117.47 ? 216  VAL A CG1   1 
ATOM   1657  C  CG2   . VAL A 1  216  ? 106.005 60.158  -53.077 1.00 119.15 ? 216  VAL A CG2   1 
ATOM   1658  N  N     . LYS A 1  217  ? 107.195 64.508  -51.796 1.00 117.71 ? 217  LYS A N     1 
ATOM   1659  C  CA    . LYS A 1  217  ? 107.948 65.629  -51.221 1.00 117.20 ? 217  LYS A CA    1 
ATOM   1660  C  C     . LYS A 1  217  ? 107.117 66.352  -50.151 1.00 120.04 ? 217  LYS A C     1 
ATOM   1661  O  O     . LYS A 1  217  ? 107.647 66.668  -49.078 1.00 118.31 ? 217  LYS A O     1 
ATOM   1662  C  CB    . LYS A 1  217  ? 108.377 66.613  -52.330 1.00 121.04 ? 217  LYS A CB    1 
ATOM   1663  C  CG    . LYS A 1  217  ? 109.031 65.970  -53.559 1.00 139.98 ? 217  LYS A CG    1 
ATOM   1664  C  CD    . LYS A 1  217  ? 110.494 65.577  -53.328 1.00 153.04 ? 217  LYS A CD    1 
ATOM   1665  C  CE    . LYS A 1  217  ? 111.367 65.872  -54.528 1.00 166.98 ? 217  LYS A CE    1 
ATOM   1666  N  NZ    . LYS A 1  217  ? 111.719 67.316  -54.636 1.00 173.38 ? 217  LYS A NZ    1 
ATOM   1667  N  N     . ASP A 1  218  ? 105.805 66.570  -50.448 1.00 117.21 ? 218  ASP A N     1 
ATOM   1668  C  CA    . ASP A 1  218  ? 104.805 67.209  -49.585 1.00 116.89 ? 218  ASP A CA    1 
ATOM   1669  C  C     . ASP A 1  218  ? 104.605 66.376  -48.301 1.00 116.87 ? 218  ASP A C     1 
ATOM   1670  O  O     . ASP A 1  218  ? 104.982 66.849  -47.229 1.00 116.26 ? 218  ASP A O     1 
ATOM   1671  C  CB    . ASP A 1  218  ? 103.441 67.394  -50.318 1.00 120.61 ? 218  ASP A CB    1 
ATOM   1672  C  CG    . ASP A 1  218  ? 103.270 68.542  -51.318 1.00 137.88 ? 218  ASP A CG    1 
ATOM   1673  O  OD1   . ASP A 1  218  ? 104.218 69.351  -51.472 1.00 140.57 ? 218  ASP A OD1   1 
ATOM   1674  O  OD2   . ASP A 1  218  ? 102.177 68.631  -51.942 1.00 142.95 ? 218  ASP A OD2   1 
ATOM   1675  N  N     . PHE A 1  219  ? 104.051 65.133  -48.399 1.00 110.26 ? 219  PHE A N     1 
ATOM   1676  C  CA    . PHE A 1  219  ? 103.849 64.300  -47.202 1.00 107.61 ? 219  PHE A CA    1 
ATOM   1677  C  C     . PHE A 1  219  ? 105.123 64.046  -46.420 1.00 109.83 ? 219  PHE A C     1 
ATOM   1678  O  O     . PHE A 1  219  ? 105.061 63.901  -45.206 1.00 108.53 ? 219  PHE A O     1 
ATOM   1679  C  CB    . PHE A 1  219  ? 103.041 63.003  -47.448 1.00 108.35 ? 219  PHE A CB    1 
ATOM   1680  C  CG    . PHE A 1  219  ? 103.634 61.828  -48.208 1.00 108.72 ? 219  PHE A CG    1 
ATOM   1681  C  CD1   . PHE A 1  219  ? 104.787 61.198  -47.763 1.00 109.61 ? 219  PHE A CD1   1 
ATOM   1682  C  CD2   . PHE A 1  219  ? 102.954 61.261  -49.278 1.00 111.00 ? 219  PHE A CD2   1 
ATOM   1683  C  CE1   . PHE A 1  219  ? 105.316 60.109  -48.450 1.00 110.01 ? 219  PHE A CE1   1 
ATOM   1684  C  CE2   . PHE A 1  219  ? 103.467 60.147  -49.942 1.00 113.06 ? 219  PHE A CE2   1 
ATOM   1685  C  CZ    . PHE A 1  219  ? 104.646 59.581  -49.523 1.00 109.79 ? 219  PHE A CZ    1 
ATOM   1686  N  N     . THR A 1  220  ? 106.275 64.011  -47.123 1.00 105.66 ? 220  THR A N     1 
ATOM   1687  C  CA    . THR A 1  220  ? 107.583 63.806  -46.528 1.00 104.50 ? 220  THR A CA    1 
ATOM   1688  C  C     . THR A 1  220  ? 108.019 65.048  -45.769 1.00 109.82 ? 220  THR A C     1 
ATOM   1689  O  O     . THR A 1  220  ? 108.820 64.927  -44.850 1.00 109.14 ? 220  THR A O     1 
ATOM   1690  C  CB    . THR A 1  220  ? 108.556 63.221  -47.550 1.00 110.26 ? 220  THR A CB    1 
ATOM   1691  O  OG1   . THR A 1  220  ? 109.039 61.946  -47.114 1.00 103.70 ? 220  THR A OG1   1 
ATOM   1692  C  CG2   . THR A 1  220  ? 109.678 64.178  -47.938 1.00 113.16 ? 220  THR A CG2   1 
ATOM   1693  N  N     . SER A 1  221  ? 107.465 66.230  -46.111 1.00 108.56 ? 221  SER A N     1 
ATOM   1694  C  CA    . SER A 1  221  ? 107.735 67.471  -45.373 1.00 109.23 ? 221  SER A CA    1 
ATOM   1695  C  C     . SER A 1  221  ? 106.926 67.452  -44.069 1.00 112.35 ? 221  SER A C     1 
ATOM   1696  O  O     . SER A 1  221  ? 107.371 67.987  -43.056 1.00 111.54 ? 221  SER A O     1 
ATOM   1697  C  CB    . SER A 1  221  ? 107.458 68.697  -46.228 1.00 115.06 ? 221  SER A CB    1 
ATOM   1698  O  OG    . SER A 1  221  ? 108.341 68.679  -47.339 1.00 126.27 ? 221  SER A OG    1 
ATOM   1699  N  N     . LEU A 1  222  ? 105.785 66.733  -44.076 1.00 108.65 ? 222  LEU A N     1 
ATOM   1700  C  CA    . LEU A 1  222  ? 105.002 66.414  -42.882 1.00 107.53 ? 222  LEU A CA    1 
ATOM   1701  C  C     . LEU A 1  222  ? 105.742 65.171  -42.301 1.00 112.19 ? 222  LEU A C     1 
ATOM   1702  O  O     . LEU A 1  222  ? 106.589 64.604  -42.996 1.00 112.58 ? 222  LEU A O     1 
ATOM   1703  C  CB    . LEU A 1  222  ? 103.569 66.027  -43.291 1.00 107.24 ? 222  LEU A CB    1 
ATOM   1704  C  CG    . LEU A 1  222  ? 102.619 67.103  -43.820 1.00 111.58 ? 222  LEU A CG    1 
ATOM   1705  C  CD1   . LEU A 1  222  ? 102.960 68.488  -43.315 1.00 111.93 ? 222  LEU A CD1   1 
ATOM   1706  C  CD2   . LEU A 1  222  ? 102.489 67.040  -45.300 1.00 112.26 ? 222  LEU A CD2   1 
ATOM   1707  N  N     . GLY A 1  223  ? 105.434 64.734  -41.084 1.00 108.19 ? 223  GLY A N     1 
ATOM   1708  C  CA    . GLY A 1  223  ? 106.137 63.593  -40.475 1.00 107.80 ? 223  GLY A CA    1 
ATOM   1709  C  C     . GLY A 1  223  ? 106.292 62.258  -41.223 1.00 112.29 ? 223  GLY A C     1 
ATOM   1710  O  O     . GLY A 1  223  ? 107.004 61.366  -40.741 1.00 111.79 ? 223  GLY A O     1 
ATOM   1711  N  N     . PHE A 1  224  ? 105.659 62.107  -42.415 1.00 108.21 ? 224  PHE A N     1 
ATOM   1712  C  CA    . PHE A 1  224  ? 105.574 60.870  -43.214 1.00 106.63 ? 224  PHE A CA    1 
ATOM   1713  C  C     . PHE A 1  224  ? 106.828 60.332  -43.854 1.00 108.84 ? 224  PHE A C     1 
ATOM   1714  O  O     . PHE A 1  224  ? 107.871 60.984  -43.817 1.00 108.94 ? 224  PHE A O     1 
ATOM   1715  C  CB    . PHE A 1  224  ? 104.356 60.881  -44.154 1.00 108.68 ? 224  PHE A CB    1 
ATOM   1716  C  CG    . PHE A 1  224  ? 103.113 61.123  -43.342 1.00 109.84 ? 224  PHE A CG    1 
ATOM   1717  C  CD1   . PHE A 1  224  ? 102.739 62.415  -42.982 1.00 112.33 ? 224  PHE A CD1   1 
ATOM   1718  C  CD2   . PHE A 1  224  ? 102.390 60.061  -42.821 1.00 112.40 ? 224  PHE A CD2   1 
ATOM   1719  C  CE1   . PHE A 1  224  ? 101.655 62.638  -42.136 1.00 115.07 ? 224  PHE A CE1   1 
ATOM   1720  C  CE2   . PHE A 1  224  ? 101.288 60.288  -41.994 1.00 113.45 ? 224  PHE A CE2   1 
ATOM   1721  C  CZ    . PHE A 1  224  ? 100.927 61.575  -41.660 1.00 112.84 ? 224  PHE A CZ    1 
ATOM   1722  N  N     . ASN A 1  225  ? 106.730 59.099  -44.379 1.00 103.84 ? 225  ASN A N     1 
ATOM   1723  C  CA    . ASN A 1  225  ? 107.818 58.340  -44.997 1.00 103.52 ? 225  ASN A CA    1 
ATOM   1724  C  C     . ASN A 1  225  ? 107.259 57.468  -46.132 1.00 108.43 ? 225  ASN A C     1 
ATOM   1725  O  O     . ASN A 1  225  ? 106.506 56.524  -45.859 1.00 108.59 ? 225  ASN A O     1 
ATOM   1726  C  CB    . ASN A 1  225  ? 108.484 57.451  -43.934 1.00 99.86  ? 225  ASN A CB    1 
ATOM   1727  C  CG    . ASN A 1  225  ? 109.653 56.633  -44.416 1.00 107.71 ? 225  ASN A CG    1 
ATOM   1728  O  OD1   . ASN A 1  225  ? 109.549 55.786  -45.319 1.00 92.96  ? 225  ASN A OD1   1 
ATOM   1729  N  ND2   . ASN A 1  225  ? 110.788 56.842  -43.780 1.00 100.85 ? 225  ASN A ND2   1 
ATOM   1730  N  N     . GLU A 1  226  ? 107.677 57.739  -47.389 1.00 103.96 ? 226  GLU A N     1 
ATOM   1731  C  CA    . GLU A 1  226  ? 107.207 57.018  -48.576 1.00 103.55 ? 226  GLU A CA    1 
ATOM   1732  C  C     . GLU A 1  226  ? 107.328 55.483  -48.578 1.00 104.05 ? 226  GLU A C     1 
ATOM   1733  O  O     . GLU A 1  226  ? 106.660 54.812  -49.380 1.00 103.63 ? 226  GLU A O     1 
ATOM   1734  C  CB    . GLU A 1  226  ? 107.769 57.640  -49.858 1.00 106.46 ? 226  GLU A CB    1 
ATOM   1735  C  CG    . GLU A 1  226  ? 109.285 57.676  -49.962 1.00 121.09 ? 226  GLU A CG    1 
ATOM   1736  C  CD    . GLU A 1  226  ? 109.836 57.359  -51.341 1.00 146.67 ? 226  GLU A CD    1 
ATOM   1737  O  OE1   . GLU A 1  226  ? 109.192 57.742  -52.348 1.00 134.14 ? 226  GLU A OE1   1 
ATOM   1738  O  OE2   . GLU A 1  226  ? 110.899 56.696  -51.413 1.00 148.29 ? 226  GLU A OE2   1 
ATOM   1739  N  N     . VAL A 1  227  ? 108.140 54.930  -47.664 1.00 98.22  ? 227  VAL A N     1 
ATOM   1740  C  CA    . VAL A 1  227  ? 108.357 53.486  -47.589 1.00 97.00  ? 227  VAL A CA    1 
ATOM   1741  C  C     . VAL A 1  227  ? 107.597 52.798  -46.494 1.00 100.12 ? 227  VAL A C     1 
ATOM   1742  O  O     . VAL A 1  227  ? 106.956 51.790  -46.764 1.00 98.78  ? 227  VAL A O     1 
ATOM   1743  C  CB    . VAL A 1  227  ? 109.843 53.103  -47.531 1.00 100.24 ? 227  VAL A CB    1 
ATOM   1744  C  CG1   . VAL A 1  227  ? 110.071 51.763  -48.224 1.00 99.88  ? 227  VAL A CG1   1 
ATOM   1745  C  CG2   . VAL A 1  227  ? 110.722 54.198  -48.139 1.00 100.80 ? 227  VAL A CG2   1 
ATOM   1746  N  N     . PHE A 1  228  ? 107.698 53.310  -45.256 1.00 98.21  ? 228  PHE A N     1 
ATOM   1747  C  CA    . PHE A 1  228  ? 107.087 52.707  -44.061 1.00 97.86  ? 228  PHE A CA    1 
ATOM   1748  C  C     . PHE A 1  228  ? 105.779 53.311  -43.586 1.00 100.08 ? 228  PHE A C     1 
ATOM   1749  O  O     . PHE A 1  228  ? 105.006 52.562  -42.987 1.00 99.84  ? 228  PHE A O     1 
ATOM   1750  C  CB    . PHE A 1  228  ? 108.098 52.592  -42.889 1.00 99.14  ? 228  PHE A CB    1 
ATOM   1751  C  CG    . PHE A 1  228  ? 109.446 52.052  -43.297 1.00 100.43 ? 228  PHE A CG    1 
ATOM   1752  C  CD1   . PHE A 1  228  ? 109.642 50.690  -43.476 1.00 103.62 ? 228  PHE A CD1   1 
ATOM   1753  C  CD2   . PHE A 1  228  ? 110.502 52.905  -43.554 1.00 102.53 ? 228  PHE A CD2   1 
ATOM   1754  C  CE1   . PHE A 1  228  ? 110.870 50.194  -43.911 1.00 104.26 ? 228  PHE A CE1   1 
ATOM   1755  C  CE2   . PHE A 1  228  ? 111.724 52.408  -43.989 1.00 105.81 ? 228  PHE A CE2   1 
ATOM   1756  C  CZ    . PHE A 1  228  ? 111.904 51.054  -44.155 1.00 103.54 ? 228  PHE A CZ    1 
ATOM   1757  N  N     . SER A 1  229  ? 105.534 54.638  -43.810 1.00 94.73  ? 229  SER A N     1 
ATOM   1758  C  CA    . SER A 1  229  ? 104.301 55.305  -43.372 1.00 94.20  ? 229  SER A CA    1 
ATOM   1759  C  C     . SER A 1  229  ? 103.797 56.503  -44.202 1.00 99.43  ? 229  SER A C     1 
ATOM   1760  O  O     . SER A 1  229  ? 104.116 57.663  -43.905 1.00 99.97  ? 229  SER A O     1 
ATOM   1761  C  CB    . SER A 1  229  ? 104.376 55.671  -41.898 1.00 96.63  ? 229  SER A CB    1 
ATOM   1762  O  OG    . SER A 1  229  ? 105.351 56.673  -41.683 1.00 106.14 ? 229  SER A OG    1 
ATOM   1763  N  N     . ARG A 1  230  ? 102.967 56.209  -45.217 1.00 95.33  ? 230  ARG A N     1 
ATOM   1764  C  CA    . ARG A 1  230  ? 102.301 57.169  -46.100 1.00 95.32  ? 230  ARG A CA    1 
ATOM   1765  C  C     . ARG A 1  230  ? 101.005 57.633  -45.418 1.00 100.24 ? 230  ARG A C     1 
ATOM   1766  O  O     . ARG A 1  230  ? 100.442 56.845  -44.661 1.00 100.12 ? 230  ARG A O     1 
ATOM   1767  C  CB    . ARG A 1  230  ? 101.988 56.491  -47.424 1.00 93.69  ? 230  ARG A CB    1 
ATOM   1768  C  CG    . ARG A 1  230  ? 103.235 56.233  -48.245 1.00 101.38 ? 230  ARG A CG    1 
ATOM   1769  C  CD    . ARG A 1  230  ? 102.910 55.400  -49.459 1.00 111.89 ? 230  ARG A CD    1 
ATOM   1770  N  NE    . ARG A 1  230  ? 103.875 55.604  -50.532 1.00 118.61 ? 230  ARG A NE    1 
ATOM   1771  C  CZ    . ARG A 1  230  ? 103.720 56.500  -51.497 1.00 133.85 ? 230  ARG A CZ    1 
ATOM   1772  N  NH1   . ARG A 1  230  ? 102.635 57.269  -51.530 1.00 117.70 ? 230  ARG A NH1   1 
ATOM   1773  N  NH2   . ARG A 1  230  ? 104.645 56.636  -52.439 1.00 126.29 ? 230  ARG A NH2   1 
ATOM   1774  N  N     . PRO A 1  231  ? 100.504 58.876  -45.617 1.00 97.74  ? 231  PRO A N     1 
ATOM   1775  C  CA    . PRO A 1  231  ? 99.287  59.305  -44.886 1.00 98.00  ? 231  PRO A CA    1 
ATOM   1776  C  C     . PRO A 1  231  ? 98.041  58.440  -45.109 1.00 102.90 ? 231  PRO A C     1 
ATOM   1777  O  O     . PRO A 1  231  ? 97.316  58.140  -44.146 1.00 99.75  ? 231  PRO A O     1 
ATOM   1778  C  CB    . PRO A 1  231  ? 99.086  60.753  -45.342 1.00 100.24 ? 231  PRO A CB    1 
ATOM   1779  C  CG    . PRO A 1  231  ? 100.395 61.173  -45.839 1.00 104.33 ? 231  PRO A CG    1 
ATOM   1780  C  CD    . PRO A 1  231  ? 101.023 59.969  -46.454 1.00 99.72  ? 231  PRO A CD    1 
ATOM   1781  N  N     . GLU A 1  232  ? 97.837  58.000  -46.382 1.00 102.03 ? 232  GLU A N     1 
ATOM   1782  C  CA    . GLU A 1  232  ? 96.754  57.118  -46.829 1.00 102.11 ? 232  GLU A CA    1 
ATOM   1783  C  C     . GLU A 1  232  ? 96.594  55.870  -45.947 1.00 106.82 ? 232  GLU A C     1 
ATOM   1784  O  O     . GLU A 1  232  ? 95.468  55.383  -45.825 1.00 107.20 ? 232  GLU A O     1 
ATOM   1785  C  CB    . GLU A 1  232  ? 96.922  56.728  -48.310 1.00 103.88 ? 232  GLU A CB    1 
ATOM   1786  C  CG    . GLU A 1  232  ? 98.276  56.137  -48.667 1.00 112.19 ? 232  GLU A CG    1 
ATOM   1787  C  CD    . GLU A 1  232  ? 99.044  56.885  -49.740 1.00 140.02 ? 232  GLU A CD    1 
ATOM   1788  O  OE1   . GLU A 1  232  ? 99.364  58.082  -49.541 1.00 128.15 ? 232  GLU A OE1   1 
ATOM   1789  O  OE2   . GLU A 1  232  ? 99.363  56.250  -50.772 1.00 140.80 ? 232  GLU A OE2   1 
ATOM   1790  N  N     . TRP A 1  233  ? 97.702  55.389  -45.299 1.00 102.50 ? 233  TRP A N     1 
ATOM   1791  C  CA    . TRP A 1  233  ? 97.734  54.211  -44.408 1.00 101.41 ? 233  TRP A CA    1 
ATOM   1792  C  C     . TRP A 1  233  ? 97.171  54.405  -42.993 1.00 102.09 ? 233  TRP A C     1 
ATOM   1793  O  O     . TRP A 1  233  ? 97.079  53.437  -42.218 1.00 100.52 ? 233  TRP A O     1 
ATOM   1794  C  CB    . TRP A 1  233  ? 99.112  53.562  -44.370 1.00 100.29 ? 233  TRP A CB    1 
ATOM   1795  C  CG    . TRP A 1  233  ? 99.607  53.100  -45.706 1.00 102.42 ? 233  TRP A CG    1 
ATOM   1796  C  CD1   . TRP A 1  233  ? 98.860  52.658  -46.761 1.00 106.17 ? 233  TRP A CD1   1 
ATOM   1797  C  CD2   . TRP A 1  233  ? 100.972 52.965  -46.097 1.00 102.38 ? 233  TRP A CD2   1 
ATOM   1798  N  NE1   . TRP A 1  233  ? 99.682  52.294  -47.799 1.00 106.18 ? 233  TRP A NE1   1 
ATOM   1799  C  CE2   . TRP A 1  233  ? 100.985 52.478  -47.419 1.00 107.11 ? 233  TRP A CE2   1 
ATOM   1800  C  CE3   . TRP A 1  233  ? 102.194 53.210  -45.456 1.00 103.35 ? 233  TRP A CE3   1 
ATOM   1801  C  CZ2   . TRP A 1  233  ? 102.172 52.246  -48.113 1.00 106.97 ? 233  TRP A CZ2   1 
ATOM   1802  C  CZ3   . TRP A 1  233  ? 103.370 52.993  -46.147 1.00 105.26 ? 233  TRP A CZ3   1 
ATOM   1803  C  CH2   . TRP A 1  233  ? 103.355 52.505  -47.455 1.00 106.73 ? 233  TRP A CH2   1 
ATOM   1804  N  N     . MET A 1  234  ? 96.761  55.651  -42.677 1.00 97.05  ? 234  MET A N     1 
ATOM   1805  C  CA    . MET A 1  234  ? 96.089  55.988  -41.423 1.00 94.95  ? 234  MET A CA    1 
ATOM   1806  C  C     . MET A 1  234  ? 94.610  55.609  -41.567 1.00 97.00  ? 234  MET A C     1 
ATOM   1807  O  O     . MET A 1  234  ? 93.913  55.507  -40.568 1.00 96.83  ? 234  MET A O     1 
ATOM   1808  C  CB    . MET A 1  234  ? 96.244  57.472  -41.087 1.00 97.14  ? 234  MET A CB    1 
ATOM   1809  C  CG    . MET A 1  234  ? 97.662  57.861  -40.803 1.00 100.08 ? 234  MET A CG    1 
ATOM   1810  S  SD    . MET A 1  234  ? 97.786  59.528  -40.158 1.00 104.60 ? 234  MET A SD    1 
ATOM   1811  C  CE    . MET A 1  234  ? 97.486  60.495  -41.652 1.00 103.01 ? 234  MET A CE    1 
ATOM   1812  N  N     . ILE A 1  235  ? 94.145  55.404  -42.816 1.00 92.30  ? 235  ILE A N     1 
ATOM   1813  C  CA    . ILE A 1  235  ? 92.803  54.964  -43.177 1.00 92.25  ? 235  ILE A CA    1 
ATOM   1814  C  C     . ILE A 1  235  ? 92.893  53.457  -43.378 1.00 98.56  ? 235  ILE A C     1 
ATOM   1815  O  O     . ILE A 1  235  ? 93.802  52.984  -44.067 1.00 99.62  ? 235  ILE A O     1 
ATOM   1816  C  CB    . ILE A 1  235  ? 92.308  55.703  -44.446 1.00 95.84  ? 235  ILE A CB    1 
ATOM   1817  C  CG1   . ILE A 1  235  ? 91.789  57.107  -44.074 1.00 96.55  ? 235  ILE A CG1   1 
ATOM   1818  C  CG2   . ILE A 1  235  ? 91.223  54.900  -45.172 1.00 96.40  ? 235  ILE A CG2   1 
ATOM   1819  C  CD1   . ILE A 1  235  ? 92.156  58.195  -45.031 1.00 102.32 ? 235  ILE A CD1   1 
ATOM   1820  N  N     . LEU A 1  236  ? 91.969  52.698  -42.772 1.00 95.03  ? 236  LEU A N     1 
ATOM   1821  C  CA    . LEU A 1  236  ? 91.991  51.239  -42.879 1.00 94.05  ? 236  LEU A CA    1 
ATOM   1822  C  C     . LEU A 1  236  ? 91.095  50.734  -43.993 1.00 100.68 ? 236  LEU A C     1 
ATOM   1823  O  O     . LEU A 1  236  ? 89.920  51.100  -44.081 1.00 101.21 ? 236  LEU A O     1 
ATOM   1824  C  CB    . LEU A 1  236  ? 91.704  50.564  -41.534 1.00 92.49  ? 236  LEU A CB    1 
ATOM   1825  C  CG    . LEU A 1  236  ? 92.438  51.170  -40.339 1.00 95.26  ? 236  LEU A CG    1 
ATOM   1826  C  CD1   . LEU A 1  236  ? 91.742  50.851  -39.080 1.00 95.03  ? 236  LEU A CD1   1 
ATOM   1827  C  CD2   . LEU A 1  236  ? 93.912  50.779  -40.297 1.00 94.62  ? 236  LEU A CD2   1 
ATOM   1828  N  N     . THR A 1  237  ? 91.688  49.930  -44.877 1.00 98.07  ? 237  THR A N     1 
ATOM   1829  C  CA    . THR A 1  237  ? 91.033  49.371  -46.052 1.00 98.79  ? 237  THR A CA    1 
ATOM   1830  C  C     . THR A 1  237  ? 90.950  47.868  -45.905 1.00 103.04 ? 237  THR A C     1 
ATOM   1831  O  O     . THR A 1  237  ? 89.891  47.282  -46.099 1.00 104.77 ? 237  THR A O     1 
ATOM   1832  C  CB    . THR A 1  237  ? 91.846  49.760  -47.280 1.00 105.26 ? 237  THR A CB    1 
ATOM   1833  O  OG1   . THR A 1  237  ? 91.952  51.180  -47.299 1.00 109.66 ? 237  THR A OG1   1 
ATOM   1834  C  CG2   . THR A 1  237  ? 91.259  49.228  -48.578 1.00 101.48 ? 237  THR A CG2   1 
ATOM   1835  N  N     . CYS A 1  238  ? 92.076  47.241  -45.608 1.00 96.92  ? 238  CYS A N     1 
ATOM   1836  C  CA    . CYS A 1  238  ? 92.133  45.807  -45.455 1.00 95.34  ? 238  CYS A CA    1 
ATOM   1837  C  C     . CYS A 1  238  ? 92.642  45.600  -44.056 1.00 95.24  ? 238  CYS A C     1 
ATOM   1838  O  O     . CYS A 1  238  ? 93.675  46.174  -43.682 1.00 95.03  ? 238  CYS A O     1 
ATOM   1839  C  CB    . CYS A 1  238  ? 93.059  45.205  -46.502 1.00 96.14  ? 238  CYS A CB    1 
ATOM   1840  S  SG    . CYS A 1  238  ? 93.277  43.423  -46.347 1.00 99.67  ? 238  CYS A SG    1 
ATOM   1841  N  N     . LEU A 1  239  ? 91.878  44.842  -43.254 1.00 87.28  ? 239  LEU A N     1 
ATOM   1842  C  CA    . LEU A 1  239  ? 92.168  44.676  -41.841 1.00 83.55  ? 239  LEU A CA    1 
ATOM   1843  C  C     . LEU A 1  239  ? 92.876  43.398  -41.438 1.00 87.47  ? 239  LEU A C     1 
ATOM   1844  O  O     . LEU A 1  239  ? 92.300  42.320  -41.617 1.00 87.27  ? 239  LEU A O     1 
ATOM   1845  C  CB    . LEU A 1  239  ? 90.868  44.920  -41.039 1.00 82.21  ? 239  LEU A CB    1 
ATOM   1846  C  CG    . LEU A 1  239  ? 90.822  44.675  -39.545 1.00 83.77  ? 239  LEU A CG    1 
ATOM   1847  C  CD1   . LEU A 1  239  ? 91.830  45.497  -38.829 1.00 83.70  ? 239  LEU A CD1   1 
ATOM   1848  C  CD2   . LEU A 1  239  ? 89.488  45.059  -39.002 1.00 82.97  ? 239  LEU A CD2   1 
ATOM   1849  N  N     . PRO A 1  240  ? 94.086  43.500  -40.808 1.00 84.58  ? 240  PRO A N     1 
ATOM   1850  C  CA    . PRO A 1  240  ? 94.750  42.279  -40.288 1.00 84.00  ? 240  PRO A CA    1 
ATOM   1851  C  C     . PRO A 1  240  ? 93.995  41.628  -39.105 1.00 87.17  ? 240  PRO A C     1 
ATOM   1852  O  O     . PRO A 1  240  ? 93.619  42.283  -38.096 1.00 85.77  ? 240  PRO A O     1 
ATOM   1853  C  CB    . PRO A 1  240  ? 96.169  42.744  -39.911 1.00 85.08  ? 240  PRO A CB    1 
ATOM   1854  C  CG    . PRO A 1  240  ? 96.067  44.207  -39.721 1.00 89.64  ? 240  PRO A CG    1 
ATOM   1855  C  CD    . PRO A 1  240  ? 94.885  44.715  -40.530 1.00 86.00  ? 240  PRO A CD    1 
ATOM   1856  N  N     . VAL A 1  241  ? 93.742  40.312  -39.285 1.00 83.12  ? 241  VAL A N     1 
ATOM   1857  C  CA    . VAL A 1  241  ? 93.036  39.412  -38.365 1.00 81.95  ? 241  VAL A CA    1 
ATOM   1858  C  C     . VAL A 1  241  ? 94.096  38.642  -37.545 1.00 84.84  ? 241  VAL A C     1 
ATOM   1859  O  O     . VAL A 1  241  ? 94.689  37.702  -38.081 1.00 85.15  ? 241  VAL A O     1 
ATOM   1860  C  CB    . VAL A 1  241  ? 92.064  38.461  -39.143 1.00 85.68  ? 241  VAL A CB    1 
ATOM   1861  C  CG1   . VAL A 1  241  ? 91.390  37.457  -38.210 1.00 84.52  ? 241  VAL A CG1   1 
ATOM   1862  C  CG2   . VAL A 1  241  ? 91.012  39.260  -39.918 1.00 86.49  ? 241  VAL A CG2   1 
ATOM   1863  N  N     . PRO A 1  242  ? 94.396  39.035  -36.277 1.00 79.89  ? 242  PRO A N     1 
ATOM   1864  C  CA    . PRO A 1  242  ? 95.416  38.313  -35.518 1.00 78.61  ? 242  PRO A CA    1 
ATOM   1865  C  C     . PRO A 1  242  ? 95.036  36.861  -35.263 1.00 83.24  ? 242  PRO A C     1 
ATOM   1866  O  O     . PRO A 1  242  ? 93.856  36.499  -35.247 1.00 83.54  ? 242  PRO A O     1 
ATOM   1867  C  CB    . PRO A 1  242  ? 95.558  39.128  -34.234 1.00 79.63  ? 242  PRO A CB    1 
ATOM   1868  C  CG    . PRO A 1  242  ? 94.289  39.803  -34.091 1.00 85.02  ? 242  PRO A CG    1 
ATOM   1869  C  CD    . PRO A 1  242  ? 93.849  40.143  -35.477 1.00 81.74  ? 242  PRO A CD    1 
ATOM   1870  N  N     . PRO A 1  243  ? 96.059  36.014  -35.120 1.00 79.56  ? 243  PRO A N     1 
ATOM   1871  C  CA    . PRO A 1  243  ? 95.815  34.577  -34.919 1.00 80.15  ? 243  PRO A CA    1 
ATOM   1872  C  C     . PRO A 1  243  ? 95.342  34.171  -33.517 1.00 86.25  ? 243  PRO A C     1 
ATOM   1873  O  O     . PRO A 1  243  ? 95.514  34.947  -32.579 1.00 87.41  ? 243  PRO A O     1 
ATOM   1874  C  CB    . PRO A 1  243  ? 97.206  34.000  -35.131 1.00 81.45  ? 243  PRO A CB    1 
ATOM   1875  C  CG    . PRO A 1  243  ? 98.120  35.099  -34.632 1.00 84.29  ? 243  PRO A CG    1 
ATOM   1876  C  CD    . PRO A 1  243  ? 97.507  36.316  -35.163 1.00 80.05  ? 243  PRO A CD    1 
ATOM   1877  N  N     . PRO A 1  244  ? 94.916  32.899  -33.318 1.00 82.56  ? 244  PRO A N     1 
ATOM   1878  C  CA    . PRO A 1  244  ? 94.576  32.429  -31.965 1.00 81.60  ? 244  PRO A CA    1 
ATOM   1879  C  C     . PRO A 1  244  ? 95.578  32.768  -30.855 1.00 82.37  ? 244  PRO A C     1 
ATOM   1880  O  O     . PRO A 1  244  ? 95.100  33.306  -29.874 1.00 81.80  ? 244  PRO A O     1 
ATOM   1881  C  CB    . PRO A 1  244  ? 94.438  30.920  -32.151 1.00 83.91  ? 244  PRO A CB    1 
ATOM   1882  C  CG    . PRO A 1  244  ? 93.911  30.801  -33.515 1.00 89.34  ? 244  PRO A CG    1 
ATOM   1883  C  CD    . PRO A 1  244  ? 94.680  31.830  -34.308 1.00 84.94  ? 244  PRO A CD    1 
ATOM   1884  N  N     . PRO A 1  245  ? 96.920  32.592  -30.961 1.00 77.53  ? 245  PRO A N     1 
ATOM   1885  C  CA    . PRO A 1  245  ? 97.807  32.940  -29.826 1.00 76.76  ? 245  PRO A CA    1 
ATOM   1886  C  C     . PRO A 1  245  ? 97.591  34.265  -29.101 1.00 79.65  ? 245  PRO A C     1 
ATOM   1887  O  O     . PRO A 1  245  ? 97.932  34.385  -27.905 1.00 79.75  ? 245  PRO A O     1 
ATOM   1888  C  CB    . PRO A 1  245  ? 99.200  32.861  -30.440 1.00 78.74  ? 245  PRO A CB    1 
ATOM   1889  C  CG    . PRO A 1  245  ? 99.084  31.766  -31.408 1.00 83.82  ? 245  PRO A CG    1 
ATOM   1890  C  CD    . PRO A 1  245  ? 97.697  31.927  -32.024 1.00 79.63  ? 245  PRO A CD    1 
ATOM   1891  N  N     . VAL A 1  246  ? 97.029  35.244  -29.842 1.00 74.40  ? 246  VAL A N     1 
ATOM   1892  C  CA    . VAL A 1  246  ? 96.699  36.618  -29.448 1.00 73.20  ? 246  VAL A CA    1 
ATOM   1893  C  C     . VAL A 1  246  ? 95.346  36.666  -28.702 1.00 77.43  ? 246  VAL A C     1 
ATOM   1894  O  O     . VAL A 1  246  ? 95.193  37.402  -27.736 1.00 76.00  ? 246  VAL A O     1 
ATOM   1895  C  CB    . VAL A 1  246  ? 96.679  37.500  -30.737 1.00 76.42  ? 246  VAL A CB    1 
ATOM   1896  C  CG1   . VAL A 1  246  ? 96.380  38.959  -30.432 1.00 76.05  ? 246  VAL A CG1   1 
ATOM   1897  C  CG2   . VAL A 1  246  ? 97.990  37.382  -31.493 1.00 76.21  ? 246  VAL A CG2   1 
ATOM   1898  N  N     . ARG A 1  247  ? 94.379  35.885  -29.174 1.00 76.02  ? 247  ARG A N     1 
ATOM   1899  C  CA    . ARG A 1  247  ? 93.004  35.825  -28.696 1.00 77.43  ? 247  ARG A CA    1 
ATOM   1900  C  C     . ARG A 1  247  ? 92.564  34.341  -28.346 1.00 89.86  ? 247  ARG A C     1 
ATOM   1901  O  O     . ARG A 1  247  ? 91.506  33.837  -28.821 1.00 90.27  ? 247  ARG A O     1 
ATOM   1902  C  CB    . ARG A 1  247  ? 92.092  36.498  -29.751 1.00 73.40  ? 247  ARG A CB    1 
ATOM   1903  C  CG    . ARG A 1  247  ? 92.463  36.185  -31.225 1.00 67.82  ? 247  ARG A CG    1 
ATOM   1904  C  CD    . ARG A 1  247  ? 91.487  36.832  -32.195 1.00 66.42  ? 247  ARG A CD    1 
ATOM   1905  N  NE    . ARG A 1  247  ? 91.537  36.235  -33.530 1.00 78.74  ? 247  ARG A NE    1 
ATOM   1906  C  CZ    . ARG A 1  247  ? 90.980  35.066  -33.855 1.00 101.45 ? 247  ARG A CZ    1 
ATOM   1907  N  NH1   . ARG A 1  247  ? 90.363  34.338  -32.931 1.00 97.91  ? 247  ARG A NH1   1 
ATOM   1908  N  NH2   . ARG A 1  247  ? 91.050  34.610  -35.105 1.00 81.79  ? 247  ARG A NH2   1 
ATOM   1909  N  N     . PRO A 1  248  ? 93.358  33.644  -27.474 1.00 90.40  ? 248  PRO A N     1 
ATOM   1910  C  CA    . PRO A 1  248  ? 93.034  32.254  -27.144 1.00 92.91  ? 248  PRO A CA    1 
ATOM   1911  C  C     . PRO A 1  248  ? 91.679  32.019  -26.502 1.00 108.48 ? 248  PRO A C     1 
ATOM   1912  O  O     . PRO A 1  248  ? 91.223  32.798  -25.647 1.00 107.82 ? 248  PRO A O     1 
ATOM   1913  C  CB    . PRO A 1  248  ? 94.167  31.843  -26.199 1.00 92.82  ? 248  PRO A CB    1 
ATOM   1914  C  CG    . PRO A 1  248  ? 94.691  33.102  -25.666 1.00 95.10  ? 248  PRO A CG    1 
ATOM   1915  C  CD    . PRO A 1  248  ? 94.605  34.048  -26.797 1.00 90.64  ? 248  PRO A CD    1 
ATOM   1916  N  N     . SER A 1  249  ? 91.060  30.906  -26.918 1.00 114.19 ? 249  SER A N     1 
ATOM   1917  C  CA    . SER A 1  249  ? 89.794  30.423  -26.391 1.00 118.35 ? 249  SER A CA    1 
ATOM   1918  C  C     . SER A 1  249  ? 90.069  29.628  -25.116 1.00 130.26 ? 249  SER A C     1 
ATOM   1919  O  O     . SER A 1  249  ? 90.713  28.575  -25.166 1.00 129.56 ? 249  SER A O     1 
ATOM   1920  C  CB    . SER A 1  249  ? 89.054  29.572  -27.427 1.00 123.93 ? 249  SER A CB    1 
ATOM   1921  O  OG    . SER A 1  249  ? 89.675  28.333  -27.736 1.00 134.46 ? 249  SER A OG    1 
ATOM   1922  N  N     . ILE A 1  250  ? 89.618  30.158  -23.967 1.00 134.12 ? 250  ILE A N     1 
ATOM   1923  C  CA    . ILE A 1  250  ? 89.758  29.520  -22.648 1.00 137.06 ? 250  ILE A CA    1 
ATOM   1924  C  C     . ILE A 1  250  ? 88.703  28.378  -22.596 1.00 150.96 ? 250  ILE A C     1 
ATOM   1925  O  O     . ILE A 1  250  ? 87.615  28.526  -22.021 1.00 150.82 ? 250  ILE A O     1 
ATOM   1926  C  CB    . ILE A 1  250  ? 89.654  30.586  -21.506 1.00 139.42 ? 250  ILE A CB    1 
ATOM   1927  C  CG1   . ILE A 1  250  ? 90.658  31.766  -21.706 1.00 139.01 ? 250  ILE A CG1   1 
ATOM   1928  C  CG2   . ILE A 1  250  ? 89.781  29.966  -20.119 1.00 139.89 ? 250  ILE A CG2   1 
ATOM   1929  C  CD1   . ILE A 1  250  ? 92.184  31.400  -21.942 1.00 139.92 ? 250  ILE A CD1   1 
ATOM   1930  N  N     . SER A 1  251  ? 89.042  27.259  -23.286 1.00 154.51 ? 251  SER A N     1 
ATOM   1931  C  CA    . SER A 1  251  ? 88.223  26.064  -23.526 1.00 157.79 ? 251  SER A CA    1 
ATOM   1932  C  C     . SER A 1  251  ? 87.955  25.100  -22.345 1.00 168.78 ? 251  SER A C     1 
ATOM   1933  O  O     . SER A 1  251  ? 88.554  24.016  -22.266 1.00 168.63 ? 251  SER A O     1 
ATOM   1934  C  CB    . SER A 1  251  ? 88.698  25.328  -24.779 1.00 161.70 ? 251  SER A CB    1 
ATOM   1935  O  OG    . SER A 1  251  ? 90.096  25.080  -24.741 1.00 170.17 ? 251  SER A OG    1 
ATOM   1936  N  N     . PHE A 1  252  ? 87.003  25.492  -21.458 1.00 170.11 ? 252  PHE A N     1 
ATOM   1937  C  CA    . PHE A 1  252  ? 86.548  24.705  -20.297 1.00 171.78 ? 252  PHE A CA    1 
ATOM   1938  C  C     . PHE A 1  252  ? 85.860  23.427  -20.787 1.00 178.80 ? 252  PHE A C     1 
ATOM   1939  O  O     . PHE A 1  252  ? 85.247  23.435  -21.865 1.00 179.29 ? 252  PHE A O     1 
ATOM   1940  C  CB    . PHE A 1  252  ? 85.580  25.502  -19.381 1.00 174.21 ? 252  PHE A CB    1 
ATOM   1941  C  CG    . PHE A 1  252  ? 85.106  26.859  -19.866 1.00 176.64 ? 252  PHE A CG    1 
ATOM   1942  C  CD1   . PHE A 1  252  ? 84.178  26.965  -20.899 1.00 180.45 ? 252  PHE A CD1   1 
ATOM   1943  C  CD2   . PHE A 1  252  ? 85.554  28.028  -19.258 1.00 179.14 ? 252  PHE A CD2   1 
ATOM   1944  C  CE1   . PHE A 1  252  ? 83.747  28.218  -21.349 1.00 181.76 ? 252  PHE A CE1   1 
ATOM   1945  C  CE2   . PHE A 1  252  ? 85.110  29.282  -19.699 1.00 182.29 ? 252  PHE A CE2   1 
ATOM   1946  C  CZ    . PHE A 1  252  ? 84.208  29.367  -20.740 1.00 180.86 ? 252  PHE A CZ    1 
ATOM   1947  N  N     . ASN A 1  253  ? 85.976  22.328  -19.998 1.00 176.04 ? 253  ASN A N     1 
ATOM   1948  C  CA    . ASN A 1  253  ? 85.394  21.004  -20.292 1.00 176.08 ? 253  ASN A CA    1 
ATOM   1949  C  C     . ASN A 1  253  ? 85.892  20.471  -21.666 1.00 179.70 ? 253  ASN A C     1 
ATOM   1950  O  O     . ASN A 1  253  ? 87.051  20.715  -22.026 1.00 179.00 ? 253  ASN A O     1 
ATOM   1951  C  CB    . ASN A 1  253  ? 83.840  21.026  -20.175 1.00 175.44 ? 253  ASN A CB    1 
ATOM   1952  C  CG    . ASN A 1  253  ? 83.274  21.984  -19.137 1.00 191.01 ? 253  ASN A CG    1 
ATOM   1953  O  OD1   . ASN A 1  253  ? 83.837  22.205  -18.049 1.00 181.74 ? 253  ASN A OD1   1 
ATOM   1954  N  ND2   . ASN A 1  253  ? 82.151  22.596  -19.467 1.00 182.92 ? 253  ASN A ND2   1 
ATOM   1955  N  N     . GLU A 1  254  ? 85.034  19.754  -22.415 1.00 176.12 ? 254  GLU A N     1 
ATOM   1956  C  CA    . GLU A 1  254  ? 85.354  19.235  -23.746 1.00 175.70 ? 254  GLU A CA    1 
ATOM   1957  C  C     . GLU A 1  254  ? 84.359  19.798  -24.756 1.00 178.77 ? 254  GLU A C     1 
ATOM   1958  O  O     . GLU A 1  254  ? 84.706  20.034  -25.914 1.00 178.05 ? 254  GLU A O     1 
ATOM   1959  C  CB    . GLU A 1  254  ? 85.365  17.695  -23.758 1.00 177.30 ? 254  GLU A CB    1 
ATOM   1960  C  CG    . GLU A 1  254  ? 86.038  17.086  -24.983 1.00 187.93 ? 254  GLU A CG    1 
ATOM   1961  C  CD    . GLU A 1  254  ? 87.393  17.654  -25.372 1.00 205.07 ? 254  GLU A CD    1 
ATOM   1962  O  OE1   . GLU A 1  254  ? 88.291  17.714  -24.500 1.00 195.02 ? 254  GLU A OE1   1 
ATOM   1963  O  OE2   . GLU A 1  254  ? 87.556  18.038  -26.553 1.00 197.99 ? 254  GLU A OE2   1 
ATOM   1964  N  N     . SER A 1  255  ? 83.127  20.033  -24.291 1.00 175.06 ? 255  SER A N     1 
ATOM   1965  C  CA    . SER A 1  255  ? 82.038  20.603  -25.071 1.00 174.83 ? 255  SER A CA    1 
ATOM   1966  C  C     . SER A 1  255  ? 81.598  21.959  -24.460 1.00 175.78 ? 255  SER A C     1 
ATOM   1967  O  O     . SER A 1  255  ? 80.577  22.049  -23.760 1.00 176.07 ? 255  SER A O     1 
ATOM   1968  C  CB    . SER A 1  255  ? 80.883  19.609  -25.195 1.00 179.36 ? 255  SER A CB    1 
ATOM   1969  O  OG    . SER A 1  255  ? 80.437  19.182  -23.919 1.00 188.17 ? 255  SER A OG    1 
ATOM   1970  N  N     . GLN A 1  256  ? 82.432  23.003  -24.703 1.00 168.47 ? 256  GLN A N     1 
ATOM   1971  C  CA    . GLN A 1  256  ? 82.251  24.409  -24.297 1.00 166.16 ? 256  GLN A CA    1 
ATOM   1972  C  C     . GLN A 1  256  ? 83.344  25.280  -24.944 1.00 163.51 ? 256  GLN A C     1 
ATOM   1973  O  O     . GLN A 1  256  ? 84.534  24.998  -24.759 1.00 162.61 ? 256  GLN A O     1 
ATOM   1974  C  CB    . GLN A 1  256  ? 82.228  24.578  -22.762 1.00 167.24 ? 256  GLN A CB    1 
ATOM   1975  C  CG    . GLN A 1  256  ? 81.090  25.470  -22.264 1.00 179.68 ? 256  GLN A CG    1 
ATOM   1976  C  CD    . GLN A 1  256  ? 80.356  24.854  -21.098 1.00 194.81 ? 256  GLN A CD    1 
ATOM   1977  O  OE1   . GLN A 1  256  ? 79.662  23.837  -21.237 1.00 189.02 ? 256  GLN A OE1   1 
ATOM   1978  N  NE2   . GLN A 1  256  ? 80.484  25.463  -19.921 1.00 185.02 ? 256  GLN A NE2   1 
ATOM   1979  N  N     . ARG A 1  257  ? 82.928  26.309  -25.730 1.00 155.09 ? 257  ARG A N     1 
ATOM   1980  C  CA    . ARG A 1  257  ? 83.815  27.231  -26.456 1.00 151.83 ? 257  ARG A CA    1 
ATOM   1981  C  C     . ARG A 1  257  ? 84.768  28.025  -25.528 1.00 145.51 ? 257  ARG A C     1 
ATOM   1982  O  O     . ARG A 1  257  ? 85.867  27.547  -25.246 1.00 144.30 ? 257  ARG A O     1 
ATOM   1983  C  CB    . ARG A 1  257  ? 83.021  28.146  -27.434 1.00 154.98 ? 257  ARG A CB    1 
ATOM   1984  C  CG    . ARG A 1  257  ? 83.229  27.846  -28.938 1.00 170.93 ? 257  ARG A CG    1 
ATOM   1985  C  CD    . ARG A 1  257  ? 82.622  28.929  -29.843 1.00 188.94 ? 257  ARG A CD    1 
ATOM   1986  N  NE    . ARG A 1  257  ? 82.354  28.462  -31.213 1.00 202.73 ? 257  ARG A NE    1 
ATOM   1987  C  CZ    . ARG A 1  257  ? 81.608  29.111  -32.111 1.00 213.19 ? 257  ARG A CZ    1 
ATOM   1988  N  NH1   . ARG A 1  257  ? 81.070  30.290  -31.814 1.00 194.96 ? 257  ARG A NH1   1 
ATOM   1989  N  NH2   . ARG A 1  257  ? 81.422  28.600  -33.323 1.00 197.12 ? 257  ARG A NH2   1 
ATOM   1990  N  N     . GLY A 1  258  ? 84.341  29.203  -25.074 1.00 134.82 ? 258  GLY A N     1 
ATOM   1991  C  CA    . GLY A 1  258  ? 85.136  30.083  -24.220 1.00 130.74 ? 258  GLY A CA    1 
ATOM   1992  C  C     . GLY A 1  258  ? 86.003  31.069  -24.987 1.00 125.66 ? 258  GLY A C     1 
ATOM   1993  O  O     . GLY A 1  258  ? 87.147  31.325  -24.600 1.00 124.06 ? 258  GLY A O     1 
ATOM   1994  N  N     . GLU A 1  259  ? 85.445  31.657  -26.062 1.00 116.57 ? 259  GLU A N     1 
ATOM   1995  C  CA    . GLU A 1  259  ? 86.132  32.589  -26.958 1.00 113.28 ? 259  GLU A CA    1 
ATOM   1996  C  C     . GLU A 1  259  ? 86.542  33.919  -26.340 1.00 111.80 ? 259  GLU A C     1 
ATOM   1997  O  O     . GLU A 1  259  ? 85.846  34.436  -25.473 1.00 110.27 ? 259  GLU A O     1 
ATOM   1998  C  CB    . GLU A 1  259  ? 85.367  32.772  -28.283 1.00 114.70 ? 259  GLU A CB    1 
ATOM   1999  C  CG    . GLU A 1  259  ? 85.287  31.518  -29.144 1.00 117.96 ? 259  GLU A CG    1 
ATOM   2000  C  CD    . GLU A 1  259  ? 86.599  30.889  -29.577 1.00 131.18 ? 259  GLU A CD    1 
ATOM   2001  O  OE1   . GLU A 1  259  ? 87.620  31.614  -29.656 1.00 125.61 ? 259  GLU A OE1   1 
ATOM   2002  O  OE2   . GLU A 1  259  ? 86.605  29.662  -29.835 1.00 121.47 ? 259  GLU A OE2   1 
ATOM   2003  N  N     . ASP A 1  260  ? 87.687  34.462  -26.796 1.00 105.98 ? 260  ASP A N     1 
ATOM   2004  C  CA    . ASP A 1  260  ? 88.242  35.718  -26.304 1.00 104.65 ? 260  ASP A CA    1 
ATOM   2005  C  C     . ASP A 1  260  ? 87.379  36.919  -26.673 1.00 106.00 ? 260  ASP A C     1 
ATOM   2006  O  O     . ASP A 1  260  ? 86.518  36.830  -27.541 1.00 105.04 ? 260  ASP A O     1 
ATOM   2007  C  CB    . ASP A 1  260  ? 89.693  35.907  -26.794 1.00 106.41 ? 260  ASP A CB    1 
ATOM   2008  C  CG    . ASP A 1  260  ? 90.578  36.753  -25.875 1.00 115.94 ? 260  ASP A CG    1 
ATOM   2009  O  OD1   . ASP A 1  260  ? 90.405  38.002  -25.858 1.00 115.84 ? 260  ASP A OD1   1 
ATOM   2010  O  OD2   . ASP A 1  260  ? 91.456  36.169  -25.187 1.00 121.15 ? 260  ASP A OD2   1 
ATOM   2011  N  N     . ASP A 1  261  ? 87.607  38.042  -25.997 1.00 102.06 ? 261  ASP A N     1 
ATOM   2012  C  CA    . ASP A 1  261  ? 86.884  39.274  -26.254 1.00 102.38 ? 261  ASP A CA    1 
ATOM   2013  C  C     . ASP A 1  261  ? 87.178  39.726  -27.681 1.00 102.06 ? 261  ASP A C     1 
ATOM   2014  O  O     . ASP A 1  261  ? 86.250  40.097  -28.408 1.00 102.61 ? 261  ASP A O     1 
ATOM   2015  C  CB    . ASP A 1  261  ? 87.277  40.358  -25.223 1.00 105.44 ? 261  ASP A CB    1 
ATOM   2016  C  CG    . ASP A 1  261  ? 86.331  40.502  -24.032 1.00 125.83 ? 261  ASP A CG    1 
ATOM   2017  O  OD1   . ASP A 1  261  ? 86.090  39.483  -23.332 1.00 128.38 ? 261  ASP A OD1   1 
ATOM   2018  O  OD2   . ASP A 1  261  ? 85.875  41.645  -23.766 1.00 132.89 ? 261  ASP A OD2   1 
ATOM   2019  N  N     . LEU A 1  262  ? 88.461  39.628  -28.095 1.00 94.34  ? 262  LEU A N     1 
ATOM   2020  C  CA    . LEU A 1  262  ? 88.914  40.004  -29.431 1.00 92.97  ? 262  LEU A CA    1 
ATOM   2021  C  C     . LEU A 1  262  ? 88.254  39.200  -30.526 1.00 96.65  ? 262  LEU A C     1 
ATOM   2022  O  O     . LEU A 1  262  ? 87.871  39.774  -31.549 1.00 96.73  ? 262  LEU A O     1 
ATOM   2023  C  CB    . LEU A 1  262  ? 90.430  39.954  -29.542 1.00 91.80  ? 262  LEU A CB    1 
ATOM   2024  C  CG    . LEU A 1  262  ? 91.170  41.109  -28.875 1.00 95.37  ? 262  LEU A CG    1 
ATOM   2025  C  CD1   . LEU A 1  262  ? 92.616  41.137  -29.322 1.00 94.71  ? 262  LEU A CD1   1 
ATOM   2026  C  CD2   . LEU A 1  262  ? 90.494  42.477  -29.159 1.00 97.92  ? 262  LEU A CD2   1 
ATOM   2027  N  N     . THR A 1  263  ? 88.043  37.894  -30.271 1.00 92.00  ? 263  THR A N     1 
ATOM   2028  C  CA    . THR A 1  263  ? 87.344  36.988  -31.172 1.00 91.85  ? 263  THR A CA    1 
ATOM   2029  C  C     . THR A 1  263  ? 85.880  37.445  -31.332 1.00 97.49  ? 263  THR A C     1 
ATOM   2030  O  O     . THR A 1  263  ? 85.378  37.443  -32.452 1.00 98.79  ? 263  THR A O     1 
ATOM   2031  C  CB    . THR A 1  263  ? 87.483  35.544  -30.700 1.00 96.05  ? 263  THR A CB    1 
ATOM   2032  O  OG1   . THR A 1  263  ? 88.859  35.243  -30.459 1.00 96.59  ? 263  THR A OG1   1 
ATOM   2033  C  CG2   . THR A 1  263  ? 86.917  34.553  -31.686 1.00 92.81  ? 263  THR A CG2   1 
ATOM   2034  N  N     . PHE A 1  264  ? 85.220  37.897  -30.252 1.00 94.25  ? 264  PHE A N     1 
ATOM   2035  C  CA    . PHE A 1  264  ? 83.844  38.395  -30.379 1.00 95.56  ? 264  PHE A CA    1 
ATOM   2036  C  C     . PHE A 1  264  ? 83.757  39.712  -31.128 1.00 97.44  ? 264  PHE A C     1 
ATOM   2037  O  O     . PHE A 1  264  ? 82.940  39.820  -32.055 1.00 96.90  ? 264  PHE A O     1 
ATOM   2038  C  CB    . PHE A 1  264  ? 83.095  38.464  -29.035 1.00 98.40  ? 264  PHE A CB    1 
ATOM   2039  C  CG    . PHE A 1  264  ? 82.747  37.104  -28.464 1.00 100.86 ? 264  PHE A CG    1 
ATOM   2040  C  CD1   . PHE A 1  264  ? 82.278  36.081  -29.289 1.00 104.54 ? 264  PHE A CD1   1 
ATOM   2041  C  CD2   . PHE A 1  264  ? 82.883  36.847  -27.104 1.00 103.23 ? 264  PHE A CD2   1 
ATOM   2042  C  CE1   . PHE A 1  264  ? 81.976  34.824  -28.768 1.00 105.34 ? 264  PHE A CE1   1 
ATOM   2043  C  CE2   . PHE A 1  264  ? 82.581  35.589  -26.584 1.00 106.19 ? 264  PHE A CE2   1 
ATOM   2044  C  CZ    . PHE A 1  264  ? 82.133  34.584  -27.421 1.00 104.46 ? 264  PHE A CZ    1 
ATOM   2045  N  N     . LYS A 1  265  ? 84.629  40.699  -30.762 1.00 91.79  ? 265  LYS A N     1 
ATOM   2046  C  CA    . LYS A 1  265  ? 84.673  42.004  -31.429 1.00 90.41  ? 265  LYS A CA    1 
ATOM   2047  C  C     . LYS A 1  265  ? 85.014  41.843  -32.897 1.00 94.05  ? 265  LYS A C     1 
ATOM   2048  O  O     . LYS A 1  265  ? 84.524  42.629  -33.715 1.00 94.12  ? 265  LYS A O     1 
ATOM   2049  C  CB    . LYS A 1  265  ? 85.636  42.982  -30.756 1.00 90.38  ? 265  LYS A CB    1 
ATOM   2050  C  CG    . LYS A 1  265  ? 85.425  44.425  -31.237 1.00 91.67  ? 265  LYS A CG    1 
ATOM   2051  C  CD    . LYS A 1  265  ? 84.439  45.206  -30.390 1.00 94.17  ? 265  LYS A CD    1 
ATOM   2052  C  CE    . LYS A 1  265  ? 83.683  46.231  -31.180 1.00 96.63  ? 265  LYS A CE    1 
ATOM   2053  N  NZ    . LYS A 1  265  ? 82.238  46.241  -30.817 1.00 100.01 ? 265  LYS A NZ    1 
ATOM   2054  N  N     . LEU A 1  266  ? 85.826  40.810  -33.244 1.00 89.33  ? 266  LEU A N     1 
ATOM   2055  C  CA    . LEU A 1  266  ? 86.150  40.589  -34.645 1.00 89.10  ? 266  LEU A CA    1 
ATOM   2056  C  C     . LEU A 1  266  ? 84.923  40.126  -35.403 1.00 95.41  ? 266  LEU A C     1 
ATOM   2057  O  O     . LEU A 1  266  ? 84.633  40.673  -36.469 1.00 97.04  ? 266  LEU A O     1 
ATOM   2058  C  CB    . LEU A 1  266  ? 87.394  39.711  -34.872 1.00 87.85  ? 266  LEU A CB    1 
ATOM   2059  C  CG    . LEU A 1  266  ? 88.729  40.457  -34.718 1.00 90.67  ? 266  LEU A CG    1 
ATOM   2060  C  CD1   . LEU A 1  266  ? 89.889  39.513  -34.607 1.00 90.12  ? 266  LEU A CD1   1 
ATOM   2061  C  CD2   . LEU A 1  266  ? 88.961  41.414  -35.843 1.00 92.46  ? 266  LEU A CD2   1 
ATOM   2062  N  N     . ALA A 1  267  ? 84.127  39.232  -34.797 1.00 91.10  ? 267  ALA A N     1 
ATOM   2063  C  CA    . ALA A 1  267  ? 82.884  38.757  -35.412 1.00 91.11  ? 267  ALA A CA    1 
ATOM   2064  C  C     . ALA A 1  267  ? 81.873  39.896  -35.565 1.00 91.35  ? 267  ALA A C     1 
ATOM   2065  O  O     . ALA A 1  267  ? 81.128  39.929  -36.541 1.00 89.54  ? 267  ALA A O     1 
ATOM   2066  C  CB    . ALA A 1  267  ? 82.292  37.625  -34.592 1.00 91.97  ? 267  ALA A CB    1 
ATOM   2067  N  N     . ASP A 1  268  ? 81.883  40.845  -34.620 1.00 87.66  ? 268  ASP A N     1 
ATOM   2068  C  CA    . ASP A 1  268  ? 81.016  42.010  -34.689 1.00 88.87  ? 268  ASP A CA    1 
ATOM   2069  C  C     . ASP A 1  268  ? 81.387  42.784  -35.943 1.00 91.62  ? 268  ASP A C     1 
ATOM   2070  O  O     . ASP A 1  268  ? 80.495  43.093  -36.731 1.00 92.53  ? 268  ASP A O     1 
ATOM   2071  C  CB    . ASP A 1  268  ? 81.148  42.898  -33.428 1.00 91.58  ? 268  ASP A CB    1 
ATOM   2072  C  CG    . ASP A 1  268  ? 80.338  42.463  -32.203 1.00 112.95 ? 268  ASP A CG    1 
ATOM   2073  O  OD1   . ASP A 1  268  ? 79.310  41.750  -32.383 1.00 116.88 ? 268  ASP A OD1   1 
ATOM   2074  O  OD2   . ASP A 1  268  ? 80.689  42.897  -31.064 1.00 118.62 ? 268  ASP A OD2   1 
ATOM   2075  N  N     . ILE A 1  269  ? 82.709  43.011  -36.170 1.00 86.23  ? 269  ILE A N     1 
ATOM   2076  C  CA    . ILE A 1  269  ? 83.249  43.726  -37.336 1.00 86.16  ? 269  ILE A CA    1 
ATOM   2077  C  C     . ILE A 1  269  ? 82.790  43.056  -38.613 1.00 90.67  ? 269  ILE A C     1 
ATOM   2078  O  O     . ILE A 1  269  ? 82.256  43.725  -39.494 1.00 90.08  ? 269  ILE A O     1 
ATOM   2079  C  CB    . ILE A 1  269  ? 84.795  43.866  -37.290 1.00 88.62  ? 269  ILE A CB    1 
ATOM   2080  C  CG1   . ILE A 1  269  ? 85.254  44.799  -36.146 1.00 88.93  ? 269  ILE A CG1   1 
ATOM   2081  C  CG2   . ILE A 1  269  ? 85.341  44.340  -38.644 1.00 89.31  ? 269  ILE A CG2   1 
ATOM   2082  C  CD1   . ILE A 1  269  ? 86.771  44.673  -35.766 1.00 98.10  ? 269  ILE A CD1   1 
ATOM   2083  N  N     . LEU A 1  270  ? 82.992  41.728  -38.693 1.00 88.55  ? 270  LEU A N     1 
ATOM   2084  C  CA    . LEU A 1  270  ? 82.594  40.879  -39.807 1.00 89.49  ? 270  LEU A CA    1 
ATOM   2085  C  C     . LEU A 1  270  ? 81.142  41.100  -40.127 1.00 97.03  ? 270  LEU A C     1 
ATOM   2086  O  O     . LEU A 1  270  ? 80.842  41.482  -41.249 1.00 98.33  ? 270  LEU A O     1 
ATOM   2087  C  CB    . LEU A 1  270  ? 82.786  39.416  -39.420 1.00 88.97  ? 270  LEU A CB    1 
ATOM   2088  C  CG    . LEU A 1  270  ? 83.865  38.648  -40.121 1.00 93.85  ? 270  LEU A CG    1 
ATOM   2089  C  CD1   . LEU A 1  270  ? 83.502  38.341  -41.578 1.00 94.75  ? 270  LEU A CD1   1 
ATOM   2090  C  CD2   . LEU A 1  270  ? 85.206  39.299  -39.923 1.00 96.65  ? 270  LEU A CD2   1 
ATOM   2091  N  N     . LYS A 1  271  ? 80.246  40.912  -39.121 1.00 94.53  ? 271  LYS A N     1 
ATOM   2092  C  CA    . LYS A 1  271  ? 78.792  41.081  -39.227 1.00 95.53  ? 271  LYS A CA    1 
ATOM   2093  C  C     . LYS A 1  271  ? 78.405  42.482  -39.765 1.00 100.77 ? 271  LYS A C     1 
ATOM   2094  O  O     . LYS A 1  271  ? 77.664  42.589  -40.762 1.00 101.14 ? 271  LYS A O     1 
ATOM   2095  C  CB    . LYS A 1  271  ? 78.106  40.743  -37.886 1.00 97.33  ? 271  LYS A CB    1 
ATOM   2096  C  CG    . LYS A 1  271  ? 78.140  39.241  -37.549 1.00 105.78 ? 271  LYS A CG    1 
ATOM   2097  C  CD    . LYS A 1  271  ? 77.262  38.856  -36.341 1.00 115.59 ? 271  LYS A CD    1 
ATOM   2098  C  CE    . LYS A 1  271  ? 78.047  38.619  -35.068 1.00 121.80 ? 271  LYS A CE    1 
ATOM   2099  N  NZ    . LYS A 1  271  ? 77.176  38.534  -33.863 1.00 122.68 ? 271  LYS A NZ    1 
ATOM   2100  N  N     . ALA A 1  272  ? 79.003  43.539  -39.161 1.00 96.96  ? 272  ALA A N     1 
ATOM   2101  C  CA    . ALA A 1  272  ? 78.823  44.952  -39.535 1.00 97.37  ? 272  ALA A CA    1 
ATOM   2102  C  C     . ALA A 1  272  ? 79.251  45.222  -40.983 1.00 100.10 ? 272  ALA A C     1 
ATOM   2103  O  O     . ALA A 1  272  ? 78.669  46.077  -41.670 1.00 98.40  ? 272  ALA A O     1 
ATOM   2104  C  CB    . ALA A 1  272  ? 79.620  45.845  -38.586 1.00 97.38  ? 272  ALA A CB    1 
ATOM   2105  N  N     . ASN A 1  273  ? 80.303  44.491  -41.407 1.00 97.31  ? 273  ASN A N     1 
ATOM   2106  C  CA    . ASN A 1  273  ? 80.917  44.560  -42.722 1.00 98.10  ? 273  ASN A CA    1 
ATOM   2107  C  C     . ASN A 1  273  ? 80.031  43.865  -43.737 1.00 106.20 ? 273  ASN A C     1 
ATOM   2108  O  O     . ASN A 1  273  ? 79.750  44.451  -44.789 1.00 107.62 ? 273  ASN A O     1 
ATOM   2109  C  CB    . ASN A 1  273  ? 82.322  43.942  -42.701 1.00 92.33  ? 273  ASN A CB    1 
ATOM   2110  C  CG    . ASN A 1  273  ? 83.140  44.310  -43.897 1.00 104.89 ? 273  ASN A CG    1 
ATOM   2111  O  OD1   . ASN A 1  273  ? 83.501  45.472  -44.097 1.00 95.55  ? 273  ASN A OD1   1 
ATOM   2112  N  ND2   . ASN A 1  273  ? 83.413  43.335  -44.740 1.00 99.71  ? 273  ASN A ND2   1 
ATOM   2113  N  N     . ILE A 1  274  ? 79.572  42.627  -43.418 1.00 103.27 ? 274  ILE A N     1 
ATOM   2114  C  CA    . ILE A 1  274  ? 78.718  41.836  -44.302 1.00 104.23 ? 274  ILE A CA    1 
ATOM   2115  C  C     . ILE A 1  274  ? 77.444  42.598  -44.621 1.00 112.66 ? 274  ILE A C     1 
ATOM   2116  O  O     . ILE A 1  274  ? 77.088  42.684  -45.805 1.00 114.06 ? 274  ILE A O     1 
ATOM   2117  C  CB    . ILE A 1  274  ? 78.463  40.394  -43.808 1.00 106.27 ? 274  ILE A CB    1 
ATOM   2118  C  CG1   . ILE A 1  274  ? 79.787  39.631  -43.663 1.00 105.48 ? 274  ILE A CG1   1 
ATOM   2119  C  CG2   . ILE A 1  274  ? 77.565  39.659  -44.799 1.00 108.46 ? 274  ILE A CG2   1 
ATOM   2120  C  CD1   . ILE A 1  274  ? 79.795  38.469  -42.672 1.00 110.39 ? 274  ILE A CD1   1 
ATOM   2121  N  N     . SER A 1  275  ? 76.794  43.202  -43.586 1.00 109.99 ? 275  SER A N     1 
ATOM   2122  C  CA    . SER A 1  275  ? 75.576  43.993  -43.795 1.00 111.13 ? 275  SER A CA    1 
ATOM   2123  C  C     . SER A 1  275  ? 75.826  45.110  -44.834 1.00 114.98 ? 275  SER A C     1 
ATOM   2124  O  O     . SER A 1  275  ? 75.177  45.115  -45.876 1.00 114.59 ? 275  SER A O     1 
ATOM   2125  C  CB    . SER A 1  275  ? 75.040  44.547  -42.476 1.00 115.50 ? 275  SER A CB    1 
ATOM   2126  O  OG    . SER A 1  275  ? 75.823  45.616  -41.965 1.00 128.79 ? 275  SER A OG    1 
ATOM   2127  N  N     . LEU A 1  276  ? 76.846  45.963  -44.596 1.00 111.78 ? 276  LEU A N     1 
ATOM   2128  C  CA    . LEU A 1  276  ? 77.235  47.077  -45.457 1.00 112.55 ? 276  LEU A CA    1 
ATOM   2129  C  C     . LEU A 1  276  ? 77.448  46.650  -46.894 1.00 121.68 ? 276  LEU A C     1 
ATOM   2130  O  O     . LEU A 1  276  ? 76.971  47.320  -47.810 1.00 122.54 ? 276  LEU A O     1 
ATOM   2131  C  CB    . LEU A 1  276  ? 78.499  47.756  -44.911 1.00 111.08 ? 276  LEU A CB    1 
ATOM   2132  C  CG    . LEU A 1  276  ? 78.999  48.993  -45.655 1.00 115.62 ? 276  LEU A CG    1 
ATOM   2133  C  CD1   . LEU A 1  276  ? 78.045  50.177  -45.494 1.00 116.16 ? 276  LEU A CD1   1 
ATOM   2134  C  CD2   . LEU A 1  276  ? 80.364  49.383  -45.170 1.00 117.58 ? 276  LEU A CD2   1 
ATOM   2135  N  N     . GLU A 1  277  ? 78.153  45.531  -47.081 1.00 121.45 ? 277  GLU A N     1 
ATOM   2136  C  CA    . GLU A 1  277  ? 78.489  44.959  -48.383 1.00 123.62 ? 277  GLU A CA    1 
ATOM   2137  C  C     . GLU A 1  277  ? 77.215  44.621  -49.174 1.00 130.48 ? 277  GLU A C     1 
ATOM   2138  O  O     . GLU A 1  277  ? 77.040  45.127  -50.289 1.00 131.71 ? 277  GLU A O     1 
ATOM   2139  C  CB    . GLU A 1  277  ? 79.427  43.738  -48.186 1.00 124.56 ? 277  GLU A CB    1 
ATOM   2140  C  CG    . GLU A 1  277  ? 79.828  42.977  -49.443 1.00 140.00 ? 277  GLU A CG    1 
ATOM   2141  C  CD    . GLU A 1  277  ? 78.976  41.758  -49.755 1.00 172.86 ? 277  GLU A CD    1 
ATOM   2142  O  OE1   . GLU A 1  277  ? 78.774  40.909  -48.852 1.00 168.75 ? 277  GLU A OE1   1 
ATOM   2143  O  OE2   . GLU A 1  277  ? 78.517  41.649  -50.915 1.00 172.32 ? 277  GLU A OE2   1 
ATOM   2144  N  N     . THR A 1  278  ? 76.317  43.807  -48.576 1.00 127.20 ? 278  THR A N     1 
ATOM   2145  C  CA    . THR A 1  278  ? 75.061  43.389  -49.199 1.00 127.97 ? 278  THR A CA    1 
ATOM   2146  C  C     . THR A 1  278  ? 74.172  44.621  -49.437 1.00 134.02 ? 278  THR A C     1 
ATOM   2147  O  O     . THR A 1  278  ? 73.681  44.810  -50.547 1.00 134.52 ? 278  THR A O     1 
ATOM   2148  C  CB    . THR A 1  278  ? 74.403  42.223  -48.415 1.00 129.88 ? 278  THR A CB    1 
ATOM   2149  O  OG1   . THR A 1  278  ? 74.154  42.628  -47.075 1.00 127.88 ? 278  THR A OG1   1 
ATOM   2150  C  CG2   . THR A 1  278  ? 75.259  40.956  -48.394 1.00 124.92 ? 278  THR A CG2   1 
ATOM   2151  N  N     . LEU A 1  279  ? 74.080  45.515  -48.427 1.00 131.13 ? 279  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  279  ? 73.299  46.757  -48.462 1.00 131.79 ? 279  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  279  ? 73.636  47.661  -49.618 1.00 139.10 ? 279  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  279  ? 72.738  48.320  -50.130 1.00 139.90 ? 279  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  279  ? 73.427  47.531  -47.142 1.00 130.36 ? 279  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  279  ? 72.194  47.619  -46.253 1.00 134.19 ? 279  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  279  ? 71.167  48.554  -46.830 1.00 135.59 ? 279  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  279  ? 71.619  46.238  -45.913 1.00 135.21 ? 279  LEU A CD2   1 
ATOM   2159  N  N     . GLU A 1  280  ? 74.913  47.708  -50.028 1.00 137.60 ? 280  GLU A N     1 
ATOM   2160  C  CA    . GLU A 1  280  ? 75.305  48.535  -51.161 1.00 139.87 ? 280  GLU A CA    1 
ATOM   2161  C  C     . GLU A 1  280  ? 75.223  47.795  -52.490 1.00 148.65 ? 280  GLU A C     1 
ATOM   2162  O  O     . GLU A 1  280  ? 74.714  48.366  -53.461 1.00 149.80 ? 280  GLU A O     1 
ATOM   2163  C  CB    . GLU A 1  280  ? 76.628  49.291  -50.943 1.00 140.44 ? 280  GLU A CB    1 
ATOM   2164  C  CG    . GLU A 1  280  ? 77.879  48.446  -50.790 1.00 150.25 ? 280  GLU A CG    1 
ATOM   2165  C  CD    . GLU A 1  280  ? 79.027  49.200  -50.149 1.00 171.97 ? 280  GLU A CD    1 
ATOM   2166  O  OE1   . GLU A 1  280  ? 78.850  49.691  -49.011 1.00 167.98 ? 280  GLU A OE1   1 
ATOM   2167  O  OE2   . GLU A 1  280  ? 80.095  49.320  -50.790 1.00 167.86 ? 280  GLU A OE2   1 
ATOM   2168  N  N     . HIS A 1  281  ? 75.667  46.514  -52.521 1.00 147.37 ? 281  HIS A N     1 
ATOM   2169  C  CA    . HIS A 1  281  ? 75.610  45.660  -53.716 1.00 149.44 ? 281  HIS A CA    1 
ATOM   2170  C  C     . HIS A 1  281  ? 74.146  45.471  -54.164 1.00 156.29 ? 281  HIS A C     1 
ATOM   2171  O  O     . HIS A 1  281  ? 73.854  45.570  -55.360 1.00 157.45 ? 281  HIS A O     1 
ATOM   2172  C  CB    . HIS A 1  281  ? 76.306  44.295  -53.478 1.00 149.62 ? 281  HIS A CB    1 
ATOM   2173  C  CG    . HIS A 1  281  ? 76.082  43.293  -54.581 1.00 154.11 ? 281  HIS A CG    1 
ATOM   2174  N  ND1   . HIS A 1  281  ? 75.029  42.385  -54.536 1.00 156.28 ? 281  HIS A ND1   1 
ATOM   2175  C  CD2   . HIS A 1  281  ? 76.760  43.114  -55.740 1.00 156.48 ? 281  HIS A CD2   1 
ATOM   2176  C  CE1   . HIS A 1  281  ? 75.106  41.688  -55.658 1.00 156.49 ? 281  HIS A CE1   1 
ATOM   2177  N  NE2   . HIS A 1  281  ? 76.131  42.089  -56.414 1.00 157.00 ? 281  HIS A NE2   1 
ATOM   2178  N  N     . ASN A 1  282  ? 73.237  45.223  -53.193 1.00 152.96 ? 282  ASN A N     1 
ATOM   2179  C  CA    . ASN A 1  282  ? 71.805  45.041  -53.423 1.00 153.93 ? 282  ASN A CA    1 
ATOM   2180  C  C     . ASN A 1  282  ? 71.110  46.395  -53.500 1.00 160.53 ? 282  ASN A C     1 
ATOM   2181  O  O     . ASN A 1  282  ? 71.746  47.415  -53.817 1.00 159.75 ? 282  ASN A O     1 
ATOM   2182  C  CB    . ASN A 1  282  ? 71.188  44.197  -52.295 1.00 151.01 ? 282  ASN A CB    1 
ATOM   2183  C  CG    . ASN A 1  282  ? 71.273  42.711  -52.500 1.00 166.03 ? 282  ASN A CG    1 
ATOM   2184  O  OD1   . ASN A 1  282  ? 72.223  42.178  -53.089 1.00 158.25 ? 282  ASN A OD1   1 
ATOM   2185  N  ND2   . ASN A 1  282  ? 70.277  42.004  -51.995 1.00 156.86 ? 282  ASN A ND2   1 
ATOM   2186  N  N     . GLY A 1  283  ? 69.803  46.380  -53.215 1.00 159.57 ? 283  GLY A N     1 
ATOM   2187  C  CA    . GLY A 1  283  ? 68.965  47.570  -53.171 1.00 160.87 ? 283  GLY A CA    1 
ATOM   2188  C  C     . GLY A 1  283  ? 69.561  48.533  -52.171 1.00 164.25 ? 283  GLY A C     1 
ATOM   2189  O  O     . GLY A 1  283  ? 69.566  48.243  -50.967 1.00 163.40 ? 283  GLY A O     1 
ATOM   2190  N  N     . ALA A 1  284  ? 70.183  49.614  -52.692 1.00 159.80 ? 284  ALA A N     1 
ATOM   2191  C  CA    . ALA A 1  284  ? 70.876  50.624  -51.905 1.00 158.11 ? 284  ALA A CA    1 
ATOM   2192  C  C     . ALA A 1  284  ? 69.945  51.769  -51.431 1.00 161.37 ? 284  ALA A C     1 
ATOM   2193  O  O     . ALA A 1  284  ? 69.832  52.772  -52.136 1.00 161.86 ? 284  ALA A O     1 
ATOM   2194  C  CB    . ALA A 1  284  ? 72.066  51.165  -52.694 1.00 158.73 ? 284  ALA A CB    1 
ATOM   2195  N  N     . PRO A 1  285  ? 69.282  51.675  -50.241 1.00 156.79 ? 285  PRO A N     1 
ATOM   2196  C  CA    . PRO A 1  285  ? 68.406  52.769  -49.804 1.00 157.40 ? 285  PRO A CA    1 
ATOM   2197  C  C     . PRO A 1  285  ? 69.180  53.944  -49.197 1.00 162.80 ? 285  PRO A C     1 
ATOM   2198  O  O     . PRO A 1  285  ? 68.856  54.398  -48.099 1.00 162.11 ? 285  PRO A O     1 
ATOM   2199  C  CB    . PRO A 1  285  ? 67.451  52.086  -48.803 1.00 158.58 ? 285  PRO A CB    1 
ATOM   2200  C  CG    . PRO A 1  285  ? 67.831  50.623  -48.793 1.00 162.02 ? 285  PRO A CG    1 
ATOM   2201  C  CD    . PRO A 1  285  ? 69.248  50.585  -49.253 1.00 156.98 ? 285  PRO A CD    1 
ATOM   2202  N  N     . HIS A 1  286  ? 70.203  54.428  -49.942 1.00 161.11 ? 286  HIS A N     1 
ATOM   2203  C  CA    . HIS A 1  286  ? 71.123  55.560  -49.720 1.00 161.52 ? 286  HIS A CA    1 
ATOM   2204  C  C     . HIS A 1  286  ? 71.512  55.946  -48.278 1.00 161.89 ? 286  HIS A C     1 
ATOM   2205  O  O     . HIS A 1  286  ? 72.703  55.986  -47.986 1.00 160.12 ? 286  HIS A O     1 
ATOM   2206  C  CB    . HIS A 1  286  ? 70.753  56.772  -50.602 1.00 164.92 ? 286  HIS A CB    1 
ATOM   2207  C  CG    . HIS A 1  286  ? 70.458  56.422  -52.044 1.00 170.48 ? 286  HIS A CG    1 
ATOM   2208  N  ND1   . HIS A 1  286  ? 71.478  56.159  -52.957 1.00 172.57 ? 286  HIS A ND1   1 
ATOM   2209  C  CD2   . HIS A 1  286  ? 69.266  56.309  -52.685 1.00 173.97 ? 286  HIS A CD2   1 
ATOM   2210  C  CE1   . HIS A 1  286  ? 70.874  55.897  -54.110 1.00 173.30 ? 286  HIS A CE1   1 
ATOM   2211  N  NE2   . HIS A 1  286  ? 69.545  55.976  -53.998 1.00 174.49 ? 286  HIS A NE2   1 
ATOM   2212  N  N     . HIS A 1  287  ? 70.529  56.238  -47.398 1.00 157.57 ? 287  HIS A N     1 
ATOM   2213  C  CA    . HIS A 1  287  ? 70.741  56.544  -45.975 1.00 156.08 ? 287  HIS A CA    1 
ATOM   2214  C  C     . HIS A 1  287  ? 71.097  55.263  -45.181 1.00 158.30 ? 287  HIS A C     1 
ATOM   2215  O  O     . HIS A 1  287  ? 71.938  55.305  -44.278 1.00 156.64 ? 287  HIS A O     1 
ATOM   2216  C  CB    . HIS A 1  287  ? 69.508  57.246  -45.354 1.00 157.44 ? 287  HIS A CB    1 
ATOM   2217  C  CG    . HIS A 1  287  ? 69.416  57.118  -43.856 1.00 159.73 ? 287  HIS A CG    1 
ATOM   2218  N  ND1   . HIS A 1  287  ? 68.691  56.096  -43.259 1.00 161.07 ? 287  HIS A ND1   1 
ATOM   2219  C  CD2   . HIS A 1  287  ? 70.002  57.857  -42.886 1.00 160.56 ? 287  HIS A CD2   1 
ATOM   2220  C  CE1   . HIS A 1  287  ? 68.845  56.258  -41.955 1.00 159.48 ? 287  HIS A CE1   1 
ATOM   2221  N  NE2   . HIS A 1  287  ? 69.624  57.304  -41.681 1.00 159.53 ? 287  HIS A NE2   1 
ATOM   2222  N  N     . ALA A 1  288  ? 70.434  54.134  -45.503 1.00 154.63 ? 288  ALA A N     1 
ATOM   2223  C  CA    . ALA A 1  288  ? 70.642  52.834  -44.850 1.00 152.96 ? 288  ALA A CA    1 
ATOM   2224  C  C     . ALA A 1  288  ? 72.092  52.345  -44.951 1.00 153.69 ? 288  ALA A C     1 
ATOM   2225  O  O     . ALA A 1  288  ? 72.491  51.449  -44.200 1.00 152.04 ? 288  ALA A O     1 
ATOM   2226  C  CB    . ALA A 1  288  ? 69.698  51.802  -45.440 1.00 154.53 ? 288  ALA A CB    1 
ATOM   2227  N  N     . ILE A 1  289  ? 72.871  52.954  -45.866 1.00 148.89 ? 289  ILE A N     1 
ATOM   2228  C  CA    . ILE A 1  289  ? 74.277  52.648  -46.100 1.00 147.21 ? 289  ILE A CA    1 
ATOM   2229  C  C     . ILE A 1  289  ? 75.160  53.466  -45.159 1.00 149.81 ? 289  ILE A C     1 
ATOM   2230  O  O     . ILE A 1  289  ? 76.003  52.881  -44.470 1.00 148.58 ? 289  ILE A O     1 
ATOM   2231  C  CB    . ILE A 1  289  ? 74.651  52.771  -47.603 1.00 150.82 ? 289  ILE A CB    1 
ATOM   2232  C  CG1   . ILE A 1  289  ? 73.903  51.713  -48.442 1.00 151.77 ? 289  ILE A CG1   1 
ATOM   2233  C  CG2   . ILE A 1  289  ? 76.165  52.648  -47.829 1.00 150.58 ? 289  ILE A CG2   1 
ATOM   2234  C  CD1   . ILE A 1  289  ? 72.630  52.168  -49.014 1.00 159.00 ? 289  ILE A CD1   1 
ATOM   2235  N  N     . GLU A 1  290  ? 74.929  54.802  -45.079 1.00 146.17 ? 290  GLU A N     1 
ATOM   2236  C  CA    . GLU A 1  290  ? 75.669  55.705  -44.174 1.00 144.98 ? 290  GLU A CA    1 
ATOM   2237  C  C     . GLU A 1  290  ? 75.423  55.324  -42.708 1.00 144.62 ? 290  GLU A C     1 
ATOM   2238  O  O     . GLU A 1  290  ? 76.195  55.684  -41.823 1.00 143.09 ? 290  GLU A O     1 
ATOM   2239  C  CB    . GLU A 1  290  ? 75.416  57.210  -44.483 1.00 147.78 ? 290  GLU A CB    1 
ATOM   2240  C  CG    . GLU A 1  290  ? 73.962  57.680  -44.459 1.00 164.24 ? 290  GLU A CG    1 
ATOM   2241  C  CD    . GLU A 1  290  ? 73.513  58.713  -45.488 1.00 192.02 ? 290  GLU A CD    1 
ATOM   2242  O  OE1   . GLU A 1  290  ? 73.592  58.433  -46.708 1.00 181.95 ? 290  GLU A OE1   1 
ATOM   2243  O  OE2   . GLU A 1  290  ? 72.968  59.758  -45.062 1.00 189.70 ? 290  GLU A OE2   1 
ATOM   2244  N  N     . GLU A 1  291  ? 74.371  54.524  -42.494 1.00 139.26 ? 291  GLU A N     1 
ATOM   2245  C  CA    . GLU A 1  291  ? 73.959  53.923  -41.244 1.00 137.54 ? 291  GLU A CA    1 
ATOM   2246  C  C     . GLU A 1  291  ? 74.965  52.791  -40.956 1.00 137.77 ? 291  GLU A C     1 
ATOM   2247  O  O     . GLU A 1  291  ? 75.837  52.974  -40.105 1.00 136.33 ? 291  GLU A O     1 
ATOM   2248  C  CB    . GLU A 1  291  ? 72.537  53.359  -41.417 1.00 139.93 ? 291  GLU A CB    1 
ATOM   2249  C  CG    . GLU A 1  291  ? 71.901  52.849  -40.141 1.00 153.07 ? 291  GLU A CG    1 
ATOM   2250  C  CD    . GLU A 1  291  ? 70.907  53.818  -39.541 1.00 183.84 ? 291  GLU A CD    1 
ATOM   2251  O  OE1   . GLU A 1  291  ? 71.321  54.939  -39.167 1.00 182.26 ? 291  GLU A OE1   1 
ATOM   2252  O  OE2   . GLU A 1  291  ? 69.707  53.469  -39.471 1.00 184.98 ? 291  GLU A OE2   1 
ATOM   2253  N  N     . ALA A 1  292  ? 74.882  51.656  -41.715 1.00 132.56 ? 292  ALA A N     1 
ATOM   2254  C  CA    . ALA A 1  292  ? 75.740  50.461  -41.584 1.00 130.40 ? 292  ALA A CA    1 
ATOM   2255  C  C     . ALA A 1  292  ? 77.228  50.753  -41.660 1.00 131.31 ? 292  ALA A C     1 
ATOM   2256  O  O     . ALA A 1  292  ? 78.015  50.008  -41.061 1.00 129.93 ? 292  ALA A O     1 
ATOM   2257  C  CB    . ALA A 1  292  ? 75.362  49.409  -42.609 1.00 131.59 ? 292  ALA A CB    1 
ATOM   2258  N  N     . GLU A 1  293  ? 77.609  51.837  -42.389 1.00 126.16 ? 293  GLU A N     1 
ATOM   2259  C  CA    . GLU A 1  293  ? 78.993  52.301  -42.503 1.00 124.19 ? 293  GLU A CA    1 
ATOM   2260  C  C     . GLU A 1  293  ? 79.451  52.804  -41.128 1.00 124.49 ? 293  GLU A C     1 
ATOM   2261  O  O     . GLU A 1  293  ? 80.442  52.295  -40.599 1.00 123.66 ? 293  GLU A O     1 
ATOM   2262  C  CB    . GLU A 1  293  ? 79.149  53.399  -43.579 1.00 126.36 ? 293  GLU A CB    1 
ATOM   2263  C  CG    . GLU A 1  293  ? 80.606  53.763  -43.843 1.00 136.45 ? 293  GLU A CG    1 
ATOM   2264  C  CD    . GLU A 1  293  ? 80.924  54.670  -45.019 1.00 156.03 ? 293  GLU A CD    1 
ATOM   2265  O  OE1   . GLU A 1  293  ? 79.988  55.057  -45.759 1.00 146.15 ? 293  GLU A OE1   1 
ATOM   2266  O  OE2   . GLU A 1  293  ? 82.125  54.981  -45.208 1.00 144.24 ? 293  GLU A OE2   1 
ATOM   2267  N  N     . SER A 1  294  ? 78.689  53.746  -40.525 1.00 118.09 ? 294  SER A N     1 
ATOM   2268  C  CA    . SER A 1  294  ? 78.986  54.326  -39.213 1.00 115.27 ? 294  SER A CA    1 
ATOM   2269  C  C     . SER A 1  294  ? 79.072  53.298  -38.102 1.00 112.64 ? 294  SER A C     1 
ATOM   2270  O  O     . SER A 1  294  ? 79.848  53.493  -37.169 1.00 111.45 ? 294  SER A O     1 
ATOM   2271  C  CB    . SER A 1  294  ? 77.999  55.430  -38.864 1.00 120.68 ? 294  SER A CB    1 
ATOM   2272  O  OG    . SER A 1  294  ? 78.235  56.586  -39.653 1.00 133.10 ? 294  SER A OG    1 
ATOM   2273  N  N     . LEU A 1  295  ? 78.325  52.190  -38.225 1.00 105.37 ? 295  LEU A N     1 
ATOM   2274  C  CA    . LEU A 1  295  ? 78.377  51.092  -37.265 1.00 102.86 ? 295  LEU A CA    1 
ATOM   2275  C  C     . LEU A 1  295  ? 79.690  50.290  -37.428 1.00 103.65 ? 295  LEU A C     1 
ATOM   2276  O  O     . LEU A 1  295  ? 80.300  49.892  -36.423 1.00 102.04 ? 295  LEU A O     1 
ATOM   2277  C  CB    . LEU A 1  295  ? 77.159  50.190  -37.437 1.00 103.12 ? 295  LEU A CB    1 
ATOM   2278  C  CG    . LEU A 1  295  ? 77.299  48.758  -36.944 1.00 106.96 ? 295  LEU A CG    1 
ATOM   2279  C  CD1   . LEU A 1  295  ? 77.009  48.641  -35.450 1.00 106.04 ? 295  LEU A CD1   1 
ATOM   2280  C  CD2   . LEU A 1  295  ? 76.444  47.829  -37.764 1.00 111.73 ? 295  LEU A CD2   1 
ATOM   2281  N  N     . LEU A 1  296  ? 80.110  50.043  -38.697 1.00 98.27  ? 296  LEU A N     1 
ATOM   2282  C  CA    . LEU A 1  296  ? 81.362  49.340  -38.998 1.00 95.80  ? 296  LEU A CA    1 
ATOM   2283  C  C     . LEU A 1  296  ? 82.508  50.189  -38.483 1.00 99.58  ? 296  LEU A C     1 
ATOM   2284  O  O     . LEU A 1  296  ? 83.396  49.645  -37.834 1.00 99.46  ? 296  LEU A O     1 
ATOM   2285  C  CB    . LEU A 1  296  ? 81.528  49.070  -40.503 1.00 95.50  ? 296  LEU A CB    1 
ATOM   2286  C  CG    . LEU A 1  296  ? 82.883  48.537  -40.973 1.00 97.43  ? 296  LEU A CG    1 
ATOM   2287  C  CD1   . LEU A 1  296  ? 83.042  47.082  -40.632 1.00 96.11  ? 296  LEU A CD1   1 
ATOM   2288  C  CD2   . LEU A 1  296  ? 83.054  48.729  -42.460 1.00 99.43  ? 296  LEU A CD2   1 
ATOM   2289  N  N     . GLN A 1  297  ? 82.462  51.524  -38.717 1.00 95.38  ? 297  GLN A N     1 
ATOM   2290  C  CA    . GLN A 1  297  ? 83.478  52.434  -38.209 1.00 94.43  ? 297  GLN A CA    1 
ATOM   2291  C  C     . GLN A 1  297  ? 83.581  52.287  -36.695 1.00 99.32  ? 297  GLN A C     1 
ATOM   2292  O  O     . GLN A 1  297  ? 84.686  52.116  -36.186 1.00 99.34  ? 297  GLN A O     1 
ATOM   2293  C  CB    . GLN A 1  297  ? 83.190  53.883  -38.618 1.00 96.20  ? 297  GLN A CB    1 
ATOM   2294  C  CG    . GLN A 1  297  ? 83.955  54.979  -37.843 1.00 101.73 ? 297  GLN A CG    1 
ATOM   2295  C  CD    . GLN A 1  297  ? 85.445  54.950  -38.055 1.00 110.94 ? 297  GLN A CD    1 
ATOM   2296  O  OE1   . GLN A 1  297  ? 85.996  55.567  -38.975 1.00 107.19 ? 297  GLN A OE1   1 
ATOM   2297  N  NE2   . GLN A 1  297  ? 86.135  54.278  -37.163 1.00 98.89  ? 297  GLN A NE2   1 
ATOM   2298  N  N     . PHE A 1  298  ? 82.437  52.269  -35.992 1.00 95.76  ? 298  PHE A N     1 
ATOM   2299  C  CA    . PHE A 1  298  ? 82.397  52.101  -34.543 1.00 94.75  ? 298  PHE A CA    1 
ATOM   2300  C  C     . PHE A 1  298  ? 83.106  50.824  -34.064 1.00 98.48  ? 298  PHE A C     1 
ATOM   2301  O  O     . PHE A 1  298  ? 83.904  50.886  -33.124 1.00 96.54  ? 298  PHE A O     1 
ATOM   2302  C  CB    . PHE A 1  298  ? 80.948  52.124  -34.051 1.00 96.82  ? 298  PHE A CB    1 
ATOM   2303  C  CG    . PHE A 1  298  ? 80.779  51.701  -32.613 1.00 97.54  ? 298  PHE A CG    1 
ATOM   2304  C  CD1   . PHE A 1  298  ? 80.971  52.609  -31.577 1.00 100.58 ? 298  PHE A CD1   1 
ATOM   2305  C  CD2   . PHE A 1  298  ? 80.434  50.394  -32.293 1.00 99.28  ? 298  PHE A CD2   1 
ATOM   2306  C  CE1   . PHE A 1  298  ? 80.812  52.219  -30.245 1.00 100.88 ? 298  PHE A CE1   1 
ATOM   2307  C  CE2   . PHE A 1  298  ? 80.294  49.998  -30.961 1.00 101.78 ? 298  PHE A CE2   1 
ATOM   2308  C  CZ    . PHE A 1  298  ? 80.475  50.916  -29.946 1.00 99.72  ? 298  PHE A CZ    1 
ATOM   2309  N  N     . HIS A 1  299  ? 82.782  49.673  -34.676 1.00 96.83  ? 299  HIS A N     1 
ATOM   2310  C  CA    . HIS A 1  299  ? 83.370  48.385  -34.301 1.00 96.88  ? 299  HIS A CA    1 
ATOM   2311  C  C     . HIS A 1  299  ? 84.887  48.319  -34.468 1.00 101.14 ? 299  HIS A C     1 
ATOM   2312  O  O     . HIS A 1  299  ? 85.577  47.851  -33.559 1.00 100.15 ? 299  HIS A O     1 
ATOM   2313  C  CB    . HIS A 1  299  ? 82.685  47.230  -35.030 1.00 98.28  ? 299  HIS A CB    1 
ATOM   2314  C  CG    . HIS A 1  299  ? 81.369  46.837  -34.446 1.00 102.18 ? 299  HIS A CG    1 
ATOM   2315  N  ND1   . HIS A 1  299  ? 80.999  47.221  -33.171 1.00 103.72 ? 299  HIS A ND1   1 
ATOM   2316  C  CD2   . HIS A 1  299  ? 80.390  46.069  -34.977 1.00 104.87 ? 299  HIS A CD2   1 
ATOM   2317  C  CE1   . HIS A 1  299  ? 79.799  46.701  -32.981 1.00 103.94 ? 299  HIS A CE1   1 
ATOM   2318  N  NE2   . HIS A 1  299  ? 79.393  45.996  -34.040 1.00 104.82 ? 299  HIS A NE2   1 
ATOM   2319  N  N     . VAL A 1  300  ? 85.398  48.828  -35.606 1.00 98.09  ? 300  VAL A N     1 
ATOM   2320  C  CA    . VAL A 1  300  ? 86.823  48.901  -35.936 1.00 97.33  ? 300  VAL A CA    1 
ATOM   2321  C  C     . VAL A 1  300  ? 87.522  49.953  -35.023 1.00 101.93 ? 300  VAL A C     1 
ATOM   2322  O  O     . VAL A 1  300  ? 88.720  49.836  -34.740 1.00 100.95 ? 300  VAL A O     1 
ATOM   2323  C  CB    . VAL A 1  300  ? 87.006  49.127  -37.459 1.00 101.45 ? 300  VAL A CB    1 
ATOM   2324  C  CG1   . VAL A 1  300  ? 88.465  49.341  -37.835 1.00 101.18 ? 300  VAL A CG1   1 
ATOM   2325  C  CG2   . VAL A 1  300  ? 86.437  47.952  -38.239 1.00 101.28 ? 300  VAL A CG2   1 
ATOM   2326  N  N     . ALA A 1  301  ? 86.745  50.924  -34.497 1.00 99.33  ? 301  ALA A N     1 
ATOM   2327  C  CA    . ALA A 1  301  ? 87.250  51.910  -33.543 1.00 98.54  ? 301  ALA A CA    1 
ATOM   2328  C  C     . ALA A 1  301  ? 87.401  51.228  -32.163 1.00 99.93  ? 301  ALA A C     1 
ATOM   2329  O  O     . ALA A 1  301  ? 88.529  50.991  -31.719 1.00 97.62  ? 301  ALA A O     1 
ATOM   2330  C  CB    . ALA A 1  301  ? 86.316  53.118  -33.464 1.00 99.96  ? 301  ALA A CB    1 
ATOM   2331  N  N     . THR A 1  302  ? 86.269  50.806  -31.558 1.00 96.39  ? 302  THR A N     1 
ATOM   2332  C  CA    . THR A 1  302  ? 86.213  50.139  -30.252 1.00 95.63  ? 302  THR A CA    1 
ATOM   2333  C  C     . THR A 1  302  ? 87.016  48.823  -30.104 1.00 99.90  ? 302  THR A C     1 
ATOM   2334  O  O     . THR A 1  302  ? 87.251  48.377  -28.978 1.00 99.86  ? 302  THR A O     1 
ATOM   2335  C  CB    . THR A 1  302  ? 84.785  50.084  -29.721 1.00 100.69 ? 302  THR A CB    1 
ATOM   2336  O  OG1   . THR A 1  302  ? 83.963  49.443  -30.692 1.00 100.14 ? 302  THR A OG1   1 
ATOM   2337  C  CG2   . THR A 1  302  ? 84.239  51.469  -29.374 1.00 98.22  ? 302  THR A CG2   1 
ATOM   2338  N  N     . TYR A 1  303  ? 87.456  48.220  -31.226 1.00 95.31  ? 303  TYR A N     1 
ATOM   2339  C  CA    . TYR A 1  303  ? 88.294  47.016  -31.222 1.00 93.25  ? 303  TYR A CA    1 
ATOM   2340  C  C     . TYR A 1  303  ? 89.699  47.428  -30.783 1.00 97.93  ? 303  TYR A C     1 
ATOM   2341  O  O     . TYR A 1  303  ? 90.247  46.839  -29.848 1.00 98.36  ? 303  TYR A O     1 
ATOM   2342  C  CB    . TYR A 1  303  ? 88.254  46.371  -32.614 1.00 92.80  ? 303  TYR A CB    1 
ATOM   2343  C  CG    . TYR A 1  303  ? 89.374  45.449  -33.039 1.00 91.42  ? 303  TYR A CG    1 
ATOM   2344  C  CD1   . TYR A 1  303  ? 89.463  44.152  -32.543 1.00 91.93  ? 303  TYR A CD1   1 
ATOM   2345  C  CD2   . TYR A 1  303  ? 90.192  45.782  -34.109 1.00 92.25  ? 303  TYR A CD2   1 
ATOM   2346  C  CE1   . TYR A 1  303  ? 90.407  43.247  -33.040 1.00 91.30  ? 303  TYR A CE1   1 
ATOM   2347  C  CE2   . TYR A 1  303  ? 91.135  44.890  -34.614 1.00 92.56  ? 303  TYR A CE2   1 
ATOM   2348  C  CZ    . TYR A 1  303  ? 91.243  43.624  -34.080 1.00 95.73  ? 303  TYR A CZ    1 
ATOM   2349  O  OH    . TYR A 1  303  ? 92.218  42.805  -34.605 1.00 92.48  ? 303  TYR A OH    1 
ATOM   2350  N  N     . MET A 1  304  ? 90.207  48.524  -31.362 1.00 93.61  ? 304  MET A N     1 
ATOM   2351  C  CA    . MET A 1  304  ? 91.523  49.070  -31.066 1.00 92.70  ? 304  MET A CA    1 
ATOM   2352  C  C     . MET A 1  304  ? 91.558  49.912  -29.792 1.00 97.09  ? 304  MET A C     1 
ATOM   2353  O  O     . MET A 1  304  ? 92.513  49.807  -29.036 1.00 95.03  ? 304  MET A O     1 
ATOM   2354  C  CB    . MET A 1  304  ? 92.059  49.809  -32.283 1.00 95.41  ? 304  MET A CB    1 
ATOM   2355  C  CG    . MET A 1  304  ? 91.955  48.962  -33.530 1.00 99.45  ? 304  MET A CG    1 
ATOM   2356  S  SD    . MET A 1  304  ? 92.985  49.449  -34.916 1.00 104.21 ? 304  MET A SD    1 
ATOM   2357  C  CE    . MET A 1  304  ? 92.051  50.873  -35.514 1.00 101.96 ? 304  MET A CE    1 
ATOM   2358  N  N     . ASP A 1  305  ? 90.511  50.722  -29.540 1.00 96.14  ? 305  ASP A N     1 
ATOM   2359  C  CA    . ASP A 1  305  ? 90.351  51.539  -28.323 1.00 95.92  ? 305  ASP A CA    1 
ATOM   2360  C  C     . ASP A 1  305  ? 88.870  51.670  -27.916 1.00 100.12 ? 305  ASP A C     1 
ATOM   2361  O  O     . ASP A 1  305  ? 88.098  52.292  -28.631 1.00 100.35 ? 305  ASP A O     1 
ATOM   2362  C  CB    . ASP A 1  305  ? 91.032  52.915  -28.446 1.00 97.60  ? 305  ASP A CB    1 
ATOM   2363  C  CG    . ASP A 1  305  ? 90.855  53.816  -27.230 1.00 104.18 ? 305  ASP A CG    1 
ATOM   2364  O  OD1   . ASP A 1  305  ? 90.594  53.283  -26.121 1.00 103.80 ? 305  ASP A OD1   1 
ATOM   2365  O  OD2   . ASP A 1  305  ? 91.037  55.046  -27.371 1.00 109.63 ? 305  ASP A OD2   1 
ATOM   2366  N  N     . ASN A 1  306  ? 88.488  51.090  -26.769 1.00 96.64  ? 306  ASN A N     1 
ATOM   2367  C  CA    . ASN A 1  306  ? 87.107  51.115  -26.287 1.00 97.13  ? 306  ASN A CA    1 
ATOM   2368  C  C     . ASN A 1  306  ? 86.790  52.325  -25.478 1.00 105.62 ? 306  ASN A C     1 
ATOM   2369  O  O     . ASN A 1  306  ? 85.641  52.759  -25.461 1.00 107.36 ? 306  ASN A O     1 
ATOM   2370  C  CB    . ASN A 1  306  ? 86.788  49.899  -25.450 1.00 92.62  ? 306  ASN A CB    1 
ATOM   2371  C  CG    . ASN A 1  306  ? 85.335  49.536  -25.517 1.00 107.95 ? 306  ASN A CG    1 
ATOM   2372  O  OD1   . ASN A 1  306  ? 84.559  50.110  -26.281 1.00 98.55  ? 306  ASN A OD1   1 
ATOM   2373  N  ND2   . ASN A 1  306  ? 84.944  48.518  -24.777 1.00 103.83 ? 306  ASN A ND2   1 
ATOM   2374  N  N     . ASP A 1  307  ? 87.806  52.855  -24.793 1.00 103.58 ? 307  ASP A N     1 
ATOM   2375  C  CA    . ASP A 1  307  ? 87.773  53.994  -23.874 1.00 104.19 ? 307  ASP A CA    1 
ATOM   2376  C  C     . ASP A 1  307  ? 88.034  55.360  -24.607 1.00 107.29 ? 307  ASP A C     1 
ATOM   2377  O  O     . ASP A 1  307  ? 89.044  56.045  -24.362 1.00 106.60 ? 307  ASP A O     1 
ATOM   2378  C  CB    . ASP A 1  307  ? 88.741  53.699  -22.704 1.00 106.27 ? 307  ASP A CB    1 
ATOM   2379  C  CG    . ASP A 1  307  ? 89.278  52.260  -22.745 1.00 126.82 ? 307  ASP A CG    1 
ATOM   2380  O  OD1   . ASP A 1  307  ? 88.500  51.319  -22.425 1.00 128.48 ? 307  ASP A OD1   1 
ATOM   2381  O  OD2   . ASP A 1  307  ? 90.424  52.062  -23.235 1.00 135.54 ? 307  ASP A OD2   1 
ATOM   2382  N  N     . ILE A 1  308  ? 87.080  55.733  -25.511 1.00 102.83 ? 308  ILE A N     1 
ATOM   2383  C  CA    . ILE A 1  308  ? 87.093  56.950  -26.339 1.00 102.51 ? 308  ILE A CA    1 
ATOM   2384  C  C     . ILE A 1  308  ? 86.273  58.061  -25.691 1.00 111.95 ? 308  ILE A C     1 
ATOM   2385  O  O     . ILE A 1  308  ? 85.248  57.767  -25.070 1.00 112.83 ? 308  ILE A O     1 
ATOM   2386  C  CB    . ILE A 1  308  ? 86.581  56.675  -27.784 1.00 104.35 ? 308  ILE A CB    1 
ATOM   2387  C  CG1   . ILE A 1  308  ? 86.983  55.276  -28.294 1.00 103.40 ? 308  ILE A CG1   1 
ATOM   2388  C  CG2   . ILE A 1  308  ? 87.049  57.767  -28.735 1.00 104.32 ? 308  ILE A CG2   1 
ATOM   2389  C  CD1   . ILE A 1  308  ? 86.446  54.859  -29.659 1.00 106.44 ? 308  ILE A CD1   1 
ATOM   2390  N  N     . ALA A 1  309  ? 86.707  59.335  -25.877 1.00 111.77 ? 309  ALA A N     1 
ATOM   2391  C  CA    . ALA A 1  309  ? 86.069  60.580  -25.418 1.00 114.07 ? 309  ALA A CA    1 
ATOM   2392  C  C     . ALA A 1  309  ? 84.548  60.611  -25.722 1.00 123.98 ? 309  ALA A C     1 
ATOM   2393  O  O     . ALA A 1  309  ? 83.731  60.814  -24.806 1.00 123.09 ? 309  ALA A O     1 
ATOM   2394  C  CB    . ALA A 1  309  ? 86.749  61.761  -26.091 1.00 115.28 ? 309  ALA A CB    1 
ATOM   2395  N  N     . GLY A 1  310  ? 84.212  60.383  -27.009 1.00 125.43 ? 310  GLY A N     1 
ATOM   2396  C  CA    . GLY A 1  310  ? 82.859  60.261  -27.560 1.00 127.50 ? 310  GLY A CA    1 
ATOM   2397  C  C     . GLY A 1  310  ? 82.183  59.045  -26.960 1.00 133.78 ? 310  GLY A C     1 
ATOM   2398  O  O     . GLY A 1  310  ? 82.034  57.985  -27.593 1.00 131.32 ? 310  GLY A O     1 
ATOM   2399  N  N     . GLN A 1  311  ? 81.855  59.241  -25.675 1.00 134.16 ? 311  GLN A N     1 
ATOM   2400  C  CA    . GLN A 1  311  ? 81.278  58.410  -24.631 1.00 135.72 ? 311  GLN A CA    1 
ATOM   2401  C  C     . GLN A 1  311  ? 80.790  56.946  -24.886 1.00 141.64 ? 311  GLN A C     1 
ATOM   2402  O  O     . GLN A 1  311  ? 81.227  56.081  -24.115 1.00 142.04 ? 311  GLN A O     1 
ATOM   2403  C  CB    . GLN A 1  311  ? 80.256  59.226  -23.818 1.00 138.29 ? 311  GLN A CB    1 
ATOM   2404  C  CG    . GLN A 1  311  ? 80.621  59.399  -22.349 1.00 159.86 ? 311  GLN A CG    1 
ATOM   2405  C  CD    . GLN A 1  311  ? 79.379  59.367  -21.488 1.00 182.95 ? 311  GLN A CD    1 
ATOM   2406  O  OE1   . GLN A 1  311  ? 78.900  58.296  -21.083 1.00 177.26 ? 311  GLN A OE1   1 
ATOM   2407  N  NE2   . GLN A 1  311  ? 78.811  60.539  -21.218 1.00 176.61 ? 311  GLN A NE2   1 
ATOM   2408  N  N     . PRO A 1  312  ? 79.848  56.629  -25.828 1.00 137.74 ? 312  PRO A N     1 
ATOM   2409  C  CA    . PRO A 1  312  ? 79.346  55.245  -25.946 1.00 136.27 ? 312  PRO A CA    1 
ATOM   2410  C  C     . PRO A 1  312  ? 80.392  54.153  -25.955 1.00 135.48 ? 312  PRO A C     1 
ATOM   2411  O  O     . PRO A 1  312  ? 81.099  53.981  -26.948 1.00 135.91 ? 312  PRO A O     1 
ATOM   2412  C  CB    . PRO A 1  312  ? 78.553  55.268  -27.259 1.00 139.28 ? 312  PRO A CB    1 
ATOM   2413  C  CG    . PRO A 1  312  ? 79.002  56.538  -27.961 1.00 144.98 ? 312  PRO A CG    1 
ATOM   2414  C  CD    . PRO A 1  312  ? 79.170  57.483  -26.819 1.00 140.59 ? 312  PRO A CD    1 
ATOM   2415  N  N     . GLN A 1  313  ? 80.513  53.443  -24.832 1.00 127.47 ? 313  GLN A N     1 
ATOM   2416  C  CA    . GLN A 1  313  ? 81.469  52.355  -24.726 1.00 124.63 ? 313  GLN A CA    1 
ATOM   2417  C  C     . GLN A 1  313  ? 80.820  51.100  -25.273 1.00 126.79 ? 313  GLN A C     1 
ATOM   2418  O  O     . GLN A 1  313  ? 79.633  50.887  -25.050 1.00 126.66 ? 313  GLN A O     1 
ATOM   2419  C  CB    . GLN A 1  313  ? 81.909  52.162  -23.276 1.00 124.68 ? 313  GLN A CB    1 
ATOM   2420  C  CG    . GLN A 1  313  ? 83.285  51.541  -23.155 1.00 121.04 ? 313  GLN A CG    1 
ATOM   2421  C  CD    . GLN A 1  313  ? 83.944  51.949  -21.871 1.00 123.83 ? 313  GLN A CD    1 
ATOM   2422  O  OE1   . GLN A 1  313  ? 83.682  51.390  -20.810 1.00 109.76 ? 313  GLN A OE1   1 
ATOM   2423  N  NE2   . GLN A 1  313  ? 84.799  52.955  -21.933 1.00 120.77 ? 313  GLN A NE2   1 
ATOM   2424  N  N     . ALA A 1  314  ? 81.571  50.304  -26.039 1.00 122.38 ? 314  ALA A N     1 
ATOM   2425  C  CA    . ALA A 1  314  ? 81.060  49.061  -26.593 1.00 122.28 ? 314  ALA A CA    1 
ATOM   2426  C  C     . ALA A 1  314  ? 81.018  48.062  -25.430 1.00 128.03 ? 314  ALA A C     1 
ATOM   2427  O  O     . ALA A 1  314  ? 82.069  47.631  -24.940 1.00 127.17 ? 314  ALA A O     1 
ATOM   2428  C  CB    . ALA A 1  314  ? 81.971  48.571  -27.706 1.00 122.41 ? 314  ALA A CB    1 
ATOM   2429  N  N     . LEU A 1  315  ? 79.807  47.778  -24.919 1.00 126.16 ? 315  LEU A N     1 
ATOM   2430  C  CA    . LEU A 1  315  ? 79.642  46.880  -23.772 1.00 126.01 ? 315  LEU A CA    1 
ATOM   2431  C  C     . LEU A 1  315  ? 79.209  45.492  -24.199 1.00 131.80 ? 315  LEU A C     1 
ATOM   2432  O  O     . LEU A 1  315  ? 78.250  45.368  -24.967 1.00 132.07 ? 315  LEU A O     1 
ATOM   2433  C  CB    . LEU A 1  315  ? 78.657  47.426  -22.716 1.00 126.39 ? 315  LEU A CB    1 
ATOM   2434  C  CG    . LEU A 1  315  ? 78.398  48.924  -22.669 1.00 131.79 ? 315  LEU A CG    1 
ATOM   2435  C  CD1   . LEU A 1  315  ? 77.133  49.288  -23.448 1.00 133.08 ? 315  LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A 1  315  ? 78.260  49.397  -21.247 1.00 134.33 ? 315  LEU A CD2   1 
ATOM   2437  N  N     . GLN A 1  316  ? 79.911  44.445  -23.682 1.00 129.16 ? 316  GLN A N     1 
ATOM   2438  C  CA    . GLN A 1  316  ? 79.627  43.018  -23.904 1.00 129.69 ? 316  GLN A CA    1 
ATOM   2439  C  C     . GLN A 1  316  ? 78.238  42.743  -23.312 1.00 138.42 ? 316  GLN A C     1 
ATOM   2440  O  O     . GLN A 1  316  ? 77.869  43.398  -22.329 1.00 138.88 ? 316  GLN A O     1 
ATOM   2441  C  CB    . GLN A 1  316  ? 80.698  42.157  -23.193 1.00 129.71 ? 316  GLN A CB    1 
ATOM   2442  C  CG    . GLN A 1  316  ? 80.493  40.644  -23.252 1.00 149.22 ? 316  GLN A CG    1 
ATOM   2443  C  CD    . GLN A 1  316  ? 81.257  39.964  -24.369 1.00 177.53 ? 316  GLN A CD    1 
ATOM   2444  O  OE1   . GLN A 1  316  ? 82.334  40.413  -24.805 1.00 172.56 ? 316  GLN A OE1   1 
ATOM   2445  N  NE2   . GLN A 1  316  ? 80.742  38.819  -24.816 1.00 171.98 ? 316  GLN A NE2   1 
ATOM   2446  N  N     . LYS A 1  317  ? 77.448  41.821  -23.919 1.00 137.38 ? 317  LYS A N     1 
ATOM   2447  C  CA    . LYS A 1  317  ? 76.121  41.479  -23.388 1.00 138.23 ? 317  LYS A CA    1 
ATOM   2448  C  C     . LYS A 1  317  ? 76.414  40.866  -22.025 1.00 141.05 ? 317  LYS A C     1 
ATOM   2449  O  O     . LYS A 1  317  ? 76.924  39.744  -21.950 1.00 139.75 ? 317  LYS A O     1 
ATOM   2450  C  CB    . LYS A 1  317  ? 75.372  40.506  -24.321 1.00 141.78 ? 317  LYS A CB    1 
ATOM   2451  C  CG    . LYS A 1  317  ? 73.856  40.738  -24.373 1.00 159.53 ? 317  LYS A CG    1 
ATOM   2452  C  CD    . LYS A 1  317  ? 73.163  39.770  -25.354 1.00 171.09 ? 317  LYS A CD    1 
ATOM   2453  C  CE    . LYS A 1  317  ? 71.657  39.934  -25.411 1.00 181.60 ? 317  LYS A CE    1 
ATOM   2454  N  NZ    . LYS A 1  317  ? 71.007  38.915  -26.285 1.00 187.40 ? 317  LYS A NZ    1 
ATOM   2455  N  N     . SER A 1  318  ? 76.279  41.720  -20.979 1.00 137.46 ? 318  SER A N     1 
ATOM   2456  C  CA    . SER A 1  318  ? 76.567  41.538  -19.542 1.00 136.85 ? 318  SER A CA    1 
ATOM   2457  C  C     . SER A 1  318  ? 76.809  42.925  -18.899 1.00 141.09 ? 318  SER A C     1 
ATOM   2458  O  O     . SER A 1  318  ? 76.936  43.029  -17.675 1.00 141.35 ? 318  SER A O     1 
ATOM   2459  C  CB    . SER A 1  318  ? 77.794  40.644  -19.301 1.00 138.85 ? 318  SER A CB    1 
ATOM   2460  O  OG    . SER A 1  318  ? 79.039  41.238  -19.642 1.00 144.38 ? 318  SER A OG    1 
ATOM   2461  N  N     . GLY A 1  319  ? 76.905  43.964  -19.734 1.00 136.59 ? 319  GLY A N     1 
ATOM   2462  C  CA    . GLY A 1  319  ? 77.162  45.333  -19.290 1.00 135.63 ? 319  GLY A CA    1 
ATOM   2463  C  C     . GLY A 1  319  ? 78.636  45.664  -19.196 1.00 135.93 ? 319  GLY A C     1 
ATOM   2464  O  O     . GLY A 1  319  ? 79.031  46.819  -19.396 1.00 135.50 ? 319  GLY A O     1 
ATOM   2465  N  N     . ARG A 1  320  ? 79.457  44.635  -18.878 1.00 129.08 ? 320  ARG A N     1 
ATOM   2466  C  CA    . ARG A 1  320  ? 80.913  44.691  -18.775 1.00 126.33 ? 320  ARG A CA    1 
ATOM   2467  C  C     . ARG A 1  320  ? 81.445  45.111  -20.164 1.00 123.78 ? 320  ARG A C     1 
ATOM   2468  O  O     . ARG A 1  320  ? 80.993  44.547  -21.160 1.00 123.89 ? 320  ARG A O     1 
ATOM   2469  C  CB    . ARG A 1  320  ? 81.435  43.298  -18.354 1.00 127.53 ? 320  ARG A CB    1 
ATOM   2470  C  CG    . ARG A 1  320  ? 82.898  43.252  -17.918 1.00 141.97 ? 320  ARG A CG    1 
ATOM   2471  C  CD    . ARG A 1  320  ? 83.849  42.841  -19.038 1.00 157.68 ? 320  ARG A CD    1 
ATOM   2472  N  NE    . ARG A 1  320  ? 83.631  41.467  -19.508 1.00 168.21 ? 320  ARG A NE    1 
ATOM   2473  C  CZ    . ARG A 1  320  ? 83.721  41.081  -20.779 1.00 179.89 ? 320  ARG A CZ    1 
ATOM   2474  N  NH1   . ARG A 1  320  ? 84.018  41.960  -21.730 1.00 167.55 ? 320  ARG A NH1   1 
ATOM   2475  N  NH2   . ARG A 1  320  ? 83.512  39.815  -21.109 1.00 163.54 ? 320  ARG A NH2   1 
ATOM   2476  N  N     . PRO A 1  321  ? 82.310  46.138  -20.289 1.00 114.75 ? 321  PRO A N     1 
ATOM   2477  C  CA    . PRO A 1  321  ? 82.750  46.547  -21.627 1.00 113.19 ? 321  PRO A CA    1 
ATOM   2478  C  C     . PRO A 1  321  ? 83.825  45.638  -22.220 1.00 113.32 ? 321  PRO A C     1 
ATOM   2479  O  O     . PRO A 1  321  ? 84.499  44.900  -21.488 1.00 111.86 ? 321  PRO A O     1 
ATOM   2480  C  CB    . PRO A 1  321  ? 83.221  47.993  -21.428 1.00 114.73 ? 321  PRO A CB    1 
ATOM   2481  C  CG    . PRO A 1  321  ? 83.077  48.273  -19.971 1.00 119.28 ? 321  PRO A CG    1 
ATOM   2482  C  CD    . PRO A 1  321  ? 82.940  46.977  -19.263 1.00 115.02 ? 321  PRO A CD    1 
ATOM   2483  N  N     . VAL A 1  322  ? 83.961  45.680  -23.558 1.00 107.67 ? 322  VAL A N     1 
ATOM   2484  C  CA    . VAL A 1  322  ? 84.933  44.880  -24.292 1.00 106.16 ? 322  VAL A CA    1 
ATOM   2485  C  C     . VAL A 1  322  ? 86.376  45.341  -24.029 1.00 107.61 ? 322  VAL A C     1 
ATOM   2486  O  O     . VAL A 1  322  ? 86.623  46.541  -23.879 1.00 107.18 ? 322  VAL A O     1 
ATOM   2487  C  CB    . VAL A 1  322  ? 84.547  44.767  -25.794 1.00 110.55 ? 322  VAL A CB    1 
ATOM   2488  C  CG1   . VAL A 1  322  ? 85.506  45.519  -26.722 1.00 110.12 ? 322  VAL A CG1   1 
ATOM   2489  C  CG2   . VAL A 1  322  ? 84.407  43.306  -26.211 1.00 110.42 ? 322  VAL A CG2   1 
ATOM   2490  N  N     . LYS A 1  323  ? 87.320  44.394  -23.939 1.00 102.28 ? 323  LYS A N     1 
ATOM   2491  C  CA    . LYS A 1  323  ? 88.722  44.759  -23.710 1.00 101.32 ? 323  LYS A CA    1 
ATOM   2492  C  C     . LYS A 1  323  ? 89.359  45.190  -25.028 1.00 102.90 ? 323  LYS A C     1 
ATOM   2493  O  O     . LYS A 1  323  ? 89.501  44.373  -25.936 1.00 103.70 ? 323  LYS A O     1 
ATOM   2494  C  CB    . LYS A 1  323  ? 89.507  43.594  -23.085 1.00 104.54 ? 323  LYS A CB    1 
ATOM   2495  C  CG    . LYS A 1  323  ? 89.196  43.359  -21.609 1.00 136.26 ? 323  LYS A CG    1 
ATOM   2496  C  CD    . LYS A 1  323  ? 88.074  42.327  -21.364 1.00 149.27 ? 323  LYS A CD    1 
ATOM   2497  C  CE    . LYS A 1  323  ? 87.515  42.414  -19.960 1.00 159.32 ? 323  LYS A CE    1 
ATOM   2498  N  NZ    . LYS A 1  323  ? 86.815  41.165  -19.565 1.00 169.27 ? 323  LYS A NZ    1 
ATOM   2499  N  N     . SER A 1  324  ? 89.703  46.474  -25.164 1.00 96.33  ? 324  SER A N     1 
ATOM   2500  C  CA    . SER A 1  324  ? 90.332  46.971  -26.398 1.00 94.50  ? 324  SER A CA    1 
ATOM   2501  C  C     . SER A 1  324  ? 91.772  46.438  -26.495 1.00 94.71  ? 324  SER A C     1 
ATOM   2502  O  O     . SER A 1  324  ? 92.300  45.930  -25.490 1.00 95.03  ? 324  SER A O     1 
ATOM   2503  C  CB    . SER A 1  324  ? 90.337  48.500  -26.422 1.00 97.46  ? 324  SER A CB    1 
ATOM   2504  O  OG    . SER A 1  324  ? 90.098  49.121  -25.163 1.00 104.29 ? 324  SER A OG    1 
ATOM   2505  N  N     . ILE A 1  325  ? 92.408  46.526  -27.691 1.00 86.44  ? 325  ILE A N     1 
ATOM   2506  C  CA    . ILE A 1  325  ? 93.808  46.096  -27.822 1.00 82.78  ? 325  ILE A CA    1 
ATOM   2507  C  C     . ILE A 1  325  ? 94.658  47.123  -27.038 1.00 84.97  ? 325  ILE A C     1 
ATOM   2508  O  O     . ILE A 1  325  ? 95.565  46.724  -26.304 1.00 83.46  ? 325  ILE A O     1 
ATOM   2509  C  CB    . ILE A 1  325  ? 94.274  45.854  -29.295 1.00 84.63  ? 325  ILE A CB    1 
ATOM   2510  C  CG1   . ILE A 1  325  ? 93.389  44.809  -29.992 1.00 84.05  ? 325  ILE A CG1   1 
ATOM   2511  C  CG2   . ILE A 1  325  ? 95.741  45.417  -29.347 1.00 84.62  ? 325  ILE A CG2   1 
ATOM   2512  C  CD1   . ILE A 1  325  ? 93.729  44.531  -31.410 1.00 86.43  ? 325  ILE A CD1   1 
ATOM   2513  N  N     . ARG A 1  326  ? 94.283  48.438  -27.120 1.00 81.84  ? 326  ARG A N     1 
ATOM   2514  C  CA    . ARG A 1  326  ? 94.951  49.550  -26.427 1.00 81.19  ? 326  ARG A CA    1 
ATOM   2515  C  C     . ARG A 1  326  ? 94.947  49.280  -24.960 1.00 86.70  ? 326  ARG A C     1 
ATOM   2516  O  O     . ARG A 1  326  ? 95.974  49.461  -24.309 1.00 86.85  ? 326  ARG A O     1 
ATOM   2517  C  CB    . ARG A 1  326  ? 94.297  50.912  -26.715 1.00 79.21  ? 326  ARG A CB    1 
ATOM   2518  C  CG    . ARG A 1  326  ? 94.849  52.018  -25.841 1.00 86.11  ? 326  ARG A CG    1 
ATOM   2519  C  CD    . ARG A 1  326  ? 94.290  53.365  -26.184 1.00 101.52 ? 326  ARG A CD    1 
ATOM   2520  N  NE    . ARG A 1  326  ? 94.724  54.382  -25.224 1.00 115.06 ? 326  ARG A NE    1 
ATOM   2521  C  CZ    . ARG A 1  326  ? 94.071  54.698  -24.109 1.00 135.18 ? 326  ARG A CZ    1 
ATOM   2522  N  NH1   . ARG A 1  326  ? 92.945  54.067  -23.787 1.00 129.44 ? 326  ARG A NH1   1 
ATOM   2523  N  NH2   . ARG A 1  326  ? 94.539  55.644  -23.305 1.00 117.80 ? 326  ARG A NH2   1 
ATOM   2524  N  N     . ALA A 1  327  ? 93.808  48.800  -24.450 1.00 84.56  ? 327  ALA A N     1 
ATOM   2525  C  CA    . ALA A 1  327  ? 93.635  48.461  -23.048 1.00 85.05  ? 327  ALA A CA    1 
ATOM   2526  C  C     . ALA A 1  327  ? 94.642  47.410  -22.586 1.00 89.80  ? 327  ALA A C     1 
ATOM   2527  O  O     . ALA A 1  327  ? 95.150  47.537  -21.466 1.00 90.78  ? 327  ALA A O     1 
ATOM   2528  C  CB    . ALA A 1  327  ? 92.217  47.990  -22.794 1.00 86.41  ? 327  ALA A CB    1 
ATOM   2529  N  N     . ARG A 1  328  ? 94.972  46.413  -23.458 1.00 85.11  ? 328  ARG A N     1 
ATOM   2530  C  CA    . ARG A 1  328  ? 95.948  45.345  -23.177 1.00 83.54  ? 328  ARG A CA    1 
ATOM   2531  C  C     . ARG A 1  328  ? 97.364  45.899  -22.936 1.00 89.12  ? 328  ARG A C     1 
ATOM   2532  O  O     . ARG A 1  328  ? 98.130  45.301  -22.176 1.00 88.70  ? 328  ARG A O     1 
ATOM   2533  C  CB    . ARG A 1  328  ? 96.042  44.361  -24.350 1.00 78.33  ? 328  ARG A CB    1 
ATOM   2534  C  CG    . ARG A 1  328  ? 94.788  43.618  -24.718 1.00 76.03  ? 328  ARG A CG    1 
ATOM   2535  C  CD    . ARG A 1  328  ? 95.219  42.292  -25.308 1.00 81.69  ? 328  ARG A CD    1 
ATOM   2536  N  NE    . ARG A 1  328  ? 94.102  41.397  -25.618 1.00 86.08  ? 328  ARG A NE    1 
ATOM   2537  C  CZ    . ARG A 1  328  ? 94.235  40.248  -26.273 1.00 92.51  ? 328  ARG A CZ    1 
ATOM   2538  N  NH1   . ARG A 1  328  ? 95.430  39.852  -26.698 1.00 62.51  ? 328  ARG A NH1   1 
ATOM   2539  N  NH2   . ARG A 1  328  ? 93.174  39.491  -26.518 1.00 85.68  ? 328  ARG A NH2   1 
ATOM   2540  N  N     . LEU A 1  329  ? 97.723  47.013  -23.605 1.00 86.51  ? 329  LEU A N     1 
ATOM   2541  C  CA    . LEU A 1  329  ? 99.075  47.564  -23.510 1.00 86.53  ? 329  LEU A CA    1 
ATOM   2542  C  C     . LEU A 1  329  ? 99.315  48.670  -22.460 1.00 92.80  ? 329  LEU A C     1 
ATOM   2543  O  O     . LEU A 1  329  ? 100.472 48.881  -22.074 1.00 92.59  ? 329  LEU A O     1 
ATOM   2544  C  CB    . LEU A 1  329  ? 99.651  47.924  -24.901 1.00 86.31  ? 329  LEU A CB    1 
ATOM   2545  C  CG    . LEU A 1  329  ? 99.188  47.105  -26.119 1.00 90.11  ? 329  LEU A CG    1 
ATOM   2546  C  CD1   . LEU A 1  329  ? 99.785  47.647  -27.363 1.00 90.67  ? 329  LEU A CD1   1 
ATOM   2547  C  CD2   . LEU A 1  329  ? 99.601  45.656  -26.025 1.00 91.81  ? 329  LEU A CD2   1 
ATOM   2548  N  N     . LYS A 1  330  ? 98.230  49.339  -21.984 1.00 90.67  ? 330  LYS A N     1 
ATOM   2549  C  CA    . LYS A 1  330  ? 98.229  50.415  -20.979 1.00 91.40  ? 330  LYS A CA    1 
ATOM   2550  C  C     . LYS A 1  330  ? 98.873  50.027  -19.649 1.00 97.79  ? 330  LYS A C     1 
ATOM   2551  O  O     . LYS A 1  330  ? 98.623  48.938  -19.110 1.00 97.37  ? 330  LYS A O     1 
ATOM   2552  C  CB    . LYS A 1  330  ? 96.813  50.916  -20.725 1.00 94.49  ? 330  LYS A CB    1 
ATOM   2553  C  CG    . LYS A 1  330  ? 96.373  52.043  -21.641 1.00 109.55 ? 330  LYS A CG    1 
ATOM   2554  C  CD    . LYS A 1  330  ? 95.439  53.026  -20.912 1.00 122.78 ? 330  LYS A CD    1 
ATOM   2555  C  CE    . LYS A 1  330  ? 93.991  52.581  -20.794 1.00 135.91 ? 330  LYS A CE    1 
ATOM   2556  N  NZ    . LYS A 1  330  ? 93.750  51.727  -19.600 1.00 143.85 ? 330  LYS A NZ    1 
ATOM   2557  N  N     . GLY A 1  331  ? 99.655  50.973  -19.136 1.00 96.20  ? 331  GLY A N     1 
ATOM   2558  C  CA    . GLY A 1  331  ? 100.507 50.905  -17.946 1.00 96.63  ? 331  GLY A CA    1 
ATOM   2559  C  C     . GLY A 1  331  ? 100.163 50.089  -16.708 1.00 99.37  ? 331  GLY A C     1 
ATOM   2560  O  O     . GLY A 1  331  ? 98.988  49.993  -16.349 1.00 99.47  ? 331  GLY A O     1 
ATOM   2561  N  N     . LYS A 1  332  ? 101.246 49.625  -15.980 1.00 94.23  ? 332  LYS A N     1 
ATOM   2562  C  CA    . LYS A 1  332  ? 101.330 48.810  -14.752 1.00 93.44  ? 332  LYS A CA    1 
ATOM   2563  C  C     . LYS A 1  332  ? 100.278 47.778  -14.809 1.00 99.40  ? 332  LYS A C     1 
ATOM   2564  O  O     . LYS A 1  332  ? 99.102  48.103  -14.618 1.00 101.63 ? 332  LYS A O     1 
ATOM   2565  C  CB    . LYS A 1  332  ? 101.219 49.631  -13.461 1.00 95.34  ? 332  LYS A CB    1 
ATOM   2566  C  CG    . LYS A 1  332  ? 101.487 48.785  -12.200 1.00 104.60 ? 332  LYS A CG    1 
ATOM   2567  C  CD    . LYS A 1  332  ? 101.127 49.484  -10.888 1.00 116.27 ? 332  LYS A CD    1 
ATOM   2568  C  CE    . LYS A 1  332  ? 99.644  49.534  -10.577 1.00 135.50 ? 332  LYS A CE    1 
ATOM   2569  N  NZ    . LYS A 1  332  ? 99.317  50.642  -9.631  1.00 149.41 ? 332  LYS A NZ    1 
ATOM   2570  N  N     . GLU A 1  333  ? 100.672 46.533  -15.075 1.00 94.62  ? 333  GLU A N     1 
ATOM   2571  C  CA    . GLU A 1  333  ? 99.785  45.406  -15.383 1.00 94.48  ? 333  GLU A CA    1 
ATOM   2572  C  C     . GLU A 1  333  ? 99.461  45.662  -16.862 1.00 97.27  ? 333  GLU A C     1 
ATOM   2573  O  O     . GLU A 1  333  ? 99.070  46.769  -17.252 1.00 97.11  ? 333  GLU A O     1 
ATOM   2574  C  CB    . GLU A 1  333  ? 98.458  45.307  -14.543 1.00 96.58  ? 333  GLU A CB    1 
ATOM   2575  C  CG    . GLU A 1  333  ? 98.491  45.543  -13.028 1.00 114.19 ? 333  GLU A CG    1 
ATOM   2576  C  CD    . GLU A 1  333  ? 99.287  44.614  -12.124 1.00 155.81 ? 333  GLU A CD    1 
ATOM   2577  O  OE1   . GLU A 1  333  ? 100.532 44.531  -12.266 1.00 152.22 ? 333  GLU A OE1   1 
ATOM   2578  O  OE2   . GLU A 1  333  ? 98.663  44.049  -11.196 1.00 167.02 ? 333  GLU A OE2   1 
ATOM   2579  N  N     . GLY A 1  334  ? 99.717  44.679  -17.692 1.00 93.24  ? 334  GLY A N     1 
ATOM   2580  C  CA    . GLY A 1  334  ? 99.469  44.852  -19.111 1.00 92.94  ? 334  GLY A CA    1 
ATOM   2581  C  C     . GLY A 1  334  ? 100.719 45.116  -19.911 1.00 94.07  ? 334  GLY A C     1 
ATOM   2582  O  O     . GLY A 1  334  ? 101.342 46.177  -19.793 1.00 95.26  ? 334  GLY A O     1 
ATOM   2583  N  N     . ARG A 1  335  ? 101.039 44.113  -20.740 1.00 86.41  ? 335  ARG A N     1 
ATOM   2584  C  CA    . ARG A 1  335  ? 102.115 43.940  -21.707 1.00 83.83  ? 335  ARG A CA    1 
ATOM   2585  C  C     . ARG A 1  335  ? 103.442 44.610  -21.431 1.00 86.42  ? 335  ARG A C     1 
ATOM   2586  O  O     . ARG A 1  335  ? 104.397 43.905  -21.118 1.00 86.36  ? 335  ARG A O     1 
ATOM   2587  C  CB    . ARG A 1  335  ? 101.634 44.078  -23.165 1.00 78.64  ? 335  ARG A CB    1 
ATOM   2588  C  CG    . ARG A 1  335  ? 102.198 42.962  -24.049 1.00 79.00  ? 335  ARG A CG    1 
ATOM   2589  C  CD    . ARG A 1  335  ? 101.322 41.722  -24.292 1.00 79.51  ? 335  ARG A CD    1 
ATOM   2590  N  NE    . ARG A 1  335  ? 100.622 41.244  -23.105 1.00 86.26  ? 335  ARG A NE    1 
ATOM   2591  C  CZ    . ARG A 1  335  ? 99.315  41.009  -23.053 1.00 105.94 ? 335  ARG A CZ    1 
ATOM   2592  N  NH1   . ARG A 1  335  ? 98.567  41.137  -24.141 1.00 90.36  ? 335  ARG A NH1   1 
ATOM   2593  N  NH2   . ARG A 1  335  ? 98.747  40.636  -21.913 1.00 96.10  ? 335  ARG A NH2   1 
ATOM   2594  N  N     . ILE A 1  336  ? 103.519 45.952  -21.527 1.00 80.92  ? 336  ILE A N     1 
ATOM   2595  C  CA    . ILE A 1  336  ? 104.774 46.666  -21.315 1.00 78.59  ? 336  ILE A CA    1 
ATOM   2596  C  C     . ILE A 1  336  ? 105.292 46.543  -19.888 1.00 78.38  ? 336  ILE A C     1 
ATOM   2597  O  O     . ILE A 1  336  ? 106.185 45.733  -19.619 1.00 75.88  ? 336  ILE A O     1 
ATOM   2598  C  CB    . ILE A 1  336  ? 104.710 48.113  -21.851 1.00 81.84  ? 336  ILE A CB    1 
ATOM   2599  C  CG1   . ILE A 1  336  ? 104.046 48.147  -23.251 1.00 83.24  ? 336  ILE A CG1   1 
ATOM   2600  C  CG2   . ILE A 1  336  ? 106.116 48.795  -21.843 1.00 81.15  ? 336  ILE A CG2   1 
ATOM   2601  C  CD1   . ILE A 1  336  ? 105.008 47.887  -24.483 1.00 94.15  ? 336  ILE A CD1   1 
ATOM   2602  N  N     . ARG A 1  337  ? 104.708 47.304  -18.975 1.00 74.84  ? 337  ARG A N     1 
ATOM   2603  C  CA    . ARG A 1  337  ? 105.148 47.312  -17.587 1.00 74.88  ? 337  ARG A CA    1 
ATOM   2604  C  C     . ARG A 1  337  ? 104.780 46.028  -16.848 1.00 80.53  ? 337  ARG A C     1 
ATOM   2605  O  O     . ARG A 1  337  ? 105.387 45.712  -15.819 1.00 80.80  ? 337  ARG A O     1 
ATOM   2606  C  CB    . ARG A 1  337  ? 104.553 48.512  -16.856 1.00 74.99  ? 337  ARG A CB    1 
ATOM   2607  C  CG    . ARG A 1  337  ? 104.235 49.678  -17.755 1.00 85.89  ? 337  ARG A CG    1 
ATOM   2608  C  CD    . ARG A 1  337  ? 104.806 50.946  -17.164 1.00 103.04 ? 337  ARG A CD    1 
ATOM   2609  N  NE    . ARG A 1  337  ? 103.871 51.627  -16.260 1.00 108.30 ? 337  ARG A NE    1 
ATOM   2610  C  CZ    . ARG A 1  337  ? 103.913 51.562  -14.933 1.00 105.14 ? 337  ARG A CZ    1 
ATOM   2611  N  NH1   . ARG A 1  337  ? 104.870 50.872  -14.322 1.00 84.46  ? 337  ARG A NH1   1 
ATOM   2612  N  NH2   . ARG A 1  337  ? 103.017 52.205  -14.207 1.00 82.62  ? 337  ARG A NH2   1 
ATOM   2613  N  N     . GLY A 1  338  ? 103.789 45.311  -17.368 1.00 76.88  ? 338  GLY A N     1 
ATOM   2614  C  CA    . GLY A 1  338  ? 103.293 44.101  -16.739 1.00 76.39  ? 338  GLY A CA    1 
ATOM   2615  C  C     . GLY A 1  338  ? 103.950 42.800  -17.143 1.00 79.24  ? 338  GLY A C     1 
ATOM   2616  O  O     . GLY A 1  338  ? 104.026 41.855  -16.345 1.00 80.33  ? 338  GLY A O     1 
ATOM   2617  N  N     . ASN A 1  339  ? 104.365 42.709  -18.385 1.00 72.77  ? 339  ASN A N     1 
ATOM   2618  C  CA    . ASN A 1  339  ? 104.929 41.459  -18.825 1.00 71.13  ? 339  ASN A CA    1 
ATOM   2619  C  C     . ASN A 1  339  ? 106.298 41.607  -19.413 1.00 75.47  ? 339  ASN A C     1 
ATOM   2620  O  O     . ASN A 1  339  ? 106.890 40.585  -19.745 1.00 76.51  ? 339  ASN A O     1 
ATOM   2621  C  CB    . ASN A 1  339  ? 103.997 40.803  -19.837 1.00 67.63  ? 339  ASN A CB    1 
ATOM   2622  C  CG    . ASN A 1  339  ? 102.622 40.556  -19.336 1.00 81.69  ? 339  ASN A CG    1 
ATOM   2623  O  OD1   . ASN A 1  339  ? 101.628 40.958  -19.955 1.00 63.68  ? 339  ASN A OD1   1 
ATOM   2624  N  ND2   . ASN A 1  339  ? 102.545 39.900  -18.191 1.00 84.66  ? 339  ASN A ND2   1 
ATOM   2625  N  N     . LEU A 1  340  ? 106.806 42.834  -19.600 1.00 70.82  ? 340  LEU A N     1 
ATOM   2626  C  CA    . LEU A 1  340  ? 108.118 42.961  -20.229 1.00 70.53  ? 340  LEU A CA    1 
ATOM   2627  C  C     . LEU A 1  340  ? 109.157 43.614  -19.327 1.00 77.67  ? 340  LEU A C     1 
ATOM   2628  O  O     . LEU A 1  340  ? 110.290 43.118  -19.230 1.00 76.93  ? 340  LEU A O     1 
ATOM   2629  C  CB    . LEU A 1  340  ? 108.016 43.640  -21.607 1.00 69.95  ? 340  LEU A CB    1 
ATOM   2630  C  CG    . LEU A 1  340  ? 107.235 42.889  -22.688 1.00 72.87  ? 340  LEU A CG    1 
ATOM   2631  C  CD1   . LEU A 1  340  ? 106.984 43.772  -23.858 1.00 73.40  ? 340  LEU A CD1   1 
ATOM   2632  C  CD2   . LEU A 1  340  ? 107.974 41.683  -23.163 1.00 73.50  ? 340  LEU A CD2   1 
ATOM   2633  N  N     . MET A 1  341  ? 108.751 44.704  -18.650 1.00 76.41  ? 341  MET A N     1 
ATOM   2634  C  CA    . MET A 1  341  ? 109.576 45.457  -17.713 1.00 77.67  ? 341  MET A CA    1 
ATOM   2635  C  C     . MET A 1  341  ? 109.712 44.687  -16.428 1.00 82.74  ? 341  MET A C     1 
ATOM   2636  O  O     . MET A 1  341  ? 110.754 44.750  -15.786 1.00 82.61  ? 341  MET A O     1 
ATOM   2637  C  CB    . MET A 1  341  ? 108.963 46.833  -17.443 1.00 81.04  ? 341  MET A CB    1 
ATOM   2638  C  CG    . MET A 1  341  ? 108.963 47.740  -18.661 1.00 86.21  ? 341  MET A CG    1 
ATOM   2639  S  SD    . MET A 1  341  ? 110.577 47.896  -19.488 1.00 91.56  ? 341  MET A SD    1 
ATOM   2640  C  CE    . MET A 1  341  ? 111.382 48.905  -18.356 1.00 88.60  ? 341  MET A CE    1 
ATOM   2641  N  N     . GLY A 1  342  ? 108.634 43.996  -16.066 1.00 80.47  ? 342  GLY A N     1 
ATOM   2642  C  CA    . GLY A 1  342  ? 108.497 43.104  -14.919 1.00 80.24  ? 342  GLY A CA    1 
ATOM   2643  C  C     . GLY A 1  342  ? 107.892 41.799  -15.405 1.00 83.50  ? 342  GLY A C     1 
ATOM   2644  O  O     . GLY A 1  342  ? 107.198 41.792  -16.427 1.00 83.72  ? 342  GLY A O     1 
ATOM   2645  N  N     . LYS A 1  343  ? 108.145 40.687  -14.695 1.00 78.16  ? 343  LYS A N     1 
ATOM   2646  C  CA    . LYS A 1  343  ? 107.675 39.341  -15.076 1.00 76.42  ? 343  LYS A CA    1 
ATOM   2647  C  C     . LYS A 1  343  ? 107.568 38.455  -13.846 1.00 78.26  ? 343  LYS A C     1 
ATOM   2648  O  O     . LYS A 1  343  ? 108.374 38.583  -12.915 1.00 77.61  ? 343  LYS A O     1 
ATOM   2649  C  CB    . LYS A 1  343  ? 108.751 38.651  -15.975 1.00 77.19  ? 343  LYS A CB    1 
ATOM   2650  C  CG    . LYS A 1  343  ? 108.672 38.853  -17.465 1.00 68.84  ? 343  LYS A CG    1 
ATOM   2651  C  CD    . LYS A 1  343  ? 109.871 38.207  -18.166 1.00 70.79  ? 343  LYS A CD    1 
ATOM   2652  C  CE    . LYS A 1  343  ? 109.980 38.577  -19.647 1.00 79.70  ? 343  LYS A CE    1 
ATOM   2653  N  NZ    . LYS A 1  343  ? 110.563 39.951  -19.948 1.00 85.92  ? 343  LYS A NZ    1 
ATOM   2654  N  N     . ARG A 1  344  ? 106.693 37.454  -13.899 1.00 73.47  ? 344  ARG A N     1 
ATOM   2655  C  CA    . ARG A 1  344  ? 106.706 36.430  -12.857 1.00 72.69  ? 344  ARG A CA    1 
ATOM   2656  C  C     . ARG A 1  344  ? 107.851 35.494  -13.261 1.00 74.97  ? 344  ARG A C     1 
ATOM   2657  O  O     . ARG A 1  344  ? 108.163 35.433  -14.446 1.00 75.41  ? 344  ARG A O     1 
ATOM   2658  C  CB    . ARG A 1  344  ? 105.364 35.713  -12.741 1.00 73.08  ? 344  ARG A CB    1 
ATOM   2659  C  CG    . ARG A 1  344  ? 104.636 36.189  -11.519 1.00 79.81  ? 344  ARG A CG    1 
ATOM   2660  C  CD    . ARG A 1  344  ? 103.130 36.199  -11.639 1.00 92.35  ? 344  ARG A CD    1 
ATOM   2661  N  NE    . ARG A 1  344  ? 102.573 37.156  -10.679 1.00 116.29 ? 344  ARG A NE    1 
ATOM   2662  C  CZ    . ARG A 1  344  ? 102.618 37.024  -9.351  1.00 148.75 ? 344  ARG A CZ    1 
ATOM   2663  N  NH1   . ARG A 1  344  ? 103.154 35.940  -8.797  1.00 139.35 ? 344  ARG A NH1   1 
ATOM   2664  N  NH2   . ARG A 1  344  ? 102.098 37.960  -8.568  1.00 149.36 ? 344  ARG A NH2   1 
ATOM   2665  N  N     . VAL A 1  345  ? 108.557 34.876  -12.328 1.00 70.20  ? 345  VAL A N     1 
ATOM   2666  C  CA    . VAL A 1  345  ? 109.726 34.085  -12.735 1.00 70.21  ? 345  VAL A CA    1 
ATOM   2667  C  C     . VAL A 1  345  ? 109.808 32.731  -12.076 1.00 76.22  ? 345  VAL A C     1 
ATOM   2668  O  O     . VAL A 1  345  ? 109.334 32.594  -10.945 1.00 77.32  ? 345  VAL A O     1 
ATOM   2669  C  CB    . VAL A 1  345  ? 111.062 34.869  -12.524 1.00 73.93  ? 345  VAL A CB    1 
ATOM   2670  C  CG1   . VAL A 1  345  ? 111.192 36.027  -13.494 1.00 73.86  ? 345  VAL A CG1   1 
ATOM   2671  C  CG2   . VAL A 1  345  ? 111.243 35.350  -11.074 1.00 73.71  ? 345  VAL A CG2   1 
ATOM   2672  N  N     . ASP A 1  346  ? 110.471 31.748  -12.723 1.00 73.08  ? 346  ASP A N     1 
ATOM   2673  C  CA    . ASP A 1  346  ? 110.734 30.443  -12.086 1.00 74.08  ? 346  ASP A CA    1 
ATOM   2674  C  C     . ASP A 1  346  ? 112.035 30.606  -11.227 1.00 79.42  ? 346  ASP A C     1 
ATOM   2675  O  O     . ASP A 1  346  ? 112.662 31.676  -11.277 1.00 78.63  ? 346  ASP A O     1 
ATOM   2676  C  CB    . ASP A 1  346  ? 110.909 29.321  -13.125 1.00 76.62  ? 346  ASP A CB    1 
ATOM   2677  C  CG    . ASP A 1  346  ? 109.783 29.121  -14.126 1.00 91.51  ? 346  ASP A CG    1 
ATOM   2678  O  OD1   . ASP A 1  346  ? 108.612 29.371  -13.761 1.00 91.06  ? 346  ASP A OD1   1 
ATOM   2679  O  OD2   . ASP A 1  346  ? 110.066 28.618  -15.252 1.00 100.57 ? 346  ASP A OD2   1 
ATOM   2680  N  N     . PHE A 1  347  ? 112.433 29.570  -10.438 1.00 77.01  ? 347  PHE A N     1 
ATOM   2681  C  CA    . PHE A 1  347  ? 113.629 29.620  -9.551  1.00 77.15  ? 347  PHE A CA    1 
ATOM   2682  C  C     . PHE A 1  347  ? 113.590 30.780  -8.541  1.00 79.67  ? 347  PHE A C     1 
ATOM   2683  O  O     . PHE A 1  347  ? 114.562 31.515  -8.334  1.00 80.01  ? 347  PHE A O     1 
ATOM   2684  C  CB    . PHE A 1  347  ? 114.950 29.523  -10.334 1.00 79.26  ? 347  PHE A CB    1 
ATOM   2685  C  CG    . PHE A 1  347  ? 114.920 28.308  -11.215 1.00 81.86  ? 347  PHE A CG    1 
ATOM   2686  C  CD1   . PHE A 1  347  ? 115.192 27.049  -10.696 1.00 85.35  ? 347  PHE A CD1   1 
ATOM   2687  C  CD2   . PHE A 1  347  ? 114.523 28.404  -12.546 1.00 86.14  ? 347  PHE A CD2   1 
ATOM   2688  C  CE1   . PHE A 1  347  ? 115.096 25.910  -11.494 1.00 86.92  ? 347  PHE A CE1   1 
ATOM   2689  C  CE2   . PHE A 1  347  ? 114.432 27.264  -13.350 1.00 89.69  ? 347  PHE A CE2   1 
ATOM   2690  C  CZ    . PHE A 1  347  ? 114.710 26.023  -12.812 1.00 87.72  ? 347  PHE A CZ    1 
ATOM   2691  N  N     . SER A 1  348  ? 112.421 30.921  -7.930  1.00 73.87  ? 348  SER A N     1 
ATOM   2692  C  CA    . SER A 1  348  ? 112.107 31.960  -6.988  1.00 73.39  ? 348  SER A CA    1 
ATOM   2693  C  C     . SER A 1  348  ? 111.327 31.353  -5.824  1.00 74.89  ? 348  SER A C     1 
ATOM   2694  O  O     . SER A 1  348  ? 110.490 30.466  -6.023  1.00 74.88  ? 348  SER A O     1 
ATOM   2695  C  CB    . SER A 1  348  ? 111.299 33.058  -7.678  1.00 78.91  ? 348  SER A CB    1 
ATOM   2696  O  OG    . SER A 1  348  ? 110.034 32.585  -8.127  1.00 90.49  ? 348  SER A OG    1 
ATOM   2697  N  N     . ALA A 1  349  ? 111.608 31.846  -4.610  1.00 68.36  ? 349  ALA A N     1 
ATOM   2698  C  CA    . ALA A 1  349  ? 111.010 31.390  -3.372  1.00 66.31  ? 349  ALA A CA    1 
ATOM   2699  C  C     . ALA A 1  349  ? 110.761 32.534  -2.409  1.00 68.36  ? 349  ALA A C     1 
ATOM   2700  O  O     . ALA A 1  349  ? 111.512 33.514  -2.388  1.00 69.07  ? 349  ALA A O     1 
ATOM   2701  C  CB    . ALA A 1  349  ? 111.936 30.394  -2.730  1.00 67.09  ? 349  ALA A CB    1 
ATOM   2702  N  N     . ARG A 1  350  ? 109.725 32.404  -1.582  1.00 63.57  ? 350  ARG A N     1 
ATOM   2703  C  CA    . ARG A 1  350  ? 109.385 33.436  -0.604  1.00 63.42  ? 350  ARG A CA    1 
ATOM   2704  C  C     . ARG A 1  350  ? 108.820 32.915  0.736   1.00 70.00  ? 350  ARG A C     1 
ATOM   2705  O  O     . ARG A 1  350  ? 107.867 32.136  0.763   1.00 70.81  ? 350  ARG A O     1 
ATOM   2706  C  CB    . ARG A 1  350  ? 108.456 34.448  -1.248  1.00 59.86  ? 350  ARG A CB    1 
ATOM   2707  C  CG    . ARG A 1  350  ? 107.914 35.442  -0.309  1.00 67.45  ? 350  ARG A CG    1 
ATOM   2708  C  CD    . ARG A 1  350  ? 106.845 36.198  -1.015  1.00 78.80  ? 350  ARG A CD    1 
ATOM   2709  N  NE    . ARG A 1  350  ? 106.121 37.013  -0.054  1.00 82.93  ? 350  ARG A NE    1 
ATOM   2710  C  CZ    . ARG A 1  350  ? 106.224 38.326  0.034   1.00 88.74  ? 350  ARG A CZ    1 
ATOM   2711  N  NH1   . ARG A 1  350  ? 107.003 38.998  -0.805  1.00 71.40  ? 350  ARG A NH1   1 
ATOM   2712  N  NH2   . ARG A 1  350  ? 105.536 38.985  0.956   1.00 81.07  ? 350  ARG A NH2   1 
ATOM   2713  N  N     . THR A 1  351  ? 109.416 33.351  1.849   1.00 66.80  ? 351  THR A N     1 
ATOM   2714  C  CA    . THR A 1  351  ? 108.956 32.990  3.190   1.00 66.28  ? 351  THR A CA    1 
ATOM   2715  C  C     . THR A 1  351  ? 109.233 34.101  4.157   1.00 70.19  ? 351  THR A C     1 
ATOM   2716  O  O     . THR A 1  351  ? 109.838 35.099  3.791   1.00 69.79  ? 351  THR A O     1 
ATOM   2717  C  CB    . THR A 1  351  ? 109.441 31.602  3.668   1.00 68.72  ? 351  THR A CB    1 
ATOM   2718  O  OG1   . THR A 1  351  ? 108.689 31.263  4.831   1.00 64.44  ? 351  THR A OG1   1 
ATOM   2719  C  CG2   . THR A 1  351  ? 110.922 31.560  4.004   1.00 65.12  ? 351  THR A CG2   1 
ATOM   2720  N  N     . VAL A 1  352  ? 108.771 33.928  5.390   1.00 67.55  ? 352  VAL A N     1 
ATOM   2721  C  CA    . VAL A 1  352  ? 108.952 34.848  6.506   1.00 67.50  ? 352  VAL A CA    1 
ATOM   2722  C  C     . VAL A 1  352  ? 110.424 34.894  6.870   1.00 76.15  ? 352  VAL A C     1 
ATOM   2723  O  O     . VAL A 1  352  ? 111.130 33.888  6.765   1.00 77.18  ? 352  VAL A O     1 
ATOM   2724  C  CB    . VAL A 1  352  ? 108.117 34.369  7.691   1.00 69.66  ? 352  VAL A CB    1 
ATOM   2725  C  CG1   . VAL A 1  352  ? 108.439 35.157  8.940   1.00 69.59  ? 352  VAL A CG1   1 
ATOM   2726  C  CG2   . VAL A 1  352  ? 106.639 34.431  7.361   1.00 69.30  ? 352  VAL A CG2   1 
ATOM   2727  N  N     . ILE A 1  353  ? 110.895 36.060  7.266   1.00 74.61  ? 353  ILE A N     1 
ATOM   2728  C  CA    . ILE A 1  353  ? 112.286 36.186  7.653   1.00 75.34  ? 353  ILE A CA    1 
ATOM   2729  C  C     . ILE A 1  353  ? 112.389 36.276  9.142   1.00 81.45  ? 353  ILE A C     1 
ATOM   2730  O  O     . ILE A 1  353  ? 111.449 36.739  9.799   1.00 83.15  ? 353  ILE A O     1 
ATOM   2731  C  CB    . ILE A 1  353  ? 113.043 37.332  6.928   1.00 78.32  ? 353  ILE A CB    1 
ATOM   2732  C  CG1   . ILE A 1  353  ? 112.230 38.629  6.885   1.00 78.66  ? 353  ILE A CG1   1 
ATOM   2733  C  CG2   . ILE A 1  353  ? 113.468 36.910  5.537   1.00 78.59  ? 353  ILE A CG2   1 
ATOM   2734  C  CD1   . ILE A 1  353  ? 112.856 39.704  7.581   1.00 82.51  ? 353  ILE A CD1   1 
ATOM   2735  N  N     . SER A 1  354  ? 113.508 35.780  9.676   1.00 77.48  ? 354  SER A N     1 
ATOM   2736  C  CA    . SER A 1  354  ? 113.889 35.860  11.081  1.00 77.82  ? 354  SER A CA    1 
ATOM   2737  C  C     . SER A 1  354  ? 115.417 36.049  11.200  1.00 83.65  ? 354  SER A C     1 
ATOM   2738  O  O     . SER A 1  354  ? 116.158 35.702  10.284  1.00 83.33  ? 354  SER A O     1 
ATOM   2739  C  CB    . SER A 1  354  ? 113.293 34.738  11.934  1.00 79.77  ? 354  SER A CB    1 
ATOM   2740  O  OG    . SER A 1  354  ? 113.390 33.457  11.339  1.00 84.75  ? 354  SER A OG    1 
ATOM   2741  N  N     . GLY A 1  355  ? 115.855 36.726  12.248  1.00 81.83  ? 355  GLY A N     1 
ATOM   2742  C  CA    . GLY A 1  355  ? 117.267 37.026  12.449  1.00 81.88  ? 355  GLY A CA    1 
ATOM   2743  C  C     . GLY A 1  355  ? 118.030 35.923  13.131  1.00 84.75  ? 355  GLY A C     1 
ATOM   2744  O  O     . GLY A 1  355  ? 117.472 35.197  13.963  1.00 86.21  ? 355  GLY A O     1 
ATOM   2745  N  N     . ASP A 1  356  ? 119.315 35.809  12.800  1.00 78.44  ? 356  ASP A N     1 
ATOM   2746  C  CA    . ASP A 1  356  ? 120.137 34.780  13.395  1.00 78.07  ? 356  ASP A CA    1 
ATOM   2747  C  C     . ASP A 1  356  ? 121.497 35.341  13.753  1.00 81.36  ? 356  ASP A C     1 
ATOM   2748  O  O     . ASP A 1  356  ? 122.183 35.786  12.834  1.00 81.42  ? 356  ASP A O     1 
ATOM   2749  C  CB    . ASP A 1  356  ? 120.283 33.619  12.411  1.00 79.84  ? 356  ASP A CB    1 
ATOM   2750  C  CG    . ASP A 1  356  ? 120.624 32.289  13.042  1.00 94.10  ? 356  ASP A CG    1 
ATOM   2751  O  OD1   . ASP A 1  356  ? 121.533 32.254  13.906  1.00 96.30  ? 356  ASP A OD1   1 
ATOM   2752  O  OD2   . ASP A 1  356  ? 120.039 31.270  12.619  1.00 98.54  ? 356  ASP A OD2   1 
ATOM   2753  N  N     . PRO A 1  357  ? 121.931 35.340  15.052  1.00 76.85  ? 357  PRO A N     1 
ATOM   2754  C  CA    . PRO A 1  357  ? 123.272 35.862  15.376  1.00 76.84  ? 357  PRO A CA    1 
ATOM   2755  C  C     . PRO A 1  357  ? 124.352 34.849  14.996  1.00 81.15  ? 357  PRO A C     1 
ATOM   2756  O  O     . PRO A 1  357  ? 125.533 35.185  14.901  1.00 82.07  ? 357  PRO A O     1 
ATOM   2757  C  CB    . PRO A 1  357  ? 123.215 36.117  16.893  1.00 78.81  ? 357  PRO A CB    1 
ATOM   2758  C  CG    . PRO A 1  357  ? 121.823 35.776  17.332  1.00 82.38  ? 357  PRO A CG    1 
ATOM   2759  C  CD    . PRO A 1  357  ? 121.243 34.893  16.274  1.00 77.67  ? 357  PRO A CD    1 
ATOM   2760  N  N     . ASN A 1  358  ? 123.935 33.625  14.707  1.00 76.70  ? 358  ASN A N     1 
ATOM   2761  C  CA    . ASN A 1  358  ? 124.878 32.596  14.328  1.00 77.01  ? 358  ASN A CA    1 
ATOM   2762  C  C     . ASN A 1  358  ? 125.059 32.385  12.837  1.00 81.16  ? 358  ASN A C     1 
ATOM   2763  O  O     . ASN A 1  358  ? 125.680 31.412  12.404  1.00 81.06  ? 358  ASN A O     1 
ATOM   2764  C  CB    . ASN A 1  358  ? 124.614 31.341  15.095  1.00 78.52  ? 358  ASN A CB    1 
ATOM   2765  C  CG    . ASN A 1  358  ? 124.901 31.566  16.535  1.00 93.37  ? 358  ASN A CG    1 
ATOM   2766  O  OD1   . ASN A 1  358  ? 126.066 31.714  16.924  1.00 78.88  ? 358  ASN A OD1   1 
ATOM   2767  N  ND2   . ASN A 1  358  ? 123.837 31.711  17.325  1.00 87.32  ? 358  ASN A ND2   1 
ATOM   2768  N  N     . LEU A 1  359  ? 124.550 33.316  12.048  1.00 77.47  ? 359  LEU A N     1 
ATOM   2769  C  CA    . LEU A 1  359  ? 124.786 33.293  10.620  1.00 76.88  ? 359  LEU A CA    1 
ATOM   2770  C  C     . LEU A 1  359  ? 125.822 34.388  10.308  1.00 82.41  ? 359  LEU A C     1 
ATOM   2771  O  O     . LEU A 1  359  ? 125.932 35.382  11.041  1.00 82.17  ? 359  LEU A O     1 
ATOM   2772  C  CB    . LEU A 1  359  ? 123.495 33.481  9.807   1.00 76.15  ? 359  LEU A CB    1 
ATOM   2773  C  CG    . LEU A 1  359  ? 122.585 32.266  9.614   1.00 79.95  ? 359  LEU A CG    1 
ATOM   2774  C  CD1   . LEU A 1  359  ? 121.534 32.556  8.588   1.00 78.49  ? 359  LEU A CD1   1 
ATOM   2775  C  CD2   . LEU A 1  359  ? 123.363 31.046  9.168   1.00 83.75  ? 359  LEU A CD2   1 
ATOM   2776  N  N     . GLU A 1  360  ? 126.634 34.152  9.274   1.00 79.28  ? 360  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1  360  ? 127.656 35.082  8.841   1.00 79.41  ? 360  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1  360  ? 126.979 36.176  8.042   1.00 83.09  ? 360  GLU A C     1 
ATOM   2779  O  O     . GLU A 1  360  ? 125.971 35.880  7.393   1.00 82.93  ? 360  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1  360  ? 128.740 34.341  8.047   1.00 80.92  ? 360  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1  360  ? 129.863 33.811  8.932   1.00 97.81  ? 360  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1  360  ? 130.627 34.842  9.761   1.00 147.36 ? 360  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1  360  ? 130.769 36.008  9.313   1.00 154.26 ? 360  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1  360  ? 131.088 34.474  10.869  1.00 151.47 ? 360  GLU A OE2   1 
ATOM   2785  N  N     . LEU A 1  361  ? 127.477 37.446  8.125   1.00 78.57  ? 361  LEU A N     1 
ATOM   2786  C  CA    . LEU A 1  361  ? 126.871 38.605  7.425   1.00 77.00  ? 361  LEU A CA    1 
ATOM   2787  C  C     . LEU A 1  361  ? 126.347 38.267  5.997   1.00 78.80  ? 361  LEU A C     1 
ATOM   2788  O  O     . LEU A 1  361  ? 125.184 38.565  5.672   1.00 77.56  ? 361  LEU A O     1 
ATOM   2789  C  CB    . LEU A 1  361  ? 127.833 39.828  7.409   1.00 76.72  ? 361  LEU A CB    1 
ATOM   2790  C  CG    . LEU A 1  361  ? 127.310 41.172  6.824   1.00 79.22  ? 361  LEU A CG    1 
ATOM   2791  C  CD1   . LEU A 1  361  ? 126.775 42.082  7.922   1.00 79.41  ? 361  LEU A CD1   1 
ATOM   2792  C  CD2   . LEU A 1  361  ? 128.407 41.914  6.060   1.00 77.81  ? 361  LEU A CD2   1 
ATOM   2793  N  N     . ASP A 1  362  ? 127.187 37.552  5.214   1.00 74.07  ? 362  ASP A N     1 
ATOM   2794  C  CA    . ASP A 1  362  ? 126.907 37.195  3.835   1.00 74.17  ? 362  ASP A CA    1 
ATOM   2795  C  C     . ASP A 1  362  ? 126.097 35.931  3.568   1.00 76.97  ? 362  ASP A C     1 
ATOM   2796  O  O     . ASP A 1  362  ? 125.785 35.648  2.405   1.00 76.23  ? 362  ASP A O     1 
ATOM   2797  C  CB    . ASP A 1  362  ? 128.174 37.282  2.957   1.00 77.38  ? 362  ASP A CB    1 
ATOM   2798  C  CG    . ASP A 1  362  ? 129.243 36.239  3.208   1.00 94.73  ? 362  ASP A CG    1 
ATOM   2799  O  OD1   . ASP A 1  362  ? 129.297 35.703  4.343   1.00 97.86  ? 362  ASP A OD1   1 
ATOM   2800  O  OD2   . ASP A 1  362  ? 130.079 36.015  2.293   1.00 98.95  ? 362  ASP A OD2   1 
ATOM   2801  N  N     . GLN A 1  363  ? 125.735 35.171  4.606   1.00 71.76  ? 363  GLN A N     1 
ATOM   2802  C  CA    . GLN A 1  363  ? 124.899 34.003  4.326   1.00 69.06  ? 363  GLN A CA    1 
ATOM   2803  C  C     . GLN A 1  363  ? 123.418 34.250  4.620   1.00 70.99  ? 363  GLN A C     1 
ATOM   2804  O  O     . GLN A 1  363  ? 123.043 35.296  5.197   1.00 71.32  ? 363  GLN A O     1 
ATOM   2805  C  CB    . GLN A 1  363  ? 125.454 32.688  4.893   1.00 69.66  ? 363  GLN A CB    1 
ATOM   2806  C  CG    . GLN A 1  363  ? 125.572 32.645  6.403   1.00 79.90  ? 363  GLN A CG    1 
ATOM   2807  C  CD    . GLN A 1  363  ? 126.575 31.624  6.873   1.00 94.71  ? 363  GLN A CD    1 
ATOM   2808  O  OE1   . GLN A 1  363  ? 126.399 30.965  7.912   1.00 86.39  ? 363  GLN A OE1   1 
ATOM   2809  N  NE2   . GLN A 1  363  ? 127.673 31.501  6.144   1.00 88.25  ? 363  GLN A NE2   1 
ATOM   2810  N  N     . VAL A 1  364  ? 122.587 33.323  4.116   1.00 64.87  ? 364  VAL A N     1 
ATOM   2811  C  CA    . VAL A 1  364  ? 121.133 33.275  4.244   1.00 63.04  ? 364  VAL A CA    1 
ATOM   2812  C  C     . VAL A 1  364  ? 120.691 31.850  4.621   1.00 69.72  ? 364  VAL A C     1 
ATOM   2813  O  O     . VAL A 1  364  ? 121.107 30.845  4.006   1.00 69.52  ? 364  VAL A O     1 
ATOM   2814  C  CB    . VAL A 1  364  ? 120.376 33.824  3.002   1.00 63.56  ? 364  VAL A CB    1 
ATOM   2815  C  CG1   . VAL A 1  364  ? 120.775 33.096  1.719   1.00 61.90  ? 364  VAL A CG1   1 
ATOM   2816  C  CG2   . VAL A 1  364  ? 118.862 33.775  3.213   1.00 62.77  ? 364  VAL A CG2   1 
ATOM   2817  N  N     . GLY A 1  365  ? 119.856 31.793  5.642   1.00 67.25  ? 365  GLY A N     1 
ATOM   2818  C  CA    . GLY A 1  365  ? 119.282 30.547  6.118   1.00 67.44  ? 365  GLY A CA    1 
ATOM   2819  C  C     . GLY A 1  365  ? 118.197 30.109  5.169   1.00 71.03  ? 365  GLY A C     1 
ATOM   2820  O  O     . GLY A 1  365  ? 117.214 30.826  4.978   1.00 71.08  ? 365  GLY A O     1 
ATOM   2821  N  N     . VAL A 1  366  ? 118.401 28.986  4.503   1.00 67.08  ? 366  VAL A N     1 
ATOM   2822  C  CA    . VAL A 1  366  ? 117.417 28.524  3.539   1.00 66.44  ? 366  VAL A CA    1 
ATOM   2823  C  C     . VAL A 1  366  ? 116.699 27.287  4.080   1.00 69.77  ? 366  VAL A C     1 
ATOM   2824  O  O     . VAL A 1  366  ? 117.342 26.265  4.312   1.00 69.74  ? 366  VAL A O     1 
ATOM   2825  C  CB    . VAL A 1  366  ? 118.001 28.334  2.111   1.00 70.18  ? 366  VAL A CB    1 
ATOM   2826  C  CG1   . VAL A 1  366  ? 116.884 28.143  1.092   1.00 70.10  ? 366  VAL A CG1   1 
ATOM   2827  C  CG2   . VAL A 1  366  ? 118.890 29.511  1.710   1.00 69.68  ? 366  VAL A CG2   1 
ATOM   2828  N  N     . PRO A 1  367  ? 115.376 27.362  4.324   1.00 66.24  ? 367  PRO A N     1 
ATOM   2829  C  CA    . PRO A 1  367  ? 114.658 26.181  4.837   1.00 66.61  ? 367  PRO A CA    1 
ATOM   2830  C  C     . PRO A 1  367  ? 114.836 24.989  3.907   1.00 69.02  ? 367  PRO A C     1 
ATOM   2831  O  O     . PRO A 1  367  ? 114.722 25.189  2.696   1.00 66.98  ? 367  PRO A O     1 
ATOM   2832  C  CB    . PRO A 1  367  ? 113.197 26.650  4.873   1.00 68.75  ? 367  PRO A CB    1 
ATOM   2833  C  CG    . PRO A 1  367  ? 113.280 28.131  4.990   1.00 72.95  ? 367  PRO A CG    1 
ATOM   2834  C  CD    . PRO A 1  367  ? 114.465 28.510  4.158   1.00 67.94  ? 367  PRO A CD    1 
ATOM   2835  N  N     . LYS A 1  368  ? 115.174 23.772  4.468   1.00 66.32  ? 368  LYS A N     1 
ATOM   2836  C  CA    . LYS A 1  368  ? 115.415 22.496  3.733   1.00 65.49  ? 368  LYS A CA    1 
ATOM   2837  C  C     . LYS A 1  368  ? 114.415 22.288  2.576   1.00 67.80  ? 368  LYS A C     1 
ATOM   2838  O  O     . LYS A 1  368  ? 114.839 22.150  1.430   1.00 66.14  ? 368  LYS A O     1 
ATOM   2839  C  CB    . LYS A 1  368  ? 115.454 21.277  4.689   1.00 67.41  ? 368  LYS A CB    1 
ATOM   2840  C  CG    . LYS A 1  368  ? 116.190 20.028  4.176   1.00 80.75  ? 368  LYS A CG    1 
ATOM   2841  C  CD    . LYS A 1  368  ? 115.565 18.711  4.790   1.00 103.12 ? 368  LYS A CD    1 
ATOM   2842  C  CE    . LYS A 1  368  ? 116.395 17.409  4.756   1.00 114.70 ? 368  LYS A CE    1 
ATOM   2843  N  NZ    . LYS A 1  368  ? 115.724 16.226  4.077   1.00 104.33 ? 368  LYS A NZ    1 
ATOM   2844  N  N     . SER A 1  369  ? 113.097 22.399  2.874   1.00 63.96  ? 369  SER A N     1 
ATOM   2845  C  CA    . SER A 1  369  ? 111.991 22.269  1.926   1.00 63.10  ? 369  SER A CA    1 
ATOM   2846  C  C     . SER A 1  369  ? 112.185 23.128  0.708   1.00 66.60  ? 369  SER A C     1 
ATOM   2847  O  O     . SER A 1  369  ? 111.982 22.639  -0.400  1.00 65.78  ? 369  SER A O     1 
ATOM   2848  C  CB    . SER A 1  369  ? 110.647 22.556  2.596   1.00 66.33  ? 369  SER A CB    1 
ATOM   2849  O  OG    . SER A 1  369  ? 110.203 23.902  2.572   1.00 71.75  ? 369  SER A OG    1 
ATOM   2850  N  N     . ILE A 1  370  ? 112.619 24.392  0.910   1.00 63.99  ? 370  ILE A N     1 
ATOM   2851  C  CA    . ILE A 1  370  ? 112.914 25.336  -0.178  1.00 63.25  ? 370  ILE A CA    1 
ATOM   2852  C  C     . ILE A 1  370  ? 114.150 24.846  -0.975  1.00 71.93  ? 370  ILE A C     1 
ATOM   2853  O  O     . ILE A 1  370  ? 114.101 24.804  -2.208  1.00 73.10  ? 370  ILE A O     1 
ATOM   2854  C  CB    . ILE A 1  370  ? 113.023 26.803  0.302   1.00 63.91  ? 370  ILE A CB    1 
ATOM   2855  C  CG1   . ILE A 1  370  ? 111.695 27.252  0.980   1.00 63.86  ? 370  ILE A CG1   1 
ATOM   2856  C  CG2   . ILE A 1  370  ? 113.392 27.678  -0.860  1.00 60.87  ? 370  ILE A CG2   1 
ATOM   2857  C  CD1   . ILE A 1  370  ? 111.550 28.752  1.426   1.00 71.51  ? 370  ILE A CD1   1 
ATOM   2858  N  N     . ALA A 1  371  ? 115.210 24.387  -0.276  1.00 69.04  ? 371  ALA A N     1 
ATOM   2859  C  CA    . ALA A 1  371  ? 116.398 23.876  -0.952  1.00 68.59  ? 371  ALA A CA    1 
ATOM   2860  C  C     . ALA A 1  371  ? 116.097 22.640  -1.770  1.00 71.27  ? 371  ALA A C     1 
ATOM   2861  O  O     . ALA A 1  371  ? 116.696 22.454  -2.822  1.00 71.07  ? 371  ALA A O     1 
ATOM   2862  C  CB    . ALA A 1  371  ? 117.494 23.586  0.047   1.00 69.70  ? 371  ALA A CB    1 
ATOM   2863  N  N     . LYS A 1  372  ? 115.139 21.820  -1.312  1.00 66.97  ? 372  LYS A N     1 
ATOM   2864  C  CA    . LYS A 1  372  ? 114.747 20.593  -1.999  1.00 66.34  ? 372  LYS A CA    1 
ATOM   2865  C  C     . LYS A 1  372  ? 113.843 20.874  -3.199  1.00 72.44  ? 372  LYS A C     1 
ATOM   2866  O  O     . LYS A 1  372  ? 113.465 19.930  -3.895  1.00 74.16  ? 372  LYS A O     1 
ATOM   2867  C  CB    . LYS A 1  372  ? 114.079 19.590  -1.039  1.00 67.70  ? 372  LYS A CB    1 
ATOM   2868  C  CG    . LYS A 1  372  ? 115.001 18.979  0.032   1.00 75.34  ? 372  LYS A CG    1 
ATOM   2869  C  CD    . LYS A 1  372  ? 114.761 17.473  0.278   1.00 86.31  ? 372  LYS A CD    1 
ATOM   2870  C  CE    . LYS A 1  372  ? 113.337 17.027  0.608   1.00 93.57  ? 372  LYS A CE    1 
ATOM   2871  N  NZ    . LYS A 1  372  ? 112.927 17.381  1.991   1.00 103.32 ? 372  LYS A NZ    1 
ATOM   2872  N  N     . THR A 1  373  ? 113.495 22.154  -3.452  1.00 68.54  ? 373  THR A N     1 
ATOM   2873  C  CA    . THR A 1  373  ? 112.610 22.571  -4.552  1.00 67.96  ? 373  THR A CA    1 
ATOM   2874  C  C     . THR A 1  373  ? 113.441 23.322  -5.592  1.00 72.15  ? 373  THR A C     1 
ATOM   2875  O  O     . THR A 1  373  ? 113.428 22.972  -6.777  1.00 72.22  ? 373  THR A O     1 
ATOM   2876  C  CB    . THR A 1  373  ? 111.466 23.448  -4.002  1.00 72.81  ? 373  THR A CB    1 
ATOM   2877  O  OG1   . THR A 1  373  ? 110.855 22.788  -2.910  1.00 82.50  ? 373  THR A OG1   1 
ATOM   2878  C  CG2   . THR A 1  373  ? 110.423 23.747  -5.012  1.00 66.30  ? 373  THR A CG2   1 
ATOM   2879  N  N     . LEU A 1  374  ? 114.157 24.358  -5.141  1.00 67.76  ? 374  LEU A N     1 
ATOM   2880  C  CA    . LEU A 1  374  ? 115.003 25.157  -6.006  1.00 67.32  ? 374  LEU A CA    1 
ATOM   2881  C  C     . LEU A 1  374  ? 116.194 24.298  -6.477  1.00 73.54  ? 374  LEU A C     1 
ATOM   2882  O  O     . LEU A 1  374  ? 116.867 23.619  -5.701  1.00 75.40  ? 374  LEU A O     1 
ATOM   2883  C  CB    . LEU A 1  374  ? 115.446 26.456  -5.313  1.00 66.80  ? 374  LEU A CB    1 
ATOM   2884  C  CG    . LEU A 1  374  ? 114.342 27.345  -4.756  1.00 69.85  ? 374  LEU A CG    1 
ATOM   2885  C  CD1   . LEU A 1  374  ? 114.918 28.425  -3.890  1.00 69.27  ? 374  LEU A CD1   1 
ATOM   2886  C  CD2   . LEU A 1  374  ? 113.476 27.907  -5.856  1.00 71.29  ? 374  LEU A CD2   1 
ATOM   2887  N  N     . THR A 1  375  ? 116.400 24.305  -7.756  1.00 68.40  ? 375  THR A N     1 
ATOM   2888  C  CA    . THR A 1  375  ? 117.347 23.474  -8.398  1.00 68.63  ? 375  THR A CA    1 
ATOM   2889  C  C     . THR A 1  375  ? 118.374 24.306  -9.167  1.00 77.96  ? 375  THR A C     1 
ATOM   2890  O  O     . THR A 1  375  ? 118.055 25.408  -9.617  1.00 80.48  ? 375  THR A O     1 
ATOM   2891  C  CB    . THR A 1  375  ? 116.464 22.573  -9.242  1.00 77.03  ? 375  THR A CB    1 
ATOM   2892  O  OG1   . THR A 1  375  ? 116.704 21.220  -8.905  1.00 85.74  ? 375  THR A OG1   1 
ATOM   2893  C  CG2   . THR A 1  375  ? 116.456 22.893  -10.766 1.00 71.21  ? 375  THR A CG2   1 
ATOM   2894  N  N     . TYR A 1  376  ? 119.610 23.809  -9.305  1.00 74.23  ? 376  TYR A N     1 
ATOM   2895  C  CA    . TYR A 1  376  ? 120.610 24.484  -10.126 1.00 73.25  ? 376  TYR A CA    1 
ATOM   2896  C  C     . TYR A 1  376  ? 121.028 23.476  -11.181 1.00 79.14  ? 376  TYR A C     1 
ATOM   2897  O  O     . TYR A 1  376  ? 121.286 22.322  -10.820 1.00 78.83  ? 376  TYR A O     1 
ATOM   2898  C  CB    . TYR A 1  376  ? 121.808 24.985  -9.320  1.00 73.69  ? 376  TYR A CB    1 
ATOM   2899  C  CG    . TYR A 1  376  ? 122.950 25.471  -10.184 1.00 75.32  ? 376  TYR A CG    1 
ATOM   2900  C  CD1   . TYR A 1  376  ? 122.942 26.746  -10.732 1.00 77.30  ? 376  TYR A CD1   1 
ATOM   2901  C  CD2   . TYR A 1  376  ? 124.037 24.652  -10.462 1.00 76.83  ? 376  TYR A CD2   1 
ATOM   2902  C  CE1   . TYR A 1  376  ? 123.973 27.184  -11.564 1.00 78.69  ? 376  TYR A CE1   1 
ATOM   2903  C  CE2   . TYR A 1  376  ? 125.079 25.082  -11.282 1.00 78.05  ? 376  TYR A CE2   1 
ATOM   2904  C  CZ    . TYR A 1  376  ? 125.052 26.356  -11.818 1.00 85.23  ? 376  TYR A CZ    1 
ATOM   2905  O  OH    . TYR A 1  376  ? 126.087 26.783  -12.614 1.00 87.26  ? 376  TYR A OH    1 
ATOM   2906  N  N     . PRO A 1  377  ? 121.080 23.867  -12.481 1.00 77.17  ? 377  PRO A N     1 
ATOM   2907  C  CA    . PRO A 1  377  ? 121.445 22.898  -13.532 1.00 77.04  ? 377  PRO A CA    1 
ATOM   2908  C  C     . PRO A 1  377  ? 122.935 22.775  -13.731 1.00 78.21  ? 377  PRO A C     1 
ATOM   2909  O  O     . PRO A 1  377  ? 123.533 23.590  -14.433 1.00 76.98  ? 377  PRO A O     1 
ATOM   2910  C  CB    . PRO A 1  377  ? 120.751 23.450  -14.777 1.00 79.33  ? 377  PRO A CB    1 
ATOM   2911  C  CG    . PRO A 1  377  ? 120.542 24.913  -14.502 1.00 83.70  ? 377  PRO A CG    1 
ATOM   2912  C  CD    . PRO A 1  377  ? 120.789 25.192  -13.058 1.00 78.93  ? 377  PRO A CD    1 
ATOM   2913  N  N     . GLU A 1  378  ? 123.536 21.773  -13.074 1.00 74.37  ? 378  GLU A N     1 
ATOM   2914  C  CA    . GLU A 1  378  ? 124.977 21.527  -13.141 1.00 73.93  ? 378  GLU A CA    1 
ATOM   2915  C  C     . GLU A 1  378  ? 125.315 20.634  -14.332 1.00 80.64  ? 378  GLU A C     1 
ATOM   2916  O  O     . GLU A 1  378  ? 124.589 19.674  -14.585 1.00 80.70  ? 378  GLU A O     1 
ATOM   2917  C  CB    . GLU A 1  378  ? 125.491 20.926  -11.826 1.00 74.23  ? 378  GLU A CB    1 
ATOM   2918  C  CG    . GLU A 1  378  ? 126.991 21.040  -11.695 1.00 79.24  ? 378  GLU A CG    1 
ATOM   2919  C  CD    . GLU A 1  378  ? 127.486 21.194  -10.276 1.00 103.87 ? 378  GLU A CD    1 
ATOM   2920  O  OE1   . GLU A 1  378  ? 127.428 20.191  -9.535  1.00 74.66  ? 378  GLU A OE1   1 
ATOM   2921  O  OE2   . GLU A 1  378  ? 127.952 22.298  -9.906  1.00 119.45 ? 378  GLU A OE2   1 
ATOM   2922  N  N     . VAL A 1  379  ? 126.400 20.958  -15.074 1.00 78.19  ? 379  VAL A N     1 
ATOM   2923  C  CA    . VAL A 1  379  ? 126.840 20.136  -16.211 1.00 78.25  ? 379  VAL A CA    1 
ATOM   2924  C  C     . VAL A 1  379  ? 127.750 18.994  -15.783 1.00 83.72  ? 379  VAL A C     1 
ATOM   2925  O  O     . VAL A 1  379  ? 128.664 19.206  -14.979 1.00 83.84  ? 379  VAL A O     1 
ATOM   2926  C  CB    . VAL A 1  379  ? 127.422 20.945  -17.389 1.00 81.15  ? 379  VAL A CB    1 
ATOM   2927  C  CG1   . VAL A 1  379  ? 128.578 20.216  -18.064 1.00 81.28  ? 379  VAL A CG1   1 
ATOM   2928  C  CG2   . VAL A 1  379  ? 126.339 21.227  -18.404 1.00 80.62  ? 379  VAL A CG2   1 
ATOM   2929  N  N     . VAL A 1  380  ? 127.516 17.794  -16.352 1.00 80.59  ? 380  VAL A N     1 
ATOM   2930  C  CA    . VAL A 1  380  ? 128.342 16.629  -16.074 1.00 81.12  ? 380  VAL A CA    1 
ATOM   2931  C  C     . VAL A 1  380  ? 129.730 16.814  -16.706 1.00 86.12  ? 380  VAL A C     1 
ATOM   2932  O  O     . VAL A 1  380  ? 129.903 16.908  -17.922 1.00 85.42  ? 380  VAL A O     1 
ATOM   2933  C  CB    . VAL A 1  380  ? 127.670 15.292  -16.395 1.00 85.39  ? 380  VAL A CB    1 
ATOM   2934  C  CG1   . VAL A 1  380  ? 128.604 14.143  -16.066 1.00 86.10  ? 380  VAL A CG1   1 
ATOM   2935  C  CG2   . VAL A 1  380  ? 126.372 15.143  -15.619 1.00 84.75  ? 380  VAL A CG2   1 
ATOM   2936  N  N     . THR A 1  381  ? 130.694 16.950  -15.819 1.00 83.81  ? 381  THR A N     1 
ATOM   2937  C  CA    . THR A 1  381  ? 132.076 17.260  -16.077 1.00 84.23  ? 381  THR A CA    1 
ATOM   2938  C  C     . THR A 1  381  ? 132.919 16.229  -15.324 1.00 88.73  ? 381  THR A C     1 
ATOM   2939  O  O     . THR A 1  381  ? 132.409 15.629  -14.386 1.00 85.60  ? 381  THR A O     1 
ATOM   2940  C  CB    . THR A 1  381  ? 132.291 18.732  -15.645 1.00 95.74  ? 381  THR A CB    1 
ATOM   2941  O  OG1   . THR A 1  381  ? 133.221 19.359  -16.509 1.00 99.71  ? 381  THR A OG1   1 
ATOM   2942  C  CG2   . THR A 1  381  ? 132.719 18.894  -14.188 1.00 94.36  ? 381  THR A CG2   1 
ATOM   2943  N  N     . PRO A 1  382  ? 134.198 15.995  -15.702 1.00 89.82  ? 382  PRO A N     1 
ATOM   2944  C  CA    . PRO A 1  382  ? 134.996 14.986  -14.989 1.00 91.13  ? 382  PRO A CA    1 
ATOM   2945  C  C     . PRO A 1  382  ? 135.237 15.345  -13.543 1.00 98.33  ? 382  PRO A C     1 
ATOM   2946  O  O     . PRO A 1  382  ? 135.295 14.437  -12.706 1.00 98.70  ? 382  PRO A O     1 
ATOM   2947  C  CB    . PRO A 1  382  ? 136.303 14.943  -15.778 1.00 93.40  ? 382  PRO A CB    1 
ATOM   2948  C  CG    . PRO A 1  382  ? 135.991 15.554  -17.097 1.00 97.55  ? 382  PRO A CG    1 
ATOM   2949  C  CD    . PRO A 1  382  ? 134.977 16.595  -16.806 1.00 92.26  ? 382  PRO A CD    1 
ATOM   2950  N  N     . TYR A 1  383  ? 135.317 16.666  -13.255 1.00 96.55  ? 383  TYR A N     1 
ATOM   2951  C  CA    . TYR A 1  383  ? 135.530 17.222  -11.921 1.00 97.49  ? 383  TYR A CA    1 
ATOM   2952  C  C     . TYR A 1  383  ? 134.380 16.877  -10.966 1.00 101.34 ? 383  TYR A C     1 
ATOM   2953  O  O     . TYR A 1  383  ? 134.640 16.639  -9.782  1.00 101.79 ? 383  TYR A O     1 
ATOM   2954  C  CB    . TYR A 1  383  ? 135.754 18.753  -11.957 1.00 99.38  ? 383  TYR A CB    1 
ATOM   2955  C  CG    . TYR A 1  383  ? 136.372 19.291  -13.229 1.00 103.16 ? 383  TYR A CG    1 
ATOM   2956  C  CD1   . TYR A 1  383  ? 137.631 18.865  -13.657 1.00 106.23 ? 383  TYR A CD1   1 
ATOM   2957  C  CD2   . TYR A 1  383  ? 135.737 20.283  -13.966 1.00 104.13 ? 383  TYR A CD2   1 
ATOM   2958  C  CE1   . TYR A 1  383  ? 138.208 19.369  -14.827 1.00 107.84 ? 383  TYR A CE1   1 
ATOM   2959  C  CE2   . TYR A 1  383  ? 136.299 20.790  -15.138 1.00 105.76 ? 383  TYR A CE2   1 
ATOM   2960  C  CZ    . TYR A 1  383  ? 137.537 20.336  -15.564 1.00 114.54 ? 383  TYR A CZ    1 
ATOM   2961  O  OH    . TYR A 1  383  ? 138.068 20.849  -16.726 1.00 115.89 ? 383  TYR A OH    1 
ATOM   2962  N  N     . ASN A 1  384  ? 133.123 16.800  -11.482 1.00 96.09  ? 384  ASN A N     1 
ATOM   2963  C  CA    . ASN A 1  384  ? 131.950 16.518  -10.644 1.00 94.70  ? 384  ASN A CA    1 
ATOM   2964  C  C     . ASN A 1  384  ? 131.234 15.169  -10.829 1.00 96.12  ? 384  ASN A C     1 
ATOM   2965  O  O     . ASN A 1  384  ? 130.425 14.783  -9.985  1.00 94.92  ? 384  ASN A O     1 
ATOM   2966  C  CB    . ASN A 1  384  ? 130.954 17.680  -10.719 1.00 93.15  ? 384  ASN A CB    1 
ATOM   2967  C  CG    . ASN A 1  384  ? 130.173 17.797  -12.002 1.00 97.22  ? 384  ASN A CG    1 
ATOM   2968  O  OD1   . ASN A 1  384  ? 129.794 16.817  -12.624 1.00 76.16  ? 384  ASN A OD1   1 
ATOM   2969  N  ND2   . ASN A 1  384  ? 129.831 19.020  -12.374 1.00 96.13  ? 384  ASN A ND2   1 
ATOM   2970  N  N     . ILE A 1  385  ? 131.495 14.492  -11.951 1.00 91.47  ? 385  ILE A N     1 
ATOM   2971  C  CA    . ILE A 1  385  ? 130.849 13.246  -12.356 1.00 90.12  ? 385  ILE A CA    1 
ATOM   2972  C  C     . ILE A 1  385  ? 130.418 12.365  -11.216 1.00 94.26  ? 385  ILE A C     1 
ATOM   2973  O  O     . ILE A 1  385  ? 129.227 12.112  -11.102 1.00 93.60  ? 385  ILE A O     1 
ATOM   2974  C  CB    . ILE A 1  385  ? 131.590 12.541  -13.526 1.00 93.00  ? 385  ILE A CB    1 
ATOM   2975  C  CG1   . ILE A 1  385  ? 130.682 11.824  -14.570 1.00 92.04  ? 385  ILE A CG1   1 
ATOM   2976  C  CG2   . ILE A 1  385  ? 132.844 11.789  -13.121 1.00 95.54  ? 385  ILE A CG2   1 
ATOM   2977  C  CD1   . ILE A 1  385  ? 129.758 10.723  -14.150 1.00 93.26  ? 385  ILE A CD1   1 
ATOM   2978  N  N     . ASP A 1  386  ? 131.347 12.031  -10.300 1.00 92.27  ? 386  ASP A N     1 
ATOM   2979  C  CA    . ASP A 1  386  ? 131.134 11.153  -9.131  1.00 92.10  ? 386  ASP A CA    1 
ATOM   2980  C  C     . ASP A 1  386  ? 130.181 11.742  -8.120  1.00 89.75  ? 386  ASP A C     1 
ATOM   2981  O  O     . ASP A 1  386  ? 129.283 11.040  -7.647  1.00 87.40  ? 386  ASP A O     1 
ATOM   2982  C  CB    . ASP A 1  386  ? 132.468 10.793  -8.452  1.00 95.93  ? 386  ASP A CB    1 
ATOM   2983  C  CG    . ASP A 1  386  ? 133.669 10.890  -9.374  1.00 117.47 ? 386  ASP A CG    1 
ATOM   2984  O  OD1   . ASP A 1  386  ? 134.075 12.054  -9.713  1.00 120.68 ? 386  ASP A OD1   1 
ATOM   2985  O  OD2   . ASP A 1  386  ? 134.181 9.813   -9.799  1.00 122.58 ? 386  ASP A OD2   1 
ATOM   2986  N  N     . ARG A 1  387  ? 130.376 13.032  -7.800  1.00 84.58  ? 387  ARG A N     1 
ATOM   2987  C  CA    . ARG A 1  387  ? 129.522 13.759  -6.867  1.00 83.93  ? 387  ARG A CA    1 
ATOM   2988  C  C     . ARG A 1  387  ? 128.085 13.783  -7.391  1.00 84.96  ? 387  ARG A C     1 
ATOM   2989  O  O     . ARG A 1  387  ? 127.173 13.318  -6.700  1.00 84.70  ? 387  ARG A O     1 
ATOM   2990  C  CB    . ARG A 1  387  ? 130.063 15.180  -6.649  1.00 86.15  ? 387  ARG A CB    1 
ATOM   2991  C  CG    . ARG A 1  387  ? 129.220 16.049  -5.706  1.00 99.20  ? 387  ARG A CG    1 
ATOM   2992  C  CD    . ARG A 1  387  ? 129.906 17.372  -5.383  1.00 111.10 ? 387  ARG A CD    1 
ATOM   2993  N  NE    . ARG A 1  387  ? 130.113 18.203  -6.569  1.00 112.31 ? 387  ARG A NE    1 
ATOM   2994  C  CZ    . ARG A 1  387  ? 129.217 19.061  -7.047  1.00 122.00 ? 387  ARG A CZ    1 
ATOM   2995  N  NH1   . ARG A 1  387  ? 128.047 19.226  -6.432  1.00 98.37  ? 387  ARG A NH1   1 
ATOM   2996  N  NH2   . ARG A 1  387  ? 129.485 19.766  -8.138  1.00 109.91 ? 387  ARG A NH2   1 
ATOM   2997  N  N     . LEU A 1  388  ? 127.900 14.274  -8.633  1.00 78.69  ? 388  LEU A N     1 
ATOM   2998  C  CA    . LEU A 1  388  ? 126.596 14.326  -9.278  1.00 76.64  ? 388  LEU A CA    1 
ATOM   2999  C  C     . LEU A 1  388  ? 125.927 12.943  -9.331  1.00 79.95  ? 388  LEU A C     1 
ATOM   3000  O  O     . LEU A 1  388  ? 124.750 12.847  -8.977  1.00 79.25  ? 388  LEU A O     1 
ATOM   3001  C  CB    . LEU A 1  388  ? 126.693 14.951  -10.676 1.00 75.79  ? 388  LEU A CB    1 
ATOM   3002  C  CG    . LEU A 1  388  ? 126.906 16.443  -10.762 1.00 78.35  ? 388  LEU A CG    1 
ATOM   3003  C  CD1   . LEU A 1  388  ? 126.518 16.937  -12.107 1.00 78.21  ? 388  LEU A CD1   1 
ATOM   3004  C  CD2   . LEU A 1  388  ? 126.043 17.163  -9.798  1.00 79.26  ? 388  LEU A CD2   1 
ATOM   3005  N  N     . THR A 1  389  ? 126.692 11.865  -9.684  1.00 76.03  ? 389  THR A N     1 
ATOM   3006  C  CA    . THR A 1  389  ? 126.154 10.497  -9.728  1.00 75.69  ? 389  THR A CA    1 
ATOM   3007  C  C     . THR A 1  389  ? 125.559 10.112  -8.392  1.00 79.52  ? 389  THR A C     1 
ATOM   3008  O  O     . THR A 1  389  ? 124.553 9.401   -8.367  1.00 79.16  ? 389  THR A O     1 
ATOM   3009  C  CB    . THR A 1  389  ? 127.151 9.465   -10.241 1.00 84.19  ? 389  THR A CB    1 
ATOM   3010  O  OG1   . THR A 1  389  ? 127.842 9.989   -11.361 1.00 87.54  ? 389  THR A OG1   1 
ATOM   3011  C  CG2   . THR A 1  389  ? 126.462 8.219   -10.725 1.00 85.32  ? 389  THR A CG2   1 
ATOM   3012  N  N     . GLN A 1  390  ? 126.129 10.646  -7.292  1.00 75.79  ? 390  GLN A N     1 
ATOM   3013  C  CA    . GLN A 1  390  ? 125.627 10.393  -5.959  1.00 75.48  ? 390  GLN A CA    1 
ATOM   3014  C  C     . GLN A 1  390  ? 124.392 11.196  -5.650  1.00 80.48  ? 390  GLN A C     1 
ATOM   3015  O  O     . GLN A 1  390  ? 123.472 10.628  -5.077  1.00 82.26  ? 390  GLN A O     1 
ATOM   3016  C  CB    . GLN A 1  390  ? 126.709 10.528  -4.876  1.00 77.09  ? 390  GLN A CB    1 
ATOM   3017  C  CG    . GLN A 1  390  ? 126.333 9.919   -3.513  1.00 98.21  ? 390  GLN A CG    1 
ATOM   3018  C  CD    . GLN A 1  390  ? 125.730 8.522   -3.581  1.00 133.60 ? 390  GLN A CD    1 
ATOM   3019  O  OE1   . GLN A 1  390  ? 126.211 7.624   -4.294  1.00 133.64 ? 390  GLN A OE1   1 
ATOM   3020  N  NE2   . GLN A 1  390  ? 124.666 8.301   -2.818  1.00 128.73 ? 390  GLN A NE2   1 
ATOM   3021  N  N     . LEU A 1  391  ? 124.325 12.480  -6.019  1.00 76.27  ? 391  LEU A N     1 
ATOM   3022  C  CA    . LEU A 1  391  ? 123.107 13.254  -5.730  1.00 76.42  ? 391  LEU A CA    1 
ATOM   3023  C  C     . LEU A 1  391  ? 121.893 12.691  -6.505  1.00 81.59  ? 391  LEU A C     1 
ATOM   3024  O  O     . LEU A 1  391  ? 120.760 12.769  -6.020  1.00 81.90  ? 391  LEU A O     1 
ATOM   3025  C  CB    . LEU A 1  391  ? 123.276 14.723  -6.098  1.00 76.39  ? 391  LEU A CB    1 
ATOM   3026  C  CG    . LEU A 1  391  ? 124.110 15.584  -5.198  1.00 81.41  ? 391  LEU A CG    1 
ATOM   3027  C  CD1   . LEU A 1  391  ? 125.396 15.970  -5.881  1.00 81.81  ? 391  LEU A CD1   1 
ATOM   3028  C  CD2   . LEU A 1  391  ? 123.392 16.868  -4.939  1.00 85.30  ? 391  LEU A CD2   1 
ATOM   3029  N  N     . VAL A 1  392  ? 122.135 12.147  -7.717  1.00 77.72  ? 392  VAL A N     1 
ATOM   3030  C  CA    . VAL A 1  392  ? 121.087 11.551  -8.537  1.00 77.61  ? 392  VAL A CA    1 
ATOM   3031  C  C     . VAL A 1  392  ? 120.605 10.295  -7.787  1.00 86.80  ? 392  VAL A C     1 
ATOM   3032  O  O     . VAL A 1  392  ? 119.394 10.109  -7.578  1.00 87.42  ? 392  VAL A O     1 
ATOM   3033  C  CB    . VAL A 1  392  ? 121.591 11.248  -9.963  1.00 80.12  ? 392  VAL A CB    1 
ATOM   3034  C  CG1   . VAL A 1  392  ? 120.544 10.500  -10.753 1.00 79.71  ? 392  VAL A CG1   1 
ATOM   3035  C  CG2   . VAL A 1  392  ? 121.963 12.527  -10.687 1.00 79.29  ? 392  VAL A CG2   1 
ATOM   3036  N  N     . ARG A 1  393  ? 121.578 9.482   -7.307  1.00 85.48  ? 393  ARG A N     1 
ATOM   3037  C  CA    . ARG A 1  393  ? 121.347 8.277   -6.503  1.00 85.76  ? 393  ARG A CA    1 
ATOM   3038  C  C     . ARG A 1  393  ? 120.456 8.677   -5.313  1.00 88.51  ? 393  ARG A C     1 
ATOM   3039  O  O     . ARG A 1  393  ? 119.418 8.051   -5.111  1.00 89.23  ? 393  ARG A O     1 
ATOM   3040  C  CB    . ARG A 1  393  ? 122.693 7.666   -6.039  1.00 87.28  ? 393  ARG A CB    1 
ATOM   3041  C  CG    . ARG A 1  393  ? 122.815 6.150   -6.207  1.00 106.18 ? 393  ARG A CG    1 
ATOM   3042  C  CD    . ARG A 1  393  ? 123.944 5.732   -7.144  1.00 128.13 ? 393  ARG A CD    1 
ATOM   3043  N  NE    . ARG A 1  393  ? 123.430 5.386   -8.476  1.00 153.31 ? 393  ARG A NE    1 
ATOM   3044  C  CZ    . ARG A 1  393  ? 124.173 4.934   -9.486  1.00 176.39 ? 393  ARG A CZ    1 
ATOM   3045  N  NH1   . ARG A 1  393  ? 125.484 4.763   -9.334  1.00 164.58 ? 393  ARG A NH1   1 
ATOM   3046  N  NH2   . ARG A 1  393  ? 123.609 4.650   -10.656 1.00 165.20 ? 393  ARG A NH2   1 
ATOM   3047  N  N     . ASN A 1  394  ? 120.798 9.791   -4.621  1.00 82.74  ? 394  ASN A N     1 
ATOM   3048  C  CA    . ASN A 1  394  ? 120.058 10.343  -3.489  1.00 81.91  ? 394  ASN A CA    1 
ATOM   3049  C  C     . ASN A 1  394  ? 118.623 10.688  -3.839  1.00 85.76  ? 394  ASN A C     1 
ATOM   3050  O  O     . ASN A 1  394  ? 117.709 10.462  -3.033  1.00 86.32  ? 394  ASN A O     1 
ATOM   3051  C  CB    . ASN A 1  394  ? 120.757 11.565  -2.961  1.00 80.87  ? 394  ASN A CB    1 
ATOM   3052  C  CG    . ASN A 1  394  ? 121.801 11.233  -1.967  1.00 104.15 ? 394  ASN A CG    1 
ATOM   3053  O  OD1   . ASN A 1  394  ? 122.815 10.607  -2.282  1.00 93.15  ? 394  ASN A OD1   1 
ATOM   3054  N  ND2   . ASN A 1  394  ? 121.551 11.622  -0.730  1.00 104.67 ? 394  ASN A ND2   1 
ATOM   3055  N  N     . GLY A 1  395  ? 118.434 11.241  -5.026  1.00 80.99  ? 395  GLY A N     1 
ATOM   3056  C  CA    . GLY A 1  395  ? 117.098 11.549  -5.508  1.00 80.79  ? 395  GLY A CA    1 
ATOM   3057  C  C     . GLY A 1  395  ? 116.389 12.756  -4.935  1.00 83.31  ? 395  GLY A C     1 
ATOM   3058  O  O     . GLY A 1  395  ? 116.950 13.467  -4.109  1.00 84.22  ? 395  GLY A O     1 
ATOM   3059  N  N     . PRO A 1  396  ? 115.135 12.991  -5.386  1.00 78.48  ? 396  PRO A N     1 
ATOM   3060  C  CA    . PRO A 1  396  ? 114.412 14.218  -5.016  1.00 79.30  ? 396  PRO A CA    1 
ATOM   3061  C  C     . PRO A 1  396  ? 113.998 14.512  -3.578  1.00 87.43  ? 396  PRO A C     1 
ATOM   3062  O  O     . PRO A 1  396  ? 113.558 15.639  -3.307  1.00 86.23  ? 396  PRO A O     1 
ATOM   3063  C  CB    . PRO A 1  396  ? 113.191 14.181  -5.932  1.00 80.44  ? 396  PRO A CB    1 
ATOM   3064  C  CG    . PRO A 1  396  ? 113.047 12.792  -6.346  1.00 83.61  ? 396  PRO A CG    1 
ATOM   3065  C  CD    . PRO A 1  396  ? 114.411 12.265  -6.446  1.00 79.13  ? 396  PRO A CD    1 
ATOM   3066  N  N     . ASN A 1  397  ? 114.127 13.535  -2.672  1.00 88.00  ? 397  ASN A N     1 
ATOM   3067  C  CA    . ASN A 1  397  ? 113.656 13.688  -1.293  1.00 89.78  ? 397  ASN A CA    1 
ATOM   3068  C  C     . ASN A 1  397  ? 114.711 13.596  -0.178  1.00 97.42  ? 397  ASN A C     1 
ATOM   3069  O  O     . ASN A 1  397  ? 114.391 13.800  1.002   1.00 98.33  ? 397  ASN A O     1 
ATOM   3070  C  CB    . ASN A 1  397  ? 112.487 12.755  -1.039  1.00 91.51  ? 397  ASN A CB    1 
ATOM   3071  C  CG    . ASN A 1  397  ? 112.003 12.093  -2.292  1.00 113.74 ? 397  ASN A CG    1 
ATOM   3072  O  OD1   . ASN A 1  397  ? 111.158 12.650  -3.017  1.00 105.64 ? 397  ASN A OD1   1 
ATOM   3073  N  ND2   . ASN A 1  397  ? 112.644 10.962  -2.635  1.00 104.69 ? 397  ASN A ND2   1 
ATOM   3074  N  N     . GLU A 1  398  ? 115.961 13.300  -0.543  1.00 95.04  ? 398  GLU A N     1 
ATOM   3075  C  CA    . GLU A 1  398  ? 117.081 13.274  0.407   1.00 95.40  ? 398  GLU A CA    1 
ATOM   3076  C  C     . GLU A 1  398  ? 117.596 14.700  0.374   1.00 92.95  ? 398  GLU A C     1 
ATOM   3077  O  O     . GLU A 1  398  ? 117.457 15.261  -0.717  1.00 90.78  ? 398  GLU A O     1 
ATOM   3078  C  CB    . GLU A 1  398  ? 118.188 12.316  -0.123  1.00 97.96  ? 398  GLU A CB    1 
ATOM   3079  C  CG    . GLU A 1  398  ? 118.376 11.031  0.683   1.00 117.08 ? 398  GLU A CG    1 
ATOM   3080  C  CD    . GLU A 1  398  ? 117.197 10.076  0.619   1.00 157.51 ? 398  GLU A CD    1 
ATOM   3081  O  OE1   . GLU A 1  398  ? 117.169 9.226   -0.303  1.00 158.95 ? 398  GLU A OE1   1 
ATOM   3082  O  OE2   . GLU A 1  398  ? 116.284 10.206  1.470   1.00 158.40 ? 398  GLU A OE2   1 
ATOM   3083  N  N     . HIS A 1  399  ? 118.172 15.314  1.480   1.00 86.81  ? 399  HIS A N     1 
ATOM   3084  C  CA    . HIS A 1  399  ? 118.655 16.633  1.157   1.00 86.59  ? 399  HIS A CA    1 
ATOM   3085  C  C     . HIS A 1  399  ? 119.678 16.686  0.053   1.00 94.90  ? 399  HIS A C     1 
ATOM   3086  O  O     . HIS A 1  399  ? 119.254 17.088  -1.036  1.00 100.28 ? 399  HIS A O     1 
ATOM   3087  C  CB    . HIS A 1  399  ? 118.915 17.709  2.201   1.00 87.13  ? 399  HIS A CB    1 
ATOM   3088  C  CG    . HIS A 1  399  ? 119.287 18.992  1.474   1.00 89.59  ? 399  HIS A CG    1 
ATOM   3089  N  ND1   . HIS A 1  399  ? 120.597 19.461  1.450   1.00 91.10  ? 399  HIS A ND1   1 
ATOM   3090  C  CD2   . HIS A 1  399  ? 118.565 19.709  0.569   1.00 90.10  ? 399  HIS A CD2   1 
ATOM   3091  C  CE1   . HIS A 1  399  ? 120.603 20.490  0.611   1.00 89.66  ? 399  HIS A CE1   1 
ATOM   3092  N  NE2   . HIS A 1  399  ? 119.414 20.661  0.036   1.00 89.51  ? 399  HIS A NE2   1 
ATOM   3093  N  N     . PRO A 1  400  ? 120.992 16.445  0.193   1.00 85.83  ? 400  PRO A N     1 
ATOM   3094  C  CA    . PRO A 1  400  ? 121.842 16.639  -1.004  1.00 83.90  ? 400  PRO A CA    1 
ATOM   3095  C  C     . PRO A 1  400  ? 121.401 15.660  -2.115  1.00 86.53  ? 400  PRO A C     1 
ATOM   3096  O  O     . PRO A 1  400  ? 121.821 14.500  -2.151  1.00 88.07  ? 400  PRO A O     1 
ATOM   3097  C  CB    . PRO A 1  400  ? 123.265 16.504  -0.473  1.00 85.64  ? 400  PRO A CB    1 
ATOM   3098  C  CG    . PRO A 1  400  ? 123.117 16.531  1.044   1.00 90.54  ? 400  PRO A CG    1 
ATOM   3099  C  CD    . PRO A 1  400  ? 121.766 15.999  1.358   1.00 86.17  ? 400  PRO A CD    1 
ATOM   3100  N  N     . GLY A 1  401  ? 120.434 16.111  -2.927  1.00 78.99  ? 401  GLY A N     1 
ATOM   3101  C  CA    . GLY A 1  401  ? 119.823 15.299  -3.967  1.00 77.34  ? 401  GLY A CA    1 
ATOM   3102  C  C     . GLY A 1  401  ? 119.574 16.032  -5.255  1.00 78.08  ? 401  GLY A C     1 
ATOM   3103  O  O     . GLY A 1  401  ? 119.879 17.218  -5.363  1.00 77.47  ? 401  GLY A O     1 
ATOM   3104  N  N     . ALA A 1  402  ? 119.012 15.328  -6.233  1.00 73.64  ? 402  ALA A N     1 
ATOM   3105  C  CA    . ALA A 1  402  ? 118.668 15.912  -7.527  1.00 73.42  ? 402  ALA A CA    1 
ATOM   3106  C  C     . ALA A 1  402  ? 117.176 15.649  -7.901  1.00 76.82  ? 402  ALA A C     1 
ATOM   3107  O  O     . ALA A 1  402  ? 116.562 14.749  -7.344  1.00 75.54  ? 402  ALA A O     1 
ATOM   3108  C  CB    . ALA A 1  402  ? 119.608 15.380  -8.592  1.00 74.35  ? 402  ALA A CB    1 
ATOM   3109  N  N     . LYS A 1  403  ? 116.597 16.455  -8.813  1.00 74.00  ? 403  LYS A N     1 
ATOM   3110  C  CA    . LYS A 1  403  ? 115.192 16.342  -9.256  1.00 73.54  ? 403  LYS A CA    1 
ATOM   3111  C  C     . LYS A 1  403  ? 115.051 15.785  -10.665 1.00 76.96  ? 403  LYS A C     1 
ATOM   3112  O  O     . LYS A 1  403  ? 114.098 15.045  -10.911 1.00 76.85  ? 403  LYS A O     1 
ATOM   3113  C  CB    . LYS A 1  403  ? 114.460 17.696  -9.166  1.00 75.11  ? 403  LYS A CB    1 
ATOM   3114  C  CG    . LYS A 1  403  ? 114.164 18.155  -7.732  1.00 83.53  ? 403  LYS A CG    1 
ATOM   3115  C  CD    . LYS A 1  403  ? 113.638 19.590  -7.669  1.00 85.93  ? 403  LYS A CD    1 
ATOM   3116  C  CE    . LYS A 1  403  ? 112.168 19.671  -8.002  1.00 101.31 ? 403  LYS A CE    1 
ATOM   3117  N  NZ    . LYS A 1  403  ? 111.550 20.922  -7.499  1.00 116.80 ? 403  LYS A NZ    1 
ATOM   3118  N  N     . TYR A 1  404  ? 115.972 16.190  -11.592 1.00 72.81  ? 404  TYR A N     1 
ATOM   3119  C  CA    . TYR A 1  404  ? 116.038 15.819  -13.020 1.00 72.36  ? 404  TYR A CA    1 
ATOM   3120  C  C     . TYR A 1  404  ? 117.455 15.565  -13.508 1.00 74.41  ? 404  TYR A C     1 
ATOM   3121  O  O     . TYR A 1  404  ? 118.428 16.038  -12.899 1.00 73.42  ? 404  TYR A O     1 
ATOM   3122  C  CB    . TYR A 1  404  ? 115.443 16.925  -13.925 1.00 74.10  ? 404  TYR A CB    1 
ATOM   3123  C  CG    . TYR A 1  404  ? 113.966 17.146  -13.730 1.00 78.57  ? 404  TYR A CG    1 
ATOM   3124  C  CD1   . TYR A 1  404  ? 113.495 18.006  -12.748 1.00 81.55  ? 404  TYR A CD1   1 
ATOM   3125  C  CD2   . TYR A 1  404  ? 113.034 16.450  -14.483 1.00 80.76  ? 404  TYR A CD2   1 
ATOM   3126  C  CE1   . TYR A 1  404  ? 112.130 18.172  -12.520 1.00 84.02  ? 404  TYR A CE1   1 
ATOM   3127  C  CE2   . TYR A 1  404  ? 111.663 16.623  -14.281 1.00 82.66  ? 404  TYR A CE2   1 
ATOM   3128  C  CZ    . TYR A 1  404  ? 111.214 17.494  -13.301 1.00 92.37  ? 404  TYR A CZ    1 
ATOM   3129  O  OH    . TYR A 1  404  ? 109.866 17.683  -13.088 1.00 96.57  ? 404  TYR A OH    1 
ATOM   3130  N  N     . VAL A 1  405  ? 117.554 14.814  -14.630 1.00 70.25  ? 405  VAL A N     1 
ATOM   3131  C  CA    . VAL A 1  405  ? 118.782 14.541  -15.384 1.00 69.75  ? 405  VAL A CA    1 
ATOM   3132  C  C     . VAL A 1  405  ? 118.442 14.925  -16.818 1.00 79.16  ? 405  VAL A C     1 
ATOM   3133  O  O     . VAL A 1  405  ? 117.541 14.340  -17.411 1.00 79.18  ? 405  VAL A O     1 
ATOM   3134  C  CB    . VAL A 1  405  ? 119.377 13.101  -15.268 1.00 70.52  ? 405  VAL A CB    1 
ATOM   3135  C  CG1   . VAL A 1  405  ? 120.572 12.933  -16.196 1.00 69.26  ? 405  VAL A CG1   1 
ATOM   3136  C  CG2   . VAL A 1  405  ? 119.798 12.796  -13.845 1.00 69.85  ? 405  VAL A CG2   1 
ATOM   3137  N  N     . ILE A 1  406  ? 119.109 15.946  -17.349 1.00 79.66  ? 406  ILE A N     1 
ATOM   3138  C  CA    . ILE A 1  406  ? 118.864 16.391  -18.719 1.00 81.22  ? 406  ILE A CA    1 
ATOM   3139  C  C     . ILE A 1  406  ? 119.931 15.817  -19.635 1.00 88.40  ? 406  ILE A C     1 
ATOM   3140  O  O     . ILE A 1  406  ? 121.135 15.973  -19.397 1.00 86.20  ? 406  ILE A O     1 
ATOM   3141  C  CB    . ILE A 1  406  ? 118.643 17.923  -18.859 1.00 83.99  ? 406  ILE A CB    1 
ATOM   3142  C  CG1   . ILE A 1  406  ? 117.530 18.400  -17.902 1.00 84.10  ? 406  ILE A CG1   1 
ATOM   3143  C  CG2   . ILE A 1  406  ? 118.303 18.295  -20.305 1.00 84.70  ? 406  ILE A CG2   1 
ATOM   3144  C  CD1   . ILE A 1  406  ? 117.616 19.874  -17.483 1.00 93.06  ? 406  ILE A CD1   1 
ATOM   3145  N  N     . ARG A 1  407  ? 119.464 15.108  -20.655 1.00 89.97  ? 407  ARG A N     1 
ATOM   3146  C  CA    . ARG A 1  407  ? 120.328 14.423  -21.583 1.00 93.14  ? 407  ARG A CA    1 
ATOM   3147  C  C     . ARG A 1  407  ? 120.869 15.281  -22.681 1.00 106.30 ? 407  ARG A C     1 
ATOM   3148  O  O     . ARG A 1  407  ? 120.479 16.447  -22.804 1.00 106.26 ? 407  ARG A O     1 
ATOM   3149  C  CB    . ARG A 1  407  ? 119.598 13.231  -22.156 1.00 91.72  ? 407  ARG A CB    1 
ATOM   3150  C  CG    . ARG A 1  407  ? 120.308 11.968  -21.789 1.00 95.03  ? 407  ARG A CG    1 
ATOM   3151  C  CD    . ARG A 1  407  ? 119.384 11.013  -21.101 1.00 98.90  ? 407  ARG A CD    1 
ATOM   3152  N  NE    . ARG A 1  407  ? 118.845 10.031  -22.042 1.00 105.24 ? 407  ARG A NE    1 
ATOM   3153  C  CZ    . ARG A 1  407  ? 117.645 10.099  -22.611 1.00 120.86 ? 407  ARG A CZ    1 
ATOM   3154  N  NH1   . ARG A 1  407  ? 116.823 11.109  -22.335 1.00 110.33 ? 407  ARG A NH1   1 
ATOM   3155  N  NH2   . ARG A 1  407  ? 117.252 9.154   -23.449 1.00 109.90 ? 407  ARG A NH2   1 
ATOM   3156  N  N     . ASP A 1  408  ? 121.800 14.701  -23.483 1.00 109.89 ? 408  ASP A N     1 
ATOM   3157  C  CA    . ASP A 1  408  ? 122.372 15.350  -24.671 1.00 113.13 ? 408  ASP A CA    1 
ATOM   3158  C  C     . ASP A 1  408  ? 121.208 15.583  -25.639 1.00 121.02 ? 408  ASP A C     1 
ATOM   3159  O  O     . ASP A 1  408  ? 121.046 16.697  -26.144 1.00 120.31 ? 408  ASP A O     1 
ATOM   3160  C  CB    . ASP A 1  408  ? 123.530 14.526  -25.327 1.00 116.86 ? 408  ASP A CB    1 
ATOM   3161  C  CG    . ASP A 1  408  ? 123.618 13.012  -25.063 1.00 139.97 ? 408  ASP A CG    1 
ATOM   3162  O  OD1   . ASP A 1  408  ? 122.574 12.311  -25.197 1.00 142.78 ? 408  ASP A OD1   1 
ATOM   3163  O  OD2   . ASP A 1  408  ? 124.751 12.512  -24.826 1.00 149.10 ? 408  ASP A OD2   1 
ATOM   3164  N  N     . SER A 1  409  ? 120.316 14.550  -25.748 1.00 121.11 ? 409  SER A N     1 
ATOM   3165  C  CA    . SER A 1  409  ? 119.067 14.446  -26.524 1.00 122.16 ? 409  SER A CA    1 
ATOM   3166  C  C     . SER A 1  409  ? 118.096 15.616  -26.262 1.00 127.79 ? 409  SER A C     1 
ATOM   3167  O  O     . SER A 1  409  ? 117.132 15.810  -27.014 1.00 128.25 ? 409  SER A O     1 
ATOM   3168  C  CB    . SER A 1  409  ? 118.356 13.135  -26.179 1.00 125.64 ? 409  SER A CB    1 
ATOM   3169  O  OG    . SER A 1  409  ? 117.501 13.290  -25.053 1.00 132.80 ? 409  SER A OG    1 
ATOM   3170  N  N     . GLY A 1  410  ? 118.331 16.343  -25.176 1.00 124.28 ? 410  GLY A N     1 
ATOM   3171  C  CA    . GLY A 1  410  ? 117.476 17.444  -24.768 1.00 123.82 ? 410  GLY A CA    1 
ATOM   3172  C  C     . GLY A 1  410  ? 116.358 16.972  -23.855 1.00 127.46 ? 410  GLY A C     1 
ATOM   3173  O  O     . GLY A 1  410  ? 115.849 17.784  -23.060 1.00 127.88 ? 410  GLY A O     1 
ATOM   3174  N  N     . ASP A 1  411  ? 115.966 15.642  -23.943 1.00 121.02 ? 411  ASP A N     1 
ATOM   3175  C  CA    . ASP A 1  411  ? 114.883 15.089  -23.114 1.00 118.64 ? 411  ASP A CA    1 
ATOM   3176  C  C     . ASP A 1  411  ? 115.182 14.881  -21.628 1.00 114.60 ? 411  ASP A C     1 
ATOM   3177  O  O     . ASP A 1  411  ? 116.170 14.231  -21.262 1.00 115.84 ? 411  ASP A O     1 
ATOM   3178  C  CB    . ASP A 1  411  ? 114.109 13.924  -23.749 1.00 121.21 ? 411  ASP A CB    1 
ATOM   3179  C  CG    . ASP A 1  411  ? 112.604 13.974  -23.440 1.00 133.21 ? 411  ASP A CG    1 
ATOM   3180  O  OD1   . ASP A 1  411  ? 112.204 14.655  -22.440 1.00 130.87 ? 411  ASP A OD1   1 
ATOM   3181  O  OD2   . ASP A 1  411  ? 111.826 13.351  -24.193 1.00 142.68 ? 411  ASP A OD2   1 
ATOM   3182  N  N     . ARG A 1  412  ? 114.280 15.439  -20.793 1.00 101.85 ? 412  ARG A N     1 
ATOM   3183  C  CA    . ARG A 1  412  ? 114.294 15.513  -19.339 1.00 97.51  ? 412  ARG A CA    1 
ATOM   3184  C  C     . ARG A 1  412  ? 113.867 14.206  -18.640 1.00 95.30  ? 412  ARG A C     1 
ATOM   3185  O  O     . ARG A 1  412  ? 112.741 13.748  -18.848 1.00 96.43  ? 412  ARG A O     1 
ATOM   3186  C  CB    . ARG A 1  412  ? 113.337 16.632  -18.962 1.00 94.59  ? 412  ARG A CB    1 
ATOM   3187  C  CG    . ARG A 1  412  ? 113.735 17.433  -17.774 1.00 97.03  ? 412  ARG A CG    1 
ATOM   3188  C  CD    . ARG A 1  412  ? 112.979 18.745  -17.783 1.00 94.04  ? 412  ARG A CD    1 
ATOM   3189  N  NE    . ARG A 1  412  ? 113.905 19.834  -18.072 1.00 96.61  ? 412  ARG A NE    1 
ATOM   3190  C  CZ    . ARG A 1  412  ? 113.548 21.072  -18.381 1.00 112.64 ? 412  ARG A CZ    1 
ATOM   3191  N  NH1   . ARG A 1  412  ? 112.264 21.400  -18.461 1.00 106.55 ? 412  ARG A NH1   1 
ATOM   3192  N  NH2   . ARG A 1  412  ? 114.473 21.996  -18.615 1.00 97.86  ? 412  ARG A NH2   1 
ATOM   3193  N  N     . ILE A 1  413  ? 114.759 13.617  -17.804 1.00 84.62  ? 413  ILE A N     1 
ATOM   3194  C  CA    . ILE A 1  413  ? 114.495 12.395  -17.036 1.00 81.08  ? 413  ILE A CA    1 
ATOM   3195  C  C     . ILE A 1  413  ? 114.005 12.855  -15.692 1.00 83.09  ? 413  ILE A C     1 
ATOM   3196  O  O     . ILE A 1  413  ? 114.691 13.652  -15.065 1.00 82.61  ? 413  ILE A O     1 
ATOM   3197  C  CB    . ILE A 1  413  ? 115.757 11.498  -16.848 1.00 82.88  ? 413  ILE A CB    1 
ATOM   3198  C  CG1   . ILE A 1  413  ? 116.398 11.057  -18.174 1.00 82.00  ? 413  ILE A CG1   1 
ATOM   3199  C  CG2   . ILE A 1  413  ? 115.447 10.293  -15.964 1.00 83.35  ? 413  ILE A CG2   1 
ATOM   3200  C  CD1   . ILE A 1  413  ? 117.811 10.496  -18.009 1.00 76.29  ? 413  ILE A CD1   1 
ATOM   3201  N  N     . ASP A 1  414  ? 112.864 12.336  -15.220 1.00 79.42  ? 414  ASP A N     1 
ATOM   3202  C  CA    . ASP A 1  414  ? 112.330 12.708  -13.906 1.00 79.14  ? 414  ASP A CA    1 
ATOM   3203  C  C     . ASP A 1  414  ? 112.705 11.665  -12.857 1.00 86.33  ? 414  ASP A C     1 
ATOM   3204  O  O     . ASP A 1  414  ? 112.101 10.586  -12.806 1.00 88.36  ? 414  ASP A O     1 
ATOM   3205  C  CB    . ASP A 1  414  ? 110.811 12.877  -13.962 1.00 80.39  ? 414  ASP A CB    1 
ATOM   3206  C  CG    . ASP A 1  414  ? 110.178 13.485  -12.732 1.00 89.79  ? 414  ASP A CG    1 
ATOM   3207  O  OD1   . ASP A 1  414  ? 110.884 13.624  -11.700 1.00 91.29  ? 414  ASP A OD1   1 
ATOM   3208  O  OD2   . ASP A 1  414  ? 108.986 13.868  -12.808 1.00 95.06  ? 414  ASP A OD2   1 
ATOM   3209  N  N     . LEU A 1  415  ? 113.658 12.001  -11.977 1.00 81.65  ? 415  LEU A N     1 
ATOM   3210  C  CA    . LEU A 1  415  ? 114.106 11.066  -10.942 1.00 81.08  ? 415  LEU A CA    1 
ATOM   3211  C  C     . LEU A 1  415  ? 113.035 10.717  -9.914  1.00 85.93  ? 415  LEU A C     1 
ATOM   3212  O  O     . LEU A 1  415  ? 113.286 9.925   -9.020  1.00 87.17  ? 415  LEU A O     1 
ATOM   3213  C  CB    . LEU A 1  415  ? 115.337 11.608  -10.226 1.00 80.60  ? 415  LEU A CB    1 
ATOM   3214  C  CG    . LEU A 1  415  ? 116.492 12.055  -11.074 1.00 84.59  ? 415  LEU A CG    1 
ATOM   3215  C  CD1   . LEU A 1  415  ? 117.612 12.537  -10.186 1.00 84.83  ? 415  LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A 1  415  ? 116.954 10.956  -12.042 1.00 85.45  ? 415  LEU A CD2   1 
ATOM   3217  N  N     . ARG A 1  416  ? 111.867 11.330  -10.015 1.00 81.98  ? 416  ARG A N     1 
ATOM   3218  C  CA    . ARG A 1  416  ? 110.757 11.115  -9.103  1.00 81.72  ? 416  ARG A CA    1 
ATOM   3219  C  C     . ARG A 1  416  ? 109.904 9.937   -9.595  1.00 85.73  ? 416  ARG A C     1 
ATOM   3220  O  O     . ARG A 1  416  ? 109.208 9.326   -8.779  1.00 85.39  ? 416  ARG A O     1 
ATOM   3221  C  CB    . ARG A 1  416  ? 109.924 12.397  -9.070  1.00 82.39  ? 416  ARG A CB    1 
ATOM   3222  C  CG    . ARG A 1  416  ? 108.995 12.581  -7.887  1.00 99.81  ? 416  ARG A CG    1 
ATOM   3223  C  CD    . ARG A 1  416  ? 108.122 13.822  -8.087  1.00 116.22 ? 416  ARG A CD    1 
ATOM   3224  N  NE    . ARG A 1  416  ? 108.819 14.914  -8.780  1.00 121.39 ? 416  ARG A NE    1 
ATOM   3225  C  CZ    . ARG A 1  416  ? 108.318 15.611  -9.798  1.00 134.55 ? 416  ARG A CZ    1 
ATOM   3226  N  NH1   . ARG A 1  416  ? 107.100 15.351  -10.257 1.00 108.16 ? 416  ARG A NH1   1 
ATOM   3227  N  NH2   . ARG A 1  416  ? 109.025 16.586  -10.352 1.00 133.87 ? 416  ARG A NH2   1 
ATOM   3228  N  N     . TYR A 1  417  ? 109.946 9.627   -10.930 1.00 81.58  ? 417  TYR A N     1 
ATOM   3229  C  CA    . TYR A 1  417  ? 109.127 8.574   -11.546 1.00 81.28  ? 417  TYR A CA    1 
ATOM   3230  C  C     . TYR A 1  417  ? 109.842 7.641   -12.482 1.00 85.51  ? 417  TYR A C     1 
ATOM   3231  O  O     . TYR A 1  417  ? 109.344 6.530   -12.689 1.00 87.47  ? 417  TYR A O     1 
ATOM   3232  C  CB    . TYR A 1  417  ? 107.928 9.158   -12.308 1.00 82.61  ? 417  TYR A CB    1 
ATOM   3233  C  CG    . TYR A 1  417  ? 107.103 10.127  -11.505 1.00 86.19  ? 417  TYR A CG    1 
ATOM   3234  C  CD1   . TYR A 1  417  ? 106.340 9.694   -10.423 1.00 88.94  ? 417  TYR A CD1   1 
ATOM   3235  C  CD2   . TYR A 1  417  ? 107.105 11.485  -11.801 1.00 87.56  ? 417  TYR A CD2   1 
ATOM   3236  C  CE1   . TYR A 1  417  ? 105.605 10.593  -9.647  1.00 90.97  ? 417  TYR A CE1   1 
ATOM   3237  C  CE2   . TYR A 1  417  ? 106.369 12.395  -11.037 1.00 89.06  ? 417  TYR A CE2   1 
ATOM   3238  C  CZ    . TYR A 1  417  ? 105.616 11.944  -9.961  1.00 98.80  ? 417  TYR A CZ    1 
ATOM   3239  O  OH    . TYR A 1  417  ? 104.876 12.827  -9.208  1.00 101.10 ? 417  TYR A OH    1 
ATOM   3240  N  N     . SER A 1  418  ? 110.950 8.085   -13.110 1.00 79.75  ? 418  SER A N     1 
ATOM   3241  C  CA    . SER A 1  418  ? 111.654 7.272   -14.102 1.00 78.76  ? 418  SER A CA    1 
ATOM   3242  C  C     . SER A 1  418  ? 111.976 5.903   -13.585 1.00 81.81  ? 418  SER A C     1 
ATOM   3243  O  O     . SER A 1  418  ? 112.568 5.788   -12.509 1.00 82.21  ? 418  SER A O     1 
ATOM   3244  C  CB    . SER A 1  418  ? 112.921 7.962   -14.578 1.00 81.86  ? 418  SER A CB    1 
ATOM   3245  O  OG    . SER A 1  418  ? 113.622 7.113   -15.471 1.00 92.04  ? 418  SER A OG    1 
ATOM   3246  N  N     . LYS A 1  419  ? 111.569 4.859   -14.323 1.00 77.88  ? 419  LYS A N     1 
ATOM   3247  C  CA    . LYS A 1  419  ? 111.851 3.472   -13.914 1.00 78.38  ? 419  LYS A CA    1 
ATOM   3248  C  C     . LYS A 1  419  ? 113.374 3.213   -13.756 1.00 85.09  ? 419  LYS A C     1 
ATOM   3249  O  O     . LYS A 1  419  ? 113.783 2.237   -13.127 1.00 85.98  ? 419  LYS A O     1 
ATOM   3250  C  CB    . LYS A 1  419  ? 111.221 2.453   -14.887 1.00 79.25  ? 419  LYS A CB    1 
ATOM   3251  C  CG    . LYS A 1  419  ? 111.968 2.315   -16.220 1.00 70.79  ? 419  LYS A CG    1 
ATOM   3252  C  CD    . LYS A 1  419  ? 111.418 1.232   -17.118 1.00 72.61  ? 419  LYS A CD    1 
ATOM   3253  C  CE    . LYS A 1  419  ? 110.077 1.507   -17.769 1.00 67.62  ? 419  LYS A CE    1 
ATOM   3254  N  NZ    . LYS A 1  419  ? 110.167 2.411   -18.943 1.00 66.63  ? 419  LYS A NZ    1 
ATOM   3255  N  N     . ARG A 1  420  ? 114.192 4.118   -14.310 1.00 81.55  ? 420  ARG A N     1 
ATOM   3256  C  CA    . ARG A 1  420  ? 115.637 4.029   -14.314 1.00 80.80  ? 420  ARG A CA    1 
ATOM   3257  C  C     . ARG A 1  420  ? 116.301 5.018   -13.376 1.00 85.56  ? 420  ARG A C     1 
ATOM   3258  O  O     . ARG A 1  420  ? 117.507 5.237   -13.464 1.00 84.01  ? 420  ARG A O     1 
ATOM   3259  C  CB    . ARG A 1  420  ? 116.119 4.187   -15.748 1.00 76.04  ? 420  ARG A CB    1 
ATOM   3260  C  CG    . ARG A 1  420  ? 115.903 2.925   -16.549 1.00 72.61  ? 420  ARG A CG    1 
ATOM   3261  C  CD    . ARG A 1  420  ? 116.475 3.065   -17.918 1.00 77.70  ? 420  ARG A CD    1 
ATOM   3262  N  NE    . ARG A 1  420  ? 117.865 3.502   -17.868 1.00 88.60  ? 420  ARG A NE    1 
ATOM   3263  C  CZ    . ARG A 1  420  ? 118.889 2.798   -18.321 1.00 111.71 ? 420  ARG A CZ    1 
ATOM   3264  N  NH1   . ARG A 1  420  ? 118.691 1.605   -18.874 1.00 105.91 ? 420  ARG A NH1   1 
ATOM   3265  N  NH2   . ARG A 1  420  ? 120.121 3.281   -18.237 1.00 102.21 ? 420  ARG A NH2   1 
ATOM   3266  N  N     . ALA A 1  421  ? 115.532 5.564   -12.434 1.00 85.05  ? 421  ALA A N     1 
ATOM   3267  C  CA    . ALA A 1  421  ? 116.045 6.539   -11.479 1.00 86.78  ? 421  ALA A CA    1 
ATOM   3268  C  C     . ALA A 1  421  ? 117.207 5.979   -10.637 1.00 96.68  ? 421  ALA A C     1 
ATOM   3269  O  O     . ALA A 1  421  ? 118.054 6.750   -10.137 1.00 95.97  ? 421  ALA A O     1 
ATOM   3270  C  CB    . ALA A 1  421  ? 114.925 7.047   -10.598 1.00 87.30  ? 421  ALA A CB    1 
ATOM   3271  N  N     . GLY A 1  422  ? 117.263 4.646   -10.541 1.00 97.13  ? 422  GLY A N     1 
ATOM   3272  C  CA    . GLY A 1  422  ? 118.336 3.970   -9.831  1.00 98.77  ? 422  GLY A CA    1 
ATOM   3273  C  C     . GLY A 1  422  ? 119.578 3.923   -10.695 1.00 105.64 ? 422  GLY A C     1 
ATOM   3274  O  O     . GLY A 1  422  ? 120.525 4.703   -10.502 1.00 105.32 ? 422  GLY A O     1 
ATOM   3275  N  N     . ASP A 1  423  ? 119.548 3.004   -11.676 1.00 103.76 ? 423  ASP A N     1 
ATOM   3276  C  CA    . ASP A 1  423  ? 120.622 2.791   -12.637 1.00 104.22 ? 423  ASP A CA    1 
ATOM   3277  C  C     . ASP A 1  423  ? 120.525 3.880   -13.688 1.00 104.24 ? 423  ASP A C     1 
ATOM   3278  O  O     . ASP A 1  423  ? 119.751 3.820   -14.648 1.00 103.53 ? 423  ASP A O     1 
ATOM   3279  C  CB    . ASP A 1  423  ? 120.618 1.347   -13.207 1.00 107.87 ? 423  ASP A CB    1 
ATOM   3280  C  CG    . ASP A 1  423  ? 120.199 1.181   -14.665 1.00 126.01 ? 423  ASP A CG    1 
ATOM   3281  O  OD1   . ASP A 1  423  ? 121.075 1.333   -15.558 1.00 128.63 ? 423  ASP A OD1   1 
ATOM   3282  O  OD2   . ASP A 1  423  ? 118.985 0.939   -14.915 1.00 132.64 ? 423  ASP A OD2   1 
ATOM   3283  N  N     . ILE A 1  424  ? 121.263 4.925   -13.443 1.00 97.98  ? 424  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1  424  ? 121.243 6.044   -14.342 1.00 96.31  ? 424  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1  424  ? 122.666 6.402   -14.575 1.00 100.30 ? 424  ILE A C     1 
ATOM   3286  O  O     . ILE A 1  424  ? 123.320 6.992   -13.713 1.00 100.55 ? 424  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1  424  ? 120.353 7.162   -13.769 1.00 98.01  ? 424  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1  424  ? 120.192 8.324   -14.719 1.00 96.05  ? 424  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1  424  ? 120.711 7.549   -12.316 1.00 100.50 ? 424  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1  424  ? 118.794 8.542   -14.993 1.00 95.24  ? 424  ILE A CD1   1 
ATOM   3291  N  N     . GLN A 1  425  ? 123.205 5.903   -15.672 1.00 96.39  ? 425  GLN A N     1 
ATOM   3292  C  CA    . GLN A 1  425  ? 124.589 6.225   -15.877 1.00 95.87  ? 425  GLN A CA    1 
ATOM   3293  C  C     . GLN A 1  425  ? 124.873 7.511   -16.636 1.00 93.92  ? 425  GLN A C     1 
ATOM   3294  O  O     . GLN A 1  425  ? 124.709 7.582   -17.857 1.00 93.40  ? 425  GLN A O     1 
ATOM   3295  C  CB    . GLN A 1  425  ? 125.488 5.030   -16.208 1.00 98.79  ? 425  GLN A CB    1 
ATOM   3296  C  CG    . GLN A 1  425  ? 126.634 4.907   -15.176 1.00 137.54 ? 425  GLN A CG    1 
ATOM   3297  C  CD    . GLN A 1  425  ? 127.222 6.247   -14.700 1.00 164.94 ? 425  GLN A CD    1 
ATOM   3298  O  OE1   . GLN A 1  425  ? 128.014 6.893   -15.404 1.00 163.49 ? 425  GLN A OE1   1 
ATOM   3299  N  NE2   . GLN A 1  425  ? 126.796 6.727   -13.526 1.00 149.28 ? 425  GLN A NE2   1 
ATOM   3300  N  N     . LEU A 1  426  ? 125.283 8.533   -15.852 1.00 86.34  ? 426  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1  426  ? 125.631 9.896   -16.257 1.00 84.14  ? 426  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1  426  ? 126.711 9.957   -17.322 1.00 90.68  ? 426  LEU A C     1 
ATOM   3303  O  O     . LEU A 1  426  ? 127.663 9.181   -17.267 1.00 92.69  ? 426  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1  426  ? 126.105 10.693  -15.039 1.00 82.15  ? 426  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1  426  ? 125.054 11.229  -14.125 1.00 82.77  ? 426  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1  426  ? 125.649 12.228  -13.196 1.00 81.79  ? 426  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1  426  ? 123.950 11.865  -14.896 1.00 81.54  ? 426  LEU A CD2   1 
ATOM   3308  N  N     . GLN A 1  427  ? 126.570 10.879  -18.279 1.00 86.19  ? 427  GLN A N     1 
ATOM   3309  C  CA    . GLN A 1  427  ? 127.541 11.066  -19.354 1.00 86.41  ? 427  GLN A CA    1 
ATOM   3310  C  C     . GLN A 1  427  ? 127.977 12.493  -19.352 1.00 90.72  ? 427  GLN A C     1 
ATOM   3311  O  O     . GLN A 1  427  ? 127.145 13.362  -19.066 1.00 90.85  ? 427  GLN A O     1 
ATOM   3312  C  CB    . GLN A 1  427  ? 126.922 10.729  -20.711 1.00 87.78  ? 427  GLN A CB    1 
ATOM   3313  C  CG    . GLN A 1  427  ? 127.309 9.348   -21.205 1.00 107.91 ? 427  GLN A CG    1 
ATOM   3314  C  CD    . GLN A 1  427  ? 126.120 8.599   -21.753 1.00 133.99 ? 427  GLN A CD    1 
ATOM   3315  O  OE1   . GLN A 1  427  ? 125.629 8.869   -22.867 1.00 132.85 ? 427  GLN A OE1   1 
ATOM   3316  N  NE2   . GLN A 1  427  ? 125.624 7.642   -20.969 1.00 124.64 ? 427  GLN A NE2   1 
ATOM   3317  N  N     . TYR A 1  428  ? 129.261 12.765  -19.700 1.00 86.61  ? 428  TYR A N     1 
ATOM   3318  C  CA    . TYR A 1  428  ? 129.758 14.145  -19.755 1.00 85.93  ? 428  TYR A CA    1 
ATOM   3319  C  C     . TYR A 1  428  ? 128.876 14.972  -20.664 1.00 90.24  ? 428  TYR A C     1 
ATOM   3320  O  O     . TYR A 1  428  ? 128.323 14.443  -21.636 1.00 91.17  ? 428  TYR A O     1 
ATOM   3321  C  CB    . TYR A 1  428  ? 131.217 14.220  -20.206 1.00 87.49  ? 428  TYR A CB    1 
ATOM   3322  C  CG    . TYR A 1  428  ? 132.176 13.528  -19.270 1.00 90.41  ? 428  TYR A CG    1 
ATOM   3323  C  CD1   . TYR A 1  428  ? 132.357 13.978  -17.968 1.00 92.76  ? 428  TYR A CD1   1 
ATOM   3324  C  CD2   . TYR A 1  428  ? 132.905 12.424  -19.681 1.00 92.15  ? 428  TYR A CD2   1 
ATOM   3325  C  CE1   . TYR A 1  428  ? 133.201 13.310  -17.083 1.00 93.42  ? 428  TYR A CE1   1 
ATOM   3326  C  CE2   . TYR A 1  428  ? 133.795 11.781  -18.818 1.00 93.57  ? 428  TYR A CE2   1 
ATOM   3327  C  CZ    . TYR A 1  428  ? 133.962 12.250  -17.529 1.00 98.82  ? 428  TYR A CZ    1 
ATOM   3328  O  OH    . TYR A 1  428  ? 134.826 11.619  -16.675 1.00 100.23 ? 428  TYR A OH    1 
ATOM   3329  N  N     . GLY A 1  429  ? 128.663 16.224  -20.297 1.00 86.07  ? 429  GLY A N     1 
ATOM   3330  C  CA    . GLY A 1  429  ? 127.799 17.097  -21.082 1.00 85.87  ? 429  GLY A CA    1 
ATOM   3331  C  C     . GLY A 1  429  ? 126.325 17.060  -20.712 1.00 88.22  ? 429  GLY A C     1 
ATOM   3332  O  O     . GLY A 1  429  ? 125.562 17.952  -21.090 1.00 88.08  ? 429  GLY A O     1 
ATOM   3333  N  N     . TRP A 1  430  ? 125.899 16.061  -19.955 1.00 82.79  ? 430  TRP A N     1 
ATOM   3334  C  CA    . TRP A 1  430  ? 124.518 16.063  -19.534 1.00 81.55  ? 430  TRP A CA    1 
ATOM   3335  C  C     . TRP A 1  430  ? 124.394 17.098  -18.436 1.00 82.80  ? 430  TRP A C     1 
ATOM   3336  O  O     . TRP A 1  430  ? 125.404 17.597  -17.926 1.00 82.30  ? 430  TRP A O     1 
ATOM   3337  C  CB    . TRP A 1  430  ? 124.155 14.710  -18.958 1.00 80.78  ? 430  TRP A CB    1 
ATOM   3338  C  CG    . TRP A 1  430  ? 124.005 13.612  -19.961 1.00 82.74  ? 430  TRP A CG    1 
ATOM   3339  C  CD1   . TRP A 1  430  ? 124.375 13.626  -21.272 1.00 86.01  ? 430  TRP A CD1   1 
ATOM   3340  C  CD2   . TRP A 1  430  ? 123.500 12.297  -19.702 1.00 82.90  ? 430  TRP A CD2   1 
ATOM   3341  N  NE1   . TRP A 1  430  ? 124.119 12.405  -21.844 1.00 85.77  ? 430  TRP A NE1   1 
ATOM   3342  C  CE2   . TRP A 1  430  ? 123.574 11.576  -20.903 1.00 86.83  ? 430  TRP A CE2   1 
ATOM   3343  C  CE3   . TRP A 1  430  ? 122.973 11.661  -18.566 1.00 84.00  ? 430  TRP A CE3   1 
ATOM   3344  C  CZ2   . TRP A 1  430  ? 123.151 10.260  -20.999 1.00 86.60  ? 430  TRP A CZ2   1 
ATOM   3345  C  CZ3   . TRP A 1  430  ? 122.523 10.366  -18.673 1.00 85.24  ? 430  TRP A CZ3   1 
ATOM   3346  C  CH2   . TRP A 1  430  ? 122.614 9.679   -19.875 1.00 86.31  ? 430  TRP A CH2   1 
ATOM   3347  N  N     . LYS A 1  431  ? 123.167 17.413  -18.063 1.00 76.59  ? 431  LYS A N     1 
ATOM   3348  C  CA    . LYS A 1  431  ? 122.940 18.323  -16.965 1.00 74.75  ? 431  LYS A CA    1 
ATOM   3349  C  C     . LYS A 1  431  ? 122.216 17.576  -15.837 1.00 78.04  ? 431  LYS A C     1 
ATOM   3350  O  O     . LYS A 1  431  ? 121.310 16.784  -16.092 1.00 77.78  ? 431  LYS A O     1 
ATOM   3351  C  CB    . LYS A 1  431  ? 122.095 19.514  -17.418 1.00 75.96  ? 431  LYS A CB    1 
ATOM   3352  C  CG    . LYS A 1  431  ? 122.788 20.550  -18.275 1.00 79.38  ? 431  LYS A CG    1 
ATOM   3353  C  CD    . LYS A 1  431  ? 121.882 21.783  -18.406 1.00 87.66  ? 431  LYS A CD    1 
ATOM   3354  C  CE    . LYS A 1  431  ? 122.350 22.822  -19.387 1.00 100.87 ? 431  LYS A CE    1 
ATOM   3355  N  NZ    . LYS A 1  431  ? 122.245 22.336  -20.793 1.00 121.79 ? 431  LYS A NZ    1 
ATOM   3356  N  N     . VAL A 1  432  ? 122.600 17.834  -14.597 1.00 74.30  ? 432  VAL A N     1 
ATOM   3357  C  CA    . VAL A 1  432  ? 121.894 17.286  -13.449 1.00 74.05  ? 432  VAL A CA    1 
ATOM   3358  C  C     . VAL A 1  432  ? 121.273 18.458  -12.695 1.00 76.53  ? 432  VAL A C     1 
ATOM   3359  O  O     . VAL A 1  432  ? 121.990 19.339  -12.222 1.00 75.12  ? 432  VAL A O     1 
ATOM   3360  C  CB    . VAL A 1  432  ? 122.788 16.420  -12.553 1.00 79.06  ? 432  VAL A CB    1 
ATOM   3361  C  CG1   . VAL A 1  432  ? 122.131 16.168  -11.205 1.00 79.21  ? 432  VAL A CG1   1 
ATOM   3362  C  CG2   . VAL A 1  432  ? 123.095 15.108  -13.233 1.00 79.44  ? 432  VAL A CG2   1 
ATOM   3363  N  N     . GLU A 1  433  ? 119.946 18.501  -12.628 1.00 73.50  ? 433  GLU A N     1 
ATOM   3364  C  CA    . GLU A 1  433  ? 119.266 19.566  -11.905 1.00 73.16  ? 433  GLU A CA    1 
ATOM   3365  C  C     . GLU A 1  433  ? 119.300 19.170  -10.432 1.00 79.03  ? 433  GLU A C     1 
ATOM   3366  O  O     . GLU A 1  433  ? 118.451 18.415  -9.954  1.00 79.67  ? 433  GLU A O     1 
ATOM   3367  C  CB    . GLU A 1  433  ? 117.832 19.792  -12.424 1.00 74.21  ? 433  GLU A CB    1 
ATOM   3368  C  CG    . GLU A 1  433  ? 117.756 20.457  -13.793 1.00 86.50  ? 433  GLU A CG    1 
ATOM   3369  C  CD    . GLU A 1  433  ? 116.505 21.262  -14.114 1.00 108.27 ? 433  GLU A CD    1 
ATOM   3370  O  OE1   . GLU A 1  433  ? 115.453 21.036  -13.470 1.00 106.93 ? 433  GLU A OE1   1 
ATOM   3371  O  OE2   . GLU A 1  433  ? 116.572 22.113  -15.030 1.00 99.44  ? 433  GLU A OE2   1 
ATOM   3372  N  N     . ARG A 1  434  ? 120.351 19.604  -9.742  1.00 75.66  ? 434  ARG A N     1 
ATOM   3373  C  CA    . ARG A 1  434  ? 120.560 19.298  -8.330  1.00 75.82  ? 434  ARG A CA    1 
ATOM   3374  C  C     . ARG A 1  434  ? 119.925 20.328  -7.427  1.00 79.61  ? 434  ARG A C     1 
ATOM   3375  O  O     . ARG A 1  434  ? 119.809 21.492  -7.818  1.00 79.18  ? 434  ARG A O     1 
ATOM   3376  C  CB    . ARG A 1  434  ? 122.062 19.179  -8.001  1.00 76.29  ? 434  ARG A CB    1 
ATOM   3377  C  CG    . ARG A 1  434  ? 122.948 20.258  -8.612  1.00 80.06  ? 434  ARG A CG    1 
ATOM   3378  C  CD    . ARG A 1  434  ? 124.218 20.425  -7.835  1.00 74.98  ? 434  ARG A CD    1 
ATOM   3379  N  NE    . ARG A 1  434  ? 124.018 21.525  -6.916  1.00 78.32  ? 434  ARG A NE    1 
ATOM   3380  C  CZ    . ARG A 1  434  ? 124.667 22.676  -6.970  1.00 83.85  ? 434  ARG A CZ    1 
ATOM   3381  N  NH1   . ARG A 1  434  ? 125.628 22.864  -7.866  1.00 71.60  ? 434  ARG A NH1   1 
ATOM   3382  N  NH2   . ARG A 1  434  ? 124.384 23.638  -6.109  1.00 61.36  ? 434  ARG A NH2   1 
ATOM   3383  N  N     . HIS A 1  435  ? 119.590 19.918  -6.188  1.00 75.81  ? 435  HIS A N     1 
ATOM   3384  C  CA    . HIS A 1  435  ? 119.027 20.805  -5.182  1.00 75.89  ? 435  HIS A CA    1 
ATOM   3385  C  C     . HIS A 1  435  ? 119.982 21.962  -4.915  1.00 77.92  ? 435  HIS A C     1 
ATOM   3386  O  O     . HIS A 1  435  ? 121.176 21.865  -5.213  1.00 77.12  ? 435  HIS A O     1 
ATOM   3387  C  CB    . HIS A 1  435  ? 118.764 20.051  -3.858  1.00 77.83  ? 435  HIS A CB    1 
ATOM   3388  C  CG    . HIS A 1  435  ? 117.603 19.105  -3.879  1.00 82.07  ? 435  HIS A CG    1 
ATOM   3389  N  ND1   . HIS A 1  435  ? 117.648 17.899  -3.198  1.00 84.71  ? 435  HIS A ND1   1 
ATOM   3390  C  CD2   . HIS A 1  435  ? 116.416 19.196  -4.523  1.00 84.48  ? 435  HIS A CD2   1 
ATOM   3391  C  CE1   . HIS A 1  435  ? 116.479 17.311  -3.417  1.00 84.55  ? 435  HIS A CE1   1 
ATOM   3392  N  NE2   . HIS A 1  435  ? 115.701 18.050  -4.212  1.00 84.70  ? 435  HIS A NE2   1 
ATOM   3393  N  N     . ILE A 1  436  ? 119.443 23.055  -4.357  1.00 73.60  ? 436  ILE A N     1 
ATOM   3394  C  CA    . ILE A 1  436  ? 120.193 24.230  -3.946  1.00 72.98  ? 436  ILE A CA    1 
ATOM   3395  C  C     . ILE A 1  436  ? 121.019 23.822  -2.720  1.00 81.17  ? 436  ILE A C     1 
ATOM   3396  O  O     . ILE A 1  436  ? 120.502 23.124  -1.829  1.00 80.46  ? 436  ILE A O     1 
ATOM   3397  C  CB    . ILE A 1  436  ? 119.229 25.467  -3.874  1.00 74.61  ? 436  ILE A CB    1 
ATOM   3398  C  CG1   . ILE A 1  436  ? 119.648 26.473  -4.873  1.00 75.55  ? 436  ILE A CG1   1 
ATOM   3399  C  CG2   . ILE A 1  436  ? 118.926 26.106  -2.528  1.00 73.05  ? 436  ILE A CG2   1 
ATOM   3400  C  CD1   . ILE A 1  436  ? 119.687 25.877  -6.286  1.00 91.89  ? 436  ILE A CD1   1 
ATOM   3401  N  N     . MET A 1  437  ? 122.337 24.068  -2.774  1.00 80.73  ? 437  MET A N     1 
ATOM   3402  C  CA    . MET A 1  437  ? 123.246 23.608  -1.723  1.00 82.57  ? 437  MET A CA    1 
ATOM   3403  C  C     . MET A 1  437  ? 124.065 24.689  -1.033  1.00 85.41  ? 437  MET A C     1 
ATOM   3404  O  O     . MET A 1  437  ? 124.386 25.721  -1.639  1.00 84.88  ? 437  MET A O     1 
ATOM   3405  C  CB    . MET A 1  437  ? 124.182 22.551  -2.275  1.00 86.81  ? 437  MET A CB    1 
ATOM   3406  C  CG    . MET A 1  437  ? 123.454 21.428  -2.967  1.00 93.73  ? 437  MET A CG    1 
ATOM   3407  S  SD    . MET A 1  437  ? 124.445 19.941  -3.276  1.00 102.03 ? 437  MET A SD    1 
ATOM   3408  C  CE    . MET A 1  437  ? 125.999 20.721  -4.192  1.00 99.16  ? 437  MET A CE    1 
ATOM   3409  N  N     . ASP A 1  438  ? 124.437 24.419  0.250   1.00 80.70  ? 438  ASP A N     1 
ATOM   3410  C  CA    . ASP A 1  438  ? 125.238 25.292  1.113   1.00 79.03  ? 438  ASP A CA    1 
ATOM   3411  C  C     . ASP A 1  438  ? 126.325 25.910  0.282   1.00 79.76  ? 438  ASP A C     1 
ATOM   3412  O  O     . ASP A 1  438  ? 127.047 25.211  -0.429  1.00 79.73  ? 438  ASP A O     1 
ATOM   3413  C  CB    . ASP A 1  438  ? 125.856 24.515  2.296   1.00 81.51  ? 438  ASP A CB    1 
ATOM   3414  C  CG    . ASP A 1  438  ? 124.989 24.379  3.538   1.00 101.16 ? 438  ASP A CG    1 
ATOM   3415  O  OD1   . ASP A 1  438  ? 123.797 24.728  3.473   1.00 103.33 ? 438  ASP A OD1   1 
ATOM   3416  O  OD2   . ASP A 1  438  ? 125.502 23.896  4.572   1.00 110.68 ? 438  ASP A OD2   1 
ATOM   3417  N  N     . ASN A 1  439  ? 126.337 27.228  0.272   1.00 73.89  ? 439  ASN A N     1 
ATOM   3418  C  CA    . ASN A 1  439  ? 127.288 28.067  -0.427  1.00 72.51  ? 439  ASN A CA    1 
ATOM   3419  C  C     . ASN A 1  439  ? 126.940 28.502  -1.860  1.00 75.30  ? 439  ASN A C     1 
ATOM   3420  O  O     . ASN A 1  439  ? 127.600 29.402  -2.393  1.00 73.83  ? 439  ASN A O     1 
ATOM   3421  C  CB    . ASN A 1  439  ? 128.749 27.663  -0.163  1.00 68.96  ? 439  ASN A CB    1 
ATOM   3422  C  CG    . ASN A 1  439  ? 129.253 28.343  1.089   1.00 100.55 ? 439  ASN A CG    1 
ATOM   3423  O  OD1   . ASN A 1  439  ? 128.492 28.615  2.048   1.00 96.33  ? 439  ASN A OD1   1 
ATOM   3424  N  ND2   . ASN A 1  439  ? 130.501 28.786  1.047   1.00 98.03  ? 439  ASN A ND2   1 
ATOM   3425  N  N     . ASP A 1  440  ? 125.843 27.984  -2.439  1.00 72.83  ? 440  ASP A N     1 
ATOM   3426  C  CA    . ASP A 1  440  ? 125.444 28.498  -3.755  1.00 73.76  ? 440  ASP A CA    1 
ATOM   3427  C  C     . ASP A 1  440  ? 125.061 29.996  -3.632  1.00 77.76  ? 440  ASP A C     1 
ATOM   3428  O  O     . ASP A 1  440  ? 124.313 30.358  -2.703  1.00 78.85  ? 440  ASP A O     1 
ATOM   3429  C  CB    . ASP A 1  440  ? 124.229 27.748  -4.328  1.00 76.06  ? 440  ASP A CB    1 
ATOM   3430  C  CG    . ASP A 1  440  ? 124.453 26.297  -4.664  1.00 90.53  ? 440  ASP A CG    1 
ATOM   3431  O  OD1   . ASP A 1  440  ? 125.637 25.901  -4.820  1.00 92.94  ? 440  ASP A OD1   1 
ATOM   3432  O  OD2   . ASP A 1  440  ? 123.433 25.541  -4.779  1.00 93.30  ? 440  ASP A OD2   1 
ATOM   3433  N  N     . PRO A 1  441  ? 125.553 30.888  -4.524  1.00 70.87  ? 441  PRO A N     1 
ATOM   3434  C  CA    . PRO A 1  441  ? 125.127 32.286  -4.439  1.00 69.34  ? 441  PRO A CA    1 
ATOM   3435  C  C     . PRO A 1  441  ? 123.681 32.436  -4.933  1.00 71.81  ? 441  PRO A C     1 
ATOM   3436  O  O     . PRO A 1  441  ? 123.282 31.824  -5.934  1.00 71.49  ? 441  PRO A O     1 
ATOM   3437  C  CB    . PRO A 1  441  ? 126.139 33.015  -5.304  1.00 70.90  ? 441  PRO A CB    1 
ATOM   3438  C  CG    . PRO A 1  441  ? 126.516 32.032  -6.323  1.00 75.81  ? 441  PRO A CG    1 
ATOM   3439  C  CD    . PRO A 1  441  ? 126.442 30.673  -5.676  1.00 71.82  ? 441  PRO A CD    1 
ATOM   3440  N  N     . VAL A 1  442  ? 122.876 33.174  -4.153  1.00 66.85  ? 442  VAL A N     1 
ATOM   3441  C  CA    . VAL A 1  442  ? 121.472 33.455  -4.422  1.00 65.83  ? 442  VAL A CA    1 
ATOM   3442  C  C     . VAL A 1  442  ? 121.186 34.938  -4.191  1.00 70.88  ? 442  VAL A C     1 
ATOM   3443  O  O     . VAL A 1  442  ? 121.774 35.545  -3.286  1.00 71.44  ? 442  VAL A O     1 
ATOM   3444  C  CB    . VAL A 1  442  ? 120.497 32.540  -3.629  1.00 69.34  ? 442  VAL A CB    1 
ATOM   3445  C  CG1   . VAL A 1  442  ? 120.545 31.113  -4.143  1.00 69.73  ? 442  VAL A CG1   1 
ATOM   3446  C  CG2   . VAL A 1  442  ? 120.751 32.569  -2.128  1.00 68.98  ? 442  VAL A CG2   1 
ATOM   3447  N  N     . LEU A 1  443  ? 120.298 35.530  -5.015  1.00 66.45  ? 443  LEU A N     1 
ATOM   3448  C  CA    . LEU A 1  443  ? 119.906 36.928  -4.871  1.00 65.47  ? 443  LEU A CA    1 
ATOM   3449  C  C     . LEU A 1  443  ? 118.786 36.994  -3.832  1.00 71.57  ? 443  LEU A C     1 
ATOM   3450  O  O     . LEU A 1  443  ? 117.747 36.347  -3.996  1.00 71.43  ? 443  LEU A O     1 
ATOM   3451  C  CB    . LEU A 1  443  ? 119.411 37.501  -6.217  1.00 64.50  ? 443  LEU A CB    1 
ATOM   3452  C  CG    . LEU A 1  443  ? 119.729 38.978  -6.630  1.00 68.05  ? 443  LEU A CG    1 
ATOM   3453  C  CD1   . LEU A 1  443  ? 118.502 39.688  -7.099  1.00 67.20  ? 443  LEU A CD1   1 
ATOM   3454  C  CD2   . LEU A 1  443  ? 120.370 39.787  -5.549  1.00 69.81  ? 443  LEU A CD2   1 
ATOM   3455  N  N     . PHE A 1  444  ? 119.002 37.765  -2.761  1.00 69.23  ? 444  PHE A N     1 
ATOM   3456  C  CA    . PHE A 1  444  ? 118.007 37.972  -1.711  1.00 69.63  ? 444  PHE A CA    1 
ATOM   3457  C  C     . PHE A 1  444  ? 117.409 39.376  -1.812  1.00 74.93  ? 444  PHE A C     1 
ATOM   3458  O  O     . PHE A 1  444  ? 118.159 40.336  -2.020  1.00 75.44  ? 444  PHE A O     1 
ATOM   3459  C  CB    . PHE A 1  444  ? 118.663 37.796  -0.350  1.00 71.76  ? 444  PHE A CB    1 
ATOM   3460  C  CG    . PHE A 1  444  ? 117.728 37.330  0.729   1.00 73.31  ? 444  PHE A CG    1 
ATOM   3461  C  CD1   . PHE A 1  444  ? 116.757 36.375  0.464   1.00 76.62  ? 444  PHE A CD1   1 
ATOM   3462  C  CD2   . PHE A 1  444  ? 117.875 37.774  2.028   1.00 75.85  ? 444  PHE A CD2   1 
ATOM   3463  C  CE1   . PHE A 1  444  ? 115.917 35.918  1.469   1.00 78.11  ? 444  PHE A CE1   1 
ATOM   3464  C  CE2   . PHE A 1  444  ? 117.031 37.317  3.034   1.00 79.30  ? 444  PHE A CE2   1 
ATOM   3465  C  CZ    . PHE A 1  444  ? 116.054 36.397  2.748   1.00 77.50  ? 444  PHE A CZ    1 
ATOM   3466  N  N     . ASN A 1  445  ? 116.078 39.520  -1.652  1.00 71.19  ? 445  ASN A N     1 
ATOM   3467  C  CA    . ASN A 1  445  ? 115.461 40.842  -1.799  1.00 70.71  ? 445  ASN A CA    1 
ATOM   3468  C  C     . ASN A 1  445  ? 114.250 41.126  -0.949  1.00 74.62  ? 445  ASN A C     1 
ATOM   3469  O  O     . ASN A 1  445  ? 113.392 40.251  -0.793  1.00 74.94  ? 445  ASN A O     1 
ATOM   3470  C  CB    . ASN A 1  445  ? 115.196 41.108  -3.296  1.00 70.10  ? 445  ASN A CB    1 
ATOM   3471  C  CG    . ASN A 1  445  ? 113.831 41.582  -3.748  1.00 84.34  ? 445  ASN A CG    1 
ATOM   3472  O  OD1   . ASN A 1  445  ? 113.516 42.776  -3.678  1.00 81.25  ? 445  ASN A OD1   1 
ATOM   3473  N  ND2   . ASN A 1  445  ? 113.083 40.694  -4.411  1.00 69.63  ? 445  ASN A ND2   1 
ATOM   3474  N  N     . ARG A 1  446  ? 114.147 42.372  -0.451  1.00 71.54  ? 446  ARG A N     1 
ATOM   3475  C  CA    . ARG A 1  446  ? 112.963 42.816  0.291   1.00 72.75  ? 446  ARG A CA    1 
ATOM   3476  C  C     . ARG A 1  446  ? 112.272 43.999  -0.373  1.00 79.16  ? 446  ARG A C     1 
ATOM   3477  O  O     . ARG A 1  446  ? 112.790 45.132  -0.321  1.00 79.75  ? 446  ARG A O     1 
ATOM   3478  C  CB    . ARG A 1  446  ? 113.249 43.158  1.752   1.00 73.65  ? 446  ARG A CB    1 
ATOM   3479  C  CG    . ARG A 1  446  ? 111.957 43.463  2.523   1.00 78.47  ? 446  ARG A CG    1 
ATOM   3480  C  CD    . ARG A 1  446  ? 112.204 44.272  3.773   1.00 74.63  ? 446  ARG A CD    1 
ATOM   3481  N  NE    . ARG A 1  446  ? 110.969 44.849  4.283   1.00 78.02  ? 446  ARG A NE    1 
ATOM   3482  C  CZ    . ARG A 1  446  ? 110.633 46.126  4.155   1.00 112.52 ? 446  ARG A CZ    1 
ATOM   3483  N  NH1   . ARG A 1  446  ? 111.448 46.978  3.533   1.00 107.10 ? 446  ARG A NH1   1 
ATOM   3484  N  NH2   . ARG A 1  446  ? 109.489 46.568  4.654   1.00 116.14 ? 446  ARG A NH2   1 
ATOM   3485  N  N     . GLN A 1  447  ? 111.054 43.738  -0.914  1.00 75.93  ? 447  GLN A N     1 
ATOM   3486  C  CA    . GLN A 1  447  ? 110.204 44.738  -1.571  1.00 76.34  ? 447  GLN A CA    1 
ATOM   3487  C  C     . GLN A 1  447  ? 109.621 45.715  -0.526  1.00 80.49  ? 447  GLN A C     1 
ATOM   3488  O  O     . GLN A 1  447  ? 109.222 45.237  0.543   1.00 81.40  ? 447  GLN A O     1 
ATOM   3489  C  CB    . GLN A 1  447  ? 109.082 44.075  -2.388  1.00 77.95  ? 447  GLN A CB    1 
ATOM   3490  C  CG    . GLN A 1  447  ? 109.546 43.381  -3.667  1.00 96.03  ? 447  GLN A CG    1 
ATOM   3491  C  CD    . GLN A 1  447  ? 109.323 41.890  -3.634  1.00 125.24 ? 447  GLN A CD    1 
ATOM   3492  O  OE1   . GLN A 1  447  ? 109.012 41.289  -2.584  1.00 125.61 ? 447  GLN A OE1   1 
ATOM   3493  N  NE2   . GLN A 1  447  ? 109.505 41.255  -4.790  1.00 117.50 ? 447  GLN A NE2   1 
ATOM   3494  N  N     . PRO A 1  448  ? 109.615 47.060  -0.711  1.00 75.95  ? 448  PRO A N     1 
ATOM   3495  C  CA    . PRO A 1  448  ? 109.884 47.887  -1.885  1.00 76.48  ? 448  PRO A CA    1 
ATOM   3496  C  C     . PRO A 1  448  ? 110.946 47.578  -2.927  1.00 85.46  ? 448  PRO A C     1 
ATOM   3497  O  O     . PRO A 1  448  ? 110.581 47.091  -4.019  1.00 86.62  ? 448  PRO A O     1 
ATOM   3498  C  CB    . PRO A 1  448  ? 109.977 49.264  -1.280  1.00 77.99  ? 448  PRO A CB    1 
ATOM   3499  C  CG    . PRO A 1  448  ? 108.858 49.229  -0.359  1.00 81.84  ? 448  PRO A CG    1 
ATOM   3500  C  CD    . PRO A 1  448  ? 109.039 47.917  0.335   1.00 77.32  ? 448  PRO A CD    1 
ATOM   3501  N  N     . SER A 1  449  ? 112.224 47.892  -2.636  1.00 82.45  ? 449  SER A N     1 
ATOM   3502  C  CA    . SER A 1  449  ? 113.374 47.734  -3.552  1.00 81.98  ? 449  SER A CA    1 
ATOM   3503  C  C     . SER A 1  449  ? 113.653 49.057  -4.200  1.00 88.37  ? 449  SER A C     1 
ATOM   3504  O  O     . SER A 1  449  ? 113.652 49.184  -5.435  1.00 89.09  ? 449  SER A O     1 
ATOM   3505  C  CB    . SER A 1  449  ? 113.206 46.616  -4.588  1.00 81.97  ? 449  SER A CB    1 
ATOM   3506  O  OG    . SER A 1  449  ? 113.339 45.342  -3.979  1.00 86.15  ? 449  SER A OG    1 
ATOM   3507  N  N     . LEU A 1  450  ? 113.881 50.054  -3.332  1.00 85.38  ? 450  LEU A N     1 
ATOM   3508  C  CA    . LEU A 1  450  ? 114.220 51.427  -3.693  1.00 86.29  ? 450  LEU A CA    1 
ATOM   3509  C  C     . LEU A 1  450  ? 115.754 51.608  -3.738  1.00 92.84  ? 450  LEU A C     1 
ATOM   3510  O  O     . LEU A 1  450  ? 116.256 52.703  -3.987  1.00 93.26  ? 450  LEU A O     1 
ATOM   3511  C  CB    . LEU A 1  450  ? 113.642 52.406  -2.647  1.00 86.57  ? 450  LEU A CB    1 
ATOM   3512  C  CG    . LEU A 1  450  ? 112.511 51.960  -1.721  1.00 89.95  ? 450  LEU A CG    1 
ATOM   3513  C  CD1   . LEU A 1  450  ? 112.666 52.610  -0.367  1.00 89.67  ? 450  LEU A CD1   1 
ATOM   3514  C  CD2   . LEU A 1  450  ? 111.151 52.346  -2.290  1.00 92.06  ? 450  LEU A CD2   1 
ATOM   3515  N  N     . HIS A 1  451  ? 116.480 50.526  -3.495  1.00 90.71  ? 451  HIS A N     1 
ATOM   3516  C  CA    . HIS A 1  451  ? 117.915 50.505  -3.360  1.00 91.85  ? 451  HIS A CA    1 
ATOM   3517  C  C     . HIS A 1  451  ? 118.630 49.547  -4.254  1.00 94.16  ? 451  HIS A C     1 
ATOM   3518  O  O     . HIS A 1  451  ? 118.134 48.444  -4.514  1.00 92.73  ? 451  HIS A O     1 
ATOM   3519  C  CB    . HIS A 1  451  ? 118.181 49.938  -1.987  1.00 94.21  ? 451  HIS A CB    1 
ATOM   3520  C  CG    . HIS A 1  451  ? 118.640 50.904  -0.994  1.00 99.17  ? 451  HIS A CG    1 
ATOM   3521  N  ND1   . HIS A 1  451  ? 118.774 50.536  0.325   1.00 101.86 ? 451  HIS A ND1   1 
ATOM   3522  C  CD2   . HIS A 1  451  ? 118.991 52.197  -1.147  1.00 102.59 ? 451  HIS A CD2   1 
ATOM   3523  C  CE1   . HIS A 1  451  ? 119.197 51.619  0.948   1.00 102.94 ? 451  HIS A CE1   1 
ATOM   3524  N  NE2   . HIS A 1  451  ? 119.352 52.645  0.097   1.00 103.58 ? 451  HIS A NE2   1 
ATOM   3525  N  N     . LYS A 1  452  ? 119.906 49.882  -4.531  1.00 89.84  ? 452  LYS A N     1 
ATOM   3526  C  CA    . LYS A 1  452  ? 120.863 49.010  -5.207  1.00 88.21  ? 452  LYS A CA    1 
ATOM   3527  C  C     . LYS A 1  452  ? 120.996 47.825  -4.216  1.00 90.05  ? 452  LYS A C     1 
ATOM   3528  O  O     . LYS A 1  452  ? 120.885 46.673  -4.622  1.00 90.10  ? 452  LYS A O     1 
ATOM   3529  C  CB    . LYS A 1  452  ? 122.210 49.765  -5.354  1.00 90.08  ? 452  LYS A CB    1 
ATOM   3530  C  CG    . LYS A 1  452  ? 123.176 49.232  -6.410  1.00 90.57  ? 452  LYS A CG    1 
ATOM   3531  C  CD    . LYS A 1  452  ? 124.574 48.958  -5.862  1.00 89.40  ? 452  LYS A CD    1 
ATOM   3532  C  CE    . LYS A 1  452  ? 125.501 50.146  -5.802  1.00 95.23  ? 452  LYS A CE    1 
ATOM   3533  N  NZ    . LYS A 1  452  ? 126.783 49.815  -5.081  1.00 107.62 ? 452  LYS A NZ    1 
ATOM   3534  N  N     . MET A 1  453  ? 121.065 48.147  -2.896  1.00 84.80  ? 453  MET A N     1 
ATOM   3535  C  CA    . MET A 1  453  ? 121.196 47.232  -1.761  1.00 83.71  ? 453  MET A CA    1 
ATOM   3536  C  C     . MET A 1  453  ? 119.910 46.614  -1.318  1.00 83.72  ? 453  MET A C     1 
ATOM   3537  O  O     . MET A 1  453  ? 119.904 46.019  -0.251  1.00 83.97  ? 453  MET A O     1 
ATOM   3538  C  CB    . MET A 1  453  ? 121.798 47.934  -0.530  1.00 87.11  ? 453  MET A CB    1 
ATOM   3539  C  CG    . MET A 1  453  ? 123.125 48.594  -0.768  1.00 91.85  ? 453  MET A CG    1 
ATOM   3540  S  SD    . MET A 1  453  ? 122.859 50.285  -1.330  1.00 96.91  ? 453  MET A SD    1 
ATOM   3541  C  CE    . MET A 1  453  ? 122.602 51.140  0.227   1.00 94.62  ? 453  MET A CE    1 
ATOM   3542  N  N     . SER A 1  454  ? 118.817 46.747  -2.057  1.00 77.99  ? 454  SER A N     1 
ATOM   3543  C  CA    . SER A 1  454  ? 117.589 46.091  -1.598  1.00 77.31  ? 454  SER A CA    1 
ATOM   3544  C  C     . SER A 1  454  ? 117.481 44.678  -2.195  1.00 78.93  ? 454  SER A C     1 
ATOM   3545  O  O     . SER A 1  454  ? 116.497 43.966  -1.981  1.00 77.59  ? 454  SER A O     1 
ATOM   3546  C  CB    . SER A 1  454  ? 116.362 46.941  -1.892  1.00 81.35  ? 454  SER A CB    1 
ATOM   3547  O  OG    . SER A 1  454  ? 115.714 47.270  -0.672  1.00 94.48  ? 454  SER A OG    1 
ATOM   3548  N  N     . MET A 1  455  ? 118.532 44.309  -2.958  1.00 74.50  ? 455  MET A N     1 
ATOM   3549  C  CA    . MET A 1  455  ? 118.785 43.061  -3.650  1.00 73.71  ? 455  MET A CA    1 
ATOM   3550  C  C     . MET A 1  455  ? 120.271 42.812  -3.552  1.00 76.48  ? 455  MET A C     1 
ATOM   3551  O  O     . MET A 1  455  ? 121.078 43.507  -4.194  1.00 74.78  ? 455  MET A O     1 
ATOM   3552  C  CB    . MET A 1  455  ? 118.448 43.177  -5.117  1.00 76.41  ? 455  MET A CB    1 
ATOM   3553  C  CG    . MET A 1  455  ? 117.044 43.417  -5.383  1.00 81.53  ? 455  MET A CG    1 
ATOM   3554  S  SD    . MET A 1  455  ? 116.772 42.874  -7.053  1.00 87.57  ? 455  MET A SD    1 
ATOM   3555  C  CE    . MET A 1  455  ? 115.569 41.651  -6.778  1.00 84.25  ? 455  MET A CE    1 
ATOM   3556  N  N     . MET A 1  456  ? 120.639 41.841  -2.710  1.00 73.09  ? 456  MET A N     1 
ATOM   3557  C  CA    . MET A 1  456  ? 122.029 41.437  -2.497  1.00 72.24  ? 456  MET A CA    1 
ATOM   3558  C  C     . MET A 1  456  ? 122.203 39.905  -2.600  1.00 73.84  ? 456  MET A C     1 
ATOM   3559  O  O     . MET A 1  456  ? 121.277 39.104  -2.376  1.00 71.50  ? 456  MET A O     1 
ATOM   3560  C  CB    . MET A 1  456  ? 122.626 42.008  -1.191  1.00 74.76  ? 456  MET A CB    1 
ATOM   3561  C  CG    . MET A 1  456  ? 122.768 43.517  -1.182  1.00 78.69  ? 456  MET A CG    1 
ATOM   3562  S  SD    . MET A 1  456  ? 123.348 44.182  0.405   1.00 84.10  ? 456  MET A SD    1 
ATOM   3563  C  CE    . MET A 1  456  ? 121.970 43.856  1.467   1.00 80.38  ? 456  MET A CE    1 
ATOM   3564  N  N     . ALA A 1  457  ? 123.392 39.520  -3.014  1.00 70.26  ? 457  ALA A N     1 
ATOM   3565  C  CA    . ALA A 1  457  ? 123.718 38.131  -3.178  1.00 69.60  ? 457  ALA A CA    1 
ATOM   3566  C  C     . ALA A 1  457  ? 124.247 37.584  -1.855  1.00 71.08  ? 457  ALA A C     1 
ATOM   3567  O  O     . ALA A 1  457  ? 125.022 38.257  -1.158  1.00 69.54  ? 457  ALA A O     1 
ATOM   3568  C  CB    . ALA A 1  457  ? 124.731 37.972  -4.304  1.00 70.64  ? 457  ALA A CB    1 
ATOM   3569  N  N     . HIS A 1  458  ? 123.762 36.390  -1.488  1.00 67.39  ? 458  HIS A N     1 
ATOM   3570  C  CA    . HIS A 1  458  ? 124.131 35.695  -0.257  1.00 67.93  ? 458  HIS A CA    1 
ATOM   3571  C  C     . HIS A 1  458  ? 124.603 34.276  -0.568  1.00 72.04  ? 458  HIS A C     1 
ATOM   3572  O  O     . HIS A 1  458  ? 124.399 33.788  -1.686  1.00 71.87  ? 458  HIS A O     1 
ATOM   3573  C  CB    . HIS A 1  458  ? 122.934 35.606  0.711   1.00 68.85  ? 458  HIS A CB    1 
ATOM   3574  C  CG    . HIS A 1  458  ? 122.459 36.905  1.276   1.00 72.77  ? 458  HIS A CG    1 
ATOM   3575  N  ND1   . HIS A 1  458  ? 122.494 37.151  2.631   1.00 75.17  ? 458  HIS A ND1   1 
ATOM   3576  C  CD2   . HIS A 1  458  ? 121.892 37.968  0.654   1.00 74.22  ? 458  HIS A CD2   1 
ATOM   3577  C  CE1   . HIS A 1  458  ? 121.962 38.352  2.789   1.00 74.46  ? 458  HIS A CE1   1 
ATOM   3578  N  NE2   . HIS A 1  458  ? 121.588 38.881  1.625   1.00 74.16  ? 458  HIS A NE2   1 
ATOM   3579  N  N     . ARG A 1  459  ? 125.205 33.604  0.449   1.00 67.37  ? 459  ARG A N     1 
ATOM   3580  C  CA    . ARG A 1  459  ? 125.675 32.217  0.400   1.00 65.98  ? 459  ARG A CA    1 
ATOM   3581  C  C     . ARG A 1  459  ? 124.554 31.360  0.960   1.00 70.01  ? 459  ARG A C     1 
ATOM   3582  O  O     . ARG A 1  459  ? 124.068 31.639  2.063   1.00 70.37  ? 459  ARG A O     1 
ATOM   3583  C  CB    . ARG A 1  459  ? 126.897 32.053  1.328   1.00 63.55  ? 459  ARG A CB    1 
ATOM   3584  C  CG    . ARG A 1  459  ? 128.257 32.389  0.742   1.00 58.09  ? 459  ARG A CG    1 
ATOM   3585  C  CD    . ARG A 1  459  ? 129.189 32.947  1.804   1.00 58.17  ? 459  ARG A CD    1 
ATOM   3586  N  NE    . ARG A 1  459  ? 129.948 31.898  2.476   1.00 78.00  ? 459  ARG A NE    1 
ATOM   3587  C  CZ    . ARG A 1  459  ? 130.229 31.896  3.776   1.00 105.75 ? 459  ARG A CZ    1 
ATOM   3588  N  NH1   . ARG A 1  459  ? 129.831 32.899  4.551   1.00 93.49  ? 459  ARG A NH1   1 
ATOM   3589  N  NH2   . ARG A 1  459  ? 130.911 30.891  4.312   1.00 102.56 ? 459  ARG A NH2   1 
ATOM   3590  N  N     . VAL A 1  460  ? 124.142 30.316  0.250   1.00 66.41  ? 460  VAL A N     1 
ATOM   3591  C  CA    . VAL A 1  460  ? 123.095 29.443  0.815   1.00 66.48  ? 460  VAL A CA    1 
ATOM   3592  C  C     . VAL A 1  460  ? 123.619 28.755  2.107   1.00 73.29  ? 460  VAL A C     1 
ATOM   3593  O  O     . VAL A 1  460  ? 124.834 28.511  2.282   1.00 73.29  ? 460  VAL A O     1 
ATOM   3594  C  CB    . VAL A 1  460  ? 122.480 28.420  -0.219  1.00 68.57  ? 460  VAL A CB    1 
ATOM   3595  C  CG1   . VAL A 1  460  ? 121.588 27.370  0.444   1.00 67.40  ? 460  VAL A CG1   1 
ATOM   3596  C  CG2   . VAL A 1  460  ? 121.707 29.137  -1.315  1.00 67.87  ? 460  VAL A CG2   1 
ATOM   3597  N  N     . LYS A 1  461  ? 122.686 28.558  3.039   1.00 70.29  ? 461  LYS A N     1 
ATOM   3598  C  CA    . LYS A 1  461  ? 122.884 27.789  4.249   1.00 70.21  ? 461  LYS A CA    1 
ATOM   3599  C  C     . LYS A 1  461  ? 121.592 27.066  4.490   1.00 75.73  ? 461  LYS A C     1 
ATOM   3600  O  O     . LYS A 1  461  ? 120.642 27.668  5.009   1.00 77.11  ? 461  LYS A O     1 
ATOM   3601  C  CB    . LYS A 1  461  ? 123.281 28.621  5.463   1.00 71.45  ? 461  LYS A CB    1 
ATOM   3602  C  CG    . LYS A 1  461  ? 124.375 27.949  6.283   1.00 77.44  ? 461  LYS A CG    1 
ATOM   3603  C  CD    . LYS A 1  461  ? 124.000 26.625  6.962   1.00 84.67  ? 461  LYS A CD    1 
ATOM   3604  C  CE    . LYS A 1  461  ? 124.761 26.469  8.259   1.00 107.05 ? 461  LYS A CE    1 
ATOM   3605  N  NZ    . LYS A 1  461  ? 124.287 27.405  9.342   1.00 118.65 ? 461  LYS A NZ    1 
ATOM   3606  N  N     . VAL A 1  462  ? 121.527 25.791  4.042   1.00 70.11  ? 462  VAL A N     1 
ATOM   3607  C  CA    . VAL A 1  462  ? 120.345 24.957  4.209   1.00 68.26  ? 462  VAL A CA    1 
ATOM   3608  C  C     . VAL A 1  462  ? 120.188 24.667  5.694   1.00 71.99  ? 462  VAL A C     1 
ATOM   3609  O  O     . VAL A 1  462  ? 121.161 24.265  6.355   1.00 72.43  ? 462  VAL A O     1 
ATOM   3610  C  CB    . VAL A 1  462  ? 120.324 23.690  3.342   1.00 70.88  ? 462  VAL A CB    1 
ATOM   3611  C  CG1   . VAL A 1  462  ? 118.915 23.143  3.272   1.00 70.52  ? 462  VAL A CG1   1 
ATOM   3612  C  CG2   . VAL A 1  462  ? 120.838 23.960  1.944   1.00 70.18  ? 462  VAL A CG2   1 
ATOM   3613  N  N     . ILE A 1  463  ? 118.984 24.957  6.222   1.00 67.21  ? 463  ILE A N     1 
ATOM   3614  C  CA    . ILE A 1  463  ? 118.675 24.850  7.642   1.00 67.14  ? 463  ILE A CA    1 
ATOM   3615  C  C     . ILE A 1  463  ? 117.266 24.335  7.922   1.00 71.64  ? 463  ILE A C     1 
ATOM   3616  O  O     . ILE A 1  463  ? 116.383 24.478  7.068   1.00 69.29  ? 463  ILE A O     1 
ATOM   3617  C  CB    . ILE A 1  463  ? 118.900 26.220  8.381   1.00 69.48  ? 463  ILE A CB    1 
ATOM   3618  C  CG1   . ILE A 1  463  ? 118.384 27.416  7.605   1.00 68.02  ? 463  ILE A CG1   1 
ATOM   3619  C  CG2   . ILE A 1  463  ? 120.317 26.407  8.871   1.00 70.85  ? 463  ILE A CG2   1 
ATOM   3620  C  CD1   . ILE A 1  463  ? 117.209 27.951  8.180   1.00 74.18  ? 463  ILE A CD1   1 
ATOM   3621  N  N     . PRO A 1  464  ? 117.012 23.851  9.171   1.00 70.97  ? 464  PRO A N     1 
ATOM   3622  C  CA    . PRO A 1  464  ? 115.650 23.428  9.532   1.00 72.14  ? 464  PRO A CA    1 
ATOM   3623  C  C     . PRO A 1  464  ? 114.737 24.623  9.747   1.00 80.02  ? 464  PRO A C     1 
ATOM   3624  O  O     . PRO A 1  464  ? 115.211 25.758  9.763   1.00 80.87  ? 464  PRO A O     1 
ATOM   3625  C  CB    . PRO A 1  464  ? 115.855 22.661  10.840  1.00 74.21  ? 464  PRO A CB    1 
ATOM   3626  C  CG    . PRO A 1  464  ? 117.048 23.258  11.434  1.00 78.03  ? 464  PRO A CG    1 
ATOM   3627  C  CD    . PRO A 1  464  ? 117.947 23.626  10.295  1.00 72.93  ? 464  PRO A CD    1 
ATOM   3628  N  N     . TYR A 1  465  ? 113.433 24.354  9.969   1.00 78.80  ? 465  TYR A N     1 
ATOM   3629  C  CA    . TYR A 1  465  ? 112.351 25.330  10.197  1.00 79.42  ? 465  TYR A CA    1 
ATOM   3630  C  C     . TYR A 1  465  ? 112.020 26.184  8.963   1.00 85.70  ? 465  TYR A C     1 
ATOM   3631  O  O     . TYR A 1  465  ? 112.844 26.323  8.040   1.00 85.85  ? 465  TYR A O     1 
ATOM   3632  C  CB    . TYR A 1  465  ? 112.472 26.098  11.515  1.00 80.20  ? 465  TYR A CB    1 
ATOM   3633  C  CG    . TYR A 1  465  ? 112.960 25.221  12.645  1.00 82.14  ? 465  TYR A CG    1 
ATOM   3634  C  CD1   . TYR A 1  465  ? 112.079 24.414  13.360  1.00 84.78  ? 465  TYR A CD1   1 
ATOM   3635  C  CD2   . TYR A 1  465  ? 114.308 25.167  12.977  1.00 83.26  ? 465  TYR A CD2   1 
ATOM   3636  C  CE1   . TYR A 1  465  ? 112.519 23.621  14.421  1.00 87.01  ? 465  TYR A CE1   1 
ATOM   3637  C  CE2   . TYR A 1  465  ? 114.767 24.348  14.006  1.00 85.61  ? 465  TYR A CE2   1 
ATOM   3638  C  CZ    . TYR A 1  465  ? 113.867 23.598  14.752  1.00 96.64  ? 465  TYR A CZ    1 
ATOM   3639  O  OH    . TYR A 1  465  ? 114.323 22.812  15.802  1.00 98.56  ? 465  TYR A OH    1 
ATOM   3640  N  N     . SER A 1  466  ? 110.768 26.654  8.901   1.00 80.66  ? 466  SER A N     1 
ATOM   3641  C  CA    . SER A 1  466  ? 110.234 27.301  7.712   1.00 78.18  ? 466  SER A CA    1 
ATOM   3642  C  C     . SER A 1  466  ? 110.542 28.790  7.408   1.00 78.35  ? 466  SER A C     1 
ATOM   3643  O  O     . SER A 1  466  ? 109.908 29.365  6.529   1.00 78.06  ? 466  SER A O     1 
ATOM   3644  C  CB    . SER A 1  466  ? 108.763 26.949  7.581   1.00 81.19  ? 466  SER A CB    1 
ATOM   3645  O  OG    . SER A 1  466  ? 108.552 25.619  8.037   1.00 88.74  ? 466  SER A OG    1 
ATOM   3646  N  N     . THR A 1  467  ? 111.556 29.392  8.044   1.00 72.18  ? 467  THR A N     1 
ATOM   3647  C  CA    . THR A 1  467  ? 111.870 30.796  7.742   1.00 70.32  ? 467  THR A CA    1 
ATOM   3648  C  C     . THR A 1  467  ? 113.245 30.984  7.162   1.00 74.12  ? 467  THR A C     1 
ATOM   3649  O  O     . THR A 1  467  ? 114.155 30.196  7.473   1.00 74.67  ? 467  THR A O     1 
ATOM   3650  C  CB    . THR A 1  467  ? 111.823 31.676  8.980   1.00 66.43  ? 467  THR A CB    1 
ATOM   3651  O  OG1   . THR A 1  467  ? 112.632 31.103  10.010  1.00 71.33  ? 467  THR A OG1   1 
ATOM   3652  C  CG2   . THR A 1  467  ? 110.444 31.945  9.445   1.00 57.81  ? 467  THR A CG2   1 
ATOM   3653  N  N     . PHE A 1  468  ? 113.403 32.072  6.356   1.00 68.45  ? 468  PHE A N     1 
ATOM   3654  C  CA    . PHE A 1  468  ? 114.685 32.522  5.822   1.00 67.06  ? 468  PHE A CA    1 
ATOM   3655  C  C     . PHE A 1  468  ? 115.372 33.215  7.016   1.00 73.92  ? 468  PHE A C     1 
ATOM   3656  O  O     . PHE A 1  468  ? 114.739 34.033  7.695   1.00 75.16  ? 468  PHE A O     1 
ATOM   3657  C  CB    . PHE A 1  468  ? 114.529 33.551  4.679   1.00 66.93  ? 468  PHE A CB    1 
ATOM   3658  C  CG    . PHE A 1  468  ? 114.113 33.053  3.328   1.00 66.88  ? 468  PHE A CG    1 
ATOM   3659  C  CD1   . PHE A 1  468  ? 114.676 31.903  2.788   1.00 70.30  ? 468  PHE A CD1   1 
ATOM   3660  C  CD2   . PHE A 1  468  ? 113.218 33.771  2.553   1.00 67.80  ? 468  PHE A CD2   1 
ATOM   3661  C  CE1   . PHE A 1  468  ? 114.281 31.432  1.526   1.00 70.34  ? 468  PHE A CE1   1 
ATOM   3662  C  CE2   . PHE A 1  468  ? 112.839 33.315  1.284   1.00 70.13  ? 468  PHE A CE2   1 
ATOM   3663  C  CZ    . PHE A 1  468  ? 113.368 32.145  0.783   1.00 68.35  ? 468  PHE A CZ    1 
ATOM   3664  N  N     . ARG A 1  469  ? 116.636 32.868  7.295   1.00 69.76  ? 469  ARG A N     1 
ATOM   3665  C  CA    . ARG A 1  469  ? 117.379 33.469  8.394   1.00 69.45  ? 469  ARG A CA    1 
ATOM   3666  C  C     . ARG A 1  469  ? 118.443 34.395  7.850   1.00 74.45  ? 469  ARG A C     1 
ATOM   3667  O  O     . ARG A 1  469  ? 119.222 34.001  6.974   1.00 73.58  ? 469  ARG A O     1 
ATOM   3668  C  CB    . ARG A 1  469  ? 117.987 32.415  9.334   1.00 67.62  ? 469  ARG A CB    1 
ATOM   3669  C  CG    . ARG A 1  469  ? 117.076 31.248  9.580   1.00 74.36  ? 469  ARG A CG    1 
ATOM   3670  C  CD    . ARG A 1  469  ? 117.280 30.640  10.926  1.00 77.49  ? 469  ARG A CD    1 
ATOM   3671  N  NE    . ARG A 1  469  ? 116.095 30.843  11.740  1.00 78.12  ? 469  ARG A NE    1 
ATOM   3672  C  CZ    . ARG A 1  469  ? 116.083 31.500  12.892  1.00 96.13  ? 469  ARG A CZ    1 
ATOM   3673  N  NH1   . ARG A 1  469  ? 117.211 31.982  13.404  1.00 77.42  ? 469  ARG A NH1   1 
ATOM   3674  N  NH2   . ARG A 1  469  ? 114.952 31.656  13.557  1.00 95.66  ? 469  ARG A NH2   1 
ATOM   3675  N  N     . LEU A 1  470  ? 118.472 35.634  8.354   1.00 72.71  ? 470  LEU A N     1 
ATOM   3676  C  CA    . LEU A 1  470  ? 119.477 36.605  7.924   1.00 73.58  ? 470  LEU A CA    1 
ATOM   3677  C  C     . LEU A 1  470  ? 120.253 37.187  9.071   1.00 76.25  ? 470  LEU A C     1 
ATOM   3678  O  O     . LEU A 1  470  ? 119.675 37.369  10.150  1.00 75.25  ? 470  LEU A O     1 
ATOM   3679  C  CB    . LEU A 1  470  ? 118.893 37.722  7.013   1.00 74.19  ? 470  LEU A CB    1 
ATOM   3680  C  CG    . LEU A 1  470  ? 117.629 38.469  7.457   1.00 79.53  ? 470  LEU A CG    1 
ATOM   3681  C  CD1   . LEU A 1  470  ? 117.974 39.797  8.110   1.00 80.95  ? 470  LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A 1  470  ? 116.735 38.719  6.291   1.00 78.06  ? 470  LEU A CD2   1 
ATOM   3683  N  N     . ASN A 1  471  ? 121.560 37.512  8.834   1.00 73.29  ? 471  ASN A N     1 
ATOM   3684  C  CA    . ASN A 1  471  ? 122.394 38.150  9.869   1.00 73.98  ? 471  ASN A CA    1 
ATOM   3685  C  C     . ASN A 1  471  ? 121.785 39.491  10.311  1.00 76.78  ? 471  ASN A C     1 
ATOM   3686  O  O     . ASN A 1  471  ? 121.208 40.209  9.487   1.00 75.59  ? 471  ASN A O     1 
ATOM   3687  C  CB    . ASN A 1  471  ? 123.865 38.329  9.451   1.00 73.95  ? 471  ASN A CB    1 
ATOM   3688  C  CG    . ASN A 1  471  ? 124.680 38.936  10.583  1.00 92.60  ? 471  ASN A CG    1 
ATOM   3689  O  OD1   . ASN A 1  471  ? 124.882 40.148  10.663  1.00 71.36  ? 471  ASN A OD1   1 
ATOM   3690  N  ND2   . ASN A 1  471  ? 124.956 38.145  11.608  1.00 95.51  ? 471  ASN A ND2   1 
ATOM   3691  N  N     . LEU A 1  472  ? 121.882 39.825  11.594  1.00 73.50  ? 472  LEU A N     1 
ATOM   3692  C  CA    . LEU A 1  472  ? 121.226 41.070  11.982  1.00 74.01  ? 472  LEU A CA    1 
ATOM   3693  C  C     . LEU A 1  472  ? 121.731 42.410  11.400  1.00 77.58  ? 472  LEU A C     1 
ATOM   3694  O  O     . LEU A 1  472  ? 120.940 43.331  11.198  1.00 75.12  ? 472  LEU A O     1 
ATOM   3695  C  CB    . LEU A 1  472  ? 120.922 41.136  13.476  1.00 74.48  ? 472  LEU A CB    1 
ATOM   3696  C  CG    . LEU A 1  472  ? 119.445 41.093  13.732  1.00 78.15  ? 472  LEU A CG    1 
ATOM   3697  C  CD1   . LEU A 1  472  ? 119.041 39.836  14.456  1.00 78.11  ? 472  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU A 1  472  ? 118.962 42.375  14.322  1.00 80.37  ? 472  LEU A CD2   1 
ATOM   3699  N  N     . SER A 1  473  ? 123.024 42.495  11.094  1.00 75.82  ? 473  SER A N     1 
ATOM   3700  C  CA    . SER A 1  473  ? 123.598 43.724  10.585  1.00 76.19  ? 473  SER A CA    1 
ATOM   3701  C  C     . SER A 1  473  ? 123.120 44.070  9.195   1.00 80.96  ? 473  SER A C     1 
ATOM   3702  O  O     . SER A 1  473  ? 122.976 45.259  8.918   1.00 82.26  ? 473  SER A O     1 
ATOM   3703  C  CB    . SER A 1  473  ? 125.116 43.730  10.732  1.00 80.66  ? 473  SER A CB    1 
ATOM   3704  O  OG    . SER A 1  473  ? 125.500 43.957  12.085  1.00 90.64  ? 473  SER A OG    1 
ATOM   3705  N  N     . VAL A 1  474  ? 122.757 43.042  8.375   1.00 76.66  ? 474  VAL A N     1 
ATOM   3706  C  CA    . VAL A 1  474  ? 122.218 43.128  7.002   1.00 76.14  ? 474  VAL A CA    1 
ATOM   3707  C  C     . VAL A 1  474  ? 120.760 43.679  6.933   1.00 81.97  ? 474  VAL A C     1 
ATOM   3708  O  O     . VAL A 1  474  ? 120.267 44.046  5.867   1.00 78.19  ? 474  VAL A O     1 
ATOM   3709  C  CB    . VAL A 1  474  ? 122.366 41.748  6.318   1.00 79.53  ? 474  VAL A CB    1 
ATOM   3710  C  CG1   . VAL A 1  474  ? 121.055 40.969  6.288   1.00 79.14  ? 474  VAL A CG1   1 
ATOM   3711  C  CG2   . VAL A 1  474  ? 122.925 41.894  4.924   1.00 79.08  ? 474  VAL A CG2   1 
ATOM   3712  N  N     . THR A 1  475  ? 120.091 43.708  8.099   1.00 84.38  ? 475  THR A N     1 
ATOM   3713  C  CA    . THR A 1  475  ? 118.728 44.189  8.350   1.00 85.69  ? 475  THR A CA    1 
ATOM   3714  C  C     . THR A 1  475  ? 118.474 45.640  7.824   1.00 91.04  ? 475  THR A C     1 
ATOM   3715  O  O     . THR A 1  475  ? 117.471 45.861  7.139   1.00 91.82  ? 475  THR A O     1 
ATOM   3716  C  CB    . THR A 1  475  ? 118.333 43.866  9.838   1.00 95.13  ? 475  THR A CB    1 
ATOM   3717  O  OG1   . THR A 1  475  ? 117.071 43.199  9.918   1.00 91.05  ? 475  THR A OG1   1 
ATOM   3718  C  CG2   . THR A 1  475  ? 118.427 45.075  10.805  1.00 96.56  ? 475  THR A CG2   1 
ATOM   3719  N  N     . SER A 1  476  ? 119.382 46.601  8.115   1.00 86.91  ? 476  SER A N     1 
ATOM   3720  C  CA    . SER A 1  476  ? 119.219 47.984  7.657   1.00 86.60  ? 476  SER A CA    1 
ATOM   3721  C  C     . SER A 1  476  ? 119.138 48.184  6.140   1.00 87.06  ? 476  SER A C     1 
ATOM   3722  O  O     . SER A 1  476  ? 118.121 48.734  5.725   1.00 87.03  ? 476  SER A O     1 
ATOM   3723  C  CB    . SER A 1  476  ? 120.192 48.959  8.322   1.00 92.97  ? 476  SER A CB    1 
ATOM   3724  O  OG    . SER A 1  476  ? 121.504 48.441  8.488   1.00 108.77 ? 476  SER A OG    1 
ATOM   3725  N  N     . PRO A 1  477  ? 120.086 47.723  5.274   1.00 80.36  ? 477  PRO A N     1 
ATOM   3726  C  CA    . PRO A 1  477  ? 119.926 47.979  3.835   1.00 79.22  ? 477  PRO A CA    1 
ATOM   3727  C  C     . PRO A 1  477  ? 118.610 47.503  3.225   1.00 83.79  ? 477  PRO A C     1 
ATOM   3728  O  O     . PRO A 1  477  ? 118.081 48.187  2.332   1.00 84.66  ? 477  PRO A O     1 
ATOM   3729  C  CB    . PRO A 1  477  ? 121.158 47.324  3.197   1.00 80.31  ? 477  PRO A CB    1 
ATOM   3730  C  CG    . PRO A 1  477  ? 121.699 46.449  4.216   1.00 85.02  ? 477  PRO A CG    1 
ATOM   3731  C  CD    . PRO A 1  477  ? 121.362 47.035  5.535   1.00 81.30  ? 477  PRO A CD    1 
ATOM   3732  N  N     . TYR A 1  478  ? 118.068 46.366  3.724   1.00 79.28  ? 478  TYR A N     1 
ATOM   3733  C  CA    . TYR A 1  478  ? 116.818 45.775  3.243   1.00 78.20  ? 478  TYR A CA    1 
ATOM   3734  C  C     . TYR A 1  478  ? 115.612 46.498  3.785   1.00 84.39  ? 478  TYR A C     1 
ATOM   3735  O  O     . TYR A 1  478  ? 114.573 46.546  3.098   1.00 85.90  ? 478  TYR A O     1 
ATOM   3736  C  CB    . TYR A 1  478  ? 116.724 44.302  3.638   1.00 78.33  ? 478  TYR A CB    1 
ATOM   3737  C  CG    . TYR A 1  478  ? 117.618 43.396  2.830   1.00 79.85  ? 478  TYR A CG    1 
ATOM   3738  C  CD1   . TYR A 1  478  ? 117.510 43.333  1.444   1.00 82.20  ? 478  TYR A CD1   1 
ATOM   3739  C  CD2   . TYR A 1  478  ? 118.546 42.573  3.448   1.00 80.51  ? 478  TYR A CD2   1 
ATOM   3740  C  CE1   . TYR A 1  478  ? 118.329 42.496  0.693   1.00 83.49  ? 478  TYR A CE1   1 
ATOM   3741  C  CE2   . TYR A 1  478  ? 119.363 41.724  2.711   1.00 81.22  ? 478  TYR A CE2   1 
ATOM   3742  C  CZ    . TYR A 1  478  ? 119.247 41.684  1.334   1.00 89.99  ? 478  TYR A CZ    1 
ATOM   3743  O  OH    . TYR A 1  478  ? 120.063 40.858  0.608   1.00 93.10  ? 478  TYR A OH    1 
ATOM   3744  N  N     . ASN A 1  479  ? 115.769 47.083  5.010   1.00 79.64  ? 479  ASN A N     1 
ATOM   3745  C  CA    . ASN A 1  479  ? 114.768 47.758  5.839   1.00 79.68  ? 479  ASN A CA    1 
ATOM   3746  C  C     . ASN A 1  479  ? 113.849 46.696  6.450   1.00 86.53  ? 479  ASN A C     1 
ATOM   3747  O  O     . ASN A 1  479  ? 112.668 46.945  6.752   1.00 88.89  ? 479  ASN A O     1 
ATOM   3748  C  CB    . ASN A 1  479  ? 113.984 48.832  5.084   1.00 78.09  ? 479  ASN A CB    1 
ATOM   3749  C  CG    . ASN A 1  479  ? 113.254 49.814  5.970   1.00 102.80 ? 479  ASN A CG    1 
ATOM   3750  O  OD1   . ASN A 1  479  ? 112.195 50.332  5.588   1.00 105.40 ? 479  ASN A OD1   1 
ATOM   3751  N  ND2   . ASN A 1  479  ? 113.795 50.101  7.164   1.00 87.17  ? 479  ASN A ND2   1 
ATOM   3752  N  N     . ALA A 1  480  ? 114.416 45.499  6.649   1.00 81.07  ? 480  ALA A N     1 
ATOM   3753  C  CA    . ALA A 1  480  ? 113.717 44.368  7.216   1.00 79.78  ? 480  ALA A CA    1 
ATOM   3754  C  C     . ALA A 1  480  ? 113.729 44.419  8.724   1.00 83.96  ? 480  ALA A C     1 
ATOM   3755  O  O     . ALA A 1  480  ? 114.623 45.022  9.323   1.00 83.66  ? 480  ALA A O     1 
ATOM   3756  C  CB    . ALA A 1  480  ? 114.377 43.099  6.756   1.00 79.89  ? 480  ALA A CB    1 
ATOM   3757  N  N     . ASP A 1  481  ? 112.704 43.793  9.322   1.00 81.26  ? 481  ASP A N     1 
ATOM   3758  C  CA    . ASP A 1  481  ? 112.461 43.565  10.749  1.00 82.25  ? 481  ASP A CA    1 
ATOM   3759  C  C     . ASP A 1  481  ? 111.741 42.216  10.818  1.00 84.86  ? 481  ASP A C     1 
ATOM   3760  O  O     . ASP A 1  481  ? 111.393 41.668  9.777   1.00 85.37  ? 481  ASP A O     1 
ATOM   3761  C  CB    . ASP A 1  481  ? 111.645 44.710  11.403  1.00 86.06  ? 481  ASP A CB    1 
ATOM   3762  C  CG    . ASP A 1  481  ? 110.363 45.062  10.677  1.00 109.33 ? 481  ASP A CG    1 
ATOM   3763  O  OD1   . ASP A 1  481  ? 109.554 44.160  10.462  1.00 111.26 ? 481  ASP A OD1   1 
ATOM   3764  O  OD2   . ASP A 1  481  ? 110.191 46.251  10.296  1.00 120.64 ? 481  ASP A OD2   1 
ATOM   3765  N  N     . PHE A 1  482  ? 111.535 41.658  11.999  1.00 79.63  ? 482  PHE A N     1 
ATOM   3766  C  CA    . PHE A 1  482  ? 110.917 40.349  12.067  1.00 77.81  ? 482  PHE A CA    1 
ATOM   3767  C  C     . PHE A 1  482  ? 109.540 40.353  12.738  1.00 83.84  ? 482  PHE A C     1 
ATOM   3768  O  O     . PHE A 1  482  ? 109.183 39.417  13.445  1.00 85.62  ? 482  PHE A O     1 
ATOM   3769  C  CB    . PHE A 1  482  ? 111.916 39.317  12.616  1.00 78.78  ? 482  PHE A CB    1 
ATOM   3770  C  CG    . PHE A 1  482  ? 113.346 39.545  12.165  1.00 79.69  ? 482  PHE A CG    1 
ATOM   3771  C  CD1   . PHE A 1  482  ? 113.726 39.319  10.848  1.00 82.50  ? 482  PHE A CD1   1 
ATOM   3772  C  CD2   . PHE A 1  482  ? 114.309 39.996  13.052  1.00 82.18  ? 482  PHE A CD2   1 
ATOM   3773  C  CE1   . PHE A 1  482  ? 115.055 39.508  10.434  1.00 83.02  ? 482  PHE A CE1   1 
ATOM   3774  C  CE2   . PHE A 1  482  ? 115.630 40.221  12.626  1.00 84.78  ? 482  PHE A CE2   1 
ATOM   3775  C  CZ    . PHE A 1  482  ? 115.992 39.979  11.318  1.00 81.88  ? 482  PHE A CZ    1 
ATOM   3776  N  N     . ASP A 1  483  ? 108.738 41.394  12.463  1.00 80.30  ? 483  ASP A N     1 
ATOM   3777  C  CA    . ASP A 1  483  ? 107.356 41.502  12.929  1.00 81.15  ? 483  ASP A CA    1 
ATOM   3778  C  C     . ASP A 1  483  ? 106.429 40.790  11.896  1.00 84.86  ? 483  ASP A C     1 
ATOM   3779  O  O     . ASP A 1  483  ? 105.223 41.043  11.857  1.00 84.54  ? 483  ASP A O     1 
ATOM   3780  C  CB    . ASP A 1  483  ? 106.952 42.991  13.176  1.00 84.96  ? 483  ASP A CB    1 
ATOM   3781  C  CG    . ASP A 1  483  ? 106.948 43.903  11.948  1.00 111.48 ? 483  ASP A CG    1 
ATOM   3782  O  OD1   . ASP A 1  483  ? 106.727 43.391  10.827  1.00 116.19 ? 483  ASP A OD1   1 
ATOM   3783  O  OD2   . ASP A 1  483  ? 107.223 45.130  12.099  1.00 117.57 ? 483  ASP A OD2   1 
ATOM   3784  N  N     . GLY A 1  484  ? 107.014 39.939  11.050  1.00 81.16  ? 484  GLY A N     1 
ATOM   3785  C  CA    . GLY A 1  484  ? 106.263 39.180  10.065  1.00 80.50  ? 484  GLY A CA    1 
ATOM   3786  C  C     . GLY A 1  484  ? 106.548 39.522  8.630   1.00 85.18  ? 484  GLY A C     1 
ATOM   3787  O  O     . GLY A 1  484  ? 105.718 39.241  7.754   1.00 85.65  ? 484  GLY A O     1 
ATOM   3788  N  N     . ASP A 1  485  ? 107.736 40.082  8.375   1.00 81.83  ? 485  ASP A N     1 
ATOM   3789  C  CA    . ASP A 1  485  ? 108.159 40.460  7.019   1.00 81.39  ? 485  ASP A CA    1 
ATOM   3790  C  C     . ASP A 1  485  ? 108.477 39.191  6.226   1.00 84.82  ? 485  ASP A C     1 
ATOM   3791  O  O     . ASP A 1  485  ? 108.890 38.201  6.834   1.00 86.34  ? 485  ASP A O     1 
ATOM   3792  C  CB    . ASP A 1  485  ? 109.433 41.353  7.079   1.00 83.30  ? 485  ASP A CB    1 
ATOM   3793  C  CG    . ASP A 1  485  ? 109.348 42.771  7.675   1.00 93.96  ? 485  ASP A CG    1 
ATOM   3794  O  OD1   . ASP A 1  485  ? 108.419 43.038  8.498   1.00 94.09  ? 485  ASP A OD1   1 
ATOM   3795  O  OD2   . ASP A 1  485  ? 110.235 43.601  7.360   1.00 99.86  ? 485  ASP A OD2   1 
ATOM   3796  N  N     . GLU A 1  486  ? 108.293 39.200  4.898   1.00 78.88  ? 486  GLU A N     1 
ATOM   3797  C  CA    . GLU A 1  486  ? 108.694 38.052  4.058   1.00 77.84  ? 486  GLU A CA    1 
ATOM   3798  C  C     . GLU A 1  486  ? 109.717 38.534  3.013   1.00 80.61  ? 486  GLU A C     1 
ATOM   3799  O  O     . GLU A 1  486  ? 109.715 39.706  2.623   1.00 81.46  ? 486  GLU A O     1 
ATOM   3800  C  CB    . GLU A 1  486  ? 107.511 37.394  3.313   1.00 79.29  ? 486  GLU A CB    1 
ATOM   3801  C  CG    . GLU A 1  486  ? 106.383 36.798  4.143   1.00 96.00  ? 486  GLU A CG    1 
ATOM   3802  C  CD    . GLU A 1  486  ? 105.056 36.706  3.395   1.00 129.80 ? 486  GLU A CD    1 
ATOM   3803  O  OE1   . GLU A 1  486  ? 104.942 35.878  2.459   1.00 114.40 ? 486  GLU A OE1   1 
ATOM   3804  O  OE2   . GLU A 1  486  ? 104.135 37.487  3.731   1.00 150.59 ? 486  GLU A OE2   1 
ATOM   3805  N  N     . MET A 1  487  ? 110.561 37.645  2.518   1.00 75.75  ? 487  MET A N     1 
ATOM   3806  C  CA    . MET A 1  487  ? 111.530 38.058  1.497   1.00 75.03  ? 487  MET A CA    1 
ATOM   3807  C  C     . MET A 1  487  ? 111.641 37.120  0.317   1.00 77.79  ? 487  MET A C     1 
ATOM   3808  O  O     . MET A 1  487  ? 111.212 35.958  0.385   1.00 76.68  ? 487  MET A O     1 
ATOM   3809  C  CB    . MET A 1  487  ? 112.900 38.333  2.089   1.00 77.54  ? 487  MET A CB    1 
ATOM   3810  C  CG    . MET A 1  487  ? 112.923 39.543  2.927   1.00 81.83  ? 487  MET A CG    1 
ATOM   3811  S  SD    . MET A 1  487  ? 114.605 40.092  3.022   1.00 86.83  ? 487  MET A SD    1 
ATOM   3812  C  CE    . MET A 1  487  ? 114.670 40.375  4.609   1.00 83.93  ? 487  MET A CE    1 
ATOM   3813  N  N     . ASN A 1  488  ? 112.200 37.637  -0.784  1.00 73.52  ? 488  ASN A N     1 
ATOM   3814  C  CA    . ASN A 1  488  ? 112.320 36.839  -1.989  1.00 72.61  ? 488  ASN A CA    1 
ATOM   3815  C  C     . ASN A 1  488  ? 113.744 36.356  -2.286  1.00 73.91  ? 488  ASN A C     1 
ATOM   3816  O  O     . ASN A 1  488  ? 114.734 37.082  -2.099  1.00 72.49  ? 488  ASN A O     1 
ATOM   3817  C  CB    . ASN A 1  488  ? 111.670 37.549  -3.173  1.00 75.73  ? 488  ASN A CB    1 
ATOM   3818  C  CG    . ASN A 1  488  ? 110.181 37.819  -3.033  1.00 100.08 ? 488  ASN A CG    1 
ATOM   3819  O  OD1   . ASN A 1  488  ? 109.612 37.834  -1.942  1.00 83.60  ? 488  ASN A OD1   1 
ATOM   3820  N  ND2   . ASN A 1  488  ? 109.523 38.117  -4.151  1.00 100.70 ? 488  ASN A ND2   1 
ATOM   3821  N  N     . LEU A 1  489  ? 113.828 35.097  -2.716  1.00 69.42  ? 489  LEU A N     1 
ATOM   3822  C  CA    . LEU A 1  489  ? 115.075 34.440  -3.072  1.00 69.05  ? 489  LEU A CA    1 
ATOM   3823  C  C     . LEU A 1  489  ? 115.058 34.099  -4.559  1.00 72.93  ? 489  LEU A C     1 
ATOM   3824  O  O     . LEU A 1  489  ? 114.045 33.619  -5.065  1.00 71.92  ? 489  LEU A O     1 
ATOM   3825  C  CB    . LEU A 1  489  ? 115.241 33.175  -2.243  1.00 69.18  ? 489  LEU A CB    1 
ATOM   3826  C  CG    . LEU A 1  489  ? 116.660 32.700  -2.099  1.00 74.38  ? 489  LEU A CG    1 
ATOM   3827  C  CD1   . LEU A 1  489  ? 116.980 32.426  -0.667  1.00 75.17  ? 489  LEU A CD1   1 
ATOM   3828  C  CD2   . LEU A 1  489  ? 116.891 31.475  -2.918  1.00 76.90  ? 489  LEU A CD2   1 
ATOM   3829  N  N     . HIS A 1  490  ? 116.164 34.375  -5.264  1.00 70.26  ? 490  HIS A N     1 
ATOM   3830  C  CA    . HIS A 1  490  ? 116.275 34.098  -6.695  1.00 70.30  ? 490  HIS A CA    1 
ATOM   3831  C  C     . HIS A 1  490  ? 117.504 33.272  -6.965  1.00 72.85  ? 490  HIS A C     1 
ATOM   3832  O  O     . HIS A 1  490  ? 118.604 33.677  -6.588  1.00 73.78  ? 490  HIS A O     1 
ATOM   3833  C  CB    . HIS A 1  490  ? 116.278 35.392  -7.525  1.00 71.61  ? 490  HIS A CB    1 
ATOM   3834  C  CG    . HIS A 1  490  ? 114.956 36.099  -7.536  1.00 75.41  ? 490  HIS A CG    1 
ATOM   3835  N  ND1   . HIS A 1  490  ? 113.896 35.646  -8.317  1.00 77.15  ? 490  HIS A ND1   1 
ATOM   3836  C  CD2   . HIS A 1  490  ? 114.564 37.207  -6.856  1.00 77.10  ? 490  HIS A CD2   1 
ATOM   3837  C  CE1   . HIS A 1  490  ? 112.906 36.494  -8.083  1.00 76.67  ? 490  HIS A CE1   1 
ATOM   3838  N  NE2   . HIS A 1  490  ? 113.264 37.455  -7.211  1.00 76.85  ? 490  HIS A NE2   1 
ATOM   3839  N  N     . VAL A 1  491  ? 117.327 32.103  -7.593  1.00 66.63  ? 491  VAL A N     1 
ATOM   3840  C  CA    . VAL A 1  491  ? 118.452 31.234  -7.889  1.00 65.40  ? 491  VAL A CA    1 
ATOM   3841  C  C     . VAL A 1  491  ? 118.977 31.418  -9.314  1.00 72.82  ? 491  VAL A C     1 
ATOM   3842  O  O     . VAL A 1  491  ? 118.270 31.074  -10.267 1.00 73.03  ? 491  VAL A O     1 
ATOM   3843  C  CB    . VAL A 1  491  ? 118.130 29.770  -7.612  1.00 66.91  ? 491  VAL A CB    1 
ATOM   3844  C  CG1   . VAL A 1  491  ? 119.367 28.898  -7.834  1.00 66.18  ? 491  VAL A CG1   1 
ATOM   3845  C  CG2   . VAL A 1  491  ? 117.574 29.610  -6.214  1.00 66.26  ? 491  VAL A CG2   1 
ATOM   3846  N  N     . PRO A 1  492  ? 120.237 31.884  -9.488  1.00 71.36  ? 492  PRO A N     1 
ATOM   3847  C  CA    . PRO A 1  492  ? 120.802 31.983  -10.853 1.00 71.87  ? 492  PRO A CA    1 
ATOM   3848  C  C     . PRO A 1  492  ? 121.032 30.570  -11.442 1.00 76.48  ? 492  PRO A C     1 
ATOM   3849  O  O     . PRO A 1  492  ? 121.502 29.694  -10.706 1.00 77.62  ? 492  PRO A O     1 
ATOM   3850  C  CB    . PRO A 1  492  ? 122.128 32.711  -10.613 1.00 73.89  ? 492  PRO A CB    1 
ATOM   3851  C  CG    . PRO A 1  492  ? 122.523 32.289  -9.210  1.00 78.25  ? 492  PRO A CG    1 
ATOM   3852  C  CD    . PRO A 1  492  ? 121.221 32.291  -8.462  1.00 73.29  ? 492  PRO A CD    1 
ATOM   3853  N  N     . GLN A 1  493  ? 120.695 30.330  -12.731 1.00 70.63  ? 493  GLN A N     1 
ATOM   3854  C  CA    . GLN A 1  493  ? 120.854 29.004  -13.349 1.00 69.81  ? 493  GLN A CA    1 
ATOM   3855  C  C     . GLN A 1  493  ? 122.152 28.777  -14.181 1.00 77.52  ? 493  GLN A C     1 
ATOM   3856  O  O     . GLN A 1  493  ? 122.360 27.688  -14.736 1.00 77.19  ? 493  GLN A O     1 
ATOM   3857  C  CB    . GLN A 1  493  ? 119.611 28.660  -14.196 1.00 70.11  ? 493  GLN A CB    1 
ATOM   3858  C  CG    . GLN A 1  493  ? 118.273 28.791  -13.499 1.00 60.04  ? 493  GLN A CG    1 
ATOM   3859  C  CD    . GLN A 1  493  ? 118.195 27.891  -12.322 1.00 84.12  ? 493  GLN A CD    1 
ATOM   3860  O  OE1   . GLN A 1  493  ? 118.173 26.658  -12.453 1.00 88.16  ? 493  GLN A OE1   1 
ATOM   3861  N  NE2   . GLN A 1  493  ? 118.201 28.491  -11.141 1.00 71.27  ? 493  GLN A NE2   1 
ATOM   3862  N  N     . SER A 1  494  ? 122.997 29.803  -14.295 1.00 77.83  ? 494  SER A N     1 
ATOM   3863  C  CA    . SER A 1  494  ? 124.217 29.797  -15.117 1.00 79.34  ? 494  SER A CA    1 
ATOM   3864  C  C     . SER A 1  494  ? 125.474 29.886  -14.252 1.00 83.32  ? 494  SER A C     1 
ATOM   3865  O  O     . SER A 1  494  ? 125.408 30.306  -13.095 1.00 82.09  ? 494  SER A O     1 
ATOM   3866  C  CB    . SER A 1  494  ? 124.173 30.982  -16.103 1.00 85.32  ? 494  SER A CB    1 
ATOM   3867  O  OG    . SER A 1  494  ? 125.063 30.897  -17.210 1.00 98.54  ? 494  SER A OG    1 
ATOM   3868  N  N     . GLU A 1  495  ? 126.632 29.530  -14.833 1.00 80.87  ? 495  GLU A N     1 
ATOM   3869  C  CA    . GLU A 1  495  ? 127.919 29.677  -14.148 1.00 80.44  ? 495  GLU A CA    1 
ATOM   3870  C  C     . GLU A 1  495  ? 128.289 31.175  -14.265 1.00 81.24  ? 495  GLU A C     1 
ATOM   3871  O  O     . GLU A 1  495  ? 128.870 31.766  -13.353 1.00 79.69  ? 495  GLU A O     1 
ATOM   3872  C  CB    . GLU A 1  495  ? 128.982 28.737  -14.772 1.00 81.99  ? 495  GLU A CB    1 
ATOM   3873  C  CG    . GLU A 1  495  ? 130.111 28.370  -13.822 1.00 92.25  ? 495  GLU A CG    1 
ATOM   3874  C  CD    . GLU A 1  495  ? 129.756 27.669  -12.521 1.00 122.94 ? 495  GLU A CD    1 
ATOM   3875  O  OE1   . GLU A 1  495  ? 129.162 26.567  -12.590 1.00 120.22 ? 495  GLU A OE1   1 
ATOM   3876  O  OE2   . GLU A 1  495  ? 130.123 28.189  -11.438 1.00 119.99 ? 495  GLU A OE2   1 
ATOM   3877  N  N     . GLU A 1  496  ? 127.836 31.776  -15.374 1.00 77.26  ? 496  GLU A N     1 
ATOM   3878  C  CA    . GLU A 1  496  ? 127.985 33.163  -15.789 1.00 77.45  ? 496  GLU A CA    1 
ATOM   3879  C  C     . GLU A 1  496  ? 127.227 34.094  -14.863 1.00 79.95  ? 496  GLU A C     1 
ATOM   3880  O  O     . GLU A 1  496  ? 127.792 35.105  -14.441 1.00 79.88  ? 496  GLU A O     1 
ATOM   3881  C  CB    . GLU A 1  496  ? 127.440 33.317  -17.218 1.00 79.31  ? 496  GLU A CB    1 
ATOM   3882  C  CG    . GLU A 1  496  ? 128.428 33.847  -18.247 1.00 94.70  ? 496  GLU A CG    1 
ATOM   3883  C  CD    . GLU A 1  496  ? 127.765 34.564  -19.410 1.00 127.15 ? 496  GLU A CD    1 
ATOM   3884  O  OE1   . GLU A 1  496  ? 126.698 34.079  -19.864 1.00 132.04 ? 496  GLU A OE1   1 
ATOM   3885  O  OE2   . GLU A 1  496  ? 128.276 35.632  -19.831 1.00 117.13 ? 496  GLU A OE2   1 
ATOM   3886  N  N     . THR A 1  497  ? 125.937 33.784  -14.578 1.00 75.21  ? 497  THR A N     1 
ATOM   3887  C  CA    . THR A 1  497  ? 125.121 34.631  -13.698 1.00 74.19  ? 497  THR A CA    1 
ATOM   3888  C  C     . THR A 1  497  ? 125.573 34.501  -12.274 1.00 77.16  ? 497  THR A C     1 
ATOM   3889  O  O     . THR A 1  497  ? 125.593 35.500  -11.567 1.00 77.40  ? 497  THR A O     1 
ATOM   3890  C  CB    . THR A 1  497  ? 123.618 34.417  -13.852 1.00 78.88  ? 497  THR A CB    1 
ATOM   3891  O  OG1   . THR A 1  497  ? 123.309 33.050  -13.670 1.00 77.95  ? 497  THR A OG1   1 
ATOM   3892  C  CG2   . THR A 1  497  ? 123.107 34.864  -15.173 1.00 78.02  ? 497  THR A CG2   1 
ATOM   3893  N  N     . ARG A 1  498  ? 125.978 33.297  -11.851 1.00 72.61  ? 498  ARG A N     1 
ATOM   3894  C  CA    . ARG A 1  498  ? 126.495 33.106  -10.500 1.00 72.62  ? 498  ARG A CA    1 
ATOM   3895  C  C     . ARG A 1  498  ? 127.648 34.077  -10.222 1.00 76.63  ? 498  ARG A C     1 
ATOM   3896  O  O     . ARG A 1  498  ? 127.651 34.735  -9.170  1.00 76.72  ? 498  ARG A O     1 
ATOM   3897  C  CB    . ARG A 1  498  ? 126.996 31.686  -10.331 1.00 73.37  ? 498  ARG A CB    1 
ATOM   3898  C  CG    . ARG A 1  498  ? 125.940 30.752  -9.869  1.00 80.92  ? 498  ARG A CG    1 
ATOM   3899  C  CD    . ARG A 1  498  ? 126.411 29.353  -10.096 1.00 84.82  ? 498  ARG A CD    1 
ATOM   3900  N  NE    . ARG A 1  498  ? 126.006 28.528  -8.972  1.00 96.33  ? 498  ARG A NE    1 
ATOM   3901  C  CZ    . ARG A 1  498  ? 126.827 28.177  -8.000  1.00 112.18 ? 498  ARG A CZ    1 
ATOM   3902  N  NH1   . ARG A 1  498  ? 128.099 28.563  -8.026  1.00 97.42  ? 498  ARG A NH1   1 
ATOM   3903  N  NH2   . ARG A 1  498  ? 126.388 27.439  -6.989  1.00 99.91  ? 498  ARG A NH2   1 
ATOM   3904  N  N     . ALA A 1  499  ? 128.601 34.191  -11.199 1.00 71.54  ? 499  ALA A N     1 
ATOM   3905  C  CA    . ALA A 1  499  ? 129.756 35.074  -11.112 1.00 70.80  ? 499  ALA A CA    1 
ATOM   3906  C  C     . ALA A 1  499  ? 129.284 36.499  -10.909 1.00 75.95  ? 499  ALA A C     1 
ATOM   3907  O  O     . ALA A 1  499  ? 129.650 37.103  -9.902  1.00 77.07  ? 499  ALA A O     1 
ATOM   3908  C  CB    . ALA A 1  499  ? 130.610 34.960  -12.351 1.00 71.34  ? 499  ALA A CB    1 
ATOM   3909  N  N     . GLU A 1  500  ? 128.368 36.993  -11.776 1.00 71.21  ? 500  GLU A N     1 
ATOM   3910  C  CA    . GLU A 1  500  ? 127.782 38.334  -11.654 1.00 70.15  ? 500  GLU A CA    1 
ATOM   3911  C  C     . GLU A 1  500  ? 127.383 38.601  -10.198 1.00 71.80  ? 500  GLU A C     1 
ATOM   3912  O  O     . GLU A 1  500  ? 127.811 39.593  -9.622  1.00 72.39  ? 500  GLU A O     1 
ATOM   3913  C  CB    . GLU A 1  500  ? 126.550 38.458  -12.560 1.00 71.24  ? 500  GLU A CB    1 
ATOM   3914  C  CG    . GLU A 1  500  ? 126.595 39.652  -13.481 1.00 84.86  ? 500  GLU A CG    1 
ATOM   3915  C  CD    . GLU A 1  500  ? 126.214 39.342  -14.917 1.00 114.26 ? 500  GLU A CD    1 
ATOM   3916  O  OE1   . GLU A 1  500  ? 127.025 38.715  -15.647 1.00 112.24 ? 500  GLU A OE1   1 
ATOM   3917  O  OE2   . GLU A 1  500  ? 125.097 39.748  -15.311 1.00 94.38  ? 500  GLU A OE2   1 
ATOM   3918  N  N     . LEU A 1  501  ? 126.660 37.659  -9.590  1.00 65.33  ? 501  LEU A N     1 
ATOM   3919  C  CA    . LEU A 1  501  ? 126.197 37.758  -8.230  1.00 64.63  ? 501  LEU A CA    1 
ATOM   3920  C  C     . LEU A 1  501  ? 127.303 37.794  -7.188  1.00 68.83  ? 501  LEU A C     1 
ATOM   3921  O  O     . LEU A 1  501  ? 127.311 38.694  -6.338  1.00 69.09  ? 501  LEU A O     1 
ATOM   3922  C  CB    . LEU A 1  501  ? 125.176 36.660  -7.941  1.00 64.30  ? 501  LEU A CB    1 
ATOM   3923  C  CG    . LEU A 1  501  ? 123.833 36.891  -8.600  1.00 68.93  ? 501  LEU A CG    1 
ATOM   3924  C  CD1   . LEU A 1  501  ? 122.974 35.704  -8.487  1.00 68.25  ? 501  LEU A CD1   1 
ATOM   3925  C  CD2   . LEU A 1  501  ? 123.128 38.079  -7.988  1.00 74.29  ? 501  LEU A CD2   1 
ATOM   3926  N  N     . SER A 1  502  ? 128.248 36.847  -7.262  1.00 64.09  ? 502  SER A N     1 
ATOM   3927  C  CA    . SER A 1  502  ? 129.342 36.763  -6.295  1.00 63.90  ? 502  SER A CA    1 
ATOM   3928  C  C     . SER A 1  502  ? 130.343 37.902  -6.447  1.00 69.66  ? 502  SER A C     1 
ATOM   3929  O  O     . SER A 1  502  ? 130.895 38.404  -5.458  1.00 69.21  ? 502  SER A O     1 
ATOM   3930  C  CB    . SER A 1  502  ? 130.055 35.423  -6.428  1.00 66.17  ? 502  SER A CB    1 
ATOM   3931  O  OG    . SER A 1  502  ? 130.883 35.377  -7.576  1.00 72.10  ? 502  SER A OG    1 
ATOM   3932  N  N     . GLN A 1  503  ? 130.572 38.299  -7.699  1.00 67.74  ? 503  GLN A N     1 
ATOM   3933  C  CA    . GLN A 1  503  ? 131.541 39.318  -8.053  1.00 68.70  ? 503  GLN A CA    1 
ATOM   3934  C  C     . GLN A 1  503  ? 131.048 40.746  -7.994  1.00 76.85  ? 503  GLN A C     1 
ATOM   3935  O  O     . GLN A 1  503  ? 131.880 41.658  -7.908  1.00 79.39  ? 503  GLN A O     1 
ATOM   3936  C  CB    . GLN A 1  503  ? 132.220 39.002  -9.396  1.00 69.49  ? 503  GLN A CB    1 
ATOM   3937  C  CG    . GLN A 1  503  ? 132.996 37.679  -9.399  1.00 76.69  ? 503  GLN A CG    1 
ATOM   3938  C  CD    . GLN A 1  503  ? 133.808 37.453  -8.139  1.00 84.95  ? 503  GLN A CD    1 
ATOM   3939  O  OE1   . GLN A 1  503  ? 134.811 38.143  -7.861  1.00 73.58  ? 503  GLN A OE1   1 
ATOM   3940  N  NE2   . GLN A 1  503  ? 133.379 36.477  -7.346  1.00 75.49  ? 503  GLN A NE2   1 
ATOM   3941  N  N     . LEU A 1  504  ? 129.720 40.971  -8.023  1.00 72.12  ? 504  LEU A N     1 
ATOM   3942  C  CA    . LEU A 1  504  ? 129.220 42.346  -8.008  1.00 70.59  ? 504  LEU A CA    1 
ATOM   3943  C  C     . LEU A 1  504  ? 128.247 42.665  -6.863  1.00 75.55  ? 504  LEU A C     1 
ATOM   3944  O  O     . LEU A 1  504  ? 128.435 43.670  -6.181  1.00 75.29  ? 504  LEU A O     1 
ATOM   3945  C  CB    . LEU A 1  504  ? 128.615 42.736  -9.383  1.00 69.24  ? 504  LEU A CB    1 
ATOM   3946  C  CG    . LEU A 1  504  ? 129.486 42.614  -10.644 1.00 72.16  ? 504  LEU A CG    1 
ATOM   3947  C  CD1   . LEU A 1  504  ? 128.643 42.591  -11.887 1.00 71.53  ? 504  LEU A CD1   1 
ATOM   3948  C  CD2   . LEU A 1  504  ? 130.432 43.761  -10.771 1.00 74.32  ? 504  LEU A CD2   1 
ATOM   3949  N  N     . CYS A 1  505  ? 127.217 41.826  -6.664  1.00 73.01  ? 505  CYS A N     1 
ATOM   3950  C  CA    . CYS A 1  505  ? 126.128 42.047  -5.708  1.00 73.87  ? 505  CYS A CA    1 
ATOM   3951  C  C     . CYS A 1  505  ? 126.261 41.359  -4.359  1.00 76.15  ? 505  CYS A C     1 
ATOM   3952  O  O     . CYS A 1  505  ? 125.316 41.357  -3.569  1.00 75.87  ? 505  CYS A O     1 
ATOM   3953  C  CB    . CYS A 1  505  ? 124.781 41.742  -6.355  1.00 75.31  ? 505  CYS A CB    1 
ATOM   3954  S  SG    . CYS A 1  505  ? 124.853 41.484  -8.149  1.00 79.96  ? 505  CYS A SG    1 
ATOM   3955  N  N     . ALA A 1  506  ? 127.415 40.790  -4.083  1.00 71.41  ? 506  ALA A N     1 
ATOM   3956  C  CA    . ALA A 1  506  ? 127.663 40.138  -2.815  1.00 70.94  ? 506  ALA A CA    1 
ATOM   3957  C  C     . ALA A 1  506  ? 127.510 41.120  -1.686  1.00 73.71  ? 506  ALA A C     1 
ATOM   3958  O  O     . ALA A 1  506  ? 128.013 42.231  -1.789  1.00 74.68  ? 506  ALA A O     1 
ATOM   3959  C  CB    . ALA A 1  506  ? 129.076 39.607  -2.804  1.00 72.48  ? 506  ALA A CB    1 
ATOM   3960  N  N     . VAL A 1  507  ? 126.848 40.715  -0.599  1.00 69.37  ? 507  VAL A N     1 
ATOM   3961  C  CA    . VAL A 1  507  ? 126.670 41.538  0.621   1.00 68.55  ? 507  VAL A CA    1 
ATOM   3962  C  C     . VAL A 1  507  ? 127.969 42.290  1.049   1.00 72.40  ? 507  VAL A C     1 
ATOM   3963  O  O     . VAL A 1  507  ? 127.873 43.509  1.256   1.00 71.58  ? 507  VAL A O     1 
ATOM   3964  C  CB    . VAL A 1  507  ? 126.076 40.722  1.803   1.00 70.85  ? 507  VAL A CB    1 
ATOM   3965  C  CG1   . VAL A 1  507  ? 126.109 41.514  3.101   1.00 70.55  ? 507  VAL A CG1   1 
ATOM   3966  C  CG2   . VAL A 1  507  ? 124.669 40.237  1.489   1.00 69.97  ? 507  VAL A CG2   1 
ATOM   3967  N  N     . PRO A 1  508  ? 129.173 41.623  1.156   1.00 68.61  ? 508  PRO A N     1 
ATOM   3968  C  CA    . PRO A 1  508  ? 130.363 42.337  1.631   1.00 69.05  ? 508  PRO A CA    1 
ATOM   3969  C  C     . PRO A 1  508  ? 130.786 43.471  0.736   1.00 74.33  ? 508  PRO A C     1 
ATOM   3970  O  O     . PRO A 1  508  ? 131.231 44.518  1.245   1.00 75.44  ? 508  PRO A O     1 
ATOM   3971  C  CB    . PRO A 1  508  ? 131.412 41.238  1.738   1.00 70.42  ? 508  PRO A CB    1 
ATOM   3972  C  CG    . PRO A 1  508  ? 130.623 40.025  1.937   1.00 74.10  ? 508  PRO A CG    1 
ATOM   3973  C  CD    . PRO A 1  508  ? 129.502 40.197  0.988   1.00 69.29  ? 508  PRO A CD    1 
ATOM   3974  N  N     . LEU A 1  509  ? 130.577 43.299  -0.583  1.00 69.63  ? 509  LEU A N     1 
ATOM   3975  C  CA    . LEU A 1  509  ? 130.876 44.357  -1.549  1.00 69.06  ? 509  LEU A CA    1 
ATOM   3976  C  C     . LEU A 1  509  ? 130.029 45.592  -1.244  1.00 76.63  ? 509  LEU A C     1 
ATOM   3977  O  O     . LEU A 1  509  ? 130.573 46.704  -1.167  1.00 79.03  ? 509  LEU A O     1 
ATOM   3978  C  CB    . LEU A 1  509  ? 130.698 43.873  -2.985  1.00 67.45  ? 509  LEU A CB    1 
ATOM   3979  C  CG    . LEU A 1  509  ? 131.522 42.635  -3.315  1.00 70.57  ? 509  LEU A CG    1 
ATOM   3980  C  CD1   . LEU A 1  509  ? 131.136 42.011  -4.672  1.00 68.77  ? 509  LEU A CD1   1 
ATOM   3981  C  CD2   . LEU A 1  509  ? 133.015 42.925  -3.189  1.00 74.05  ? 509  LEU A CD2   1 
ATOM   3982  N  N     . GLN A 1  510  ? 128.755 45.369  -0.883  1.00 72.36  ? 510  GLN A N     1 
ATOM   3983  C  CA    . GLN A 1  510  ? 127.810 46.436  -0.560  1.00 72.15  ? 510  GLN A CA    1 
ATOM   3984  C  C     . GLN A 1  510  ? 128.017 47.237  0.748   1.00 74.97  ? 510  GLN A C     1 
ATOM   3985  O  O     . GLN A 1  510  ? 127.361 48.273  0.885   1.00 74.63  ? 510  GLN A O     1 
ATOM   3986  C  CB    . GLN A 1  510  ? 126.355 45.958  -0.712  1.00 72.86  ? 510  GLN A CB    1 
ATOM   3987  C  CG    . GLN A 1  510  ? 126.068 45.216  -2.006  1.00 73.70  ? 510  GLN A CG    1 
ATOM   3988  C  CD    . GLN A 1  510  ? 126.234 46.094  -3.203  1.00 95.37  ? 510  GLN A CD    1 
ATOM   3989  O  OE1   . GLN A 1  510  ? 125.875 47.273  -3.182  1.00 99.81  ? 510  GLN A OE1   1 
ATOM   3990  N  NE2   . GLN A 1  510  ? 126.765 45.533  -4.278  1.00 82.56  ? 510  GLN A NE2   1 
ATOM   3991  N  N     . ILE A 1  511  ? 128.935 46.804  1.660   1.00 70.74  ? 511  ILE A N     1 
ATOM   3992  C  CA    . ILE A 1  511  ? 129.207 47.449  2.968   1.00 70.80  ? 511  ILE A CA    1 
ATOM   3993  C  C     . ILE A 1  511  ? 129.305 48.970  2.928   1.00 76.92  ? 511  ILE A C     1 
ATOM   3994  O  O     . ILE A 1  511  ? 128.513 49.624  3.595   1.00 75.36  ? 511  ILE A O     1 
ATOM   3995  C  CB    . ILE A 1  511  ? 130.322 46.771  3.828   1.00 73.35  ? 511  ILE A CB    1 
ATOM   3996  C  CG1   . ILE A 1  511  ? 129.937 45.328  4.207   1.00 72.50  ? 511  ILE A CG1   1 
ATOM   3997  C  CG2   . ILE A 1  511  ? 130.612 47.584  5.093   1.00 73.55  ? 511  ILE A CG2   1 
ATOM   3998  C  CD1   . ILE A 1  511  ? 131.049 44.505  4.590   1.00 74.76  ? 511  ILE A CD1   1 
ATOM   3999  N  N     . VAL A 1  512  ? 130.254 49.533  2.158   1.00 77.22  ? 512  VAL A N     1 
ATOM   4000  C  CA    . VAL A 1  512  ? 130.345 50.992  2.013   1.00 79.30  ? 512  VAL A CA    1 
ATOM   4001  C  C     . VAL A 1  512  ? 129.463 51.326  0.796   1.00 86.19  ? 512  VAL A C     1 
ATOM   4002  O  O     . VAL A 1  512  ? 129.569 50.640  -0.221  1.00 86.18  ? 512  VAL A O     1 
ATOM   4003  C  CB    . VAL A 1  512  ? 131.799 51.518  1.882   1.00 84.29  ? 512  VAL A CB    1 
ATOM   4004  C  CG1   . VAL A 1  512  ? 131.815 52.993  1.505   1.00 85.21  ? 512  VAL A CG1   1 
ATOM   4005  C  CG2   . VAL A 1  512  ? 132.581 51.306  3.174   1.00 84.31  ? 512  VAL A CG2   1 
ATOM   4006  N  N     . SER A 1  513  ? 128.543 52.309  0.926   1.00 83.90  ? 513  SER A N     1 
ATOM   4007  C  CA    . SER A 1  513  ? 127.577 52.645  -0.131  1.00 83.30  ? 513  SER A CA    1 
ATOM   4008  C  C     . SER A 1  513  ? 127.808 53.997  -0.741  1.00 85.83  ? 513  SER A C     1 
ATOM   4009  O  O     . SER A 1  513  ? 127.942 54.972  0.008   1.00 86.29  ? 513  SER A O     1 
ATOM   4010  C  CB    . SER A 1  513  ? 126.141 52.535  0.383   1.00 87.86  ? 513  SER A CB    1 
ATOM   4011  O  OG    . SER A 1  513  ? 125.332 53.666  0.092   1.00 96.74  ? 513  SER A OG    1 
ATOM   4012  N  N     . PRO A 1  514  ? 127.710 54.075  -2.094  1.00 80.89  ? 514  PRO A N     1 
ATOM   4013  C  CA    . PRO A 1  514  ? 127.901 55.351  -2.797  1.00 81.58  ? 514  PRO A CA    1 
ATOM   4014  C  C     . PRO A 1  514  ? 126.833 56.429  -2.537  1.00 90.31  ? 514  PRO A C     1 
ATOM   4015  O  O     . PRO A 1  514  ? 127.109 57.622  -2.717  1.00 91.31  ? 514  PRO A O     1 
ATOM   4016  C  CB    . PRO A 1  514  ? 127.929 54.926  -4.268  1.00 81.93  ? 514  PRO A CB    1 
ATOM   4017  C  CG    . PRO A 1  514  ? 127.146 53.728  -4.324  1.00 84.92  ? 514  PRO A CG    1 
ATOM   4018  C  CD    . PRO A 1  514  ? 127.487 52.991  -3.066  1.00 81.07  ? 514  PRO A CD    1 
ATOM   4019  N  N     . GLN A 1  515  ? 125.627 56.017  -2.098  1.00 88.04  ? 515  GLN A N     1 
ATOM   4020  C  CA    . GLN A 1  515  ? 124.505 56.904  -1.810  1.00 88.69  ? 515  GLN A CA    1 
ATOM   4021  C  C     . GLN A 1  515  ? 124.911 58.027  -0.900  1.00 94.77  ? 515  GLN A C     1 
ATOM   4022  O  O     . GLN A 1  515  ? 124.420 59.139  -1.057  1.00 97.50  ? 515  GLN A O     1 
ATOM   4023  C  CB    . GLN A 1  515  ? 123.356 56.111  -1.168  1.00 90.11  ? 515  GLN A CB    1 
ATOM   4024  C  CG    . GLN A 1  515  ? 122.096 56.921  -0.839  1.00 103.82 ? 515  GLN A CG    1 
ATOM   4025  C  CD    . GLN A 1  515  ? 120.899 56.016  -0.747  1.00 120.85 ? 515  GLN A CD    1 
ATOM   4026  O  OE1   . GLN A 1  515  ? 120.715 55.083  -1.555  1.00 113.17 ? 515  GLN A OE1   1 
ATOM   4027  N  NE2   . GLN A 1  515  ? 120.048 56.289  0.227   1.00 113.82 ? 515  GLN A NE2   1 
ATOM   4028  N  N     . SER A 1  516  ? 125.814 57.757  0.031   1.00 90.07  ? 516  SER A N     1 
ATOM   4029  C  CA    . SER A 1  516  ? 126.208 58.771  0.991   1.00 90.53  ? 516  SER A CA    1 
ATOM   4030  C  C     . SER A 1  516  ? 127.672 58.632  1.355   1.00 92.59  ? 516  SER A C     1 
ATOM   4031  O  O     . SER A 1  516  ? 128.116 59.209  2.354   1.00 92.94  ? 516  SER A O     1 
ATOM   4032  C  CB    . SER A 1  516  ? 125.341 58.619  2.229   1.00 96.33  ? 516  SER A CB    1 
ATOM   4033  O  OG    . SER A 1  516  ? 125.306 57.230  2.527   1.00 114.40 ? 516  SER A OG    1 
ATOM   4034  N  N     . ASN A 1  517  ? 128.427 57.880  0.530   1.00 87.01  ? 517  ASN A N     1 
ATOM   4035  C  CA    . ASN A 1  517  ? 129.856 57.589  0.677   1.00 86.70  ? 517  ASN A CA    1 
ATOM   4036  C  C     . ASN A 1  517  ? 130.267 57.050  2.065   1.00 92.50  ? 517  ASN A C     1 
ATOM   4037  O  O     . ASN A 1  517  ? 131.390 57.286  2.528   1.00 93.37  ? 517  ASN A O     1 
ATOM   4038  C  CB    . ASN A 1  517  ? 130.732 58.745  0.189   1.00 84.27  ? 517  ASN A CB    1 
ATOM   4039  C  CG    . ASN A 1  517  ? 130.632 60.014  0.977   1.00 106.27 ? 517  ASN A CG    1 
ATOM   4040  O  OD1   . ASN A 1  517  ? 130.110 61.017  0.492   1.00 102.13 ? 517  ASN A OD1   1 
ATOM   4041  N  ND2   . ASN A 1  517  ? 131.123 60.007  2.212   1.00 102.56 ? 517  ASN A ND2   1 
ATOM   4042  N  N     . LYS A 1  518  ? 129.345 56.330  2.728   1.00 88.33  ? 518  LYS A N     1 
ATOM   4043  C  CA    . LYS A 1  518  ? 129.577 55.772  4.057   1.00 87.61  ? 518  LYS A CA    1 
ATOM   4044  C  C     . LYS A 1  518  ? 128.898 54.399  4.194   1.00 91.07  ? 518  LYS A C     1 
ATOM   4045  O  O     . LYS A 1  518  ? 127.919 54.127  3.471   1.00 90.58  ? 518  LYS A O     1 
ATOM   4046  C  CB    . LYS A 1  518  ? 129.148 56.758  5.174   1.00 89.18  ? 518  LYS A CB    1 
ATOM   4047  C  CG    . LYS A 1  518  ? 127.643 57.030  5.248   1.00 93.41  ? 518  LYS A CG    1 
ATOM   4048  C  CD    . LYS A 1  518  ? 127.083 56.846  6.664   1.00 97.37  ? 518  LYS A CD    1 
ATOM   4049  C  CE    . LYS A 1  518  ? 125.567 56.730  6.736   1.00 99.71  ? 518  LYS A CE    1 
ATOM   4050  N  NZ    . LYS A 1  518  ? 125.062 55.402  6.267   1.00 110.67 ? 518  LYS A NZ    1 
ATOM   4051  N  N     . PRO A 1  519  ? 129.398 53.544  5.130   1.00 86.22  ? 519  PRO A N     1 
ATOM   4052  C  CA    . PRO A 1  519  ? 128.805 52.213  5.319   1.00 84.92  ? 519  PRO A CA    1 
ATOM   4053  C  C     . PRO A 1  519  ? 127.294 52.201  5.547   1.00 88.29  ? 519  PRO A C     1 
ATOM   4054  O  O     . PRO A 1  519  ? 126.772 52.995  6.320   1.00 88.33  ? 519  PRO A O     1 
ATOM   4055  C  CB    . PRO A 1  519  ? 129.578 51.648  6.515   1.00 86.93  ? 519  PRO A CB    1 
ATOM   4056  C  CG    . PRO A 1  519  ? 130.259 52.816  7.148   1.00 92.09  ? 519  PRO A CG    1 
ATOM   4057  C  CD    . PRO A 1  519  ? 130.543 53.743  6.041   1.00 87.79  ? 519  PRO A CD    1 
ATOM   4058  N  N     . CYS A 1  520  ? 126.596 51.311  4.845   1.00 84.57  ? 520  CYS A N     1 
ATOM   4059  C  CA    . CYS A 1  520  ? 125.141 51.172  4.928   1.00 84.50  ? 520  CYS A CA    1 
ATOM   4060  C  C     . CYS A 1  520  ? 124.677 50.027  5.833   1.00 85.51  ? 520  CYS A C     1 
ATOM   4061  O  O     . CYS A 1  520  ? 123.480 49.707  5.869   1.00 83.65  ? 520  CYS A O     1 
ATOM   4062  C  CB    . CYS A 1  520  ? 124.543 51.057  3.531   1.00 85.16  ? 520  CYS A CB    1 
ATOM   4063  S  SG    . CYS A 1  520  ? 124.927 49.504  2.694   1.00 88.82  ? 520  CYS A SG    1 
ATOM   4064  N  N     . MET A 1  521  ? 125.639 49.405  6.533   1.00 81.93  ? 521  MET A N     1 
ATOM   4065  C  CA    . MET A 1  521  ? 125.478 48.306  7.487   1.00 81.33  ? 521  MET A CA    1 
ATOM   4066  C  C     . MET A 1  521  ? 126.361 48.594  8.681   1.00 89.31  ? 521  MET A C     1 
ATOM   4067  O  O     . MET A 1  521  ? 127.501 49.050  8.515   1.00 89.80  ? 521  MET A O     1 
ATOM   4068  C  CB    . MET A 1  521  ? 125.928 46.986  6.871   1.00 82.17  ? 521  MET A CB    1 
ATOM   4069  C  CG    . MET A 1  521  ? 124.948 46.418  5.938   1.00 84.54  ? 521  MET A CG    1 
ATOM   4070  S  SD    . MET A 1  521  ? 125.719 45.141  4.962   1.00 88.38  ? 521  MET A SD    1 
ATOM   4071  C  CE    . MET A 1  521  ? 125.521 45.797  3.311   1.00 84.59  ? 521  MET A CE    1 
ATOM   4072  N  N     . GLY A 1  522  ? 125.852 48.312  9.870   1.00 87.45  ? 522  GLY A N     1 
ATOM   4073  C  CA    . GLY A 1  522  ? 126.627 48.508  11.091  1.00 88.53  ? 522  GLY A CA    1 
ATOM   4074  C  C     . GLY A 1  522  ? 126.161 47.624  12.216  1.00 93.15  ? 522  GLY A C     1 
ATOM   4075  O  O     . GLY A 1  522  ? 125.226 46.843  12.031  1.00 93.53  ? 522  GLY A O     1 
ATOM   4076  N  N     . ILE A 1  523  ? 126.783 47.746  13.391  1.00 89.47  ? 523  ILE A N     1 
ATOM   4077  C  CA    . ILE A 1  523  ? 126.318 46.962  14.537  1.00 89.25  ? 523  ILE A CA    1 
ATOM   4078  C  C     . ILE A 1  523  ? 124.994 47.576  15.047  1.00 93.23  ? 523  ILE A C     1 
ATOM   4079  O  O     . ILE A 1  523  ? 124.881 48.794  15.163  1.00 93.41  ? 523  ILE A O     1 
ATOM   4080  C  CB    . ILE A 1  523  ? 127.431 46.711  15.601  1.00 92.35  ? 523  ILE A CB    1 
ATOM   4081  C  CG1   . ILE A 1  523  ? 128.321 45.535  15.179  1.00 91.90  ? 523  ILE A CG1   1 
ATOM   4082  C  CG2   . ILE A 1  523  ? 126.864 46.425  16.979  1.00 92.82  ? 523  ILE A CG2   1 
ATOM   4083  C  CD1   . ILE A 1  523  ? 129.360 45.850  14.198  1.00 94.23  ? 523  ILE A CD1   1 
ATOM   4084  N  N     . VAL A 1  524  ? 123.987 46.736  15.262  1.00 89.25  ? 524  VAL A N     1 
ATOM   4085  C  CA    . VAL A 1  524  ? 122.659 47.177  15.652  1.00 89.55  ? 524  VAL A CA    1 
ATOM   4086  C  C     . VAL A 1  524  ? 122.114 46.467  16.931  1.00 95.22  ? 524  VAL A C     1 
ATOM   4087  O  O     . VAL A 1  524  ? 122.662 45.449  17.370  1.00 96.50  ? 524  VAL A O     1 
ATOM   4088  C  CB    . VAL A 1  524  ? 121.776 46.957  14.393  1.00 93.50  ? 524  VAL A CB    1 
ATOM   4089  C  CG1   . VAL A 1  524  ? 121.490 45.481  14.134  1.00 93.04  ? 524  VAL A CG1   1 
ATOM   4090  C  CG2   . VAL A 1  524  ? 120.490 47.766  14.438  1.00 94.06  ? 524  VAL A CG2   1 
ATOM   4091  N  N     . GLN A 1  525  ? 121.030 47.007  17.505  1.00 91.26  ? 525  GLN A N     1 
ATOM   4092  C  CA    . GLN A 1  525  ? 120.281 46.452  18.643  1.00 91.31  ? 525  GLN A CA    1 
ATOM   4093  C  C     . GLN A 1  525  ? 121.068 45.835  19.797  1.00 97.10  ? 525  GLN A C     1 
ATOM   4094  O  O     . GLN A 1  525  ? 121.827 46.561  20.441  1.00 97.77  ? 525  GLN A O     1 
ATOM   4095  C  CB    . GLN A 1  525  ? 119.112 45.562  18.181  1.00 91.39  ? 525  GLN A CB    1 
ATOM   4096  C  CG    . GLN A 1  525  ? 117.924 46.371  17.675  1.00 99.36  ? 525  GLN A CG    1 
ATOM   4097  C  CD    . GLN A 1  525  ? 116.575 45.754  17.948  1.00 120.79 ? 525  GLN A CD    1 
ATOM   4098  O  OE1   . GLN A 1  525  ? 116.441 44.606  18.412  1.00 115.39 ? 525  GLN A OE1   1 
ATOM   4099  N  NE2   . GLN A 1  525  ? 115.532 46.516  17.639  1.00 117.64 ? 525  GLN A NE2   1 
ATOM   4100  N  N     . ASP A 1  526  ? 120.863 44.518  20.083  1.00 93.80  ? 526  ASP A N     1 
ATOM   4101  C  CA    . ASP A 1  526  ? 121.508 43.789  21.189  1.00 94.19  ? 526  ASP A CA    1 
ATOM   4102  C  C     . ASP A 1  526  ? 122.994 44.055  21.219  1.00 97.88  ? 526  ASP A C     1 
ATOM   4103  O  O     . ASP A 1  526  ? 123.491 44.534  22.237  1.00 98.49  ? 526  ASP A O     1 
ATOM   4104  C  CB    . ASP A 1  526  ? 121.263 42.260  21.119  1.00 95.77  ? 526  ASP A CB    1 
ATOM   4105  C  CG    . ASP A 1  526  ? 119.985 41.737  21.749  1.00 111.23 ? 526  ASP A CG    1 
ATOM   4106  O  OD1   . ASP A 1  526  ? 119.013 42.527  21.871  1.00 112.16 ? 526  ASP A OD1   1 
ATOM   4107  O  OD2   . ASP A 1  526  ? 119.934 40.512  22.073  1.00 119.91 ? 526  ASP A OD2   1 
ATOM   4108  N  N     . THR A 1  527  ? 123.688 43.798  20.082  1.00 93.24  ? 527  THR A N     1 
ATOM   4109  C  CA    . THR A 1  527  ? 125.130 43.962  19.949  1.00 93.14  ? 527  THR A CA    1 
ATOM   4110  C  C     . THR A 1  527  ? 125.573 45.385  20.183  1.00 98.87  ? 527  THR A C     1 
ATOM   4111  O  O     . THR A 1  527  ? 126.578 45.581  20.863  1.00 99.97  ? 527  THR A O     1 
ATOM   4112  C  CB    . THR A 1  527  ? 125.680 43.215  18.743  1.00 99.68  ? 527  THR A CB    1 
ATOM   4113  O  OG1   . THR A 1  527  ? 125.270 41.854  18.852  1.00 99.22  ? 527  THR A OG1   1 
ATOM   4114  C  CG2   . THR A 1  527  ? 127.198 43.240  18.675  1.00 98.76  ? 527  THR A CG2   1 
ATOM   4115  N  N     . LEU A 1  528  ? 124.787 46.382  19.741  1.00 95.29  ? 528  LEU A N     1 
ATOM   4116  C  CA    . LEU A 1  528  ? 125.142 47.770  20.042  1.00 95.59  ? 528  LEU A CA    1 
ATOM   4117  C  C     . LEU A 1  528  ? 125.004 48.063  21.552  1.00 101.91 ? 528  LEU A C     1 
ATOM   4118  O  O     . LEU A 1  528  ? 125.947 48.559  22.160  1.00 101.69 ? 528  LEU A O     1 
ATOM   4119  C  CB    . LEU A 1  528  ? 124.351 48.770  19.192  1.00 94.73  ? 528  LEU A CB    1 
ATOM   4120  C  CG    . LEU A 1  528  ? 124.834 50.205  19.307  1.00 99.11  ? 528  LEU A CG    1 
ATOM   4121  C  CD1   . LEU A 1  528  ? 126.310 50.313  18.991  1.00 98.66  ? 528  LEU A CD1   1 
ATOM   4122  C  CD2   . LEU A 1  528  ? 124.030 51.116  18.424  1.00 101.47 ? 528  LEU A CD2   1 
ATOM   4123  N  N     . CYS A 1  529  ? 123.852 47.680  22.150  1.00 99.98  ? 529  CYS A N     1 
ATOM   4124  C  CA    . CYS A 1  529  ? 123.517 47.826  23.574  1.00 100.79 ? 529  CYS A CA    1 
ATOM   4125  C  C     . CYS A 1  529  ? 124.556 47.169  24.511  1.00 98.65  ? 529  CYS A C     1 
ATOM   4126  O  O     . CYS A 1  529  ? 124.929 47.759  25.528  1.00 98.72  ? 529  CYS A O     1 
ATOM   4127  C  CB    . CYS A 1  529  ? 122.108 47.296  23.840  1.00 102.37 ? 529  CYS A CB    1 
ATOM   4128  S  SG    . CYS A 1  529  ? 121.420 47.771  25.452  1.00 108.32 ? 529  CYS A SG    1 
ATOM   4129  N  N     . GLY A 1  530  ? 124.991 45.969  24.143  1.00 90.70  ? 530  GLY A N     1 
ATOM   4130  C  CA    . GLY A 1  530  ? 125.965 45.183  24.884  1.00 90.07  ? 530  GLY A CA    1 
ATOM   4131  C  C     . GLY A 1  530  ? 127.403 45.599  24.650  1.00 92.92  ? 530  GLY A C     1 
ATOM   4132  O  O     . GLY A 1  530  ? 128.243 45.430  25.542  1.00 92.92  ? 530  GLY A O     1 
ATOM   4133  N  N     . ILE A 1  531  ? 127.713 46.142  23.447  1.00 87.77  ? 531  ILE A N     1 
ATOM   4134  C  CA    . ILE A 1  531  ? 129.078 46.580  23.164  1.00 86.78  ? 531  ILE A CA    1 
ATOM   4135  C  C     . ILE A 1  531  ? 129.473 47.762  24.072  1.00 91.69  ? 531  ILE A C     1 
ATOM   4136  O  O     . ILE A 1  531  ? 130.606 47.790  24.550  1.00 92.97  ? 531  ILE A O     1 
ATOM   4137  C  CB    . ILE A 1  531  ? 129.439 46.719  21.655  1.00 87.84  ? 531  ILE A CB    1 
ATOM   4138  C  CG1   . ILE A 1  531  ? 130.954 46.579  21.421  1.00 87.53  ? 531  ILE A CG1   1 
ATOM   4139  C  CG2   . ILE A 1  531  ? 128.867 47.986  21.030  1.00 88.38  ? 531  ILE A CG2   1 
ATOM   4140  C  CD1   . ILE A 1  531  ? 131.382 46.400  20.004  1.00 87.38  ? 531  ILE A CD1   1 
ATOM   4141  N  N     . ARG A 1  532  ? 128.512 48.661  24.392  1.00 87.06  ? 532  ARG A N     1 
ATOM   4142  C  CA    . ARG A 1  532  ? 128.741 49.787  25.303  1.00 87.63  ? 532  ARG A CA    1 
ATOM   4143  C  C     . ARG A 1  532  ? 129.023 49.240  26.692  1.00 91.90  ? 532  ARG A C     1 
ATOM   4144  O  O     . ARG A 1  532  ? 130.062 49.572  27.278  1.00 92.32  ? 532  ARG A O     1 
ATOM   4145  C  CB    . ARG A 1  532  ? 127.538 50.747  25.347  1.00 87.12  ? 532  ARG A CB    1 
ATOM   4146  C  CG    . ARG A 1  532  ? 127.857 52.028  26.087  1.00 95.20  ? 532  ARG A CG    1 
ATOM   4147  C  CD    . ARG A 1  532  ? 126.622 52.843  26.348  1.00 107.18 ? 532  ARG A CD    1 
ATOM   4148  N  NE    . ARG A 1  532  ? 126.466 53.134  27.769  1.00 118.08 ? 532  ARG A NE    1 
ATOM   4149  C  CZ    . ARG A 1  532  ? 125.890 52.305  28.633  1.00 135.94 ? 532  ARG A CZ    1 
ATOM   4150  N  NH1   . ARG A 1  532  ? 125.424 51.126  28.224  1.00 126.91 ? 532  ARG A NH1   1 
ATOM   4151  N  NH2   . ARG A 1  532  ? 125.778 52.645  29.914  1.00 116.80 ? 532  ARG A NH2   1 
ATOM   4152  N  N     . LYS A 1  533  ? 128.111 48.374  27.190  1.00 87.73  ? 533  LYS A N     1 
ATOM   4153  C  CA    . LYS A 1  533  ? 128.195 47.735  28.499  1.00 88.48  ? 533  LYS A CA    1 
ATOM   4154  C  C     . LYS A 1  533  ? 129.508 46.989  28.668  1.00 95.58  ? 533  LYS A C     1 
ATOM   4155  O  O     . LYS A 1  533  ? 130.172 47.178  29.685  1.00 96.88  ? 533  LYS A O     1 
ATOM   4156  C  CB    . LYS A 1  533  ? 127.003 46.802  28.759  1.00 89.62  ? 533  LYS A CB    1 
ATOM   4157  C  CG    . LYS A 1  533  ? 125.695 47.530  29.012  1.00 101.64 ? 533  LYS A CG    1 
ATOM   4158  C  CD    . LYS A 1  533  ? 124.654 46.627  29.658  1.00 111.77 ? 533  LYS A CD    1 
ATOM   4159  C  CE    . LYS A 1  533  ? 124.695 46.696  31.172  1.00 124.74 ? 533  LYS A CE    1 
ATOM   4160  N  NZ    . LYS A 1  533  ? 123.330 46.666  31.771  1.00 130.75 ? 533  LYS A NZ    1 
ATOM   4161  N  N     . LEU A 1  534  ? 129.914 46.189  27.660  1.00 92.82  ? 534  LEU A N     1 
ATOM   4162  C  CA    . LEU A 1  534  ? 131.162 45.417  27.706  1.00 93.52  ? 534  LEU A CA    1 
ATOM   4163  C  C     . LEU A 1  534  ? 132.401 46.316  27.858  1.00 100.90 ? 534  LEU A C     1 
ATOM   4164  O  O     . LEU A 1  534  ? 133.306 45.983  28.623  1.00 100.60 ? 534  LEU A O     1 
ATOM   4165  C  CB    . LEU A 1  534  ? 131.277 44.511  26.451  1.00 92.17  ? 534  LEU A CB    1 
ATOM   4166  C  CG    . LEU A 1  534  ? 132.614 43.780  26.183  1.00 96.48  ? 534  LEU A CG    1 
ATOM   4167  C  CD1   . LEU A 1  534  ? 132.823 42.580  27.119  1.00 96.88  ? 534  LEU A CD1   1 
ATOM   4168  C  CD2   . LEU A 1  534  ? 132.717 43.354  24.735  1.00 97.01  ? 534  LEU A CD2   1 
ATOM   4169  N  N     . THR A 1  535  ? 132.405 47.472  27.166  1.00 100.07 ? 535  THR A N     1 
ATOM   4170  C  CA    . THR A 1  535  ? 133.543 48.393  27.082  1.00 101.32 ? 535  THR A CA    1 
ATOM   4171  C  C     . THR A 1  535  ? 133.679 49.539  28.094  1.00 108.43 ? 535  THR A C     1 
ATOM   4172  O  O     . THR A 1  535  ? 134.539 50.401  27.887  1.00 109.47 ? 535  THR A O     1 
ATOM   4173  C  CB    . THR A 1  535  ? 133.770 48.825  25.632  1.00 106.65 ? 535  THR A CB    1 
ATOM   4174  O  OG1   . THR A 1  535  ? 132.647 49.585  25.182  1.00 103.82 ? 535  THR A OG1   1 
ATOM   4175  C  CG2   . THR A 1  535  ? 134.035 47.644  24.709  1.00 103.06 ? 535  THR A CG2   1 
ATOM   4176  N  N     . LEU A 1  536  ? 132.908 49.538  29.202  1.00 105.80 ? 536  LEU A N     1 
ATOM   4177  C  CA    . LEU A 1  536  ? 133.060 50.574  30.245  1.00 106.90 ? 536  LEU A CA    1 
ATOM   4178  C  C     . LEU A 1  536  ? 134.361 50.331  31.046  1.00 114.83 ? 536  LEU A C     1 
ATOM   4179  O  O     . LEU A 1  536  ? 134.866 49.187  31.056  1.00 115.43 ? 536  LEU A O     1 
ATOM   4180  C  CB    . LEU A 1  536  ? 131.863 50.586  31.197  1.00 106.66 ? 536  LEU A CB    1 
ATOM   4181  C  CG    . LEU A 1  536  ? 130.493 50.456  30.563  1.00 109.56 ? 536  LEU A CG    1 
ATOM   4182  C  CD1   . LEU A 1  536  ? 129.491 50.021  31.577  1.00 110.46 ? 536  LEU A CD1   1 
ATOM   4183  C  CD2   . LEU A 1  536  ? 130.048 51.741  29.909  1.00 110.37 ? 536  LEU A CD2   1 
ATOM   4184  N  N     . ARG A 1  537  ? 134.926 51.395  31.696  1.00 112.09 ? 537  ARG A N     1 
ATOM   4185  C  CA    . ARG A 1  537  ? 136.174 51.216  32.471  1.00 112.47 ? 537  ARG A CA    1 
ATOM   4186  C  C     . ARG A 1  537  ? 135.962 50.146  33.533  1.00 114.52 ? 537  ARG A C     1 
ATOM   4187  O  O     . ARG A 1  537  ? 136.724 49.185  33.594  1.00 113.61 ? 537  ARG A O     1 
ATOM   4188  C  CB    . ARG A 1  537  ? 136.720 52.539  33.060  1.00 113.57 ? 537  ARG A CB    1 
ATOM   4189  C  CG    . ARG A 1  537  ? 138.090 52.944  32.491  1.00 120.60 ? 537  ARG A CG    1 
ATOM   4190  C  CD    . ARG A 1  537  ? 138.735 54.141  33.184  1.00 126.41 ? 537  ARG A CD    1 
ATOM   4191  N  NE    . ARG A 1  537  ? 138.177 55.436  32.772  1.00 129.75 ? 537  ARG A NE    1 
ATOM   4192  C  CZ    . ARG A 1  537  ? 138.615 56.166  31.746  1.00 139.88 ? 537  ARG A CZ    1 
ATOM   4193  N  NH1   . ARG A 1  537  ? 139.612 55.728  30.986  1.00 121.76 ? 537  ARG A NH1   1 
ATOM   4194  N  NH2   . ARG A 1  537  ? 138.046 57.327  31.459  1.00 127.23 ? 537  ARG A NH2   1 
ATOM   4195  N  N     . ASP A 1  538  ? 134.830 50.260  34.234  1.00 110.71 ? 538  ASP A N     1 
ATOM   4196  C  CA    . ASP A 1  538  ? 134.264 49.400  35.261  1.00 111.63 ? 538  ASP A CA    1 
ATOM   4197  C  C     . ASP A 1  538  ? 134.220 47.885  34.935  1.00 115.20 ? 538  ASP A C     1 
ATOM   4198  O  O     . ASP A 1  538  ? 134.252 47.061  35.859  1.00 115.45 ? 538  ASP A O     1 
ATOM   4199  C  CB    . ASP A 1  538  ? 132.812 49.855  35.442  1.00 114.06 ? 538  ASP A CB    1 
ATOM   4200  C  CG    . ASP A 1  538  ? 132.475 50.465  36.777  1.00 133.80 ? 538  ASP A CG    1 
ATOM   4201  O  OD1   . ASP A 1  538  ? 133.395 51.018  37.429  1.00 137.00 ? 538  ASP A OD1   1 
ATOM   4202  O  OD2   . ASP A 1  538  ? 131.279 50.431  37.157  1.00 142.27 ? 538  ASP A OD2   1 
ATOM   4203  N  N     . THR A 1  539  ? 134.066 47.525  33.640  1.00 110.02 ? 539  THR A N     1 
ATOM   4204  C  CA    . THR A 1  539  ? 133.879 46.143  33.175  1.00 108.40 ? 539  THR A CA    1 
ATOM   4205  C  C     . THR A 1  539  ? 135.117 45.248  33.057  1.00 110.43 ? 539  THR A C     1 
ATOM   4206  O  O     . THR A 1  539  ? 135.885 45.394  32.103  1.00 109.00 ? 539  THR A O     1 
ATOM   4207  C  CB    . THR A 1  539  ? 132.942 46.113  31.962  1.00 116.19 ? 539  THR A CB    1 
ATOM   4208  O  OG1   . THR A 1  539  ? 131.781 46.900  32.253  1.00 118.42 ? 539  THR A OG1   1 
ATOM   4209  C  CG2   . THR A 1  539  ? 132.522 44.702  31.581  1.00 112.97 ? 539  THR A CG2   1 
ATOM   4210  N  N     . PHE A 1  540  ? 135.252 44.275  34.002  1.00 106.82 ? 540  PHE A N     1 
ATOM   4211  C  CA    . PHE A 1  540  ? 136.342 43.287  34.066  1.00 106.38 ? 540  PHE A CA    1 
ATOM   4212  C  C     . PHE A 1  540  ? 135.815 41.886  34.043  1.00 106.59 ? 540  PHE A C     1 
ATOM   4213  O  O     . PHE A 1  540  ? 134.833 41.596  34.713  1.00 106.16 ? 540  PHE A O     1 
ATOM   4214  C  CB    . PHE A 1  540  ? 137.200 43.470  35.312  1.00 110.34 ? 540  PHE A CB    1 
ATOM   4215  C  CG    . PHE A 1  540  ? 137.763 44.856  35.427  1.00 113.57 ? 540  PHE A CG    1 
ATOM   4216  C  CD1   . PHE A 1  540  ? 138.898 45.222  34.714  1.00 117.80 ? 540  PHE A CD1   1 
ATOM   4217  C  CD2   . PHE A 1  540  ? 137.141 45.809  36.224  1.00 117.53 ? 540  PHE A CD2   1 
ATOM   4218  C  CE1   . PHE A 1  540  ? 139.391 46.523  34.783  1.00 120.27 ? 540  PHE A CE1   1 
ATOM   4219  C  CE2   . PHE A 1  540  ? 137.644 47.107  36.310  1.00 121.97 ? 540  PHE A CE2   1 
ATOM   4220  C  CZ    . PHE A 1  540  ? 138.772 47.455  35.598  1.00 120.56 ? 540  PHE A CZ    1 
ATOM   4221  N  N     . ILE A 1  541  ? 136.477 41.005  33.298  1.00 101.40 ? 541  ILE A N     1 
ATOM   4222  C  CA    . ILE A 1  541  ? 136.040 39.618  33.118  1.00 100.38 ? 541  ILE A CA    1 
ATOM   4223  C  C     . ILE A 1  541  ? 137.055 38.614  33.697  1.00 107.10 ? 541  ILE A C     1 
ATOM   4224  O  O     . ILE A 1  541  ? 138.256 38.777  33.486  1.00 107.33 ? 541  ILE A O     1 
ATOM   4225  C  CB    . ILE A 1  541  ? 135.718 39.350  31.614  1.00 100.93 ? 541  ILE A CB    1 
ATOM   4226  C  CG1   . ILE A 1  541  ? 134.806 40.412  31.013  1.00 99.29  ? 541  ILE A CG1   1 
ATOM   4227  C  CG2   . ILE A 1  541  ? 135.090 37.999  31.415  1.00 102.15 ? 541  ILE A CG2   1 
ATOM   4228  C  CD1   . ILE A 1  541  ? 135.425 41.086  29.922  1.00 104.96 ? 541  ILE A CD1   1 
ATOM   4229  N  N     . GLU A 1  542  ? 136.566 37.579  34.414  1.00 105.35 ? 542  GLU A N     1 
ATOM   4230  C  CA    . GLU A 1  542  ? 137.405 36.535  35.020  1.00 106.96 ? 542  GLU A CA    1 
ATOM   4231  C  C     . GLU A 1  542  ? 137.760 35.468  33.992  1.00 110.64 ? 542  GLU A C     1 
ATOM   4232  O  O     . GLU A 1  542  ? 136.964 35.255  33.080  1.00 109.79 ? 542  GLU A O     1 
ATOM   4233  C  CB    . GLU A 1  542  ? 136.686 35.885  36.204  1.00 109.41 ? 542  GLU A CB    1 
ATOM   4234  C  CG    . GLU A 1  542  ? 136.564 36.776  37.425  1.00 124.98 ? 542  GLU A CG    1 
ATOM   4235  C  CD    . GLU A 1  542  ? 135.701 36.219  38.542  1.00 164.09 ? 542  GLU A CD    1 
ATOM   4236  O  OE1   . GLU A 1  542  ? 135.738 34.988  38.779  1.00 173.80 ? 542  GLU A OE1   1 
ATOM   4237  O  OE2   . GLU A 1  542  ? 135.031 37.030  39.222  1.00 162.93 ? 542  GLU A OE2   1 
ATOM   4238  N  N     . LEU A 1  543  ? 138.924 34.769  34.163  1.00 107.48 ? 543  LEU A N     1 
ATOM   4239  C  CA    . LEU A 1  543  ? 139.460 33.723  33.260  1.00 106.56 ? 543  LEU A CA    1 
ATOM   4240  C  C     . LEU A 1  543  ? 138.448 32.767  32.612  1.00 111.66 ? 543  LEU A C     1 
ATOM   4241  O  O     . LEU A 1  543  ? 138.444 32.634  31.382  1.00 109.96 ? 543  LEU A O     1 
ATOM   4242  C  CB    . LEU A 1  543  ? 140.610 32.925  33.895  1.00 107.09 ? 543  LEU A CB    1 
ATOM   4243  C  CG    . LEU A 1  543  ? 141.192 31.809  33.026  1.00 110.18 ? 543  LEU A CG    1 
ATOM   4244  C  CD1   . LEU A 1  543  ? 142.396 32.277  32.279  1.00 109.95 ? 543  LEU A CD1   1 
ATOM   4245  C  CD2   . LEU A 1  543  ? 141.511 30.595  33.835  1.00 112.58 ? 543  LEU A CD2   1 
ATOM   4246  N  N     . ASP A 1  544  ? 137.628 32.084  33.441  1.00 110.75 ? 544  ASP A N     1 
ATOM   4247  C  CA    . ASP A 1  544  ? 136.587 31.122  33.021  1.00 110.84 ? 544  ASP A CA    1 
ATOM   4248  C  C     . ASP A 1  544  ? 135.856 31.571  31.736  1.00 111.92 ? 544  ASP A C     1 
ATOM   4249  O  O     . ASP A 1  544  ? 135.928 30.884  30.700  1.00 111.21 ? 544  ASP A O     1 
ATOM   4250  C  CB    . ASP A 1  544  ? 135.583 30.845  34.175  1.00 114.12 ? 544  ASP A CB    1 
ATOM   4251  C  CG    . ASP A 1  544  ? 135.216 32.082  34.985  1.00 134.83 ? 544  ASP A CG    1 
ATOM   4252  O  OD1   . ASP A 1  544  ? 134.420 32.913  34.480  1.00 134.51 ? 544  ASP A OD1   1 
ATOM   4253  O  OD2   . ASP A 1  544  ? 135.775 32.252  36.102  1.00 149.05 ? 544  ASP A OD2   1 
ATOM   4254  N  N     . GLN A 1  545  ? 135.220 32.759  31.817  1.00 105.27 ? 545  GLN A N     1 
ATOM   4255  C  CA    . GLN A 1  545  ? 134.473 33.412  30.764  1.00 102.84 ? 545  GLN A CA    1 
ATOM   4256  C  C     . GLN A 1  545  ? 135.449 33.936  29.712  1.00 104.54 ? 545  GLN A C     1 
ATOM   4257  O  O     . GLN A 1  545  ? 135.220 33.685  28.535  1.00 105.20 ? 545  GLN A O     1 
ATOM   4258  C  CB    . GLN A 1  545  ? 133.642 34.547  31.363  1.00 104.58 ? 545  GLN A CB    1 
ATOM   4259  C  CG    . GLN A 1  545  ? 132.430 35.004  30.542  1.00 124.25 ? 545  GLN A CG    1 
ATOM   4260  C  CD    . GLN A 1  545  ? 131.744 36.255  31.110  1.00 147.93 ? 545  GLN A CD    1 
ATOM   4261  O  OE1   . GLN A 1  545  ? 131.001 36.959  30.409  1.00 142.18 ? 545  GLN A OE1   1 
ATOM   4262  N  NE2   . GLN A 1  545  ? 131.948 36.568  32.394  1.00 141.59 ? 545  GLN A NE2   1 
ATOM   4263  N  N     . VAL A 1  546  ? 136.560 34.597  30.106  1.00 98.13  ? 546  VAL A N     1 
ATOM   4264  C  CA    . VAL A 1  546  ? 137.548 35.112  29.137  1.00 96.02  ? 546  VAL A CA    1 
ATOM   4265  C  C     . VAL A 1  546  ? 137.928 34.034  28.108  1.00 97.37  ? 546  VAL A C     1 
ATOM   4266  O  O     . VAL A 1  546  ? 137.989 34.330  26.918  1.00 94.63  ? 546  VAL A O     1 
ATOM   4267  C  CB    . VAL A 1  546  ? 138.806 35.742  29.795  1.00 100.32 ? 546  VAL A CB    1 
ATOM   4268  C  CG1   . VAL A 1  546  ? 139.803 36.218  28.741  1.00 99.70  ? 546  VAL A CG1   1 
ATOM   4269  C  CG2   . VAL A 1  546  ? 138.437 36.893  30.716  1.00 100.61 ? 546  VAL A CG2   1 
ATOM   4270  N  N     . LEU A 1  547  ? 138.130 32.777  28.568  1.00 94.40  ? 547  LEU A N     1 
ATOM   4271  C  CA    . LEU A 1  547  ? 138.495 31.660  27.697  1.00 93.31  ? 547  LEU A CA    1 
ATOM   4272  C  C     . LEU A 1  547  ? 137.415 31.308  26.663  1.00 96.72  ? 547  LEU A C     1 
ATOM   4273  O  O     . LEU A 1  547  ? 137.763 30.920  25.538  1.00 96.59  ? 547  LEU A O     1 
ATOM   4274  C  CB    . LEU A 1  547  ? 138.951 30.426  28.496  1.00 93.62  ? 547  LEU A CB    1 
ATOM   4275  C  CG    . LEU A 1  547  ? 140.241 30.541  29.338  1.00 98.71  ? 547  LEU A CG    1 
ATOM   4276  C  CD1   . LEU A 1  547  ? 140.749 29.161  29.715  1.00 99.69  ? 547  LEU A CD1   1 
ATOM   4277  C  CD2   . LEU A 1  547  ? 141.360 31.317  28.620  1.00 98.36  ? 547  LEU A CD2   1 
ATOM   4278  N  N     . ASN A 1  548  ? 136.116 31.479  27.032  1.00 91.56  ? 548  ASN A N     1 
ATOM   4279  C  CA    . ASN A 1  548  ? 134.952 31.225  26.166  1.00 89.62  ? 548  ASN A CA    1 
ATOM   4280  C  C     . ASN A 1  548  ? 134.769 32.389  25.194  1.00 92.01  ? 548  ASN A C     1 
ATOM   4281  O  O     . ASN A 1  548  ? 134.527 32.184  24.006  1.00 89.69  ? 548  ASN A O     1 
ATOM   4282  C  CB    . ASN A 1  548  ? 133.681 31.021  26.992  1.00 89.27  ? 548  ASN A CB    1 
ATOM   4283  C  CG    . ASN A 1  548  ? 133.616 29.751  27.812  1.00 119.20 ? 548  ASN A CG    1 
ATOM   4284  O  OD1   . ASN A 1  548  ? 134.042 28.650  27.395  1.00 104.98 ? 548  ASN A OD1   1 
ATOM   4285  N  ND2   . ASN A 1  548  ? 132.981 29.877  28.973  1.00 119.02 ? 548  ASN A ND2   1 
ATOM   4286  N  N     . MET A 1  549  ? 134.946 33.610  25.701  1.00 90.02  ? 549  MET A N     1 
ATOM   4287  C  CA    . MET A 1  549  ? 134.908 34.846  24.933  1.00 89.97  ? 549  MET A CA    1 
ATOM   4288  C  C     . MET A 1  549  ? 135.952 34.739  23.812  1.00 93.56  ? 549  MET A C     1 
ATOM   4289  O  O     . MET A 1  549  ? 135.739 35.282  22.742  1.00 93.46  ? 549  MET A O     1 
ATOM   4290  C  CB    . MET A 1  549  ? 135.273 36.038  25.840  1.00 93.72  ? 549  MET A CB    1 
ATOM   4291  C  CG    . MET A 1  549  ? 134.319 36.285  27.001  1.00 98.90  ? 549  MET A CG    1 
ATOM   4292  S  SD    . MET A 1  549  ? 133.193 37.670  26.693  1.00 104.19 ? 549  MET A SD    1 
ATOM   4293  C  CE    . MET A 1  549  ? 133.919 38.893  27.664  1.00 102.21 ? 549  MET A CE    1 
ATOM   4294  N  N     . LEU A 1  550  ? 137.067 34.022  24.056  1.00 89.98  ? 550  LEU A N     1 
ATOM   4295  C  CA    . LEU A 1  550  ? 138.139 33.848  23.092  1.00 89.28  ? 550  LEU A CA    1 
ATOM   4296  C  C     . LEU A 1  550  ? 137.809 32.767  22.078  1.00 94.99  ? 550  LEU A C     1 
ATOM   4297  O  O     . LEU A 1  550  ? 137.695 33.076  20.896  1.00 93.49  ? 550  LEU A O     1 
ATOM   4298  C  CB    . LEU A 1  550  ? 139.477 33.576  23.795  1.00 89.94  ? 550  LEU A CB    1 
ATOM   4299  C  CG    . LEU A 1  550  ? 140.069 34.722  24.608  1.00 95.05  ? 550  LEU A CG    1 
ATOM   4300  C  CD1   . LEU A 1  550  ? 140.983 34.201  25.673  1.00 96.39  ? 550  LEU A CD1   1 
ATOM   4301  C  CD2   . LEU A 1  550  ? 140.788 35.736  23.728  1.00 97.04  ? 550  LEU A CD2   1 
ATOM   4302  N  N     . TYR A 1  551  ? 137.624 31.511  22.527  1.00 94.87  ? 551  TYR A N     1 
ATOM   4303  C  CA    . TYR A 1  551  ? 137.310 30.369  21.663  1.00 95.97  ? 551  TYR A CA    1 
ATOM   4304  C  C     . TYR A 1  551  ? 136.192 30.673  20.662  1.00 101.14 ? 551  TYR A C     1 
ATOM   4305  O  O     . TYR A 1  551  ? 136.201 30.111  19.562  1.00 98.85  ? 551  TYR A O     1 
ATOM   4306  C  CB    . TYR A 1  551  ? 136.988 29.111  22.506  1.00 98.89  ? 551  TYR A CB    1 
ATOM   4307  C  CG    . TYR A 1  551  ? 136.797 27.830  21.711  1.00 102.10 ? 551  TYR A CG    1 
ATOM   4308  C  CD1   . TYR A 1  551  ? 137.636 27.514  20.647  1.00 104.79 ? 551  TYR A CD1   1 
ATOM   4309  C  CD2   . TYR A 1  551  ? 135.822 26.904  22.064  1.00 102.88 ? 551  TYR A CD2   1 
ATOM   4310  C  CE1   . TYR A 1  551  ? 137.448 26.355  19.892  1.00 106.17 ? 551  TYR A CE1   1 
ATOM   4311  C  CE2   . TYR A 1  551  ? 135.646 25.721  21.336  1.00 103.24 ? 551  TYR A CE2   1 
ATOM   4312  C  CZ    . TYR A 1  551  ? 136.457 25.456  20.244  1.00 108.82 ? 551  TYR A CZ    1 
ATOM   4313  O  OH    . TYR A 1  551  ? 136.298 24.319  19.491  1.00 104.28 ? 551  TYR A OH    1 
ATOM   4314  N  N     . TRP A 1  552  ? 135.263 31.607  21.042  1.00 100.81 ? 552  TRP A N     1 
ATOM   4315  C  CA    . TRP A 1  552  ? 134.116 32.071  20.246  1.00 101.06 ? 552  TRP A CA    1 
ATOM   4316  C  C     . TRP A 1  552  ? 134.491 32.841  18.996  1.00 107.39 ? 552  TRP A C     1 
ATOM   4317  O  O     . TRP A 1  552  ? 133.773 32.709  17.999  1.00 106.97 ? 552  TRP A O     1 
ATOM   4318  C  CB    . TRP A 1  552  ? 133.107 32.853  21.078  1.00 100.14 ? 552  TRP A CB    1 
ATOM   4319  C  CG    . TRP A 1  552  ? 131.930 32.022  21.497  1.00 101.02 ? 552  TRP A CG    1 
ATOM   4320  C  CD1   . TRP A 1  552  ? 131.730 31.427  22.709  1.00 104.70 ? 552  TRP A CD1   1 
ATOM   4321  C  CD2   . TRP A 1  552  ? 130.799 31.688  20.695  1.00 99.81  ? 552  TRP A CD2   1 
ATOM   4322  N  NE1   . TRP A 1  552  ? 130.538 30.745  22.712  1.00 103.67 ? 552  TRP A NE1   1 
ATOM   4323  C  CE2   . TRP A 1  552  ? 129.945 30.888  21.486  1.00 104.02 ? 552  TRP A CE2   1 
ATOM   4324  C  CE3   . TRP A 1  552  ? 130.425 31.981  19.379  1.00 100.14 ? 552  TRP A CE3   1 
ATOM   4325  C  CZ2   . TRP A 1  552  ? 128.748 30.363  20.995  1.00 102.68 ? 552  TRP A CZ2   1 
ATOM   4326  C  CZ3   . TRP A 1  552  ? 129.240 31.462  18.894  1.00 101.08 ? 552  TRP A CZ3   1 
ATOM   4327  C  CH2   . TRP A 1  552  ? 128.415 30.663  19.697  1.00 101.95 ? 552  TRP A CH2   1 
ATOM   4328  N  N     . VAL A 1  553  ? 135.611 33.635  19.037  1.00 105.06 ? 553  VAL A N     1 
ATOM   4329  C  CA    . VAL A 1  553  ? 136.184 34.340  17.872  1.00 103.83 ? 553  VAL A CA    1 
ATOM   4330  C  C     . VAL A 1  553  ? 136.778 33.224  16.999  1.00 108.90 ? 553  VAL A C     1 
ATOM   4331  O  O     . VAL A 1  553  ? 137.772 32.585  17.398  1.00 109.50 ? 553  VAL A O     1 
ATOM   4332  C  CB    . VAL A 1  553  ? 137.279 35.374  18.212  1.00 107.21 ? 553  VAL A CB    1 
ATOM   4333  C  CG1   . VAL A 1  553  ? 137.829 36.002  16.939  1.00 106.55 ? 553  VAL A CG1   1 
ATOM   4334  C  CG2   . VAL A 1  553  ? 136.775 36.445  19.160  1.00 107.06 ? 553  VAL A CG2   1 
ATOM   4335  N  N     . PRO A 1  554  ? 136.149 32.947  15.836  1.00 105.00 ? 554  PRO A N     1 
ATOM   4336  C  CA    . PRO A 1  554  ? 136.626 31.834  14.986  1.00 104.91 ? 554  PRO A CA    1 
ATOM   4337  C  C     . PRO A 1  554  ? 138.018 31.980  14.363  1.00 110.80 ? 554  PRO A C     1 
ATOM   4338  O  O     . PRO A 1  554  ? 138.513 31.054  13.725  1.00 110.20 ? 554  PRO A O     1 
ATOM   4339  C  CB    . PRO A 1  554  ? 135.531 31.682  13.922  1.00 105.49 ? 554  PRO A CB    1 
ATOM   4340  C  CG    . PRO A 1  554  ? 134.669 32.860  14.031  1.00 109.53 ? 554  PRO A CG    1 
ATOM   4341  C  CD    . PRO A 1  554  ? 134.953 33.608  15.277  1.00 105.78 ? 554  PRO A CD    1 
ATOM   4342  N  N     . ASP A 1  555  ? 138.652 33.124  14.564  1.00 109.81 ? 555  ASP A N     1 
ATOM   4343  C  CA    . ASP A 1  555  ? 139.939 33.416  13.968  1.00 111.27 ? 555  ASP A CA    1 
ATOM   4344  C  C     . ASP A 1  555  ? 141.021 33.649  15.007  1.00 116.98 ? 555  ASP A C     1 
ATOM   4345  O  O     . ASP A 1  555  ? 142.155 33.976  14.639  1.00 117.87 ? 555  ASP A O     1 
ATOM   4346  C  CB    . ASP A 1  555  ? 139.790 34.640  13.044  1.00 113.86 ? 555  ASP A CB    1 
ATOM   4347  C  CG    . ASP A 1  555  ? 138.611 34.555  12.081  1.00 129.12 ? 555  ASP A CG    1 
ATOM   4348  O  OD1   . ASP A 1  555  ? 138.581 33.601  11.244  1.00 130.29 ? 555  ASP A OD1   1 
ATOM   4349  O  OD2   . ASP A 1  555  ? 137.715 35.425  12.166  1.00 133.57 ? 555  ASP A OD2   1 
ATOM   4350  N  N     . TRP A 1  556  ? 140.681 33.472  16.303  1.00 113.44 ? 556  TRP A N     1 
ATOM   4351  C  CA    . TRP A 1  556  ? 141.580 33.666  17.444  1.00 113.61 ? 556  TRP A CA    1 
ATOM   4352  C  C     . TRP A 1  556  ? 142.931 32.975  17.227  1.00 117.67 ? 556  TRP A C     1 
ATOM   4353  O  O     . TRP A 1  556  ? 142.968 31.828  16.776  1.00 117.29 ? 556  TRP A O     1 
ATOM   4354  C  CB    . TRP A 1  556  ? 140.909 33.190  18.739  1.00 112.41 ? 556  TRP A CB    1 
ATOM   4355  C  CG    . TRP A 1  556  ? 141.779 33.317  19.950  1.00 114.53 ? 556  TRP A CG    1 
ATOM   4356  C  CD1   . TRP A 1  556  ? 142.433 34.432  20.373  1.00 118.27 ? 556  TRP A CD1   1 
ATOM   4357  C  CD2   . TRP A 1  556  ? 142.081 32.293  20.900  1.00 115.15 ? 556  TRP A CD2   1 
ATOM   4358  N  NE1   . TRP A 1  556  ? 143.122 34.169  21.531  1.00 119.05 ? 556  TRP A NE1   1 
ATOM   4359  C  CE2   . TRP A 1  556  ? 142.914 32.865  21.884  1.00 120.45 ? 556  TRP A CE2   1 
ATOM   4360  C  CE3   . TRP A 1  556  ? 141.708 30.949  21.032  1.00 116.51 ? 556  TRP A CE3   1 
ATOM   4361  C  CZ2   . TRP A 1  556  ? 143.372 32.145  22.989  1.00 120.98 ? 556  TRP A CZ2   1 
ATOM   4362  C  CZ3   . TRP A 1  556  ? 142.188 30.227  22.111  1.00 119.24 ? 556  TRP A CZ3   1 
ATOM   4363  C  CH2   . TRP A 1  556  ? 143.029 30.818  23.063  1.00 121.06 ? 556  TRP A CH2   1 
ATOM   4364  N  N     . ASP A 1  557  ? 144.032 33.689  17.506  1.00 113.86 ? 557  ASP A N     1 
ATOM   4365  C  CA    . ASP A 1  557  ? 145.389 33.178  17.311  1.00 113.61 ? 557  ASP A CA    1 
ATOM   4366  C  C     . ASP A 1  557  ? 145.802 32.020  18.232  1.00 116.40 ? 557  ASP A C     1 
ATOM   4367  O  O     . ASP A 1  557  ? 146.817 31.374  17.964  1.00 117.14 ? 557  ASP A O     1 
ATOM   4368  C  CB    . ASP A 1  557  ? 146.426 34.326  17.307  1.00 116.47 ? 557  ASP A CB    1 
ATOM   4369  C  CG    . ASP A 1  557  ? 146.433 35.268  18.511  1.00 133.25 ? 557  ASP A CG    1 
ATOM   4370  O  OD1   . ASP A 1  557  ? 145.453 35.255  19.294  1.00 135.30 ? 557  ASP A OD1   1 
ATOM   4371  O  OD2   . ASP A 1  557  ? 147.411 36.030  18.659  1.00 140.47 ? 557  ASP A OD2   1 
ATOM   4372  N  N     . GLY A 1  558  ? 145.011 31.745  19.271  1.00 111.02 ? 558  GLY A N     1 
ATOM   4373  C  CA    . GLY A 1  558  ? 145.310 30.690  20.236  1.00 110.91 ? 558  GLY A CA    1 
ATOM   4374  C  C     . GLY A 1  558  ? 146.171 31.216  21.368  1.00 114.56 ? 558  GLY A C     1 
ATOM   4375  O  O     . GLY A 1  558  ? 146.596 30.462  22.254  1.00 113.95 ? 558  GLY A O     1 
ATOM   4376  N  N     . VAL A 1  559  ? 146.382 32.550  21.350  1.00 111.22 ? 559  VAL A N     1 
ATOM   4377  C  CA    . VAL A 1  559  ? 147.168 33.327  22.309  1.00 111.92 ? 559  VAL A CA    1 
ATOM   4378  C  C     . VAL A 1  559  ? 146.272 34.038  23.319  1.00 114.43 ? 559  VAL A C     1 
ATOM   4379  O  O     . VAL A 1  559  ? 145.594 35.012  22.962  1.00 112.63 ? 559  VAL A O     1 
ATOM   4380  C  CB    . VAL A 1  559  ? 148.080 34.344  21.586  1.00 115.98 ? 559  VAL A CB    1 
ATOM   4381  C  CG1   . VAL A 1  559  ? 148.820 35.233  22.585  1.00 116.94 ? 559  VAL A CG1   1 
ATOM   4382  C  CG2   . VAL A 1  559  ? 149.055 33.636  20.653  1.00 115.87 ? 559  VAL A CG2   1 
ATOM   4383  N  N     . ILE A 1  560  ? 146.303 33.558  24.583  1.00 111.13 ? 560  ILE A N     1 
ATOM   4384  C  CA    . ILE A 1  560  ? 145.559 34.149  25.692  1.00 110.86 ? 560  ILE A CA    1 
ATOM   4385  C  C     . ILE A 1  560  ? 146.299 35.449  26.057  1.00 114.94 ? 560  ILE A C     1 
ATOM   4386  O  O     . ILE A 1  560  ? 147.443 35.393  26.523  1.00 115.25 ? 560  ILE A O     1 
ATOM   4387  C  CB    . ILE A 1  560  ? 145.398 33.208  26.921  1.00 114.63 ? 560  ILE A CB    1 
ATOM   4388  C  CG1   . ILE A 1  560  ? 145.138 31.735  26.522  1.00 114.71 ? 560  ILE A CG1   1 
ATOM   4389  C  CG2   . ILE A 1  560  ? 144.305 33.739  27.849  1.00 115.19 ? 560  ILE A CG2   1 
ATOM   4390  C  CD1   . ILE A 1  560  ? 145.375 30.649  27.671  1.00 121.26 ? 560  ILE A CD1   1 
ATOM   4391  N  N     . PRO A 1  561  ? 145.702 36.631  25.784  1.00 110.78 ? 561  PRO A N     1 
ATOM   4392  C  CA    . PRO A 1  561  ? 146.408 37.877  26.089  1.00 111.14 ? 561  PRO A CA    1 
ATOM   4393  C  C     . PRO A 1  561  ? 146.635 38.100  27.582  1.00 116.46 ? 561  PRO A C     1 
ATOM   4394  O  O     . PRO A 1  561  ? 145.921 37.535  28.422  1.00 115.42 ? 561  PRO A O     1 
ATOM   4395  C  CB    . PRO A 1  561  ? 145.534 38.952  25.440  1.00 111.94 ? 561  PRO A CB    1 
ATOM   4396  C  CG    . PRO A 1  561  ? 144.187 38.366  25.354  1.00 115.30 ? 561  PRO A CG    1 
ATOM   4397  C  CD    . PRO A 1  561  ? 144.366 36.893  25.203  1.00 111.02 ? 561  PRO A CD    1 
ATOM   4398  N  N     . THR A 1  562  ? 147.671 38.893  27.904  1.00 114.87 ? 562  THR A N     1 
ATOM   4399  C  CA    . THR A 1  562  ? 148.032 39.195  29.285  1.00 115.81 ? 562  THR A CA    1 
ATOM   4400  C  C     . THR A 1  562  ? 146.986 40.113  29.887  1.00 118.06 ? 562  THR A C     1 
ATOM   4401  O  O     . THR A 1  562  ? 146.686 41.132  29.267  1.00 115.89 ? 562  THR A O     1 
ATOM   4402  C  CB    . THR A 1  562  ? 149.486 39.675  29.397  1.00 124.79 ? 562  THR A CB    1 
ATOM   4403  O  OG1   . THR A 1  562  ? 150.348 38.623  28.949  1.00 123.99 ? 562  THR A OG1   1 
ATOM   4404  C  CG2   . THR A 1  562  ? 149.870 40.041  30.822  1.00 124.79 ? 562  THR A CG2   1 
ATOM   4405  N  N     . PRO A 1  563  ? 146.383 39.719  31.049  1.00 115.85 ? 563  PRO A N     1 
ATOM   4406  C  CA    . PRO A 1  563  ? 145.334 40.545  31.671  1.00 115.79 ? 563  PRO A CA    1 
ATOM   4407  C  C     . PRO A 1  563  ? 145.800 41.932  32.086  1.00 120.91 ? 563  PRO A C     1 
ATOM   4408  O  O     . PRO A 1  563  ? 146.956 42.105  32.485  1.00 122.09 ? 563  PRO A O     1 
ATOM   4409  C  CB    . PRO A 1  563  ? 144.921 39.723  32.906  1.00 118.03 ? 563  PRO A CB    1 
ATOM   4410  C  CG    . PRO A 1  563  ? 146.087 38.874  33.215  1.00 123.15 ? 563  PRO A CG    1 
ATOM   4411  C  CD    . PRO A 1  563  ? 146.634 38.507  31.860  1.00 118.10 ? 563  PRO A CD    1 
ATOM   4412  N  N     . ALA A 1  564  ? 144.882 42.913  32.025  1.00 116.53 ? 564  ALA A N     1 
ATOM   4413  C  CA    . ALA A 1  564  ? 145.158 44.285  32.439  1.00 117.17 ? 564  ALA A CA    1 
ATOM   4414  C  C     . ALA A 1  564  ? 145.415 44.339  33.947  1.00 122.19 ? 564  ALA A C     1 
ATOM   4415  O  O     . ALA A 1  564  ? 145.929 45.332  34.444  1.00 123.88 ? 564  ALA A O     1 
ATOM   4416  C  CB    . ALA A 1  564  ? 144.001 45.190  32.067  1.00 117.30 ? 564  ALA A CB    1 
ATOM   4417  N  N     . ILE A 1  565  ? 145.066 43.275  34.668  1.00 117.51 ? 565  ILE A N     1 
ATOM   4418  C  CA    . ILE A 1  565  ? 145.321 43.162  36.090  1.00 118.57 ? 565  ILE A CA    1 
ATOM   4419  C  C     . ILE A 1  565  ? 145.899 41.768  36.331  1.00 126.23 ? 565  ILE A C     1 
ATOM   4420  O  O     . ILE A 1  565  ? 145.213 40.776  36.069  1.00 125.84 ? 565  ILE A O     1 
ATOM   4421  C  CB    . ILE A 1  565  ? 144.048 43.448  36.941  1.00 120.81 ? 565  ILE A CB    1 
ATOM   4422  C  CG1   . ILE A 1  565  ? 143.594 44.915  36.812  1.00 119.84 ? 565  ILE A CG1   1 
ATOM   4423  C  CG2   . ILE A 1  565  ? 144.264 43.069  38.420  1.00 122.79 ? 565  ILE A CG2   1 
ATOM   4424  C  CD1   . ILE A 1  565  ? 142.179 45.059  36.517  1.00 118.07 ? 565  ILE A CD1   1 
ATOM   4425  N  N     . ILE A 1  566  ? 147.179 41.699  36.772  1.00 125.06 ? 566  ILE A N     1 
ATOM   4426  C  CA    . ILE A 1  566  ? 147.883 40.457  37.139  1.00 125.68 ? 566  ILE A CA    1 
ATOM   4427  C  C     . ILE A 1  566  ? 148.042 40.582  38.631  1.00 134.98 ? 566  ILE A C     1 
ATOM   4428  O  O     . ILE A 1  566  ? 148.939 41.298  39.068  1.00 137.37 ? 566  ILE A O     1 
ATOM   4429  C  CB    . ILE A 1  566  ? 149.292 40.297  36.497  1.00 127.95 ? 566  ILE A CB    1 
ATOM   4430  C  CG1   . ILE A 1  566  ? 149.326 40.653  35.015  1.00 126.71 ? 566  ILE A CG1   1 
ATOM   4431  C  CG2   . ILE A 1  566  ? 149.890 38.918  36.793  1.00 128.05 ? 566  ILE A CG2   1 
ATOM   4432  C  CD1   . ILE A 1  566  ? 150.266 41.734  34.747  1.00 134.17 ? 566  ILE A CD1   1 
ATOM   4433  N  N     . LYS A 1  567  ? 147.170 39.947  39.417  1.00 132.60 ? 567  LYS A N     1 
ATOM   4434  C  CA    . LYS A 1  567  ? 147.214 40.018  40.894  1.00 134.22 ? 567  LYS A CA    1 
ATOM   4435  C  C     . LYS A 1  567  ? 147.013 41.432  41.574  1.00 135.66 ? 567  LYS A C     1 
ATOM   4436  O  O     . LYS A 1  567  ? 147.600 42.438  41.155  1.00 134.30 ? 567  LYS A O     1 
ATOM   4437  C  CB    . LYS A 1  567  ? 148.331 39.151  41.522  1.00 139.16 ? 567  LYS A CB    1 
ATOM   4438  C  CG    . LYS A 1  567  ? 148.106 37.652  41.256  1.00 158.87 ? 567  LYS A CG    1 
ATOM   4439  C  CD    . LYS A 1  567  ? 148.975 36.729  42.112  1.00 169.85 ? 567  LYS A CD    1 
ATOM   4440  C  CE    . LYS A 1  567  ? 148.851 35.293  41.655  1.00 173.68 ? 567  LYS A CE    1 
ATOM   4441  N  NZ    . LYS A 1  567  ? 149.761 34.385  42.400  1.00 177.99 ? 567  LYS A NZ    1 
ATOM   4442  N  N     . PRO A 1  568  ? 146.132 41.526  42.600  1.00 131.18 ? 568  PRO A N     1 
ATOM   4443  C  CA    . PRO A 1  568  ? 145.291 40.452  43.179  1.00 130.74 ? 568  PRO A CA    1 
ATOM   4444  C  C     . PRO A 1  568  ? 144.293 39.985  42.111  1.00 134.63 ? 568  PRO A C     1 
ATOM   4445  O  O     . PRO A 1  568  ? 143.707 40.871  41.473  1.00 137.21 ? 568  PRO A O     1 
ATOM   4446  C  CB    . PRO A 1  568  ? 144.585 41.169  44.339  1.00 133.16 ? 568  PRO A CB    1 
ATOM   4447  C  CG    . PRO A 1  568  ? 144.552 42.623  43.944  1.00 137.04 ? 568  PRO A CG    1 
ATOM   4448  C  CD    . PRO A 1  568  ? 145.847 42.838  43.217  1.00 132.81 ? 568  PRO A CD    1 
ATOM   4449  N  N     . LYS A 1  569  ? 144.166 38.650  41.813  1.00 125.93 ? 569  LYS A N     1 
ATOM   4450  C  CA    . LYS A 1  569  ? 143.235 38.123  40.768  1.00 121.32 ? 569  LYS A CA    1 
ATOM   4451  C  C     . LYS A 1  569  ? 143.513 38.578  39.294  1.00 119.57 ? 569  LYS A C     1 
ATOM   4452  O  O     . LYS A 1  569  ? 143.552 39.769  39.002  1.00 116.84 ? 569  LYS A O     1 
ATOM   4453  C  CB    . LYS A 1  569  ? 141.751 38.360  41.162  1.00 122.04 ? 569  LYS A CB    1 
ATOM   4454  C  CG    . LYS A 1  569  ? 140.722 37.599  40.350  1.00 122.49 ? 569  LYS A CG    1 
ATOM   4455  C  CD    . LYS A 1  569  ? 139.354 37.603  41.018  1.00 127.78 ? 569  LYS A CD    1 
ATOM   4456  C  CE    . LYS A 1  569  ? 138.580 36.372  40.599  1.00 136.59 ? 569  LYS A CE    1 
ATOM   4457  N  NZ    . LYS A 1  569  ? 137.359 36.140  41.421  1.00 144.31 ? 569  LYS A NZ    1 
ATOM   4458  N  N     . PRO A 1  570  ? 143.651 37.653  38.330  1.00 115.94 ? 570  PRO A N     1 
ATOM   4459  C  CA    . PRO A 1  570  ? 143.847 38.091  36.942  1.00 114.89 ? 570  PRO A CA    1 
ATOM   4460  C  C     . PRO A 1  570  ? 142.523 38.536  36.311  1.00 117.88 ? 570  PRO A C     1 
ATOM   4461  O  O     . PRO A 1  570  ? 141.572 37.745  36.223  1.00 117.59 ? 570  PRO A O     1 
ATOM   4462  C  CB    . PRO A 1  570  ? 144.432 36.854  36.259  1.00 116.10 ? 570  PRO A CB    1 
ATOM   4463  C  CG    . PRO A 1  570  ? 143.851 35.706  37.017  1.00 120.76 ? 570  PRO A CG    1 
ATOM   4464  C  CD    . PRO A 1  570  ? 143.611 36.178  38.430  1.00 117.73 ? 570  PRO A CD    1 
ATOM   4465  N  N     . LEU A 1  571  ? 142.447 39.810  35.915  1.00 112.98 ? 571  LEU A N     1 
ATOM   4466  C  CA    . LEU A 1  571  ? 141.241 40.343  35.298  1.00 111.64 ? 571  LEU A CA    1 
ATOM   4467  C  C     . LEU A 1  571  ? 141.534 40.973  33.950  1.00 117.69 ? 571  LEU A C     1 
ATOM   4468  O  O     . LEU A 1  571  ? 142.489 41.746  33.819  1.00 119.84 ? 571  LEU A O     1 
ATOM   4469  C  CB    . LEU A 1  571  ? 140.554 41.385  36.199  1.00 111.79 ? 571  LEU A CB    1 
ATOM   4470  C  CG    . LEU A 1  571  ? 139.631 40.934  37.329  1.00 115.66 ? 571  LEU A CG    1 
ATOM   4471  C  CD1   . LEU A 1  571  ? 138.852 39.672  36.993  1.00 114.00 ? 571  LEU A CD1   1 
ATOM   4472  C  CD2   . LEU A 1  571  ? 140.359 40.883  38.647  1.00 119.52 ? 571  LEU A CD2   1 
ATOM   4473  N  N     . TRP A 1  572  ? 140.679 40.678  32.961  1.00 111.99 ? 572  TRP A N     1 
ATOM   4474  C  CA    . TRP A 1  572  ? 140.749 41.241  31.620  1.00 109.92 ? 572  TRP A CA    1 
ATOM   4475  C  C     . TRP A 1  572  ? 139.648 42.269  31.522  1.00 109.78 ? 572  TRP A C     1 
ATOM   4476  O  O     . TRP A 1  572  ? 138.621 42.125  32.181  1.00 108.09 ? 572  TRP A O     1 
ATOM   4477  C  CB    . TRP A 1  572  ? 140.521 40.148  30.576  1.00 108.11 ? 572  TRP A CB    1 
ATOM   4478  C  CG    . TRP A 1  572  ? 141.658 39.185  30.444  1.00 110.04 ? 572  TRP A CG    1 
ATOM   4479  C  CD1   . TRP A 1  572  ? 142.581 39.142  29.440  1.00 112.75 ? 572  TRP A CD1   1 
ATOM   4480  C  CD2   . TRP A 1  572  ? 141.984 38.111  31.337  1.00 110.96 ? 572  TRP A CD2   1 
ATOM   4481  N  NE1   . TRP A 1  572  ? 143.469 38.110  29.656  1.00 113.03 ? 572  TRP A NE1   1 
ATOM   4482  C  CE2   . TRP A 1  572  ? 143.112 37.448  30.802  1.00 115.28 ? 572  TRP A CE2   1 
ATOM   4483  C  CE3   . TRP A 1  572  ? 141.428 37.637  32.538  1.00 113.24 ? 572  TRP A CE3   1 
ATOM   4484  C  CZ2   . TRP A 1  572  ? 143.693 36.336  31.427  1.00 115.62 ? 572  TRP A CZ2   1 
ATOM   4485  C  CZ3   . TRP A 1  572  ? 141.997 36.529  33.152  1.00 115.71 ? 572  TRP A CZ3   1 
ATOM   4486  C  CH2   . TRP A 1  572  ? 143.118 35.895  32.602  1.00 116.47 ? 572  TRP A CH2   1 
ATOM   4487  N  N     . SER A 1  573  ? 139.843 43.302  30.714  1.00 105.87 ? 573  SER A N     1 
ATOM   4488  C  CA    . SER A 1  573  ? 138.810 44.326  30.542  1.00 105.51 ? 573  SER A CA    1 
ATOM   4489  C  C     . SER A 1  573  ? 137.971 44.084  29.282  1.00 107.37 ? 573  SER A C     1 
ATOM   4490  O  O     . SER A 1  573  ? 138.422 43.387  28.361  1.00 107.01 ? 573  SER A O     1 
ATOM   4491  C  CB    . SER A 1  573  ? 139.427 45.720  30.503  1.00 109.71 ? 573  SER A CB    1 
ATOM   4492  O  OG    . SER A 1  573  ? 140.142 45.944  29.300  1.00 115.85 ? 573  SER A OG    1 
ATOM   4493  N  N     . GLY A 1  574  ? 136.768 44.665  29.250  1.00 101.47 ? 574  GLY A N     1 
ATOM   4494  C  CA    . GLY A 1  574  ? 135.889 44.552  28.099  1.00 99.07  ? 574  GLY A CA    1 
ATOM   4495  C  C     . GLY A 1  574  ? 136.680 44.907  26.865  1.00 101.37 ? 574  GLY A C     1 
ATOM   4496  O  O     . GLY A 1  574  ? 136.908 44.042  26.008  1.00 101.17 ? 574  GLY A O     1 
ATOM   4497  N  N     . LYS A 1  575  ? 137.226 46.149  26.866  1.00 96.22  ? 575  LYS A N     1 
ATOM   4498  C  CA    . LYS A 1  575  ? 138.085 46.724  25.825  1.00 94.79  ? 575  LYS A CA    1 
ATOM   4499  C  C     . LYS A 1  575  ? 139.107 45.706  25.324  1.00 97.27  ? 575  LYS A C     1 
ATOM   4500  O  O     . LYS A 1  575  ? 139.077 45.315  24.154  1.00 96.04  ? 575  LYS A O     1 
ATOM   4501  C  CB    . LYS A 1  575  ? 138.804 47.984  26.346  1.00 97.43  ? 575  LYS A CB    1 
ATOM   4502  C  CG    . LYS A 1  575  ? 137.876 49.150  26.651  1.00 97.83  ? 575  LYS A CG    1 
ATOM   4503  C  CD    . LYS A 1  575  ? 138.668 50.408  26.869  1.00 101.38 ? 575  LYS A CD    1 
ATOM   4504  C  CE    . LYS A 1  575  ? 137.831 51.664  26.916  1.00 114.60 ? 575  LYS A CE    1 
ATOM   4505  N  NZ    . LYS A 1  575  ? 136.976 51.758  28.130  1.00 124.09 ? 575  LYS A NZ    1 
ATOM   4506  N  N     . GLN A 1  576  ? 139.934 45.212  26.243  1.00 94.14  ? 576  GLN A N     1 
ATOM   4507  C  CA    . GLN A 1  576  ? 140.974 44.214  26.010  1.00 93.77  ? 576  GLN A CA    1 
ATOM   4508  C  C     . GLN A 1  576  ? 140.501 43.039  25.159  1.00 97.71  ? 576  GLN A C     1 
ATOM   4509  O  O     . GLN A 1  576  ? 141.091 42.748  24.108  1.00 96.66  ? 576  GLN A O     1 
ATOM   4510  C  CB    . GLN A 1  576  ? 141.483 43.698  27.354  1.00 95.16  ? 576  GLN A CB    1 
ATOM   4511  C  CG    . GLN A 1  576  ? 142.798 42.990  27.290  1.00 86.71  ? 576  GLN A CG    1 
ATOM   4512  C  CD    . GLN A 1  576  ? 143.429 43.001  28.644  1.00 111.13 ? 576  GLN A CD    1 
ATOM   4513  O  OE1   . GLN A 1  576  ? 142.765 43.146  29.682  1.00 102.66 ? 576  GLN A OE1   1 
ATOM   4514  N  NE2   . GLN A 1  576  ? 144.739 42.861  28.658  1.00 115.86 ? 576  GLN A NE2   1 
ATOM   4515  N  N     . ILE A 1  577  ? 139.445 42.369  25.606  1.00 94.77  ? 577  ILE A N     1 
ATOM   4516  C  CA    . ILE A 1  577  ? 139.020 41.211  24.851  1.00 94.66  ? 577  ILE A CA    1 
ATOM   4517  C  C     . ILE A 1  577  ? 138.172 41.528  23.602  1.00 95.76  ? 577  ILE A C     1 
ATOM   4518  O  O     . ILE A 1  577  ? 138.110 40.695  22.691  1.00 95.14  ? 577  ILE A O     1 
ATOM   4519  C  CB    . ILE A 1  577  ? 138.568 39.989  25.706  1.00 98.75  ? 577  ILE A CB    1 
ATOM   4520  C  CG1   . ILE A 1  577  ? 137.094 40.073  26.119  1.00 99.40  ? 577  ILE A CG1   1 
ATOM   4521  C  CG2   . ILE A 1  577  ? 139.516 39.703  26.889  1.00 100.46 ? 577  ILE A CG2   1 
ATOM   4522  C  CD1   . ILE A 1  577  ? 136.174 39.386  25.073  1.00 105.68 ? 577  ILE A CD1   1 
ATOM   4523  N  N     . LEU A 1  578  ? 137.536 42.713  23.539  1.00 89.22  ? 578  LEU A N     1 
ATOM   4524  C  CA    . LEU A 1  578  ? 136.800 43.043  22.327  1.00 86.90  ? 578  LEU A CA    1 
ATOM   4525  C  C     . LEU A 1  578  ? 137.851 43.255  21.219  1.00 91.74  ? 578  LEU A C     1 
ATOM   4526  O  O     . LEU A 1  578  ? 137.629 42.882  20.065  1.00 89.20  ? 578  LEU A O     1 
ATOM   4527  C  CB    . LEU A 1  578  ? 135.899 44.286  22.521  1.00 86.28  ? 578  LEU A CB    1 
ATOM   4528  C  CG    . LEU A 1  578  ? 135.340 44.972  21.242  1.00 88.85  ? 578  LEU A CG    1 
ATOM   4529  C  CD1   . LEU A 1  578  ? 134.341 44.106  20.519  1.00 87.91  ? 578  LEU A CD1   1 
ATOM   4530  C  CD2   . LEU A 1  578  ? 134.702 46.278  21.551  1.00 89.37  ? 578  LEU A CD2   1 
ATOM   4531  N  N     . SER A 1  579  ? 139.034 43.761  21.612  1.00 91.44  ? 579  SER A N     1 
ATOM   4532  C  CA    . SER A 1  579  ? 140.156 44.057  20.717  1.00 92.47  ? 579  SER A CA    1 
ATOM   4533  C  C     . SER A 1  579  ? 140.691 42.858  19.906  1.00 97.44  ? 579  SER A C     1 
ATOM   4534  O  O     . SER A 1  579  ? 141.395 43.031  18.890  1.00 97.20  ? 579  SER A O     1 
ATOM   4535  C  CB    . SER A 1  579  ? 141.260 44.774  21.481  1.00 97.28  ? 579  SER A CB    1 
ATOM   4536  O  OG    . SER A 1  579  ? 140.738 45.988  21.995  1.00 106.10 ? 579  SER A OG    1 
ATOM   4537  N  N     . VAL A 1  580  ? 140.303 41.651  20.338  1.00 93.52  ? 580  VAL A N     1 
ATOM   4538  C  CA    . VAL A 1  580  ? 140.664 40.398  19.691  1.00 93.02  ? 580  VAL A CA    1 
ATOM   4539  C  C     . VAL A 1  580  ? 139.901 40.288  18.335  1.00 96.21  ? 580  VAL A C     1 
ATOM   4540  O  O     . VAL A 1  580  ? 140.410 39.665  17.395  1.00 95.55  ? 580  VAL A O     1 
ATOM   4541  C  CB    . VAL A 1  580  ? 140.449 39.202  20.658  1.00 97.34  ? 580  VAL A CB    1 
ATOM   4542  C  CG1   . VAL A 1  580  ? 141.066 37.934  20.107  1.00 97.01  ? 580  VAL A CG1   1 
ATOM   4543  C  CG2   . VAL A 1  580  ? 141.039 39.496  22.037  1.00 98.47  ? 580  VAL A CG2   1 
ATOM   4544  N  N     . ALA A 1  581  ? 138.723 40.972  18.216  1.00 91.80  ? 581  ALA A N     1 
ATOM   4545  C  CA    . ALA A 1  581  ? 137.943 41.024  16.970  1.00 89.90  ? 581  ALA A CA    1 
ATOM   4546  C  C     . ALA A 1  581  ? 138.619 42.001  16.026  1.00 94.15  ? 581  ALA A C     1 
ATOM   4547  O  O     . ALA A 1  581  ? 138.765 41.671  14.848  1.00 94.86  ? 581  ALA A O     1 
ATOM   4548  C  CB    . ALA A 1  581  ? 136.506 41.468  17.229  1.00 89.89  ? 581  ALA A CB    1 
ATOM   4549  N  N     . ILE A 1  582  ? 139.064 43.186  16.542  1.00 89.22  ? 582  ILE A N     1 
ATOM   4550  C  CA    . ILE A 1  582  ? 139.720 44.231  15.743  1.00 88.00  ? 582  ILE A CA    1 
ATOM   4551  C  C     . ILE A 1  582  ? 141.071 43.752  15.199  1.00 96.46  ? 582  ILE A C     1 
ATOM   4552  O  O     . ILE A 1  582  ? 141.977 43.451  15.993  1.00 98.13  ? 582  ILE A O     1 
ATOM   4553  C  CB    . ILE A 1  582  ? 139.750 45.645  16.407  1.00 89.97  ? 582  ILE A CB    1 
ATOM   4554  C  CG1   . ILE A 1  582  ? 138.359 46.067  16.937  1.00 88.78  ? 582  ILE A CG1   1 
ATOM   4555  C  CG2   . ILE A 1  582  ? 140.224 46.686  15.407  1.00 89.20  ? 582  ILE A CG2   1 
ATOM   4556  C  CD1   . ILE A 1  582  ? 138.259 46.245  18.367  1.00 86.96  ? 582  ILE A CD1   1 
ATOM   4557  N  N     . PRO A 1  583  ? 141.176 43.631  13.843  1.00 94.73  ? 583  PRO A N     1 
ATOM   4558  C  CA    . PRO A 1  583  ? 142.411 43.103  13.222  1.00 96.00  ? 583  PRO A CA    1 
ATOM   4559  C  C     . PRO A 1  583  ? 143.641 43.976  13.345  1.00 104.64 ? 583  PRO A C     1 
ATOM   4560  O  O     . PRO A 1  583  ? 143.543 45.205  13.338  1.00 104.46 ? 583  PRO A O     1 
ATOM   4561  C  CB    . PRO A 1  583  ? 142.031 42.915  11.752  1.00 96.78  ? 583  PRO A CB    1 
ATOM   4562  C  CG    . PRO A 1  583  ? 140.881 43.811  11.527  1.00 100.15 ? 583  PRO A CG    1 
ATOM   4563  C  CD    . PRO A 1  583  ? 140.143 43.913  12.824  1.00 95.62  ? 583  PRO A CD    1 
ATOM   4564  N  N     . ASN A 1  584  ? 144.810 43.325  13.413  1.00 105.00 ? 584  ASN A N     1 
ATOM   4565  C  CA    . ASN A 1  584  ? 146.078 44.028  13.577  1.00 107.26 ? 584  ASN A CA    1 
ATOM   4566  C  C     . ASN A 1  584  ? 146.466 44.860  12.351  1.00 113.17 ? 584  ASN A C     1 
ATOM   4567  O  O     . ASN A 1  584  ? 146.781 44.313  11.294  1.00 114.09 ? 584  ASN A O     1 
ATOM   4568  C  CB    . ASN A 1  584  ? 147.181 43.101  14.120  1.00 109.57 ? 584  ASN A CB    1 
ATOM   4569  C  CG    . ASN A 1  584  ? 146.844 42.540  15.503  1.00 149.81 ? 584  ASN A CG    1 
ATOM   4570  O  OD1   . ASN A 1  584  ? 146.262 43.210  16.386  1.00 144.74 ? 584  ASN A OD1   1 
ATOM   4571  N  ND2   . ASN A 1  584  ? 147.165 41.273  15.713  1.00 146.33 ? 584  ASN A ND2   1 
ATOM   4572  N  N     . GLY A 1  585  ? 146.348 46.176  12.498  1.00 109.08 ? 585  GLY A N     1 
ATOM   4573  C  CA    . GLY A 1  585  ? 146.638 47.136  11.445  1.00 108.86 ? 585  GLY A CA    1 
ATOM   4574  C  C     . GLY A 1  585  ? 145.616 48.249  11.383  1.00 113.19 ? 585  GLY A C     1 
ATOM   4575  O  O     . GLY A 1  585  ? 145.813 49.252  10.686  1.00 113.84 ? 585  GLY A O     1 
ATOM   4576  N  N     . ILE A 1  586  ? 144.515 48.079  12.119  1.00 108.60 ? 586  ILE A N     1 
ATOM   4577  C  CA    . ILE A 1  586  ? 143.449 49.069  12.177  1.00 107.36 ? 586  ILE A CA    1 
ATOM   4578  C  C     . ILE A 1  586  ? 143.825 50.194  13.145  1.00 112.92 ? 586  ILE A C     1 
ATOM   4579  O  O     . ILE A 1  586  ? 144.037 49.956  14.339  1.00 111.90 ? 586  ILE A O     1 
ATOM   4580  C  CB    . ILE A 1  586  ? 142.082 48.395  12.493  1.00 108.84 ? 586  ILE A CB    1 
ATOM   4581  C  CG1   . ILE A 1  586  ? 141.635 47.430  11.372  1.00 107.68 ? 586  ILE A CG1   1 
ATOM   4582  C  CG2   . ILE A 1  586  ? 140.996 49.404  12.819  1.00 108.86 ? 586  ILE A CG2   1 
ATOM   4583  C  CD1   . ILE A 1  586  ? 141.309 48.041  10.012  1.00 113.51 ? 586  ILE A CD1   1 
ATOM   4584  N  N     . HIS A 1  587  ? 143.937 51.418  12.604  1.00 111.58 ? 587  HIS A N     1 
ATOM   4585  C  CA    . HIS A 1  587  ? 144.224 52.612  13.388  1.00 112.84 ? 587  HIS A CA    1 
ATOM   4586  C  C     . HIS A 1  587  ? 143.040 53.576  13.308  1.00 110.78 ? 587  HIS A C     1 
ATOM   4587  O  O     . HIS A 1  587  ? 142.627 53.969  12.215  1.00 108.42 ? 587  HIS A O     1 
ATOM   4588  C  CB    . HIS A 1  587  ? 145.540 53.287  12.965  1.00 116.06 ? 587  HIS A CB    1 
ATOM   4589  C  CG    . HIS A 1  587  ? 145.976 54.377  13.908  1.00 122.10 ? 587  HIS A CG    1 
ATOM   4590  N  ND1   . HIS A 1  587  ? 145.255 55.567  14.039  1.00 124.66 ? 587  HIS A ND1   1 
ATOM   4591  C  CD2   . HIS A 1  587  ? 147.046 54.429  14.739  1.00 125.98 ? 587  HIS A CD2   1 
ATOM   4592  C  CE1   . HIS A 1  587  ? 145.902 56.287  14.945  1.00 125.49 ? 587  HIS A CE1   1 
ATOM   4593  N  NE2   . HIS A 1  587  ? 146.988 55.651  15.391  1.00 126.61 ? 587  HIS A NE2   1 
ATOM   4594  N  N     . LEU A 1  588  ? 142.508 53.963  14.477  1.00 105.50 ? 588  LEU A N     1 
ATOM   4595  C  CA    . LEU A 1  588  ? 141.358 54.864  14.588  1.00 104.09 ? 588  LEU A CA    1 
ATOM   4596  C  C     . LEU A 1  588  ? 141.482 55.881  15.759  1.00 108.39 ? 588  LEU A C     1 
ATOM   4597  O  O     . LEU A 1  588  ? 141.750 55.497  16.905  1.00 108.68 ? 588  LEU A O     1 
ATOM   4598  C  CB    . LEU A 1  588  ? 140.061 54.019  14.660  1.00 102.55 ? 588  LEU A CB    1 
ATOM   4599  C  CG    . LEU A 1  588  ? 138.712 54.692  14.868  1.00 105.28 ? 588  LEU A CG    1 
ATOM   4600  C  CD1   . LEU A 1  588  ? 138.492 55.815  13.893  1.00 105.44 ? 588  LEU A CD1   1 
ATOM   4601  C  CD2   . LEU A 1  588  ? 137.616 53.703  14.685  1.00 104.75 ? 588  LEU A CD2   1 
ATOM   4602  N  N     . GLN A 1  589  ? 141.296 57.178  15.445  1.00 103.92 ? 589  GLN A N     1 
ATOM   4603  C  CA    . GLN A 1  589  ? 141.357 58.270  16.418  1.00 104.63 ? 589  GLN A CA    1 
ATOM   4604  C  C     . GLN A 1  589  ? 140.098 59.098  16.342  1.00 107.26 ? 589  GLN A C     1 
ATOM   4605  O  O     . GLN A 1  589  ? 139.711 59.480  15.238  1.00 107.16 ? 589  GLN A O     1 
ATOM   4606  C  CB    . GLN A 1  589  ? 142.551 59.191  16.120  1.00 107.08 ? 589  GLN A CB    1 
ATOM   4607  C  CG    . GLN A 1  589  ? 143.793 58.912  16.957  1.00 126.00 ? 589  GLN A CG    1 
ATOM   4608  C  CD    . GLN A 1  589  ? 144.467 60.166  17.477  1.00 139.04 ? 589  GLN A CD    1 
ATOM   4609  O  OE1   . GLN A 1  589  ? 143.817 61.131  17.915  1.00 126.36 ? 589  GLN A OE1   1 
ATOM   4610  N  NE2   . GLN A 1  589  ? 145.799 60.142  17.504  1.00 133.98 ? 589  GLN A NE2   1 
ATOM   4611  N  N     . ARG A 1  590  ? 139.458 59.393  17.489  1.00 103.17 ? 590  ARG A N     1 
ATOM   4612  C  CA    . ARG A 1  590  ? 138.274 60.269  17.550  1.00 103.43 ? 590  ARG A CA    1 
ATOM   4613  C  C     . ARG A 1  590  ? 138.198 61.020  18.862  1.00 113.35 ? 590  ARG A C     1 
ATOM   4614  O  O     . ARG A 1  590  ? 138.328 60.409  19.925  1.00 113.98 ? 590  ARG A O     1 
ATOM   4615  C  CB    . ARG A 1  590  ? 136.924 59.562  17.249  1.00 97.83  ? 590  ARG A CB    1 
ATOM   4616  C  CG    . ARG A 1  590  ? 135.675 60.400  17.641  1.00 90.19  ? 590  ARG A CG    1 
ATOM   4617  C  CD    . ARG A 1  590  ? 134.322 59.798  17.347  1.00 93.53  ? 590  ARG A CD    1 
ATOM   4618  N  NE    . ARG A 1  590  ? 134.219 58.365  17.649  1.00 106.36 ? 590  ARG A NE    1 
ATOM   4619  C  CZ    . ARG A 1  590  ? 133.562 57.859  18.689  1.00 123.72 ? 590  ARG A CZ    1 
ATOM   4620  N  NH1   . ARG A 1  590  ? 132.947 58.661  19.548  1.00 120.60 ? 590  ARG A NH1   1 
ATOM   4621  N  NH2   . ARG A 1  590  ? 133.517 56.549  18.877  1.00 100.34 ? 590  ARG A NH2   1 
ATOM   4622  N  N     . PHE A 1  591  ? 137.932 62.341  18.779  1.00 112.78 ? 591  PHE A N     1 
ATOM   4623  C  CA    . PHE A 1  591  ? 137.763 63.205  19.932  1.00 114.84 ? 591  PHE A CA    1 
ATOM   4624  C  C     . PHE A 1  591  ? 136.321 63.712  19.988  1.00 121.84 ? 591  PHE A C     1 
ATOM   4625  O  O     . PHE A 1  591  ? 135.840 64.307  19.018  1.00 120.65 ? 591  PHE A O     1 
ATOM   4626  C  CB    . PHE A 1  591  ? 138.789 64.340  19.877  1.00 117.97 ? 591  PHE A CB    1 
ATOM   4627  C  CG    . PHE A 1  591  ? 140.142 63.920  20.400  1.00 120.70 ? 591  PHE A CG    1 
ATOM   4628  C  CD1   . PHE A 1  591  ? 140.936 63.023  19.690  1.00 124.02 ? 591  PHE A CD1   1 
ATOM   4629  C  CD2   . PHE A 1  591  ? 140.621 64.414  21.600  1.00 123.92 ? 591  PHE A CD2   1 
ATOM   4630  C  CE1   . PHE A 1  591  ? 142.165 62.596  20.197  1.00 125.40 ? 591  PHE A CE1   1 
ATOM   4631  C  CE2   . PHE A 1  591  ? 141.853 63.996  22.099  1.00 127.75 ? 591  PHE A CE2   1 
ATOM   4632  C  CZ    . PHE A 1  591  ? 142.616 63.090  21.393  1.00 125.40 ? 591  PHE A CZ    1 
ATOM   4633  N  N     . ASP A 1  592  ? 135.601 63.379  21.079  1.00 122.21 ? 592  ASP A N     1 
ATOM   4634  C  CA    . ASP A 1  592  ? 134.212 63.805  21.310  1.00 123.80 ? 592  ASP A CA    1 
ATOM   4635  C  C     . ASP A 1  592  ? 134.264 65.043  22.219  1.00 131.87 ? 592  ASP A C     1 
ATOM   4636  O  O     . ASP A 1  592  ? 135.365 65.553  22.469  1.00 132.56 ? 592  ASP A O     1 
ATOM   4637  C  CB    . ASP A 1  592  ? 133.356 62.677  21.949  1.00 125.93 ? 592  ASP A CB    1 
ATOM   4638  C  CG    . ASP A 1  592  ? 132.957 61.494  21.063  1.00 138.68 ? 592  ASP A CG    1 
ATOM   4639  O  OD1   . ASP A 1  592  ? 132.921 61.660  19.809  1.00 137.89 ? 592  ASP A OD1   1 
ATOM   4640  O  OD2   . ASP A 1  592  ? 132.631 60.416  21.624  1.00 146.34 ? 592  ASP A OD2   1 
ATOM   4641  N  N     . GLU A 1  593  ? 133.101 65.530  22.718  1.00 130.68 ? 593  GLU A N     1 
ATOM   4642  C  CA    . GLU A 1  593  ? 133.071 66.736  23.555  1.00 132.57 ? 593  GLU A CA    1 
ATOM   4643  C  C     . GLU A 1  593  ? 134.004 66.724  24.765  1.00 136.21 ? 593  GLU A C     1 
ATOM   4644  O  O     . GLU A 1  593  ? 133.763 66.034  25.763  1.00 135.96 ? 593  GLU A O     1 
ATOM   4645  C  CB    . GLU A 1  593  ? 131.646 67.299  23.816  1.00 134.73 ? 593  GLU A CB    1 
ATOM   4646  C  CG    . GLU A 1  593  ? 130.832 66.680  24.951  1.00 153.44 ? 593  GLU A CG    1 
ATOM   4647  C  CD    . GLU A 1  593  ? 130.858 67.435  26.272  1.00 194.02 ? 593  GLU A CD    1 
ATOM   4648  O  OE1   . GLU A 1  593  ? 130.491 68.635  26.297  1.00 195.06 ? 593  GLU A OE1   1 
ATOM   4649  O  OE2   . GLU A 1  593  ? 131.232 66.811  27.293  1.00 198.87 ? 593  GLU A OE2   1 
ATOM   4650  N  N     . GLY A 1  594  ? 135.111 67.440  24.602  1.00 132.75 ? 594  GLY A N     1 
ATOM   4651  C  CA    . GLY A 1  594  ? 136.143 67.575  25.618  1.00 133.59 ? 594  GLY A CA    1 
ATOM   4652  C  C     . GLY A 1  594  ? 136.874 66.287  25.912  1.00 136.08 ? 594  GLY A C     1 
ATOM   4653  O  O     . GLY A 1  594  ? 136.947 65.859  27.070  1.00 136.97 ? 594  GLY A O     1 
ATOM   4654  N  N     . THR A 1  595  ? 137.388 65.643  24.863  1.00 129.73 ? 595  THR A N     1 
ATOM   4655  C  CA    . THR A 1  595  ? 138.149 64.424  25.055  1.00 128.36 ? 595  THR A CA    1 
ATOM   4656  C  C     . THR A 1  595  ? 139.581 64.868  25.202  1.00 131.54 ? 595  THR A C     1 
ATOM   4657  O  O     . THR A 1  595  ? 140.086 65.578  24.340  1.00 131.50 ? 595  THR A O     1 
ATOM   4658  C  CB    . THR A 1  595  ? 137.962 63.460  23.886  1.00 132.79 ? 595  THR A CB    1 
ATOM   4659  O  OG1   . THR A 1  595  ? 136.573 63.287  23.644  1.00 130.48 ? 595  THR A OG1   1 
ATOM   4660  C  CG2   . THR A 1  595  ? 138.608 62.115  24.140  1.00 130.95 ? 595  THR A CG2   1 
ATOM   4661  N  N     . THR A 1  596  ? 140.198 64.531  26.327  1.00 127.72 ? 596  THR A N     1 
ATOM   4662  C  CA    . THR A 1  596  ? 141.604 64.815  26.606  1.00 128.08 ? 596  THR A CA    1 
ATOM   4663  C  C     . THR A 1  596  ? 142.329 63.562  26.093  1.00 129.41 ? 596  THR A C     1 
ATOM   4664  O  O     . THR A 1  596  ? 141.681 62.548  25.839  1.00 127.08 ? 596  THR A O     1 
ATOM   4665  C  CB    . THR A 1  596  ? 141.788 65.079  28.135  1.00 139.92 ? 596  THR A CB    1 
ATOM   4666  O  OG1   . THR A 1  596  ? 141.046 66.244  28.517  1.00 141.30 ? 596  THR A OG1   1 
ATOM   4667  C  CG2   . THR A 1  596  ? 143.248 65.245  28.567  1.00 138.53 ? 596  THR A CG2   1 
ATOM   4668  N  N     . LEU A 1  597  ? 143.652 63.624  25.924  1.00 126.42 ? 597  LEU A N     1 
ATOM   4669  C  CA    . LEU A 1  597  ? 144.448 62.468  25.518  1.00 125.61 ? 597  LEU A CA    1 
ATOM   4670  C  C     . LEU A 1  597  ? 144.501 61.475  26.711  1.00 130.35 ? 597  LEU A C     1 
ATOM   4671  O  O     . LEU A 1  597  ? 145.027 60.367  26.594  1.00 129.59 ? 597  LEU A O     1 
ATOM   4672  C  CB    . LEU A 1  597  ? 145.854 62.951  25.108  1.00 126.30 ? 597  LEU A CB    1 
ATOM   4673  C  CG    . LEU A 1  597  ? 146.544 62.303  23.898  1.00 129.80 ? 597  LEU A CG    1 
ATOM   4674  C  CD1   . LEU A 1  597  ? 147.271 61.042  24.273  1.00 129.88 ? 597  LEU A CD1   1 
ATOM   4675  C  CD2   . LEU A 1  597  ? 145.605 62.081  22.736  1.00 130.29 ? 597  LEU A CD2   1 
ATOM   4676  N  N     . LEU A 1  598  ? 143.918 61.887  27.851  1.00 128.08 ? 598  LEU A N     1 
ATOM   4677  C  CA    . LEU A 1  598  ? 143.788 61.087  29.054  1.00 128.81 ? 598  LEU A CA    1 
ATOM   4678  C  C     . LEU A 1  598  ? 142.348 60.602  29.182  1.00 133.51 ? 598  LEU A C     1 
ATOM   4679  O  O     . LEU A 1  598  ? 142.047 59.869  30.125  1.00 134.46 ? 598  LEU A O     1 
ATOM   4680  C  CB    . LEU A 1  598  ? 144.152 61.911  30.290  1.00 130.38 ? 598  LEU A CB    1 
ATOM   4681  C  CG    . LEU A 1  598  ? 145.189 61.319  31.260  1.00 136.26 ? 598  LEU A CG    1 
ATOM   4682  C  CD1   . LEU A 1  598  ? 145.100 62.001  32.594  1.00 138.03 ? 598  LEU A CD1   1 
ATOM   4683  C  CD2   . LEU A 1  598  ? 145.020 59.815  31.481  1.00 137.63 ? 598  LEU A CD2   1 
ATOM   4684  N  N     . SER A 1  599  ? 141.460 61.012  28.238  1.00 128.67 ? 599  SER A N     1 
ATOM   4685  C  CA    . SER A 1  599  ? 140.021 60.676  28.160  1.00 126.86 ? 599  SER A CA    1 
ATOM   4686  C  C     . SER A 1  599  ? 139.354 60.436  29.527  1.00 129.29 ? 599  SER A C     1 
ATOM   4687  O  O     . SER A 1  599  ? 139.001 59.293  29.853  1.00 128.51 ? 599  SER A O     1 
ATOM   4688  C  CB    . SER A 1  599  ? 139.775 59.505  27.218  1.00 128.17 ? 599  SER A CB    1 
ATOM   4689  O  OG    . SER A 1  599  ? 138.384 59.353  26.995  1.00 134.45 ? 599  SER A OG    1 
ATOM   4690  N  N     . PRO A 1  600  ? 139.235 61.501  30.353  1.00 124.41 ? 600  PRO A N     1 
ATOM   4691  C  CA    . PRO A 1  600  ? 138.656 61.341  31.696  1.00 124.23 ? 600  PRO A CA    1 
ATOM   4692  C  C     . PRO A 1  600  ? 137.254 60.752  31.759  1.00 125.34 ? 600  PRO A C     1 
ATOM   4693  O  O     . PRO A 1  600  ? 136.957 60.029  32.703  1.00 125.46 ? 600  PRO A O     1 
ATOM   4694  C  CB    . PRO A 1  600  ? 138.661 62.768  32.241  1.00 127.20 ? 600  PRO A CB    1 
ATOM   4695  C  CG    . PRO A 1  600  ? 138.752 63.647  31.028  1.00 130.91 ? 600  PRO A CG    1 
ATOM   4696  C  CD    . PRO A 1  600  ? 139.644 62.900  30.124  1.00 125.72 ? 600  PRO A CD    1 
ATOM   4697  N  N     . LYS A 1  601  ? 136.409 61.061  30.766  1.00 119.55 ? 601  LYS A N     1 
ATOM   4698  C  CA    . LYS A 1  601  ? 135.014 60.635  30.701  1.00 118.50 ? 601  LYS A CA    1 
ATOM   4699  C  C     . LYS A 1  601  ? 134.782 59.287  29.977  1.00 122.19 ? 601  LYS A C     1 
ATOM   4700  O  O     . LYS A 1  601  ? 133.660 58.755  30.002  1.00 121.37 ? 601  LYS A O     1 
ATOM   4701  C  CB    . LYS A 1  601  ? 134.201 61.736  30.007  1.00 120.54 ? 601  LYS A CB    1 
ATOM   4702  C  CG    . LYS A 1  601  ? 134.142 63.066  30.760  1.00 139.29 ? 601  LYS A CG    1 
ATOM   4703  C  CD    . LYS A 1  601  ? 133.346 64.134  29.991  1.00 149.88 ? 601  LYS A CD    1 
ATOM   4704  C  CE    . LYS A 1  601  ? 131.854 64.068  30.250  1.00 159.81 ? 601  LYS A CE    1 
ATOM   4705  N  NZ    . LYS A 1  601  ? 131.080 64.822  29.230  1.00 168.02 ? 601  LYS A NZ    1 
ATOM   4706  N  N     . ASP A 1  602  ? 135.858 58.732  29.359  1.00 118.29 ? 602  ASP A N     1 
ATOM   4707  C  CA    . ASP A 1  602  ? 135.884 57.554  28.471  1.00 115.84 ? 602  ASP A CA    1 
ATOM   4708  C  C     . ASP A 1  602  ? 135.045 57.961  27.237  1.00 118.01 ? 602  ASP A C     1 
ATOM   4709  O  O     . ASP A 1  602  ? 134.047 57.336  26.884  1.00 116.35 ? 602  ASP A O     1 
ATOM   4710  C  CB    . ASP A 1  602  ? 135.460 56.232  29.165  1.00 116.77 ? 602  ASP A CB    1 
ATOM   4711  C  CG    . ASP A 1  602  ? 136.352 55.000  28.925  1.00 120.75 ? 602  ASP A CG    1 
ATOM   4712  O  OD1   . ASP A 1  602  ? 137.516 55.173  28.458  1.00 119.75 ? 602  ASP A OD1   1 
ATOM   4713  O  OD2   . ASP A 1  602  ? 135.906 53.867  29.252  1.00 122.29 ? 602  ASP A OD2   1 
ATOM   4714  N  N     . ASN A 1  603  ? 135.442 59.125  26.671  1.00 115.00 ? 603  ASN A N     1 
ATOM   4715  C  CA    . ASN A 1  603  ? 134.903 59.831  25.510  1.00 113.85 ? 603  ASN A CA    1 
ATOM   4716  C  C     . ASN A 1  603  ? 135.693 59.428  24.289  1.00 117.43 ? 603  ASN A C     1 
ATOM   4717  O  O     . ASN A 1  603  ? 136.761 58.823  24.422  1.00 117.74 ? 603  ASN A O     1 
ATOM   4718  C  CB    . ASN A 1  603  ? 135.106 61.329  25.703  1.00 114.38 ? 603  ASN A CB    1 
ATOM   4719  C  CG    . ASN A 1  603  ? 133.920 62.081  26.221  1.00 144.24 ? 603  ASN A CG    1 
ATOM   4720  O  OD1   . ASN A 1  603  ? 134.074 63.118  26.871  1.00 146.21 ? 603  ASN A OD1   1 
ATOM   4721  N  ND2   . ASN A 1  603  ? 132.713 61.610  25.922  1.00 133.08 ? 603  ASN A ND2   1 
ATOM   4722  N  N     . GLY A 1  604  ? 135.195 59.792  23.114  1.00 112.98 ? 604  GLY A N     1 
ATOM   4723  C  CA    . GLY A 1  604  ? 135.874 59.507  21.858  1.00 112.16 ? 604  GLY A CA    1 
ATOM   4724  C  C     . GLY A 1  604  ? 136.330 58.074  21.677  1.00 116.22 ? 604  GLY A C     1 
ATOM   4725  O  O     . GLY A 1  604  ? 135.695 57.143  22.194  1.00 115.41 ? 604  GLY A O     1 
ATOM   4726  N  N     . MET A 1  605  ? 137.441 57.896  20.933  1.00 113.61 ? 605  MET A N     1 
ATOM   4727  C  CA    . MET A 1  605  ? 137.979 56.578  20.586  1.00 113.84 ? 605  MET A CA    1 
ATOM   4728  C  C     . MET A 1  605  ? 139.424 56.602  20.143  1.00 118.57 ? 605  MET A C     1 
ATOM   4729  O  O     . MET A 1  605  ? 139.788 57.350  19.233  1.00 118.30 ? 605  MET A O     1 
ATOM   4730  C  CB    . MET A 1  605  ? 137.148 55.950  19.440  1.00 115.13 ? 605  MET A CB    1 
ATOM   4731  C  CG    . MET A 1  605  ? 137.288 54.460  19.337  1.00 118.36 ? 605  MET A CG    1 
ATOM   4732  S  SD    . MET A 1  605  ? 136.459 53.667  20.726  1.00 123.07 ? 605  MET A SD    1 
ATOM   4733  C  CE    . MET A 1  605  ? 137.608 52.496  21.093  1.00 119.93 ? 605  MET A CE    1 
ATOM   4734  N  N     . LEU A 1  606  ? 140.222 55.711  20.715  1.00 115.39 ? 606  LEU A N     1 
ATOM   4735  C  CA    . LEU A 1  606  ? 141.600 55.571  20.305  1.00 115.69 ? 606  LEU A CA    1 
ATOM   4736  C  C     . LEU A 1  606  ? 141.912 54.103  20.136  1.00 118.87 ? 606  LEU A C     1 
ATOM   4737  O  O     . LEU A 1  606  ? 142.015 53.374  21.124  1.00 119.71 ? 606  LEU A O     1 
ATOM   4738  C  CB    . LEU A 1  606  ? 142.575 56.266  21.275  1.00 117.40 ? 606  LEU A CB    1 
ATOM   4739  C  CG    . LEU A 1  606  ? 144.078 56.142  20.943  1.00 123.16 ? 606  LEU A CG    1 
ATOM   4740  C  CD1   . LEU A 1  606  ? 144.379 56.558  19.505  1.00 122.97 ? 606  LEU A CD1   1 
ATOM   4741  C  CD2   . LEU A 1  606  ? 144.917 56.954  21.900  1.00 126.96 ? 606  LEU A CD2   1 
ATOM   4742  N  N     . ILE A 1  607  ? 142.027 53.669  18.873  1.00 112.91 ? 607  ILE A N     1 
ATOM   4743  C  CA    . ILE A 1  607  ? 142.359 52.288  18.518  1.00 111.17 ? 607  ILE A CA    1 
ATOM   4744  C  C     . ILE A 1  607  ? 143.701 52.294  17.776  1.00 113.74 ? 607  ILE A C     1 
ATOM   4745  O  O     . ILE A 1  607  ? 143.780 52.821  16.662  1.00 113.34 ? 607  ILE A O     1 
ATOM   4746  C  CB    . ILE A 1  607  ? 141.221 51.551  17.725  1.00 112.37 ? 607  ILE A CB    1 
ATOM   4747  C  CG1   . ILE A 1  607  ? 139.839 51.766  18.370  1.00 111.66 ? 607  ILE A CG1   1 
ATOM   4748  C  CG2   . ILE A 1  607  ? 141.529 50.044  17.557  1.00 112.37 ? 607  ILE A CG2   1 
ATOM   4749  C  CD1   . ILE A 1  607  ? 138.733 51.679  17.452  1.00 111.73 ? 607  ILE A CD1   1 
ATOM   4750  N  N     . ILE A 1  608  ? 144.753 51.749  18.409  1.00 108.73 ? 608  ILE A N     1 
ATOM   4751  C  CA    . ILE A 1  608  ? 146.082 51.669  17.807  1.00 108.04 ? 608  ILE A CA    1 
ATOM   4752  C  C     . ILE A 1  608  ? 146.392 50.201  17.514  1.00 113.19 ? 608  ILE A C     1 
ATOM   4753  O  O     . ILE A 1  608  ? 146.361 49.379  18.430  1.00 112.80 ? 608  ILE A O     1 
ATOM   4754  C  CB    . ILE A 1  608  ? 147.164 52.364  18.680  1.00 111.62 ? 608  ILE A CB    1 
ATOM   4755  C  CG1   . ILE A 1  608  ? 146.803 53.838  18.968  1.00 111.31 ? 608  ILE A CG1   1 
ATOM   4756  C  CG2   . ILE A 1  608  ? 148.537 52.254  18.029  1.00 113.26 ? 608  ILE A CG2   1 
ATOM   4757  C  CD1   . ILE A 1  608  ? 147.483 54.452  20.141  1.00 112.57 ? 608  ILE A CD1   1 
ATOM   4758  N  N     . ASP A 1  609  ? 146.671 49.877  16.233  1.00 111.49 ? 609  ASP A N     1 
ATOM   4759  C  CA    . ASP A 1  609  ? 146.985 48.520  15.733  1.00 112.02 ? 609  ASP A CA    1 
ATOM   4760  C  C     . ASP A 1  609  ? 145.985 47.448  16.228  1.00 116.45 ? 609  ASP A C     1 
ATOM   4761  O  O     . ASP A 1  609  ? 146.361 46.506  16.945  1.00 117.79 ? 609  ASP A O     1 
ATOM   4762  C  CB    . ASP A 1  609  ? 148.467 48.124  15.991  1.00 115.16 ? 609  ASP A CB    1 
ATOM   4763  C  CG    . ASP A 1  609  ? 148.919 46.822  15.329  1.00 128.37 ? 609  ASP A CG    1 
ATOM   4764  O  OD1   . ASP A 1  609  ? 148.837 46.726  14.083  1.00 128.59 ? 609  ASP A OD1   1 
ATOM   4765  O  OD2   . ASP A 1  609  ? 149.367 45.906  16.060  1.00 136.79 ? 609  ASP A OD2   1 
ATOM   4766  N  N     . GLY A 1  610  ? 144.712 47.650  15.874  1.00 110.35 ? 610  GLY A N     1 
ATOM   4767  C  CA    . GLY A 1  610  ? 143.607 46.763  16.226  1.00 108.08 ? 610  GLY A CA    1 
ATOM   4768  C  C     . GLY A 1  610  ? 143.419 46.490  17.704  1.00 108.22 ? 610  GLY A C     1 
ATOM   4769  O  O     . GLY A 1  610  ? 143.025 45.372  18.070  1.00 106.94 ? 610  GLY A O     1 
ATOM   4770  N  N     . GLN A 1  611  ? 143.737 47.513  18.559  1.00 102.40 ? 611  GLN A N     1 
ATOM   4771  C  CA    . GLN A 1  611  ? 143.662 47.479  20.031  1.00 101.63 ? 611  GLN A CA    1 
ATOM   4772  C  C     . GLN A 1  611  ? 143.060 48.779  20.561  1.00 102.38 ? 611  GLN A C     1 
ATOM   4773  O  O     . GLN A 1  611  ? 143.571 49.849  20.250  1.00 102.46 ? 611  GLN A O     1 
ATOM   4774  C  CB    . GLN A 1  611  ? 145.059 47.257  20.686  1.00 103.90 ? 611  GLN A CB    1 
ATOM   4775  C  CG    . GLN A 1  611  ? 145.821 45.969  20.310  1.00 124.81 ? 611  GLN A CG    1 
ATOM   4776  C  CD    . GLN A 1  611  ? 145.112 44.648  20.602  1.00 147.81 ? 611  GLN A CD    1 
ATOM   4777  O  OE1   . GLN A 1  611  ? 144.874 43.837  19.687  1.00 149.24 ? 611  GLN A OE1   1 
ATOM   4778  N  NE2   . GLN A 1  611  ? 144.810 44.369  21.877  1.00 127.91 ? 611  GLN A NE2   1 
ATOM   4779  N  N     . ILE A 1  612  ? 141.988 48.690  21.361  1.00 96.78  ? 612  ILE A N     1 
ATOM   4780  C  CA    . ILE A 1  612  ? 141.323 49.855  21.958  1.00 96.57  ? 612  ILE A CA    1 
ATOM   4781  C  C     . ILE A 1  612  ? 142.177 50.383  23.122  1.00 105.78 ? 612  ILE A C     1 
ATOM   4782  O  O     . ILE A 1  612  ? 142.430 49.646  24.082  1.00 108.02 ? 612  ILE A O     1 
ATOM   4783  C  CB    . ILE A 1  612  ? 139.877 49.529  22.451  1.00 97.76  ? 612  ILE A CB    1 
ATOM   4784  C  CG1   . ILE A 1  612  ? 138.948 49.043  21.333  1.00 94.79  ? 612  ILE A CG1   1 
ATOM   4785  C  CG2   . ILE A 1  612  ? 139.273 50.700  23.239  1.00 99.15  ? 612  ILE A CG2   1 
ATOM   4786  C  CD1   . ILE A 1  612  ? 137.969 48.067  21.790  1.00 85.62  ? 612  ILE A CD1   1 
ATOM   4787  N  N     . ILE A 1  613  ? 142.579 51.657  23.057  1.00 103.07 ? 613  ILE A N     1 
ATOM   4788  C  CA    . ILE A 1  613  ? 143.352 52.283  24.116  1.00 103.98 ? 613  ILE A CA    1 
ATOM   4789  C  C     . ILE A 1  613  ? 142.387 52.916  25.089  1.00 109.50 ? 613  ILE A C     1 
ATOM   4790  O  O     . ILE A 1  613  ? 142.466 52.626  26.278  1.00 110.57 ? 613  ILE A O     1 
ATOM   4791  C  CB    . ILE A 1  613  ? 144.421 53.235  23.541  1.00 107.38 ? 613  ILE A CB    1 
ATOM   4792  C  CG1   . ILE A 1  613  ? 145.705 52.469  23.233  1.00 107.46 ? 613  ILE A CG1   1 
ATOM   4793  C  CG2   . ILE A 1  613  ? 144.731 54.369  24.482  1.00 110.32 ? 613  ILE A CG2   1 
ATOM   4794  C  CD1   . ILE A 1  613  ? 145.718 51.843  21.955  1.00 113.62 ? 613  ILE A CD1   1 
ATOM   4795  N  N     . PHE A 1  614  ? 141.453 53.744  24.593  1.00 106.50 ? 614  PHE A N     1 
ATOM   4796  C  CA    . PHE A 1  614  ? 140.425 54.377  25.424  1.00 107.45 ? 614  PHE A CA    1 
ATOM   4797  C  C     . PHE A 1  614  ? 139.118 54.577  24.655  1.00 111.87 ? 614  PHE A C     1 
ATOM   4798  O  O     . PHE A 1  614  ? 139.071 54.375  23.434  1.00 110.77 ? 614  PHE A O     1 
ATOM   4799  C  CB    . PHE A 1  614  ? 140.910 55.712  26.064  1.00 110.47 ? 614  PHE A CB    1 
ATOM   4800  C  CG    . PHE A 1  614  ? 141.221 56.910  25.168  1.00 111.58 ? 614  PHE A CG    1 
ATOM   4801  C  CD1   . PHE A 1  614  ? 140.213 57.547  24.443  1.00 113.15 ? 614  PHE A CD1   1 
ATOM   4802  C  CD2   . PHE A 1  614  ? 142.501 57.455  25.127  1.00 113.32 ? 614  PHE A CD2   1 
ATOM   4803  C  CE1   . PHE A 1  614  ? 140.497 58.654  23.644  1.00 113.31 ? 614  PHE A CE1   1 
ATOM   4804  C  CE2   . PHE A 1  614  ? 142.782 58.558  24.323  1.00 115.43 ? 614  PHE A CE2   1 
ATOM   4805  C  CZ    . PHE A 1  614  ? 141.780 59.150  23.588  1.00 112.63 ? 614  PHE A CZ    1 
ATOM   4806  N  N     . GLY A 1  615  ? 138.091 55.020  25.381  1.00 108.74 ? 615  GLY A N     1 
ATOM   4807  C  CA    . GLY A 1  615  ? 136.784 55.343  24.826  1.00 107.09 ? 615  GLY A CA    1 
ATOM   4808  C  C     . GLY A 1  615  ? 135.800 54.204  24.850  1.00 107.66 ? 615  GLY A C     1 
ATOM   4809  O  O     . GLY A 1  615  ? 136.176 53.050  24.656  1.00 105.81 ? 615  GLY A O     1 
ATOM   4810  N  N     . VAL A 1  616  ? 134.530 54.529  25.071  1.00 103.64 ? 616  VAL A N     1 
ATOM   4811  C  CA    . VAL A 1  616  ? 133.493 53.512  25.064  1.00 102.87 ? 616  VAL A CA    1 
ATOM   4812  C  C     . VAL A 1  616  ? 132.977 53.319  23.616  1.00 106.86 ? 616  VAL A C     1 
ATOM   4813  O  O     . VAL A 1  616  ? 132.713 54.286  22.874  1.00 107.36 ? 616  VAL A O     1 
ATOM   4814  C  CB    . VAL A 1  616  ? 132.377 53.745  26.109  1.00 106.91 ? 616  VAL A CB    1 
ATOM   4815  C  CG1   . VAL A 1  616  ? 131.485 52.516  26.245  1.00 106.20 ? 616  VAL A CG1   1 
ATOM   4816  C  CG2   . VAL A 1  616  ? 132.975 54.083  27.460  1.00 108.19 ? 616  VAL A CG2   1 
ATOM   4817  N  N     . VAL A 1  617  ? 132.915 52.051  23.206  1.00 100.61 ? 617  VAL A N     1 
ATOM   4818  C  CA    . VAL A 1  617  ? 132.457 51.674  21.887  1.00 97.89  ? 617  VAL A CA    1 
ATOM   4819  C  C     . VAL A 1  617  ? 130.932 51.697  21.863  1.00 100.97 ? 617  VAL A C     1 
ATOM   4820  O  O     . VAL A 1  617  ? 130.277 51.053  22.691  1.00 100.28 ? 617  VAL A O     1 
ATOM   4821  C  CB    . VAL A 1  617  ? 133.026 50.304  21.491  1.00 99.93  ? 617  VAL A CB    1 
ATOM   4822  C  CG1   . VAL A 1  617  ? 132.691 49.968  20.034  1.00 98.32  ? 617  VAL A CG1   1 
ATOM   4823  C  CG2   . VAL A 1  617  ? 134.530 50.260  21.745  1.00 99.98  ? 617  VAL A CG2   1 
ATOM   4824  N  N     . GLU A 1  618  ? 130.383 52.474  20.918  1.00 96.34  ? 618  GLU A N     1 
ATOM   4825  C  CA    . GLU A 1  618  ? 128.948 52.617  20.660  1.00 94.75  ? 618  GLU A CA    1 
ATOM   4826  C  C     . GLU A 1  618  ? 128.683 53.141  19.220  1.00 95.59  ? 618  GLU A C     1 
ATOM   4827  O  O     . GLU A 1  618  ? 129.608 53.209  18.403  1.00 94.69  ? 618  GLU A O     1 
ATOM   4828  C  CB    . GLU A 1  618  ? 128.242 53.452  21.756  1.00 96.75  ? 618  GLU A CB    1 
ATOM   4829  C  CG    . GLU A 1  618  ? 128.953 54.744  22.107  1.00 108.53 ? 618  GLU A CG    1 
ATOM   4830  C  CD    . GLU A 1  618  ? 129.185 55.686  20.943  1.00 126.48 ? 618  GLU A CD    1 
ATOM   4831  O  OE1   . GLU A 1  618  ? 128.210 56.351  20.521  1.00 114.20 ? 618  GLU A OE1   1 
ATOM   4832  O  OE2   . GLU A 1  618  ? 130.315 55.684  20.398  1.00 118.10 ? 618  GLU A OE2   1 
ATOM   4833  N  N     . LYS A 1  619  ? 127.429 53.538  18.935  1.00 89.80  ? 619  LYS A N     1 
ATOM   4834  C  CA    . LYS A 1  619  ? 126.946 54.000  17.636  1.00 87.68  ? 619  LYS A CA    1 
ATOM   4835  C  C     . LYS A 1  619  ? 127.952 54.807  16.794  1.00 92.46  ? 619  LYS A C     1 
ATOM   4836  O  O     . LYS A 1  619  ? 128.054 54.574  15.589  1.00 91.90  ? 619  LYS A O     1 
ATOM   4837  C  CB    . LYS A 1  619  ? 125.589 54.700  17.794  1.00 88.56  ? 619  LYS A CB    1 
ATOM   4838  C  CG    . LYS A 1  619  ? 124.724 54.700  16.538  1.00 96.29  ? 619  LYS A CG    1 
ATOM   4839  C  CD    . LYS A 1  619  ? 123.307 55.160  16.857  1.00 106.63 ? 619  LYS A CD    1 
ATOM   4840  C  CE    . LYS A 1  619  ? 122.513 55.595  15.647  1.00 116.78 ? 619  LYS A CE    1 
ATOM   4841  N  NZ    . LYS A 1  619  ? 121.112 55.937  16.020  1.00 128.14 ? 619  LYS A NZ    1 
ATOM   4842  N  N     . LYS A 1  620  ? 128.719 55.717  17.430  1.00 89.92  ? 620  LYS A N     1 
ATOM   4843  C  CA    . LYS A 1  620  ? 129.709 56.550  16.734  1.00 89.44  ? 620  LYS A CA    1 
ATOM   4844  C  C     . LYS A 1  620  ? 130.876 55.722  16.180  1.00 94.80  ? 620  LYS A C     1 
ATOM   4845  O  O     . LYS A 1  620  ? 131.409 56.076  15.128  1.00 95.97  ? 620  LYS A O     1 
ATOM   4846  C  CB    . LYS A 1  620  ? 130.255 57.690  17.622  1.00 91.06  ? 620  LYS A CB    1 
ATOM   4847  C  CG    . LYS A 1  620  ? 129.224 58.642  18.206  1.00 97.71  ? 620  LYS A CG    1 
ATOM   4848  C  CD    . LYS A 1  620  ? 129.889 59.775  18.999  1.00 110.10 ? 620  LYS A CD    1 
ATOM   4849  C  CE    . LYS A 1  620  ? 129.205 60.078  20.319  1.00 130.37 ? 620  LYS A CE    1 
ATOM   4850  N  NZ    . LYS A 1  620  ? 129.837 59.374  21.482  1.00 143.27 ? 620  LYS A NZ    1 
ATOM   4851  N  N     . THR A 1  621  ? 131.286 54.649  16.880  1.00 90.16  ? 621  THR A N     1 
ATOM   4852  C  CA    . THR A 1  621  ? 132.444 53.861  16.466  1.00 89.81  ? 621  THR A CA    1 
ATOM   4853  C  C     . THR A 1  621  ? 132.055 52.711  15.584  1.00 96.34  ? 621  THR A C     1 
ATOM   4854  O  O     . THR A 1  621  ? 132.628 52.505  14.515  1.00 96.92  ? 621  THR A O     1 
ATOM   4855  C  CB    . THR A 1  621  ? 133.200 53.265  17.697  1.00 89.00  ? 621  THR A CB    1 
ATOM   4856  O  OG1   . THR A 1  621  ? 133.282 54.183  18.793  1.00 90.25  ? 621  THR A OG1   1 
ATOM   4857  C  CG2   . THR A 1  621  ? 134.572 52.681  17.337  1.00 80.03  ? 621  THR A CG2   1 
ATOM   4858  N  N     . VAL A 1  622  ? 131.131 51.917  16.086  1.00 93.50  ? 622  VAL A N     1 
ATOM   4859  C  CA    . VAL A 1  622  ? 130.746 50.643  15.541  1.00 92.09  ? 622  VAL A CA    1 
ATOM   4860  C  C     . VAL A 1  622  ? 129.500 50.654  14.674  1.00 95.24  ? 622  VAL A C     1 
ATOM   4861  O  O     . VAL A 1  622  ? 129.251 49.693  13.959  1.00 94.19  ? 622  VAL A O     1 
ATOM   4862  C  CB    . VAL A 1  622  ? 130.734 49.653  16.728  1.00 96.08  ? 622  VAL A CB    1 
ATOM   4863  C  CG1   . VAL A 1  622  ? 129.363 49.518  17.380  1.00 95.59  ? 622  VAL A CG1   1 
ATOM   4864  C  CG2   . VAL A 1  622  ? 131.308 48.318  16.328  1.00 95.73  ? 622  VAL A CG2   1 
ATOM   4865  N  N     . GLY A 1  623  ? 128.750 51.749  14.713  1.00 92.62  ? 623  GLY A N     1 
ATOM   4866  C  CA    . GLY A 1  623  ? 127.556 51.903  13.891  1.00 92.41  ? 623  GLY A CA    1 
ATOM   4867  C  C     . GLY A 1  623  ? 127.935 52.128  12.445  1.00 98.16  ? 623  GLY A C     1 
ATOM   4868  O  O     . GLY A 1  623  ? 129.125 52.013  12.100  1.00 97.96  ? 623  GLY A O     1 
ATOM   4869  N  N     . SER A 1  624  ? 126.921 52.452  11.584  1.00 95.95  ? 624  SER A N     1 
ATOM   4870  C  CA    . SER A 1  624  ? 127.106 52.697  10.130  1.00 95.44  ? 624  SER A CA    1 
ATOM   4871  C  C     . SER A 1  624  ? 127.436 54.175  9.835   1.00 99.40  ? 624  SER A C     1 
ATOM   4872  O  O     . SER A 1  624  ? 126.801 54.820  9.001   1.00 96.54  ? 624  SER A O     1 
ATOM   4873  C  CB    . SER A 1  624  ? 125.937 52.152  9.303   1.00 97.72  ? 624  SER A CB    1 
ATOM   4874  O  OG    . SER A 1  624  ? 124.729 52.867  9.506   1.00 107.43 ? 624  SER A OG    1 
ATOM   4875  N  N     . SER A 1  625  ? 128.476 54.673  10.551  1.00 99.19  ? 625  SER A N     1 
ATOM   4876  C  CA    . SER A 1  625  ? 129.005 56.040  10.570  1.00 100.36 ? 625  SER A CA    1 
ATOM   4877  C  C     . SER A 1  625  ? 130.222 56.281  9.681   1.00 104.23 ? 625  SER A C     1 
ATOM   4878  O  O     . SER A 1  625  ? 131.001 55.346  9.409   1.00 103.91 ? 625  SER A O     1 
ATOM   4879  C  CB    . SER A 1  625  ? 129.297 56.480  12.004  1.00 104.64 ? 625  SER A CB    1 
ATOM   4880  O  OG    . SER A 1  625  ? 130.049 55.507  12.707  1.00 112.31 ? 625  SER A OG    1 
ATOM   4881  N  N     . ASN A 1  626  ? 130.377 57.568  9.262   1.00 99.90  ? 626  ASN A N     1 
ATOM   4882  C  CA    . ASN A 1  626  ? 131.415 58.056  8.367   1.00 99.81  ? 626  ASN A CA    1 
ATOM   4883  C  C     . ASN A 1  626  ? 132.839 57.693  8.769   1.00 105.36 ? 626  ASN A C     1 
ATOM   4884  O  O     . ASN A 1  626  ? 133.513 56.972  8.038   1.00 104.75 ? 626  ASN A O     1 
ATOM   4885  C  CB    . ASN A 1  626  ? 131.254 59.538  8.061   1.00 100.36 ? 626  ASN A CB    1 
ATOM   4886  C  CG    . ASN A 1  626  ? 131.641 59.905  6.637   1.00 138.50 ? 626  ASN A CG    1 
ATOM   4887  O  OD1   . ASN A 1  626  ? 132.829 59.944  6.265   1.00 135.08 ? 626  ASN A OD1   1 
ATOM   4888  N  ND2   . ASN A 1  626  ? 130.643 60.214  5.807   1.00 132.59 ? 626  ASN A ND2   1 
ATOM   4889  N  N     . GLY A 1  627  ? 133.284 58.142  9.927   1.00 103.78 ? 627  GLY A N     1 
ATOM   4890  C  CA    . GLY A 1  627  ? 134.643 57.825  10.365  1.00 104.77 ? 627  GLY A CA    1 
ATOM   4891  C  C     . GLY A 1  627  ? 134.835 56.415  10.891  1.00 108.20 ? 627  GLY A C     1 
ATOM   4892  O  O     . GLY A 1  627  ? 135.974 55.984  11.094  1.00 108.08 ? 627  GLY A O     1 
ATOM   4893  N  N     . GLY A 1  628  ? 133.701 55.724  11.082  1.00 103.23 ? 628  GLY A N     1 
ATOM   4894  C  CA    . GLY A 1  628  ? 133.502 54.392  11.649  1.00 101.12 ? 628  GLY A CA    1 
ATOM   4895  C  C     . GLY A 1  628  ? 134.551 53.314  11.503  1.00 99.13  ? 628  GLY A C     1 
ATOM   4896  O  O     . GLY A 1  628  ? 135.203 53.193  10.462  1.00 98.50  ? 628  GLY A O     1 
ATOM   4897  N  N     . LEU A 1  629  ? 134.659 52.482  12.560  1.00 90.50  ? 629  LEU A N     1 
ATOM   4898  C  CA    . LEU A 1  629  ? 135.511 51.297  12.643  1.00 86.90  ? 629  LEU A CA    1 
ATOM   4899  C  C     . LEU A 1  629  ? 135.214 50.456  11.396  1.00 87.53  ? 629  LEU A C     1 
ATOM   4900  O  O     . LEU A 1  629  ? 136.151 50.066  10.705  1.00 86.41  ? 629  LEU A O     1 
ATOM   4901  C  CB    . LEU A 1  629  ? 135.204 50.521  13.957  1.00 85.63  ? 629  LEU A CB    1 
ATOM   4902  C  CG    . LEU A 1  629  ? 136.126 49.387  14.437  1.00 87.92  ? 629  LEU A CG    1 
ATOM   4903  C  CD1   . LEU A 1  629  ? 135.574 48.036  14.138  1.00 86.22  ? 629  LEU A CD1   1 
ATOM   4904  C  CD2   . LEU A 1  629  ? 137.520 49.518  13.942  1.00 88.95  ? 629  LEU A CD2   1 
ATOM   4905  N  N     . ILE A 1  630  ? 133.913 50.325  11.031  1.00 82.48  ? 630  ILE A N     1 
ATOM   4906  C  CA    . ILE A 1  630  ? 133.489 49.593  9.834   1.00 80.49  ? 630  ILE A CA    1 
ATOM   4907  C  C     . ILE A 1  630  ? 134.000 50.231  8.524   1.00 83.51  ? 630  ILE A C     1 
ATOM   4908  O  O     . ILE A 1  630  ? 134.660 49.531  7.747   1.00 80.30  ? 630  ILE A O     1 
ATOM   4909  C  CB    . ILE A 1  630  ? 131.984 49.218  9.871   1.00 81.57  ? 630  ILE A CB    1 
ATOM   4910  C  CG1   . ILE A 1  630  ? 131.792 48.042  10.803  1.00 80.11  ? 630  ILE A CG1   1 
ATOM   4911  C  CG2   . ILE A 1  630  ? 131.412 48.890  8.478   1.00 80.89  ? 630  ILE A CG2   1 
ATOM   4912  C  CD1   . ILE A 1  630  ? 130.605 48.102  11.444  1.00 84.81  ? 630  ILE A CD1   1 
ATOM   4913  N  N     . HIS A 1  631  ? 133.772 51.562  8.331   1.00 82.49  ? 631  HIS A N     1 
ATOM   4914  C  CA    . HIS A 1  631  ? 134.259 52.302  7.150   1.00 83.50  ? 631  HIS A CA    1 
ATOM   4915  C  C     . HIS A 1  631  ? 135.776 52.085  6.895   1.00 85.73  ? 631  HIS A C     1 
ATOM   4916  O  O     . HIS A 1  631  ? 136.187 51.831  5.756   1.00 83.40  ? 631  HIS A O     1 
ATOM   4917  C  CB    . HIS A 1  631  ? 133.970 53.805  7.279   1.00 85.86  ? 631  HIS A CB    1 
ATOM   4918  C  CG    . HIS A 1  631  ? 134.040 54.555  5.975   1.00 90.04  ? 631  HIS A CG    1 
ATOM   4919  N  ND1   . HIS A 1  631  ? 133.370 55.756  5.800   1.00 92.43  ? 631  HIS A ND1   1 
ATOM   4920  C  CD2   . HIS A 1  631  ? 134.651 54.229  4.806   1.00 92.18  ? 631  HIS A CD2   1 
ATOM   4921  C  CE1   . HIS A 1  631  ? 133.613 56.130  4.552   1.00 91.99  ? 631  HIS A CE1   1 
ATOM   4922  N  NE2   . HIS A 1  631  ? 134.374 55.240  3.910   1.00 92.07  ? 631  HIS A NE2   1 
ATOM   4923  N  N     . VAL A 1  632  ? 136.581 52.171  7.980   1.00 82.31  ? 632  VAL A N     1 
ATOM   4924  C  CA    . VAL A 1  632  ? 138.031 51.956  8.018   1.00 81.27  ? 632  VAL A CA    1 
ATOM   4925  C  C     . VAL A 1  632  ? 138.378 50.490  7.745   1.00 85.37  ? 632  VAL A C     1 
ATOM   4926  O  O     . VAL A 1  632  ? 139.292 50.238  6.956   1.00 84.68  ? 632  VAL A O     1 
ATOM   4927  C  CB    . VAL A 1  632  ? 138.598 52.384  9.372   1.00 84.06  ? 632  VAL A CB    1 
ATOM   4928  C  CG1   . VAL A 1  632  ? 140.103 52.186  9.424   1.00 83.86  ? 632  VAL A CG1   1 
ATOM   4929  C  CG2   . VAL A 1  632  ? 138.233 53.818  9.667   1.00 84.26  ? 632  VAL A CG2   1 
ATOM   4930  N  N     . VAL A 1  633  ? 137.682 49.532  8.413   1.00 81.80  ? 633  VAL A N     1 
ATOM   4931  C  CA    . VAL A 1  633  ? 137.969 48.114  8.201   1.00 82.12  ? 633  VAL A CA    1 
ATOM   4932  C  C     . VAL A 1  633  ? 137.815 47.752  6.711   1.00 88.32  ? 633  VAL A C     1 
ATOM   4933  O  O     . VAL A 1  633  ? 138.767 47.215  6.138   1.00 89.60  ? 633  VAL A O     1 
ATOM   4934  C  CB    . VAL A 1  633  ? 137.321 47.100  9.209   1.00 85.62  ? 633  VAL A CB    1 
ATOM   4935  C  CG1   . VAL A 1  633  ? 137.808 45.667  8.963   1.00 84.77  ? 633  VAL A CG1   1 
ATOM   4936  C  CG2   . VAL A 1  633  ? 137.620 47.489  10.653  1.00 86.29  ? 633  VAL A CG2   1 
ATOM   4937  N  N     . THR A 1  634  ? 136.687 48.147  6.062   1.00 83.88  ? 634  THR A N     1 
ATOM   4938  C  CA    . THR A 1  634  ? 136.460 47.873  4.633   1.00 82.41  ? 634  THR A CA    1 
ATOM   4939  C  C     . THR A 1  634  ? 137.542 48.533  3.812   1.00 88.44  ? 634  THR A C     1 
ATOM   4940  O  O     . THR A 1  634  ? 138.256 47.841  3.082   1.00 88.01  ? 634  THR A O     1 
ATOM   4941  C  CB    . THR A 1  634  ? 135.091 48.358  4.157   1.00 83.77  ? 634  THR A CB    1 
ATOM   4942  O  OG1   . THR A 1  634  ? 134.181 48.452  5.241   1.00 83.97  ? 634  THR A OG1   1 
ATOM   4943  C  CG2   . THR A 1  634  ? 134.516 47.475  3.082   1.00 82.98  ? 634  THR A CG2   1 
ATOM   4944  N  N     . ARG A 1  635  ? 137.692 49.869  3.979   1.00 87.14  ? 635  ARG A N     1 
ATOM   4945  C  CA    . ARG A 1  635  ? 138.680 50.680  3.275   1.00 88.28  ? 635  ARG A CA    1 
ATOM   4946  C  C     . ARG A 1  635  ? 140.097 50.158  3.466   1.00 94.40  ? 635  ARG A C     1 
ATOM   4947  O  O     . ARG A 1  635  ? 140.872 50.186  2.512   1.00 95.31  ? 635  ARG A O     1 
ATOM   4948  C  CB    . ARG A 1  635  ? 138.620 52.163  3.709   1.00 89.27  ? 635  ARG A CB    1 
ATOM   4949  C  CG    . ARG A 1  635  ? 137.608 53.045  2.972   1.00 98.57  ? 635  ARG A CG    1 
ATOM   4950  C  CD    . ARG A 1  635  ? 137.983 53.417  1.540   1.00 104.57 ? 635  ARG A CD    1 
ATOM   4951  N  NE    . ARG A 1  635  ? 136.849 53.169  0.652   1.00 111.01 ? 635  ARG A NE    1 
ATOM   4952  C  CZ    . ARG A 1  635  ? 136.627 52.016  0.027   1.00 121.25 ? 635  ARG A CZ    1 
ATOM   4953  N  NH1   . ARG A 1  635  ? 137.495 51.012  0.140   1.00 102.84 ? 635  ARG A NH1   1 
ATOM   4954  N  NH2   . ARG A 1  635  ? 135.539 51.857  -0.721  1.00 102.79 ? 635  ARG A NH2   1 
ATOM   4955  N  N     . GLU A 1  636  ? 140.451 49.706  4.681   1.00 90.43  ? 636  GLU A N     1 
ATOM   4956  C  CA    . GLU A 1  636  ? 141.816 49.269  4.904   1.00 90.62  ? 636  GLU A CA    1 
ATOM   4957  C  C     . GLU A 1  636  ? 142.091 47.809  4.607   1.00 95.01  ? 636  GLU A C     1 
ATOM   4958  O  O     . GLU A 1  636  ? 142.988 47.538  3.814   1.00 95.17  ? 636  GLU A O     1 
ATOM   4959  C  CB    . GLU A 1  636  ? 142.349 49.716  6.272   1.00 92.66  ? 636  GLU A CB    1 
ATOM   4960  C  CG    . GLU A 1  636  ? 143.854 49.932  6.300   1.00 106.26 ? 636  GLU A CG    1 
ATOM   4961  C  CD    . GLU A 1  636  ? 144.366 51.233  5.706   1.00 145.63 ? 636  GLU A CD    1 
ATOM   4962  O  OE1   . GLU A 1  636  ? 143.769 52.295  5.999   1.00 145.43 ? 636  GLU A OE1   1 
ATOM   4963  O  OE2   . GLU A 1  636  ? 145.393 51.196  4.985   1.00 155.05 ? 636  GLU A OE2   1 
ATOM   4964  N  N     . LYS A 1  637  ? 141.330 46.872  5.221   1.00 91.12  ? 637  LYS A N     1 
ATOM   4965  C  CA    . LYS A 1  637  ? 141.544 45.415  5.108   1.00 89.87  ? 637  LYS A CA    1 
ATOM   4966  C  C     . LYS A 1  637  ? 140.833 44.638  3.980   1.00 93.58  ? 637  LYS A C     1 
ATOM   4967  O  O     . LYS A 1  637  ? 141.367 43.633  3.506   1.00 92.32  ? 637  LYS A O     1 
ATOM   4968  C  CB    . LYS A 1  637  ? 141.361 44.721  6.464   1.00 90.82  ? 637  LYS A CB    1 
ATOM   4969  C  CG    . LYS A 1  637  ? 142.257 45.252  7.574   1.00 97.03  ? 637  LYS A CG    1 
ATOM   4970  C  CD    . LYS A 1  637  ? 143.683 44.713  7.558   1.00 103.64 ? 637  LYS A CD    1 
ATOM   4971  C  CE    . LYS A 1  637  ? 144.361 44.937  8.893   1.00 112.63 ? 637  LYS A CE    1 
ATOM   4972  N  NZ    . LYS A 1  637  ? 145.841 44.866  8.780   1.00 123.77 ? 637  LYS A NZ    1 
ATOM   4973  N  N     . GLY A 1  638  ? 139.657 45.091  3.564   1.00 91.37  ? 638  GLY A N     1 
ATOM   4974  C  CA    . GLY A 1  638  ? 138.913 44.428  2.498   1.00 91.69  ? 638  GLY A CA    1 
ATOM   4975  C  C     . GLY A 1  638  ? 137.445 44.245  2.807   1.00 98.01  ? 638  GLY A C     1 
ATOM   4976  O  O     . GLY A 1  638  ? 137.047 44.447  3.956   1.00 98.92  ? 638  GLY A O     1 
ATOM   4977  N  N     . PRO A 1  639  ? 136.580 43.895  1.825   1.00 94.55  ? 639  PRO A N     1 
ATOM   4978  C  CA    . PRO A 1  639  ? 135.166 43.699  2.161   1.00 93.89  ? 639  PRO A CA    1 
ATOM   4979  C  C     . PRO A 1  639  ? 134.961 42.348  2.851   1.00 98.25  ? 639  PRO A C     1 
ATOM   4980  O  O     . PRO A 1  639  ? 134.049 42.205  3.672   1.00 97.82  ? 639  PRO A O     1 
ATOM   4981  C  CB    . PRO A 1  639  ? 134.468 43.790  0.807   1.00 94.73  ? 639  PRO A CB    1 
ATOM   4982  C  CG    . PRO A 1  639  ? 135.451 43.232  -0.133  1.00 99.79  ? 639  PRO A CG    1 
ATOM   4983  C  CD    . PRO A 1  639  ? 136.832 43.580  0.406   1.00 96.21  ? 639  PRO A CD    1 
ATOM   4984  N  N     . GLN A 1  640  ? 135.838 41.371  2.552   1.00 94.50  ? 640  GLN A N     1 
ATOM   4985  C  CA    . GLN A 1  640  ? 135.741 40.051  3.137   1.00 94.08  ? 640  GLN A CA    1 
ATOM   4986  C  C     . GLN A 1  640  ? 136.162 40.086  4.601   1.00 95.65  ? 640  GLN A C     1 
ATOM   4987  O  O     . GLN A 1  640  ? 135.482 39.504  5.448   1.00 94.72  ? 640  GLN A O     1 
ATOM   4988  C  CB    . GLN A 1  640  ? 136.552 39.052  2.315   1.00 96.25  ? 640  GLN A CB    1 
ATOM   4989  C  CG    . GLN A 1  640  ? 135.699 37.926  1.712   1.00 128.09 ? 640  GLN A CG    1 
ATOM   4990  C  CD    . GLN A 1  640  ? 135.567 36.698  2.606   1.00 160.18 ? 640  GLN A CD    1 
ATOM   4991  O  OE1   . GLN A 1  640  ? 136.547 36.199  3.189   1.00 156.87 ? 640  GLN A OE1   1 
ATOM   4992  N  NE2   . GLN A 1  640  ? 134.357 36.139  2.683   1.00 155.56 ? 640  GLN A NE2   1 
ATOM   4993  N  N     . VAL A 1  641  ? 137.236 40.833  4.901   1.00 91.08  ? 641  VAL A N     1 
ATOM   4994  C  CA    . VAL A 1  641  ? 137.777 40.990  6.253   1.00 90.76  ? 641  VAL A CA    1 
ATOM   4995  C  C     . VAL A 1  641  ? 136.809 41.776  7.129   1.00 92.78  ? 641  VAL A C     1 
ATOM   4996  O  O     . VAL A 1  641  ? 136.626 41.453  8.303   1.00 92.60  ? 641  VAL A O     1 
ATOM   4997  C  CB    . VAL A 1  641  ? 139.164 41.663  6.205   1.00 95.88  ? 641  VAL A CB    1 
ATOM   4998  C  CG1   . VAL A 1  641  ? 139.831 41.668  7.579   1.00 96.69  ? 641  VAL A CG1   1 
ATOM   4999  C  CG2   . VAL A 1  641  ? 140.061 40.996  5.164   1.00 95.84  ? 641  VAL A CG2   1 
ATOM   5000  N  N     . CYS A 1  642  ? 136.181 42.799  6.545   1.00 88.25  ? 642  CYS A N     1 
ATOM   5001  C  CA    . CYS A 1  642  ? 135.218 43.640  7.240   1.00 87.50  ? 642  CYS A CA    1 
ATOM   5002  C  C     . CYS A 1  642  ? 133.967 42.868  7.581   1.00 90.59  ? 642  CYS A C     1 
ATOM   5003  O  O     . CYS A 1  642  ? 133.429 43.044  8.672   1.00 91.45  ? 642  CYS A O     1 
ATOM   5004  C  CB    . CYS A 1  642  ? 134.889 44.888  6.431   1.00 87.06  ? 642  CYS A CB    1 
ATOM   5005  S  SG    . CYS A 1  642  ? 133.779 46.035  7.282   1.00 90.91  ? 642  CYS A SG    1 
ATOM   5006  N  N     . ALA A 1  643  ? 133.496 42.030  6.643   1.00 84.36  ? 643  ALA A N     1 
ATOM   5007  C  CA    . ALA A 1  643  ? 132.287 41.251  6.818   1.00 83.10  ? 643  ALA A CA    1 
ATOM   5008  C  C     . ALA A 1  643  ? 132.504 40.176  7.871   1.00 88.42  ? 643  ALA A C     1 
ATOM   5009  O  O     . ALA A 1  643  ? 131.571 39.842  8.625   1.00 89.08  ? 643  ALA A O     1 
ATOM   5010  C  CB    . ALA A 1  643  ? 131.877 40.642  5.497   1.00 83.01  ? 643  ALA A CB    1 
ATOM   5011  N  N     . LYS A 1  644  ? 133.748 39.660  7.951   1.00 84.84  ? 644  LYS A N     1 
ATOM   5012  C  CA    . LYS A 1  644  ? 134.100 38.662  8.950   1.00 84.94  ? 644  LYS A CA    1 
ATOM   5013  C  C     . LYS A 1  644  ? 134.081 39.333  10.344  1.00 89.90  ? 644  LYS A C     1 
ATOM   5014  O  O     . LYS A 1  644  ? 133.493 38.778  11.273  1.00 90.44  ? 644  LYS A O     1 
ATOM   5015  C  CB    . LYS A 1  644  ? 135.432 37.967  8.602   1.00 87.27  ? 644  LYS A CB    1 
ATOM   5016  C  CG    . LYS A 1  644  ? 135.807 36.783  9.504   1.00 109.10 ? 644  LYS A CG    1 
ATOM   5017  C  CD    . LYS A 1  644  ? 134.774 35.627  9.527   1.00 123.91 ? 644  LYS A CD    1 
ATOM   5018  C  CE    . LYS A 1  644  ? 134.889 34.757  10.769  1.00 133.21 ? 644  LYS A CE    1 
ATOM   5019  N  NZ    . LYS A 1  644  ? 133.781 33.769  10.891  1.00 140.31 ? 644  LYS A NZ    1 
ATOM   5020  N  N     . LEU A 1  645  ? 134.607 40.577  10.441  1.00 85.85  ? 645  LEU A N     1 
ATOM   5021  C  CA    . LEU A 1  645  ? 134.626 41.409  11.655  1.00 85.62  ? 645  LEU A CA    1 
ATOM   5022  C  C     . LEU A 1  645  ? 133.231 41.613  12.272  1.00 87.73  ? 645  LEU A C     1 
ATOM   5023  O  O     . LEU A 1  645  ? 133.102 41.654  13.498  1.00 87.71  ? 645  LEU A O     1 
ATOM   5024  C  CB    . LEU A 1  645  ? 135.256 42.773  11.339  1.00 85.75  ? 645  LEU A CB    1 
ATOM   5025  C  CG    . LEU A 1  645  ? 135.144 43.844  12.415  1.00 90.20  ? 645  LEU A CG    1 
ATOM   5026  C  CD1   . LEU A 1  645  ? 136.248 43.705  13.450  1.00 90.40  ? 645  LEU A CD1   1 
ATOM   5027  C  CD2   . LEU A 1  645  ? 135.097 45.222  11.798  1.00 92.93  ? 645  LEU A CD2   1 
ATOM   5028  N  N     . PHE A 1  646  ? 132.204 41.776  11.420  1.00 82.85  ? 646  PHE A N     1 
ATOM   5029  C  CA    . PHE A 1  646  ? 130.817 41.929  11.842  1.00 82.03  ? 646  PHE A CA    1 
ATOM   5030  C  C     . PHE A 1  646  ? 130.488 40.754  12.706  1.00 87.06  ? 646  PHE A C     1 
ATOM   5031  O  O     . PHE A 1  646  ? 130.268 40.929  13.904  1.00 86.79  ? 646  PHE A O     1 
ATOM   5032  C  CB    . PHE A 1  646  ? 129.877 41.938  10.634  1.00 82.55  ? 646  PHE A CB    1 
ATOM   5033  C  CG    . PHE A 1  646  ? 129.611 43.314  10.102  1.00 83.52  ? 646  PHE A CG    1 
ATOM   5034  C  CD1   . PHE A 1  646  ? 128.603 44.101  10.645  1.00 86.86  ? 646  PHE A CD1   1 
ATOM   5035  C  CD2   . PHE A 1  646  ? 130.372 43.831  9.062   1.00 85.10  ? 646  PHE A CD2   1 
ATOM   5036  C  CE1   . PHE A 1  646  ? 128.365 45.389  10.169  1.00 88.07  ? 646  PHE A CE1   1 
ATOM   5037  C  CE2   . PHE A 1  646  ? 130.134 45.114  8.577   1.00 88.63  ? 646  PHE A CE2   1 
ATOM   5038  C  CZ    . PHE A 1  646  ? 129.123 45.884  9.126   1.00 87.36  ? 646  PHE A CZ    1 
ATOM   5039  N  N     . GLY A 1  647  ? 130.587 39.566  12.101  1.00 84.48  ? 647  GLY A N     1 
ATOM   5040  C  CA    . GLY A 1  647  ? 130.348 38.271  12.732  1.00 84.46  ? 647  GLY A CA    1 
ATOM   5041  C  C     . GLY A 1  647  ? 131.056 38.099  14.054  1.00 87.52  ? 647  GLY A C     1 
ATOM   5042  O  O     . GLY A 1  647  ? 130.419 37.734  15.042  1.00 88.44  ? 647  GLY A O     1 
ATOM   5043  N  N     . ASN A 1  648  ? 132.362 38.428  14.088  1.00 81.98  ? 648  ASN A N     1 
ATOM   5044  C  CA    . ASN A 1  648  ? 133.199 38.340  15.278  1.00 81.45  ? 648  ASN A CA    1 
ATOM   5045  C  C     . ASN A 1  648  ? 132.743 39.258  16.407  1.00 82.44  ? 648  ASN A C     1 
ATOM   5046  O  O     . ASN A 1  648  ? 132.405 38.759  17.483  1.00 80.65  ? 648  ASN A O     1 
ATOM   5047  C  CB    . ASN A 1  648  ? 134.669 38.477  14.911  1.00 82.90  ? 648  ASN A CB    1 
ATOM   5048  C  CG    . ASN A 1  648  ? 135.141 37.258  14.163  1.00 113.99 ? 648  ASN A CG    1 
ATOM   5049  O  OD1   . ASN A 1  648  ? 134.340 36.419  13.709  1.00 109.49 ? 648  ASN A OD1   1 
ATOM   5050  N  ND2   . ASN A 1  648  ? 136.446 37.121  14.027  1.00 109.35 ? 648  ASN A ND2   1 
ATOM   5051  N  N     . ILE A 1  649  ? 132.616 40.567  16.137  1.00 78.78  ? 649  ILE A N     1 
ATOM   5052  C  CA    . ILE A 1  649  ? 132.106 41.515  17.129  1.00 79.31  ? 649  ILE A CA    1 
ATOM   5053  C  C     . ILE A 1  649  ? 130.767 40.971  17.733  1.00 86.25  ? 649  ILE A C     1 
ATOM   5054  O  O     . ILE A 1  649  ? 130.630 40.896  18.963  1.00 87.13  ? 649  ILE A O     1 
ATOM   5055  C  CB    . ILE A 1  649  ? 131.976 42.946  16.539  1.00 81.16  ? 649  ILE A CB    1 
ATOM   5056  C  CG1   . ILE A 1  649  ? 133.349 43.533  16.210  1.00 80.56  ? 649  ILE A CG1   1 
ATOM   5057  C  CG2   . ILE A 1  649  ? 131.185 43.879  17.475  1.00 82.00  ? 649  ILE A CG2   1 
ATOM   5058  C  CD1   . ILE A 1  649  ? 133.257 44.795  15.423  1.00 80.90  ? 649  ILE A CD1   1 
ATOM   5059  N  N     . GLN A 1  650  ? 129.832 40.516  16.863  1.00 82.22  ? 650  GLN A N     1 
ATOM   5060  C  CA    . GLN A 1  650  ? 128.561 39.965  17.332  1.00 81.04  ? 650  GLN A CA    1 
ATOM   5061  C  C     . GLN A 1  650  ? 128.647 38.628  18.074  1.00 85.48  ? 650  GLN A C     1 
ATOM   5062  O  O     . GLN A 1  650  ? 127.982 38.485  19.089  1.00 86.57  ? 650  GLN A O     1 
ATOM   5063  C  CB    . GLN A 1  650  ? 127.394 40.099  16.333  1.00 80.60  ? 650  GLN A CB    1 
ATOM   5064  C  CG    . GLN A 1  650  ? 127.658 39.635  14.912  1.00 88.34  ? 650  GLN A CG    1 
ATOM   5065  C  CD    . GLN A 1  650  ? 126.633 40.172  13.938  1.00 102.65 ? 650  GLN A CD    1 
ATOM   5066  O  OE1   . GLN A 1  650  ? 125.666 39.483  13.565  1.00 93.45  ? 650  GLN A OE1   1 
ATOM   5067  N  NE2   . GLN A 1  650  ? 126.816 41.421  13.511  1.00 95.61  ? 650  GLN A NE2   1 
ATOM   5068  N  N     . LYS A 1  651  ? 129.535 37.720  17.676  1.00 81.36  ? 651  LYS A N     1 
ATOM   5069  C  CA    . LYS A 1  651  ? 129.683 36.450  18.400  1.00 82.42  ? 651  LYS A CA    1 
ATOM   5070  C  C     . LYS A 1  651  ? 130.148 36.638  19.905  1.00 88.99  ? 651  LYS A C     1 
ATOM   5071  O  O     . LYS A 1  651  ? 129.654 35.946  20.824  1.00 88.35  ? 651  LYS A O     1 
ATOM   5072  C  CB    . LYS A 1  651  ? 130.604 35.469  17.624  1.00 83.58  ? 651  LYS A CB    1 
ATOM   5073  C  CG    . LYS A 1  651  ? 129.850 34.542  16.671  1.00 85.36  ? 651  LYS A CG    1 
ATOM   5074  C  CD    . LYS A 1  651  ? 130.762 33.739  15.714  1.00 91.86  ? 651  LYS A CD    1 
ATOM   5075  C  CE    . LYS A 1  651  ? 130.839 34.286  14.291  1.00 100.38 ? 651  LYS A CE    1 
ATOM   5076  N  NZ    . LYS A 1  651  ? 129.517 34.269  13.594  1.00 106.85 ? 651  LYS A NZ    1 
ATOM   5077  N  N     . VAL A 1  652  ? 131.064 37.609  20.124  1.00 85.55  ? 652  VAL A N     1 
ATOM   5078  C  CA    . VAL A 1  652  ? 131.668 37.908  21.424  1.00 85.81  ? 652  VAL A CA    1 
ATOM   5079  C  C     . VAL A 1  652  ? 130.747 38.735  22.262  1.00 92.59  ? 652  VAL A C     1 
ATOM   5080  O  O     . VAL A 1  652  ? 130.558 38.439  23.451  1.00 93.53  ? 652  VAL A O     1 
ATOM   5081  C  CB    . VAL A 1  652  ? 133.044 38.597  21.263  1.00 88.40  ? 652  VAL A CB    1 
ATOM   5082  C  CG1   . VAL A 1  652  ? 133.535 39.181  22.578  1.00 88.88  ? 652  VAL A CG1   1 
ATOM   5083  C  CG2   . VAL A 1  652  ? 134.064 37.632  20.702  1.00 87.72  ? 652  VAL A CG2   1 
ATOM   5084  N  N     . VAL A 1  653  ? 130.225 39.817  21.660  1.00 89.21  ? 653  VAL A N     1 
ATOM   5085  C  CA    . VAL A 1  653  ? 129.355 40.745  22.362  1.00 89.26  ? 653  VAL A CA    1 
ATOM   5086  C  C     . VAL A 1  653  ? 128.072 40.040  22.770  1.00 90.65  ? 653  VAL A C     1 
ATOM   5087  O  O     . VAL A 1  653  ? 127.691 40.102  23.954  1.00 90.05  ? 653  VAL A O     1 
ATOM   5088  C  CB    . VAL A 1  653  ? 129.161 42.082  21.605  1.00 93.24  ? 653  VAL A CB    1 
ATOM   5089  C  CG1   . VAL A 1  653  ? 128.066 42.932  22.243  1.00 93.61  ? 653  VAL A CG1   1 
ATOM   5090  C  CG2   . VAL A 1  653  ? 130.473 42.865  21.555  1.00 93.42  ? 653  VAL A CG2   1 
ATOM   5091  N  N     . ASN A 1  654  ? 127.486 39.270  21.824  1.00 84.82  ? 654  ASN A N     1 
ATOM   5092  C  CA    . ASN A 1  654  ? 126.271 38.510  22.093  1.00 83.88  ? 654  ASN A CA    1 
ATOM   5093  C  C     . ASN A 1  654  ? 126.426 37.491  23.204  1.00 88.80  ? 654  ASN A C     1 
ATOM   5094  O  O     . ASN A 1  654  ? 125.511 37.329  24.031  1.00 87.16  ? 654  ASN A O     1 
ATOM   5095  C  CB    . ASN A 1  654  ? 125.783 37.840  20.854  1.00 78.81  ? 654  ASN A CB    1 
ATOM   5096  C  CG    . ASN A 1  654  ? 124.999 38.748  19.996  1.00 93.44  ? 654  ASN A CG    1 
ATOM   5097  O  OD1   . ASN A 1  654  ? 124.121 39.473  20.467  1.00 85.70  ? 654  ASN A OD1   1 
ATOM   5098  N  ND2   . ASN A 1  654  ? 125.263 38.674  18.709  1.00 90.20  ? 654  ASN A ND2   1 
ATOM   5099  N  N     . PHE A 1  655  ? 127.590 36.803  23.209  1.00 87.08  ? 655  PHE A N     1 
ATOM   5100  C  CA    . PHE A 1  655  ? 127.913 35.806  24.215  1.00 88.36  ? 655  PHE A CA    1 
ATOM   5101  C  C     . PHE A 1  655  ? 128.029 36.465  25.573  1.00 92.00  ? 655  PHE A C     1 
ATOM   5102  O  O     . PHE A 1  655  ? 127.510 35.933  26.554  1.00 92.43  ? 655  PHE A O     1 
ATOM   5103  C  CB    . PHE A 1  655  ? 129.211 35.057  23.864  1.00 90.89  ? 655  PHE A CB    1 
ATOM   5104  C  CG    . PHE A 1  655  ? 129.716 34.198  24.995  1.00 93.69  ? 655  PHE A CG    1 
ATOM   5105  C  CD1   . PHE A 1  655  ? 129.205 32.927  25.202  1.00 97.35  ? 655  PHE A CD1   1 
ATOM   5106  C  CD2   . PHE A 1  655  ? 130.669 34.681  25.885  1.00 97.27  ? 655  PHE A CD2   1 
ATOM   5107  C  CE1   . PHE A 1  655  ? 129.642 32.149  26.279  1.00 100.02 ? 655  PHE A CE1   1 
ATOM   5108  C  CE2   . PHE A 1  655  ? 131.101 33.907  26.965  1.00 101.60 ? 655  PHE A CE2   1 
ATOM   5109  C  CZ    . PHE A 1  655  ? 130.579 32.649  27.161  1.00 100.08 ? 655  PHE A CZ    1 
ATOM   5110  N  N     . TRP A 1  656  ? 128.727 37.607  25.631  1.00 87.76  ? 656  TRP A N     1 
ATOM   5111  C  CA    . TRP A 1  656  ? 128.924 38.329  26.875  1.00 88.26  ? 656  TRP A CA    1 
ATOM   5112  C  C     . TRP A 1  656  ? 127.616 38.809  27.445  1.00 89.98  ? 656  TRP A C     1 
ATOM   5113  O  O     . TRP A 1  656  ? 127.383 38.627  28.641  1.00 89.58  ? 656  TRP A O     1 
ATOM   5114  C  CB    . TRP A 1  656  ? 129.885 39.478  26.677  1.00 87.61  ? 656  TRP A CB    1 
ATOM   5115  C  CG    . TRP A 1  656  ? 130.105 40.242  27.933  1.00 90.03  ? 656  TRP A CG    1 
ATOM   5116  C  CD1   . TRP A 1  656  ? 130.995 39.956  28.920  1.00 94.18  ? 656  TRP A CD1   1 
ATOM   5117  C  CD2   . TRP A 1  656  ? 129.376 41.380  28.367  1.00 90.43  ? 656  TRP A CD2   1 
ATOM   5118  N  NE1   . TRP A 1  656  ? 130.905 40.886  29.921  1.00 94.89  ? 656  TRP A NE1   1 
ATOM   5119  C  CE2   . TRP A 1  656  ? 129.919 41.777  29.606  1.00 95.97  ? 656  TRP A CE2   1 
ATOM   5120  C  CE3   . TRP A 1  656  ? 128.325 42.125  27.818  1.00 91.65  ? 656  TRP A CE3   1 
ATOM   5121  C  CZ2   . TRP A 1  656  ? 129.446 42.884  30.307  1.00 96.45  ? 656  TRP A CZ2   1 
ATOM   5122  C  CZ3   . TRP A 1  656  ? 127.860 43.229  28.507  1.00 94.40  ? 656  TRP A CZ3   1 
ATOM   5123  C  CH2   . TRP A 1  656  ? 128.416 43.598  29.739  1.00 96.45  ? 656  TRP A CH2   1 
ATOM   5124  N  N     . LEU A 1  657  ? 126.765 39.405  26.582  1.00 85.13  ? 657  LEU A N     1 
ATOM   5125  C  CA    . LEU A 1  657  ? 125.441 39.886  26.950  1.00 84.87  ? 657  LEU A CA    1 
ATOM   5126  C  C     . LEU A 1  657  ? 124.512 38.720  27.325  1.00 90.65  ? 657  LEU A C     1 
ATOM   5127  O  O     . LEU A 1  657  ? 123.721 38.881  28.245  1.00 90.42  ? 657  LEU A O     1 
ATOM   5128  C  CB    . LEU A 1  657  ? 124.826 40.778  25.848  1.00 83.62  ? 657  LEU A CB    1 
ATOM   5129  C  CG    . LEU A 1  657  ? 123.468 41.460  26.172  1.00 87.65  ? 657  LEU A CG    1 
ATOM   5130  C  CD1   . LEU A 1  657  ? 123.610 42.561  27.201  1.00 88.79  ? 657  LEU A CD1   1 
ATOM   5131  C  CD2   . LEU A 1  657  ? 122.832 42.026  24.951  1.00 87.87  ? 657  LEU A CD2   1 
ATOM   5132  N  N     . LEU A 1  658  ? 124.628 37.538  26.668  1.00 88.91  ? 658  LEU A N     1 
ATOM   5133  C  CA    . LEU A 1  658  ? 123.791 36.373  27.028  1.00 89.64  ? 658  LEU A CA    1 
ATOM   5134  C  C     . LEU A 1  658  ? 123.888 36.120  28.496  1.00 95.52  ? 658  LEU A C     1 
ATOM   5135  O  O     . LEU A 1  658  ? 122.860 35.975  29.150  1.00 95.13  ? 658  LEU A O     1 
ATOM   5136  C  CB    . LEU A 1  658  ? 124.183 35.074  26.283  1.00 89.19  ? 658  LEU A CB    1 
ATOM   5137  C  CG    . LEU A 1  658  ? 123.560 33.759  26.830  1.00 93.66  ? 658  LEU A CG    1 
ATOM   5138  C  CD1   . LEU A 1  658  ? 122.144 33.588  26.368  1.00 92.85  ? 658  LEU A CD1   1 
ATOM   5139  C  CD2   . LEU A 1  658  ? 124.323 32.559  26.367  1.00 96.86  ? 658  LEU A CD2   1 
ATOM   5140  N  N     . HIS A 1  659  ? 125.134 36.103  29.000  1.00 94.40  ? 659  HIS A N     1 
ATOM   5141  C  CA    . HIS A 1  659  ? 125.484 35.863  30.390  1.00 96.29  ? 659  HIS A CA    1 
ATOM   5142  C  C     . HIS A 1  659  ? 125.372 37.053  31.323  1.00 98.81  ? 659  HIS A C     1 
ATOM   5143  O  O     . HIS A 1  659  ? 125.183 36.832  32.512  1.00 99.48  ? 659  HIS A O     1 
ATOM   5144  C  CB    . HIS A 1  659  ? 126.823 35.138  30.504  1.00 98.40  ? 659  HIS A CB    1 
ATOM   5145  C  CG    . HIS A 1  659  ? 126.807 33.833  29.779  1.00 101.87 ? 659  HIS A CG    1 
ATOM   5146  N  ND1   . HIS A 1  659  ? 126.134 32.741  30.285  1.00 104.22 ? 659  HIS A ND1   1 
ATOM   5147  C  CD2   . HIS A 1  659  ? 127.318 33.511  28.569  1.00 103.20 ? 659  HIS A CD2   1 
ATOM   5148  C  CE1   . HIS A 1  659  ? 126.276 31.783  29.382  1.00 103.06 ? 659  HIS A CE1   1 
ATOM   5149  N  NE2   . HIS A 1  659  ? 127.002 32.192  28.345  1.00 102.72 ? 659  HIS A NE2   1 
ATOM   5150  N  N     . ASN A 1  660  ? 125.424 38.293  30.803  1.00 93.99  ? 660  ASN A N     1 
ATOM   5151  C  CA    . ASN A 1  660  ? 125.268 39.518  31.609  1.00 94.27  ? 660  ASN A CA    1 
ATOM   5152  C  C     . ASN A 1  660  ? 123.782 39.881  31.847  1.00 97.46  ? 660  ASN A C     1 
ATOM   5153  O  O     . ASN A 1  660  ? 123.381 40.288  32.951  1.00 96.18  ? 660  ASN A O     1 
ATOM   5154  C  CB    . ASN A 1  660  ? 125.969 40.698  30.935  1.00 92.85  ? 660  ASN A CB    1 
ATOM   5155  C  CG    . ASN A 1  660  ? 126.248 41.804  31.909  1.00 110.93 ? 660  ASN A CG    1 
ATOM   5156  O  OD1   . ASN A 1  660  ? 127.209 41.735  32.687  1.00 109.42 ? 660  ASN A OD1   1 
ATOM   5157  N  ND2   . ASN A 1  660  ? 125.371 42.804  31.947  1.00 96.26  ? 660  ASN A ND2   1 
ATOM   5158  N  N     . GLY A 1  661  ? 123.004 39.748  30.773  1.00 94.12  ? 661  GLY A N     1 
ATOM   5159  C  CA    . GLY A 1  661  ? 121.584 40.066  30.701  1.00 93.32  ? 661  GLY A CA    1 
ATOM   5160  C  C     . GLY A 1  661  ? 121.378 41.548  30.477  1.00 95.24  ? 661  GLY A C     1 
ATOM   5161  O  O     . GLY A 1  661  ? 122.302 42.344  30.670  1.00 95.93  ? 661  GLY A O     1 
ATOM   5162  N  N     . PHE A 1  662  ? 120.176 41.919  30.055  1.00 89.36  ? 662  PHE A N     1 
ATOM   5163  C  CA    . PHE A 1  662  ? 119.747 43.302  29.881  1.00 89.41  ? 662  PHE A CA    1 
ATOM   5164  C  C     . PHE A 1  662  ? 118.228 43.286  29.838  1.00 94.19  ? 662  PHE A C     1 
ATOM   5165  O  O     . PHE A 1  662  ? 117.655 42.417  29.180  1.00 92.64  ? 662  PHE A O     1 
ATOM   5166  C  CB    . PHE A 1  662  ? 120.366 43.977  28.634  1.00 90.58  ? 662  PHE A CB    1 
ATOM   5167  C  CG    . PHE A 1  662  ? 120.010 45.444  28.525  1.00 92.56  ? 662  PHE A CG    1 
ATOM   5168  C  CD1   . PHE A 1  662  ? 120.735 46.405  29.215  1.00 97.27  ? 662  PHE A CD1   1 
ATOM   5169  C  CD2   . PHE A 1  662  ? 118.912 45.857  27.777  1.00 94.11  ? 662  PHE A CD2   1 
ATOM   5170  C  CE1   . PHE A 1  662  ? 120.365 47.757  29.163  1.00 98.68  ? 662  PHE A CE1   1 
ATOM   5171  C  CE2   . PHE A 1  662  ? 118.539 47.205  27.734  1.00 97.52  ? 662  PHE A CE2   1 
ATOM   5172  C  CZ    . PHE A 1  662  ? 119.268 48.148  28.424  1.00 96.60  ? 662  PHE A CZ    1 
ATOM   5173  N  N     . SER A 1  663  ? 117.570 44.202  30.572  1.00 92.94  ? 663  SER A N     1 
ATOM   5174  C  CA    . SER A 1  663  ? 116.100 44.254  30.611  1.00 93.21  ? 663  SER A CA    1 
ATOM   5175  C  C     . SER A 1  663  ? 115.619 45.687  30.672  1.00 99.20  ? 663  SER A C     1 
ATOM   5176  O  O     . SER A 1  663  ? 116.448 46.574  30.825  1.00 99.94  ? 663  SER A O     1 
ATOM   5177  C  CB    . SER A 1  663  ? 115.576 43.474  31.814  1.00 96.61  ? 663  SER A CB    1 
ATOM   5178  O  OG    . SER A 1  663  ? 114.159 43.440  31.855  1.00 100.91 ? 663  SER A OG    1 
ATOM   5179  N  N     . THR A 1  664  ? 114.294 45.920  30.525  1.00 96.40  ? 664  THR A N     1 
ATOM   5180  C  CA    . THR A 1  664  ? 113.662 47.245  30.649  1.00 97.30  ? 664  THR A CA    1 
ATOM   5181  C  C     . THR A 1  664  ? 112.211 47.139  31.187  1.00 103.12 ? 664  THR A C     1 
ATOM   5182  O  O     . THR A 1  664  ? 111.446 46.319  30.683  1.00 103.46 ? 664  THR A O     1 
ATOM   5183  C  CB    . THR A 1  664  ? 113.922 48.140  29.424  1.00 103.01 ? 664  THR A CB    1 
ATOM   5184  O  OG1   . THR A 1  664  ? 113.884 49.495  29.841  1.00 108.50 ? 664  THR A OG1   1 
ATOM   5185  C  CG2   . THR A 1  664  ? 112.938 47.936  28.326  1.00 98.09  ? 664  THR A CG2   1 
ATOM   5186  N  N     . GLY A 1  665  ? 111.879 47.893  32.239  1.00 100.25 ? 665  GLY A N     1 
ATOM   5187  C  CA    . GLY A 1  665  ? 110.560 47.830  32.876  1.00 101.01 ? 665  GLY A CA    1 
ATOM   5188  C  C     . GLY A 1  665  ? 109.972 49.183  33.194  1.00 106.49 ? 665  GLY A C     1 
ATOM   5189  O  O     . GLY A 1  665  ? 110.567 50.182  32.778  1.00 107.43 ? 665  GLY A O     1 
ATOM   5190  N  N     . ILE A 1  666  ? 108.806 49.249  33.942  1.00 102.50 ? 666  ILE A N     1 
ATOM   5191  C  CA    . ILE A 1  666  ? 108.172 50.550  34.317  1.00 102.59 ? 666  ILE A CA    1 
ATOM   5192  C  C     . ILE A 1  666  ? 109.078 51.364  35.199  1.00 108.98 ? 666  ILE A C     1 
ATOM   5193  O  O     . ILE A 1  666  ? 109.049 52.596  35.120  1.00 109.64 ? 666  ILE A O     1 
ATOM   5194  C  CB    . ILE A 1  666  ? 106.747 50.565  34.929  1.00 105.41 ? 666  ILE A CB    1 
ATOM   5195  C  CG1   . ILE A 1  666  ? 106.242 49.201  35.335  1.00 107.14 ? 666  ILE A CG1   1 
ATOM   5196  C  CG2   . ILE A 1  666  ? 105.750 51.435  34.163  1.00 102.51 ? 666  ILE A CG2   1 
ATOM   5197  C  CD1   . ILE A 1  666  ? 106.834 48.765  36.660  1.00 124.41 ? 666  ILE A CD1   1 
ATOM   5198  N  N     . GLY A 1  667  ? 109.885 50.683  36.013  1.00 105.93 ? 667  GLY A N     1 
ATOM   5199  C  CA    . GLY A 1  667  ? 110.852 51.333  36.890  1.00 106.61 ? 667  GLY A CA    1 
ATOM   5200  C  C     . GLY A 1  667  ? 111.711 52.370  36.187  1.00 108.46 ? 667  GLY A C     1 
ATOM   5201  O  O     . GLY A 1  667  ? 112.052 53.409  36.770  1.00 109.20 ? 667  GLY A O     1 
ATOM   5202  N  N     . ASP A 1  668  ? 112.029 52.090  34.913  1.00 102.13 ? 668  ASP A N     1 
ATOM   5203  C  CA    . ASP A 1  668  ? 112.822 52.943  34.045  1.00 101.32 ? 668  ASP A CA    1 
ATOM   5204  C  C     . ASP A 1  668  ? 112.117 54.234  33.584  1.00 106.15 ? 668  ASP A C     1 
ATOM   5205  O  O     . ASP A 1  668  ? 112.804 55.146  33.113  1.00 105.23 ? 668  ASP A O     1 
ATOM   5206  C  CB    . ASP A 1  668  ? 113.414 52.135  32.882  1.00 101.49 ? 668  ASP A CB    1 
ATOM   5207  C  CG    . ASP A 1  668  ? 114.325 51.021  33.353  1.00 108.22 ? 668  ASP A CG    1 
ATOM   5208  O  OD1   . ASP A 1  668  ? 115.364 51.328  33.984  1.00 108.91 ? 668  ASP A OD1   1 
ATOM   5209  O  OD2   . ASP A 1  668  ? 113.989 49.843  33.118  1.00 110.78 ? 668  ASP A OD2   1 
ATOM   5210  N  N     . THR A 1  669  ? 110.766 54.330  33.740  1.00 104.07 ? 669  THR A N     1 
ATOM   5211  C  CA    . THR A 1  669  ? 109.981 55.536  33.385  1.00 104.68 ? 669  THR A CA    1 
ATOM   5212  C  C     . THR A 1  669  ? 109.750 56.430  34.618  1.00 111.44 ? 669  THR A C     1 
ATOM   5213  O  O     . THR A 1  669  ? 109.486 57.632  34.480  1.00 112.92 ? 669  THR A O     1 
ATOM   5214  C  CB    . THR A 1  669  ? 108.647 55.205  32.669  1.00 111.29 ? 669  THR A CB    1 
ATOM   5215  O  OG1   . THR A 1  669  ? 107.849 54.359  33.490  1.00 109.66 ? 669  THR A OG1   1 
ATOM   5216  C  CG2   . THR A 1  669  ? 108.843 54.575  31.292  1.00 110.03 ? 669  THR A CG2   1 
ATOM   5217  N  N     . ILE A 1  670  ? 109.859 55.837  35.821  1.00 107.24 ? 670  ILE A N     1 
ATOM   5218  C  CA    . ILE A 1  670  ? 109.675 56.528  37.086  1.00 107.47 ? 670  ILE A CA    1 
ATOM   5219  C  C     . ILE A 1  670  ? 110.787 57.523  37.307  1.00 110.75 ? 670  ILE A C     1 
ATOM   5220  O  O     . ILE A 1  670  ? 111.965 57.186  37.141  1.00 108.68 ? 670  ILE A O     1 
ATOM   5221  C  CB    . ILE A 1  670  ? 109.565 55.490  38.220  1.00 111.07 ? 670  ILE A CB    1 
ATOM   5222  C  CG1   . ILE A 1  670  ? 108.213 54.784  38.142  1.00 111.51 ? 670  ILE A CG1   1 
ATOM   5223  C  CG2   . ILE A 1  670  ? 109.765 56.111  39.598  1.00 113.20 ? 670  ILE A CG2   1 
ATOM   5224  C  CD1   . ILE A 1  670  ? 108.263 53.339  38.396  1.00 120.87 ? 670  ILE A CD1   1 
ATOM   5225  N  N     . ALA A 1  671  ? 110.394 58.757  37.656  1.00 109.10 ? 671  ALA A N     1 
ATOM   5226  C  CA    . ALA A 1  671  ? 111.296 59.856  37.990  1.00 109.89 ? 671  ALA A CA    1 
ATOM   5227  C  C     . ALA A 1  671  ? 111.076 60.260  39.447  1.00 117.25 ? 671  ALA A C     1 
ATOM   5228  O  O     . ALA A 1  671  ? 109.951 60.149  39.951  1.00 117.18 ? 671  ALA A O     1 
ATOM   5229  C  CB    . ALA A 1  671  ? 111.022 61.034  37.090  1.00 110.08 ? 671  ALA A CB    1 
ATOM   5230  N  N     . ASP A 1  672  ? 112.145 60.736  40.115  1.00 116.34 ? 672  ASP A N     1 
ATOM   5231  C  CA    . ASP A 1  672  ? 112.166 61.202  41.513  1.00 118.60 ? 672  ASP A CA    1 
ATOM   5232  C  C     . ASP A 1  672  ? 110.957 62.064  41.882  1.00 125.09 ? 672  ASP A C     1 
ATOM   5233  O  O     . ASP A 1  672  ? 110.529 62.875  41.052  1.00 125.69 ? 672  ASP A O     1 
ATOM   5234  C  CB    . ASP A 1  672  ? 113.395 62.101  41.716  1.00 121.21 ? 672  ASP A CB    1 
ATOM   5235  C  CG    . ASP A 1  672  ? 114.479 61.635  42.661  1.00 136.35 ? 672  ASP A CG    1 
ATOM   5236  O  OD1   . ASP A 1  672  ? 114.611 60.399  42.859  1.00 138.09 ? 672  ASP A OD1   1 
ATOM   5237  O  OD2   . ASP A 1  672  ? 115.263 62.498  43.133  1.00 142.66 ? 672  ASP A OD2   1 
ATOM   5238  N  N     . GLY A 1  673  ? 110.479 61.932  43.132  1.00 122.25 ? 673  GLY A N     1 
ATOM   5239  C  CA    . GLY A 1  673  ? 109.424 62.761  43.727  1.00 122.64 ? 673  GLY A CA    1 
ATOM   5240  C  C     . GLY A 1  673  ? 109.794 64.236  43.636  1.00 125.39 ? 673  GLY A C     1 
ATOM   5241  O  O     . GLY A 1  673  ? 109.047 65.009  43.025  1.00 123.48 ? 673  GLY A O     1 
ATOM   5242  N  N     . PRO A 1  674  ? 111.015 64.637  44.102  1.00 122.88 ? 674  PRO A N     1 
ATOM   5243  C  CA    . PRO A 1  674  ? 111.459 66.028  43.905  1.00 123.65 ? 674  PRO A CA    1 
ATOM   5244  C  C     . PRO A 1  674  ? 111.551 66.456  42.437  1.00 127.36 ? 674  PRO A C     1 
ATOM   5245  O  O     . PRO A 1  674  ? 111.233 67.606  42.129  1.00 127.43 ? 674  PRO A O     1 
ATOM   5246  C  CB    . PRO A 1  674  ? 112.834 66.063  44.584  1.00 126.08 ? 674  PRO A CB    1 
ATOM   5247  C  CG    . PRO A 1  674  ? 113.280 64.661  44.633  1.00 129.47 ? 674  PRO A CG    1 
ATOM   5248  C  CD    . PRO A 1  674  ? 112.038 63.869  44.843  1.00 124.78 ? 674  PRO A CD    1 
ATOM   5249  N  N     . THR A 1  675  ? 111.964 65.542  41.533  1.00 123.46 ? 675  THR A N     1 
ATOM   5250  C  CA    . THR A 1  675  ? 112.046 65.840  40.103  1.00 122.64 ? 675  THR A CA    1 
ATOM   5251  C  C     . THR A 1  675  ? 110.644 65.987  39.526  1.00 128.39 ? 675  THR A C     1 
ATOM   5252  O  O     . THR A 1  675  ? 110.435 66.788  38.618  1.00 127.86 ? 675  THR A O     1 
ATOM   5253  C  CB    . THR A 1  675  ? 112.949 64.855  39.376  1.00 130.07 ? 675  THR A CB    1 
ATOM   5254  O  OG1   . THR A 1  675  ? 114.180 64.792  40.092  1.00 133.99 ? 675  THR A OG1   1 
ATOM   5255  C  CG2   . THR A 1  675  ? 113.236 65.272  37.934  1.00 126.76 ? 675  THR A CG2   1 
ATOM   5256  N  N     . MET A 1  676  ? 109.672 65.283  40.114  1.00 126.78 ? 676  MET A N     1 
ATOM   5257  C  CA    . MET A 1  676  ? 108.274 65.385  39.719  1.00 127.01 ? 676  MET A CA    1 
ATOM   5258  C  C     . MET A 1  676  ? 107.665 66.698  40.207  1.00 131.87 ? 676  MET A C     1 
ATOM   5259  O  O     . MET A 1  676  ? 106.906 67.317  39.464  1.00 130.42 ? 676  MET A O     1 
ATOM   5260  C  CB    . MET A 1  676  ? 107.474 64.177  40.205  1.00 129.60 ? 676  MET A CB    1 
ATOM   5261  C  CG    . MET A 1  676  ? 107.647 62.974  39.331  1.00 132.11 ? 676  MET A CG    1 
ATOM   5262  S  SD    . MET A 1  676  ? 107.088 63.331  37.656  1.00 135.49 ? 676  MET A SD    1 
ATOM   5263  C  CE    . MET A 1  676  ? 106.616 61.570  37.058  1.00 131.15 ? 676  MET A CE    1 
ATOM   5264  N  N     . ARG A 1  677  ? 108.024 67.134  41.436  1.00 130.61 ? 677  ARG A N     1 
ATOM   5265  C  CA    . ARG A 1  677  ? 107.591 68.413  42.014  1.00 132.50 ? 677  ARG A CA    1 
ATOM   5266  C  C     . ARG A 1  677  ? 108.040 69.533  41.062  1.00 135.90 ? 677  ARG A C     1 
ATOM   5267  O  O     . ARG A 1  677  ? 107.211 70.324  40.598  1.00 134.98 ? 677  ARG A O     1 
ATOM   5268  C  CB    . ARG A 1  677  ? 108.251 68.623  43.395  1.00 136.38 ? 677  ARG A CB    1 
ATOM   5269  C  CG    . ARG A 1  677  ? 107.336 68.403  44.596  1.00 152.49 ? 677  ARG A CG    1 
ATOM   5270  C  CD    . ARG A 1  677  ? 108.128 68.267  45.895  1.00 165.80 ? 677  ARG A CD    1 
ATOM   5271  N  NE    . ARG A 1  677  ? 108.504 66.873  46.163  1.00 171.70 ? 677  ARG A NE    1 
ATOM   5272  C  CZ    . ARG A 1  677  ? 109.598 66.495  46.819  1.00 178.40 ? 677  ARG A CZ    1 
ATOM   5273  N  NH1   . ARG A 1  677  ? 110.458 67.402  47.271  1.00 161.52 ? 677  ARG A NH1   1 
ATOM   5274  N  NH2   . ARG A 1  677  ? 109.857 65.204  47.003  1.00 157.32 ? 677  ARG A NH2   1 
ATOM   5275  N  N     . GLU A 1  678  ? 109.359 69.526  40.735  1.00 132.19 ? 678  GLU A N     1 
ATOM   5276  C  CA    . GLU A 1  678  ? 110.092 70.426  39.843  1.00 131.64 ? 678  GLU A CA    1 
ATOM   5277  C  C     . GLU A 1  678  ? 109.435 70.515  38.450  1.00 133.07 ? 678  GLU A C     1 
ATOM   5278  O  O     . GLU A 1  678  ? 109.270 71.617  37.927  1.00 132.84 ? 678  GLU A O     1 
ATOM   5279  C  CB    . GLU A 1  678  ? 111.550 69.944  39.731  1.00 132.86 ? 678  GLU A CB    1 
ATOM   5280  C  CG    . GLU A 1  678  ? 112.599 71.045  39.763  1.00 147.74 ? 678  GLU A CG    1 
ATOM   5281  C  CD    . GLU A 1  678  ? 114.052 70.592  39.797  1.00 172.51 ? 678  GLU A CD    1 
ATOM   5282  O  OE1   . GLU A 1  678  ? 114.364 69.630  40.537  1.00 169.97 ? 678  GLU A OE1   1 
ATOM   5283  O  OE2   . GLU A 1  678  ? 114.888 71.232  39.115  1.00 162.11 ? 678  GLU A OE2   1 
ATOM   5284  N  N     . ILE A 1  679  ? 109.042 69.362  37.870  1.00 127.21 ? 679  ILE A N     1 
ATOM   5285  C  CA    . ILE A 1  679  ? 108.367 69.292  36.571  1.00 125.08 ? 679  ILE A CA    1 
ATOM   5286  C  C     . ILE A 1  679  ? 106.949 69.893  36.667  1.00 131.80 ? 679  ILE A C     1 
ATOM   5287  O  O     . ILE A 1  679  ? 106.570 70.710  35.826  1.00 130.70 ? 679  ILE A O     1 
ATOM   5288  C  CB    . ILE A 1  679  ? 108.399 67.840  36.027  1.00 125.58 ? 679  ILE A CB    1 
ATOM   5289  C  CG1   . ILE A 1  679  ? 109.789 67.531  35.457  1.00 124.79 ? 679  ILE A CG1   1 
ATOM   5290  C  CG2   . ILE A 1  679  ? 107.312 67.597  34.979  1.00 124.16 ? 679  ILE A CG2   1 
ATOM   5291  C  CD1   . ILE A 1  679  ? 110.214 66.079  35.488  1.00 129.94 ? 679  ILE A CD1   1 
ATOM   5292  N  N     . THR A 1  680  ? 106.189 69.502  37.712  1.00 131.35 ? 680  THR A N     1 
ATOM   5293  C  CA    . THR A 1  680  ? 104.824 69.967  37.976  1.00 132.54 ? 680  THR A CA    1 
ATOM   5294  C  C     . THR A 1  680  ? 104.779 71.486  38.091  1.00 138.63 ? 680  THR A C     1 
ATOM   5295  O  O     . THR A 1  680  ? 103.924 72.119  37.464  1.00 138.45 ? 680  THR A O     1 
ATOM   5296  C  CB    . THR A 1  680  ? 104.233 69.226  39.179  1.00 143.43 ? 680  THR A CB    1 
ATOM   5297  O  OG1   . THR A 1  680  ? 104.178 67.831  38.871  1.00 142.43 ? 680  THR A OG1   1 
ATOM   5298  C  CG2   . THR A 1  680  ? 102.846 69.716  39.547  1.00 144.49 ? 680  THR A CG2   1 
ATOM   5299  N  N     . GLU A 1  681  ? 105.725 72.069  38.853  1.00 136.56 ? 681  GLU A N     1 
ATOM   5300  C  CA    . GLU A 1  681  ? 105.815 73.523  38.991  1.00 137.49 ? 681  GLU A CA    1 
ATOM   5301  C  C     . GLU A 1  681  ? 106.326 74.217  37.704  1.00 137.34 ? 681  GLU A C     1 
ATOM   5302  O  O     . GLU A 1  681  ? 105.979 75.374  37.477  1.00 137.54 ? 681  GLU A O     1 
ATOM   5303  C  CB    . GLU A 1  681  ? 106.536 73.974  40.295  1.00 140.96 ? 681  GLU A CB    1 
ATOM   5304  C  CG    . GLU A 1  681  ? 107.993 73.545  40.459  1.00 156.09 ? 681  GLU A CG    1 
ATOM   5305  C  CD    . GLU A 1  681  ? 108.588 73.603  41.860  1.00 183.48 ? 681  GLU A CD    1 
ATOM   5306  O  OE1   . GLU A 1  681  ? 107.870 73.294  42.841  1.00 179.39 ? 681  GLU A OE1   1 
ATOM   5307  O  OE2   . GLU A 1  681  ? 109.802 73.895  41.967  1.00 177.98 ? 681  GLU A OE2   1 
ATOM   5308  N  N     . THR A 1  682  ? 107.090 73.488  36.845  1.00 129.51 ? 682  THR A N     1 
ATOM   5309  C  CA    . THR A 1  682  ? 107.616 73.973  35.564  1.00 126.92 ? 682  THR A CA    1 
ATOM   5310  C  C     . THR A 1  682  ? 106.461 74.237  34.604  1.00 128.74 ? 682  THR A C     1 
ATOM   5311  O  O     . THR A 1  682  ? 106.456 75.251  33.907  1.00 126.82 ? 682  THR A O     1 
ATOM   5312  C  CB    . THR A 1  682  ? 108.681 72.995  35.045  1.00 128.96 ? 682  THR A CB    1 
ATOM   5313  O  OG1   . THR A 1  682  ? 109.899 73.282  35.719  1.00 128.80 ? 682  THR A OG1   1 
ATOM   5314  C  CG2   . THR A 1  682  ? 108.898 73.057  33.535  1.00 124.79 ? 682  THR A CG2   1 
ATOM   5315  N  N     . ILE A 1  683  ? 105.476 73.328  34.592  1.00 126.19 ? 683  ILE A N     1 
ATOM   5316  C  CA    . ILE A 1  683  ? 104.280 73.440  33.757  1.00 126.05 ? 683  ILE A CA    1 
ATOM   5317  C  C     . ILE A 1  683  ? 103.392 74.580  34.285  1.00 131.96 ? 683  ILE A C     1 
ATOM   5318  O  O     . ILE A 1  683  ? 102.958 75.430  33.500  1.00 131.17 ? 683  ILE A O     1 
ATOM   5319  C  CB    . ILE A 1  683  ? 103.535 72.077  33.615  1.00 128.36 ? 683  ILE A CB    1 
ATOM   5320  C  CG1   . ILE A 1  683  ? 104.457 71.010  32.973  1.00 127.56 ? 683  ILE A CG1   1 
ATOM   5321  C  CG2   . ILE A 1  683  ? 102.255 72.240  32.793  1.00 128.61 ? 683  ILE A CG2   1 
ATOM   5322  C  CD1   . ILE A 1  683  ? 104.066 69.504  33.245  1.00 136.79 ? 683  ILE A CD1   1 
ATOM   5323  N  N     . ALA A 1  684  ? 103.176 74.615  35.620  1.00 130.54 ? 684  ALA A N     1 
ATOM   5324  C  CA    . ALA A 1  684  ? 102.379 75.634  36.311  1.00 132.14 ? 684  ALA A CA    1 
ATOM   5325  C  C     . ALA A 1  684  ? 102.819 77.075  35.960  1.00 136.78 ? 684  ALA A C     1 
ATOM   5326  O  O     . ALA A 1  684  ? 101.963 77.906  35.627  1.00 136.41 ? 684  ALA A O     1 
ATOM   5327  C  CB    . ALA A 1  684  ? 102.426 75.406  37.814  1.00 134.12 ? 684  ALA A CB    1 
ATOM   5328  N  N     . GLU A 1  685  ? 104.152 77.350  35.987  1.00 133.54 ? 685  GLU A N     1 
ATOM   5329  C  CA    . GLU A 1  685  ? 104.705 78.669  35.636  1.00 133.70 ? 685  GLU A CA    1 
ATOM   5330  C  C     . GLU A 1  685  ? 104.483 78.992  34.162  1.00 133.34 ? 685  GLU A C     1 
ATOM   5331  O  O     . GLU A 1  685  ? 104.134 80.130  33.843  1.00 133.98 ? 685  GLU A O     1 
ATOM   5332  C  CB    . GLU A 1  685  ? 106.186 78.874  36.075  1.00 135.94 ? 685  GLU A CB    1 
ATOM   5333  C  CG    . GLU A 1  685  ? 107.172 77.793  35.642  1.00 151.56 ? 685  GLU A CG    1 
ATOM   5334  C  CD    . GLU A 1  685  ? 108.419 78.209  34.879  1.00 177.06 ? 685  GLU A CD    1 
ATOM   5335  O  OE1   . GLU A 1  685  ? 109.402 78.643  35.525  1.00 175.23 ? 685  GLU A OE1   1 
ATOM   5336  O  OE2   . GLU A 1  685  ? 108.447 78.005  33.643  1.00 169.06 ? 685  GLU A OE2   1 
ATOM   5337  N  N     . ALA A 1  686  ? 104.623 77.986  33.279  1.00 125.57 ? 686  ALA A N     1 
ATOM   5338  C  CA    . ALA A 1  686  ? 104.407 78.154  31.848  1.00 123.15 ? 686  ALA A CA    1 
ATOM   5339  C  C     . ALA A 1  686  ? 102.953 78.525  31.585  1.00 124.64 ? 686  ALA A C     1 
ATOM   5340  O  O     . ALA A 1  686  ? 102.687 79.446  30.809  1.00 122.97 ? 686  ALA A O     1 
ATOM   5341  C  CB    . ALA A 1  686  ? 104.768 76.879  31.117  1.00 122.38 ? 686  ALA A CB    1 
ATOM   5342  N  N     . LYS A 1  687  ? 102.020 77.854  32.294  1.00 121.38 ? 687  LYS A N     1 
ATOM   5343  C  CA    . LYS A 1  687  ? 100.578 78.099  32.200  1.00 121.59 ? 687  LYS A CA    1 
ATOM   5344  C  C     . LYS A 1  687  ? 100.200 79.517  32.620  1.00 126.81 ? 687  LYS A C     1 
ATOM   5345  O  O     . LYS A 1  687  ? 99.272  80.079  32.035  1.00 126.54 ? 687  LYS A O     1 
ATOM   5346  C  CB    . LYS A 1  687  ? 99.773  77.053  32.983  1.00 124.16 ? 687  LYS A CB    1 
ATOM   5347  C  CG    . LYS A 1  687  ? 99.695  75.697  32.290  1.00 129.97 ? 687  LYS A CG    1 
ATOM   5348  C  CD    . LYS A 1  687  ? 99.030  74.649  33.166  1.00 135.86 ? 687  LYS A CD    1 
ATOM   5349  C  CE    . LYS A 1  687  ? 97.538  74.581  32.961  1.00 142.46 ? 687  LYS A CE    1 
ATOM   5350  N  NZ    . LYS A 1  687  ? 96.920  73.536  33.814  1.00 150.59 ? 687  LYS A NZ    1 
ATOM   5351  N  N     . LYS A 1  688  ? 100.934 80.098  33.610  1.00 124.16 ? 688  LYS A N     1 
ATOM   5352  C  CA    . LYS A 1  688  ? 100.756 81.483  34.064  1.00 125.19 ? 688  LYS A CA    1 
ATOM   5353  C  C     . LYS A 1  688  ? 101.279 82.427  32.976  1.00 128.67 ? 688  LYS A C     1 
ATOM   5354  O  O     . LYS A 1  688  ? 100.522 83.281  32.523  1.00 128.13 ? 688  LYS A O     1 
ATOM   5355  C  CB    . LYS A 1  688  ? 101.479 81.751  35.395  1.00 128.81 ? 688  LYS A CB    1 
ATOM   5356  C  CG    . LYS A 1  688  ? 101.000 83.030  36.098  1.00 142.19 ? 688  LYS A CG    1 
ATOM   5357  C  CD    . LYS A 1  688  ? 102.150 83.980  36.416  1.00 149.36 ? 688  LYS A CD    1 
ATOM   5358  C  CE    . LYS A 1  688  ? 101.716 85.156  37.260  1.00 153.60 ? 688  LYS A CE    1 
ATOM   5359  N  NZ    . LYS A 1  688  ? 102.881 85.948  37.745  1.00 157.20 ? 688  LYS A NZ    1 
ATOM   5360  N  N     . LYS A 1  689  ? 102.553 82.243  32.528  1.00 125.35 ? 689  LYS A N     1 
ATOM   5361  C  CA    . LYS A 1  689  ? 103.222 83.009  31.456  1.00 125.15 ? 689  LYS A CA    1 
ATOM   5362  C  C     . LYS A 1  689  ? 102.289 83.140  30.237  1.00 130.11 ? 689  LYS A C     1 
ATOM   5363  O  O     . LYS A 1  689  ? 102.210 84.218  29.641  1.00 130.68 ? 689  LYS A O     1 
ATOM   5364  C  CB    . LYS A 1  689  ? 104.543 82.318  31.061  1.00 126.15 ? 689  LYS A CB    1 
ATOM   5365  C  CG    . LYS A 1  689  ? 105.567 83.182  30.323  1.00 139.26 ? 689  LYS A CG    1 
ATOM   5366  C  CD    . LYS A 1  689  ? 106.696 82.292  29.764  1.00 151.25 ? 689  LYS A CD    1 
ATOM   5367  C  CE    . LYS A 1  689  ? 107.904 83.015  29.195  1.00 162.24 ? 689  LYS A CE    1 
ATOM   5368  N  NZ    . LYS A 1  689  ? 108.797 82.095  28.421  1.00 164.38 ? 689  LYS A NZ    1 
ATOM   5369  N  N     . VAL A 1  690  ? 101.545 82.050  29.920  1.00 126.16 ? 690  VAL A N     1 
ATOM   5370  C  CA    . VAL A 1  690  ? 100.549 81.980  28.852  1.00 125.30 ? 690  VAL A CA    1 
ATOM   5371  C  C     . VAL A 1  690  ? 99.344  82.863  29.187  1.00 132.21 ? 690  VAL A C     1 
ATOM   5372  O  O     . VAL A 1  690  ? 98.993  83.713  28.371  1.00 132.05 ? 690  VAL A O     1 
ATOM   5373  C  CB    . VAL A 1  690  ? 100.168 80.520  28.515  1.00 127.22 ? 690  VAL A CB    1 
ATOM   5374  C  CG1   . VAL A 1  690  ? 98.817  80.433  27.813  1.00 126.46 ? 690  VAL A CG1   1 
ATOM   5375  C  CG2   . VAL A 1  690  ? 101.252 79.880  27.663  1.00 125.66 ? 690  VAL A CG2   1 
ATOM   5376  N  N     . LEU A 1  691  ? 98.742  82.690  30.395  1.00 131.15 ? 691  LEU A N     1 
ATOM   5377  C  CA    . LEU A 1  691  ? 97.591  83.474  30.903  1.00 132.58 ? 691  LEU A CA    1 
ATOM   5378  C  C     . LEU A 1  691  ? 97.907  84.981  30.947  1.00 138.15 ? 691  LEU A C     1 
ATOM   5379  O  O     . LEU A 1  691  ? 97.028  85.810  30.688  1.00 138.20 ? 691  LEU A O     1 
ATOM   5380  C  CB    . LEU A 1  691  ? 97.144  82.954  32.301  1.00 133.22 ? 691  LEU A CB    1 
ATOM   5381  C  CG    . LEU A 1  691  ? 96.114  83.764  33.125  1.00 138.46 ? 691  LEU A CG    1 
ATOM   5382  C  CD1   . LEU A 1  691  ? 94.772  83.926  32.387  1.00 138.14 ? 691  LEU A CD1   1 
ATOM   5383  C  CD2   . LEU A 1  691  ? 95.905  83.135  34.488  1.00 140.54 ? 691  LEU A CD2   1 
ATOM   5384  N  N     . ASP A 1  692  ? 99.169  85.312  31.262  1.00 135.40 ? 692  ASP A N     1 
ATOM   5385  C  CA    . ASP A 1  692  ? 99.676  86.671  31.330  1.00 136.67 ? 692  ASP A CA    1 
ATOM   5386  C  C     . ASP A 1  692  ? 99.563  87.332  29.958  1.00 138.93 ? 692  ASP A C     1 
ATOM   5387  O  O     . ASP A 1  692  ? 98.970  88.407  29.852  1.00 139.77 ? 692  ASP A O     1 
ATOM   5388  C  CB    . ASP A 1  692  ? 101.122 86.670  31.864  1.00 139.55 ? 692  ASP A CB    1 
ATOM   5389  C  CG    . ASP A 1  692  ? 101.266 86.369  33.360  1.00 158.02 ? 692  ASP A CG    1 
ATOM   5390  O  OD1   . ASP A 1  692  ? 100.218 86.241  34.057  1.00 159.65 ? 692  ASP A OD1   1 
ATOM   5391  O  OD2   . ASP A 1  692  ? 102.424 86.289  33.842  1.00 167.18 ? 692  ASP A OD2   1 
ATOM   5392  N  N     . VAL A 1  693  ? 100.044 86.642  28.904  1.00 133.01 ? 693  VAL A N     1 
ATOM   5393  C  CA    . VAL A 1  693  ? 99.969  87.098  27.508  1.00 131.82 ? 693  VAL A CA    1 
ATOM   5394  C  C     . VAL A 1  693  ? 98.492  87.069  27.035  1.00 136.20 ? 693  VAL A C     1 
ATOM   5395  O  O     . VAL A 1  693  ? 98.107  87.879  26.187  1.00 135.85 ? 693  VAL A O     1 
ATOM   5396  C  CB    . VAL A 1  693  ? 100.957 86.309  26.587  1.00 133.49 ? 693  VAL A CB    1 
ATOM   5397  C  CG1   . VAL A 1  693  ? 100.867 86.753  25.126  1.00 132.32 ? 693  VAL A CG1   1 
ATOM   5398  C  CG2   . VAL A 1  693  ? 102.393 86.450  27.088  1.00 133.42 ? 693  VAL A CG2   1 
ATOM   5399  N  N     . THR A 1  694  ? 97.661  86.188  27.644  1.00 133.42 ? 694  THR A N     1 
ATOM   5400  C  CA    . THR A 1  694  ? 96.233  86.056  27.343  1.00 133.74 ? 694  THR A CA    1 
ATOM   5401  C  C     . THR A 1  694  ? 95.448  87.269  27.852  1.00 140.56 ? 694  THR A C     1 
ATOM   5402  O  O     . THR A 1  694  ? 94.643  87.808  27.095  1.00 141.23 ? 694  THR A O     1 
ATOM   5403  C  CB    . THR A 1  694  ? 95.666  84.702  27.807  1.00 142.36 ? 694  THR A CB    1 
ATOM   5404  O  OG1   . THR A 1  694  ? 96.537  83.651  27.386  1.00 141.41 ? 694  THR A OG1   1 
ATOM   5405  C  CG2   . THR A 1  694  ? 94.269  84.431  27.263  1.00 141.27 ? 694  THR A CG2   1 
ATOM   5406  N  N     . LYS A 1  695  ? 95.689  87.717  29.106  1.00 138.24 ? 695  LYS A N     1 
ATOM   5407  C  CA    . LYS A 1  695  ? 95.018  88.905  29.667  1.00 139.35 ? 695  LYS A CA    1 
ATOM   5408  C  C     . LYS A 1  695  ? 95.464  90.172  28.899  1.00 144.27 ? 695  LYS A C     1 
ATOM   5409  O  O     . LYS A 1  695  ? 94.636  91.026  28.570  1.00 144.24 ? 695  LYS A O     1 
ATOM   5410  C  CB    . LYS A 1  695  ? 95.277  89.046  31.187  1.00 141.97 ? 695  LYS A CB    1 
ATOM   5411  C  CG    . LYS A 1  695  ? 94.649  87.957  32.059  1.00 146.81 ? 695  LYS A CG    1 
ATOM   5412  C  CD    . LYS A 1  695  ? 93.147  88.138  32.312  1.00 154.68 ? 695  LYS A CD    1 
ATOM   5413  C  CE    . LYS A 1  695  ? 92.546  86.942  33.021  1.00 164.94 ? 695  LYS A CE    1 
ATOM   5414  N  NZ    . LYS A 1  695  ? 91.132  87.170  33.426  1.00 174.03 ? 695  LYS A NZ    1 
ATOM   5415  N  N     . GLU A 1  696  ? 96.770  90.243  28.576  1.00 141.12 ? 696  GLU A N     1 
ATOM   5416  C  CA    . GLU A 1  696  ? 97.428  91.309  27.822  1.00 141.67 ? 696  GLU A CA    1 
ATOM   5417  C  C     . GLU A 1  696  ? 96.789  91.510  26.432  1.00 145.61 ? 696  GLU A C     1 
ATOM   5418  O  O     . GLU A 1  696  ? 96.456  92.642  26.083  1.00 146.73 ? 696  GLU A O     1 
ATOM   5419  C  CB    . GLU A 1  696  ? 98.934  90.989  27.719  1.00 142.53 ? 696  GLU A CB    1 
ATOM   5420  C  CG    . GLU A 1  696  ? 99.723  91.752  26.663  1.00 155.21 ? 696  GLU A CG    1 
ATOM   5421  C  CD    . GLU A 1  696  ? 101.131 91.243  26.409  1.00 180.58 ? 696  GLU A CD    1 
ATOM   5422  O  OE1   . GLU A 1  696  ? 101.651 90.465  27.242  1.00 175.45 ? 696  GLU A OE1   1 
ATOM   5423  O  OE2   . GLU A 1  696  ? 101.728 91.648  25.386  1.00 179.08 ? 696  GLU A OE2   1 
ATOM   5424  N  N     . ALA A 1  697  ? 96.616  90.424  25.655  1.00 140.41 ? 697  ALA A N     1 
ATOM   5425  C  CA    . ALA A 1  697  ? 96.027  90.473  24.315  1.00 139.62 ? 697  ALA A CA    1 
ATOM   5426  C  C     . ALA A 1  697  ? 94.515  90.788  24.308  1.00 145.00 ? 697  ALA A C     1 
ATOM   5427  O  O     . ALA A 1  697  ? 94.004  91.337  23.326  1.00 144.01 ? 697  ALA A O     1 
ATOM   5428  C  CB    . ALA A 1  697  ? 96.305  89.177  23.580  1.00 138.66 ? 697  ALA A CB    1 
ATOM   5429  N  N     . GLN A 1  698  ? 93.808  90.444  25.396  1.00 143.64 ? 698  GLN A N     1 
ATOM   5430  C  CA    . GLN A 1  698  ? 92.378  90.724  25.543  1.00 145.20 ? 698  GLN A CA    1 
ATOM   5431  C  C     . GLN A 1  698  ? 92.164  92.186  25.958  1.00 153.85 ? 698  GLN A C     1 
ATOM   5432  O  O     . GLN A 1  698  ? 91.067  92.717  25.777  1.00 154.58 ? 698  GLN A O     1 
ATOM   5433  C  CB    . GLN A 1  698  ? 91.750  89.801  26.591  1.00 146.71 ? 698  GLN A CB    1 
ATOM   5434  C  CG    . GLN A 1  698  ? 91.573  88.367  26.127  1.00 160.89 ? 698  GLN A CG    1 
ATOM   5435  C  CD    . GLN A 1  698  ? 91.178  87.449  27.258  1.00 179.60 ? 698  GLN A CD    1 
ATOM   5436  O  OE1   . GLN A 1  698  ? 91.653  87.562  28.399  1.00 172.50 ? 698  GLN A OE1   1 
ATOM   5437  N  NE2   . GLN A 1  698  ? 90.325  86.485  26.948  1.00 175.11 ? 698  GLN A NE2   1 
ATOM   5438  N  N     . ALA A 1  699  ? 93.204  92.823  26.543  1.00 152.45 ? 699  ALA A N     1 
ATOM   5439  C  CA    . ALA A 1  699  ? 93.165  94.217  26.983  1.00 154.37 ? 699  ALA A CA    1 
ATOM   5440  C  C     . ALA A 1  699  ? 93.723  95.185  25.910  1.00 160.17 ? 699  ALA A C     1 
ATOM   5441  O  O     . ALA A 1  699  ? 93.962  96.359  26.208  1.00 161.37 ? 699  ALA A O     1 
ATOM   5442  C  CB    . ALA A 1  699  ? 93.911  94.366  28.302  1.00 155.94 ? 699  ALA A CB    1 
ATOM   5443  N  N     . ASN A 1  700  ? 93.903  94.685  24.654  1.00 156.44 ? 700  ASN A N     1 
ATOM   5444  C  CA    . ASN A 1  700  ? 94.396  95.400  23.461  1.00 156.42 ? 700  ASN A CA    1 
ATOM   5445  C  C     . ASN A 1  700  ? 95.862  95.878  23.555  1.00 162.68 ? 700  ASN A C     1 
ATOM   5446  O  O     . ASN A 1  700  ? 96.342  96.526  22.624  1.00 162.92 ? 700  ASN A O     1 
ATOM   5447  C  CB    . ASN A 1  700  ? 93.449  96.565  23.080  1.00 157.13 ? 700  ASN A CB    1 
ATOM   5448  C  CG    . ASN A 1  700  ? 93.281  96.813  21.599  1.00 175.93 ? 700  ASN A CG    1 
ATOM   5449  O  OD1   . ASN A 1  700  ? 92.906  95.927  20.824  1.00 166.06 ? 700  ASN A OD1   1 
ATOM   5450  N  ND2   . ASN A 1  700  ? 93.469  98.056  21.185  1.00 169.81 ? 700  ASN A ND2   1 
ATOM   5451  N  N     . LEU A 1  701  ? 96.576  95.534  24.650  1.00 160.45 ? 701  LEU A N     1 
ATOM   5452  C  CA    . LEU A 1  701  ? 97.963  95.954  24.932  1.00 161.06 ? 701  LEU A CA    1 
ATOM   5453  C  C     . LEU A 1  701  ? 99.051  95.293  24.076  1.00 163.89 ? 701  LEU A C     1 
ATOM   5454  O  O     . LEU A 1  701  ? 100.148 95.845  23.957  1.00 163.67 ? 701  LEU A O     1 
ATOM   5455  C  CB    . LEU A 1  701  ? 98.301  95.791  26.428  1.00 162.13 ? 701  LEU A CB    1 
ATOM   5456  C  CG    . LEU A 1  701  ? 97.220  96.159  27.451  1.00 168.62 ? 701  LEU A CG    1 
ATOM   5457  C  CD1   . LEU A 1  701  ? 97.542  95.578  28.810  1.00 169.42 ? 701  LEU A CD1   1 
ATOM   5458  C  CD2   . LEU A 1  701  ? 97.024  97.663  27.551  1.00 173.11 ? 701  LEU A CD2   1 
ATOM   5459  N  N     . LEU A 1  702  ? 98.756  94.113  23.506  1.00 159.34 ? 702  LEU A N     1 
ATOM   5460  C  CA    . LEU A 1  702  ? 99.681  93.351  22.666  1.00 158.07 ? 702  LEU A CA    1 
ATOM   5461  C  C     . LEU A 1  702  ? 100.031 94.133  21.397  1.00 163.47 ? 702  LEU A C     1 
ATOM   5462  O  O     . LEU A 1  702  ? 99.164  94.775  20.804  1.00 162.75 ? 702  LEU A O     1 
ATOM   5463  C  CB    . LEU A 1  702  ? 99.058  91.986  22.308  1.00 156.66 ? 702  LEU A CB    1 
ATOM   5464  C  CG    . LEU A 1  702  ? 100.012 90.819  22.021  1.00 159.15 ? 702  LEU A CG    1 
ATOM   5465  C  CD1   . LEU A 1  702  ? 100.071 89.861  23.192  1.00 158.92 ? 702  LEU A CD1   1 
ATOM   5466  C  CD2   . LEU A 1  702  ? 99.553  90.040  20.815  1.00 159.50 ? 702  LEU A CD2   1 
ATOM   5467  N  N     . THR A 1  703  ? 101.312 94.101  21.014  1.00 162.13 ? 703  THR A N     1 
ATOM   5468  C  CA    . THR A 1  703  ? 101.836 94.769  19.821  1.00 162.90 ? 703  THR A CA    1 
ATOM   5469  C  C     . THR A 1  703  ? 102.221 93.697  18.800  1.00 166.68 ? 703  THR A C     1 
ATOM   5470  O  O     . THR A 1  703  ? 103.241 93.019  18.969  1.00 165.05 ? 703  THR A O     1 
ATOM   5471  C  CB    . THR A 1  703  ? 103.001 95.714  20.194  1.00 175.33 ? 703  THR A CB    1 
ATOM   5472  O  OG1   . THR A 1  703  ? 102.553 96.641  21.186  1.00 179.03 ? 703  THR A OG1   1 
ATOM   5473  C  CG2   . THR A 1  703  ? 103.563 96.471  18.988  1.00 173.63 ? 703  THR A CG2   1 
ATOM   5474  N  N     . ALA A 1  704  ? 101.386 93.545  17.754  1.00 164.43 ? 704  ALA A N     1 
ATOM   5475  C  CA    . ALA A 1  704  ? 101.569 92.575  16.671  1.00 163.61 ? 704  ALA A CA    1 
ATOM   5476  C  C     . ALA A 1  704  ? 102.948 92.669  16.019  1.00 169.75 ? 704  ALA A C     1 
ATOM   5477  O  O     . ALA A 1  704  ? 103.439 93.773  15.763  1.00 170.35 ? 704  ALA A O     1 
ATOM   5478  C  CB    . ALA A 1  704  ? 100.488 92.757  15.620  1.00 164.08 ? 704  ALA A CB    1 
ATOM   5479  N  N     . LYS A 1  705  ? 103.574 91.501  15.777  1.00 166.87 ? 705  LYS A N     1 
ATOM   5480  C  CA    . LYS A 1  705  ? 104.893 91.366  15.137  1.00 166.66 ? 705  LYS A CA    1 
ATOM   5481  C  C     . LYS A 1  705  ? 104.762 91.796  13.664  1.00 172.82 ? 705  LYS A C     1 
ATOM   5482  O  O     . LYS A 1  705  ? 103.719 91.524  13.057  1.00 172.48 ? 705  LYS A O     1 
ATOM   5483  C  CB    . LYS A 1  705  ? 105.404 89.902  15.230  1.00 166.75 ? 705  LYS A CB    1 
ATOM   5484  C  CG    . LYS A 1  705  ? 105.210 89.230  16.598  1.00 165.32 ? 705  LYS A CG    1 
ATOM   5485  C  CD    . LYS A 1  705  ? 106.042 87.963  16.788  1.00 163.42 ? 705  LYS A CD    1 
ATOM   5486  C  CE    . LYS A 1  705  ? 105.907 87.445  18.203  1.00 162.42 ? 705  LYS A CE    1 
ATOM   5487  N  NZ    . LYS A 1  705  ? 106.948 86.440  18.552  1.00 160.87 ? 705  LYS A NZ    1 
ATOM   5488  N  N     . HIS A 1  706  ? 105.784 92.488  13.096  1.00 170.58 ? 706  HIS A N     1 
ATOM   5489  C  CA    . HIS A 1  706  ? 105.732 92.927  11.691  1.00 170.44 ? 706  HIS A CA    1 
ATOM   5490  C  C     . HIS A 1  706  ? 105.558 91.730  10.739  1.00 171.44 ? 706  HIS A C     1 
ATOM   5491  O  O     . HIS A 1  706  ? 106.400 90.819  10.709  1.00 169.95 ? 706  HIS A O     1 
ATOM   5492  C  CB    . HIS A 1  706  ? 106.940 93.803  11.299  1.00 172.12 ? 706  HIS A CB    1 
ATOM   5493  C  CG    . HIS A 1  706  ? 106.902 94.285  9.874   1.00 175.70 ? 706  HIS A CG    1 
ATOM   5494  N  ND1   . HIS A 1  706  ? 106.161 95.398  9.504   1.00 178.58 ? 706  HIS A ND1   1 
ATOM   5495  C  CD2   . HIS A 1  706  ? 107.510 93.781  8.772   1.00 176.57 ? 706  HIS A CD2   1 
ATOM   5496  C  CE1   . HIS A 1  706  ? 106.342 95.535  8.199   1.00 177.61 ? 706  HIS A CE1   1 
ATOM   5497  N  NE2   . HIS A 1  706  ? 107.146 94.586  7.713   1.00 176.74 ? 706  HIS A NE2   1 
ATOM   5498  N  N     . GLY A 1  707  ? 104.429 91.739  10.026  1.00 166.47 ? 707  GLY A N     1 
ATOM   5499  C  CA    . GLY A 1  707  ? 104.033 90.698  9.082   1.00 164.13 ? 707  GLY A CA    1 
ATOM   5500  C  C     . GLY A 1  707  ? 103.281 89.564  9.748   1.00 164.12 ? 707  GLY A C     1 
ATOM   5501  O  O     . GLY A 1  707  ? 103.543 88.391  9.467   1.00 162.82 ? 707  GLY A O     1 
ATOM   5502  N  N     . MET A 1  708  ? 102.345 89.916  10.646  1.00 158.26 ? 708  MET A N     1 
ATOM   5503  C  CA    . MET A 1  708  ? 101.545 88.976  11.423  1.00 156.26 ? 708  MET A CA    1 
ATOM   5504  C  C     . MET A 1  708  ? 100.293 89.652  11.938  1.00 155.71 ? 708  MET A C     1 
ATOM   5505  O  O     . MET A 1  708  ? 100.313 90.854  12.205  1.00 156.65 ? 708  MET A O     1 
ATOM   5506  C  CB    . MET A 1  708  ? 102.357 88.496  12.638  1.00 159.10 ? 708  MET A CB    1 
ATOM   5507  C  CG    . MET A 1  708  ? 102.827 87.071  12.535  1.00 162.20 ? 708  MET A CG    1 
ATOM   5508  S  SD    . MET A 1  708  ? 104.067 86.687  13.795  1.00 167.25 ? 708  MET A SD    1 
ATOM   5509  C  CE    . MET A 1  708  ? 105.567 87.118  12.892  1.00 163.91 ? 708  MET A CE    1 
ATOM   5510  N  N     . THR A 1  709  ? 99.222  88.864  12.150  1.00 147.87 ? 709  THR A N     1 
ATOM   5511  C  CA    . THR A 1  709  ? 97.963  89.317  12.747  1.00 146.87 ? 709  THR A CA    1 
ATOM   5512  C  C     . THR A 1  709  ? 98.306  89.582  14.207  1.00 147.82 ? 709  THR A C     1 
ATOM   5513  O  O     . THR A 1  709  ? 99.368  89.158  14.674  1.00 146.09 ? 709  THR A O     1 
ATOM   5514  C  CB    . THR A 1  709  ? 96.902  88.174  12.694  1.00 153.94 ? 709  THR A CB    1 
ATOM   5515  O  OG1   . THR A 1  709  ? 96.788  87.638  11.378  1.00 154.05 ? 709  THR A OG1   1 
ATOM   5516  C  CG2   . THR A 1  709  ? 95.535  88.591  13.193  1.00 152.10 ? 709  THR A CG2   1 
ATOM   5517  N  N     . LEU A 1  710  ? 97.411  90.249  14.937  1.00 144.25 ? 710  LEU A N     1 
ATOM   5518  C  CA    . LEU A 1  710  ? 97.592  90.443  16.367  1.00 144.55 ? 710  LEU A CA    1 
ATOM   5519  C  C     . LEU A 1  710  ? 97.461  89.036  17.044  1.00 145.61 ? 710  LEU A C     1 
ATOM   5520  O  O     . LEU A 1  710  ? 98.203  88.703  17.978  1.00 145.25 ? 710  LEU A O     1 
ATOM   5521  C  CB    . LEU A 1  710  ? 96.533  91.430  16.886  1.00 146.03 ? 710  LEU A CB    1 
ATOM   5522  C  CG    . LEU A 1  710  ? 96.805  92.058  18.255  1.00 152.03 ? 710  LEU A CG    1 
ATOM   5523  C  CD1   . LEU A 1  710  ? 97.773  93.237  18.152  1.00 152.92 ? 710  LEU A CD1   1 
ATOM   5524  C  CD2   . LEU A 1  710  ? 95.509  92.483  18.923  1.00 155.34 ? 710  LEU A CD2   1 
ATOM   5525  N  N     . ARG A 1  711  ? 96.572  88.199  16.483  1.00 138.97 ? 711  ARG A N     1 
ATOM   5526  C  CA    . ARG A 1  711  ? 96.300  86.835  16.918  1.00 136.66 ? 711  ARG A CA    1 
ATOM   5527  C  C     . ARG A 1  711  ? 97.461  85.908  16.576  1.00 138.26 ? 711  ARG A C     1 
ATOM   5528  O  O     . ARG A 1  711  ? 97.946  85.200  17.462  1.00 137.17 ? 711  ARG A O     1 
ATOM   5529  C  CB    . ARG A 1  711  ? 94.991  86.344  16.303  1.00 133.55 ? 711  ARG A CB    1 
ATOM   5530  C  CG    . ARG A 1  711  ? 93.882  87.359  16.433  1.00 136.60 ? 711  ARG A CG    1 
ATOM   5531  C  CD    . ARG A 1  711  ? 92.560  86.743  16.109  1.00 138.17 ? 711  ARG A CD    1 
ATOM   5532  N  NE    . ARG A 1  711  ? 91.824  86.400  17.321  1.00 137.02 ? 711  ARG A NE    1 
ATOM   5533  C  CZ    . ARG A 1  711  ? 90.599  86.833  17.591  1.00 146.28 ? 711  ARG A CZ    1 
ATOM   5534  N  NH1   . ARG A 1  711  ? 89.968  87.635  16.741  1.00 128.22 ? 711  ARG A NH1   1 
ATOM   5535  N  NH2   . ARG A 1  711  ? 89.989  86.458  18.706  1.00 134.06 ? 711  ARG A NH2   1 
ATOM   5536  N  N     . GLU A 1  712  ? 97.935  85.944  15.302  1.00 133.91 ? 712  GLU A N     1 
ATOM   5537  C  CA    . GLU A 1  712  ? 99.081  85.165  14.810  1.00 132.49 ? 712  GLU A CA    1 
ATOM   5538  C  C     . GLU A 1  712  ? 100.261 85.347  15.770  1.00 136.55 ? 712  GLU A C     1 
ATOM   5539  O  O     . GLU A 1  712  ? 100.929 84.376  16.126  1.00 135.07 ? 712  GLU A O     1 
ATOM   5540  C  CB    . GLU A 1  712  ? 99.500  85.623  13.391  1.00 133.42 ? 712  GLU A CB    1 
ATOM   5541  C  CG    . GLU A 1  712  ? 98.704  85.027  12.237  1.00 143.89 ? 712  GLU A CG    1 
ATOM   5542  C  CD    . GLU A 1  712  ? 99.245  85.307  10.843  1.00 166.54 ? 712  GLU A CD    1 
ATOM   5543  O  OE1   . GLU A 1  712  ? 99.364  86.498  10.475  1.00 155.96 ? 712  GLU A OE1   1 
ATOM   5544  O  OE2   . GLU A 1  712  ? 99.517  84.334  10.102  1.00 165.55 ? 712  GLU A OE2   1 
ATOM   5545  N  N     . SER A 1  713  ? 100.467 86.600  16.220  1.00 134.77 ? 713  SER A N     1 
ATOM   5546  C  CA    . SER A 1  713  ? 101.519 87.002  17.144  1.00 135.43 ? 713  SER A CA    1 
ATOM   5547  C  C     . SER A 1  713  ? 101.363 86.303  18.489  1.00 139.28 ? 713  SER A C     1 
ATOM   5548  O  O     . SER A 1  713  ? 102.325 85.684  18.947  1.00 139.24 ? 713  SER A O     1 
ATOM   5549  C  CB    . SER A 1  713  ? 101.530 88.518  17.313  1.00 140.50 ? 713  SER A CB    1 
ATOM   5550  O  OG    . SER A 1  713  ? 101.715 89.178  16.070  1.00 148.97 ? 713  SER A OG    1 
ATOM   5551  N  N     . PHE A 1  714  ? 100.143 86.349  19.081  1.00 135.00 ? 714  PHE A N     1 
ATOM   5552  C  CA    . PHE A 1  714  ? 99.792  85.728  20.367  1.00 134.55 ? 714  PHE A CA    1 
ATOM   5553  C  C     . PHE A 1  714  ? 99.961  84.203  20.368  1.00 136.60 ? 714  PHE A C     1 
ATOM   5554  O  O     . PHE A 1  714  ? 100.589 83.654  21.279  1.00 135.62 ? 714  PHE A O     1 
ATOM   5555  C  CB    . PHE A 1  714  ? 98.360  86.121  20.758  1.00 136.95 ? 714  PHE A CB    1 
ATOM   5556  C  CG    . PHE A 1  714  ? 97.615  85.209  21.711  1.00 138.23 ? 714  PHE A CG    1 
ATOM   5557  C  CD1   . PHE A 1  714  ? 97.706  85.390  23.088  1.00 142.10 ? 714  PHE A CD1   1 
ATOM   5558  C  CD2   . PHE A 1  714  ? 96.755  84.225  21.230  1.00 138.93 ? 714  PHE A CD2   1 
ATOM   5559  C  CE1   . PHE A 1  714  ? 96.976  84.584  23.965  1.00 142.87 ? 714  PHE A CE1   1 
ATOM   5560  C  CE2   . PHE A 1  714  ? 96.035  83.413  22.109  1.00 141.65 ? 714  PHE A CE2   1 
ATOM   5561  C  CZ    . PHE A 1  714  ? 96.146  83.602  23.469  1.00 140.84 ? 714  PHE A CZ    1 
ATOM   5562  N  N     . GLU A 1  715  ? 99.375  83.527  19.365  1.00 132.12 ? 715  GLU A N     1 
ATOM   5563  C  CA    . GLU A 1  715  ? 99.436  82.077  19.236  1.00 130.56 ? 715  GLU A CA    1 
ATOM   5564  C  C     . GLU A 1  715  ? 100.865 81.588  19.162  1.00 133.07 ? 715  GLU A C     1 
ATOM   5565  O  O     . GLU A 1  715  ? 101.189 80.646  19.875  1.00 132.76 ? 715  GLU A O     1 
ATOM   5566  C  CB    . GLU A 1  715  ? 98.619  81.590  18.042  1.00 131.15 ? 715  GLU A CB    1 
ATOM   5567  C  CG    . GLU A 1  715  ? 97.120  81.606  18.299  1.00 143.97 ? 715  GLU A CG    1 
ATOM   5568  C  CD    . GLU A 1  715  ? 96.528  80.408  19.019  1.00 162.34 ? 715  GLU A CD    1 
ATOM   5569  O  OE1   . GLU A 1  715  ? 97.175  79.335  19.054  1.00 143.43 ? 715  GLU A OE1   1 
ATOM   5570  O  OE2   . GLU A 1  715  ? 95.386  80.535  19.515  1.00 159.54 ? 715  GLU A OE2   1 
ATOM   5571  N  N     . ASP A 1  716  ? 101.737 82.264  18.372  1.00 128.89 ? 716  ASP A N     1 
ATOM   5572  C  CA    . ASP A 1  716  ? 103.159 81.919  18.248  1.00 128.26 ? 716  ASP A CA    1 
ATOM   5573  C  C     . ASP A 1  716  ? 103.823 81.920  19.614  1.00 130.65 ? 716  ASP A C     1 
ATOM   5574  O  O     . ASP A 1  716  ? 104.604 81.017  19.915  1.00 128.83 ? 716  ASP A O     1 
ATOM   5575  C  CB    . ASP A 1  716  ? 103.898 82.894  17.311  1.00 131.35 ? 716  ASP A CB    1 
ATOM   5576  C  CG    . ASP A 1  716  ? 105.420 82.737  17.323  1.00 150.80 ? 716  ASP A CG    1 
ATOM   5577  O  OD1   . ASP A 1  716  ? 105.923 81.736  16.746  1.00 151.07 ? 716  ASP A OD1   1 
ATOM   5578  O  OD2   . ASP A 1  716  ? 106.107 83.602  17.931  1.00 160.57 ? 716  ASP A OD2   1 
ATOM   5579  N  N     . ASN A 1  717  ? 103.499 82.938  20.435  1.00 127.94 ? 717  ASN A N     1 
ATOM   5580  C  CA    . ASN A 1  717  ? 104.026 83.103  21.785  1.00 128.23 ? 717  ASN A CA    1 
ATOM   5581  C  C     . ASN A 1  717  ? 103.528 81.974  22.694  1.00 130.43 ? 717  ASN A C     1 
ATOM   5582  O  O     . ASN A 1  717  ? 104.358 81.305  23.320  1.00 129.77 ? 717  ASN A O     1 
ATOM   5583  C  CB    . ASN A 1  717  ? 103.697 84.501  22.350  1.00 130.00 ? 717  ASN A CB    1 
ATOM   5584  C  CG    . ASN A 1  717  ? 104.248 85.680  21.560  1.00 150.15 ? 717  ASN A CG    1 
ATOM   5585  O  OD1   . ASN A 1  717  ? 105.338 85.636  20.965  1.00 143.20 ? 717  ASN A OD1   1 
ATOM   5586  N  ND2   . ASN A 1  717  ? 103.513 86.786  21.573  1.00 142.05 ? 717  ASN A ND2   1 
ATOM   5587  N  N     . VAL A 1  718  ? 102.193 81.710  22.697  1.00 125.81 ? 718  VAL A N     1 
ATOM   5588  C  CA    . VAL A 1  718  ? 101.563 80.643  23.497  1.00 125.14 ? 718  VAL A CA    1 
ATOM   5589  C  C     . VAL A 1  718  ? 102.204 79.273  23.201  1.00 128.40 ? 718  VAL A C     1 
ATOM   5590  O  O     . VAL A 1  718  ? 102.738 78.636  24.111  1.00 128.73 ? 718  VAL A O     1 
ATOM   5591  C  CB    . VAL A 1  718  ? 100.018 80.622  23.377  1.00 128.52 ? 718  VAL A CB    1 
ATOM   5592  C  CG1   . VAL A 1  718  ? 99.424  79.485  24.200  1.00 127.92 ? 718  VAL A CG1   1 
ATOM   5593  C  CG2   . VAL A 1  718  ? 99.422  81.950  23.819  1.00 129.68 ? 718  VAL A CG2   1 
ATOM   5594  N  N     . VAL A 1  719  ? 102.193 78.867  21.918  1.00 123.12 ? 719  VAL A N     1 
ATOM   5595  C  CA    . VAL A 1  719  ? 102.793 77.642  21.394  1.00 121.00 ? 719  VAL A CA    1 
ATOM   5596  C  C     . VAL A 1  719  ? 104.282 77.522  21.785  1.00 126.05 ? 719  VAL A C     1 
ATOM   5597  O  O     . VAL A 1  719  ? 104.716 76.441  22.183  1.00 125.33 ? 719  VAL A O     1 
ATOM   5598  C  CB    . VAL A 1  719  ? 102.546 77.589  19.869  1.00 123.01 ? 719  VAL A CB    1 
ATOM   5599  C  CG1   . VAL A 1  719  ? 103.757 77.093  19.082  1.00 121.96 ? 719  VAL A CG1   1 
ATOM   5600  C  CG2   . VAL A 1  719  ? 101.311 76.771  19.556  1.00 121.88 ? 719  VAL A CG2   1 
ATOM   5601  N  N     . ARG A 1  720  ? 105.036 78.640  21.718  1.00 123.65 ? 720  ARG A N     1 
ATOM   5602  C  CA    . ARG A 1  720  ? 106.453 78.675  22.056  1.00 123.81 ? 720  ARG A CA    1 
ATOM   5603  C  C     . ARG A 1  720  ? 106.726 78.486  23.552  1.00 127.39 ? 720  ARG A C     1 
ATOM   5604  O  O     . ARG A 1  720  ? 107.700 77.808  23.875  1.00 126.09 ? 720  ARG A O     1 
ATOM   5605  C  CB    . ARG A 1  720  ? 107.101 79.952  21.521  1.00 127.30 ? 720  ARG A CB    1 
ATOM   5606  C  CG    . ARG A 1  720  ? 108.634 79.934  21.452  1.00 141.85 ? 720  ARG A CG    1 
ATOM   5607  C  CD    . ARG A 1  720  ? 109.202 81.315  21.163  1.00 154.37 ? 720  ARG A CD    1 
ATOM   5608  N  NE    . ARG A 1  720  ? 108.701 82.323  22.104  1.00 166.06 ? 720  ARG A NE    1 
ATOM   5609  C  CZ    . ARG A 1  720  ? 107.791 83.246  21.804  1.00 181.60 ? 720  ARG A CZ    1 
ATOM   5610  N  NH1   . ARG A 1  720  ? 107.281 83.313  20.579  1.00 167.11 ? 720  ARG A NH1   1 
ATOM   5611  N  NH2   . ARG A 1  720  ? 107.388 84.112  22.725  1.00 170.31 ? 720  ARG A NH2   1 
ATOM   5612  N  N     . PHE A 1  721  ? 105.884 79.051  24.456  1.00 125.29 ? 721  PHE A N     1 
ATOM   5613  C  CA    . PHE A 1  721  ? 106.073 78.880  25.914  1.00 126.74 ? 721  PHE A CA    1 
ATOM   5614  C  C     . PHE A 1  721  ? 105.801 77.442  26.331  1.00 131.01 ? 721  PHE A C     1 
ATOM   5615  O  O     . PHE A 1  721  ? 106.528 76.887  27.163  1.00 131.41 ? 721  PHE A O     1 
ATOM   5616  C  CB    . PHE A 1  721  ? 105.157 79.798  26.744  1.00 130.16 ? 721  PHE A CB    1 
ATOM   5617  C  CG    . PHE A 1  721  ? 105.286 81.292  26.561  1.00 133.23 ? 721  PHE A CG    1 
ATOM   5618  C  CD1   . PHE A 1  721  ? 106.445 81.851  26.021  1.00 136.62 ? 721  PHE A CD1   1 
ATOM   5619  C  CD2   . PHE A 1  721  ? 104.265 82.145  26.962  1.00 136.23 ? 721  PHE A CD2   1 
ATOM   5620  C  CE1   . PHE A 1  721  ? 106.555 83.229  25.839  1.00 138.25 ? 721  PHE A CE1   1 
ATOM   5621  C  CE2   . PHE A 1  721  ? 104.383 83.523  26.797  1.00 139.95 ? 721  PHE A CE2   1 
ATOM   5622  C  CZ    . PHE A 1  721  ? 105.526 84.056  26.235  1.00 138.16 ? 721  PHE A CZ    1 
ATOM   5623  N  N     . LEU A 1  722  ? 104.736 76.851  25.755  1.00 126.20 ? 722  LEU A N     1 
ATOM   5624  C  CA    . LEU A 1  722  ? 104.302 75.487  26.020  1.00 124.59 ? 722  LEU A CA    1 
ATOM   5625  C  C     . LEU A 1  722  ? 105.352 74.475  25.580  1.00 128.30 ? 722  LEU A C     1 
ATOM   5626  O  O     . LEU A 1  722  ? 105.580 73.493  26.292  1.00 128.61 ? 722  LEU A O     1 
ATOM   5627  C  CB    . LEU A 1  722  ? 102.940 75.212  25.355  1.00 123.51 ? 722  LEU A CB    1 
ATOM   5628  C  CG    . LEU A 1  722  ? 101.727 75.984  25.901  1.00 128.36 ? 722  LEU A CG    1 
ATOM   5629  C  CD1   . LEU A 1  722  ? 100.485 75.677  25.095  1.00 127.67 ? 722  LEU A CD1   1 
ATOM   5630  C  CD2   . LEU A 1  722  ? 101.478 75.693  27.388  1.00 131.10 ? 722  LEU A CD2   1 
ATOM   5631  N  N     . ASN A 1  723  ? 106.018 74.730  24.434  1.00 123.72 ? 723  ASN A N     1 
ATOM   5632  C  CA    . ASN A 1  723  ? 107.061 73.843  23.931  1.00 122.41 ? 723  ASN A CA    1 
ATOM   5633  C  C     . ASN A 1  723  ? 108.330 73.978  24.723  1.00 127.49 ? 723  ASN A C     1 
ATOM   5634  O  O     . ASN A 1  723  ? 108.920 72.949  25.052  1.00 127.12 ? 723  ASN A O     1 
ATOM   5635  C  CB    . ASN A 1  723  ? 107.297 74.016  22.446  1.00 121.32 ? 723  ASN A CB    1 
ATOM   5636  C  CG    . ASN A 1  723  ? 106.127 73.560  21.620  1.00 146.35 ? 723  ASN A CG    1 
ATOM   5637  O  OD1   . ASN A 1  723  ? 105.560 72.470  21.815  1.00 140.32 ? 723  ASN A OD1   1 
ATOM   5638  N  ND2   . ASN A 1  723  ? 105.730 74.400  20.684  1.00 139.54 ? 723  ASN A ND2   1 
ATOM   5639  N  N     . GLU A 1  724  ? 108.717 75.236  25.096  1.00 124.92 ? 724  GLU A N     1 
ATOM   5640  C  CA    . GLU A 1  724  ? 109.891 75.549  25.930  1.00 125.38 ? 724  GLU A CA    1 
ATOM   5641  C  C     . GLU A 1  724  ? 109.824 74.681  27.197  1.00 128.08 ? 724  GLU A C     1 
ATOM   5642  O  O     . GLU A 1  724  ? 110.818 74.052  27.584  1.00 127.11 ? 724  GLU A O     1 
ATOM   5643  C  CB    . GLU A 1  724  ? 109.846 77.016  26.379  1.00 128.35 ? 724  GLU A CB    1 
ATOM   5644  C  CG    . GLU A 1  724  ? 110.435 78.054  25.442  1.00 144.37 ? 724  GLU A CG    1 
ATOM   5645  C  CD    . GLU A 1  724  ? 110.027 79.476  25.812  1.00 186.07 ? 724  GLU A CD    1 
ATOM   5646  O  OE1   . GLU A 1  724  ? 110.075 79.832  27.015  1.00 182.07 ? 724  GLU A OE1   1 
ATOM   5647  O  OE2   . GLU A 1  724  ? 109.640 80.232  24.891  1.00 191.19 ? 724  GLU A OE2   1 
ATOM   5648  N  N     . ALA A 1  725  ? 108.609 74.643  27.803  1.00 123.93 ? 725  ALA A N     1 
ATOM   5649  C  CA    . ALA A 1  725  ? 108.244 73.923  29.011  1.00 123.73 ? 725  ALA A CA    1 
ATOM   5650  C  C     . ALA A 1  725  ? 108.385 72.439  28.830  1.00 127.28 ? 725  ALA A C     1 
ATOM   5651  O  O     . ALA A 1  725  ? 109.092 71.818  29.621  1.00 127.38 ? 725  ALA A O     1 
ATOM   5652  C  CB    . ALA A 1  725  ? 106.819 74.262  29.406  1.00 124.96 ? 725  ALA A CB    1 
ATOM   5653  N  N     . ARG A 1  726  ? 107.734 71.862  27.788  1.00 123.67 ? 726  ARG A N     1 
ATOM   5654  C  CA    . ARG A 1  726  ? 107.765 70.424  27.498  1.00 123.17 ? 726  ARG A CA    1 
ATOM   5655  C  C     . ARG A 1  726  ? 109.204 69.912  27.466  1.00 129.97 ? 726  ARG A C     1 
ATOM   5656  O  O     . ARG A 1  726  ? 109.482 68.838  28.004  1.00 130.01 ? 726  ARG A O     1 
ATOM   5657  C  CB    . ARG A 1  726  ? 107.009 70.102  26.201  1.00 121.05 ? 726  ARG A CB    1 
ATOM   5658  C  CG    . ARG A 1  726  ? 107.039 68.617  25.807  1.00 126.20 ? 726  ARG A CG    1 
ATOM   5659  C  CD    . ARG A 1  726  ? 106.513 68.345  24.401  1.00 131.44 ? 726  ARG A CD    1 
ATOM   5660  N  NE    . ARG A 1  726  ? 106.941 69.335  23.415  1.00 137.64 ? 726  ARG A NE    1 
ATOM   5661  C  CZ    . ARG A 1  726  ? 108.100 69.301  22.767  1.00 151.90 ? 726  ARG A CZ    1 
ATOM   5662  N  NH1   . ARG A 1  726  ? 108.963 68.312  22.983  1.00 134.96 ? 726  ARG A NH1   1 
ATOM   5663  N  NH2   . ARG A 1  726  ? 108.406 70.253  21.896  1.00 142.98 ? 726  ARG A NH2   1 
ATOM   5664  N  N     . ASP A 1  727  ? 110.120 70.721  26.900  1.00 128.08 ? 727  ASP A N     1 
ATOM   5665  C  CA    . ASP A 1  727  ? 111.544 70.418  26.826  1.00 128.23 ? 727  ASP A CA    1 
ATOM   5666  C  C     . ASP A 1  727  ? 112.179 70.561  28.196  1.00 133.26 ? 727  ASP A C     1 
ATOM   5667  O  O     . ASP A 1  727  ? 112.833 69.623  28.632  1.00 133.02 ? 727  ASP A O     1 
ATOM   5668  C  CB    . ASP A 1  727  ? 112.252 71.325  25.813  1.00 130.30 ? 727  ASP A CB    1 
ATOM   5669  C  CG    . ASP A 1  727  ? 111.602 71.365  24.449  1.00 143.86 ? 727  ASP A CG    1 
ATOM   5670  O  OD1   . ASP A 1  727  ? 111.169 70.289  23.961  1.00 143.19 ? 727  ASP A OD1   1 
ATOM   5671  O  OD2   . ASP A 1  727  ? 111.526 72.467  23.865  1.00 153.17 ? 727  ASP A OD2   1 
ATOM   5672  N  N     . LYS A 1  728  ? 111.975 71.714  28.881  1.00 130.61 ? 728  LYS A N     1 
ATOM   5673  C  CA    . LYS A 1  728  ? 112.515 71.992  30.221  1.00 131.47 ? 728  LYS A CA    1 
ATOM   5674  C  C     . LYS A 1  728  ? 112.227 70.814  31.162  1.00 134.54 ? 728  LYS A C     1 
ATOM   5675  O  O     . LYS A 1  728  ? 113.173 70.192  31.659  1.00 134.40 ? 728  LYS A O     1 
ATOM   5676  C  CB    . LYS A 1  728  ? 111.951 73.325  30.772  1.00 135.27 ? 728  LYS A CB    1 
ATOM   5677  C  CG    . LYS A 1  728  ? 112.545 73.808  32.105  1.00 147.87 ? 728  LYS A CG    1 
ATOM   5678  C  CD    . LYS A 1  728  ? 111.924 75.151  32.544  1.00 157.97 ? 728  LYS A CD    1 
ATOM   5679  C  CE    . LYS A 1  728  ? 112.458 75.679  33.863  1.00 167.03 ? 728  LYS A CE    1 
ATOM   5680  N  NZ    . LYS A 1  728  ? 111.788 76.944  34.284  1.00 170.99 ? 728  LYS A NZ    1 
ATOM   5681  N  N     . ALA A 1  729  ? 110.922 70.470  31.326  1.00 129.69 ? 729  ALA A N     1 
ATOM   5682  C  CA    . ALA A 1  729  ? 110.415 69.381  32.161  1.00 128.91 ? 729  ALA A CA    1 
ATOM   5683  C  C     . ALA A 1  729  ? 110.985 68.039  31.715  1.00 131.63 ? 729  ALA A C     1 
ATOM   5684  O  O     . ALA A 1  729  ? 111.419 67.247  32.554  1.00 131.04 ? 729  ALA A O     1 
ATOM   5685  C  CB    . ALA A 1  729  ? 108.899 69.361  32.117  1.00 129.51 ? 729  ALA A CB    1 
ATOM   5686  N  N     . GLY A 1  730  ? 111.025 67.826  30.398  1.00 127.59 ? 730  GLY A N     1 
ATOM   5687  C  CA    . GLY A 1  730  ? 111.606 66.637  29.788  1.00 126.29 ? 730  GLY A CA    1 
ATOM   5688  C  C     . GLY A 1  730  ? 113.078 66.531  30.134  1.00 131.07 ? 730  GLY A C     1 
ATOM   5689  O  O     . GLY A 1  730  ? 113.537 65.459  30.533  1.00 130.96 ? 730  GLY A O     1 
ATOM   5690  N  N     . ARG A 1  731  ? 113.818 67.672  30.050  1.00 127.99 ? 731  ARG A N     1 
ATOM   5691  C  CA    . ARG A 1  731  ? 115.248 67.777  30.377  1.00 127.63 ? 731  ARG A CA    1 
ATOM   5692  C  C     . ARG A 1  731  ? 115.526 67.542  31.840  1.00 130.81 ? 731  ARG A C     1 
ATOM   5693  O  O     . ARG A 1  731  ? 116.647 67.168  32.177  1.00 130.22 ? 731  ARG A O     1 
ATOM   5694  C  CB    . ARG A 1  731  ? 115.858 69.100  29.905  1.00 128.96 ? 731  ARG A CB    1 
ATOM   5695  C  CG    . ARG A 1  731  ? 116.412 69.020  28.486  1.00 142.57 ? 731  ARG A CG    1 
ATOM   5696  C  CD    . ARG A 1  731  ? 116.981 70.337  27.987  1.00 159.09 ? 731  ARG A CD    1 
ATOM   5697  N  NE    . ARG A 1  731  ? 115.955 71.271  27.509  1.00 170.14 ? 731  ARG A NE    1 
ATOM   5698  C  CZ    . ARG A 1  731  ? 115.466 72.289  28.215  1.00 185.26 ? 731  ARG A CZ    1 
ATOM   5699  N  NH1   . ARG A 1  731  ? 115.879 72.504  29.461  1.00 171.52 ? 731  ARG A NH1   1 
ATOM   5700  N  NH2   . ARG A 1  731  ? 114.550 73.092  27.686  1.00 171.22 ? 731  ARG A NH2   1 
ATOM   5701  N  N     . LEU A 1  732  ? 114.508 67.719  32.705  1.00 127.57 ? 732  LEU A N     1 
ATOM   5702  C  CA    . LEU A 1  732  ? 114.650 67.458  34.137  1.00 128.64 ? 732  LEU A CA    1 
ATOM   5703  C  C     . LEU A 1  732  ? 114.711 65.958  34.406  1.00 132.79 ? 732  LEU A C     1 
ATOM   5704  O  O     . LEU A 1  732  ? 115.434 65.528  35.319  1.00 134.48 ? 732  LEU A O     1 
ATOM   5705  C  CB    . LEU A 1  732  ? 113.517 68.086  34.971  1.00 129.42 ? 732  LEU A CB    1 
ATOM   5706  C  CG    . LEU A 1  732  ? 113.381 69.604  34.999  1.00 134.12 ? 732  LEU A CG    1 
ATOM   5707  C  CD1   . LEU A 1  732  ? 112.529 70.031  36.166  1.00 134.99 ? 732  LEU A CD1   1 
ATOM   5708  C  CD2   . LEU A 1  732  ? 114.735 70.304  35.048  1.00 136.53 ? 732  LEU A CD2   1 
ATOM   5709  N  N     . ALA A 1  733  ? 113.950 65.167  33.613  1.00 125.87 ? 733  ALA A N     1 
ATOM   5710  C  CA    . ALA A 1  733  ? 113.890 63.719  33.749  1.00 123.88 ? 733  ALA A CA    1 
ATOM   5711  C  C     . ALA A 1  733  ? 115.216 63.059  33.373  1.00 125.92 ? 733  ALA A C     1 
ATOM   5712  O  O     . ALA A 1  733  ? 115.819 62.410  34.228  1.00 124.12 ? 733  ALA A O     1 
ATOM   5713  C  CB    . ALA A 1  733  ? 112.749 63.161  32.917  1.00 123.41 ? 733  ALA A CB    1 
ATOM   5714  N  N     . GLU A 1  734  ? 115.705 63.295  32.125  1.00 123.47 ? 734  GLU A N     1 
ATOM   5715  C  CA    . GLU A 1  734  ? 116.950 62.732  31.569  1.00 123.56 ? 734  GLU A CA    1 
ATOM   5716  C  C     . GLU A 1  734  ? 118.193 62.969  32.432  1.00 130.02 ? 734  GLU A C     1 
ATOM   5717  O  O     . GLU A 1  734  ? 119.218 62.308  32.239  1.00 130.24 ? 734  GLU A O     1 
ATOM   5718  C  CB    . GLU A 1  734  ? 117.173 63.175  30.106  1.00 124.08 ? 734  GLU A CB    1 
ATOM   5719  C  CG    . GLU A 1  734  ? 117.946 64.479  29.936  1.00 140.99 ? 734  GLU A CG    1 
ATOM   5720  C  CD    . GLU A 1  734  ? 118.300 64.883  28.513  1.00 175.31 ? 734  GLU A CD    1 
ATOM   5721  O  OE1   . GLU A 1  734  ? 118.570 63.988  27.676  1.00 173.50 ? 734  GLU A OE1   1 
ATOM   5722  O  OE2   . GLU A 1  734  ? 118.283 66.105  28.232  1.00 171.45 ? 734  GLU A OE2   1 
ATOM   5723  N  N     . VAL A 1  735  ? 118.094 63.910  33.373  1.00 127.70 ? 735  VAL A N     1 
ATOM   5724  C  CA    . VAL A 1  735  ? 119.168 64.267  34.282  1.00 128.67 ? 735  VAL A CA    1 
ATOM   5725  C  C     . VAL A 1  735  ? 119.060 63.440  35.565  1.00 135.21 ? 735  VAL A C     1 
ATOM   5726  O  O     . VAL A 1  735  ? 120.075 62.928  36.049  1.00 135.17 ? 735  VAL A O     1 
ATOM   5727  C  CB    . VAL A 1  735  ? 119.159 65.786  34.511  1.00 133.00 ? 735  VAL A CB    1 
ATOM   5728  C  CG1   . VAL A 1  735  ? 120.057 66.181  35.672  1.00 134.26 ? 735  VAL A CG1   1 
ATOM   5729  C  CG2   . VAL A 1  735  ? 119.581 66.511  33.240  1.00 132.02 ? 735  VAL A CG2   1 
ATOM   5730  N  N     . ASN A 1  736  ? 117.822 63.278  36.079  1.00 133.23 ? 736  ASN A N     1 
ATOM   5731  C  CA    . ASN A 1  736  ? 117.486 62.496  37.280  1.00 133.93 ? 736  ASN A CA    1 
ATOM   5732  C  C     . ASN A 1  736  ? 117.675 60.958  37.095  1.00 135.49 ? 736  ASN A C     1 
ATOM   5733  O  O     . ASN A 1  736  ? 117.870 60.237  38.090  1.00 135.60 ? 736  ASN A O     1 
ATOM   5734  C  CB    . ASN A 1  736  ? 116.055 62.816  37.726  1.00 136.39 ? 736  ASN A CB    1 
ATOM   5735  C  CG    . ASN A 1  736  ? 115.650 62.134  39.004  1.00 162.10 ? 736  ASN A CG    1 
ATOM   5736  O  OD1   . ASN A 1  736  ? 114.898 61.148  39.004  1.00 154.12 ? 736  ASN A OD1   1 
ATOM   5737  N  ND2   . ASN A 1  736  ? 116.204 62.608  40.113  1.00 157.47 ? 736  ASN A ND2   1 
ATOM   5738  N  N     . LEU A 1  737  ? 117.598 60.466  35.827  1.00 128.53 ? 737  LEU A N     1 
ATOM   5739  C  CA    . LEU A 1  737  ? 117.791 59.056  35.483  1.00 125.96 ? 737  LEU A CA    1 
ATOM   5740  C  C     . LEU A 1  737  ? 119.255 58.729  35.643  1.00 129.11 ? 737  LEU A C     1 
ATOM   5741  O  O     . LEU A 1  737  ? 120.105 59.373  35.020  1.00 128.45 ? 737  LEU A O     1 
ATOM   5742  C  CB    . LEU A 1  737  ? 117.354 58.755  34.041  1.00 123.96 ? 737  LEU A CB    1 
ATOM   5743  C  CG    . LEU A 1  737  ? 115.903 59.022  33.673  1.00 127.31 ? 737  LEU A CG    1 
ATOM   5744  C  CD1   . LEU A 1  737  ? 115.629 58.547  32.276  1.00 125.64 ? 737  LEU A CD1   1 
ATOM   5745  C  CD2   . LEU A 1  737  ? 114.933 58.370  34.658  1.00 129.21 ? 737  LEU A CD2   1 
ATOM   5746  N  N     . LYS A 1  738  ? 119.553 57.755  36.509  1.00 125.66 ? 738  LYS A N     1 
ATOM   5747  C  CA    . LYS A 1  738  ? 120.926 57.330  36.801  1.00 125.76 ? 738  LYS A CA    1 
ATOM   5748  C  C     . LYS A 1  738  ? 121.501 56.571  35.612  1.00 128.74 ? 738  LYS A C     1 
ATOM   5749  O  O     . LYS A 1  738  ? 120.758 56.215  34.691  1.00 127.89 ? 738  LYS A O     1 
ATOM   5750  C  CB    . LYS A 1  738  ? 120.995 56.440  38.068  1.00 128.78 ? 738  LYS A CB    1 
ATOM   5751  C  CG    . LYS A 1  738  ? 120.030 56.786  39.201  1.00 136.00 ? 738  LYS A CG    1 
ATOM   5752  C  CD    . LYS A 1  738  ? 118.761 55.941  39.136  1.00 139.56 ? 738  LYS A CD    1 
ATOM   5753  C  CE    . LYS A 1  738  ? 117.955 56.061  40.389  1.00 143.17 ? 738  LYS A CE    1 
ATOM   5754  N  NZ    . LYS A 1  738  ? 118.707 55.530  41.552  1.00 149.78 ? 738  LYS A NZ    1 
ATOM   5755  N  N     . ASP A 1  739  ? 122.811 56.279  35.644  1.00 124.69 ? 739  ASP A N     1 
ATOM   5756  C  CA    . ASP A 1  739  ? 123.464 55.507  34.582  1.00 122.91 ? 739  ASP A CA    1 
ATOM   5757  C  C     . ASP A 1  739  ? 122.945 54.045  34.495  1.00 121.52 ? 739  ASP A C     1 
ATOM   5758  O  O     . ASP A 1  739  ? 123.284 53.315  33.550  1.00 120.08 ? 739  ASP A O     1 
ATOM   5759  C  CB    . ASP A 1  739  ? 124.991 55.558  34.758  1.00 126.13 ? 739  ASP A CB    1 
ATOM   5760  C  CG    . ASP A 1  739  ? 125.653 56.716  34.041  1.00 139.46 ? 739  ASP A CG    1 
ATOM   5761  O  OD1   . ASP A 1  739  ? 125.042 57.813  33.987  1.00 140.67 ? 739  ASP A OD1   1 
ATOM   5762  O  OD2   . ASP A 1  739  ? 126.787 56.535  33.547  1.00 145.96 ? 739  ASP A OD2   1 
ATOM   5763  N  N     . LEU A 1  740  ? 122.115 53.644  35.493  1.00 114.46 ? 740  LEU A N     1 
ATOM   5764  C  CA    . LEU A 1  740  ? 121.493 52.324  35.621  1.00 111.59 ? 740  LEU A CA    1 
ATOM   5765  C  C     . LEU A 1  740  ? 120.131 52.245  34.942  1.00 109.97 ? 740  LEU A C     1 
ATOM   5766  O  O     . LEU A 1  740  ? 119.561 51.155  34.827  1.00 107.67 ? 740  LEU A O     1 
ATOM   5767  C  CB    . LEU A 1  740  ? 121.428 51.862  37.097  1.00 112.55 ? 740  LEU A CB    1 
ATOM   5768  C  CG    . LEU A 1  740  ? 120.610 52.683  38.073  1.00 117.71 ? 740  LEU A CG    1 
ATOM   5769  C  CD1   . LEU A 1  740  ? 119.341 51.976  38.442  1.00 117.66 ? 740  LEU A CD1   1 
ATOM   5770  C  CD2   . LEU A 1  740  ? 121.384 52.926  39.306  1.00 121.47 ? 740  LEU A CD2   1 
ATOM   5771  N  N     . ASN A 1  741  ? 119.621 53.402  34.479  1.00 105.04 ? 741  ASN A N     1 
ATOM   5772  C  CA    . ASN A 1  741  ? 118.339 53.464  33.790  1.00 103.51 ? 741  ASN A CA    1 
ATOM   5773  C  C     . ASN A 1  741  ? 118.497 52.813  32.451  1.00 103.72 ? 741  ASN A C     1 
ATOM   5774  O  O     . ASN A 1  741  ? 119.236 53.299  31.593  1.00 101.65 ? 741  ASN A O     1 
ATOM   5775  C  CB    . ASN A 1  741  ? 117.813 54.886  33.651  1.00 104.14 ? 741  ASN A CB    1 
ATOM   5776  C  CG    . ASN A 1  741  ? 116.348 54.901  33.326  1.00 115.32 ? 741  ASN A CG    1 
ATOM   5777  O  OD1   . ASN A 1  741  ? 115.946 54.798  32.179  1.00 103.66 ? 741  ASN A OD1   1 
ATOM   5778  N  ND2   . ASN A 1  741  ? 115.517 54.947  34.341  1.00 109.84 ? 741  ASN A ND2   1 
ATOM   5779  N  N     . ASN A 1  742  ? 117.852 51.658  32.310  1.00 99.48  ? 742  ASN A N     1 
ATOM   5780  C  CA    . ASN A 1  742  ? 117.927 50.838  31.111  1.00 97.72  ? 742  ASN A CA    1 
ATOM   5781  C  C     . ASN A 1  742  ? 117.561 51.634  29.850  1.00 99.39  ? 742  ASN A C     1 
ATOM   5782  O  O     . ASN A 1  742  ? 118.250 51.491  28.839  1.00 98.33  ? 742  ASN A O     1 
ATOM   5783  C  CB    . ASN A 1  742  ? 117.152 49.529  31.285  1.00 97.23  ? 742  ASN A CB    1 
ATOM   5784  C  CG    . ASN A 1  742  ? 117.524 48.758  32.553  1.00 119.55 ? 742  ASN A CG    1 
ATOM   5785  O  OD1   . ASN A 1  742  ? 118.469 47.952  32.591  1.00 116.20 ? 742  ASN A OD1   1 
ATOM   5786  N  ND2   . ASN A 1  742  ? 116.745 48.943  33.606  1.00 107.80 ? 742  ASN A ND2   1 
ATOM   5787  N  N     . VAL A 1  743  ? 116.556 52.545  29.942  1.00 94.41  ? 743  VAL A N     1 
ATOM   5788  C  CA    . VAL A 1  743  ? 116.159 53.412  28.821  1.00 92.77  ? 743  VAL A CA    1 
ATOM   5789  C  C     . VAL A 1  743  ? 117.354 54.304  28.453  1.00 97.95  ? 743  VAL A C     1 
ATOM   5790  O  O     . VAL A 1  743  ? 117.820 54.259  27.315  1.00 97.37  ? 743  VAL A O     1 
ATOM   5791  C  CB    . VAL A 1  743  ? 114.855 54.222  29.074  1.00 95.51  ? 743  VAL A CB    1 
ATOM   5792  C  CG1   . VAL A 1  743  ? 114.498 55.099  27.869  1.00 94.07  ? 743  VAL A CG1   1 
ATOM   5793  C  CG2   . VAL A 1  743  ? 113.693 53.301  29.450  1.00 94.92  ? 743  VAL A CG2   1 
ATOM   5794  N  N     . LYS A 1  744  ? 117.907 55.023  29.448  1.00 95.80  ? 744  LYS A N     1 
ATOM   5795  C  CA    . LYS A 1  744  ? 119.082 55.886  29.307  1.00 95.57  ? 744  LYS A CA    1 
ATOM   5796  C  C     . LYS A 1  744  ? 120.200 55.051  28.678  1.00 97.71  ? 744  LYS A C     1 
ATOM   5797  O  O     . LYS A 1  744  ? 120.810 55.500  27.716  1.00 95.66  ? 744  LYS A O     1 
ATOM   5798  C  CB    . LYS A 1  744  ? 119.506 56.454  30.687  1.00 99.23  ? 744  LYS A CB    1 
ATOM   5799  C  CG    . LYS A 1  744  ? 120.211 57.797  30.627  1.00 110.79 ? 744  LYS A CG    1 
ATOM   5800  C  CD    . LYS A 1  744  ? 120.650 58.330  31.995  1.00 120.21 ? 744  LYS A CD    1 
ATOM   5801  C  CE    . LYS A 1  744  ? 121.476 59.600  31.852  1.00 128.30 ? 744  LYS A CE    1 
ATOM   5802  N  NZ    . LYS A 1  744  ? 121.937 60.137  33.160  1.00 136.21 ? 744  LYS A NZ    1 
ATOM   5803  N  N     . GLN A 1  745  ? 120.371 53.790  29.153  1.00 94.83  ? 745  GLN A N     1 
ATOM   5804  C  CA    . GLN A 1  745  ? 121.383 52.845  28.674  1.00 94.70  ? 745  GLN A CA    1 
ATOM   5805  C  C     . GLN A 1  745  ? 121.264 52.532  27.173  1.00 99.47  ? 745  GLN A C     1 
ATOM   5806  O  O     . GLN A 1  745  ? 122.280 52.270  26.509  1.00 99.24  ? 745  GLN A O     1 
ATOM   5807  C  CB    . GLN A 1  745  ? 121.390 51.559  29.516  1.00 95.97  ? 745  GLN A CB    1 
ATOM   5808  C  CG    . GLN A 1  745  ? 122.131 51.663  30.839  1.00 106.04 ? 745  GLN A CG    1 
ATOM   5809  C  CD    . GLN A 1  745  ? 122.248 50.306  31.501  1.00 130.90 ? 745  GLN A CD    1 
ATOM   5810  O  OE1   . GLN A 1  745  ? 123.313 49.687  31.503  1.00 127.03 ? 745  GLN A OE1   1 
ATOM   5811  N  NE2   . GLN A 1  745  ? 121.156 49.799  32.071  1.00 126.60 ? 745  GLN A NE2   1 
ATOM   5812  N  N     . MET A 1  746  ? 120.025 52.547  26.649  1.00 95.45  ? 746  MET A N     1 
ATOM   5813  C  CA    . MET A 1  746  ? 119.772 52.298  25.232  1.00 93.61  ? 746  MET A CA    1 
ATOM   5814  C  C     . MET A 1  746  ? 119.958 53.589  24.464  1.00 99.43  ? 746  MET A C     1 
ATOM   5815  O  O     . MET A 1  746  ? 120.512 53.569  23.363  1.00 99.19  ? 746  MET A O     1 
ATOM   5816  C  CB    . MET A 1  746  ? 118.387 51.689  25.001  1.00 94.52  ? 746  MET A CB    1 
ATOM   5817  C  CG    . MET A 1  746  ? 118.353 50.195  25.246  1.00 96.32  ? 746  MET A CG    1 
ATOM   5818  S  SD    . MET A 1  746  ? 116.689 49.523  25.122  1.00 98.59  ? 746  MET A SD    1 
ATOM   5819  C  CE    . MET A 1  746  ? 115.966 50.152  26.642  1.00 95.98  ? 746  MET A CE    1 
ATOM   5820  N  N     . VAL A 1  747  ? 119.569 54.721  25.074  1.00 97.30  ? 747  VAL A N     1 
ATOM   5821  C  CA    . VAL A 1  747  ? 119.751 56.046  24.479  1.00 97.31  ? 747  VAL A CA    1 
ATOM   5822  C  C     . VAL A 1  747  ? 121.245 56.332  24.395  1.00 103.29 ? 747  VAL A C     1 
ATOM   5823  O  O     . VAL A 1  747  ? 121.700 56.874  23.393  1.00 102.12 ? 747  VAL A O     1 
ATOM   5824  C  CB    . VAL A 1  747  ? 118.984 57.150  25.242  1.00 101.32 ? 747  VAL A CB    1 
ATOM   5825  C  CG1   . VAL A 1  747  ? 119.118 58.491  24.542  1.00 100.75 ? 747  VAL A CG1   1 
ATOM   5826  C  CG2   . VAL A 1  747  ? 117.511 56.787  25.388  1.00 101.12 ? 747  VAL A CG2   1 
ATOM   5827  N  N     . MET A 1  748  ? 122.005 55.887  25.403  1.00 103.38 ? 748  MET A N     1 
ATOM   5828  C  CA    . MET A 1  748  ? 123.444 56.084  25.463  1.00 105.83 ? 748  MET A CA    1 
ATOM   5829  C  C     . MET A 1  748  ? 124.168 55.337  24.382  1.00 107.62 ? 748  MET A C     1 
ATOM   5830  O  O     . MET A 1  748  ? 124.960 55.949  23.668  1.00 107.41 ? 748  MET A O     1 
ATOM   5831  C  CB    . MET A 1  748  ? 124.009 55.741  26.840  1.00 110.89 ? 748  MET A CB    1 
ATOM   5832  C  CG    . MET A 1  748  ? 123.629 56.747  27.915  1.00 118.19 ? 748  MET A CG    1 
ATOM   5833  S  SD    . MET A 1  748  ? 124.442 56.392  29.498  1.00 126.27 ? 748  MET A SD    1 
ATOM   5834  C  CE    . MET A 1  748  ? 123.151 55.567  30.398  1.00 123.21 ? 748  MET A CE    1 
ATOM   5835  N  N     . ALA A 1  749  ? 123.882 54.034  24.223  1.00 103.06 ? 749  ALA A N     1 
ATOM   5836  C  CA    . ALA A 1  749  ? 124.520 53.212  23.192  1.00 101.75 ? 749  ALA A CA    1 
ATOM   5837  C  C     . ALA A 1  749  ? 124.047 53.641  21.815  1.00 104.82 ? 749  ALA A C     1 
ATOM   5838  O  O     . ALA A 1  749  ? 124.800 53.539  20.850  1.00 104.25 ? 749  ALA A O     1 
ATOM   5839  C  CB    . ALA A 1  749  ? 124.209 51.741  23.420  1.00 102.01 ? 749  ALA A CB    1 
ATOM   5840  N  N     . GLY A 1  750  ? 122.827 54.172  21.760  1.00 101.09 ? 750  GLY A N     1 
ATOM   5841  C  CA    . GLY A 1  750  ? 122.183 54.605  20.528  1.00 100.20 ? 750  GLY A CA    1 
ATOM   5842  C  C     . GLY A 1  750  ? 121.480 53.442  19.854  1.00 102.93 ? 750  GLY A C     1 
ATOM   5843  O  O     . GLY A 1  750  ? 121.047 53.561  18.703  1.00 101.91 ? 750  GLY A O     1 
ATOM   5844  N  N     . SER A 1  751  ? 121.369 52.297  20.584  1.00 98.75  ? 751  SER A N     1 
ATOM   5845  C  CA    . SER A 1  751  ? 120.720 51.056  20.151  1.00 97.01  ? 751  SER A CA    1 
ATOM   5846  C  C     . SER A 1  751  ? 119.236 51.248  19.859  1.00 98.87  ? 751  SER A C     1 
ATOM   5847  O  O     . SER A 1  751  ? 118.774 50.700  18.865  1.00 98.12  ? 751  SER A O     1 
ATOM   5848  C  CB    . SER A 1  751  ? 120.996 49.900  21.113  1.00 100.85 ? 751  SER A CB    1 
ATOM   5849  O  OG    . SER A 1  751  ? 120.544 50.141  22.435  1.00 111.11 ? 751  SER A OG    1 
ATOM   5850  N  N     . LYS A 1  752  ? 118.515 52.059  20.679  1.00 95.12  ? 752  LYS A N     1 
ATOM   5851  C  CA    . LYS A 1  752  ? 117.117 52.506  20.510  1.00 94.66  ? 752  LYS A CA    1 
ATOM   5852  C  C     . LYS A 1  752  ? 116.803 53.664  21.423  1.00 102.05 ? 752  LYS A C     1 
ATOM   5853  O  O     . LYS A 1  752  ? 117.364 53.778  22.518  1.00 101.59 ? 752  LYS A O     1 
ATOM   5854  C  CB    . LYS A 1  752  ? 116.069 51.404  20.721  1.00 95.46  ? 752  LYS A CB    1 
ATOM   5855  C  CG    . LYS A 1  752  ? 115.549 50.781  19.436  1.00 99.68  ? 752  LYS A CG    1 
ATOM   5856  C  CD    . LYS A 1  752  ? 114.477 51.563  18.707  1.00 106.43 ? 752  LYS A CD    1 
ATOM   5857  C  CE    . LYS A 1  752  ? 114.115 50.944  17.349  1.00 119.18 ? 752  LYS A CE    1 
ATOM   5858  N  NZ    . LYS A 1  752  ? 113.272 49.698  17.410  1.00 122.37 ? 752  LYS A NZ    1 
ATOM   5859  N  N     . GLY A 1  753  ? 115.887 54.505  20.967  1.00 101.71 ? 753  GLY A N     1 
ATOM   5860  C  CA    . GLY A 1  753  ? 115.397 55.636  21.747  1.00 103.71 ? 753  GLY A CA    1 
ATOM   5861  C  C     . GLY A 1  753  ? 116.266 56.870  21.756  1.00 109.76 ? 753  GLY A C     1 
ATOM   5862  O  O     . GLY A 1  753  ? 117.468 56.791  21.471  1.00 109.77 ? 753  GLY A O     1 
ATOM   5863  N  N     . SER A 1  754  ? 115.629 58.018  22.122  1.00 107.23 ? 754  SER A N     1 
ATOM   5864  C  CA    . SER A 1  754  ? 116.182 59.380  22.181  1.00 107.73 ? 754  SER A CA    1 
ATOM   5865  C  C     . SER A 1  754  ? 115.592 60.167  23.358  1.00 112.35 ? 754  SER A C     1 
ATOM   5866  O  O     . SER A 1  754  ? 114.728 59.643  24.064  1.00 111.62 ? 754  SER A O     1 
ATOM   5867  C  CB    . SER A 1  754  ? 115.853 60.118  20.890  1.00 111.69 ? 754  SER A CB    1 
ATOM   5868  O  OG    . SER A 1  754  ? 114.447 60.198  20.705  1.00 122.94 ? 754  SER A OG    1 
ATOM   5869  N  N     . PHE A 1  755  ? 116.025 61.440  23.535  1.00 110.29 ? 755  PHE A N     1 
ATOM   5870  C  CA    . PHE A 1  755  ? 115.559 62.307  24.620  1.00 111.65 ? 755  PHE A CA    1 
ATOM   5871  C  C     . PHE A 1  755  ? 114.056 62.424  24.654  1.00 112.97 ? 755  PHE A C     1 
ATOM   5872  O  O     . PHE A 1  755  ? 113.453 62.263  25.718  1.00 112.83 ? 755  PHE A O     1 
ATOM   5873  C  CB    . PHE A 1  755  ? 116.187 63.714  24.532  1.00 115.12 ? 755  PHE A CB    1 
ATOM   5874  C  CG    . PHE A 1  755  ? 115.418 64.817  25.243  1.00 118.86 ? 755  PHE A CG    1 
ATOM   5875  C  CD1   . PHE A 1  755  ? 115.539 65.002  26.612  1.00 123.95 ? 755  PHE A CD1   1 
ATOM   5876  C  CD2   . PHE A 1  755  ? 114.572 65.670  24.536  1.00 121.86 ? 755  PHE A CD2   1 
ATOM   5877  C  CE1   . PHE A 1  755  ? 114.815 66.009  27.265  1.00 126.20 ? 755  PHE A CE1   1 
ATOM   5878  C  CE2   . PHE A 1  755  ? 113.843 66.675  25.192  1.00 125.85 ? 755  PHE A CE2   1 
ATOM   5879  C  CZ    . PHE A 1  755  ? 113.970 66.840  26.552  1.00 125.06 ? 755  PHE A CZ    1 
ATOM   5880  N  N     . ILE A 1  756  ? 113.460 62.736  23.492  1.00 107.58 ? 756  ILE A N     1 
ATOM   5881  C  CA    . ILE A 1  756  ? 112.025 62.968  23.344  1.00 106.93 ? 756  ILE A CA    1 
ATOM   5882  C  C     . ILE A 1  756  ? 111.126 61.858  23.914  1.00 109.27 ? 756  ILE A C     1 
ATOM   5883  O  O     . ILE A 1  756  ? 110.101 62.155  24.543  1.00 109.70 ? 756  ILE A O     1 
ATOM   5884  C  CB    . ILE A 1  756  ? 111.690 63.457  21.915  1.00 109.19 ? 756  ILE A CB    1 
ATOM   5885  C  CG1   . ILE A 1  756  ? 110.552 64.513  21.855  1.00 110.39 ? 756  ILE A CG1   1 
ATOM   5886  C  CG2   . ILE A 1  756  ? 111.646 62.362  20.870  1.00 108.52 ? 756  ILE A CG2   1 
ATOM   5887  C  CD1   . ILE A 1  756  ? 109.111 64.060  22.034  1.00 118.55 ? 756  ILE A CD1   1 
ATOM   5888  N  N     . ASN A 1  757  ? 111.565 60.592  23.771  1.00 103.13 ? 757  ASN A N     1 
ATOM   5889  C  CA    . ASN A 1  757  ? 110.855 59.436  24.304  1.00 101.51 ? 757  ASN A CA    1 
ATOM   5890  C  C     . ASN A 1  757  ? 110.862 59.482  25.838  1.00 103.49 ? 757  ASN A C     1 
ATOM   5891  O  O     . ASN A 1  757  ? 109.788 59.406  26.424  1.00 103.47 ? 757  ASN A O     1 
ATOM   5892  C  CB    . ASN A 1  757  ? 111.416 58.133  23.739  1.00 100.75 ? 757  ASN A CB    1 
ATOM   5893  C  CG    . ASN A 1  757  ? 111.445 58.076  22.224  1.00 123.92 ? 757  ASN A CG    1 
ATOM   5894  O  OD1   . ASN A 1  757  ? 112.512 58.020  21.598  1.00 116.64 ? 757  ASN A OD1   1 
ATOM   5895  N  ND2   . ASN A 1  757  ? 110.277 58.099  21.594  1.00 117.85 ? 757  ASN A ND2   1 
ATOM   5896  N  N     . ILE A 1  758  ? 112.037 59.724  26.475  1.00 98.71  ? 758  ILE A N     1 
ATOM   5897  C  CA    . ILE A 1  758  ? 112.173 59.874  27.937  1.00 99.19  ? 758  ILE A CA    1 
ATOM   5898  C  C     . ILE A 1  758  ? 111.216 60.990  28.390  1.00 106.16 ? 758  ILE A C     1 
ATOM   5899  O  O     . ILE A 1  758  ? 110.414 60.797  29.317  1.00 105.74 ? 758  ILE A O     1 
ATOM   5900  C  CB    . ILE A 1  758  ? 113.644 60.202  28.342  1.00 101.67 ? 758  ILE A CB    1 
ATOM   5901  C  CG1   . ILE A 1  758  ? 114.575 59.014  28.127  1.00 100.59 ? 758  ILE A CG1   1 
ATOM   5902  C  CG2   . ILE A 1  758  ? 113.743 60.712  29.776  1.00 102.93 ? 758  ILE A CG2   1 
ATOM   5903  C  CD1   . ILE A 1  758  ? 116.056 59.398  27.995  1.00 103.82 ? 758  ILE A CD1   1 
ATOM   5904  N  N     . ALA A 1  759  ? 111.292 62.137  27.687  1.00 104.91 ? 759  ALA A N     1 
ATOM   5905  C  CA    . ALA A 1  759  ? 110.494 63.334  27.924  1.00 106.82 ? 759  ALA A CA    1 
ATOM   5906  C  C     . ALA A 1  759  ? 108.989 63.051  28.014  1.00 112.14 ? 759  ALA A C     1 
ATOM   5907  O  O     . ALA A 1  759  ? 108.378 63.337  29.051  1.00 113.05 ? 759  ALA A O     1 
ATOM   5908  C  CB    . ALA A 1  759  ? 110.777 64.371  26.842  1.00 107.39 ? 759  ALA A CB    1 
ATOM   5909  N  N     . GLN A 1  760  ? 108.409 62.465  26.947  1.00 107.62 ? 760  GLN A N     1 
ATOM   5910  C  CA    . GLN A 1  760  ? 106.978 62.162  26.869  1.00 107.38 ? 760  GLN A CA    1 
ATOM   5911  C  C     . GLN A 1  760  ? 106.497 61.047  27.826  1.00 113.33 ? 760  GLN A C     1 
ATOM   5912  O  O     . GLN A 1  760  ? 105.385 61.134  28.363  1.00 114.24 ? 760  GLN A O     1 
ATOM   5913  C  CB    . GLN A 1  760  ? 106.573 61.863  25.422  1.00 106.89 ? 760  GLN A CB    1 
ATOM   5914  C  CG    . GLN A 1  760  ? 106.503 63.101  24.543  1.00 107.62 ? 760  GLN A CG    1 
ATOM   5915  C  CD    . GLN A 1  760  ? 105.940 62.807  23.178  1.00 122.82 ? 760  GLN A CD    1 
ATOM   5916  O  OE1   . GLN A 1  760  ? 106.265 61.792  22.545  1.00 118.86 ? 760  GLN A OE1   1 
ATOM   5917  N  NE2   . GLN A 1  760  ? 105.104 63.710  22.676  1.00 111.02 ? 760  GLN A NE2   1 
ATOM   5918  N  N     . MET A 1  761  ? 107.333 60.012  28.031  1.00 108.81 ? 761  MET A N     1 
ATOM   5919  C  CA    . MET A 1  761  ? 107.021 58.863  28.871  1.00 108.49 ? 761  MET A CA    1 
ATOM   5920  C  C     . MET A 1  761  ? 107.040 59.169  30.350  1.00 113.75 ? 761  MET A C     1 
ATOM   5921  O  O     . MET A 1  761  ? 106.173 58.693  31.092  1.00 112.62 ? 761  MET A O     1 
ATOM   5922  C  CB    . MET A 1  761  ? 108.046 57.761  28.618  1.00 110.13 ? 761  MET A CB    1 
ATOM   5923  C  CG    . MET A 1  761  ? 107.709 56.874  27.462  1.00 112.47 ? 761  MET A CG    1 
ATOM   5924  S  SD    . MET A 1  761  ? 108.671 55.349  27.506  1.00 115.63 ? 761  MET A SD    1 
ATOM   5925  C  CE    . MET A 1  761  ? 110.158 55.859  26.599  1.00 111.68 ? 761  MET A CE    1 
ATOM   5926  N  N     . SER A 1  762  ? 108.063 59.923  30.782  1.00 112.27 ? 762  SER A N     1 
ATOM   5927  C  CA    . SER A 1  762  ? 108.332 60.218  32.188  1.00 114.14 ? 762  SER A CA    1 
ATOM   5928  C  C     . SER A 1  762  ? 107.806 61.542  32.741  1.00 118.98 ? 762  SER A C     1 
ATOM   5929  O  O     . SER A 1  762  ? 107.221 61.549  33.835  1.00 118.38 ? 762  SER A O     1 
ATOM   5930  C  CB    . SER A 1  762  ? 109.827 60.094  32.454  1.00 118.18 ? 762  SER A CB    1 
ATOM   5931  O  OG    . SER A 1  762  ? 110.330 58.968  31.753  1.00 126.00 ? 762  SER A OG    1 
ATOM   5932  N  N     . ALA A 1  763  ? 108.032 62.654  31.990  1.00 116.19 ? 763  ALA A N     1 
ATOM   5933  C  CA    . ALA A 1  763  ? 107.688 64.030  32.371  1.00 117.27 ? 763  ALA A CA    1 
ATOM   5934  C  C     . ALA A 1  763  ? 106.315 64.589  31.907  1.00 122.49 ? 763  ALA A C     1 
ATOM   5935  O  O     . ALA A 1  763  ? 105.407 64.772  32.741  1.00 123.15 ? 763  ALA A O     1 
ATOM   5936  C  CB    . ALA A 1  763  ? 108.821 64.979  31.980  1.00 117.83 ? 763  ALA A CB    1 
ATOM   5937  N  N     . CYS A 1  764  ? 106.175 64.882  30.591  1.00 118.11 ? 764  CYS A N     1 
ATOM   5938  C  CA    . CYS A 1  764  ? 104.975 65.494  30.024  1.00 117.65 ? 764  CYS A CA    1 
ATOM   5939  C  C     . CYS A 1  764  ? 104.926 65.303  28.507  1.00 116.52 ? 764  CYS A C     1 
ATOM   5940  O  O     . CYS A 1  764  ? 105.910 65.613  27.837  1.00 115.13 ? 764  CYS A O     1 
ATOM   5941  C  CB    . CYS A 1  764  ? 104.937 66.973  30.411  1.00 119.96 ? 764  CYS A CB    1 
ATOM   5942  S  SG    . CYS A 1  764  ? 104.015 68.031  29.268  1.00 124.22 ? 764  CYS A SG    1 
ATOM   5943  N  N     . VAL A 1  765  ? 103.765 64.844  27.973  1.00 110.97 ? 765  VAL A N     1 
ATOM   5944  C  CA    . VAL A 1  765  ? 103.519 64.591  26.539  1.00 109.01 ? 765  VAL A CA    1 
ATOM   5945  C  C     . VAL A 1  765  ? 103.694 65.863  25.712  1.00 113.20 ? 765  VAL A C     1 
ATOM   5946  O  O     . VAL A 1  765  ? 104.516 65.885  24.809  1.00 111.99 ? 765  VAL A O     1 
ATOM   5947  C  CB    . VAL A 1  765  ? 102.179 63.849  26.245  1.00 111.91 ? 765  VAL A CB    1 
ATOM   5948  C  CG1   . VAL A 1  765  ? 101.875 63.790  24.751  1.00 110.49 ? 765  VAL A CG1   1 
ATOM   5949  C  CG2   . VAL A 1  765  ? 102.183 62.446  26.829  1.00 111.42 ? 765  VAL A CG2   1 
ATOM   5950  N  N     . GLY A 1  766  ? 102.927 66.894  26.018  1.00 111.77 ? 766  GLY A N     1 
ATOM   5951  C  CA    . GLY A 1  766  ? 103.053 68.167  25.325  1.00 112.69 ? 766  GLY A CA    1 
ATOM   5952  C  C     . GLY A 1  766  ? 101.880 68.640  24.499  1.00 118.26 ? 766  GLY A C     1 
ATOM   5953  O  O     . GLY A 1  766  ? 100.804 68.036  24.513  1.00 117.66 ? 766  GLY A O     1 
ATOM   5954  N  N     . GLN A 1  767  ? 102.099 69.769  23.793  1.00 115.84 ? 767  GLN A N     1 
ATOM   5955  C  CA    . GLN A 1  767  ? 101.105 70.401  22.931  1.00 115.02 ? 767  GLN A CA    1 
ATOM   5956  C  C     . GLN A 1  767  ? 100.875 69.542  21.685  1.00 118.13 ? 767  GLN A C     1 
ATOM   5957  O  O     . GLN A 1  767  ? 101.831 69.053  21.073  1.00 116.66 ? 767  GLN A O     1 
ATOM   5958  C  CB    . GLN A 1  767  ? 101.508 71.850  22.581  1.00 115.92 ? 767  GLN A CB    1 
ATOM   5959  C  CG    . GLN A 1  767  ? 100.511 72.621  21.699  1.00 116.01 ? 767  GLN A CG    1 
ATOM   5960  C  CD    . GLN A 1  767  ? 99.099  72.755  22.244  1.00 136.69 ? 767  GLN A CD    1 
ATOM   5961  O  OE1   . GLN A 1  767  ? 98.813  73.482  23.222  1.00 134.63 ? 767  GLN A OE1   1 
ATOM   5962  N  NE2   . GLN A 1  767  ? 98.167  72.107  21.560  1.00 125.24 ? 767  GLN A NE2   1 
ATOM   5963  N  N     . GLN A 1  768  ? 99.590  69.320  21.369  1.00 114.50 ? 768  GLN A N     1 
ATOM   5964  C  CA    . GLN A 1  768  ? 99.105  68.557  20.224  1.00 112.89 ? 768  GLN A CA    1 
ATOM   5965  C  C     . GLN A 1  768  ? 98.836  69.503  19.053  1.00 118.09 ? 768  GLN A C     1 
ATOM   5966  O  O     . GLN A 1  768  ? 98.280  70.591  19.258  1.00 119.59 ? 768  GLN A O     1 
ATOM   5967  C  CB    . GLN A 1  768  ? 97.837  67.773  20.619  1.00 113.53 ? 768  GLN A CB    1 
ATOM   5968  C  CG    . GLN A 1  768  ? 98.044  66.268  20.739  1.00 114.63 ? 768  GLN A CG    1 
ATOM   5969  C  CD    . GLN A 1  768  ? 99.303  65.835  21.465  1.00 129.06 ? 768  GLN A CD    1 
ATOM   5970  O  OE1   . GLN A 1  768  ? 100.155 65.110  20.920  1.00 121.47 ? 768  GLN A OE1   1 
ATOM   5971  N  NE2   . GLN A 1  768  ? 99.461  66.278  22.702  1.00 122.97 ? 768  GLN A NE2   1 
ATOM   5972  N  N     . SER A 1  769  ? 99.252  69.111  17.837  1.00 113.16 ? 769  SER A N     1 
ATOM   5973  C  CA    . SER A 1  769  ? 99.045  69.950  16.666  1.00 113.16 ? 769  SER A CA    1 
ATOM   5974  C  C     . SER A 1  769  ? 98.365  69.249  15.514  1.00 116.06 ? 769  SER A C     1 
ATOM   5975  O  O     . SER A 1  769  ? 98.717  68.121  15.154  1.00 115.13 ? 769  SER A O     1 
ATOM   5976  C  CB    . SER A 1  769  ? 100.362 70.552  16.192  1.00 118.26 ? 769  SER A CB    1 
ATOM   5977  O  OG    . SER A 1  769  ? 100.608 70.285  14.816  1.00 130.16 ? 769  SER A OG    1 
ATOM   5978  N  N     . VAL A 1  770  ? 97.437  69.966  14.889  1.00 112.37 ? 770  VAL A N     1 
ATOM   5979  C  CA    . VAL A 1  770  ? 96.756  69.528  13.682  1.00 111.23 ? 770  VAL A CA    1 
ATOM   5980  C  C     . VAL A 1  770  ? 96.957  70.671  12.696  1.00 117.54 ? 770  VAL A C     1 
ATOM   5981  O  O     . VAL A 1  770  ? 96.403  71.759  12.902  1.00 118.93 ? 770  VAL A O     1 
ATOM   5982  C  CB    . VAL A 1  770  ? 95.274  69.185  13.913  1.00 114.38 ? 770  VAL A CB    1 
ATOM   5983  C  CG1   . VAL A 1  770  ? 94.573  68.899  12.589  1.00 113.27 ? 770  VAL A CG1   1 
ATOM   5984  C  CG2   . VAL A 1  770  ? 95.133  68.001  14.862  1.00 113.93 ? 770  VAL A CG2   1 
ATOM   5985  N  N     . GLU A 1  771  ? 97.800  70.442  11.662  1.00 113.25 ? 771  GLU A N     1 
ATOM   5986  C  CA    . GLU A 1  771  ? 98.177  71.436  10.643  1.00 112.74 ? 771  GLU A CA    1 
ATOM   5987  C  C     . GLU A 1  771  ? 99.017  72.565  11.274  1.00 115.35 ? 771  GLU A C     1 
ATOM   5988  O  O     . GLU A 1  771  ? 98.872  73.726  10.901  1.00 115.27 ? 771  GLU A O     1 
ATOM   5989  C  CB    . GLU A 1  771  ? 96.946  71.987  9.870   1.00 114.70 ? 771  GLU A CB    1 
ATOM   5990  C  CG    . GLU A 1  771  ? 96.254  70.963  8.977   1.00 129.64 ? 771  GLU A CG    1 
ATOM   5991  C  CD    . GLU A 1  771  ? 94.807  71.232  8.591   1.00 162.03 ? 771  GLU A CD    1 
ATOM   5992  O  OE1   . GLU A 1  771  ? 94.346  72.391  8.724   1.00 168.72 ? 771  GLU A OE1   1 
ATOM   5993  O  OE2   . GLU A 1  771  ? 94.133  70.274  8.145   1.00 155.43 ? 771  GLU A OE2   1 
ATOM   5994  N  N     . GLY A 1  772  ? 99.880  72.209  12.228  1.00 111.35 ? 772  GLY A N     1 
ATOM   5995  C  CA    . GLY A 1  772  ? 100.739 73.160  12.937  1.00 111.99 ? 772  GLY A CA    1 
ATOM   5996  C  C     . GLY A 1  772  ? 100.007 73.926  14.028  1.00 116.89 ? 772  GLY A C     1 
ATOM   5997  O  O     . GLY A 1  772  ? 100.530 74.154  15.133  1.00 118.11 ? 772  GLY A O     1 
ATOM   5998  N  N     . LYS A 1  773  ? 98.774  74.306  13.711  1.00 111.57 ? 773  LYS A N     1 
ATOM   5999  C  CA    . LYS A 1  773  ? 97.874  75.020  14.589  1.00 111.54 ? 773  LYS A CA    1 
ATOM   6000  C  C     . LYS A 1  773  ? 97.320  74.048  15.653  1.00 112.49 ? 773  LYS A C     1 
ATOM   6001  O  O     . LYS A 1  773  ? 96.881  72.938  15.328  1.00 110.45 ? 773  LYS A O     1 
ATOM   6002  C  CB    . LYS A 1  773  ? 96.749  75.654  13.746  1.00 114.71 ? 773  LYS A CB    1 
ATOM   6003  C  CG    . LYS A 1  773  ? 97.264  76.586  12.639  1.00 134.94 ? 773  LYS A CG    1 
ATOM   6004  C  CD    . LYS A 1  773  ? 96.500  76.441  11.310  1.00 148.07 ? 773  LYS A CD    1 
ATOM   6005  C  CE    . LYS A 1  773  ? 97.376  76.297  10.066  1.00 160.17 ? 773  LYS A CE    1 
ATOM   6006  N  NZ    . LYS A 1  773  ? 98.370  77.399  9.886   1.00 168.59 ? 773  LYS A NZ    1 
ATOM   6007  N  N     . ARG A 1  774  ? 97.375  74.466  16.930  1.00 108.24 ? 774  ARG A N     1 
ATOM   6008  C  CA    . ARG A 1  774  ? 96.849  73.705  18.067  1.00 107.33 ? 774  ARG A CA    1 
ATOM   6009  C  C     . ARG A 1  774  ? 95.347  73.504  17.905  1.00 110.28 ? 774  ARG A C     1 
ATOM   6010  O  O     . ARG A 1  774  ? 94.707  74.296  17.222  1.00 109.34 ? 774  ARG A O     1 
ATOM   6011  C  CB    . ARG A 1  774  ? 97.191  74.374  19.404  1.00 107.58 ? 774  ARG A CB    1 
ATOM   6012  C  CG    . ARG A 1  774  ? 97.091  75.893  19.416  1.00 117.42 ? 774  ARG A CG    1 
ATOM   6013  C  CD    . ARG A 1  774  ? 97.968  76.465  20.503  1.00 124.78 ? 774  ARG A CD    1 
ATOM   6014  N  NE    . ARG A 1  774  ? 97.271  76.593  21.781  1.00 131.23 ? 774  ARG A NE    1 
ATOM   6015  C  CZ    . ARG A 1  774  ? 96.935  77.753  22.331  1.00 138.51 ? 774  ARG A CZ    1 
ATOM   6016  N  NH1   . ARG A 1  774  ? 97.248  78.895  21.732  1.00 121.76 ? 774  ARG A NH1   1 
ATOM   6017  N  NH2   . ARG A 1  774  ? 96.305  77.783  23.496  1.00 119.94 ? 774  ARG A NH2   1 
ATOM   6018  N  N     . ILE A 1  775  ? 94.803  72.419  18.479  1.00 107.17 ? 775  ILE A N     1 
ATOM   6019  C  CA    . ILE A 1  775  ? 93.402  71.994  18.359  1.00 106.96 ? 775  ILE A CA    1 
ATOM   6020  C  C     . ILE A 1  775  ? 92.420  73.123  18.102  1.00 113.13 ? 775  ILE A C     1 
ATOM   6021  O  O     . ILE A 1  775  ? 92.247  73.995  18.952  1.00 113.61 ? 775  ILE A O     1 
ATOM   6022  C  CB    . ILE A 1  775  ? 92.963  71.025  19.489  1.00 109.80 ? 775  ILE A CB    1 
ATOM   6023  C  CG1   . ILE A 1  775  ? 93.981  69.865  19.709  1.00 108.67 ? 775  ILE A CG1   1 
ATOM   6024  C  CG2   . ILE A 1  775  ? 91.528  70.520  19.288  1.00 110.85 ? 775  ILE A CG2   1 
ATOM   6025  C  CD1   . ILE A 1  775  ? 94.293  68.955  18.501  1.00 109.91 ? 775  ILE A CD1   1 
ATOM   6026  N  N     . ALA A 1  776  ? 91.812  73.117  16.904  1.00 110.92 ? 776  ALA A N     1 
ATOM   6027  C  CA    . ALA A 1  776  ? 90.857  74.141  16.461  1.00 112.38 ? 776  ALA A CA    1 
ATOM   6028  C  C     . ALA A 1  776  ? 89.486  74.085  17.148  1.00 118.21 ? 776  ALA A C     1 
ATOM   6029  O  O     . ALA A 1  776  ? 89.203  73.173  17.923  1.00 117.36 ? 776  ALA A O     1 
ATOM   6030  C  CB    . ALA A 1  776  ? 90.689  74.070  14.950  1.00 112.51 ? 776  ALA A CB    1 
ATOM   6031  N  N     . PHE A 1  777  ? 88.636  75.068  16.858  1.00 117.47 ? 777  PHE A N     1 
ATOM   6032  C  CA    . PHE A 1  777  ? 87.294  75.098  17.407  1.00 119.44 ? 777  PHE A CA    1 
ATOM   6033  C  C     . PHE A 1  777  ? 86.355  74.423  16.403  1.00 122.78 ? 777  PHE A C     1 
ATOM   6034  O  O     . PHE A 1  777  ? 85.831  75.091  15.512  1.00 122.72 ? 777  PHE A O     1 
ATOM   6035  C  CB    . PHE A 1  777  ? 86.839  76.551  17.718  1.00 123.48 ? 777  PHE A CB    1 
ATOM   6036  C  CG    . PHE A 1  777  ? 87.550  77.344  18.802  1.00 126.94 ? 777  PHE A CG    1 
ATOM   6037  C  CD1   . PHE A 1  777  ? 88.236  76.703  19.826  1.00 131.42 ? 777  PHE A CD1   1 
ATOM   6038  C  CD2   . PHE A 1  777  ? 87.479  78.730  18.830  1.00 130.76 ? 777  PHE A CD2   1 
ATOM   6039  C  CE1   . PHE A 1  777  ? 88.851  77.440  20.852  1.00 133.68 ? 777  PHE A CE1   1 
ATOM   6040  C  CE2   . PHE A 1  777  ? 88.090  79.465  19.856  1.00 134.78 ? 777  PHE A CE2   1 
ATOM   6041  C  CZ    . PHE A 1  777  ? 88.775  78.816  20.858  1.00 133.08 ? 777  PHE A CZ    1 
ATOM   6042  N  N     . GLY A 1  778  ? 86.188  73.103  16.529  1.00 119.04 ? 778  GLY A N     1 
ATOM   6043  C  CA    . GLY A 1  778  ? 85.284  72.303  15.693  1.00 118.31 ? 778  GLY A CA    1 
ATOM   6044  C  C     . GLY A 1  778  ? 83.837  72.629  16.024  1.00 122.17 ? 778  GLY A C     1 
ATOM   6045  O  O     . GLY A 1  778  ? 82.965  72.687  15.145  1.00 120.91 ? 778  GLY A O     1 
ATOM   6046  N  N     . PHE A 1  779  ? 83.599  72.859  17.327  1.00 119.37 ? 779  PHE A N     1 
ATOM   6047  C  CA    . PHE A 1  779  ? 82.348  73.332  17.885  1.00 120.38 ? 779  PHE A CA    1 
ATOM   6048  C  C     . PHE A 1  779  ? 82.471  74.862  17.835  1.00 127.02 ? 779  PHE A C     1 
ATOM   6049  O  O     . PHE A 1  779  ? 83.585  75.387  17.661  1.00 127.23 ? 779  PHE A O     1 
ATOM   6050  C  CB    . PHE A 1  779  ? 82.163  72.839  19.336  1.00 122.40 ? 779  PHE A CB    1 
ATOM   6051  C  CG    . PHE A 1  779  ? 81.806  71.374  19.480  1.00 122.82 ? 779  PHE A CG    1 
ATOM   6052  C  CD1   . PHE A 1  779  ? 80.505  70.930  19.253  1.00 125.16 ? 779  PHE A CD1   1 
ATOM   6053  C  CD2   . PHE A 1  779  ? 82.759  70.445  19.883  1.00 123.83 ? 779  PHE A CD2   1 
ATOM   6054  C  CE1   . PHE A 1  779  ? 80.174  69.579  19.391  1.00 124.89 ? 779  PHE A CE1   1 
ATOM   6055  C  CE2   . PHE A 1  779  ? 82.429  69.092  20.006  1.00 125.53 ? 779  PHE A CE2   1 
ATOM   6056  C  CZ    . PHE A 1  779  ? 81.136  68.672  19.773  1.00 123.40 ? 779  PHE A CZ    1 
ATOM   6057  N  N     . VAL A 1  780  ? 81.346  75.581  17.960  1.00 124.03 ? 780  VAL A N     1 
ATOM   6058  C  CA    . VAL A 1  780  ? 81.357  77.038  17.895  1.00 124.06 ? 780  VAL A CA    1 
ATOM   6059  C  C     . VAL A 1  780  ? 82.118  77.619  19.087  1.00 127.55 ? 780  VAL A C     1 
ATOM   6060  O  O     . VAL A 1  780  ? 81.692  77.451  20.227  1.00 128.01 ? 780  VAL A O     1 
ATOM   6061  C  CB    . VAL A 1  780  ? 79.931  77.617  17.737  1.00 128.74 ? 780  VAL A CB    1 
ATOM   6062  C  CG1   . VAL A 1  780  ? 79.948  79.146  17.732  1.00 129.79 ? 780  VAL A CG1   1 
ATOM   6063  C  CG2   . VAL A 1  780  ? 79.266  77.083  16.472  1.00 127.65 ? 780  VAL A CG2   1 
ATOM   6064  N  N     . ASP A 1  781  ? 83.279  78.237  18.811  1.00 122.89 ? 781  ASP A N     1 
ATOM   6065  C  CA    . ASP A 1  781  ? 84.131  78.898  19.801  1.00 123.67 ? 781  ASP A CA    1 
ATOM   6066  C  C     . ASP A 1  781  ? 84.704  78.024  20.955  1.00 125.63 ? 781  ASP A C     1 
ATOM   6067  O  O     . ASP A 1  781  ? 85.149  78.533  21.995  1.00 125.97 ? 781  ASP A O     1 
ATOM   6068  C  CB    . ASP A 1  781  ? 83.510  80.238  20.276  1.00 128.04 ? 781  ASP A CB    1 
ATOM   6069  C  CG    . ASP A 1  781  ? 83.485  81.354  19.227  1.00 143.75 ? 781  ASP A CG    1 
ATOM   6070  O  OD1   . ASP A 1  781  ? 84.583  81.810  18.813  1.00 144.20 ? 781  ASP A OD1   1 
ATOM   6071  O  OD2   . ASP A 1  781  ? 82.371  81.833  18.888  1.00 152.51 ? 781  ASP A OD2   1 
ATOM   6072  N  N     . ARG A 1  782  ? 84.731  76.710  20.745  1.00 119.89 ? 782  ARG A N     1 
ATOM   6073  C  CA    . ARG A 1  782  ? 85.295  75.761  21.709  1.00 118.87 ? 782  ARG A CA    1 
ATOM   6074  C  C     . ARG A 1  782  ? 85.744  74.456  21.010  1.00 121.17 ? 782  ARG A C     1 
ATOM   6075  O  O     . ARG A 1  782  ? 85.235  74.118  19.934  1.00 120.02 ? 782  ARG A O     1 
ATOM   6076  C  CB    . ARG A 1  782  ? 84.361  75.510  22.915  1.00 117.18 ? 782  ARG A CB    1 
ATOM   6077  C  CG    . ARG A 1  782  ? 83.117  74.697  22.588  1.00 116.88 ? 782  ARG A CG    1 
ATOM   6078  C  CD    . ARG A 1  782  ? 81.866  75.527  22.692  1.00 115.25 ? 782  ARG A CD    1 
ATOM   6079  N  NE    . ARG A 1  782  ? 80.655  74.709  22.682  1.00 113.41 ? 782  ARG A NE    1 
ATOM   6080  C  CZ    . ARG A 1  782  ? 80.086  74.193  23.771  1.00 116.83 ? 782  ARG A CZ    1 
ATOM   6081  N  NH1   . ARG A 1  782  ? 80.625  74.396  24.973  1.00 86.45  ? 782  ARG A NH1   1 
ATOM   6082  N  NH2   . ARG A 1  782  ? 78.982  73.461  23.667  1.00 102.94 ? 782  ARG A NH2   1 
ATOM   6083  N  N     . THR A 1  783  ? 86.705  73.743  21.626  1.00 116.44 ? 783  THR A N     1 
ATOM   6084  C  CA    . THR A 1  783  ? 87.278  72.489  21.124  1.00 114.14 ? 783  THR A CA    1 
ATOM   6085  C  C     . THR A 1  783  ? 86.408  71.265  21.465  1.00 116.60 ? 783  THR A C     1 
ATOM   6086  O  O     . THR A 1  783  ? 86.329  70.331  20.672  1.00 114.73 ? 783  THR A O     1 
ATOM   6087  C  CB    . THR A 1  783  ? 88.700  72.349  21.633  1.00 118.83 ? 783  THR A CB    1 
ATOM   6088  O  OG1   . THR A 1  783  ? 88.658  72.279  23.060  1.00 118.13 ? 783  THR A OG1   1 
ATOM   6089  C  CG2   . THR A 1  783  ? 89.584  73.515  21.195  1.00 116.54 ? 783  THR A CG2   1 
ATOM   6090  N  N     . LEU A 1  784  ? 85.756  71.280  22.639  1.00 113.47 ? 784  LEU A N     1 
ATOM   6091  C  CA    . LEU A 1  784  ? 84.875  70.207  23.114  1.00 112.72 ? 784  LEU A CA    1 
ATOM   6092  C  C     . LEU A 1  784  ? 83.686  70.784  23.924  1.00 117.29 ? 784  LEU A C     1 
ATOM   6093  O  O     . LEU A 1  784  ? 83.836  71.881  24.468  1.00 117.54 ? 784  LEU A O     1 
ATOM   6094  C  CB    . LEU A 1  784  ? 85.681  69.220  23.988  1.00 112.05 ? 784  LEU A CB    1 
ATOM   6095  C  CG    . LEU A 1  784  ? 86.622  68.251  23.286  1.00 113.77 ? 784  LEU A CG    1 
ATOM   6096  C  CD1   . LEU A 1  784  ? 87.456  67.520  24.291  1.00 113.52 ? 784  LEU A CD1   1 
ATOM   6097  C  CD2   . LEU A 1  784  ? 85.850  67.253  22.452  1.00 113.63 ? 784  LEU A CD2   1 
ATOM   6098  N  N     . PRO A 1  785  ? 82.527  70.074  24.070  1.00 114.16 ? 785  PRO A N     1 
ATOM   6099  C  CA    . PRO A 1  785  ? 81.404  70.650  24.846  1.00 115.83 ? 785  PRO A CA    1 
ATOM   6100  C  C     . PRO A 1  785  ? 81.597  70.725  26.365  1.00 121.90 ? 785  PRO A C     1 
ATOM   6101  O  O     . PRO A 1  785  ? 80.717  71.217  27.072  1.00 121.64 ? 785  PRO A O     1 
ATOM   6102  C  CB    . PRO A 1  785  ? 80.198  69.795  24.437  1.00 117.29 ? 785  PRO A CB    1 
ATOM   6103  C  CG    . PRO A 1  785  ? 80.762  68.527  23.961  1.00 119.86 ? 785  PRO A CG    1 
ATOM   6104  C  CD    . PRO A 1  785  ? 82.168  68.759  23.500  1.00 114.54 ? 785  PRO A CD    1 
ATOM   6105  N  N     . HIS A 1  786  ? 82.769  70.271  26.852  1.00 120.23 ? 786  HIS A N     1 
ATOM   6106  C  CA    . HIS A 1  786  ? 83.186  70.282  28.261  1.00 121.67 ? 786  HIS A CA    1 
ATOM   6107  C  C     . HIS A 1  786  ? 84.034  71.519  28.534  1.00 125.52 ? 786  HIS A C     1 
ATOM   6108  O  O     . HIS A 1  786  ? 84.760  71.568  29.528  1.00 125.36 ? 786  HIS A O     1 
ATOM   6109  C  CB    . HIS A 1  786  ? 83.993  69.012  28.599  1.00 121.85 ? 786  HIS A CB    1 
ATOM   6110  C  CG    . HIS A 1  786  ? 83.470  67.793  27.929  1.00 124.35 ? 786  HIS A CG    1 
ATOM   6111  N  ND1   . HIS A 1  786  ? 83.873  67.454  26.658  1.00 124.86 ? 786  HIS A ND1   1 
ATOM   6112  C  CD2   . HIS A 1  786  ? 82.538  66.909  28.349  1.00 126.59 ? 786  HIS A CD2   1 
ATOM   6113  C  CE1   . HIS A 1  786  ? 83.196  66.362  26.350  1.00 124.02 ? 786  HIS A CE1   1 
ATOM   6114  N  NE2   . HIS A 1  786  ? 82.379  65.996  27.337  1.00 125.35 ? 786  HIS A NE2   1 
ATOM   6115  N  N     . PHE A 1  787  ? 83.952  72.506  27.633  1.00 122.19 ? 787  PHE A N     1 
ATOM   6116  C  CA    . PHE A 1  787  ? 84.672  73.768  27.717  1.00 122.81 ? 787  PHE A CA    1 
ATOM   6117  C  C     . PHE A 1  787  ? 83.727  74.928  27.474  1.00 127.78 ? 787  PHE A C     1 
ATOM   6118  O  O     . PHE A 1  787  ? 82.796  74.811  26.662  1.00 126.09 ? 787  PHE A O     1 
ATOM   6119  C  CB    . PHE A 1  787  ? 85.801  73.825  26.672  1.00 123.29 ? 787  PHE A CB    1 
ATOM   6120  C  CG    . PHE A 1  787  ? 86.965  72.900  26.916  1.00 123.46 ? 787  PHE A CG    1 
ATOM   6121  C  CD1   . PHE A 1  787  ? 87.974  73.247  27.804  1.00 126.43 ? 787  PHE A CD1   1 
ATOM   6122  C  CD2   . PHE A 1  787  ? 87.088  71.715  26.207  1.00 124.16 ? 787  PHE A CD2   1 
ATOM   6123  C  CE1   . PHE A 1  787  ? 89.057  72.397  28.023  1.00 126.38 ? 787  PHE A CE1   1 
ATOM   6124  C  CE2   . PHE A 1  787  ? 88.179  70.871  26.413  1.00 126.20 ? 787  PHE A CE2   1 
ATOM   6125  C  CZ    . PHE A 1  787  ? 89.159  71.220  27.319  1.00 124.63 ? 787  PHE A CZ    1 
ATOM   6126  N  N     . SER A 1  788  ? 83.986  76.063  28.157  1.00 126.74 ? 788  SER A N     1 
ATOM   6127  C  CA    . SER A 1  788  ? 83.209  77.284  27.955  1.00 128.31 ? 788  SER A CA    1 
ATOM   6128  C  C     . SER A 1  788  ? 83.686  77.939  26.651  1.00 134.27 ? 788  SER A C     1 
ATOM   6129  O  O     . SER A 1  788  ? 84.802  77.650  26.193  1.00 134.11 ? 788  SER A O     1 
ATOM   6130  C  CB    . SER A 1  788  ? 83.351  78.232  29.141  1.00 132.16 ? 788  SER A CB    1 
ATOM   6131  O  OG    . SER A 1  788  ? 82.078  78.482  29.718  1.00 139.67 ? 788  SER A OG    1 
ATOM   6132  N  N     . LYS A 1  789  ? 82.828  78.762  26.015  1.00 131.28 ? 789  LYS A N     1 
ATOM   6133  C  CA    . LYS A 1  789  ? 83.172  79.416  24.747  1.00 130.14 ? 789  LYS A CA    1 
ATOM   6134  C  C     . LYS A 1  789  ? 84.342  80.392  24.914  1.00 135.83 ? 789  LYS A C     1 
ATOM   6135  O  O     . LYS A 1  789  ? 84.639  80.819  26.040  1.00 136.18 ? 789  LYS A O     1 
ATOM   6136  C  CB    . LYS A 1  789  ? 81.945  80.108  24.123  1.00 131.94 ? 789  LYS A CB    1 
ATOM   6137  C  CG    . LYS A 1  789  ? 81.005  79.165  23.382  1.00 126.82 ? 789  LYS A CG    1 
ATOM   6138  C  CD    . LYS A 1  789  ? 79.741  79.866  22.897  1.00 128.89 ? 789  LYS A CD    1 
ATOM   6139  C  CE    . LYS A 1  789  ? 78.932  78.995  21.967  1.00 135.27 ? 789  LYS A CE    1 
ATOM   6140  N  NZ    . LYS A 1  789  ? 77.660  79.646  21.565  1.00 147.48 ? 789  LYS A NZ    1 
ATOM   6141  N  N     . ASP A 1  790  ? 85.036  80.689  23.792  1.00 132.92 ? 790  ASP A N     1 
ATOM   6142  C  CA    . ASP A 1  790  ? 86.178  81.610  23.689  1.00 133.49 ? 790  ASP A CA    1 
ATOM   6143  C  C     . ASP A 1  790  ? 87.320  81.335  24.719  1.00 138.62 ? 790  ASP A C     1 
ATOM   6144  O  O     . ASP A 1  790  ? 87.946  82.264  25.249  1.00 138.18 ? 790  ASP A O     1 
ATOM   6145  C  CB    . ASP A 1  790  ? 85.695  83.083  23.627  1.00 136.76 ? 790  ASP A CB    1 
ATOM   6146  C  CG    . ASP A 1  790  ? 84.762  83.405  22.453  1.00 147.00 ? 790  ASP A CG    1 
ATOM   6147  O  OD1   . ASP A 1  790  ? 85.259  83.484  21.303  1.00 147.83 ? 790  ASP A OD1   1 
ATOM   6148  O  OD2   . ASP A 1  790  ? 83.540  83.625  22.695  1.00 150.02 ? 790  ASP A OD2   1 
ATOM   6149  N  N     . ASP A 1  791  ? 87.568  80.022  24.982  1.00 136.16 ? 791  ASP A N     1 
ATOM   6150  C  CA    . ASP A 1  791  ? 88.598  79.473  25.877  1.00 136.36 ? 791  ASP A CA    1 
ATOM   6151  C  C     . ASP A 1  791  ? 89.842  79.188  25.017  1.00 139.20 ? 791  ASP A C     1 
ATOM   6152  O  O     . ASP A 1  791  ? 89.803  78.333  24.117  1.00 137.64 ? 791  ASP A O     1 
ATOM   6153  C  CB    . ASP A 1  791  ? 88.083  78.177  26.577  1.00 138.37 ? 791  ASP A CB    1 
ATOM   6154  C  CG    . ASP A 1  791  ? 88.854  77.664  27.805  1.00 147.67 ? 791  ASP A CG    1 
ATOM   6155  O  OD1   . ASP A 1  791  ? 90.090  77.831  27.847  1.00 147.13 ? 791  ASP A OD1   1 
ATOM   6156  O  OD2   . ASP A 1  791  ? 88.221  77.019  28.687  1.00 152.10 ? 791  ASP A OD2   1 
ATOM   6157  N  N     . TYR A 1  792  ? 90.924  79.944  25.273  1.00 135.93 ? 792  TYR A N     1 
ATOM   6158  C  CA    . TYR A 1  792  ? 92.186  79.852  24.539  1.00 134.68 ? 792  TYR A CA    1 
ATOM   6159  C  C     . TYR A 1  792  ? 93.286  79.151  25.332  1.00 135.09 ? 792  TYR A C     1 
ATOM   6160  O  O     . TYR A 1  792  ? 94.361  78.915  24.786  1.00 132.48 ? 792  TYR A O     1 
ATOM   6161  C  CB    . TYR A 1  792  ? 92.623  81.254  24.054  1.00 137.80 ? 792  TYR A CB    1 
ATOM   6162  C  CG    . TYR A 1  792  ? 91.902  81.696  22.795  1.00 141.89 ? 792  TYR A CG    1 
ATOM   6163  C  CD1   . TYR A 1  792  ? 90.571  82.112  22.836  1.00 145.16 ? 792  TYR A CD1   1 
ATOM   6164  C  CD2   . TYR A 1  792  ? 92.537  81.661  21.555  1.00 142.45 ? 792  TYR A CD2   1 
ATOM   6165  C  CE1   . TYR A 1  792  ? 89.884  82.463  21.672  1.00 146.65 ? 792  TYR A CE1   1 
ATOM   6166  C  CE2   . TYR A 1  792  ? 91.865  82.027  20.384  1.00 143.67 ? 792  TYR A CE2   1 
ATOM   6167  C  CZ    . TYR A 1  792  ? 90.538  82.433  20.448  1.00 153.45 ? 792  TYR A CZ    1 
ATOM   6168  O  OH    . TYR A 1  792  ? 89.866  82.798  19.302  1.00 154.88 ? 792  TYR A OH    1 
ATOM   6169  N  N     . SER A 1  793  ? 92.985  78.776  26.602  1.00 131.73 ? 793  SER A N     1 
ATOM   6170  C  CA    . SER A 1  793  ? 93.874  78.116  27.576  1.00 131.07 ? 793  SER A CA    1 
ATOM   6171  C  C     . SER A 1  793  ? 94.566  76.875  27.042  1.00 133.30 ? 793  SER A C     1 
ATOM   6172  O  O     . SER A 1  793  ? 93.914  76.122  26.312  1.00 132.78 ? 793  SER A O     1 
ATOM   6173  C  CB    . SER A 1  793  ? 93.114  77.754  28.852  1.00 134.57 ? 793  SER A CB    1 
ATOM   6174  O  OG    . SER A 1  793  ? 92.195  76.692  28.652  1.00 137.97 ? 793  SER A OG    1 
ATOM   6175  N  N     . PRO A 1  794  ? 95.844  76.602  27.447  1.00 128.63 ? 794  PRO A N     1 
ATOM   6176  C  CA    . PRO A 1  794  ? 96.550  75.390  26.953  1.00 126.85 ? 794  PRO A CA    1 
ATOM   6177  C  C     . PRO A 1  794  ? 95.718  74.097  26.922  1.00 126.79 ? 794  PRO A C     1 
ATOM   6178  O  O     . PRO A 1  794  ? 95.728  73.403  25.905  1.00 124.58 ? 794  PRO A O     1 
ATOM   6179  C  CB    . PRO A 1  794  ? 97.775  75.273  27.883  1.00 129.07 ? 794  PRO A CB    1 
ATOM   6180  C  CG    . PRO A 1  794  ? 97.665  76.389  28.878  1.00 134.53 ? 794  PRO A CG    1 
ATOM   6181  C  CD    . PRO A 1  794  ? 96.730  77.405  28.311  1.00 130.52 ? 794  PRO A CD    1 
ATOM   6182  N  N     . GLU A 1  795  ? 94.956  73.843  28.019  1.00 122.18 ? 795  GLU A N     1 
ATOM   6183  C  CA    . GLU A 1  795  ? 94.045  72.726  28.273  1.00 121.15 ? 795  GLU A CA    1 
ATOM   6184  C  C     . GLU A 1  795  ? 92.958  72.650  27.223  1.00 125.32 ? 795  GLU A C     1 
ATOM   6185  O  O     . GLU A 1  795  ? 92.611  71.544  26.817  1.00 125.28 ? 795  GLU A O     1 
ATOM   6186  C  CB    . GLU A 1  795  ? 93.367  72.837  29.658  1.00 123.85 ? 795  GLU A CB    1 
ATOM   6187  C  CG    . GLU A 1  795  ? 94.220  73.396  30.791  1.00 135.53 ? 795  GLU A CG    1 
ATOM   6188  C  CD    . GLU A 1  795  ? 94.138  74.900  31.001  1.00 151.33 ? 795  GLU A CD    1 
ATOM   6189  O  OE1   . GLU A 1  795  ? 93.050  75.397  31.376  1.00 142.89 ? 795  GLU A OE1   1 
ATOM   6190  O  OE2   . GLU A 1  795  ? 95.172  75.580  30.816  1.00 138.33 ? 795  GLU A OE2   1 
ATOM   6191  N  N     . SER A 1  796  ? 92.389  73.800  26.798  1.00 122.24 ? 796  SER A N     1 
ATOM   6192  C  CA    . SER A 1  796  ? 91.334  73.807  25.771  1.00 121.53 ? 796  SER A CA    1 
ATOM   6193  C  C     . SER A 1  796  ? 91.900  73.552  24.375  1.00 122.58 ? 796  SER A C     1 
ATOM   6194  O  O     . SER A 1  796  ? 91.365  72.722  23.648  1.00 119.91 ? 796  SER A O     1 
ATOM   6195  C  CB    . SER A 1  796  ? 90.511  75.095  25.806  1.00 126.13 ? 796  SER A CB    1 
ATOM   6196  O  OG    . SER A 1  796  ? 89.378  75.027  24.952  1.00 133.36 ? 796  SER A OG    1 
ATOM   6197  N  N     . LYS A 1  797  ? 93.013  74.216  24.033  1.00 119.39 ? 797  LYS A N     1 
ATOM   6198  C  CA    . LYS A 1  797  ? 93.644  74.075  22.728  1.00 118.16 ? 797  LYS A CA    1 
ATOM   6199  C  C     . LYS A 1  797  ? 94.513  72.818  22.495  1.00 121.21 ? 797  LYS A C     1 
ATOM   6200  O  O     . LYS A 1  797  ? 95.079  72.645  21.409  1.00 120.40 ? 797  LYS A O     1 
ATOM   6201  C  CB    . LYS A 1  797  ? 94.262  75.394  22.243  1.00 120.91 ? 797  LYS A CB    1 
ATOM   6202  C  CG    . LYS A 1  797  ? 93.215  76.419  21.786  1.00 130.89 ? 797  LYS A CG    1 
ATOM   6203  C  CD    . LYS A 1  797  ? 93.689  77.236  20.582  1.00 135.62 ? 797  LYS A CD    1 
ATOM   6204  C  CE    . LYS A 1  797  ? 92.554  77.922  19.852  1.00 139.88 ? 797  LYS A CE    1 
ATOM   6205  N  NZ    . LYS A 1  797  ? 91.879  77.026  18.869  1.00 141.25 ? 797  LYS A NZ    1 
ATOM   6206  N  N     . GLY A 1  798  ? 94.550  71.927  23.486  1.00 117.24 ? 798  GLY A N     1 
ATOM   6207  C  CA    . GLY A 1  798  ? 95.206  70.630  23.369  1.00 115.60 ? 798  GLY A CA    1 
ATOM   6208  C  C     . GLY A 1  798  ? 96.588  70.411  23.937  1.00 118.67 ? 798  GLY A C     1 
ATOM   6209  O  O     . GLY A 1  798  ? 97.355  69.628  23.373  1.00 117.53 ? 798  GLY A O     1 
ATOM   6210  N  N     . PHE A 1  799  ? 96.923  71.051  25.057  1.00 115.73 ? 799  PHE A N     1 
ATOM   6211  C  CA    . PHE A 1  799  ? 98.231  70.810  25.665  1.00 114.66 ? 799  PHE A CA    1 
ATOM   6212  C  C     . PHE A 1  799  ? 98.092  69.641  26.636  1.00 118.49 ? 799  PHE A C     1 
ATOM   6213  O  O     . PHE A 1  799  ? 97.288  69.719  27.582  1.00 119.34 ? 799  PHE A O     1 
ATOM   6214  C  CB    . PHE A 1  799  ? 98.796  72.073  26.348  1.00 116.74 ? 799  PHE A CB    1 
ATOM   6215  C  CG    . PHE A 1  799  ? 100.084 71.857  27.108  1.00 117.39 ? 799  PHE A CG    1 
ATOM   6216  C  CD1   . PHE A 1  799  ? 101.284 71.653  26.435  1.00 118.82 ? 799  PHE A CD1   1 
ATOM   6217  C  CD2   . PHE A 1  799  ? 100.103 71.884  28.498  1.00 119.77 ? 799  PHE A CD2   1 
ATOM   6218  C  CE1   . PHE A 1  799  ? 102.479 71.466  27.140  1.00 119.62 ? 799  PHE A CE1   1 
ATOM   6219  C  CE2   . PHE A 1  799  ? 101.298 71.700  29.203  1.00 122.37 ? 799  PHE A CE2   1 
ATOM   6220  C  CZ    . PHE A 1  799  ? 102.477 71.492  28.519  1.00 119.50 ? 799  PHE A CZ    1 
ATOM   6221  N  N     . VAL A 1  800  ? 98.827  68.533  26.362  1.00 112.54 ? 800  VAL A N     1 
ATOM   6222  C  CA    . VAL A 1  800  ? 98.809  67.338  27.211  1.00 111.40 ? 800  VAL A CA    1 
ATOM   6223  C  C     . VAL A 1  800  ? 99.882  67.506  28.277  1.00 115.42 ? 800  VAL A C     1 
ATOM   6224  O  O     . VAL A 1  800  ? 101.063 67.304  28.017  1.00 114.38 ? 800  VAL A O     1 
ATOM   6225  C  CB    . VAL A 1  800  ? 98.892  65.991  26.445  1.00 113.21 ? 800  VAL A CB    1 
ATOM   6226  C  CG1   . VAL A 1  800  ? 98.976  64.822  27.417  1.00 113.08 ? 800  VAL A CG1   1 
ATOM   6227  C  CG2   . VAL A 1  800  ? 97.697  65.815  25.513  1.00 112.26 ? 800  VAL A CG2   1 
ATOM   6228  N  N     . GLU A 1  801  ? 99.457  67.949  29.454  1.00 113.45 ? 801  GLU A N     1 
ATOM   6229  C  CA    . GLU A 1  801  ? 100.309 68.236  30.598  1.00 114.74 ? 801  GLU A CA    1 
ATOM   6230  C  C     . GLU A 1  801  ? 100.878 66.964  31.223  1.00 118.19 ? 801  GLU A C     1 
ATOM   6231  O  O     . GLU A 1  801  ? 101.981 66.978  31.787  1.00 118.69 ? 801  GLU A O     1 
ATOM   6232  C  CB    . GLU A 1  801  ? 99.496  69.038  31.629  1.00 117.94 ? 801  GLU A CB    1 
ATOM   6233  C  CG    . GLU A 1  801  ? 100.229 69.363  32.919  1.00 132.12 ? 801  GLU A CG    1 
ATOM   6234  C  CD    . GLU A 1  801  ? 99.355  69.933  34.012  1.00 161.82 ? 801  GLU A CD    1 
ATOM   6235  O  OE1   . GLU A 1  801  ? 98.201  69.467  34.153  1.00 157.82 ? 801  GLU A OE1   1 
ATOM   6236  O  OE2   . GLU A 1  801  ? 99.830  70.835  34.740  1.00 166.52 ? 801  GLU A OE2   1 
ATOM   6237  N  N     . ASN A 1  802  ? 100.113 65.880  31.148  1.00 113.37 ? 802  ASN A N     1 
ATOM   6238  C  CA    . ASN A 1  802  ? 100.502 64.616  31.742  1.00 112.84 ? 802  ASN A CA    1 
ATOM   6239  C  C     . ASN A 1  802  ? 101.465 63.792  30.899  1.00 115.60 ? 802  ASN A C     1 
ATOM   6240  O  O     . ASN A 1  802  ? 101.494 63.934  29.672  1.00 114.83 ? 802  ASN A O     1 
ATOM   6241  C  CB    . ASN A 1  802  ? 99.263  63.805  32.067  1.00 112.73 ? 802  ASN A CB    1 
ATOM   6242  C  CG    . ASN A 1  802  ? 98.576  64.234  33.321  1.00 136.43 ? 802  ASN A CG    1 
ATOM   6243  O  OD1   . ASN A 1  802  ? 99.162  64.231  34.411  1.00 132.27 ? 802  ASN A OD1   1 
ATOM   6244  N  ND2   . ASN A 1  802  ? 97.304  64.569  33.195  1.00 130.51 ? 802  ASN A ND2   1 
ATOM   6245  N  N     . SER A 1  803  ? 102.243 62.918  31.580  1.00 111.04 ? 803  SER A N     1 
ATOM   6246  C  CA    . SER A 1  803  ? 103.170 61.942  31.002  1.00 108.86 ? 803  SER A CA    1 
ATOM   6247  C  C     . SER A 1  803  ? 102.385 60.653  30.752  1.00 108.72 ? 803  SER A C     1 
ATOM   6248  O  O     . SER A 1  803  ? 101.327 60.463  31.373  1.00 108.66 ? 803  SER A O     1 
ATOM   6249  C  CB    . SER A 1  803  ? 104.313 61.649  31.971  1.00 114.05 ? 803  SER A CB    1 
ATOM   6250  O  OG    . SER A 1  803  ? 103.870 61.319  33.280  1.00 126.54 ? 803  SER A OG    1 
ATOM   6251  N  N     . TYR A 1  804  ? 102.904 59.761  29.859  1.00 101.11 ? 804  TYR A N     1 
ATOM   6252  C  CA    . TYR A 1  804  ? 102.280 58.465  29.575  1.00 98.07  ? 804  TYR A CA    1 
ATOM   6253  C  C     . TYR A 1  804  ? 102.264 57.607  30.846  1.00 102.71 ? 804  TYR A C     1 
ATOM   6254  O  O     . TYR A 1  804  ? 101.249 56.947  31.103  1.00 102.57 ? 804  TYR A O     1 
ATOM   6255  C  CB    . TYR A 1  804  ? 102.984 57.738  28.440  1.00 95.92  ? 804  TYR A CB    1 
ATOM   6256  C  CG    . TYR A 1  804  ? 102.747 58.345  27.077  1.00 95.34  ? 804  TYR A CG    1 
ATOM   6257  C  CD1   . TYR A 1  804  ? 101.463 58.432  26.541  1.00 96.23  ? 804  TYR A CD1   1 
ATOM   6258  C  CD2   . TYR A 1  804  ? 103.814 58.750  26.281  1.00 95.65  ? 804  TYR A CD2   1 
ATOM   6259  C  CE1   . TYR A 1  804  ? 101.244 58.962  25.266  1.00 94.77  ? 804  TYR A CE1   1 
ATOM   6260  C  CE2   . TYR A 1  804  ? 103.610 59.263  24.998  1.00 95.65  ? 804  TYR A CE2   1 
ATOM   6261  C  CZ    . TYR A 1  804  ? 102.323 59.375  24.496  1.00 100.02 ? 804  TYR A CZ    1 
ATOM   6262  O  OH    . TYR A 1  804  ? 102.144 59.898  23.235  1.00 96.52  ? 804  TYR A OH    1 
ATOM   6263  N  N     . LEU A 1  805  ? 103.354 57.693  31.689  1.00 98.49  ? 805  LEU A N     1 
ATOM   6264  C  CA    . LEU A 1  805  ? 103.468 57.010  32.993  1.00 97.66  ? 805  LEU A CA    1 
ATOM   6265  C  C     . LEU A 1  805  ? 102.307 57.419  33.897  1.00 101.51 ? 805  LEU A C     1 
ATOM   6266  O  O     . LEU A 1  805  ? 101.779 56.570  34.612  1.00 100.27 ? 805  LEU A O     1 
ATOM   6267  C  CB    . LEU A 1  805  ? 104.828 57.305  33.678  1.00 97.61  ? 805  LEU A CB    1 
ATOM   6268  C  CG    . LEU A 1  805  ? 104.978 57.039  35.205  1.00 102.23 ? 805  LEU A CG    1 
ATOM   6269  C  CD1   . LEU A 1  805  ? 105.357 55.625  35.494  1.00 100.34 ? 805  LEU A CD1   1 
ATOM   6270  C  CD2   . LEU A 1  805  ? 106.042 57.958  35.828  1.00 108.66 ? 805  LEU A CD2   1 
ATOM   6271  N  N     . ARG A 1  806  ? 101.897 58.708  33.838  1.00 99.79  ? 806  ARG A N     1 
ATOM   6272  C  CA    . ARG A 1  806  ? 100.802 59.229  34.657  1.00 101.64 ? 806  ARG A CA    1 
ATOM   6273  C  C     . ARG A 1  806  ? 99.419  59.015  34.089  1.00 104.84 ? 806  ARG A C     1 
ATOM   6274  O  O     . ARG A 1  806  ? 98.458  58.888  34.854  1.00 105.65 ? 806  ARG A O     1 
ATOM   6275  C  CB    . ARG A 1  806  ? 101.035 60.683  35.084  1.00 105.45 ? 806  ARG A CB    1 
ATOM   6276  C  CG    . ARG A 1  806  ? 101.700 60.778  36.454  1.00 121.99 ? 806  ARG A CG    1 
ATOM   6277  C  CD    . ARG A 1  806  ? 102.732 61.878  36.482  1.00 140.56 ? 806  ARG A CD    1 
ATOM   6278  N  NE    . ARG A 1  806  ? 102.137 63.166  36.853  1.00 155.87 ? 806  ARG A NE    1 
ATOM   6279  C  CZ    . ARG A 1  806  ? 102.247 63.723  38.057  1.00 167.30 ? 806  ARG A CZ    1 
ATOM   6280  N  NH1   . ARG A 1  806  ? 102.929 63.113  39.020  1.00 151.45 ? 806  ARG A NH1   1 
ATOM   6281  N  NH2   . ARG A 1  806  ? 101.689 64.901  38.303  1.00 150.59 ? 806  ARG A NH2   1 
ATOM   6282  N  N     . GLY A 1  807  ? 99.334  58.940  32.768  1.00 99.55  ? 807  GLY A N     1 
ATOM   6283  C  CA    . GLY A 1  807  ? 98.071  58.740  32.072  1.00 98.61  ? 807  GLY A CA    1 
ATOM   6284  C  C     . GLY A 1  807  ? 97.448  60.038  31.615  1.00 101.98 ? 807  GLY A C     1 
ATOM   6285  O  O     . GLY A 1  807  ? 97.705  61.091  32.201  1.00 103.39 ? 807  GLY A O     1 
ATOM   6286  N  N     . LEU A 1  808  ? 96.611  59.964  30.579  1.00 95.98  ? 808  LEU A N     1 
ATOM   6287  C  CA    . LEU A 1  808  ? 95.956  61.121  29.976  1.00 95.41  ? 808  LEU A CA    1 
ATOM   6288  C  C     . LEU A 1  808  ? 94.508  61.316  30.405  1.00 103.27 ? 808  LEU A C     1 
ATOM   6289  O  O     . LEU A 1  808  ? 93.798  60.330  30.619  1.00 104.55 ? 808  LEU A O     1 
ATOM   6290  C  CB    . LEU A 1  808  ? 96.020  60.980  28.453  1.00 93.08  ? 808  LEU A CB    1 
ATOM   6291  C  CG    . LEU A 1  808  ? 97.198  61.643  27.778  1.00 95.77  ? 808  LEU A CG    1 
ATOM   6292  C  CD1   . LEU A 1  808  ? 98.553  60.920  28.084  1.00 94.81  ? 808  LEU A CD1   1 
ATOM   6293  C  CD2   . LEU A 1  808  ? 96.933  61.809  26.298  1.00 95.85  ? 808  LEU A CD2   1 
ATOM   6294  N  N     . THR A 1  809  ? 94.052  62.588  30.482  1.00 100.28 ? 809  THR A N     1 
ATOM   6295  C  CA    . THR A 1  809  ? 92.655  62.912  30.788  1.00 100.73 ? 809  THR A CA    1 
ATOM   6296  C  C     . THR A 1  809  ? 91.796  62.689  29.507  1.00 101.62 ? 809  THR A C     1 
ATOM   6297  O  O     . THR A 1  809  ? 92.371  62.614  28.416  1.00 100.04 ? 809  THR A O     1 
ATOM   6298  C  CB    . THR A 1  809  ? 92.521  64.318  31.376  1.00 117.58 ? 809  THR A CB    1 
ATOM   6299  O  OG1   . THR A 1  809  ? 92.653  65.295  30.341  1.00 120.89 ? 809  THR A OG1   1 
ATOM   6300  C  CG2   . THR A 1  809  ? 93.481  64.572  32.548  1.00 119.86 ? 809  THR A CG2   1 
ATOM   6301  N  N     . PRO A 1  810  ? 90.447  62.545  29.599  1.00 96.95  ? 810  PRO A N     1 
ATOM   6302  C  CA    . PRO A 1  810  ? 89.645  62.288  28.387  1.00 95.59  ? 810  PRO A CA    1 
ATOM   6303  C  C     . PRO A 1  810  ? 89.807  63.334  27.294  1.00 100.01 ? 810  PRO A C     1 
ATOM   6304  O  O     . PRO A 1  810  ? 89.858  62.984  26.111  1.00 98.34  ? 810  PRO A O     1 
ATOM   6305  C  CB    . PRO A 1  810  ? 88.215  62.230  28.918  1.00 97.90  ? 810  PRO A CB    1 
ATOM   6306  C  CG    . PRO A 1  810  ? 88.363  61.863  30.327  1.00 103.18 ? 810  PRO A CG    1 
ATOM   6307  C  CD    . PRO A 1  810  ? 89.584  62.565  30.793  1.00 99.32  ? 810  PRO A CD    1 
ATOM   6308  N  N     . GLN A 1  811  ? 89.940  64.614  27.700  1.00 98.10  ? 811  GLN A N     1 
ATOM   6309  C  CA    . GLN A 1  811  ? 90.183  65.733  26.786  1.00 97.30  ? 811  GLN A CA    1 
ATOM   6310  C  C     . GLN A 1  811  ? 91.585  65.515  26.158  1.00 98.31  ? 811  GLN A C     1 
ATOM   6311  O  O     . GLN A 1  811  ? 91.678  65.398  24.932  1.00 95.92  ? 811  GLN A O     1 
ATOM   6312  C  CB    . GLN A 1  811  ? 90.088  67.099  27.508  1.00 99.74  ? 811  GLN A CB    1 
ATOM   6313  C  CG    . GLN A 1  811  ? 88.831  67.314  28.343  1.00 113.34 ? 811  GLN A CG    1 
ATOM   6314  C  CD    . GLN A 1  811  ? 89.013  66.905  29.787  1.00 144.39 ? 811  GLN A CD    1 
ATOM   6315  O  OE1   . GLN A 1  811  ? 88.100  66.357  30.403  1.00 143.67 ? 811  GLN A OE1   1 
ATOM   6316  N  NE2   . GLN A 1  811  ? 90.184  67.173  30.375  1.00 139.33 ? 811  GLN A NE2   1 
ATOM   6317  N  N     . GLU A 1  812  ? 92.641  65.353  27.017  1.00 94.44  ? 812  GLU A N     1 
ATOM   6318  C  CA    . GLU A 1  812  ? 94.026  65.083  26.621  1.00 93.39  ? 812  GLU A CA    1 
ATOM   6319  C  C     . GLU A 1  812  ? 94.066  63.921  25.622  1.00 97.57  ? 812  GLU A C     1 
ATOM   6320  O  O     . GLU A 1  812  ? 94.647  64.063  24.541  1.00 95.16  ? 812  GLU A O     1 
ATOM   6321  C  CB    . GLU A 1  812  ? 94.882  64.736  27.849  1.00 95.09  ? 812  GLU A CB    1 
ATOM   6322  C  CG    . GLU A 1  812  ? 95.421  65.929  28.616  1.00 107.19 ? 812  GLU A CG    1 
ATOM   6323  C  CD    . GLU A 1  812  ? 96.361  65.611  29.769  1.00 131.13 ? 812  GLU A CD    1 
ATOM   6324  O  OE1   . GLU A 1  812  ? 96.176  64.562  30.431  1.00 123.28 ? 812  GLU A OE1   1 
ATOM   6325  O  OE2   . GLU A 1  812  ? 97.271  66.431  30.029  1.00 127.27 ? 812  GLU A OE2   1 
ATOM   6326  N  N     . PHE A 1  813  ? 93.389  62.798  25.978  1.00 96.35  ? 813  PHE A N     1 
ATOM   6327  C  CA    . PHE A 1  813  ? 93.282  61.591  25.176  1.00 96.44  ? 813  PHE A CA    1 
ATOM   6328  C  C     . PHE A 1  813  ? 92.765  61.870  23.773  1.00 99.36  ? 813  PHE A C     1 
ATOM   6329  O  O     . PHE A 1  813  ? 93.400  61.457  22.796  1.00 98.60  ? 813  PHE A O     1 
ATOM   6330  C  CB    . PHE A 1  813  ? 92.393  60.536  25.859  1.00 99.71  ? 813  PHE A CB    1 
ATOM   6331  C  CG    . PHE A 1  813  ? 92.374  59.203  25.132  1.00 101.72 ? 813  PHE A CG    1 
ATOM   6332  C  CD1   . PHE A 1  813  ? 91.452  58.957  24.114  1.00 104.11 ? 813  PHE A CD1   1 
ATOM   6333  C  CD2   . PHE A 1  813  ? 93.300  58.205  25.445  1.00 105.41 ? 813  PHE A CD2   1 
ATOM   6334  C  CE1   . PHE A 1  813  ? 91.455  57.737  23.422  1.00 106.51 ? 813  PHE A CE1   1 
ATOM   6335  C  CE2   . PHE A 1  813  ? 93.298  56.984  24.760  1.00 105.72 ? 813  PHE A CE2   1 
ATOM   6336  C  CZ    . PHE A 1  813  ? 92.368  56.755  23.759  1.00 104.56 ? 813  PHE A CZ    1 
ATOM   6337  N  N     . PHE A 1  814  ? 91.596  62.523  23.674  1.00 94.85  ? 814  PHE A N     1 
ATOM   6338  C  CA    . PHE A 1  814  ? 90.987  62.825  22.386  1.00 92.99  ? 814  PHE A CA    1 
ATOM   6339  C  C     . PHE A 1  814  ? 91.838  63.789  21.584  1.00 99.54  ? 814  PHE A C     1 
ATOM   6340  O  O     . PHE A 1  814  ? 91.914  63.636  20.374  1.00 98.87  ? 814  PHE A O     1 
ATOM   6341  C  CB    . PHE A 1  814  ? 89.571  63.359  22.563  1.00 94.17  ? 814  PHE A CB    1 
ATOM   6342  C  CG    . PHE A 1  814  ? 88.760  63.425  21.296  1.00 93.99  ? 814  PHE A CG    1 
ATOM   6343  C  CD1   . PHE A 1  814  ? 88.772  64.566  20.500  1.00 96.08  ? 814  PHE A CD1   1 
ATOM   6344  C  CD2   . PHE A 1  814  ? 87.955  62.364  20.913  1.00 96.15  ? 814  PHE A CD2   1 
ATOM   6345  C  CE1   . PHE A 1  814  ? 88.000  64.636  19.332  1.00 98.66  ? 814  PHE A CE1   1 
ATOM   6346  C  CE2   . PHE A 1  814  ? 87.174  62.435  19.747  1.00 96.80  ? 814  PHE A CE2   1 
ATOM   6347  C  CZ    . PHE A 1  814  ? 87.205  63.567  18.963  1.00 96.27  ? 814  PHE A CZ    1 
ATOM   6348  N  N     . PHE A 1  815  ? 92.487  64.769  22.232  1.00 99.10  ? 815  PHE A N     1 
ATOM   6349  C  CA    . PHE A 1  815  ? 93.326  65.712  21.492  1.00 100.02 ? 815  PHE A CA    1 
ATOM   6350  C  C     . PHE A 1  815  ? 94.551  65.007  20.938  1.00 105.76 ? 815  PHE A C     1 
ATOM   6351  O  O     . PHE A 1  815  ? 94.884  65.198  19.762  1.00 104.52 ? 815  PHE A O     1 
ATOM   6352  C  CB    . PHE A 1  815  ? 93.688  66.963  22.320  1.00 102.99 ? 815  PHE A CB    1 
ATOM   6353  C  CG    . PHE A 1  815  ? 92.525  67.822  22.799  1.00 105.53 ? 815  PHE A CG    1 
ATOM   6354  C  CD1   . PHE A 1  815  ? 91.412  68.035  21.989  1.00 107.86 ? 815  PHE A CD1   1 
ATOM   6355  C  CD2   . PHE A 1  815  ? 92.567  68.449  24.041  1.00 109.00 ? 815  PHE A CD2   1 
ATOM   6356  C  CE1   . PHE A 1  815  ? 90.348  68.829  22.426  1.00 109.83 ? 815  PHE A CE1   1 
ATOM   6357  C  CE2   . PHE A 1  815  ? 91.510  69.257  24.469  1.00 113.00 ? 815  PHE A CE2   1 
ATOM   6358  C  CZ    . PHE A 1  815  ? 90.406  69.438  23.658  1.00 110.92 ? 815  PHE A CZ    1 
ATOM   6359  N  N     . HIS A 1  816  ? 95.150  64.104  21.752  1.00 104.26 ? 816  HIS A N     1 
ATOM   6360  C  CA    . HIS A 1  816  ? 96.295  63.285  21.335  1.00 103.63 ? 816  HIS A CA    1 
ATOM   6361  C  C     . HIS A 1  816  ? 95.884  62.429  20.143  1.00 106.43 ? 816  HIS A C     1 
ATOM   6362  O  O     . HIS A 1  816  ? 96.628  62.314  19.165  1.00 105.04 ? 816  HIS A O     1 
ATOM   6363  C  CB    . HIS A 1  816  ? 96.839  62.426  22.498  1.00 104.83 ? 816  HIS A CB    1 
ATOM   6364  C  CG    . HIS A 1  816  ? 98.125  61.724  22.179  1.00 107.91 ? 816  HIS A CG    1 
ATOM   6365  N  ND1   . HIS A 1  816  ? 99.161  62.371  21.531  1.00 109.75 ? 816  HIS A ND1   1 
ATOM   6366  C  CD2   . HIS A 1  816  ? 98.505  60.451  22.438  1.00 109.94 ? 816  HIS A CD2   1 
ATOM   6367  C  CE1   . HIS A 1  816  ? 100.123 61.468  21.390  1.00 108.73 ? 816  HIS A CE1   1 
ATOM   6368  N  NE2   . HIS A 1  816  ? 99.776  60.298  21.920  1.00 109.01 ? 816  HIS A NE2   1 
ATOM   6369  N  N     . ALA A 1  817  ? 94.644  61.922  20.199  1.00 103.20 ? 817  ALA A N     1 
ATOM   6370  C  CA    . ALA A 1  817  ? 94.041  61.113  19.163  1.00 102.37 ? 817  ALA A CA    1 
ATOM   6371  C  C     . ALA A 1  817  ? 93.917  61.879  17.837  1.00 106.94 ? 817  ALA A C     1 
ATOM   6372  O  O     . ALA A 1  817  ? 94.354  61.361  16.815  1.00 106.06 ? 817  ALA A O     1 
ATOM   6373  C  CB    . ALA A 1  817  ? 92.695  60.596  19.634  1.00 103.59 ? 817  ALA A CB    1 
ATOM   6374  N  N     . MET A 1  818  ? 93.402  63.124  17.857  1.00 105.04 ? 818  MET A N     1 
ATOM   6375  C  CA    . MET A 1  818  ? 93.269  63.967  16.659  1.00 105.01 ? 818  MET A CA    1 
ATOM   6376  C  C     . MET A 1  818  ? 94.629  64.139  15.953  1.00 108.90 ? 818  MET A C     1 
ATOM   6377  O  O     . MET A 1  818  ? 94.737  63.918  14.730  1.00 107.06 ? 818  MET A O     1 
ATOM   6378  C  CB    . MET A 1  818  ? 92.683  65.337  17.031  1.00 108.31 ? 818  MET A CB    1 
ATOM   6379  C  CG    . MET A 1  818  ? 91.219  65.287  17.349  1.00 112.56 ? 818  MET A CG    1 
ATOM   6380  S  SD    . MET A 1  818  ? 90.618  66.805  18.106  1.00 118.32 ? 818  MET A SD    1 
ATOM   6381  C  CE    . MET A 1  818  ? 90.261  67.779  16.669  1.00 114.88 ? 818  MET A CE    1 
ATOM   6382  N  N     . GLY A 1  819  ? 95.641  64.475  16.767  1.00 106.26 ? 819  GLY A N     1 
ATOM   6383  C  CA    . GLY A 1  819  ? 97.026  64.687  16.362  1.00 105.78 ? 819  GLY A CA    1 
ATOM   6384  C  C     . GLY A 1  819  ? 97.682  63.461  15.769  1.00 108.25 ? 819  GLY A C     1 
ATOM   6385  O  O     . GLY A 1  819  ? 98.306  63.549  14.706  1.00 107.64 ? 819  GLY A O     1 
ATOM   6386  N  N     . GLY A 1  820  ? 97.521  62.327  16.455  1.00 103.42 ? 820  GLY A N     1 
ATOM   6387  C  CA    . GLY A 1  820  ? 98.049  61.030  16.040  1.00 101.61 ? 820  GLY A CA    1 
ATOM   6388  C  C     . GLY A 1  820  ? 97.516  60.566  14.700  1.00 101.87 ? 820  GLY A C     1 
ATOM   6389  O  O     . GLY A 1  820  ? 98.302  60.189  13.825  1.00 100.36 ? 820  GLY A O     1 
ATOM   6390  N  N     . ARG A 1  821  ? 96.175  60.638  14.531  1.00 97.00  ? 821  ARG A N     1 
ATOM   6391  C  CA    . ARG A 1  821  ? 95.436  60.296  13.317  1.00 95.75  ? 821  ARG A CA    1 
ATOM   6392  C  C     . ARG A 1  821  ? 95.960  61.110  12.133  1.00 101.81 ? 821  ARG A C     1 
ATOM   6393  O  O     . ARG A 1  821  ? 96.039  60.567  11.036  1.00 99.76  ? 821  ARG A O     1 
ATOM   6394  C  CB    . ARG A 1  821  ? 93.919  60.493  13.526  1.00 94.08  ? 821  ARG A CB    1 
ATOM   6395  C  CG    . ARG A 1  821  ? 93.077  60.802  12.272  1.00 96.71  ? 821  ARG A CG    1 
ATOM   6396  C  CD    . ARG A 1  821  ? 92.453  59.576  11.617  1.00 96.06  ? 821  ARG A CD    1 
ATOM   6397  N  NE    . ARG A 1  821  ? 91.072  59.350  12.053  1.00 101.99 ? 821  ARG A NE    1 
ATOM   6398  C  CZ    . ARG A 1  821  ? 90.722  58.645  13.131  1.00 119.44 ? 821  ARG A CZ    1 
ATOM   6399  N  NH1   . ARG A 1  821  ? 91.652  58.082  13.899  1.00 108.59 ? 821  ARG A NH1   1 
ATOM   6400  N  NH2   . ARG A 1  821  ? 89.441  58.502  13.452  1.00 102.40 ? 821  ARG A NH2   1 
ATOM   6401  N  N     . GLU A 1  822  ? 96.369  62.391  12.359  1.00 102.12 ? 822  GLU A N     1 
ATOM   6402  C  CA    . GLU A 1  822  ? 96.924  63.271  11.302  1.00 102.28 ? 822  GLU A CA    1 
ATOM   6403  C  C     . GLU A 1  822  ? 98.216  62.676  10.679  1.00 102.74 ? 822  GLU A C     1 
ATOM   6404  O  O     . GLU A 1  822  ? 98.449  62.838  9.474   1.00 101.65 ? 822  GLU A O     1 
ATOM   6405  C  CB    . GLU A 1  822  ? 97.149  64.714  11.823  1.00 104.92 ? 822  GLU A CB    1 
ATOM   6406  C  CG    . GLU A 1  822  ? 97.261  65.793  10.744  1.00 120.38 ? 822  GLU A CG    1 
ATOM   6407  C  CD    . GLU A 1  822  ? 98.065  67.048  11.083  1.00 155.47 ? 822  GLU A CD    1 
ATOM   6408  O  OE1   . GLU A 1  822  ? 98.636  67.125  12.197  1.00 156.83 ? 822  GLU A OE1   1 
ATOM   6409  O  OE2   . GLU A 1  822  ? 98.144  67.950  10.216  1.00 149.21 ? 822  GLU A OE2   1 
ATOM   6410  N  N     . GLY A 1  823  ? 98.995  61.969  11.507  1.00 96.81  ? 823  GLY A N     1 
ATOM   6411  C  CA    . GLY A 1  823  ? 100.236 61.314  11.111  1.00 95.00  ? 823  GLY A CA    1 
ATOM   6412  C  C     . GLY A 1  823  ? 99.996  60.118  10.222  1.00 95.14  ? 823  GLY A C     1 
ATOM   6413  O  O     . GLY A 1  823  ? 100.587 60.001  9.149   1.00 92.90  ? 823  GLY A O     1 
ATOM   6414  N  N     . LEU A 1  824  ? 99.095  59.246  10.664  1.00 91.89  ? 824  LEU A N     1 
ATOM   6415  C  CA    . LEU A 1  824  ? 98.642  58.063  9.935   1.00 91.42  ? 824  LEU A CA    1 
ATOM   6416  C  C     . LEU A 1  824  ? 98.066  58.444  8.554   1.00 95.39  ? 824  LEU A C     1 
ATOM   6417  O  O     . LEU A 1  824  ? 98.251  57.684  7.603   1.00 94.13  ? 824  LEU A O     1 
ATOM   6418  C  CB    . LEU A 1  824  ? 97.621  57.259  10.774  1.00 91.79  ? 824  LEU A CB    1 
ATOM   6419  C  CG    . LEU A 1  824  ? 98.190  56.656  12.066  1.00 97.47  ? 824  LEU A CG    1 
ATOM   6420  C  CD1   . LEU A 1  824  ? 97.169  56.617  13.153  1.00 98.20  ? 824  LEU A CD1   1 
ATOM   6421  C  CD2   . LEU A 1  824  ? 98.723  55.266  11.835  1.00 102.24 ? 824  LEU A CD2   1 
ATOM   6422  N  N     . ILE A 1  825  ? 97.424  59.638  8.435   1.00 93.19  ? 825  ILE A N     1 
ATOM   6423  C  CA    . ILE A 1  825  ? 96.909  60.142  7.162   1.00 93.06  ? 825  ILE A CA    1 
ATOM   6424  C  C     . ILE A 1  825  ? 98.088  60.603  6.332   1.00 101.49 ? 825  ILE A C     1 
ATOM   6425  O  O     . ILE A 1  825  ? 98.220  60.179  5.183   1.00 100.96 ? 825  ILE A O     1 
ATOM   6426  C  CB    . ILE A 1  825  ? 95.847  61.260  7.274   1.00 96.02  ? 825  ILE A CB    1 
ATOM   6427  C  CG1   . ILE A 1  825  ? 94.630  60.808  8.066   1.00 96.68  ? 825  ILE A CG1   1 
ATOM   6428  C  CG2   . ILE A 1  825  ? 95.414  61.720  5.881   1.00 95.85  ? 825  ILE A CG2   1 
ATOM   6429  C  CD1   . ILE A 1  825  ? 93.941  61.927  8.757   1.00 102.26 ? 825  ILE A CD1   1 
ATOM   6430  N  N     . ASP A 1  826  ? 98.962  61.445  6.899   1.00 102.35 ? 826  ASP A N     1 
ATOM   6431  C  CA    . ASP A 1  826  ? 100.073 61.899  6.086   1.00 104.01 ? 826  ASP A CA    1 
ATOM   6432  C  C     . ASP A 1  826  ? 101.081 60.827  5.712   1.00 106.60 ? 826  ASP A C     1 
ATOM   6433  O  O     . ASP A 1  826  ? 101.682 60.954  4.656   1.00 106.37 ? 826  ASP A O     1 
ATOM   6434  C  CB    . ASP A 1  826  ? 100.631 63.286  6.466   1.00 108.75 ? 826  ASP A CB    1 
ATOM   6435  C  CG    . ASP A 1  826  ? 101.842 63.333  7.372   1.00 137.06 ? 826  ASP A CG    1 
ATOM   6436  O  OD1   . ASP A 1  826  ? 102.950 62.955  6.905   1.00 139.44 ? 826  ASP A OD1   1 
ATOM   6437  O  OD2   . ASP A 1  826  ? 101.719 63.884  8.501   1.00 150.03 ? 826  ASP A OD2   1 
ATOM   6438  N  N     . THR A 1  827  ? 101.165 59.712  6.460   1.00 102.95 ? 827  THR A N     1 
ATOM   6439  C  CA    . THR A 1  827  ? 102.035 58.627  6.011   1.00 102.44 ? 827  THR A CA    1 
ATOM   6440  C  C     . THR A 1  827  ? 101.388 58.006  4.790   1.00 107.94 ? 827  THR A C     1 
ATOM   6441  O  O     . THR A 1  827  ? 102.049 57.940  3.765   1.00 108.50 ? 827  THR A O     1 
ATOM   6442  C  CB    . THR A 1  827  ? 102.319 57.578  7.074   1.00 109.02 ? 827  THR A CB    1 
ATOM   6443  O  OG1   . THR A 1  827  ? 102.576 58.225  8.316   1.00 116.34 ? 827  THR A OG1   1 
ATOM   6444  C  CG2   . THR A 1  827  ? 103.503 56.703  6.702   1.00 103.02 ? 827  THR A CG2   1 
ATOM   6445  N  N     . ALA A 1  828  ? 100.078 57.655  4.873   1.00 104.71 ? 828  ALA A N     1 
ATOM   6446  C  CA    . ALA A 1  828  ? 99.265  57.050  3.804   1.00 103.99 ? 828  ALA A CA    1 
ATOM   6447  C  C     . ALA A 1  828  ? 99.241  57.854  2.498   1.00 108.96 ? 828  ALA A C     1 
ATOM   6448  O  O     . ALA A 1  828  ? 99.325  57.270  1.410   1.00 108.37 ? 828  ALA A O     1 
ATOM   6449  C  CB    . ALA A 1  828  ? 97.852  56.807  4.297   1.00 104.77 ? 828  ALA A CB    1 
ATOM   6450  N  N     . VAL A 1  829  ? 99.160  59.183  2.610   1.00 106.66 ? 829  VAL A N     1 
ATOM   6451  C  CA    . VAL A 1  829  ? 99.170  60.098  1.470   1.00 107.52 ? 829  VAL A CA    1 
ATOM   6452  C  C     . VAL A 1  829  ? 100.551 60.101  0.814   1.00 112.09 ? 829  VAL A C     1 
ATOM   6453  O  O     . VAL A 1  829  ? 100.673 59.802  -0.374  1.00 110.56 ? 829  VAL A O     1 
ATOM   6454  C  CB    . VAL A 1  829  ? 98.802  61.525  1.941   1.00 112.91 ? 829  VAL A CB    1 
ATOM   6455  C  CG1   . VAL A 1  829  ? 99.091  62.577  0.863   1.00 112.83 ? 829  VAL A CG1   1 
ATOM   6456  C  CG2   . VAL A 1  829  ? 97.353  61.588  2.403   1.00 113.55 ? 829  VAL A CG2   1 
ATOM   6457  N  N     . LYS A 1  830  ? 101.578 60.480  1.603   1.00 110.31 ? 830  LYS A N     1 
ATOM   6458  C  CA    . LYS A 1  830  ? 102.953 60.633  1.159   1.00 110.57 ? 830  LYS A CA    1 
ATOM   6459  C  C     . LYS A 1  830  ? 103.582 59.371  0.630   1.00 115.31 ? 830  LYS A C     1 
ATOM   6460  O  O     . LYS A 1  830  ? 104.182 59.422  -0.446  1.00 116.23 ? 830  LYS A O     1 
ATOM   6461  C  CB    . LYS A 1  830  ? 103.823 61.385  2.178   1.00 113.57 ? 830  LYS A CB    1 
ATOM   6462  C  CG    . LYS A 1  830  ? 103.594 62.907  2.141   1.00 124.00 ? 830  LYS A CG    1 
ATOM   6463  C  CD    . LYS A 1  830  ? 104.213 63.642  3.332   1.00 127.97 ? 830  LYS A CD    1 
ATOM   6464  C  CE    . LYS A 1  830  ? 103.613 65.011  3.520   1.00 132.15 ? 830  LYS A CE    1 
ATOM   6465  N  NZ    . LYS A 1  830  ? 102.159 64.940  3.839   1.00 137.04 ? 830  LYS A NZ    1 
ATOM   6466  N  N     . THR A 1  831  ? 103.342 58.225  1.289   1.00 110.67 ? 831  THR A N     1 
ATOM   6467  C  CA    . THR A 1  831  ? 103.832 56.913  0.836   1.00 109.13 ? 831  THR A CA    1 
ATOM   6468  C  C     . THR A 1  831  ? 103.548 56.615  -0.676  1.00 110.29 ? 831  THR A C     1 
ATOM   6469  O  O     . THR A 1  831  ? 104.284 55.858  -1.299  1.00 109.50 ? 831  THR A O     1 
ATOM   6470  C  CB    . THR A 1  831  ? 103.453 55.807  1.842   1.00 116.17 ? 831  THR A CB    1 
ATOM   6471  O  OG1   . THR A 1  831  ? 104.422 54.773  1.787   1.00 117.88 ? 831  THR A OG1   1 
ATOM   6472  C  CG2   . THR A 1  831  ? 102.034 55.252  1.644   1.00 112.35 ? 831  THR A CG2   1 
ATOM   6473  N  N     . ALA A 1  832  ? 102.529 57.265  -1.262  1.00 104.84 ? 832  ALA A N     1 
ATOM   6474  C  CA    . ALA A 1  832  ? 102.186 57.105  -2.670  1.00 103.44 ? 832  ALA A CA    1 
ATOM   6475  C  C     . ALA A 1  832  ? 102.882 58.127  -3.549  1.00 105.18 ? 832  ALA A C     1 
ATOM   6476  O  O     . ALA A 1  832  ? 103.413 57.771  -4.597  1.00 103.78 ? 832  ALA A O     1 
ATOM   6477  C  CB    . ALA A 1  832  ? 100.690 57.211  -2.843  1.00 104.61 ? 832  ALA A CB    1 
ATOM   6478  N  N     . GLU A 1  833  ? 102.848 59.403  -3.126  1.00 102.23 ? 833  GLU A N     1 
ATOM   6479  C  CA    . GLU A 1  833  ? 103.471 60.552  -3.788  1.00 102.22 ? 833  GLU A CA    1 
ATOM   6480  C  C     . GLU A 1  833  ? 104.951 60.229  -4.002  1.00 102.83 ? 833  GLU A C     1 
ATOM   6481  O  O     . GLU A 1  833  ? 105.452 60.304  -5.133  1.00 101.04 ? 833  GLU A O     1 
ATOM   6482  C  CB    . GLU A 1  833  ? 103.356 61.810  -2.881  1.00 104.87 ? 833  GLU A CB    1 
ATOM   6483  C  CG    . GLU A 1  833  ? 102.003 62.514  -2.848  1.00 123.75 ? 833  GLU A CG    1 
ATOM   6484  C  CD    . GLU A 1  833  ? 101.923 63.790  -2.014  1.00 157.23 ? 833  GLU A CD    1 
ATOM   6485  O  OE1   . GLU A 1  833  ? 102.005 63.696  -0.766  1.00 157.72 ? 833  GLU A OE1   1 
ATOM   6486  O  OE2   . GLU A 1  833  ? 101.720 64.878  -2.605  1.00 147.92 ? 833  GLU A OE2   1 
ATOM   6487  N  N     . THR A 1  834  ? 105.611 59.811  -2.888  1.00 98.10  ? 834  THR A N     1 
ATOM   6488  C  CA    . THR A 1  834  ? 107.023 59.476  -2.743  1.00 97.42  ? 834  THR A CA    1 
ATOM   6489  C  C     . THR A 1  834  ? 107.480 58.301  -3.592  1.00 100.42 ? 834  THR A C     1 
ATOM   6490  O  O     . THR A 1  834  ? 108.651 58.243  -4.009  1.00 100.18 ? 834  THR A O     1 
ATOM   6491  C  CB    . THR A 1  834  ? 107.384 59.315  -1.262  1.00 105.19 ? 834  THR A CB    1 
ATOM   6492  O  OG1   . THR A 1  834  ? 108.777 59.540  -1.096  1.00 106.88 ? 834  THR A OG1   1 
ATOM   6493  C  CG2   . THR A 1  834  ? 107.029 57.949  -0.697  1.00 103.68 ? 834  THR A CG2   1 
ATOM   6494  N  N     . GLY A 1  835  ? 106.573 57.357  -3.801  1.00 94.91  ? 835  GLY A N     1 
ATOM   6495  C  CA    . GLY A 1  835  ? 106.892 56.181  -4.590  1.00 93.24  ? 835  GLY A CA    1 
ATOM   6496  C  C     . GLY A 1  835  ? 106.965 56.498  -6.065  1.00 93.44  ? 835  GLY A C     1 
ATOM   6497  O  O     . GLY A 1  835  ? 107.797 55.940  -6.797  1.00 91.80  ? 835  GLY A O     1 
ATOM   6498  N  N     . TYR A 1  836  ? 106.065 57.388  -6.494  1.00 88.45  ? 836  TYR A N     1 
ATOM   6499  C  CA    . TYR A 1  836  ? 105.956 57.787  -7.877  1.00 87.98  ? 836  TYR A CA    1 
ATOM   6500  C  C     . TYR A 1  836  ? 107.031 58.768  -8.238  1.00 91.04  ? 836  TYR A C     1 
ATOM   6501  O  O     . TYR A 1  836  ? 107.466 58.762  -9.393  1.00 90.56  ? 836  TYR A O     1 
ATOM   6502  C  CB    . TYR A 1  836  ? 104.536 58.257  -8.187  1.00 89.90  ? 836  TYR A CB    1 
ATOM   6503  C  CG    . TYR A 1  836  ? 104.299 58.930  -9.526  1.00 92.89  ? 836  TYR A CG    1 
ATOM   6504  C  CD1   . TYR A 1  836  ? 104.644 58.303  -10.718 1.00 94.68  ? 836  TYR A CD1   1 
ATOM   6505  C  CD2   . TYR A 1  836  ? 103.585 60.122  -9.606  1.00 94.91  ? 836  TYR A CD2   1 
ATOM   6506  C  CE1   . TYR A 1  836  ? 104.372 58.896  -11.952 1.00 96.55  ? 836  TYR A CE1   1 
ATOM   6507  C  CE2   . TYR A 1  836  ? 103.290 60.712  -10.830 1.00 96.02  ? 836  TYR A CE2   1 
ATOM   6508  C  CZ    . TYR A 1  836  ? 103.672 60.092  -12.000 1.00 103.73 ? 836  TYR A CZ    1 
ATOM   6509  O  OH    . TYR A 1  836  ? 103.387 60.721  -13.184 1.00 107.40 ? 836  TYR A OH    1 
ATOM   6510  N  N     . ILE A 1  837  ? 107.535 59.547  -7.243  1.00 86.61  ? 837  ILE A N     1 
ATOM   6511  C  CA    . ILE A 1  837  ? 108.652 60.482  -7.470  1.00 85.53  ? 837  ILE A CA    1 
ATOM   6512  C  C     . ILE A 1  837  ? 109.866 59.634  -7.890  1.00 88.02  ? 837  ILE A C     1 
ATOM   6513  O  O     . ILE A 1  837  ? 110.474 59.873  -8.953  1.00 86.70  ? 837  ILE A O     1 
ATOM   6514  C  CB    . ILE A 1  837  ? 108.923 61.348  -6.215  1.00 87.91  ? 837  ILE A CB    1 
ATOM   6515  C  CG1   . ILE A 1  837  ? 108.002 62.564  -6.195  1.00 88.17  ? 837  ILE A CG1   1 
ATOM   6516  C  CG2   . ILE A 1  837  ? 110.376 61.778  -6.139  1.00 87.73  ? 837  ILE A CG2   1 
ATOM   6517  C  CD1   . ILE A 1  837  ? 107.795 63.099  -4.856  1.00 92.06  ? 837  ILE A CD1   1 
ATOM   6518  N  N     . GLN A 1  838  ? 110.117 58.567  -7.088  1.00 83.30  ? 838  GLN A N     1 
ATOM   6519  C  CA    . GLN A 1  838  ? 111.178 57.583  -7.289  1.00 81.72  ? 838  GLN A CA    1 
ATOM   6520  C  C     . GLN A 1  838  ? 111.069 56.966  -8.692  1.00 81.18  ? 838  GLN A C     1 
ATOM   6521  O  O     . GLN A 1  838  ? 112.075 56.880  -9.382  1.00 80.80  ? 838  GLN A O     1 
ATOM   6522  C  CB    . GLN A 1  838  ? 111.130 56.523  -6.167  1.00 82.98  ? 838  GLN A CB    1 
ATOM   6523  C  CG    . GLN A 1  838  ? 112.470 55.869  -5.829  1.00 95.75  ? 838  GLN A CG    1 
ATOM   6524  C  CD    . GLN A 1  838  ? 112.615 54.478  -6.417  1.00 124.16 ? 838  GLN A CD    1 
ATOM   6525  O  OE1   . GLN A 1  838  ? 111.823 54.020  -7.273  1.00 120.05 ? 838  GLN A OE1   1 
ATOM   6526  N  NE2   . GLN A 1  838  ? 113.657 53.779  -5.981  1.00 117.36 ? 838  GLN A NE2   1 
ATOM   6527  N  N     . ARG A 1  839  ? 109.846 56.650  -9.148  1.00 75.09  ? 839  ARG A N     1 
ATOM   6528  C  CA    . ARG A 1  839  ? 109.597 56.066  -10.465 1.00 73.52  ? 839  ARG A CA    1 
ATOM   6529  C  C     . ARG A 1  839  ? 110.063 56.964  -11.566 1.00 76.76  ? 839  ARG A C     1 
ATOM   6530  O  O     . ARG A 1  839  ? 110.742 56.508  -12.493 1.00 76.09  ? 839  ARG A O     1 
ATOM   6531  C  CB    . ARG A 1  839  ? 108.108 55.794  -10.681 1.00 72.65  ? 839  ARG A CB    1 
ATOM   6532  C  CG    . ARG A 1  839  ? 107.890 54.565  -11.535 1.00 81.45  ? 839  ARG A CG    1 
ATOM   6533  C  CD    . ARG A 1  839  ? 106.845 54.695  -12.622 1.00 78.94  ? 839  ARG A CD    1 
ATOM   6534  N  NE    . ARG A 1  839  ? 107.212 53.768  -13.685 1.00 78.86  ? 839  ARG A NE    1 
ATOM   6535  C  CZ    . ARG A 1  839  ? 106.605 53.677  -14.854 1.00 102.49 ? 839  ARG A CZ    1 
ATOM   6536  N  NH1   . ARG A 1  839  ? 105.542 54.435  -15.123 1.00 100.67 ? 839  ARG A NH1   1 
ATOM   6537  N  NH2   . ARG A 1  839  ? 107.049 52.827  -15.769 1.00 88.28  ? 839  ARG A NH2   1 
ATOM   6538  N  N     . ARG A 1  840  ? 109.661 58.239  -11.493 1.00 72.97  ? 840  ARG A N     1 
ATOM   6539  C  CA    . ARG A 1  840  ? 110.005 59.193  -12.531 1.00 72.12  ? 840  ARG A CA    1 
ATOM   6540  C  C     . ARG A 1  840  ? 111.485 59.442  -12.520 1.00 72.93  ? 840  ARG A C     1 
ATOM   6541  O  O     . ARG A 1  840  ? 112.092 59.307  -13.584 1.00 72.16  ? 840  ARG A O     1 
ATOM   6542  C  CB    . ARG A 1  840  ? 109.212 60.472  -12.386 1.00 72.82  ? 840  ARG A CB    1 
ATOM   6543  C  CG    . ARG A 1  840  ? 107.729 60.259  -12.557 1.00 81.40  ? 840  ARG A CG    1 
ATOM   6544  C  CD    . ARG A 1  840  ? 106.998 60.924  -11.417 1.00 90.26  ? 840  ARG A CD    1 
ATOM   6545  N  NE    . ARG A 1  840  ? 107.050 62.379  -11.490 1.00 93.89  ? 840  ARG A NE    1 
ATOM   6546  C  CZ    . ARG A 1  840  ? 106.768 63.182  -10.476 1.00 101.52 ? 840  ARG A CZ    1 
ATOM   6547  N  NH1   . ARG A 1  840  ? 106.402 62.675  -9.297  1.00 76.20  ? 840  ARG A NH1   1 
ATOM   6548  N  NH2   . ARG A 1  840  ? 106.869 64.497  -10.619 1.00 87.84  ? 840  ARG A NH2   1 
ATOM   6549  N  N     . LEU A 1  841  ? 112.089 59.676  -11.311 1.00 66.57  ? 841  LEU A N     1 
ATOM   6550  C  CA    . LEU A 1  841  ? 113.536 59.849  -11.177 1.00 65.49  ? 841  LEU A CA    1 
ATOM   6551  C  C     . LEU A 1  841  ? 114.255 58.703  -11.867 1.00 72.95  ? 841  LEU A C     1 
ATOM   6552  O  O     . LEU A 1  841  ? 115.193 58.960  -12.613 1.00 74.93  ? 841  LEU A O     1 
ATOM   6553  C  CB    . LEU A 1  841  ? 113.968 59.873  -9.728  1.00 64.78  ? 841  LEU A CB    1 
ATOM   6554  C  CG    . LEU A 1  841  ? 113.632 61.095  -8.933  1.00 69.54  ? 841  LEU A CG    1 
ATOM   6555  C  CD1   . LEU A 1  841  ? 113.829 60.831  -7.428  1.00 69.02  ? 841  LEU A CD1   1 
ATOM   6556  C  CD2   . LEU A 1  841  ? 114.433 62.297  -9.411  1.00 72.02  ? 841  LEU A CD2   1 
ATOM   6557  N  N     . VAL A 1  842  ? 113.801 57.440  -11.660 1.00 69.11  ? 842  VAL A N     1 
ATOM   6558  C  CA    . VAL A 1  842  ? 114.408 56.265  -12.294 1.00 68.21  ? 842  VAL A CA    1 
ATOM   6559  C  C     . VAL A 1  842  ? 114.198 56.293  -13.790 1.00 74.32  ? 842  VAL A C     1 
ATOM   6560  O  O     . VAL A 1  842  ? 115.156 56.209  -14.553 1.00 74.05  ? 842  VAL A O     1 
ATOM   6561  C  CB    . VAL A 1  842  ? 113.986 54.914  -11.672 1.00 70.04  ? 842  VAL A CB    1 
ATOM   6562  C  CG1   . VAL A 1  842  ? 114.384 53.753  -12.576 1.00 69.26  ? 842  VAL A CG1   1 
ATOM   6563  C  CG2   . VAL A 1  842  ? 114.590 54.740  -10.294 1.00 69.39  ? 842  VAL A CG2   1 
ATOM   6564  N  N     . LYS A 1  843  ? 112.958 56.449  -14.202 1.00 73.16  ? 843  LYS A N     1 
ATOM   6565  C  CA    . LYS A 1  843  ? 112.642 56.451  -15.617 1.00 74.45  ? 843  LYS A CA    1 
ATOM   6566  C  C     . LYS A 1  843  ? 113.354 57.560  -16.418 1.00 80.79  ? 843  LYS A C     1 
ATOM   6567  O  O     . LYS A 1  843  ? 113.793 57.322  -17.555 1.00 79.08  ? 843  LYS A O     1 
ATOM   6568  C  CB    . LYS A 1  843  ? 111.122 56.384  -15.826 1.00 76.30  ? 843  LYS A CB    1 
ATOM   6569  C  CG    . LYS A 1  843  ? 110.564 54.977  -15.595 1.00 76.12  ? 843  LYS A CG    1 
ATOM   6570  C  CD    . LYS A 1  843  ? 110.835 54.097  -16.817 1.00 86.84  ? 843  LYS A CD    1 
ATOM   6571  C  CE    . LYS A 1  843  ? 110.751 52.616  -16.562 1.00 99.73  ? 843  LYS A CE    1 
ATOM   6572  N  NZ    . LYS A 1  843  ? 111.202 51.883  -17.762 1.00 105.65 ? 843  LYS A NZ    1 
ATOM   6573  N  N     . ALA A 1  844  ? 113.555 58.731  -15.763 1.00 79.89  ? 844  ALA A N     1 
ATOM   6574  C  CA    . ALA A 1  844  ? 114.221 59.904  -16.339 1.00 80.38  ? 844  ALA A CA    1 
ATOM   6575  C  C     . ALA A 1  844  ? 115.699 59.667  -16.543 1.00 84.80  ? 844  ALA A C     1 
ATOM   6576  O  O     . ALA A 1  844  ? 116.243 60.101  -17.578 1.00 85.91  ? 844  ALA A O     1 
ATOM   6577  C  CB    . ALA A 1  844  ? 113.998 61.139  -15.471 1.00 81.10  ? 844  ALA A CB    1 
ATOM   6578  N  N     . LEU A 1  845  ? 116.338 58.937  -15.583 1.00 78.59  ? 845  LEU A N     1 
ATOM   6579  C  CA    . LEU A 1  845  ? 117.775 58.688  -15.609 1.00 76.91  ? 845  LEU A CA    1 
ATOM   6580  C  C     . LEU A 1  845  ? 118.247 57.283  -15.943 1.00 81.15  ? 845  LEU A C     1 
ATOM   6581  O  O     . LEU A 1  845  ? 119.455 57.101  -16.001 1.00 81.76  ? 845  LEU A O     1 
ATOM   6582  C  CB    . LEU A 1  845  ? 118.472 59.202  -14.332 1.00 76.10  ? 845  LEU A CB    1 
ATOM   6583  C  CG    . LEU A 1  845  ? 117.893 60.427  -13.626 1.00 80.33  ? 845  LEU A CG    1 
ATOM   6584  C  CD1   . LEU A 1  845  ? 118.529 60.612  -12.283 1.00 80.84  ? 845  LEU A CD1   1 
ATOM   6585  C  CD2   . LEU A 1  845  ? 118.053 61.681  -14.428 1.00 82.16  ? 845  LEU A CD2   1 
ATOM   6586  N  N     . GLU A 1  846  ? 117.346 56.302  -16.182 1.00 77.54  ? 846  GLU A N     1 
ATOM   6587  C  CA    . GLU A 1  846  ? 117.718 54.885  -16.419 1.00 77.21  ? 846  GLU A CA    1 
ATOM   6588  C  C     . GLU A 1  846  ? 118.917 54.596  -17.349 1.00 80.62  ? 846  GLU A C     1 
ATOM   6589  O  O     . GLU A 1  846  ? 119.904 54.004  -16.884 1.00 79.78  ? 846  GLU A O     1 
ATOM   6590  C  CB    . GLU A 1  846  ? 116.513 53.928  -16.638 1.00 78.47  ? 846  GLU A CB    1 
ATOM   6591  C  CG    . GLU A 1  846  ? 115.458 54.421  -17.619 1.00 94.67  ? 846  GLU A CG    1 
ATOM   6592  C  CD    . GLU A 1  846  ? 114.739 53.382  -18.461 1.00 114.22 ? 846  GLU A CD    1 
ATOM   6593  O  OE1   . GLU A 1  846  ? 115.416 52.682  -19.248 1.00 106.10 ? 846  GLU A OE1   1 
ATOM   6594  O  OE2   . GLU A 1  846  ? 113.488 53.349  -18.417 1.00 105.80 ? 846  GLU A OE2   1 
ATOM   6595  N  N     . ASP A 1  847  ? 118.860 55.104  -18.608 1.00 77.14  ? 847  ASP A N     1 
ATOM   6596  C  CA    . ASP A 1  847  ? 119.853 54.984  -19.695 1.00 76.93  ? 847  ASP A CA    1 
ATOM   6597  C  C     . ASP A 1  847  ? 121.221 55.711  -19.514 1.00 79.56  ? 847  ASP A C     1 
ATOM   6598  O  O     . ASP A 1  847  ? 122.072 55.607  -20.408 1.00 80.51  ? 847  ASP A O     1 
ATOM   6599  C  CB    . ASP A 1  847  ? 119.226 55.440  -21.020 1.00 79.72  ? 847  ASP A CB    1 
ATOM   6600  C  CG    . ASP A 1  847  ? 118.921 56.946  -21.121 1.00 95.10  ? 847  ASP A CG    1 
ATOM   6601  O  OD1   . ASP A 1  847  ? 118.649 57.586  -20.054 1.00 98.04  ? 847  ASP A OD1   1 
ATOM   6602  O  OD2   . ASP A 1  847  ? 118.915 57.482  -22.267 1.00 95.73  ? 847  ASP A OD2   1 
ATOM   6603  N  N     . ILE A 1  848  ? 121.436 56.445  -18.400 1.00 74.12  ? 848  ILE A N     1 
ATOM   6604  C  CA    . ILE A 1  848  ? 122.704 57.148  -18.136 1.00 73.38  ? 848  ILE A CA    1 
ATOM   6605  C  C     . ILE A 1  848  ? 123.721 56.216  -17.478 1.00 78.23  ? 848  ILE A C     1 
ATOM   6606  O  O     . ILE A 1  848  ? 123.394 55.535  -16.480 1.00 77.11  ? 848  ILE A O     1 
ATOM   6607  C  CB    . ILE A 1  848  ? 122.519 58.463  -17.335 1.00 75.94  ? 848  ILE A CB    1 
ATOM   6608  C  CG1   . ILE A 1  848  ? 121.602 59.437  -18.092 1.00 77.05  ? 848  ILE A CG1   1 
ATOM   6609  C  CG2   . ILE A 1  848  ? 123.852 59.119  -17.020 1.00 74.98  ? 848  ILE A CG2   1 
ATOM   6610  C  CD1   . ILE A 1  848  ? 120.597 60.179  -17.258 1.00 83.65  ? 848  ILE A CD1   1 
ATOM   6611  N  N     . MET A 1  849  ? 124.957 56.194  -18.080 1.00 75.57  ? 849  MET A N     1 
ATOM   6612  C  CA    . MET A 1  849  ? 126.157 55.444  -17.664 1.00 74.49  ? 849  MET A CA    1 
ATOM   6613  C  C     . MET A 1  849  ? 127.469 56.141  -18.029 1.00 77.11  ? 849  MET A C     1 
ATOM   6614  O  O     . MET A 1  849  ? 127.486 57.048  -18.867 1.00 76.72  ? 849  MET A O     1 
ATOM   6615  C  CB    . MET A 1  849  ? 126.143 53.979  -18.144 1.00 76.04  ? 849  MET A CB    1 
ATOM   6616  C  CG    . MET A 1  849  ? 126.956 53.701  -19.381 1.00 79.93  ? 849  MET A CG    1 
ATOM   6617  S  SD    . MET A 1  849  ? 127.253 51.931  -19.590 1.00 83.93  ? 849  MET A SD    1 
ATOM   6618  C  CE    . MET A 1  849  ? 128.801 51.965  -20.400 1.00 80.96  ? 849  MET A CE    1 
ATOM   6619  N  N     . VAL A 1  850  ? 128.561 55.691  -17.395 1.00 72.47  ? 850  VAL A N     1 
ATOM   6620  C  CA    . VAL A 1  850  ? 129.910 56.198  -17.594 1.00 72.71  ? 850  VAL A CA    1 
ATOM   6621  C  C     . VAL A 1  850  ? 130.536 55.413  -18.724 1.00 78.97  ? 850  VAL A C     1 
ATOM   6622  O  O     . VAL A 1  850  ? 130.685 54.202  -18.572 1.00 78.60  ? 850  VAL A O     1 
ATOM   6623  C  CB    . VAL A 1  850  ? 130.743 56.025  -16.294 1.00 76.13  ? 850  VAL A CB    1 
ATOM   6624  C  CG1   . VAL A 1  850  ? 132.166 56.544  -16.470 1.00 76.87  ? 850  VAL A CG1   1 
ATOM   6625  C  CG2   . VAL A 1  850  ? 130.074 56.700  -15.111 1.00 75.66  ? 850  VAL A CG2   1 
ATOM   6626  N  N     . HIS A 1  851  ? 130.931 56.068  -19.839 1.00 78.59  ? 851  HIS A N     1 
ATOM   6627  C  CA    . HIS A 1  851  ? 131.605 55.332  -20.930 1.00 80.22  ? 851  HIS A CA    1 
ATOM   6628  C  C     . HIS A 1  851  ? 133.117 55.298  -20.788 1.00 87.45  ? 851  HIS A C     1 
ATOM   6629  O  O     . HIS A 1  851  ? 133.672 55.901  -19.855 1.00 87.08  ? 851  HIS A O     1 
ATOM   6630  C  CB    . HIS A 1  851  ? 131.168 55.716  -22.351 1.00 81.20  ? 851  HIS A CB    1 
ATOM   6631  C  CG    . HIS A 1  851  ? 129.697 55.640  -22.554 1.00 84.43  ? 851  HIS A CG    1 
ATOM   6632  N  ND1   . HIS A 1  851  ? 128.827 56.505  -21.890 1.00 86.47  ? 851  HIS A ND1   1 
ATOM   6633  C  CD2   . HIS A 1  851  ? 128.981 54.839  -23.367 1.00 85.95  ? 851  HIS A CD2   1 
ATOM   6634  C  CE1   . HIS A 1  851  ? 127.614 56.182  -22.303 1.00 85.59  ? 851  HIS A CE1   1 
ATOM   6635  N  NE2   . HIS A 1  851  ? 127.655 55.195  -23.202 1.00 85.82  ? 851  HIS A NE2   1 
ATOM   6636  N  N     . TYR A 1  852  ? 133.780 54.550  -21.705 1.00 85.13  ? 852  TYR A N     1 
ATOM   6637  C  CA    . TYR A 1  852  ? 135.218 54.343  -21.667 1.00 85.06  ? 852  TYR A CA    1 
ATOM   6638  C  C     . TYR A 1  852  ? 136.063 55.613  -21.927 1.00 91.77  ? 852  TYR A C     1 
ATOM   6639  O  O     . TYR A 1  852  ? 137.291 55.525  -21.947 1.00 93.69  ? 852  TYR A O     1 
ATOM   6640  C  CB    . TYR A 1  852  ? 135.613 53.134  -22.527 1.00 85.07  ? 852  TYR A CB    1 
ATOM   6641  C  CG    . TYR A 1  852  ? 135.344 51.788  -21.883 1.00 84.64  ? 852  TYR A CG    1 
ATOM   6642  C  CD1   . TYR A 1  852  ? 136.204 51.269  -20.922 1.00 85.79  ? 852  TYR A CD1   1 
ATOM   6643  C  CD2   . TYR A 1  852  ? 134.291 50.986  -22.312 1.00 84.95  ? 852  TYR A CD2   1 
ATOM   6644  C  CE1   . TYR A 1  852  ? 135.983 50.015  -20.351 1.00 84.66  ? 852  TYR A CE1   1 
ATOM   6645  C  CE2   . TYR A 1  852  ? 134.082 49.713  -21.776 1.00 85.10  ? 852  TYR A CE2   1 
ATOM   6646  C  CZ    . TYR A 1  852  ? 134.926 49.236  -20.787 1.00 89.68  ? 852  TYR A CZ    1 
ATOM   6647  O  OH    . TYR A 1  852  ? 134.678 48.012  -20.207 1.00 87.67  ? 852  TYR A OH    1 
ATOM   6648  N  N     . ASP A 1  853  ? 135.412 56.794  -22.052 1.00 87.43  ? 853  ASP A N     1 
ATOM   6649  C  CA    . ASP A 1  853  ? 136.064 58.092  -22.225 1.00 88.27  ? 853  ASP A CA    1 
ATOM   6650  C  C     . ASP A 1  853  ? 135.758 58.973  -21.000 1.00 92.08  ? 853  ASP A C     1 
ATOM   6651  O  O     . ASP A 1  853  ? 135.740 60.217  -21.072 1.00 92.46  ? 853  ASP A O     1 
ATOM   6652  C  CB    . ASP A 1  853  ? 135.594 58.750  -23.531 1.00 91.15  ? 853  ASP A CB    1 
ATOM   6653  C  CG    . ASP A 1  853  ? 134.112 59.035  -23.605 1.00 104.12 ? 853  ASP A CG    1 
ATOM   6654  O  OD1   . ASP A 1  853  ? 133.344 58.377  -22.871 1.00 106.44 ? 853  ASP A OD1   1 
ATOM   6655  O  OD2   . ASP A 1  853  ? 133.717 59.908  -24.403 1.00 107.21 ? 853  ASP A OD2   1 
ATOM   6656  N  N     . ASN A 1  854  ? 135.482 58.288  -19.876 1.00 87.66  ? 854  ASN A N     1 
ATOM   6657  C  CA    . ASN A 1  854  ? 135.139 58.831  -18.563 1.00 87.56  ? 854  ASN A CA    1 
ATOM   6658  C  C     . ASN A 1  854  ? 133.931 59.782  -18.562 1.00 89.05  ? 854  ASN A C     1 
ATOM   6659  O  O     . ASN A 1  854  ? 133.565 60.357  -17.527 1.00 88.13  ? 854  ASN A O     1 
ATOM   6660  C  CB    . ASN A 1  854  ? 136.370 59.431  -17.884 1.00 93.22  ? 854  ASN A CB    1 
ATOM   6661  C  CG    . ASN A 1  854  ? 137.053 58.440  -16.977 1.00 125.91 ? 854  ASN A CG    1 
ATOM   6662  O  OD1   . ASN A 1  854  ? 137.913 57.683  -17.432 1.00 128.75 ? 854  ASN A OD1   1 
ATOM   6663  N  ND2   . ASN A 1  854  ? 136.651 58.383  -15.686 1.00 112.30 ? 854  ASN A ND2   1 
ATOM   6664  N  N     . THR A 1  855  ? 133.294 59.881  -19.728 1.00 84.09  ? 855  THR A N     1 
ATOM   6665  C  CA    . THR A 1  855  ? 132.175 60.745  -20.023 1.00 83.24  ? 855  THR A CA    1 
ATOM   6666  C  C     . THR A 1  855  ? 130.832 60.127  -19.634 1.00 85.06  ? 855  THR A C     1 
ATOM   6667  O  O     . THR A 1  855  ? 130.651 58.922  -19.803 1.00 85.75  ? 855  THR A O     1 
ATOM   6668  C  CB    . THR A 1  855  ? 132.329 61.224  -21.463 1.00 91.59  ? 855  THR A CB    1 
ATOM   6669  O  OG1   . THR A 1  855  ? 132.279 62.642  -21.501 1.00 99.15  ? 855  THR A OG1   1 
ATOM   6670  C  CG2   . THR A 1  855  ? 131.327 60.650  -22.383 1.00 85.94  ? 855  THR A CG2   1 
ATOM   6671  N  N     . THR A 1  856  ? 129.903 60.951  -19.111 1.00 78.77  ? 856  THR A N     1 
ATOM   6672  C  CA    . THR A 1  856  ? 128.565 60.553  -18.678 1.00 77.45  ? 856  THR A CA    1 
ATOM   6673  C  C     . THR A 1  856  ? 127.533 60.843  -19.783 1.00 83.89  ? 856  THR A C     1 
ATOM   6674  O  O     . THR A 1  856  ? 127.271 62.011  -20.126 1.00 84.80  ? 856  THR A O     1 
ATOM   6675  C  CB    . THR A 1  856  ? 128.306 61.187  -17.343 1.00 84.94  ? 856  THR A CB    1 
ATOM   6676  O  OG1   . THR A 1  856  ? 128.914 60.370  -16.364 1.00 84.82  ? 856  THR A OG1   1 
ATOM   6677  C  CG2   . THR A 1  856  ? 126.856 61.332  -17.028 1.00 88.06  ? 856  THR A CG2   1 
ATOM   6678  N  N     . ARG A 1  857  ? 126.995 59.764  -20.392 1.00 80.27  ? 857  ARG A N     1 
ATOM   6679  C  CA    . ARG A 1  857  ? 126.069 59.880  -21.529 1.00 79.20  ? 857  ARG A CA    1 
ATOM   6680  C  C     . ARG A 1  857  ? 124.794 59.037  -21.427 1.00 83.54  ? 857  ARG A C     1 
ATOM   6681  O  O     . ARG A 1  857  ? 124.771 57.940  -20.835 1.00 83.03  ? 857  ARG A O     1 
ATOM   6682  C  CB    . ARG A 1  857  ? 126.755 59.556  -22.875 1.00 74.43  ? 857  ARG A CB    1 
ATOM   6683  C  CG    . ARG A 1  857  ? 128.212 59.923  -23.043 1.00 71.64  ? 857  ARG A CG    1 
ATOM   6684  C  CD    . ARG A 1  857  ? 128.409 60.393  -24.455 1.00 74.30  ? 857  ARG A CD    1 
ATOM   6685  N  NE    . ARG A 1  857  ? 129.802 60.567  -24.841 1.00 77.55  ? 857  ARG A NE    1 
ATOM   6686  C  CZ    . ARG A 1  857  ? 130.208 60.814  -26.081 1.00 96.40  ? 857  ARG A CZ    1 
ATOM   6687  N  NH1   . ARG A 1  857  ? 129.332 60.869  -27.075 1.00 83.40  ? 857  ARG A NH1   1 
ATOM   6688  N  NH2   . ARG A 1  857  ? 131.496 60.944  -26.349 1.00 91.00  ? 857  ARG A NH2   1 
ATOM   6689  N  N     . ASN A 1  858  ? 123.754 59.535  -22.100 1.00 79.70  ? 858  ASN A N     1 
ATOM   6690  C  CA    . ASN A 1  858  ? 122.469 58.881  -22.189 1.00 79.70  ? 858  ASN A CA    1 
ATOM   6691  C  C     . ASN A 1  858  ? 122.434 57.901  -23.418 1.00 86.79  ? 858  ASN A C     1 
ATOM   6692  O  O     . ASN A 1  858  ? 123.474 57.688  -24.068 1.00 87.43  ? 858  ASN A O     1 
ATOM   6693  C  CB    . ASN A 1  858  ? 121.369 59.952  -22.205 1.00 78.48  ? 858  ASN A CB    1 
ATOM   6694  C  CG    . ASN A 1  858  ? 121.080 60.569  -23.539 1.00 100.56 ? 858  ASN A CG    1 
ATOM   6695  O  OD1   . ASN A 1  858  ? 121.966 60.817  -24.352 1.00 93.40  ? 858  ASN A OD1   1 
ATOM   6696  N  ND2   . ASN A 1  858  ? 119.814 60.790  -23.808 1.00 98.04  ? 858  ASN A ND2   1 
ATOM   6697  N  N     . SER A 1  859  ? 121.251 57.310  -23.729 1.00 83.38  ? 859  SER A N     1 
ATOM   6698  C  CA    . SER A 1  859  ? 121.094 56.375  -24.847 1.00 83.64  ? 859  SER A CA    1 
ATOM   6699  C  C     . SER A 1  859  ? 121.207 57.040  -26.249 1.00 89.81  ? 859  SER A C     1 
ATOM   6700  O  O     . SER A 1  859  ? 121.042 56.371  -27.285 1.00 91.20  ? 859  SER A O     1 
ATOM   6701  C  CB    . SER A 1  859  ? 119.791 55.592  -24.710 1.00 87.97  ? 859  SER A CB    1 
ATOM   6702  O  OG    . SER A 1  859  ? 118.642 56.377  -24.996 1.00 101.03 ? 859  SER A OG    1 
ATOM   6703  N  N     . LEU A 1  860  ? 121.481 58.351  -26.279 1.00 85.59  ? 860  LEU A N     1 
ATOM   6704  C  CA    . LEU A 1  860  ? 121.640 59.099  -27.521 1.00 85.48  ? 860  LEU A CA    1 
ATOM   6705  C  C     . LEU A 1  860  ? 123.077 59.548  -27.631 1.00 89.25  ? 860  LEU A C     1 
ATOM   6706  O  O     . LEU A 1  860  ? 123.447 60.239  -28.597 1.00 90.29  ? 860  LEU A O     1 
ATOM   6707  C  CB    . LEU A 1  860  ? 120.702 60.315  -27.544 1.00 85.78  ? 860  LEU A CB    1 
ATOM   6708  C  CG    . LEU A 1  860  ? 119.218 60.027  -27.600 1.00 90.34  ? 860  LEU A CG    1 
ATOM   6709  C  CD1   . LEU A 1  860  ? 118.419 61.274  -27.326 1.00 91.12  ? 860  LEU A CD1   1 
ATOM   6710  C  CD2   . LEU A 1  860  ? 118.829 59.442  -28.935 1.00 94.06  ? 860  LEU A CD2   1 
ATOM   6711  N  N     . GLY A 1  861  ? 123.862 59.165  -26.620 1.00 83.90  ? 861  GLY A N     1 
ATOM   6712  C  CA    . GLY A 1  861  ? 125.271 59.511  -26.505 1.00 83.91  ? 861  GLY A CA    1 
ATOM   6713  C  C     . GLY A 1  861  ? 125.521 60.989  -26.271 1.00 87.80  ? 861  GLY A C     1 
ATOM   6714  O  O     . GLY A 1  861  ? 126.646 61.456  -26.449 1.00 87.93  ? 861  GLY A O     1 
ATOM   6715  N  N     . ASN A 1  862  ? 124.477 61.742  -25.884 1.00 83.29  ? 862  ASN A N     1 
ATOM   6716  C  CA    . ASN A 1  862  ? 124.586 63.156  -25.568 1.00 83.13  ? 862  ASN A CA    1 
ATOM   6717  C  C     . ASN A 1  862  ? 125.340 63.265  -24.249 1.00 87.74  ? 862  ASN A C     1 
ATOM   6718  O  O     . ASN A 1  862  ? 125.202 62.401  -23.386 1.00 87.68  ? 862  ASN A O     1 
ATOM   6719  C  CB    . ASN A 1  862  ? 123.205 63.816  -25.492 1.00 82.53  ? 862  ASN A CB    1 
ATOM   6720  C  CG    . ASN A 1  862  ? 122.322 63.592  -26.708 1.00 107.68 ? 862  ASN A CG    1 
ATOM   6721  O  OD1   . ASN A 1  862  ? 122.764 63.517  -27.866 1.00 103.30 ? 862  ASN A OD1   1 
ATOM   6722  N  ND2   . ASN A 1  862  ? 121.031 63.496  -26.463 1.00 102.79 ? 862  ASN A ND2   1 
ATOM   6723  N  N     . VAL A 1  863  ? 126.212 64.248  -24.122 1.00 85.08  ? 863  VAL A N     1 
ATOM   6724  C  CA    . VAL A 1  863  ? 126.994 64.361  -22.900 1.00 84.94  ? 863  VAL A CA    1 
ATOM   6725  C  C     . VAL A 1  863  ? 126.158 65.046  -21.851 1.00 88.80  ? 863  VAL A C     1 
ATOM   6726  O  O     . VAL A 1  863  ? 125.584 66.113  -22.115 1.00 89.15  ? 863  VAL A O     1 
ATOM   6727  C  CB    . VAL A 1  863  ? 128.382 65.021  -23.122 1.00 89.36  ? 863  VAL A CB    1 
ATOM   6728  C  CG1   . VAL A 1  863  ? 129.110 65.253  -21.802 1.00 89.01  ? 863  VAL A CG1   1 
ATOM   6729  C  CG2   . VAL A 1  863  ? 129.240 64.179  -24.065 1.00 89.19  ? 863  VAL A CG2   1 
ATOM   6730  N  N     . ILE A 1  864  ? 126.034 64.389  -20.684 1.00 84.07  ? 864  ILE A N     1 
ATOM   6731  C  CA    . ILE A 1  864  ? 125.312 64.947  -19.547 1.00 83.46  ? 864  ILE A CA    1 
ATOM   6732  C  C     . ILE A 1  864  ? 126.336 65.690  -18.694 1.00 87.36  ? 864  ILE A C     1 
ATOM   6733  O  O     . ILE A 1  864  ? 126.257 66.911  -18.548 1.00 87.25  ? 864  ILE A O     1 
ATOM   6734  C  CB    . ILE A 1  864  ? 124.424 63.892  -18.821 1.00 85.32  ? 864  ILE A CB    1 
ATOM   6735  C  CG1   . ILE A 1  864  ? 123.005 63.913  -19.411 1.00 85.14  ? 864  ILE A CG1   1 
ATOM   6736  C  CG2   . ILE A 1  864  ? 124.333 64.145  -17.315 1.00 86.54  ? 864  ILE A CG2   1 
ATOM   6737  C  CD1   . ILE A 1  864  ? 122.819 63.337  -20.814 1.00 93.88  ? 864  ILE A CD1   1 
ATOM   6738  N  N     . GLN A 1  865  ? 127.348 64.955  -18.242 1.00 83.88  ? 865  GLN A N     1 
ATOM   6739  C  CA    . GLN A 1  865  ? 128.482 65.437  -17.472 1.00 84.23  ? 865  GLN A CA    1 
ATOM   6740  C  C     . GLN A 1  865  ? 129.711 65.065  -18.294 1.00 88.26  ? 865  GLN A C     1 
ATOM   6741  O  O     . GLN A 1  865  ? 129.749 63.967  -18.865 1.00 88.34  ? 865  GLN A O     1 
ATOM   6742  C  CB    . GLN A 1  865  ? 128.549 64.716  -16.110 1.00 84.95  ? 865  GLN A CB    1 
ATOM   6743  C  CG    . GLN A 1  865  ? 127.432 65.082  -15.140 1.00 96.45  ? 865  GLN A CG    1 
ATOM   6744  C  CD    . GLN A 1  865  ? 127.619 64.429  -13.795 1.00 112.80 ? 865  GLN A CD    1 
ATOM   6745  O  OE1   . GLN A 1  865  ? 128.300 63.411  -13.668 1.00 106.33 ? 865  GLN A OE1   1 
ATOM   6746  N  NE2   . GLN A 1  865  ? 127.017 64.996  -12.754 1.00 105.99 ? 865  GLN A NE2   1 
ATOM   6747  N  N     . PHE A 1  866  ? 130.705 65.958  -18.375 1.00 83.95  ? 866  PHE A N     1 
ATOM   6748  C  CA    . PHE A 1  866  ? 131.919 65.637  -19.110 1.00 83.52  ? 866  PHE A CA    1 
ATOM   6749  C  C     . PHE A 1  866  ? 132.726 64.559  -18.420 1.00 89.66  ? 866  PHE A C     1 
ATOM   6750  O  O     . PHE A 1  866  ? 133.302 63.709  -19.100 1.00 90.69  ? 866  PHE A O     1 
ATOM   6751  C  CB    . PHE A 1  866  ? 132.741 66.878  -19.443 1.00 85.37  ? 866  PHE A CB    1 
ATOM   6752  C  CG    . PHE A 1  866  ? 132.215 67.481  -20.717 1.00 86.53  ? 866  PHE A CG    1 
ATOM   6753  C  CD1   . PHE A 1  866  ? 132.616 66.990  -21.954 1.00 89.17  ? 866  PHE A CD1   1 
ATOM   6754  C  CD2   . PHE A 1  866  ? 131.250 68.481  -20.685 1.00 88.56  ? 866  PHE A CD2   1 
ATOM   6755  C  CE1   . PHE A 1  866  ? 132.092 67.518  -23.135 1.00 90.22  ? 866  PHE A CE1   1 
ATOM   6756  C  CE2   . PHE A 1  866  ? 130.708 68.991  -21.866 1.00 91.33  ? 866  PHE A CE2   1 
ATOM   6757  C  CZ    . PHE A 1  866  ? 131.132 68.503  -23.083 1.00 89.40  ? 866  PHE A CZ    1 
ATOM   6758  N  N     . ILE A 1  867  ? 132.723 64.560  -17.075 1.00 85.99  ? 867  ILE A N     1 
ATOM   6759  C  CA    . ILE A 1  867  ? 133.409 63.591  -16.213 1.00 85.84  ? 867  ILE A CA    1 
ATOM   6760  C  C     . ILE A 1  867  ? 132.436 63.351  -15.044 1.00 88.66  ? 867  ILE A C     1 
ATOM   6761  O  O     . ILE A 1  867  ? 131.860 64.334  -14.584 1.00 89.23  ? 867  ILE A O     1 
ATOM   6762  C  CB    . ILE A 1  867  ? 134.830 64.172  -15.864 1.00 90.05  ? 867  ILE A CB    1 
ATOM   6763  C  CG1   . ILE A 1  867  ? 135.899 63.678  -16.872 1.00 92.49  ? 867  ILE A CG1   1 
ATOM   6764  C  CG2   . ILE A 1  867  ? 135.300 64.011  -14.443 1.00 88.54  ? 867  ILE A CG2   1 
ATOM   6765  C  CD1   . ILE A 1  867  ? 136.150 64.749  -18.269 1.00 109.50 ? 867  ILE A CD1   1 
ATOM   6766  N  N     . TYR A 1  868  ? 132.158 62.065  -14.642 1.00 82.55  ? 868  TYR A N     1 
ATOM   6767  C  CA    . TYR A 1  868  ? 131.188 61.755  -13.572 1.00 81.36  ? 868  TYR A CA    1 
ATOM   6768  C  C     . TYR A 1  868  ? 131.438 62.519  -12.271 1.00 86.31  ? 868  TYR A C     1 
ATOM   6769  O  O     . TYR A 1  868  ? 132.554 62.521  -11.753 1.00 86.85  ? 868  TYR A O     1 
ATOM   6770  C  CB    . TYR A 1  868  ? 131.039 60.239  -13.340 1.00 81.91  ? 868  TYR A CB    1 
ATOM   6771  C  CG    . TYR A 1  868  ? 130.231 59.806  -12.116 1.00 84.09  ? 868  TYR A CG    1 
ATOM   6772  C  CD1   . TYR A 1  868  ? 128.863 60.050  -12.032 1.00 85.81  ? 868  TYR A CD1   1 
ATOM   6773  C  CD2   . TYR A 1  868  ? 130.812 59.041  -11.107 1.00 84.79  ? 868  TYR A CD2   1 
ATOM   6774  C  CE1   . TYR A 1  868  ? 128.117 59.632  -10.927 1.00 85.57  ? 868  TYR A CE1   1 
ATOM   6775  C  CE2   . TYR A 1  868  ? 130.068 58.585  -10.019 1.00 85.40  ? 868  TYR A CE2   1 
ATOM   6776  C  CZ    . TYR A 1  868  ? 128.718 58.878  -9.935  1.00 91.91  ? 868  TYR A CZ    1 
ATOM   6777  O  OH    . TYR A 1  868  ? 127.978 58.412  -8.872  1.00 93.12  ? 868  TYR A OH    1 
ATOM   6778  N  N     . GLY A 1  869  ? 130.409 63.209  -11.793 1.00 83.10  ? 869  GLY A N     1 
ATOM   6779  C  CA    . GLY A 1  869  ? 130.495 64.029  -10.594 1.00 84.05  ? 869  GLY A CA    1 
ATOM   6780  C  C     . GLY A 1  869  ? 131.577 65.104  -10.627 1.00 91.13  ? 869  GLY A C     1 
ATOM   6781  O  O     . GLY A 1  869  ? 132.105 65.453  -9.573  1.00 92.03  ? 869  GLY A O     1 
ATOM   6782  N  N     . GLU A 1  870  ? 131.937 65.626  -11.837 1.00 88.14  ? 870  GLU A N     1 
ATOM   6783  C  CA    . GLU A 1  870  ? 132.936 66.686  -12.091 1.00 88.70  ? 870  GLU A CA    1 
ATOM   6784  C  C     . GLU A 1  870  ? 134.409 66.341  -11.687 1.00 95.18  ? 870  GLU A C     1 
ATOM   6785  O  O     . GLU A 1  870  ? 135.326 67.143  -11.982 1.00 97.38  ? 870  GLU A O     1 
ATOM   6786  C  CB    . GLU A 1  870  ? 132.486 68.040  -11.488 1.00 90.15  ? 870  GLU A CB    1 
ATOM   6787  C  CG    . GLU A 1  870  ? 131.084 68.445  -11.892 1.00 99.03  ? 870  GLU A CG    1 
ATOM   6788  C  CD    . GLU A 1  870  ? 130.462 69.713  -11.335 1.00 118.16 ? 870  GLU A CD    1 
ATOM   6789  O  OE1   . GLU A 1  870  ? 131.188 70.665  -10.955 1.00 107.91 ? 870  GLU A OE1   1 
ATOM   6790  O  OE2   . GLU A 1  870  ? 129.213 69.777  -11.370 1.00 109.15 ? 870  GLU A OE2   1 
ATOM   6791  N  N     . ASP A 1  871  ? 134.628 65.156  -11.031 1.00 88.60  ? 871  ASP A N     1 
ATOM   6792  C  CA    . ASP A 1  871  ? 135.928 64.712  -10.534 1.00 87.65  ? 871  ASP A CA    1 
ATOM   6793  C  C     . ASP A 1  871  ? 136.408 63.350  -11.047 1.00 89.65  ? 871  ASP A C     1 
ATOM   6794  O  O     . ASP A 1  871  ? 137.580 63.006  -10.859 1.00 88.94  ? 871  ASP A O     1 
ATOM   6795  C  CB    . ASP A 1  871  ? 135.954 64.762  -8.995  1.00 89.87  ? 871  ASP A CB    1 
ATOM   6796  C  CG    . ASP A 1  871  ? 135.047 63.784  -8.260  1.00 101.33 ? 871  ASP A CG    1 
ATOM   6797  O  OD1   . ASP A 1  871  ? 134.567 62.820  -8.897  1.00 101.44 ? 871  ASP A OD1   1 
ATOM   6798  O  OD2   . ASP A 1  871  ? 134.848 63.962  -7.029  1.00 106.88 ? 871  ASP A OD2   1 
ATOM   6799  N  N     . GLY A 1  872  ? 135.481 62.580  -11.620 1.00 85.54  ? 872  GLY A N     1 
ATOM   6800  C  CA    . GLY A 1  872  ? 135.706 61.251  -12.192 1.00 84.70  ? 872  GLY A CA    1 
ATOM   6801  C  C     . GLY A 1  872  ? 135.928 60.182  -11.155 1.00 87.86  ? 872  GLY A C     1 
ATOM   6802  O  O     . GLY A 1  872  ? 136.628 59.203  -11.404 1.00 87.18  ? 872  GLY A O     1 
ATOM   6803  N  N     . MET A 1  873  ? 135.290 60.340  -10.007 1.00 85.05  ? 873  MET A N     1 
ATOM   6804  C  CA    . MET A 1  873  ? 135.475 59.443  -8.885  1.00 85.56  ? 873  MET A CA    1 
ATOM   6805  C  C     . MET A 1  873  ? 134.219 58.611  -8.525  1.00 91.28  ? 873  MET A C     1 
ATOM   6806  O  O     . MET A 1  873  ? 133.096 59.132  -8.586  1.00 89.76  ? 873  MET A O     1 
ATOM   6807  C  CB    . MET A 1  873  ? 135.962 60.286  -7.681  1.00 88.18  ? 873  MET A CB    1 
ATOM   6808  C  CG    . MET A 1  873  ? 137.207 59.752  -6.982  1.00 91.64  ? 873  MET A CG    1 
ATOM   6809  S  SD    . MET A 1  873  ? 138.602 59.406  -8.074  1.00 95.86  ? 873  MET A SD    1 
ATOM   6810  C  CE    . MET A 1  873  ? 139.077 61.109  -8.638  1.00 93.45  ? 873  MET A CE    1 
ATOM   6811  N  N     . ASP A 1  874  ? 134.428 57.309  -8.167  1.00 89.43  ? 874  ASP A N     1 
ATOM   6812  C  CA    . ASP A 1  874  ? 133.385 56.393  -7.684  1.00 89.91  ? 874  ASP A CA    1 
ATOM   6813  C  C     . ASP A 1  874  ? 133.083 56.838  -6.248  1.00 93.62  ? 874  ASP A C     1 
ATOM   6814  O  O     . ASP A 1  874  ? 133.991 56.924  -5.414  1.00 93.43  ? 874  ASP A O     1 
ATOM   6815  C  CB    . ASP A 1  874  ? 133.865 54.910  -7.735  1.00 93.01  ? 874  ASP A CB    1 
ATOM   6816  C  CG    . ASP A 1  874  ? 132.940 53.794  -7.187  1.00 109.95 ? 874  ASP A CG    1 
ATOM   6817  O  OD1   . ASP A 1  874  ? 131.895 54.125  -6.540  1.00 109.18 ? 874  ASP A OD1   1 
ATOM   6818  O  OD2   . ASP A 1  874  ? 133.284 52.586  -7.373  1.00 118.30 ? 874  ASP A OD2   1 
ATOM   6819  N  N     . ALA A 1  875  ? 131.808 57.140  -5.982  1.00 90.27  ? 875  ALA A N     1 
ATOM   6820  C  CA    . ALA A 1  875  ? 131.295 57.657  -4.702  1.00 89.89  ? 875  ALA A CA    1 
ATOM   6821  C  C     . ALA A 1  875  ? 131.696 56.938  -3.420  1.00 90.92  ? 875  ALA A C     1 
ATOM   6822  O  O     . ALA A 1  875  ? 131.946 57.618  -2.431  1.00 89.60  ? 875  ALA A O     1 
ATOM   6823  C  CB    . ALA A 1  875  ? 129.789 57.812  -4.768  1.00 90.32  ? 875  ALA A CB    1 
ATOM   6824  N  N     . ALA A 1  876  ? 131.781 55.587  -3.442  1.00 86.52  ? 876  ALA A N     1 
ATOM   6825  C  CA    . ALA A 1  876  ? 132.136 54.771  -2.278  1.00 86.35  ? 876  ALA A CA    1 
ATOM   6826  C  C     . ALA A 1  876  ? 133.597 54.914  -1.827  1.00 91.86  ? 876  ALA A C     1 
ATOM   6827  O  O     . ALA A 1  876  ? 133.941 54.598  -0.674  1.00 91.27  ? 876  ALA A O     1 
ATOM   6828  C  CB    . ALA A 1  876  ? 131.814 53.327  -2.550  1.00 86.32  ? 876  ALA A CB    1 
ATOM   6829  N  N     . HIS A 1  877  ? 134.440 55.432  -2.733  1.00 89.69  ? 877  HIS A N     1 
ATOM   6830  C  CA    . HIS A 1  877  ? 135.867 55.658  -2.503  1.00 90.27  ? 877  HIS A CA    1 
ATOM   6831  C  C     . HIS A 1  877  ? 136.245 57.042  -1.968  1.00 95.52  ? 877  HIS A C     1 
ATOM   6832  O  O     . HIS A 1  877  ? 137.439 57.342  -1.813  1.00 96.63  ? 877  HIS A O     1 
ATOM   6833  C  CB    . HIS A 1  877  ? 136.642 55.336  -3.767  1.00 90.42  ? 877  HIS A CB    1 
ATOM   6834  C  CG    . HIS A 1  877  ? 136.747 53.875  -3.986  1.00 92.47  ? 877  HIS A CG    1 
ATOM   6835  N  ND1   . HIS A 1  877  ? 135.738 53.175  -4.600  1.00 93.10  ? 877  HIS A ND1   1 
ATOM   6836  C  CD2   . HIS A 1  877  ? 137.717 53.018  -3.606  1.00 93.87  ? 877  HIS A CD2   1 
ATOM   6837  C  CE1   . HIS A 1  877  ? 136.132 51.918  -4.601  1.00 92.27  ? 877  HIS A CE1   1 
ATOM   6838  N  NE2   . HIS A 1  877  ? 137.320 51.779  -4.015  1.00 93.13  ? 877  HIS A NE2   1 
ATOM   6839  N  N     . ILE A 1  878  ? 135.230 57.855  -1.653  1.00 90.70  ? 878  ILE A N     1 
ATOM   6840  C  CA    . ILE A 1  878  ? 135.365 59.206  -1.127  1.00 90.50  ? 878  ILE A CA    1 
ATOM   6841  C  C     . ILE A 1  878  ? 135.131 59.212  0.406   1.00 93.90  ? 878  ILE A C     1 
ATOM   6842  O  O     . ILE A 1  878  ? 134.433 58.332  0.916   1.00 94.38  ? 878  ILE A O     1 
ATOM   6843  C  CB    . ILE A 1  878  ? 134.400 60.078  -1.965  1.00 93.06  ? 878  ILE A CB    1 
ATOM   6844  C  CG1   . ILE A 1  878  ? 135.090 60.572  -3.217  1.00 93.85  ? 878  ILE A CG1   1 
ATOM   6845  C  CG2   . ILE A 1  878  ? 133.750 61.206  -1.221  1.00 93.62  ? 878  ILE A CG2   1 
ATOM   6846  C  CD1   . ILE A 1  878  ? 134.423 60.100  -4.379  1.00 104.48 ? 878  ILE A CD1   1 
ATOM   6847  N  N     . GLU A 1  879  ? 135.795 60.137  1.130   1.00 88.95  ? 879  GLU A N     1 
ATOM   6848  C  CA    . GLU A 1  879  ? 135.720 60.322  2.586   1.00 88.70  ? 879  GLU A CA    1 
ATOM   6849  C  C     . GLU A 1  879  ? 135.899 61.801  2.916   1.00 95.76  ? 879  GLU A C     1 
ATOM   6850  O  O     . GLU A 1  879  ? 136.740 62.482  2.306   1.00 95.45  ? 879  GLU A O     1 
ATOM   6851  C  CB    . GLU A 1  879  ? 136.851 59.570  3.307   1.00 90.01  ? 879  GLU A CB    1 
ATOM   6852  C  CG    . GLU A 1  879  ? 136.936 58.089  3.011   1.00 99.31  ? 879  GLU A CG    1 
ATOM   6853  C  CD    . GLU A 1  879  ? 137.964 57.305  3.799   1.00 114.80 ? 879  GLU A CD    1 
ATOM   6854  O  OE1   . GLU A 1  879  ? 138.245 57.677  4.965   1.00 96.70  ? 879  GLU A OE1   1 
ATOM   6855  O  OE2   . GLU A 1  879  ? 138.468 56.295  3.251   1.00 106.97 ? 879  GLU A OE2   1 
ATOM   6856  N  N     . LYS A 1  880  ? 135.158 62.289  3.929   1.00 94.16  ? 880  LYS A N     1 
ATOM   6857  C  CA    . LYS A 1  880  ? 135.260 63.679  4.397   1.00 94.72  ? 880  LYS A CA    1 
ATOM   6858  C  C     . LYS A 1  880  ? 136.700 63.890  4.878   1.00 98.68  ? 880  LYS A C     1 
ATOM   6859  O  O     . LYS A 1  880  ? 137.252 63.024  5.561   1.00 98.07  ? 880  LYS A O     1 
ATOM   6860  C  CB    . LYS A 1  880  ? 134.224 63.969  5.518   1.00 97.11  ? 880  LYS A CB    1 
ATOM   6861  C  CG    . LYS A 1  880  ? 133.662 65.396  5.533   1.00 108.64 ? 880  LYS A CG    1 
ATOM   6862  C  CD    . LYS A 1  880  ? 132.267 65.485  6.200   1.00 122.97 ? 880  LYS A CD    1 
ATOM   6863  C  CE    . LYS A 1  880  ? 131.111 65.331  5.213   1.00 142.55 ? 880  LYS A CE    1 
ATOM   6864  N  NZ    . LYS A 1  880  ? 129.775 65.687  5.786   1.00 149.33 ? 880  LYS A NZ    1 
ATOM   6865  N  N     . GLN A 1  881  ? 137.340 64.961  4.409   1.00 95.86  ? 881  GLN A N     1 
ATOM   6866  C  CA    . GLN A 1  881  ? 138.727 65.304  4.750   1.00 96.60  ? 881  GLN A CA    1 
ATOM   6867  C  C     . GLN A 1  881  ? 138.848 66.804  4.960   1.00 102.61 ? 881  GLN A C     1 
ATOM   6868  O  O     . GLN A 1  881  ? 138.244 67.573  4.214   1.00 101.84 ? 881  GLN A O     1 
ATOM   6869  C  CB    . GLN A 1  881  ? 139.717 64.842  3.661   1.00 97.04  ? 881  GLN A CB    1 
ATOM   6870  C  CG    . GLN A 1  881  ? 139.781 63.346  3.508   1.00 88.29  ? 881  GLN A CG    1 
ATOM   6871  C  CD    . GLN A 1  881  ? 141.017 62.909  2.811   1.00 95.26  ? 881  GLN A CD    1 
ATOM   6872  O  OE1   . GLN A 1  881  ? 142.091 62.727  3.428   1.00 90.96  ? 881  GLN A OE1   1 
ATOM   6873  N  NE2   . GLN A 1  881  ? 140.848 62.633  1.530   1.00 81.05  ? 881  GLN A NE2   1 
ATOM   6874  N  N     . SER A 1  882  ? 139.630 67.214  5.976   1.00 101.00 ? 882  SER A N     1 
ATOM   6875  C  CA    . SER A 1  882  ? 139.852 68.616  6.314   1.00 101.62 ? 882  SER A CA    1 
ATOM   6876  C  C     . SER A 1  882  ? 140.966 69.196  5.453   1.00 106.43 ? 882  SER A C     1 
ATOM   6877  O  O     . SER A 1  882  ? 142.074 68.639  5.410   1.00 105.55 ? 882  SER A O     1 
ATOM   6878  C  CB    . SER A 1  882  ? 140.194 68.763  7.795   1.00 105.70 ? 882  SER A CB    1 
ATOM   6879  O  OG    . SER A 1  882  ? 140.344 70.121  8.171   1.00 117.13 ? 882  SER A OG    1 
ATOM   6880  N  N     . LEU A 1  883  ? 140.649 70.305  4.743   1.00 104.17 ? 883  LEU A N     1 
ATOM   6881  C  CA    . LEU A 1  883  ? 141.582 71.062  3.907   1.00 104.94 ? 883  LEU A CA    1 
ATOM   6882  C  C     . LEU A 1  883  ? 142.182 72.136  4.834   1.00 114.25 ? 883  LEU A C     1 
ATOM   6883  O  O     . LEU A 1  883  ? 141.597 73.211  5.018   1.00 114.77 ? 883  LEU A O     1 
ATOM   6884  C  CB    . LEU A 1  883  ? 140.854 71.666  2.689   1.00 103.91 ? 883  LEU A CB    1 
ATOM   6885  C  CG    . LEU A 1  883  ? 140.307 70.649  1.678   1.00 106.12 ? 883  LEU A CG    1 
ATOM   6886  C  CD1   . LEU A 1  883  ? 139.036 71.135  1.041   1.00 105.53 ? 883  LEU A CD1   1 
ATOM   6887  C  CD2   . LEU A 1  883  ? 141.325 70.318  0.614   1.00 106.95 ? 883  LEU A CD2   1 
ATOM   6888  N  N     . ASP A 1  884  ? 143.303 71.763  5.513   1.00 113.25 ? 884  ASP A N     1 
ATOM   6889  C  CA    . ASP A 1  884  ? 144.034 72.539  6.532   1.00 114.55 ? 884  ASP A CA    1 
ATOM   6890  C  C     . ASP A 1  884  ? 144.332 73.946  6.104   1.00 118.78 ? 884  ASP A C     1 
ATOM   6891  O  O     . ASP A 1  884  ? 144.060 74.879  6.860   1.00 119.79 ? 884  ASP A O     1 
ATOM   6892  C  CB    . ASP A 1  884  ? 145.342 71.844  6.925   1.00 116.92 ? 884  ASP A CB    1 
ATOM   6893  C  CG    . ASP A 1  884  ? 145.154 70.387  7.242   1.00 129.37 ? 884  ASP A CG    1 
ATOM   6894  O  OD1   . ASP A 1  884  ? 144.844 70.073  8.410   1.00 131.21 ? 884  ASP A OD1   1 
ATOM   6895  O  OD2   . ASP A 1  884  ? 145.277 69.560  6.312   1.00 135.87 ? 884  ASP A OD2   1 
ATOM   6896  N  N     . THR A 1  885  ? 144.875 74.085  4.878   1.00 113.38 ? 885  THR A N     1 
ATOM   6897  C  CA    . THR A 1  885  ? 145.252 75.321  4.215   1.00 112.94 ? 885  THR A CA    1 
ATOM   6898  C  C     . THR A 1  885  ? 144.185 76.452  4.381   1.00 116.50 ? 885  THR A C     1 
ATOM   6899  O  O     . THR A 1  885  ? 144.522 77.511  4.911   1.00 117.25 ? 885  THR A O     1 
ATOM   6900  C  CB    . THR A 1  885  ? 145.821 74.967  2.809   1.00 115.45 ? 885  THR A CB    1 
ATOM   6901  O  OG1   . THR A 1  885  ? 147.122 75.505  2.663   1.00 112.65 ? 885  THR A OG1   1 
ATOM   6902  C  CG2   . THR A 1  885  ? 144.956 75.403  1.651   1.00 113.86 ? 885  THR A CG2   1 
ATOM   6903  N  N     . ILE A 1  886  ? 142.895 76.143  4.074   1.00 111.36 ? 886  ILE A N     1 
ATOM   6904  C  CA    . ILE A 1  886  ? 141.685 76.988  4.075   1.00 110.72 ? 886  ILE A CA    1 
ATOM   6905  C  C     . ILE A 1  886  ? 141.482 78.038  5.177   1.00 116.79 ? 886  ILE A C     1 
ATOM   6906  O  O     . ILE A 1  886  ? 141.185 79.178  4.854   1.00 117.06 ? 886  ILE A O     1 
ATOM   6907  C  CB    . ILE A 1  886  ? 140.405 76.135  3.810   1.00 112.31 ? 886  ILE A CB    1 
ATOM   6908  C  CG1   . ILE A 1  886  ? 139.674 76.512  2.500   1.00 111.47 ? 886  ILE A CG1   1 
ATOM   6909  C  CG2   . ILE A 1  886  ? 139.467 76.019  5.016   1.00 113.64 ? 886  ILE A CG2   1 
ATOM   6910  C  CD1   . ILE A 1  886  ? 138.592 77.575  2.530   1.00 112.45 ? 886  ILE A CD1   1 
ATOM   6911  N  N     . GLY A 1  887  ? 141.573 77.654  6.444   1.00 115.11 ? 887  GLY A N     1 
ATOM   6912  C  CA    . GLY A 1  887  ? 141.286 78.584  7.531   1.00 116.45 ? 887  GLY A CA    1 
ATOM   6913  C  C     . GLY A 1  887  ? 142.418 79.011  8.441   1.00 122.75 ? 887  GLY A C     1 
ATOM   6914  O  O     . GLY A 1  887  ? 143.596 78.703  8.205   1.00 121.64 ? 887  GLY A O     1 
ATOM   6915  N  N     . GLY A 1  888  ? 142.020 79.737  9.487   1.00 121.83 ? 888  GLY A N     1 
ATOM   6916  C  CA    . GLY A 1  888  ? 142.915 80.257  10.514  1.00 123.49 ? 888  GLY A CA    1 
ATOM   6917  C  C     . GLY A 1  888  ? 143.582 81.562  10.141  1.00 129.02 ? 888  GLY A C     1 
ATOM   6918  O  O     . GLY A 1  888  ? 143.268 82.155  9.102   1.00 128.66 ? 888  GLY A O     1 
ATOM   6919  N  N     . SER A 1  889  ? 144.508 82.021  10.996  1.00 126.52 ? 889  SER A N     1 
ATOM   6920  C  CA    . SER A 1  889  ? 145.228 83.269  10.741  1.00 127.23 ? 889  SER A CA    1 
ATOM   6921  C  C     . SER A 1  889  ? 146.299 83.079  9.687   1.00 128.22 ? 889  SER A C     1 
ATOM   6922  O  O     . SER A 1  889  ? 146.874 81.986  9.567   1.00 126.28 ? 889  SER A O     1 
ATOM   6923  C  CB    . SER A 1  889  ? 145.826 83.846  12.022  1.00 132.81 ? 889  SER A CB    1 
ATOM   6924  O  OG    . SER A 1  889  ? 146.167 82.836  12.959  1.00 143.31 ? 889  SER A OG    1 
ATOM   6925  N  N     . ASP A 1  890  ? 146.567 84.156  8.920   1.00 123.63 ? 890  ASP A N     1 
ATOM   6926  C  CA    . ASP A 1  890  ? 147.609 84.163  7.900   1.00 122.90 ? 890  ASP A CA    1 
ATOM   6927  C  C     . ASP A 1  890  ? 148.955 83.892  8.600   1.00 124.93 ? 890  ASP A C     1 
ATOM   6928  O  O     . ASP A 1  890  ? 149.866 83.309  8.011   1.00 123.92 ? 890  ASP A O     1 
ATOM   6929  C  CB    . ASP A 1  890  ? 147.613 85.508  7.157   1.00 126.00 ? 890  ASP A CB    1 
ATOM   6930  C  CG    . ASP A 1  890  ? 146.622 85.607  6.001   1.00 141.45 ? 890  ASP A CG    1 
ATOM   6931  O  OD1   . ASP A 1  890  ? 146.890 85.000  4.928   1.00 143.08 ? 890  ASP A OD1   1 
ATOM   6932  O  OD2   . ASP A 1  890  ? 145.624 86.360  6.133   1.00 146.94 ? 890  ASP A OD2   1 
ATOM   6933  N  N     . ALA A 1  891  ? 149.015 84.244  9.902   1.00 120.80 ? 891  ALA A N     1 
ATOM   6934  C  CA    . ALA A 1  891  ? 150.140 84.069  10.814  1.00 120.61 ? 891  ALA A CA    1 
ATOM   6935  C  C     . ALA A 1  891  ? 150.347 82.612  11.165  1.00 121.80 ? 891  ALA A C     1 
ATOM   6936  O  O     . ALA A 1  891  ? 151.480 82.141  11.145  1.00 121.17 ? 891  ALA A O     1 
ATOM   6937  C  CB    . ALA A 1  891  ? 149.899 84.871  12.083  1.00 122.44 ? 891  ALA A CB    1 
ATOM   6938  N  N     . ALA A 1  892  ? 149.259 81.908  11.509  1.00 117.53 ? 892  ALA A N     1 
ATOM   6939  C  CA    . ALA A 1  892  ? 149.274 80.497  11.891  1.00 116.90 ? 892  ALA A CA    1 
ATOM   6940  C  C     . ALA A 1  892  ? 149.716 79.623  10.721  1.00 119.55 ? 892  ALA A C     1 
ATOM   6941  O  O     . ALA A 1  892  ? 150.420 78.623  10.924  1.00 118.93 ? 892  ALA A O     1 
ATOM   6942  C  CB    . ALA A 1  892  ? 147.893 80.080  12.358  1.00 117.02 ? 892  ALA A CB    1 
ATOM   6943  N  N     . PHE A 1  893  ? 149.299 80.030  9.496   1.00 114.54 ? 893  PHE A N     1 
ATOM   6944  C  CA    . PHE A 1  893  ? 149.607 79.410  8.209   1.00 112.69 ? 893  PHE A CA    1 
ATOM   6945  C  C     . PHE A 1  893  ? 151.125 79.461  7.979   1.00 115.86 ? 893  PHE A C     1 
ATOM   6946  O  O     . PHE A 1  893  ? 151.760 78.431  7.722   1.00 114.18 ? 893  PHE A O     1 
ATOM   6947  C  CB    . PHE A 1  893  ? 148.862 80.184  7.104   1.00 113.88 ? 893  PHE A CB    1 
ATOM   6948  C  CG    . PHE A 1  893  ? 149.135 79.735  5.691   1.00 114.63 ? 893  PHE A CG    1 
ATOM   6949  C  CD1   . PHE A 1  893  ? 150.276 80.157  5.016   1.00 118.52 ? 893  PHE A CD1   1 
ATOM   6950  C  CD2   . PHE A 1  893  ? 148.229 78.934  5.014   1.00 115.81 ? 893  PHE A CD2   1 
ATOM   6951  C  CE1   . PHE A 1  893  ? 150.528 79.741  3.708   1.00 119.02 ? 893  PHE A CE1   1 
ATOM   6952  C  CE2   . PHE A 1  893  ? 148.477 78.525  3.701   1.00 118.31 ? 893  PHE A CE2   1 
ATOM   6953  C  CZ    . PHE A 1  893  ? 149.624 78.933  3.057   1.00 117.17 ? 893  PHE A CZ    1 
ATOM   6954  N  N     . GLU A 1  894  ? 151.681 80.681  8.069   1.00 113.32 ? 894  GLU A N     1 
ATOM   6955  C  CA    . GLU A 1  894  ? 153.091 80.996  7.934   1.00 114.54 ? 894  GLU A CA    1 
ATOM   6956  C  C     . GLU A 1  894  ? 153.938 80.048  8.801   1.00 119.64 ? 894  GLU A C     1 
ATOM   6957  O  O     . GLU A 1  894  ? 154.855 79.432  8.268   1.00 119.44 ? 894  GLU A O     1 
ATOM   6958  C  CB    . GLU A 1  894  ? 153.313 82.473  8.320   1.00 117.51 ? 894  GLU A CB    1 
ATOM   6959  C  CG    . GLU A 1  894  ? 154.712 83.013  8.080   1.00 130.83 ? 894  GLU A CG    1 
ATOM   6960  C  CD    . GLU A 1  894  ? 154.742 84.418  7.515   1.00 153.78 ? 894  GLU A CD    1 
ATOM   6961  O  OE1   . GLU A 1  894  ? 154.542 84.570  6.287   1.00 150.09 ? 894  GLU A OE1   1 
ATOM   6962  O  OE2   . GLU A 1  894  ? 154.955 85.370  8.300   1.00 147.96 ? 894  GLU A OE2   1 
ATOM   6963  N  N     . LYS A 1  895  ? 153.604 79.890  10.113  1.00 116.70 ? 895  LYS A N     1 
ATOM   6964  C  CA    . LYS A 1  895  ? 154.335 79.002  11.031  1.00 116.81 ? 895  LYS A CA    1 
ATOM   6965  C  C     . LYS A 1  895  ? 154.293 77.551  10.553  1.00 120.22 ? 895  LYS A C     1 
ATOM   6966  O  O     . LYS A 1  895  ? 155.335 76.874  10.534  1.00 119.51 ? 895  LYS A O     1 
ATOM   6967  C  CB    . LYS A 1  895  ? 153.804 79.108  12.478  1.00 119.36 ? 895  LYS A CB    1 
ATOM   6968  C  CG    . LYS A 1  895  ? 154.686 78.371  13.509  1.00 128.97 ? 895  LYS A CG    1 
ATOM   6969  C  CD    . LYS A 1  895  ? 154.335 78.685  14.961  1.00 136.17 ? 895  LYS A CD    1 
ATOM   6970  C  CE    . LYS A 1  895  ? 155.511 78.428  15.877  1.00 150.44 ? 895  LYS A CE    1 
ATOM   6971  N  NZ    . LYS A 1  895  ? 155.308 79.013  17.234  1.00 162.95 ? 895  LYS A NZ    1 
ATOM   6972  N  N     . ARG A 1  896  ? 153.083 77.092  10.147  1.00 116.20 ? 896  ARG A N     1 
ATOM   6973  C  CA    . ARG A 1  896  ? 152.847 75.726  9.679   1.00 114.83 ? 896  ARG A CA    1 
ATOM   6974  C  C     . ARG A 1  896  ? 153.589 75.360  8.400   1.00 117.89 ? 896  ARG A C     1 
ATOM   6975  O  O     . ARG A 1  896  ? 154.202 74.292  8.357   1.00 117.89 ? 896  ARG A O     1 
ATOM   6976  C  CB    . ARG A 1  896  ? 151.342 75.417  9.533   1.00 113.21 ? 896  ARG A CB    1 
ATOM   6977  C  CG    . ARG A 1  896  ? 151.052 73.928  9.296   1.00 118.13 ? 896  ARG A CG    1 
ATOM   6978  C  CD    . ARG A 1  896  ? 149.587 73.598  9.359   1.00 122.49 ? 896  ARG A CD    1 
ATOM   6979  N  NE    . ARG A 1  896  ? 149.356 72.403  10.164  1.00 132.58 ? 896  ARG A NE    1 
ATOM   6980  C  CZ    . ARG A 1  896  ? 148.158 71.872  10.372  1.00 154.79 ? 896  ARG A CZ    1 
ATOM   6981  N  NH1   . ARG A 1  896  ? 147.077 72.421  9.827   1.00 147.52 ? 896  ARG A NH1   1 
ATOM   6982  N  NH2   . ARG A 1  896  ? 148.028 70.790  11.126  1.00 143.78 ? 896  ARG A NH2   1 
ATOM   6983  N  N     . TYR A 1  897  ? 153.527 76.222  7.370   1.00 112.72 ? 897  TYR A N     1 
ATOM   6984  C  CA    . TYR A 1  897  ? 154.088 75.914  6.057   1.00 111.41 ? 897  TYR A CA    1 
ATOM   6985  C  C     . TYR A 1  897  ? 155.460 76.478  5.678   1.00 115.63 ? 897  TYR A C     1 
ATOM   6986  O  O     . TYR A 1  897  ? 156.215 75.817  4.948   1.00 115.32 ? 897  TYR A O     1 
ATOM   6987  C  CB    . TYR A 1  897  ? 153.029 76.171  4.974   1.00 110.99 ? 897  TYR A CB    1 
ATOM   6988  C  CG    . TYR A 1  897  ? 151.790 75.329  5.177   1.00 110.75 ? 897  TYR A CG    1 
ATOM   6989  C  CD1   . TYR A 1  897  ? 151.746 74.003  4.753   1.00 111.45 ? 897  TYR A CD1   1 
ATOM   6990  C  CD2   . TYR A 1  897  ? 150.686 75.831  5.856   1.00 111.57 ? 897  TYR A CD2   1 
ATOM   6991  C  CE1   . TYR A 1  897  ? 150.623 73.205  4.978   1.00 110.39 ? 897  TYR A CE1   1 
ATOM   6992  C  CE2   . TYR A 1  897  ? 149.557 75.042  6.087   1.00 111.59 ? 897  TYR A CE2   1 
ATOM   6993  C  CZ    . TYR A 1  897  ? 149.530 73.729  5.647   1.00 116.11 ? 897  TYR A CZ    1 
ATOM   6994  O  OH    . TYR A 1  897  ? 148.409 72.967  5.856   1.00 114.83 ? 897  TYR A OH    1 
ATOM   6995  N  N     . ARG A 1  898  ? 155.778 77.683  6.172   1.00 111.99 ? 898  ARG A N     1 
ATOM   6996  C  CA    . ARG A 1  898  ? 157.008 78.392  5.849   1.00 112.02 ? 898  ARG A CA    1 
ATOM   6997  C  C     . ARG A 1  898  ? 158.313 77.817  6.325   1.00 114.50 ? 898  ARG A C     1 
ATOM   6998  O  O     . ARG A 1  898  ? 158.542 77.610  7.525   1.00 113.56 ? 898  ARG A O     1 
ATOM   6999  C  CB    . ARG A 1  898  ? 156.910 79.887  6.196   1.00 112.87 ? 898  ARG A CB    1 
ATOM   7000  C  CG    . ARG A 1  898  ? 158.010 80.770  5.618   1.00 125.46 ? 898  ARG A CG    1 
ATOM   7001  C  CD    . ARG A 1  898  ? 158.070 80.748  4.103   1.00 134.54 ? 898  ARG A CD    1 
ATOM   7002  N  NE    . ARG A 1  898  ? 159.016 81.739  3.600   1.00 143.28 ? 898  ARG A NE    1 
ATOM   7003  C  CZ    . ARG A 1  898  ? 159.848 81.529  2.589   1.00 155.98 ? 898  ARG A CZ    1 
ATOM   7004  N  NH1   . ARG A 1  898  ? 159.863 80.355  1.963   1.00 140.91 ? 898  ARG A NH1   1 
ATOM   7005  N  NH2   . ARG A 1  898  ? 160.675 82.486  2.196   1.00 144.89 ? 898  ARG A NH2   1 
ATOM   7006  N  N     . VAL A 1  899  ? 159.193 77.632  5.343   1.00 110.68 ? 899  VAL A N     1 
ATOM   7007  C  CA    . VAL A 1  899  ? 160.578 77.241  5.513   1.00 111.12 ? 899  VAL A CA    1 
ATOM   7008  C  C     . VAL A 1  899  ? 161.429 78.252  4.753   1.00 118.67 ? 899  VAL A C     1 
ATOM   7009  O  O     . VAL A 1  899  ? 161.207 78.476  3.553   1.00 119.45 ? 899  VAL A O     1 
ATOM   7010  C  CB    . VAL A 1  899  ? 160.858 75.776  5.153   1.00 112.75 ? 899  VAL A CB    1 
ATOM   7011  C  CG1   . VAL A 1  899  ? 162.328 75.542  4.818   1.00 113.05 ? 899  VAL A CG1   1 
ATOM   7012  C  CG2   . VAL A 1  899  ? 160.437 74.893  6.304   1.00 112.08 ? 899  VAL A CG2   1 
ATOM   7013  N  N     . ASP A 1  900  ? 162.342 78.918  5.497   1.00 115.61 ? 900  ASP A N     1 
ATOM   7014  C  CA    . ASP A 1  900  ? 163.275 79.938  5.029   1.00 116.19 ? 900  ASP A CA    1 
ATOM   7015  C  C     . ASP A 1  900  ? 164.654 79.448  5.437   1.00 120.92 ? 900  ASP A C     1 
ATOM   7016  O  O     . ASP A 1  900  ? 165.019 79.572  6.603   1.00 122.06 ? 900  ASP A O     1 
ATOM   7017  C  CB    . ASP A 1  900  ? 162.948 81.287  5.716   1.00 118.70 ? 900  ASP A CB    1 
ATOM   7018  C  CG    . ASP A 1  900  ? 163.626 82.544  5.190   1.00 126.60 ? 900  ASP A CG    1 
ATOM   7019  O  OD1   . ASP A 1  900  ? 164.718 82.428  4.585   1.00 127.95 ? 900  ASP A OD1   1 
ATOM   7020  O  OD2   . ASP A 1  900  ? 163.086 83.650  5.426   1.00 129.45 ? 900  ASP A OD2   1 
ATOM   7021  N  N     . LEU A 1  901  ? 165.407 78.852  4.498   1.00 116.50 ? 901  LEU A N     1 
ATOM   7022  C  CA    . LEU A 1  901  ? 166.759 78.354  4.794   1.00 116.39 ? 901  LEU A CA    1 
ATOM   7023  C  C     . LEU A 1  901  ? 167.771 79.512  4.875   1.00 120.19 ? 901  LEU A C     1 
ATOM   7024  O  O     . LEU A 1  901  ? 168.909 79.292  5.293   1.00 121.15 ? 901  LEU A O     1 
ATOM   7025  C  CB    . LEU A 1  901  ? 167.237 77.294  3.776   1.00 115.46 ? 901  LEU A CB    1 
ATOM   7026  C  CG    . LEU A 1  901  ? 166.263 76.200  3.367   1.00 117.57 ? 901  LEU A CG    1 
ATOM   7027  C  CD1   . LEU A 1  901  ? 166.717 75.558  2.094   1.00 116.93 ? 901  LEU A CD1   1 
ATOM   7028  C  CD2   . LEU A 1  901  ? 166.119 75.161  4.451   1.00 119.34 ? 901  LEU A CD2   1 
ATOM   7029  N  N     . LEU A 1  902  ? 167.358 80.732  4.479   1.00 114.95 ? 902  LEU A N     1 
ATOM   7030  C  CA    . LEU A 1  902  ? 168.215 81.914  4.507   1.00 115.95 ? 902  LEU A CA    1 
ATOM   7031  C  C     . LEU A 1  902  ? 168.076 82.731  5.799   1.00 121.68 ? 902  LEU A C     1 
ATOM   7032  O  O     . LEU A 1  902  ? 168.700 83.795  5.923   1.00 123.40 ? 902  LEU A O     1 
ATOM   7033  C  CB    . LEU A 1  902  ? 167.960 82.819  3.297   1.00 115.73 ? 902  LEU A CB    1 
ATOM   7034  C  CG    . LEU A 1  902  ? 167.923 82.206  1.919   1.00 119.33 ? 902  LEU A CG    1 
ATOM   7035  C  CD1   . LEU A 1  902  ? 167.727 83.270  0.896   1.00 120.31 ? 902  LEU A CD1   1 
ATOM   7036  C  CD2   . LEU A 1  902  ? 169.180 81.438  1.596   1.00 121.65 ? 902  LEU A CD2   1 
ATOM   7037  N  N     . ASN A 1  903  ? 167.259 82.248  6.753   1.00 116.65 ? 903  ASN A N     1 
ATOM   7038  C  CA    . ASN A 1  903  ? 167.038 82.921  8.030   1.00 116.81 ? 903  ASN A CA    1 
ATOM   7039  C  C     . ASN A 1  903  ? 167.396 81.967  9.139   1.00 121.52 ? 903  ASN A C     1 
ATOM   7040  O  O     . ASN A 1  903  ? 166.878 80.852  9.173   1.00 119.25 ? 903  ASN A O     1 
ATOM   7041  C  CB    . ASN A 1  903  ? 165.591 83.387  8.146   1.00 114.15 ? 903  ASN A CB    1 
ATOM   7042  C  CG    . ASN A 1  903  ? 165.221 83.863  9.516   1.00 131.33 ? 903  ASN A CG    1 
ATOM   7043  O  OD1   . ASN A 1  903  ? 164.669 83.119  10.315  1.00 130.86 ? 903  ASN A OD1   1 
ATOM   7044  N  ND2   . ASN A 1  903  ? 165.530 85.103  9.825   1.00 120.66 ? 903  ASN A ND2   1 
ATOM   7045  N  N     . THR A 1  904  ? 168.257 82.403  10.061  1.00 121.68 ? 904  THR A N     1 
ATOM   7046  C  CA    . THR A 1  904  ? 168.717 81.551  11.152  1.00 123.29 ? 904  THR A CA    1 
ATOM   7047  C  C     . THR A 1  904  ? 167.649 81.052  12.147  1.00 130.06 ? 904  THR A C     1 
ATOM   7048  O  O     . THR A 1  904  ? 167.918 80.123  12.918  1.00 130.06 ? 904  THR A O     1 
ATOM   7049  C  CB    . THR A 1  904  ? 170.017 82.067  11.756  1.00 133.80 ? 904  THR A CB    1 
ATOM   7050  O  OG1   . THR A 1  904  ? 170.813 80.936  12.100  1.00 135.25 ? 904  THR A OG1   1 
ATOM   7051  C  CG2   . THR A 1  904  ? 169.807 82.987  12.968  1.00 132.83 ? 904  THR A CG2   1 
ATOM   7052  N  N     . ASP A 1  905  ? 166.439 81.627  12.093  1.00 127.68 ? 905  ASP A N     1 
ATOM   7053  C  CA    . ASP A 1  905  ? 165.345 81.246  12.981  1.00 127.29 ? 905  ASP A CA    1 
ATOM   7054  C  C     . ASP A 1  905  ? 164.319 80.358  12.300  1.00 131.28 ? 905  ASP A C     1 
ATOM   7055  O  O     . ASP A 1  905  ? 163.787 79.455  12.956  1.00 130.73 ? 905  ASP A O     1 
ATOM   7056  C  CB    . ASP A 1  905  ? 164.674 82.491  13.583  1.00 129.62 ? 905  ASP A CB    1 
ATOM   7057  C  CG    . ASP A 1  905  ? 165.648 83.582  14.000  1.00 142.49 ? 905  ASP A CG    1 
ATOM   7058  O  OD1   . ASP A 1  905  ? 166.761 83.242  14.467  1.00 143.97 ? 905  ASP A OD1   1 
ATOM   7059  O  OD2   . ASP A 1  905  ? 165.302 84.778  13.845  1.00 148.80 ? 905  ASP A OD2   1 
ATOM   7060  N  N     . HIS A 1  906  ? 164.033 80.607  10.993  1.00 127.86 ? 906  HIS A N     1 
ATOM   7061  C  CA    . HIS A 1  906  ? 163.014 79.874  10.216  1.00 126.43 ? 906  HIS A CA    1 
ATOM   7062  C  C     . HIS A 1  906  ? 163.481 78.707  9.299   1.00 127.73 ? 906  HIS A C     1 
ATOM   7063  O  O     . HIS A 1  906  ? 162.729 78.263  8.424   1.00 125.81 ? 906  HIS A O     1 
ATOM   7064  C  CB    . HIS A 1  906  ? 162.023 80.826  9.506   1.00 127.31 ? 906  HIS A CB    1 
ATOM   7065  C  CG    . HIS A 1  906  ? 161.527 81.980  10.330  1.00 132.05 ? 906  HIS A CG    1 
ATOM   7066  N  ND1   . HIS A 1  906  ? 161.710 82.032  11.703  1.00 134.94 ? 906  HIS A ND1   1 
ATOM   7067  C  CD2   . HIS A 1  906  ? 160.871 83.096  9.935   1.00 134.67 ? 906  HIS A CD2   1 
ATOM   7068  C  CE1   . HIS A 1  906  ? 161.184 83.182  12.092  1.00 135.46 ? 906  HIS A CE1   1 
ATOM   7069  N  NE2   . HIS A 1  906  ? 160.663 83.855  11.064  1.00 135.54 ? 906  HIS A NE2   1 
ATOM   7070  N  N     . THR A 1  907  ? 164.696 78.186  9.539   1.00 123.56 ? 907  THR A N     1 
ATOM   7071  C  CA    . THR A 1  907  ? 165.240 77.021  8.838   1.00 122.01 ? 907  THR A CA    1 
ATOM   7072  C  C     . THR A 1  907  ? 164.615 75.805  9.541   1.00 125.44 ? 907  THR A C     1 
ATOM   7073  O  O     . THR A 1  907  ? 163.925 75.948  10.562  1.00 124.86 ? 907  THR A O     1 
ATOM   7074  C  CB    . THR A 1  907  ? 166.789 77.049  8.965   1.00 125.92 ? 907  THR A CB    1 
ATOM   7075  O  OG1   . THR A 1  907  ? 167.254 78.261  8.397   1.00 129.13 ? 907  THR A OG1   1 
ATOM   7076  C  CG2   . THR A 1  907  ? 167.497 75.885  8.266   1.00 120.42 ? 907  THR A CG2   1 
ATOM   7077  N  N     . LEU A 1  908  ? 164.840 74.615  8.994   1.00 121.59 ? 908  LEU A N     1 
ATOM   7078  C  CA    . LEU A 1  908  ? 164.425 73.372  9.625   1.00 120.45 ? 908  LEU A CA    1 
ATOM   7079  C  C     . LEU A 1  908  ? 165.620 73.008  10.525  1.00 126.63 ? 908  LEU A C     1 
ATOM   7080  O  O     . LEU A 1  908  ? 166.751 72.924  10.029  1.00 127.02 ? 908  LEU A O     1 
ATOM   7081  C  CB    . LEU A 1  908  ? 164.195 72.290  8.563   1.00 118.74 ? 908  LEU A CB    1 
ATOM   7082  C  CG    . LEU A 1  908  ? 163.213 72.635  7.467   1.00 121.18 ? 908  LEU A CG    1 
ATOM   7083  C  CD1   . LEU A 1  908  ? 163.749 72.220  6.140   1.00 120.36 ? 908  LEU A CD1   1 
ATOM   7084  C  CD2   . LEU A 1  908  ? 161.878 71.994  7.728   1.00 122.56 ? 908  LEU A CD2   1 
ATOM   7085  N  N     . ASP A 1  909  ? 165.395 72.895  11.846  1.00 124.43 ? 909  ASP A N     1 
ATOM   7086  C  CA    . ASP A 1  909  ? 166.466 72.586  12.798  1.00 126.33 ? 909  ASP A CA    1 
ATOM   7087  C  C     . ASP A 1  909  ? 167.193 71.294  12.394  1.00 131.13 ? 909  ASP A C     1 
ATOM   7088  O  O     . ASP A 1  909  ? 166.522 70.353  11.951  1.00 130.46 ? 909  ASP A O     1 
ATOM   7089  C  CB    . ASP A 1  909  ? 165.903 72.462  14.225  1.00 128.97 ? 909  ASP A CB    1 
ATOM   7090  C  CG    . ASP A 1  909  ? 166.953 72.471  15.325  1.00 147.61 ? 909  ASP A CG    1 
ATOM   7091  O  OD1   . ASP A 1  909  ? 167.689 73.478  15.437  1.00 151.69 ? 909  ASP A OD1   1 
ATOM   7092  O  OD2   . ASP A 1  909  ? 167.001 71.500  16.108  1.00 153.93 ? 909  ASP A OD2   1 
ATOM   7093  N  N     . PRO A 1  910  ? 168.545 71.208  12.512  1.00 128.37 ? 910  PRO A N     1 
ATOM   7094  C  CA    . PRO A 1  910  ? 169.242 69.961  12.120  1.00 128.01 ? 910  PRO A CA    1 
ATOM   7095  C  C     . PRO A 1  910  ? 168.863 68.703  12.929  1.00 131.11 ? 910  PRO A C     1 
ATOM   7096  O  O     . PRO A 1  910  ? 169.497 67.649  12.787  1.00 130.64 ? 910  PRO A O     1 
ATOM   7097  C  CB    . PRO A 1  910  ? 170.721 70.334  12.229  1.00 131.29 ? 910  PRO A CB    1 
ATOM   7098  C  CG    . PRO A 1  910  ? 170.742 71.428  13.232  1.00 136.79 ? 910  PRO A CG    1 
ATOM   7099  C  CD    . PRO A 1  910  ? 169.506 72.226  12.973  1.00 131.36 ? 910  PRO A CD    1 
ATOM   7100  N  N     . SER A 1  911  ? 167.804 68.826  13.761  1.00 126.50 ? 911  SER A N     1 
ATOM   7101  C  CA    . SER A 1  911  ? 167.189 67.780  14.571  1.00 125.19 ? 911  SER A CA    1 
ATOM   7102  C  C     . SER A 1  911  ? 166.075 67.139  13.753  1.00 127.36 ? 911  SER A C     1 
ATOM   7103  O  O     . SER A 1  911  ? 165.717 65.980  14.007  1.00 126.54 ? 911  SER A O     1 
ATOM   7104  C  CB    . SER A 1  911  ? 166.581 68.383  15.830  1.00 128.07 ? 911  SER A CB    1 
ATOM   7105  O  OG    . SER A 1  911  ? 165.549 69.300  15.502  1.00 133.09 ? 911  SER A OG    1 
ATOM   7106  N  N     . LEU A 1  912  ? 165.499 67.926  12.805  1.00 122.57 ? 912  LEU A N     1 
ATOM   7107  C  CA    . LEU A 1  912  ? 164.412 67.518  11.914  1.00 120.67 ? 912  LEU A CA    1 
ATOM   7108  C  C     . LEU A 1  912  ? 164.913 66.588  10.826  1.00 123.71 ? 912  LEU A C     1 
ATOM   7109  O  O     . LEU A 1  912  ? 164.232 65.597  10.507  1.00 122.14 ? 912  LEU A O     1 
ATOM   7110  C  CB    . LEU A 1  912  ? 163.700 68.729  11.276  1.00 120.34 ? 912  LEU A CB    1 
ATOM   7111  C  CG    . LEU A 1  912  ? 162.909 69.685  12.181  1.00 124.94 ? 912  LEU A CG    1 
ATOM   7112  C  CD1   . LEU A 1  912  ? 162.107 70.650  11.353  1.00 124.35 ? 912  LEU A CD1   1 
ATOM   7113  C  CD2   . LEU A 1  912  ? 161.969 68.948  13.112  1.00 126.45 ? 912  LEU A CD2   1 
ATOM   7114  N  N     . LEU A 1  913  ? 166.096 66.919  10.251  1.00 120.20 ? 913  LEU A N     1 
ATOM   7115  C  CA    . LEU A 1  913  ? 166.748 66.142  9.193   1.00 119.51 ? 913  LEU A CA    1 
ATOM   7116  C  C     . LEU A 1  913  ? 168.262 66.223  9.299   1.00 126.48 ? 913  LEU A C     1 
ATOM   7117  O  O     . LEU A 1  913  ? 168.760 67.145  9.943   1.00 127.89 ? 913  LEU A O     1 
ATOM   7118  C  CB    . LEU A 1  913  ? 166.238 66.536  7.788   1.00 118.18 ? 913  LEU A CB    1 
ATOM   7119  C  CG    . LEU A 1  913  ? 166.640 67.880  7.191   1.00 122.74 ? 913  LEU A CG    1 
ATOM   7120  C  CD1   . LEU A 1  913  ? 166.218 67.940  5.766   1.00 121.66 ? 913  LEU A CD1   1 
ATOM   7121  C  CD2   . LEU A 1  913  ? 166.026 69.056  7.942   1.00 124.42 ? 913  LEU A CD2   1 
ATOM   7122  N  N     . GLU A 1  914  ? 168.987 65.252  8.688   1.00 123.60 ? 914  GLU A N     1 
ATOM   7123  C  CA    . GLU A 1  914  ? 170.458 65.140  8.703   1.00 125.21 ? 914  GLU A CA    1 
ATOM   7124  C  C     . GLU A 1  914  ? 171.182 66.314  8.012   1.00 130.47 ? 914  GLU A C     1 
ATOM   7125  O  O     . GLU A 1  914  ? 172.175 66.845  8.539   1.00 132.02 ? 914  GLU A O     1 
ATOM   7126  C  CB    . GLU A 1  914  ? 170.901 63.796  8.095   1.00 126.31 ? 914  GLU A CB    1 
ATOM   7127  C  CG    . GLU A 1  914  ? 171.019 62.663  9.108   1.00 138.15 ? 914  GLU A CG    1 
ATOM   7128  C  CD    . GLU A 1  914  ? 170.522 61.287  8.687   1.00 150.84 ? 914  GLU A CD    1 
ATOM   7129  O  OE1   . GLU A 1  914  ? 170.561 60.967  7.475   1.00 128.48 ? 914  GLU A OE1   1 
ATOM   7130  O  OE2   . GLU A 1  914  ? 170.113 60.517  9.588   1.00 141.79 ? 914  GLU A OE2   1 
ATOM   7131  N  N     . SER A 1  915  ? 170.663 66.726  6.842   1.00 125.16 ? 915  SER A N     1 
ATOM   7132  C  CA    . SER A 1  915  ? 171.196 67.823  6.036   1.00 125.00 ? 915  SER A CA    1 
ATOM   7133  C  C     . SER A 1  915  ? 171.026 69.233  6.649   1.00 129.59 ? 915  SER A C     1 
ATOM   7134  O  O     . SER A 1  915  ? 171.577 70.185  6.096   1.00 130.63 ? 915  SER A O     1 
ATOM   7135  C  CB    . SER A 1  915  ? 170.611 67.771  4.629   1.00 126.48 ? 915  SER A CB    1 
ATOM   7136  O  OG    . SER A 1  915  ? 169.238 67.417  4.642   1.00 133.10 ? 915  SER A OG    1 
ATOM   7137  N  N     . GLY A 1  916  ? 170.306 69.336  7.780   1.00 125.04 ? 916  GLY A N     1 
ATOM   7138  C  CA    . GLY A 1  916  ? 169.987 70.570  8.512   1.00 124.84 ? 916  GLY A CA    1 
ATOM   7139  C  C     . GLY A 1  916  ? 171.108 71.575  8.719   1.00 128.01 ? 916  GLY A C     1 
ATOM   7140  O  O     . GLY A 1  916  ? 170.903 72.791  8.604   1.00 127.09 ? 916  GLY A O     1 
ATOM   7141  N  N     . SER A 1  917  ? 172.298 71.053  9.023   1.00 124.55 ? 917  SER A N     1 
ATOM   7142  C  CA    . SER A 1  917  ? 173.534 71.802  9.214   1.00 125.40 ? 917  SER A CA    1 
ATOM   7143  C  C     . SER A 1  917  ? 173.988 72.453  7.891   1.00 127.49 ? 917  SER A C     1 
ATOM   7144  O  O     . SER A 1  917  ? 174.130 73.678  7.833   1.00 128.32 ? 917  SER A O     1 
ATOM   7145  C  CB    . SER A 1  917  ? 174.618 70.871  9.752   1.00 130.17 ? 917  SER A CB    1 
ATOM   7146  O  OG    . SER A 1  917  ? 174.522 69.565  9.196   1.00 137.91 ? 917  SER A OG    1 
ATOM   7147  N  N     . GLU A 1  918  ? 174.169 71.624  6.830   1.00 121.19 ? 918  GLU A N     1 
ATOM   7148  C  CA    . GLU A 1  918  ? 174.633 71.992  5.487   1.00 120.46 ? 918  GLU A CA    1 
ATOM   7149  C  C     . GLU A 1  918  ? 173.567 72.623  4.574   1.00 122.59 ? 918  GLU A C     1 
ATOM   7150  O  O     . GLU A 1  918  ? 173.882 73.073  3.470   1.00 121.64 ? 918  GLU A O     1 
ATOM   7151  C  CB    . GLU A 1  918  ? 175.332 70.790  4.813   1.00 121.69 ? 918  GLU A CB    1 
ATOM   7152  C  CG    . GLU A 1  918  ? 174.399 69.655  4.415   1.00 137.23 ? 918  GLU A CG    1 
ATOM   7153  C  CD    . GLU A 1  918  ? 174.889 68.237  4.656   1.00 174.22 ? 918  GLU A CD    1 
ATOM   7154  O  OE1   . GLU A 1  918  ? 174.609 67.684  5.747   1.00 170.45 ? 918  GLU A OE1   1 
ATOM   7155  O  OE2   . GLU A 1  918  ? 175.487 67.651  3.723   1.00 180.69 ? 918  GLU A OE2   1 
ATOM   7156  N  N     . ILE A 1  919  ? 172.320 72.656  5.030   1.00 119.25 ? 919  ILE A N     1 
ATOM   7157  C  CA    . ILE A 1  919  ? 171.224 73.224  4.250   1.00 119.30 ? 919  ILE A CA    1 
ATOM   7158  C  C     . ILE A 1  919  ? 171.106 74.768  4.438   1.00 124.67 ? 919  ILE A C     1 
ATOM   7159  O  O     . ILE A 1  919  ? 170.446 75.445  3.630   1.00 124.34 ? 919  ILE A O     1 
ATOM   7160  C  CB    . ILE A 1  919  ? 169.911 72.431  4.553   1.00 121.51 ? 919  ILE A CB    1 
ATOM   7161  C  CG1   . ILE A 1  919  ? 169.077 72.176  3.308   1.00 121.27 ? 919  ILE A CG1   1 
ATOM   7162  C  CG2   . ILE A 1  919  ? 169.073 72.996  5.708   1.00 122.83 ? 919  ILE A CG2   1 
ATOM   7163  C  CD1   . ILE A 1  919  ? 168.789 70.681  3.071   1.00 133.43 ? 919  ILE A CD1   1 
ATOM   7164  N  N     . LEU A 1  920  ? 171.744 75.310  5.511   1.00 121.21 ? 920  LEU A N     1 
ATOM   7165  C  CA    . LEU A 1  920  ? 171.706 76.730  5.871   1.00 120.94 ? 920  LEU A CA    1 
ATOM   7166  C  C     . LEU A 1  920  ? 172.266 77.643  4.813   1.00 124.56 ? 920  LEU A C     1 
ATOM   7167  O  O     . LEU A 1  920  ? 173.371 77.432  4.317   1.00 123.28 ? 920  LEU A O     1 
ATOM   7168  C  CB    . LEU A 1  920  ? 172.429 76.992  7.192   1.00 122.03 ? 920  LEU A CB    1 
ATOM   7169  C  CG    . LEU A 1  920  ? 171.634 77.653  8.317   1.00 126.07 ? 920  LEU A CG    1 
ATOM   7170  C  CD1   . LEU A 1  920  ? 172.562 78.143  9.394   1.00 127.85 ? 920  LEU A CD1   1 
ATOM   7171  C  CD2   . LEU A 1  920  ? 170.828 78.827  7.840   1.00 126.75 ? 920  LEU A CD2   1 
ATOM   7172  N  N     . GLY A 1  921  ? 171.483 78.657  4.484   1.00 122.88 ? 921  GLY A N     1 
ATOM   7173  C  CA    . GLY A 1  921  ? 171.836 79.670  3.499   1.00 124.56 ? 921  GLY A CA    1 
ATOM   7174  C  C     . GLY A 1  921  ? 171.926 79.187  2.065   1.00 130.73 ? 921  GLY A C     1 
ATOM   7175  O  O     . GLY A 1  921  ? 172.404 79.940  1.209   1.00 131.33 ? 921  GLY A O     1 
ATOM   7176  N  N     . ASP A 1  922  ? 171.459 77.938  1.778   1.00 127.40 ? 922  ASP A N     1 
ATOM   7177  C  CA    . ASP A 1  922  ? 171.517 77.364  0.429   1.00 126.95 ? 922  ASP A CA    1 
ATOM   7178  C  C     . ASP A 1  922  ? 170.501 78.049  -0.440  1.00 129.60 ? 922  ASP A C     1 
ATOM   7179  O  O     . ASP A 1  922  ? 169.305 77.760  -0.349  1.00 128.66 ? 922  ASP A O     1 
ATOM   7180  C  CB    . ASP A 1  922  ? 171.314 75.841  0.435   1.00 128.20 ? 922  ASP A CB    1 
ATOM   7181  C  CG    . ASP A 1  922  ? 171.748 75.135  -0.845  1.00 143.19 ? 922  ASP A CG    1 
ATOM   7182  O  OD1   . ASP A 1  922  ? 171.378 75.612  -1.953  1.00 143.23 ? 922  ASP A OD1   1 
ATOM   7183  O  OD2   . ASP A 1  922  ? 172.374 74.056  -0.742  1.00 152.24 ? 922  ASP A OD2   1 
ATOM   7184  N  N     . LEU A 1  923  ? 170.984 78.980  -1.269  1.00 125.72 ? 923  LEU A N     1 
ATOM   7185  C  CA    . LEU A 1  923  ? 170.139 79.795  -2.133  1.00 124.67 ? 923  LEU A CA    1 
ATOM   7186  C  C     . LEU A 1  923  ? 169.381 79.008  -3.198  1.00 124.67 ? 923  LEU A C     1 
ATOM   7187  O  O     . LEU A 1  923  ? 168.215 79.308  -3.452  1.00 123.00 ? 923  LEU A O     1 
ATOM   7188  C  CB    . LEU A 1  923  ? 170.935 80.956  -2.722  1.00 126.43 ? 923  LEU A CB    1 
ATOM   7189  C  CG    . LEU A 1  923  ? 171.469 81.941  -1.681  1.00 132.89 ? 923  LEU A CG    1 
ATOM   7190  C  CD1   . LEU A 1  923  ? 172.976 81.888  -1.595  1.00 134.47 ? 923  LEU A CD1   1 
ATOM   7191  C  CD2   . LEU A 1  923  ? 171.002 83.340  -1.968  1.00 136.74 ? 923  LEU A CD2   1 
ATOM   7192  N  N     . LYS A 1  924  ? 170.018 77.972  -3.768  1.00 119.29 ? 924  LYS A N     1 
ATOM   7193  C  CA    . LYS A 1  924  ? 169.428 77.104  -4.786  1.00 116.96 ? 924  LYS A CA    1 
ATOM   7194  C  C     . LYS A 1  924  ? 168.198 76.351  -4.236  1.00 118.46 ? 924  LYS A C     1 
ATOM   7195  O  O     . LYS A 1  924  ? 167.149 76.301  -4.900  1.00 116.84 ? 924  LYS A O     1 
ATOM   7196  C  CB    . LYS A 1  924  ? 170.482 76.117  -5.321  1.00 119.32 ? 924  LYS A CB    1 
ATOM   7197  C  CG    . LYS A 1  924  ? 171.524 76.740  -6.250  1.00 133.18 ? 924  LYS A CG    1 
ATOM   7198  C  CD    . LYS A 1  924  ? 172.676 75.772  -6.586  1.00 144.95 ? 924  LYS A CD    1 
ATOM   7199  C  CE    . LYS A 1  924  ? 173.855 75.850  -5.631  1.00 157.28 ? 924  LYS A CE    1 
ATOM   7200  N  NZ    . LYS A 1  924  ? 174.964 74.930  -6.018  1.00 163.57 ? 924  LYS A NZ    1 
ATOM   7201  N  N     . LEU A 1  925  ? 168.329 75.775  -3.017  1.00 114.09 ? 925  LEU A N     1 
ATOM   7202  C  CA    . LEU A 1  925  ? 167.235 75.039  -2.373  1.00 111.95 ? 925  LEU A CA    1 
ATOM   7203  C  C     . LEU A 1  925  ? 166.149 75.977  -1.969  1.00 115.44 ? 925  LEU A C     1 
ATOM   7204  O  O     . LEU A 1  925  ? 164.979 75.655  -2.160  1.00 113.74 ? 925  LEU A O     1 
ATOM   7205  C  CB    . LEU A 1  925  ? 167.699 74.250  -1.155  1.00 111.77 ? 925  LEU A CB    1 
ATOM   7206  C  CG    . LEU A 1  925  ? 168.535 73.040  -1.453  1.00 116.28 ? 925  LEU A CG    1 
ATOM   7207  C  CD1   . LEU A 1  925  ? 169.353 72.668  -0.270  1.00 117.64 ? 925  LEU A CD1   1 
ATOM   7208  C  CD2   . LEU A 1  925  ? 167.682 71.869  -1.882  1.00 117.36 ? 925  LEU A CD2   1 
ATOM   7209  N  N     . GLN A 1  926  ? 166.534 77.172  -1.473  1.00 112.89 ? 926  GLN A N     1 
ATOM   7210  C  CA    . GLN A 1  926  ? 165.589 78.203  -1.060  1.00 112.55 ? 926  GLN A CA    1 
ATOM   7211  C  C     . GLN A 1  926  ? 164.654 78.665  -2.176  1.00 117.33 ? 926  GLN A C     1 
ATOM   7212  O  O     . GLN A 1  926  ? 163.562 79.161  -1.878  1.00 116.85 ? 926  GLN A O     1 
ATOM   7213  C  CB    . GLN A 1  926  ? 166.275 79.370  -0.352  1.00 114.82 ? 926  GLN A CB    1 
ATOM   7214  C  CG    . GLN A 1  926  ? 165.818 79.525  1.097   1.00 117.43 ? 926  GLN A CG    1 
ATOM   7215  C  CD    . GLN A 1  926  ? 164.326 79.670  1.248   1.00 130.21 ? 926  GLN A CD    1 
ATOM   7216  O  OE1   . GLN A 1  926  ? 163.667 78.828  1.845   1.00 125.50 ? 926  GLN A OE1   1 
ATOM   7217  N  NE2   . GLN A 1  926  ? 163.749 80.701  0.657   1.00 122.35 ? 926  GLN A NE2   1 
ATOM   7218  N  N     . VAL A 1  927  ? 165.051 78.438  -3.457  1.00 113.82 ? 927  VAL A N     1 
ATOM   7219  C  CA    . VAL A 1  927  ? 164.232 78.729  -4.634  1.00 112.63 ? 927  VAL A CA    1 
ATOM   7220  C  C     . VAL A 1  927  ? 163.096 77.718  -4.632  1.00 115.76 ? 927  VAL A C     1 
ATOM   7221  O  O     . VAL A 1  927  ? 161.936 78.109  -4.801  1.00 114.73 ? 927  VAL A O     1 
ATOM   7222  C  CB    . VAL A 1  927  ? 165.038 78.652  -5.944  1.00 116.35 ? 927  VAL A CB    1 
ATOM   7223  C  CG1   . VAL A 1  927  ? 164.125 78.765  -7.162  1.00 115.29 ? 927  VAL A CG1   1 
ATOM   7224  C  CG2   . VAL A 1  927  ? 166.113 79.723  -5.979  1.00 117.80 ? 927  VAL A CG2   1 
ATOM   7225  N  N     . LEU A 1  928  ? 163.432 76.427  -4.397  1.00 111.73 ? 928  LEU A N     1 
ATOM   7226  C  CA    . LEU A 1  928  ? 162.445 75.358  -4.335  1.00 110.38 ? 928  LEU A CA    1 
ATOM   7227  C  C     . LEU A 1  928  ? 161.389 75.568  -3.246  1.00 113.79 ? 928  LEU A C     1 
ATOM   7228  O  O     . LEU A 1  928  ? 160.202 75.391  -3.528  1.00 111.81 ? 928  LEU A O     1 
ATOM   7229  C  CB    . LEU A 1  928  ? 163.115 73.993  -4.194  1.00 110.40 ? 928  LEU A CB    1 
ATOM   7230  C  CG    . LEU A 1  928  ? 163.689 73.385  -5.463  1.00 115.76 ? 928  LEU A CG    1 
ATOM   7231  C  CD1   . LEU A 1  928  ? 164.448 72.124  -5.147  1.00 115.99 ? 928  LEU A CD1   1 
ATOM   7232  C  CD2   . LEU A 1  928  ? 162.588 73.037  -6.460  1.00 119.13 ? 928  LEU A CD2   1 
ATOM   7233  N  N     . LEU A 1  929  ? 161.807 75.984  -2.029  1.00 112.07 ? 929  LEU A N     1 
ATOM   7234  C  CA    . LEU A 1  929  ? 160.885 76.242  -0.911  1.00 112.18 ? 929  LEU A CA    1 
ATOM   7235  C  C     . LEU A 1  929  ? 160.027 77.488  -1.103  1.00 118.63 ? 929  LEU A C     1 
ATOM   7236  O  O     . LEU A 1  929  ? 158.959 77.609  -0.485  1.00 117.51 ? 929  LEU A O     1 
ATOM   7237  C  CB    . LEU A 1  929  ? 161.606 76.303  0.444   1.00 112.77 ? 929  LEU A CB    1 
ATOM   7238  C  CG    . LEU A 1  929  ? 162.175 75.013  1.030   1.00 116.15 ? 929  LEU A CG    1 
ATOM   7239  C  CD1   . LEU A 1  929  ? 161.332 73.793  0.698   1.00 114.04 ? 929  LEU A CD1   1 
ATOM   7240  C  CD2   . LEU A 1  929  ? 163.590 74.828  0.622   1.00 119.63 ? 929  LEU A CD2   1 
ATOM   7241  N  N     . ASP A 1  930  ? 160.505 78.413  -1.943  1.00 117.76 ? 930  ASP A N     1 
ATOM   7242  C  CA    . ASP A 1  930  ? 159.770 79.619  -2.274  1.00 119.03 ? 930  ASP A CA    1 
ATOM   7243  C  C     . ASP A 1  930  ? 158.681 79.264  -3.258  1.00 121.88 ? 930  ASP A C     1 
ATOM   7244  O  O     . ASP A 1  930  ? 157.550 79.701  -3.072  1.00 120.28 ? 930  ASP A O     1 
ATOM   7245  C  CB    . ASP A 1  930  ? 160.700 80.713  -2.799  1.00 123.37 ? 930  ASP A CB    1 
ATOM   7246  C  CG    . ASP A 1  930  ? 161.349 81.526  -1.689  1.00 143.00 ? 930  ASP A CG    1 
ATOM   7247  O  OD1   . ASP A 1  930  ? 160.634 81.887  -0.717  1.00 144.78 ? 930  ASP A OD1   1 
ATOM   7248  O  OD2   . ASP A 1  930  ? 162.561 81.854  -1.817  1.00 151.48 ? 930  ASP A OD2   1 
ATOM   7249  N  N     . GLU A 1  931  ? 158.996 78.400  -4.255  1.00 119.03 ? 931  GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  931  ? 158.014 77.885  -5.213  1.00 117.89 ? 931  GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  931  ? 156.954 77.221  -4.362  1.00 116.18 ? 931  GLU A C     1 
ATOM   7252  O  O     . GLU A 1  931  ? 155.794 77.619  -4.430  1.00 114.48 ? 931  GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  931  ? 158.607 76.781  -6.110  1.00 119.95 ? 931  GLU A CB    1 
ATOM   7254  C  CG    . GLU A 1  931  ? 159.693 77.163  -7.104  1.00 142.13 ? 931  GLU A CG    1 
ATOM   7255  C  CD    . GLU A 1  931  ? 160.407 75.965  -7.724  1.00 179.17 ? 931  GLU A CD    1 
ATOM   7256  O  OE1   . GLU A 1  931  ? 159.751 74.919  -7.961  1.00 170.48 ? 931  GLU A OE1   1 
ATOM   7257  O  OE2   . GLU A 1  931  ? 161.635 76.069  -7.955  1.00 184.29 ? 931  GLU A OE2   1 
ATOM   7258  N  N     . GLU A 1  932  ? 157.384 76.247  -3.509  1.00 110.48 ? 932  GLU A N     1 
ATOM   7259  C  CA    . GLU A 1  932  ? 156.528 75.478  -2.608  1.00 109.05 ? 932  GLU A CA    1 
ATOM   7260  C  C     . GLU A 1  932  ? 155.582 76.389  -1.874  1.00 113.02 ? 932  GLU A C     1 
ATOM   7261  O  O     . GLU A 1  932  ? 154.363 76.228  -2.025  1.00 112.16 ? 932  GLU A O     1 
ATOM   7262  C  CB    . GLU A 1  932  ? 157.337 74.630  -1.596  1.00 110.59 ? 932  GLU A CB    1 
ATOM   7263  C  CG    . GLU A 1  932  ? 156.450 73.949  -0.556  1.00 118.80 ? 932  GLU A CG    1 
ATOM   7264  C  CD    . GLU A 1  932  ? 157.096 73.295  0.652   1.00 132.55 ? 932  GLU A CD    1 
ATOM   7265  O  OE1   . GLU A 1  932  ? 157.541 72.132  0.517   1.00 122.66 ? 932  GLU A OE1   1 
ATOM   7266  O  OE2   . GLU A 1  932  ? 157.031 73.883  1.759   1.00 118.58 ? 932  GLU A OE2   1 
ATOM   7267  N  N     . TYR A 1  933  ? 156.143 77.356  -1.100  1.00 109.46 ? 933  TYR A N     1 
ATOM   7268  C  CA    . TYR A 1  933  ? 155.362 78.290  -0.296  1.00 108.83 ? 933  TYR A CA    1 
ATOM   7269  C  C     . TYR A 1  933  ? 154.372 79.122  -1.116  1.00 111.47 ? 933  TYR A C     1 
ATOM   7270  O  O     . TYR A 1  933  ? 153.183 79.158  -0.780  1.00 109.63 ? 933  TYR A O     1 
ATOM   7271  C  CB    . TYR A 1  933  ? 156.253 79.148  0.609   1.00 111.05 ? 933  TYR A CB    1 
ATOM   7272  C  CG    . TYR A 1  933  ? 155.476 79.877  1.681   1.00 112.74 ? 933  TYR A CG    1 
ATOM   7273  C  CD1   . TYR A 1  933  ? 155.020 79.212  2.813   1.00 115.11 ? 933  TYR A CD1   1 
ATOM   7274  C  CD2   . TYR A 1  933  ? 155.182 81.226  1.559   1.00 113.64 ? 933  TYR A CD2   1 
ATOM   7275  C  CE1   . TYR A 1  933  ? 154.279 79.874  3.794   1.00 116.68 ? 933  TYR A CE1   1 
ATOM   7276  C  CE2   . TYR A 1  933  ? 154.465 81.905  2.544   1.00 114.85 ? 933  TYR A CE2   1 
ATOM   7277  C  CZ    . TYR A 1  933  ? 154.015 81.225  3.662   1.00 122.66 ? 933  TYR A CZ    1 
ATOM   7278  O  OH    . TYR A 1  933  ? 153.310 81.891  4.637   1.00 125.27 ? 933  TYR A OH    1 
ATOM   7279  N  N     . LYS A 1  934  ? 154.839 79.715  -2.230  1.00 108.54 ? 934  LYS A N     1 
ATOM   7280  C  CA    . LYS A 1  934  ? 153.986 80.530  -3.103  1.00 107.91 ? 934  LYS A CA    1 
ATOM   7281  C  C     . LYS A 1  934  ? 152.814 79.745  -3.683  1.00 107.28 ? 934  LYS A C     1 
ATOM   7282  O  O     . LYS A 1  934  ? 151.718 80.293  -3.792  1.00 106.20 ? 934  LYS A O     1 
ATOM   7283  C  CB    . LYS A 1  934  ? 154.801 81.290  -4.176  1.00 112.29 ? 934  LYS A CB    1 
ATOM   7284  C  CG    . LYS A 1  934  ? 155.223 82.734  -3.772  1.00 130.98 ? 934  LYS A CG    1 
ATOM   7285  C  CD    . LYS A 1  934  ? 156.522 82.837  -2.908  1.00 139.79 ? 934  LYS A CD    1 
ATOM   7286  C  CE    . LYS A 1  934  ? 156.863 84.257  -2.481  1.00 143.74 ? 934  LYS A CE    1 
ATOM   7287  N  NZ    . LYS A 1  934  ? 157.999 84.307  -1.515  1.00 144.86 ? 934  LYS A NZ    1 
ATOM   7288  N  N     . GLN A 1  935  ? 153.033 78.446  -3.966  1.00 101.60 ? 935  GLN A N     1 
ATOM   7289  C  CA    . GLN A 1  935  ? 152.014 77.516  -4.468  1.00 99.49  ? 935  GLN A CA    1 
ATOM   7290  C  C     . GLN A 1  935  ? 150.952 77.282  -3.379  1.00 101.29 ? 935  GLN A C     1 
ATOM   7291  O  O     . GLN A 1  935  ? 149.746 77.369  -3.660  1.00 98.67  ? 935  GLN A O     1 
ATOM   7292  C  CB    . GLN A 1  935  ? 152.672 76.193  -4.937  1.00 99.96  ? 935  GLN A CB    1 
ATOM   7293  C  CG    . GLN A 1  935  ? 151.755 75.153  -5.597  1.00 108.00 ? 935  GLN A CG    1 
ATOM   7294  C  CD    . GLN A 1  935  ? 150.627 75.688  -6.460  1.00 124.68 ? 935  GLN A CD    1 
ATOM   7295  O  OE1   . GLN A 1  935  ? 150.835 76.319  -7.500  1.00 117.86 ? 935  GLN A OE1   1 
ATOM   7296  N  NE2   . GLN A 1  935  ? 149.398 75.387  -6.073  1.00 118.18 ? 935  GLN A NE2   1 
ATOM   7297  N  N     . LEU A 1  936  ? 151.418 77.049  -2.124  1.00 97.93  ? 936  LEU A N     1 
ATOM   7298  C  CA    . LEU A 1  936  ? 150.558 76.844  -0.950  1.00 96.55  ? 936  LEU A CA    1 
ATOM   7299  C  C     . LEU A 1  936  ? 149.678 78.059  -0.701  1.00 100.58 ? 936  LEU A C     1 
ATOM   7300  O  O     . LEU A 1  936  ? 148.500 77.896  -0.367  1.00 98.75  ? 936  LEU A O     1 
ATOM   7301  C  CB    . LEU A 1  936  ? 151.366 76.512  0.318   1.00 96.53  ? 936  LEU A CB    1 
ATOM   7302  C  CG    . LEU A 1  936  ? 152.208 75.246  0.298   1.00 100.24 ? 936  LEU A CG    1 
ATOM   7303  C  CD1   . LEU A 1  936  ? 153.219 75.292  1.379   1.00 101.52 ? 936  LEU A CD1   1 
ATOM   7304  C  CD2   . LEU A 1  936  ? 151.367 73.996  0.462   1.00 100.96 ? 936  LEU A CD2   1 
ATOM   7305  N  N     . VAL A 1  937  ? 150.243 79.276  -0.890  1.00 98.84  ? 937  VAL A N     1 
ATOM   7306  C  CA    . VAL A 1  937  ? 149.483 80.511  -0.706  1.00 99.42  ? 937  VAL A CA    1 
ATOM   7307  C  C     . VAL A 1  937  ? 148.436 80.660  -1.803  1.00 105.68 ? 937  VAL A C     1 
ATOM   7308  O  O     . VAL A 1  937  ? 147.291 80.975  -1.489  1.00 104.82 ? 937  VAL A O     1 
ATOM   7309  C  CB    . VAL A 1  937  ? 150.337 81.772  -0.484  1.00 103.76 ? 937  VAL A CB    1 
ATOM   7310  C  CG1   . VAL A 1  937  ? 149.467 82.925  -0.005  1.00 103.85 ? 937  VAL A CG1   1 
ATOM   7311  C  CG2   . VAL A 1  937  ? 151.431 81.505  0.537   1.00 104.18 ? 937  VAL A CG2   1 
ATOM   7312  N  N     . LYS A 1  938  ? 148.801 80.338  -3.068  1.00 104.28 ? 938  LYS A N     1 
ATOM   7313  C  CA    . LYS A 1  938  ? 147.896 80.349  -4.232  1.00 103.92 ? 938  LYS A CA    1 
ATOM   7314  C  C     . LYS A 1  938  ? 146.681 79.463  -3.895  1.00 107.36 ? 938  LYS A C     1 
ATOM   7315  O  O     . LYS A 1  938  ? 145.547 79.967  -3.893  1.00 105.62 ? 938  LYS A O     1 
ATOM   7316  C  CB    . LYS A 1  938  ? 148.644 79.830  -5.484  1.00 105.91 ? 938  LYS A CB    1 
ATOM   7317  C  CG    . LYS A 1  938  ? 147.949 80.002  -6.839  1.00 112.34 ? 938  LYS A CG    1 
ATOM   7318  C  CD    . LYS A 1  938  ? 148.754 79.230  -7.903  1.00 121.62 ? 938  LYS A CD    1 
ATOM   7319  C  CE    . LYS A 1  938  ? 148.369 79.477  -9.342  1.00 129.59 ? 938  LYS A CE    1 
ATOM   7320  N  NZ    . LYS A 1  938  ? 149.133 78.588  -10.262 1.00 139.81 ? 938  LYS A NZ    1 
ATOM   7321  N  N     . ASP A 1  939  ? 146.954 78.174  -3.513  1.00 104.49 ? 939  ASP A N     1 
ATOM   7322  C  CA    . ASP A 1  939  ? 145.980 77.156  -3.105  1.00 103.88 ? 939  ASP A CA    1 
ATOM   7323  C  C     . ASP A 1  939  ? 144.987 77.760  -2.144  1.00 108.67 ? 939  ASP A C     1 
ATOM   7324  O  O     . ASP A 1  939  ? 143.783 77.769  -2.410  1.00 108.27 ? 939  ASP A O     1 
ATOM   7325  C  CB    . ASP A 1  939  ? 146.693 76.016  -2.356  1.00 106.12 ? 939  ASP A CB    1 
ATOM   7326  C  CG    . ASP A 1  939  ? 147.249 74.901  -3.202  1.00 120.13 ? 939  ASP A CG    1 
ATOM   7327  O  OD1   . ASP A 1  939  ? 147.384 75.099  -4.436  1.00 121.47 ? 939  ASP A OD1   1 
ATOM   7328  O  OD2   . ASP A 1  939  ? 147.573 73.826  -2.628  1.00 124.22 ? 939  ASP A OD2   1 
ATOM   7329  N  N     . ARG A 1  940  ? 145.520 78.296  -1.028  1.00 105.58 ? 940  ARG A N     1 
ATOM   7330  C  CA    . ARG A 1  940  ? 144.783 78.917  0.060   1.00 105.14 ? 940  ARG A CA    1 
ATOM   7331  C  C     . ARG A 1  940  ? 143.825 79.989  -0.424  1.00 108.11 ? 940  ARG A C     1 
ATOM   7332  O  O     . ARG A 1  940  ? 142.690 80.031  0.048   1.00 107.25 ? 940  ARG A O     1 
ATOM   7333  C  CB    . ARG A 1  940  ? 145.747 79.483  1.102   1.00 105.43 ? 940  ARG A CB    1 
ATOM   7334  C  CG    . ARG A 1  940  ? 145.169 79.425  2.487   1.00 111.05 ? 940  ARG A CG    1 
ATOM   7335  C  CD    . ARG A 1  940  ? 145.217 80.747  3.198   1.00 111.40 ? 940  ARG A CD    1 
ATOM   7336  N  NE    . ARG A 1  940  ? 145.026 80.563  4.634   1.00 111.67 ? 940  ARG A NE    1 
ATOM   7337  C  CZ    . ARG A 1  940  ? 145.228 81.512  5.535   1.00 124.62 ? 940  ARG A CZ    1 
ATOM   7338  N  NH1   . ARG A 1  940  ? 145.620 82.721  5.156   1.00 115.42 ? 940  ARG A NH1   1 
ATOM   7339  N  NH2   . ARG A 1  940  ? 145.045 81.261  6.824   1.00 108.75 ? 940  ARG A NH2   1 
ATOM   7340  N  N     . LYS A 1  941  ? 144.254 80.826  -1.385  1.00 104.54 ? 941  LYS A N     1 
ATOM   7341  C  CA    . LYS A 1  941  ? 143.365 81.867  -1.893  1.00 104.67 ? 941  LYS A CA    1 
ATOM   7342  C  C     . LYS A 1  941  ? 142.275 81.245  -2.739  1.00 106.90 ? 941  LYS A C     1 
ATOM   7343  O  O     . LYS A 1  941  ? 141.102 81.585  -2.548  1.00 106.90 ? 941  LYS A O     1 
ATOM   7344  C  CB    . LYS A 1  941  ? 144.110 83.007  -2.623  1.00 108.71 ? 941  LYS A CB    1 
ATOM   7345  C  CG    . LYS A 1  941  ? 145.368 83.590  -1.888  1.00 134.92 ? 941  LYS A CG    1 
ATOM   7346  C  CD    . LYS A 1  941  ? 145.239 84.086  -0.383  1.00 142.12 ? 941  LYS A CD    1 
ATOM   7347  C  CE    . LYS A 1  941  ? 146.006 83.205  0.602   1.00 138.06 ? 941  LYS A CE    1 
ATOM   7348  N  NZ    . LYS A 1  941  ? 146.491 83.901  1.832   1.00 134.29 ? 941  LYS A NZ    1 
ATOM   7349  N  N     . PHE A 1  942  ? 142.650 80.263  -3.598  1.00 100.91 ? 942  PHE A N     1 
ATOM   7350  C  CA    . PHE A 1  942  ? 141.728 79.556  -4.489  1.00 98.58  ? 942  PHE A CA    1 
ATOM   7351  C  C     . PHE A 1  942  ? 140.672 78.809  -3.721  1.00 99.90  ? 942  PHE A C     1 
ATOM   7352  O  O     . PHE A 1  942  ? 139.509 78.796  -4.123  1.00 99.20  ? 942  PHE A O     1 
ATOM   7353  C  CB    . PHE A 1  942  ? 142.479 78.605  -5.439  1.00 100.07 ? 942  PHE A CB    1 
ATOM   7354  C  CG    . PHE A 1  942  ? 141.629 77.526  -6.086  1.00 100.50 ? 942  PHE A CG    1 
ATOM   7355  C  CD1   . PHE A 1  942  ? 140.760 77.831  -7.126  1.00 103.27 ? 942  PHE A CD1   1 
ATOM   7356  C  CD2   . PHE A 1  942  ? 141.680 76.213  -5.633  1.00 101.17 ? 942  PHE A CD2   1 
ATOM   7357  C  CE1   . PHE A 1  942  ? 139.960 76.840  -7.699  1.00 102.63 ? 942  PHE A CE1   1 
ATOM   7358  C  CE2   . PHE A 1  942  ? 140.881 75.226  -6.208  1.00 102.25 ? 942  PHE A CE2   1 
ATOM   7359  C  CZ    . PHE A 1  942  ? 140.035 75.544  -7.243  1.00 100.02 ? 942  PHE A CZ    1 
ATOM   7360  N  N     . LEU A 1  943  ? 141.079 78.155  -2.640  1.00 95.55  ? 943  LEU A N     1 
ATOM   7361  C  CA    . LEU A 1  943  ? 140.159 77.383  -1.828  1.00 94.57  ? 943  LEU A CA    1 
ATOM   7362  C  C     . LEU A 1  943  ? 139.076 78.273  -1.229  1.00 99.40  ? 943  LEU A C     1 
ATOM   7363  O  O     . LEU A 1  943  ? 137.896 77.913  -1.260  1.00 97.61  ? 943  LEU A O     1 
ATOM   7364  C  CB    . LEU A 1  943  ? 140.928 76.621  -0.752  1.00 94.62  ? 943  LEU A CB    1 
ATOM   7365  C  CG    . LEU A 1  943  ? 141.649 75.340  -1.167  1.00 98.42  ? 943  LEU A CG    1 
ATOM   7366  C  CD1   . LEU A 1  943  ? 141.744 74.380  0.013   1.00 98.03  ? 943  LEU A CD1   1 
ATOM   7367  C  CD2   . LEU A 1  943  ? 140.935 74.641  -2.306  1.00 100.27 ? 943  LEU A CD2   1 
ATOM   7368  N  N     . ARG A 1  944  ? 139.476 79.481  -0.782  1.00 97.96  ? 944  ARG A N     1 
ATOM   7369  C  CA    . ARG A 1  944  ? 138.571 80.477  -0.221  1.00 98.58  ? 944  ARG A CA    1 
ATOM   7370  C  C     . ARG A 1  944  ? 137.598 81.027  -1.270  1.00 105.84 ? 944  ARG A C     1 
ATOM   7371  O  O     . ARG A 1  944  ? 136.518 81.489  -0.892  1.00 106.24 ? 944  ARG A O     1 
ATOM   7372  C  CB    . ARG A 1  944  ? 139.341 81.582  0.497   1.00 97.63  ? 944  ARG A CB    1 
ATOM   7373  C  CG    . ARG A 1  944  ? 140.012 81.095  1.770   1.00 99.56  ? 944  ARG A CG    1 
ATOM   7374  C  CD    . ARG A 1  944  ? 140.517 82.217  2.654   1.00 100.28 ? 944  ARG A CD    1 
ATOM   7375  N  NE    . ARG A 1  944  ? 141.038 81.691  3.913   1.00 99.99  ? 944  ARG A NE    1 
ATOM   7376  C  CZ    . ARG A 1  944  ? 141.407 82.429  4.952   1.00 121.54 ? 944  ARG A CZ    1 
ATOM   7377  N  NH1   . ARG A 1  944  ? 141.328 83.756  4.898   1.00 114.99 ? 944  ARG A NH1   1 
ATOM   7378  N  NH2   . ARG A 1  944  ? 141.864 81.850  6.055   1.00 111.39 ? 944  ARG A NH2   1 
ATOM   7379  N  N     . GLU A 1  945  ? 137.958 80.938  -2.584  1.00 103.59 ? 945  GLU A N     1 
ATOM   7380  C  CA    . GLU A 1  945  ? 137.085 81.314  -3.707  1.00 103.48 ? 945  GLU A CA    1 
ATOM   7381  C  C     . GLU A 1  945  ? 135.981 80.243  -3.820  1.00 106.67 ? 945  GLU A C     1 
ATOM   7382  O  O     . GLU A 1  945  ? 134.803 80.590  -3.941  1.00 106.49 ? 945  GLU A O     1 
ATOM   7383  C  CB    . GLU A 1  945  ? 137.845 81.365  -5.052  1.00 105.04 ? 945  GLU A CB    1 
ATOM   7384  C  CG    . GLU A 1  945  ? 138.846 82.490  -5.227  1.00 121.06 ? 945  GLU A CG    1 
ATOM   7385  C  CD    . GLU A 1  945  ? 139.518 82.514  -6.591  1.00 154.91 ? 945  GLU A CD    1 
ATOM   7386  O  OE1   . GLU A 1  945  ? 138.793 82.597  -7.610  1.00 157.95 ? 945  GLU A OE1   1 
ATOM   7387  O  OE2   . GLU A 1  945  ? 140.770 82.481  -6.643  1.00 152.02 ? 945  GLU A OE2   1 
ATOM   7388  N  N     . VAL A 1  946  ? 136.367 78.947  -3.789  1.00 101.92 ? 946  VAL A N     1 
ATOM   7389  C  CA    . VAL A 1  946  ? 135.431 77.832  -3.916  1.00 100.85 ? 946  VAL A CA    1 
ATOM   7390  C  C     . VAL A 1  946  ? 134.521 77.750  -2.696  1.00 107.90 ? 946  VAL A C     1 
ATOM   7391  O  O     . VAL A 1  946  ? 133.294 77.805  -2.826  1.00 107.74 ? 946  VAL A O     1 
ATOM   7392  C  CB    . VAL A 1  946  ? 136.152 76.491  -4.171  1.00 103.10 ? 946  VAL A CB    1 
ATOM   7393  C  CG1   . VAL A 1  946  ? 135.153 75.367  -4.415  1.00 101.29 ? 946  VAL A CG1   1 
ATOM   7394  C  CG2   . VAL A 1  946  ? 137.122 76.609  -5.331  1.00 103.13 ? 946  VAL A CG2   1 
ATOM   7395  N  N     . PHE A 1  947  ? 135.126 77.624  -1.514  1.00 106.05 ? 947  PHE A N     1 
ATOM   7396  C  CA    . PHE A 1  947  ? 134.383 77.494  -0.276  1.00 105.98 ? 947  PHE A CA    1 
ATOM   7397  C  C     . PHE A 1  947  ? 134.320 78.826  0.430   1.00 113.30 ? 947  PHE A C     1 
ATOM   7398  O  O     . PHE A 1  947  ? 135.006 79.029  1.428   1.00 114.41 ? 947  PHE A O     1 
ATOM   7399  C  CB    . PHE A 1  947  ? 134.980 76.375  0.585   1.00 107.12 ? 947  PHE A CB    1 
ATOM   7400  C  CG    . PHE A 1  947  ? 135.206 75.089  -0.179  1.00 107.78 ? 947  PHE A CG    1 
ATOM   7401  C  CD1   . PHE A 1  947  ? 134.164 74.471  -0.860  1.00 109.87 ? 947  PHE A CD1   1 
ATOM   7402  C  CD2   . PHE A 1  947  ? 136.459 74.501  -0.225  1.00 110.48 ? 947  PHE A CD2   1 
ATOM   7403  C  CE1   . PHE A 1  947  ? 134.365 73.268  -1.544  1.00 109.81 ? 947  PHE A CE1   1 
ATOM   7404  C  CE2   . PHE A 1  947  ? 136.661 73.302  -0.918  1.00 112.50 ? 947  PHE A CE2   1 
ATOM   7405  C  CZ    . PHE A 1  947  ? 135.610 72.695  -1.572  1.00 109.39 ? 947  PHE A CZ    1 
ATOM   7406  N  N     . VAL A 1  948  ? 133.496 79.749  -0.125  1.00 110.98 ? 948  VAL A N     1 
ATOM   7407  C  CA    . VAL A 1  948  ? 133.235 81.130  0.341   1.00 112.01 ? 948  VAL A CA    1 
ATOM   7408  C  C     . VAL A 1  948  ? 133.155 81.311  1.878   1.00 117.00 ? 948  VAL A C     1 
ATOM   7409  O  O     . VAL A 1  948  ? 133.647 82.322  2.396   1.00 117.94 ? 948  VAL A O     1 
ATOM   7410  C  CB    . VAL A 1  948  ? 132.023 81.808  -0.378  1.00 115.62 ? 948  VAL A CB    1 
ATOM   7411  C  CG1   . VAL A 1  948  ? 132.478 82.928  -1.300  1.00 115.88 ? 948  VAL A CG1   1 
ATOM   7412  C  CG2   . VAL A 1  948  ? 131.153 80.798  -1.133  1.00 114.36 ? 948  VAL A CG2   1 
ATOM   7413  N  N     . ASP A 1  949  ? 132.537 80.333  2.593   1.00 112.73 ? 949  ASP A N     1 
ATOM   7414  C  CA    . ASP A 1  949  ? 132.354 80.349  4.049   1.00 113.00 ? 949  ASP A CA    1 
ATOM   7415  C  C     . ASP A 1  949  ? 133.492 79.705  4.851   1.00 116.46 ? 949  ASP A C     1 
ATOM   7416  O  O     . ASP A 1  949  ? 133.398 79.596  6.074   1.00 116.45 ? 949  ASP A O     1 
ATOM   7417  C  CB    . ASP A 1  949  ? 130.964 79.803  4.449   1.00 114.80 ? 949  ASP A CB    1 
ATOM   7418  C  CG    . ASP A 1  949  ? 130.665 78.346  4.126   1.00 134.37 ? 949  ASP A CG    1 
ATOM   7419  O  OD1   . ASP A 1  949  ? 131.395 77.749  3.292   1.00 136.32 ? 949  ASP A OD1   1 
ATOM   7420  O  OD2   . ASP A 1  949  ? 129.678 77.812  4.672   1.00 144.06 ? 949  ASP A OD2   1 
ATOM   7421  N  N     . GLY A 1  950  ? 134.564 79.328  4.158   1.00 112.86 ? 950  GLY A N     1 
ATOM   7422  C  CA    . GLY A 1  950  ? 135.749 78.717  4.749   1.00 112.98 ? 950  GLY A CA    1 
ATOM   7423  C  C     . GLY A 1  950  ? 135.571 77.308  5.272   1.00 116.84 ? 950  GLY A C     1 
ATOM   7424  O  O     . GLY A 1  950  ? 136.343 76.874  6.135   1.00 117.56 ? 950  GLY A O     1 
ATOM   7425  N  N     . GLU A 1  951  ? 134.564 76.575  4.756   1.00 111.86 ? 951  GLU A N     1 
ATOM   7426  C  CA    . GLU A 1  951  ? 134.312 75.201  5.175   1.00 110.64 ? 951  GLU A CA    1 
ATOM   7427  C  C     . GLU A 1  951  ? 135.445 74.311  4.672   1.00 112.97 ? 951  GLU A C     1 
ATOM   7428  O  O     . GLU A 1  951  ? 135.667 74.225  3.467   1.00 111.99 ? 951  GLU A O     1 
ATOM   7429  C  CB    . GLU A 1  951  ? 132.926 74.715  4.708   1.00 111.27 ? 951  GLU A CB    1 
ATOM   7430  C  CG    . GLU A 1  951  ? 132.563 73.311  5.179   1.00 122.27 ? 951  GLU A CG    1 
ATOM   7431  C  CD    . GLU A 1  951  ? 132.948 72.982  6.609   1.00 140.75 ? 951  GLU A CD    1 
ATOM   7432  O  OE1   . GLU A 1  951  ? 132.341 73.563  7.538   1.00 147.31 ? 951  GLU A OE1   1 
ATOM   7433  O  OE2   . GLU A 1  951  ? 133.902 72.192  6.796   1.00 124.56 ? 951  GLU A OE2   1 
ATOM   7434  N  N     . ALA A 1  952  ? 136.199 73.716  5.610   1.00 109.21 ? 952  ALA A N     1 
ATOM   7435  C  CA    . ALA A 1  952  ? 137.366 72.874  5.324   1.00 108.55 ? 952  ALA A CA    1 
ATOM   7436  C  C     . ALA A 1  952  ? 137.050 71.413  5.016   1.00 109.22 ? 952  ALA A C     1 
ATOM   7437  O  O     . ALA A 1  952  ? 137.755 70.808  4.203   1.00 108.35 ? 952  ALA A O     1 
ATOM   7438  C  CB    . ALA A 1  952  ? 138.357 72.949  6.478   1.00 110.28 ? 952  ALA A CB    1 
ATOM   7439  N  N     . ASN A 1  953  ? 136.029 70.844  5.691   1.00 103.07 ? 953  ASN A N     1 
ATOM   7440  C  CA    . ASN A 1  953  ? 135.656 69.440  5.578   1.00 100.76 ? 953  ASN A CA    1 
ATOM   7441  C  C     . ASN A 1  953  ? 134.855 69.101  4.345   1.00 101.66 ? 953  ASN A C     1 
ATOM   7442  O  O     . ASN A 1  953  ? 133.702 69.488  4.198   1.00 100.75 ? 953  ASN A O     1 
ATOM   7443  C  CB    . ASN A 1  953  ? 135.036 68.935  6.859   1.00 101.96 ? 953  ASN A CB    1 
ATOM   7444  C  CG    . ASN A 1  953  ? 135.960 69.118  8.030   1.00 135.11 ? 953  ASN A CG    1 
ATOM   7445  O  OD1   . ASN A 1  953  ? 136.933 68.377  8.194   1.00 135.20 ? 953  ASN A OD1   1 
ATOM   7446  N  ND2   . ASN A 1  953  ? 135.718 70.155  8.827   1.00 127.42 ? 953  ASN A ND2   1 
ATOM   7447  N  N     . TRP A 1  954  ? 135.514 68.406  3.434   1.00 97.11  ? 954  TRP A N     1 
ATOM   7448  C  CA    . TRP A 1  954  ? 134.985 68.012  2.147   1.00 96.00  ? 954  TRP A CA    1 
ATOM   7449  C  C     . TRP A 1  954  ? 135.324 66.579  1.850   1.00 98.75  ? 954  TRP A C     1 
ATOM   7450  O  O     . TRP A 1  954  ? 136.399 66.112  2.218   1.00 98.78  ? 954  TRP A O     1 
ATOM   7451  C  CB    . TRP A 1  954  ? 135.529 68.940  1.053   1.00 95.50  ? 954  TRP A CB    1 
ATOM   7452  C  CG    . TRP A 1  954  ? 134.985 70.313  1.230   1.00 97.44  ? 954  TRP A CG    1 
ATOM   7453  C  CD1   . TRP A 1  954  ? 135.581 71.352  1.883   1.00 101.27 ? 954  TRP A CD1   1 
ATOM   7454  C  CD2   . TRP A 1  954  ? 133.628 70.705  1.005   1.00 97.20  ? 954  TRP A CD2   1 
ATOM   7455  N  NE1   . TRP A 1  954  ? 134.697 72.396  2.013   1.00 101.04 ? 954  TRP A NE1   1 
ATOM   7456  C  CE2   . TRP A 1  954  ? 133.484 72.019  1.497   1.00 101.82 ? 954  TRP A CE2   1 
ATOM   7457  C  CE3   . TRP A 1  954  ? 132.517 70.073  0.419   1.00 97.42  ? 954  TRP A CE3   1 
ATOM   7458  C  CZ2   . TRP A 1  954  ? 132.286 72.721  1.394   1.00 101.03 ? 954  TRP A CZ2   1 
ATOM   7459  C  CZ3   . TRP A 1  954  ? 131.336 70.776  0.309   1.00 98.61  ? 954  TRP A CZ3   1 
ATOM   7460  C  CH2   . TRP A 1  954  ? 131.226 72.079  0.798   1.00 100.09 ? 954  TRP A CH2   1 
ATOM   7461  N  N     . PRO A 1  955  ? 134.424 65.844  1.185   1.00 93.67  ? 955  PRO A N     1 
ATOM   7462  C  CA    . PRO A 1  955  ? 134.730 64.460  0.875   1.00 91.47  ? 955  PRO A CA    1 
ATOM   7463  C  C     . PRO A 1  955  ? 135.604 64.380  -0.364  1.00 91.82  ? 955  PRO A C     1 
ATOM   7464  O  O     . PRO A 1  955  ? 135.267 64.913  -1.422  1.00 91.09  ? 955  PRO A O     1 
ATOM   7465  C  CB    . PRO A 1  955  ? 133.350 63.814  0.729   1.00 92.74  ? 955  PRO A CB    1 
ATOM   7466  C  CG    . PRO A 1  955  ? 132.343 64.921  0.771   1.00 98.38  ? 955  PRO A CG    1 
ATOM   7467  C  CD    . PRO A 1  955  ? 133.096 66.212  0.660   1.00 95.39  ? 955  PRO A CD    1 
ATOM   7468  N  N     . LEU A 1  956  ? 136.774 63.788  -0.191  1.00 86.78  ? 956  LEU A N     1 
ATOM   7469  C  CA    . LEU A 1  956  ? 137.754 63.630  -1.256  1.00 86.22  ? 956  LEU A CA    1 
ATOM   7470  C  C     . LEU A 1  956  ? 138.242 62.171  -1.275  1.00 89.29  ? 956  LEU A C     1 
ATOM   7471  O  O     . LEU A 1  956  ? 138.105 61.504  -0.254  1.00 88.64  ? 956  LEU A O     1 
ATOM   7472  C  CB    . LEU A 1  956  ? 138.938 64.603  -1.031  1.00 87.14  ? 956  LEU A CB    1 
ATOM   7473  C  CG    . LEU A 1  956  ? 138.656 66.113  -1.166  1.00 92.11  ? 956  LEU A CG    1 
ATOM   7474  C  CD1   . LEU A 1  956  ? 139.826 66.944  -0.688  1.00 92.44  ? 956  LEU A CD1   1 
ATOM   7475  C  CD2   . LEU A 1  956  ? 138.377 66.480  -2.583  1.00 96.51  ? 956  LEU A CD2   1 
ATOM   7476  N  N     . PRO A 1  957  ? 138.803 61.627  -2.387  1.00 85.62  ? 957  PRO A N     1 
ATOM   7477  C  CA    . PRO A 1  957  ? 139.315 60.252  -2.330  1.00 84.86  ? 957  PRO A CA    1 
ATOM   7478  C  C     . PRO A 1  957  ? 140.643 60.206  -1.552  1.00 89.07  ? 957  PRO A C     1 
ATOM   7479  O  O     . PRO A 1  957  ? 141.162 61.258  -1.181  1.00 88.66  ? 957  PRO A O     1 
ATOM   7480  C  CB    . PRO A 1  957  ? 139.477 59.889  -3.811  1.00 86.21  ? 957  PRO A CB    1 
ATOM   7481  C  CG    . PRO A 1  957  ? 139.837 61.154  -4.459  1.00 91.09  ? 957  PRO A CG    1 
ATOM   7482  C  CD    . PRO A 1  957  ? 139.098 62.244  -3.702  1.00 87.29  ? 957  PRO A CD    1 
ATOM   7483  N  N     . VAL A 1  958  ? 141.177 58.998  -1.286  1.00 86.59  ? 958  VAL A N     1 
ATOM   7484  C  CA    . VAL A 1  958  ? 142.443 58.772  -0.557  1.00 87.58  ? 958  VAL A CA    1 
ATOM   7485  C  C     . VAL A 1  958  ? 142.525 59.448  0.840   1.00 94.07  ? 958  VAL A C     1 
ATOM   7486  O  O     . VAL A 1  958  ? 142.793 60.652  0.916   1.00 93.46  ? 958  VAL A O     1 
ATOM   7487  C  CB    . VAL A 1  958  ? 143.699 59.066  -1.424  1.00 90.93  ? 958  VAL A CB    1 
ATOM   7488  C  CG1   . VAL A 1  958  ? 144.962 58.533  -0.761  1.00 90.94  ? 958  VAL A CG1   1 
ATOM   7489  C  CG2   . VAL A 1  958  ? 143.543 58.493  -2.823  1.00 89.85  ? 958  VAL A CG2   1 
ATOM   7490  N  N     . ASN A 1  959  ? 142.320 58.672  1.940   1.00 92.20  ? 959  ASN A N     1 
ATOM   7491  C  CA    . ASN A 1  959  ? 142.432 59.261  3.278   1.00 92.98  ? 959  ASN A CA    1 
ATOM   7492  C  C     . ASN A 1  959  ? 143.900 59.321  3.625   1.00 98.11  ? 959  ASN A C     1 
ATOM   7493  O  O     . ASN A 1  959  ? 144.508 58.292  3.960   1.00 97.68  ? 959  ASN A O     1 
ATOM   7494  C  CB    . ASN A 1  959  ? 141.638 58.506  4.340   1.00 93.64  ? 959  ASN A CB    1 
ATOM   7495  C  CG    . ASN A 1  959  ? 141.462 59.281  5.633   1.00 115.14 ? 959  ASN A CG    1 
ATOM   7496  O  OD1   . ASN A 1  959  ? 142.420 59.772  6.243   1.00 108.07 ? 959  ASN A OD1   1 
ATOM   7497  N  ND2   . ASN A 1  959  ? 140.228 59.375  6.101   1.00 107.75 ? 959  ASN A ND2   1 
ATOM   7498  N  N     . ILE A 1  960  ? 144.473 60.535  3.483   1.00 94.39  ? 960  ILE A N     1 
ATOM   7499  C  CA    . ILE A 1  960  ? 145.882 60.799  3.723   1.00 94.23  ? 960  ILE A CA    1 
ATOM   7500  C  C     . ILE A 1  960  ? 146.254 60.596  5.189   1.00 98.37  ? 960  ILE A C     1 
ATOM   7501  O  O     . ILE A 1  960  ? 147.267 59.939  5.468   1.00 97.30  ? 960  ILE A O     1 
ATOM   7502  C  CB    . ILE A 1  960  ? 146.287 62.156  3.104   1.00 97.42  ? 960  ILE A CB    1 
ATOM   7503  C  CG1   . ILE A 1  960  ? 146.662 61.973  1.638   1.00 97.17  ? 960  ILE A CG1   1 
ATOM   7504  C  CG2   . ILE A 1  960  ? 147.434 62.826  3.837   1.00 100.00 ? 960  ILE A CG2   1 
ATOM   7505  C  CD1   . ILE A 1  960  ? 145.562 62.247  0.695   1.00 104.13 ? 960  ILE A CD1   1 
ATOM   7506  N  N     . ARG A 1  961  ? 145.395 61.095  6.120   1.00 95.55  ? 961  ARG A N     1 
ATOM   7507  C  CA    . ARG A 1  961  ? 145.595 60.936  7.568   1.00 95.86  ? 961  ARG A CA    1 
ATOM   7508  C  C     . ARG A 1  961  ? 145.905 59.485  7.903   1.00 98.07  ? 961  ARG A C     1 
ATOM   7509  O  O     . ARG A 1  961  ? 146.859 59.239  8.637   1.00 99.37  ? 961  ARG A O     1 
ATOM   7510  C  CB    . ARG A 1  961  ? 144.384 61.432  8.382   1.00 96.99  ? 961  ARG A CB    1 
ATOM   7511  C  CG    . ARG A 1  961  ? 144.618 61.523  9.901   1.00 108.78 ? 961  ARG A CG    1 
ATOM   7512  C  CD    . ARG A 1  961  ? 143.354 61.922  10.643  1.00 124.21 ? 961  ARG A CD    1 
ATOM   7513  N  NE    . ARG A 1  961  ? 143.430 61.638  12.078  1.00 145.41 ? 961  ARG A NE    1 
ATOM   7514  C  CZ    . ARG A 1  961  ? 143.615 62.560  13.020  1.00 171.55 ? 961  ARG A CZ    1 
ATOM   7515  N  NH1   . ARG A 1  961  ? 143.748 63.840  12.691  1.00 162.36 ? 961  ARG A NH1   1 
ATOM   7516  N  NH2   . ARG A 1  961  ? 143.663 62.209  14.299  1.00 163.47 ? 961  ARG A NH2   1 
ATOM   7517  N  N     . ARG A 1  962  ? 145.154 58.530  7.318   1.00 91.28  ? 962  ARG A N     1 
ATOM   7518  C  CA    . ARG A 1  962  ? 145.410 57.116  7.555   1.00 89.99  ? 962  ARG A CA    1 
ATOM   7519  C  C     . ARG A 1  962  ? 146.754 56.655  7.003   1.00 92.85  ? 962  ARG A C     1 
ATOM   7520  O  O     . ARG A 1  962  ? 147.507 56.052  7.762   1.00 93.01  ? 962  ARG A O     1 
ATOM   7521  C  CB    . ARG A 1  962  ? 144.266 56.229  7.065   1.00 88.82  ? 962  ARG A CB    1 
ATOM   7522  C  CG    . ARG A 1  962  ? 143.162 56.100  8.088   1.00 97.61  ? 962  ARG A CG    1 
ATOM   7523  C  CD    . ARG A 1  962  ? 142.301 54.897  7.817   1.00 101.82 ? 962  ARG A CD    1 
ATOM   7524  N  NE    . ARG A 1  962  ? 141.146 55.209  6.978   1.00 104.57 ? 962  ARG A NE    1 
ATOM   7525  C  CZ    . ARG A 1  962  ? 141.089 54.978  5.670   1.00 121.61 ? 962  ARG A CZ    1 
ATOM   7526  N  NH1   . ARG A 1  962  ? 142.134 54.458  5.032   1.00 113.48 ? 962  ARG A NH1   1 
ATOM   7527  N  NH2   . ARG A 1  962  ? 139.992 55.265  4.990   1.00 104.28 ? 962  ARG A NH2   1 
ATOM   7528  N  N     . ILE A 1  963  ? 147.089 56.981  5.724   1.00 87.99  ? 963  ILE A N     1 
ATOM   7529  C  CA    . ILE A 1  963  ? 148.357 56.572  5.095   1.00 87.64  ? 963  ILE A CA    1 
ATOM   7530  C  C     . ILE A 1  963  ? 149.529 56.941  5.970   1.00 95.03  ? 963  ILE A C     1 
ATOM   7531  O  O     . ILE A 1  963  ? 150.331 56.063  6.301   1.00 95.47  ? 963  ILE A O     1 
ATOM   7532  C  CB    . ILE A 1  963  ? 148.541 57.037  3.631   1.00 89.98  ? 963  ILE A CB    1 
ATOM   7533  C  CG1   . ILE A 1  963  ? 147.231 56.847  2.815   1.00 89.63  ? 963  ILE A CG1   1 
ATOM   7534  C  CG2   . ILE A 1  963  ? 149.751 56.325  2.988   1.00 89.78  ? 963  ILE A CG2   1 
ATOM   7535  C  CD1   . ILE A 1  963  ? 147.294 57.029  1.314   1.00 95.77  ? 963  ILE A CD1   1 
ATOM   7536  N  N     . ILE A 1  964  ? 149.581 58.218  6.415   1.00 93.40  ? 964  ILE A N     1 
ATOM   7537  C  CA    . ILE A 1  964  ? 150.617 58.696  7.325   1.00 94.62  ? 964  ILE A CA    1 
ATOM   7538  C  C     . ILE A 1  964  ? 150.601 57.896  8.648   1.00 98.35  ? 964  ILE A C     1 
ATOM   7539  O  O     . ILE A 1  964  ? 151.638 57.343  9.022   1.00 98.53  ? 964  ILE A O     1 
ATOM   7540  C  CB    . ILE A 1  964  ? 150.579 60.239  7.486   1.00 98.58  ? 964  ILE A CB    1 
ATOM   7541  C  CG1   . ILE A 1  964  ? 151.392 60.920  6.366   1.00 99.61  ? 964  ILE A CG1   1 
ATOM   7542  C  CG2   . ILE A 1  964  ? 151.116 60.687  8.852   1.00 100.81 ? 964  ILE A CG2   1 
ATOM   7543  C  CD1   . ILE A 1  964  ? 150.649 61.258  5.149   1.00 107.98 ? 964  ILE A CD1   1 
ATOM   7544  N  N     . GLN A 1  965  ? 149.415 57.763  9.294   1.00 93.75  ? 965  GLN A N     1 
ATOM   7545  C  CA    . GLN A 1  965  ? 149.248 57.001  10.536  1.00 93.39  ? 965  GLN A CA    1 
ATOM   7546  C  C     . GLN A 1  965  ? 149.831 55.601  10.373  1.00 97.30  ? 965  GLN A C     1 
ATOM   7547  O  O     . GLN A 1  965  ? 150.648 55.166  11.195  1.00 96.95  ? 965  GLN A O     1 
ATOM   7548  C  CB    . GLN A 1  965  ? 147.766 56.920  10.941  1.00 93.75  ? 965  GLN A CB    1 
ATOM   7549  C  CG    . GLN A 1  965  ? 147.248 58.131  11.704  1.00 112.36 ? 965  GLN A CG    1 
ATOM   7550  C  CD    . GLN A 1  965  ? 145.747 58.103  11.928  1.00 140.14 ? 965  GLN A CD    1 
ATOM   7551  O  OE1   . GLN A 1  965  ? 144.975 57.438  11.213  1.00 133.21 ? 965  GLN A OE1   1 
ATOM   7552  N  NE2   . GLN A 1  965  ? 145.295 58.860  12.921  1.00 140.11 ? 965  GLN A NE2   1 
ATOM   7553  N  N     . ASN A 1  966  ? 149.454 54.934  9.269   1.00 94.38  ? 966  ASN A N     1 
ATOM   7554  C  CA    . ASN A 1  966  ? 149.897 53.590  8.928   1.00 95.19  ? 966  ASN A CA    1 
ATOM   7555  C  C     . ASN A 1  966  ? 151.391 53.544  8.684   1.00 101.80 ? 966  ASN A C     1 
ATOM   7556  O  O     . ASN A 1  966  ? 152.022 52.600  9.161   1.00 103.34 ? 966  ASN A O     1 
ATOM   7557  C  CB    . ASN A 1  966  ? 149.127 53.017  7.737   1.00 97.96  ? 966  ASN A CB    1 
ATOM   7558  C  CG    . ASN A 1  966  ? 147.621 52.927  7.906   1.00 128.21 ? 966  ASN A CG    1 
ATOM   7559  O  OD1   . ASN A 1  966  ? 147.074 52.787  9.024   1.00 120.04 ? 966  ASN A OD1   1 
ATOM   7560  N  ND2   . ASN A 1  966  ? 146.920 52.998  6.770   1.00 120.99 ? 966  ASN A ND2   1 
ATOM   7561  N  N     . ALA A 1  967  ? 151.976 54.578  8.015   1.00 97.63  ? 967  ALA A N     1 
ATOM   7562  C  CA    . ALA A 1  967  ? 153.426 54.642  7.779   1.00 97.68  ? 967  ALA A CA    1 
ATOM   7563  C  C     . ALA A 1  967  ? 154.154 54.682  9.103   1.00 104.04 ? 967  ALA A C     1 
ATOM   7564  O  O     . ALA A 1  967  ? 155.199 54.047  9.252   1.00 103.28 ? 967  ALA A O     1 
ATOM   7565  C  CB    . ALA A 1  967  ? 153.773 55.864  6.968   1.00 98.40  ? 967  ALA A CB    1 
ATOM   7566  N  N     . GLN A 1  968  ? 153.549 55.378  10.083  1.00 103.52 ? 968  GLN A N     1 
ATOM   7567  C  CA    . GLN A 1  968  ? 154.075 55.527  11.427  1.00 105.76 ? 968  GLN A CA    1 
ATOM   7568  C  C     . GLN A 1  968  ? 154.165 54.211  12.176  1.00 113.57 ? 968  GLN A C     1 
ATOM   7569  O  O     . GLN A 1  968  ? 155.235 53.931  12.720  1.00 115.69 ? 968  GLN A O     1 
ATOM   7570  C  CB    . GLN A 1  968  ? 153.388 56.658  12.193  1.00 107.17 ? 968  GLN A CB    1 
ATOM   7571  C  CG    . GLN A 1  968  ? 153.796 58.001  11.599  1.00 117.03 ? 968  GLN A CG    1 
ATOM   7572  C  CD    . GLN A 1  968  ? 153.090 59.193  12.169  1.00 129.47 ? 968  GLN A CD    1 
ATOM   7573  O  OE1   . GLN A 1  968  ? 151.860 59.236  12.281  1.00 123.48 ? 968  GLN A OE1   1 
ATOM   7574  N  NE2   . GLN A 1  968  ? 153.861 60.227  12.459  1.00 119.90 ? 968  GLN A NE2   1 
ATOM   7575  N  N     . GLN A 1  969  ? 153.122 53.353  12.146  1.00 109.81 ? 969  GLN A N     1 
ATOM   7576  C  CA    . GLN A 1  969  ? 153.338 52.056  12.801  1.00 110.14 ? 969  GLN A CA    1 
ATOM   7577  C  C     . GLN A 1  969  ? 154.149 51.095  11.930  1.00 112.69 ? 969  GLN A C     1 
ATOM   7578  O  O     . GLN A 1  969  ? 155.029 50.415  12.462  1.00 113.67 ? 969  GLN A O     1 
ATOM   7579  C  CB    . GLN A 1  969  ? 152.115 51.426  13.538  1.00 111.05 ? 969  GLN A CB    1 
ATOM   7580  C  CG    . GLN A 1  969  ? 150.916 51.024  12.673  1.00 132.98 ? 969  GLN A CG    1 
ATOM   7581  C  CD    . GLN A 1  969  ? 149.590 51.286  13.372  1.00 157.82 ? 969  GLN A CD    1 
ATOM   7582  O  OE1   . GLN A 1  969  ? 149.511 51.338  14.610  1.00 156.43 ? 969  GLN A OE1   1 
ATOM   7583  N  NE2   . GLN A 1  969  ? 148.510 51.463  12.595  1.00 143.67 ? 969  GLN A NE2   1 
ATOM   7584  N  N     . THR A 1  970  ? 153.938 51.124  10.592  1.00 106.31 ? 970  THR A N     1 
ATOM   7585  C  CA    . THR A 1  970  ? 154.659 50.251  9.663   1.00 105.58 ? 970  THR A CA    1 
ATOM   7586  C  C     . THR A 1  970  ? 156.160 50.414  9.811   1.00 112.08 ? 970  THR A C     1 
ATOM   7587  O  O     . THR A 1  970  ? 156.872 49.410  9.898   1.00 112.14 ? 970  THR A O     1 
ATOM   7588  C  CB    . THR A 1  970  ? 154.162 50.421  8.211   1.00 108.50 ? 970  THR A CB    1 
ATOM   7589  O  OG1   . THR A 1  970  ? 152.757 50.143  8.150   1.00 109.95 ? 970  THR A OG1   1 
ATOM   7590  C  CG2   . THR A 1  970  ? 154.903 49.531  7.213   1.00 102.03 ? 970  THR A CG2   1 
ATOM   7591  N  N     . PHE A 1  971  ? 156.627 51.663  9.922   1.00 110.62 ? 971  PHE A N     1 
ATOM   7592  C  CA    . PHE A 1  971  ? 158.055 51.942  9.997   1.00 112.48 ? 971  PHE A CA    1 
ATOM   7593  C  C     . PHE A 1  971  ? 158.641 52.255  11.360  1.00 123.74 ? 971  PHE A C     1 
ATOM   7594  O  O     . PHE A 1  971  ? 159.862 52.376  11.475  1.00 123.77 ? 971  PHE A O     1 
ATOM   7595  C  CB    . PHE A 1  971  ? 158.456 52.959  8.929   1.00 113.45 ? 971  PHE A CB    1 
ATOM   7596  C  CG    . PHE A 1  971  ? 158.090 52.491  7.543   1.00 112.95 ? 971  PHE A CG    1 
ATOM   7597  C  CD1   . PHE A 1  971  ? 158.913 51.616  6.849   1.00 114.83 ? 971  PHE A CD1   1 
ATOM   7598  C  CD2   . PHE A 1  971  ? 156.907 52.904  6.942   1.00 113.71 ? 971  PHE A CD2   1 
ATOM   7599  C  CE1   . PHE A 1  971  ? 158.568 51.174  5.572   1.00 114.71 ? 971  PHE A CE1   1 
ATOM   7600  C  CE2   . PHE A 1  971  ? 156.555 52.449  5.670   1.00 115.29 ? 971  PHE A CE2   1 
ATOM   7601  C  CZ    . PHE A 1  971  ? 157.389 51.591  4.992   1.00 113.03 ? 971  PHE A CZ    1 
ATOM   7602  N  N     . HIS A 1  972  ? 157.788 52.321  12.399  1.00 126.50 ? 972  HIS A N     1 
ATOM   7603  C  CA    . HIS A 1  972  ? 158.170 52.613  13.788  1.00 130.67 ? 972  HIS A CA    1 
ATOM   7604  C  C     . HIS A 1  972  ? 158.961 53.923  13.831  1.00 136.02 ? 972  HIS A C     1 
ATOM   7605  O  O     . HIS A 1  972  ? 160.128 53.949  14.218  1.00 136.70 ? 972  HIS A O     1 
ATOM   7606  C  CB    . HIS A 1  972  ? 158.925 51.426  14.444  1.00 134.01 ? 972  HIS A CB    1 
ATOM   7607  C  CG    . HIS A 1  972  ? 158.302 50.082  14.179  1.00 138.14 ? 972  HIS A CG    1 
ATOM   7608  N  ND1   . HIS A 1  972  ? 157.093 49.710  14.765  1.00 140.07 ? 972  HIS A ND1   1 
ATOM   7609  C  CD2   . HIS A 1  972  ? 158.740 49.063  13.399  1.00 140.56 ? 972  HIS A CD2   1 
ATOM   7610  C  CE1   . HIS A 1  972  ? 156.840 48.486  14.322  1.00 139.15 ? 972  HIS A CE1   1 
ATOM   7611  N  NE2   . HIS A 1  972  ? 157.799 48.055  13.494  1.00 139.66 ? 972  HIS A NE2   1 
ATOM   7612  N  N     . ILE A 1  973  ? 158.315 54.994  13.359  1.00 133.18 ? 973  ILE A N     1 
ATOM   7613  C  CA    . ILE A 1  973  ? 158.861 56.338  13.235  1.00 134.54 ? 973  ILE A CA    1 
ATOM   7614  C  C     . ILE A 1  973  ? 159.295 56.947  14.579  1.00 142.99 ? 973  ILE A C     1 
ATOM   7615  O  O     . ILE A 1  973  ? 158.484 57.050  15.503  1.00 142.89 ? 973  ILE A O     1 
ATOM   7616  C  CB    . ILE A 1  973  ? 157.920 57.199  12.329  1.00 136.42 ? 973  ILE A CB    1 
ATOM   7617  C  CG1   . ILE A 1  973  ? 158.621 57.652  11.041  1.00 136.38 ? 973  ILE A CG1   1 
ATOM   7618  C  CG2   . ILE A 1  973  ? 157.220 58.357  13.038  1.00 137.57 ? 973  ILE A CG2   1 
ATOM   7619  C  CD1   . ILE A 1  973  ? 158.789 56.606  9.993   1.00 138.15 ? 973  ILE A CD1   1 
ATOM   7620  N  N     . ASP A 1  974  ? 160.602 57.263  14.704  1.00 143.01 ? 974  ASP A N     1 
ATOM   7621  C  CA    . ASP A 1  974  ? 161.183 57.824  15.928  1.00 145.26 ? 974  ASP A CA    1 
ATOM   7622  C  C     . ASP A 1  974  ? 161.031 59.327  15.954  1.00 151.19 ? 974  ASP A C     1 
ATOM   7623  O  O     . ASP A 1  974  ? 161.768 60.047  15.270  1.00 151.11 ? 974  ASP A O     1 
ATOM   7624  C  CB    . ASP A 1  974  ? 162.662 57.421  16.098  1.00 148.64 ? 974  ASP A CB    1 
ATOM   7625  C  CG    . ASP A 1  974  ? 163.202 57.580  17.513  1.00 163.90 ? 974  ASP A CG    1 
ATOM   7626  O  OD1   . ASP A 1  974  ? 162.524 58.239  18.347  1.00 165.49 ? 974  ASP A OD1   1 
ATOM   7627  O  OD2   . ASP A 1  974  ? 164.288 57.025  17.799  1.00 170.59 ? 974  ASP A OD2   1 
ATOM   7628  N  N     . HIS A 1  975  ? 160.100 59.807  16.783  1.00 149.33 ? 975  HIS A N     1 
ATOM   7629  C  CA    . HIS A 1  975  ? 159.820 61.236  16.898  1.00 150.66 ? 975  HIS A CA    1 
ATOM   7630  C  C     . HIS A 1  975  ? 160.947 62.026  17.602  1.00 154.41 ? 975  HIS A C     1 
ATOM   7631  O  O     . HIS A 1  975  ? 160.738 63.161  18.037  1.00 154.31 ? 975  HIS A O     1 
ATOM   7632  C  CB    . HIS A 1  975  ? 158.420 61.472  17.513  1.00 151.92 ? 975  HIS A CB    1 
ATOM   7633  C  CG    . HIS A 1  975  ? 157.266 61.197  16.575  1.00 154.53 ? 975  HIS A CG    1 
ATOM   7634  N  ND1   . HIS A 1  975  ? 156.598 62.229  15.917  1.00 156.14 ? 975  HIS A ND1   1 
ATOM   7635  C  CD2   . HIS A 1  975  ? 156.682 60.020  16.237  1.00 155.41 ? 975  HIS A CD2   1 
ATOM   7636  C  CE1   . HIS A 1  975  ? 155.646 61.644  15.203  1.00 154.21 ? 975  HIS A CE1   1 
ATOM   7637  N  NE2   . HIS A 1  975  ? 155.654 60.319  15.364  1.00 154.04 ? 975  HIS A NE2   1 
ATOM   7638  N  N     . THR A 1  976  ? 162.155 61.428  17.669  1.00 150.81 ? 976  THR A N     1 
ATOM   7639  C  CA    . THR A 1  976  ? 163.352 62.013  18.288  1.00 151.64 ? 976  THR A CA    1 
ATOM   7640  C  C     . THR A 1  976  ? 164.503 62.162  17.269  1.00 153.89 ? 976  THR A C     1 
ATOM   7641  O  O     . THR A 1  976  ? 165.151 63.218  17.227  1.00 155.26 ? 976  THR A O     1 
ATOM   7642  C  CB    . THR A 1  976  ? 163.803 61.205  19.536  1.00 158.36 ? 976  THR A CB    1 
ATOM   7643  O  OG1   . THR A 1  976  ? 164.513 60.024  19.140  1.00 154.39 ? 976  THR A OG1   1 
ATOM   7644  C  CG2   . THR A 1  976  ? 162.651 60.875  20.500  1.00 156.46 ? 976  THR A CG2   1 
ATOM   7645  N  N     . LYS A 1  977  ? 164.746 61.100  16.456  1.00 146.00 ? 977  LYS A N     1 
ATOM   7646  C  CA    . LYS A 1  977  ? 165.813 61.025  15.448  1.00 144.18 ? 977  LYS A CA    1 
ATOM   7647  C  C     . LYS A 1  977  ? 165.625 61.933  14.188  1.00 143.74 ? 977  LYS A C     1 
ATOM   7648  O  O     . LYS A 1  977  ? 164.475 62.237  13.833  1.00 143.51 ? 977  LYS A O     1 
ATOM   7649  C  CB    . LYS A 1  977  ? 166.078 59.554  15.059  1.00 145.29 ? 977  LYS A CB    1 
ATOM   7650  C  CG    . LYS A 1  977  ? 166.641 58.687  16.192  1.00 156.53 ? 977  LYS A CG    1 
ATOM   7651  C  CD    . LYS A 1  977  ? 168.092 59.013  16.577  1.00 164.07 ? 977  LYS A CD    1 
ATOM   7652  C  CE    . LYS A 1  977  ? 168.191 59.656  17.941  1.00 169.01 ? 977  LYS A CE    1 
ATOM   7653  N  NZ    . LYS A 1  977  ? 169.603 59.788  18.382  1.00 175.12 ? 977  LYS A NZ    1 
ATOM   7654  N  N     . PRO A 1  978  ? 166.723 62.374  13.496  1.00 135.59 ? 978  PRO A N     1 
ATOM   7655  C  CA    . PRO A 1  978  ? 166.544 63.213  12.300  1.00 132.70 ? 978  PRO A CA    1 
ATOM   7656  C  C     . PRO A 1  978  ? 166.385 62.401  11.009  1.00 129.24 ? 978  PRO A C     1 
ATOM   7657  O  O     . PRO A 1  978  ? 167.098 61.417  10.794  1.00 128.12 ? 978  PRO A O     1 
ATOM   7658  C  CB    . PRO A 1  978  ? 167.809 64.067  12.285  1.00 136.03 ? 978  PRO A CB    1 
ATOM   7659  C  CG    . PRO A 1  978  ? 168.844 63.211  12.936  1.00 142.15 ? 978  PRO A CG    1 
ATOM   7660  C  CD    . PRO A 1  978  ? 168.159 62.139  13.755  1.00 137.63 ? 978  PRO A CD    1 
ATOM   7661  N  N     . SER A 1  979  ? 165.452 62.834  10.149  1.00 121.03 ? 979  SER A N     1 
ATOM   7662  C  CA    . SER A 1  979  ? 165.139 62.198  8.874   1.00 118.50 ? 979  SER A CA    1 
ATOM   7663  C  C     . SER A 1  979  ? 166.303 62.173  7.877   1.00 122.30 ? 979  SER A C     1 
ATOM   7664  O  O     . SER A 1  979  ? 167.188 63.027  7.921   1.00 123.38 ? 979  SER A O     1 
ATOM   7665  C  CB    . SER A 1  979  ? 163.920 62.860  8.242   1.00 119.49 ? 979  SER A CB    1 
ATOM   7666  O  OG    . SER A 1  979  ? 163.554 62.250  7.014   1.00 123.05 ? 979  SER A OG    1 
ATOM   7667  N  N     . ASP A 1  980  ? 166.268 61.195  6.961   1.00 117.30 ? 980  ASP A N     1 
ATOM   7668  C  CA    . ASP A 1  980  ? 167.246 60.992  5.893   1.00 117.60 ? 980  ASP A CA    1 
ATOM   7669  C  C     . ASP A 1  980  ? 166.710 61.548  4.544   1.00 119.29 ? 980  ASP A C     1 
ATOM   7670  O  O     . ASP A 1  980  ? 167.170 61.159  3.460   1.00 118.56 ? 980  ASP A O     1 
ATOM   7671  C  CB    . ASP A 1  980  ? 167.586 59.493  5.793   1.00 119.90 ? 980  ASP A CB    1 
ATOM   7672  C  CG    . ASP A 1  980  ? 166.386 58.595  5.550   1.00 136.36 ? 980  ASP A CG    1 
ATOM   7673  O  OD1   . ASP A 1  980  ? 165.353 58.787  6.228   1.00 137.21 ? 980  ASP A OD1   1 
ATOM   7674  O  OD2   . ASP A 1  980  ? 166.487 57.685  4.695   1.00 145.25 ? 980  ASP A OD2   1 
ATOM   7675  N  N     . LEU A 1  981  ? 165.731 62.465  4.629   1.00 114.39 ? 981  LEU A N     1 
ATOM   7676  C  CA    . LEU A 1  981  ? 165.103 63.105  3.476   1.00 112.93 ? 981  LEU A CA    1 
ATOM   7677  C  C     . LEU A 1  981  ? 165.843 64.379  3.055   1.00 118.48 ? 981  LEU A C     1 
ATOM   7678  O  O     . LEU A 1  981  ? 166.392 65.099  3.903   1.00 119.85 ? 981  LEU A O     1 
ATOM   7679  C  CB    . LEU A 1  981  ? 163.630 63.435  3.786   1.00 111.44 ? 981  LEU A CB    1 
ATOM   7680  C  CG    . LEU A 1  981  ? 162.626 62.311  3.599   1.00 113.74 ? 981  LEU A CG    1 
ATOM   7681  C  CD1   . LEU A 1  981  ? 161.413 62.518  4.466   1.00 112.70 ? 981  LEU A CD1   1 
ATOM   7682  C  CD2   . LEU A 1  981  ? 162.205 62.192  2.151   1.00 115.10 ? 981  LEU A CD2   1 
ATOM   7683  N  N     . THR A 1  982  ? 165.869 64.632  1.734   1.00 113.81 ? 982  THR A N     1 
ATOM   7684  C  CA    . THR A 1  982  ? 166.450 65.819  1.107   1.00 113.97 ? 982  THR A CA    1 
ATOM   7685  C  C     . THR A 1  982  ? 165.275 66.749  0.920   1.00 116.36 ? 982  THR A C     1 
ATOM   7686  O  O     . THR A 1  982  ? 164.132 66.284  0.892   1.00 113.89 ? 982  THR A O     1 
ATOM   7687  C  CB    . THR A 1  982  ? 167.020 65.470  -0.293  1.00 123.33 ? 982  THR A CB    1 
ATOM   7688  O  OG1   . THR A 1  982  ? 167.775 64.265  -0.227  1.00 125.51 ? 982  THR A OG1   1 
ATOM   7689  C  CG2   . THR A 1  982  ? 167.880 66.570  -0.884  1.00 125.75 ? 982  THR A CG2   1 
ATOM   7690  N  N     . ILE A 1  983  ? 165.537 68.054  0.762   1.00 114.44 ? 983  ILE A N     1 
ATOM   7691  C  CA    . ILE A 1  983  ? 164.465 68.993  0.462   1.00 113.78 ? 983  ILE A CA    1 
ATOM   7692  C  C     . ILE A 1  983  ? 163.980 68.690  -0.973  1.00 118.20 ? 983  ILE A C     1 
ATOM   7693  O  O     . ILE A 1  983  ? 162.781 68.772  -1.257  1.00 116.55 ? 983  ILE A O     1 
ATOM   7694  C  CB    . ILE A 1  983  ? 164.910 70.449  0.729   1.00 117.47 ? 983  ILE A CB    1 
ATOM   7695  C  CG1   . ILE A 1  983  ? 164.428 70.909  2.111   1.00 117.64 ? 983  ILE A CG1   1 
ATOM   7696  C  CG2   . ILE A 1  983  ? 164.388 71.400  -0.330  1.00 118.03 ? 983  ILE A CG2   1 
ATOM   7697  C  CD1   . ILE A 1  983  ? 165.076 70.279  3.263   1.00 124.16 ? 983  ILE A CD1   1 
ATOM   7698  N  N     . LYS A 1  984  ? 164.920 68.230  -1.829  1.00 116.22 ? 984  LYS A N     1 
ATOM   7699  C  CA    . LYS A 1  984  ? 164.666 67.800  -3.203  1.00 115.69 ? 984  LYS A CA    1 
ATOM   7700  C  C     . LYS A 1  984  ? 163.780 66.533  -3.161  1.00 118.60 ? 984  LYS A C     1 
ATOM   7701  O  O     . LYS A 1  984  ? 162.746 66.492  -3.840  1.00 116.94 ? 984  LYS A O     1 
ATOM   7702  C  CB    . LYS A 1  984  ? 165.992 67.551  -3.961  1.00 118.87 ? 984  LYS A CB    1 
ATOM   7703  C  CG    . LYS A 1  984  ? 166.958 68.756  -3.988  1.00 124.90 ? 984  LYS A CG    1 
ATOM   7704  C  CD    . LYS A 1  984  ? 168.003 68.710  -5.124  1.00 127.47 ? 984  LYS A CD    1 
ATOM   7705  C  CE    . LYS A 1  984  ? 167.484 69.223  -6.456  1.00 126.65 ? 984  LYS A CE    1 
ATOM   7706  N  NZ    . LYS A 1  984  ? 168.521 69.146  -7.519  1.00 131.14 ? 984  LYS A NZ    1 
ATOM   7707  N  N     . ASP A 1  985  ? 164.147 65.547  -2.285  1.00 114.72 ? 985  ASP A N     1 
ATOM   7708  C  CA    . ASP A 1  985  ? 163.395 64.305  -2.048  1.00 112.86 ? 985  ASP A CA    1 
ATOM   7709  C  C     . ASP A 1  985  ? 161.910 64.599  -1.737  1.00 114.18 ? 985  ASP A C     1 
ATOM   7710  O  O     . ASP A 1  985  ? 161.055 63.908  -2.285  1.00 113.57 ? 985  ASP A O     1 
ATOM   7711  C  CB    . ASP A 1  985  ? 164.006 63.459  -0.894  1.00 115.20 ? 985  ASP A CB    1 
ATOM   7712  C  CG    . ASP A 1  985  ? 165.235 62.590  -1.181  1.00 124.62 ? 985  ASP A CG    1 
ATOM   7713  O  OD1   . ASP A 1  985  ? 165.666 62.531  -2.358  1.00 125.91 ? 985  ASP A OD1   1 
ATOM   7714  O  OD2   . ASP A 1  985  ? 165.788 61.992  -0.212  1.00 126.80 ? 985  ASP A OD2   1 
ATOM   7715  N  N     . ILE A 1  986  ? 161.598 65.611  -0.875  1.00 108.95 ? 986  ILE A N     1 
ATOM   7716  C  CA    . ILE A 1  986  ? 160.199 65.948  -0.545  1.00 106.75 ? 986  ILE A CA    1 
ATOM   7717  C  C     . ILE A 1  986  ? 159.545 66.757  -1.665  1.00 110.12 ? 986  ILE A C     1 
ATOM   7718  O  O     . ILE A 1  986  ? 158.563 66.297  -2.259  1.00 108.45 ? 986  ILE A O     1 
ATOM   7719  C  CB    . ILE A 1  986  ? 159.972 66.596  0.862   1.00 109.34 ? 986  ILE A CB    1 
ATOM   7720  C  CG1   . ILE A 1  986  ? 160.492 65.694  1.987   1.00 110.02 ? 986  ILE A CG1   1 
ATOM   7721  C  CG2   . ILE A 1  986  ? 158.485 66.920  1.083   1.00 107.59 ? 986  ILE A CG2   1 
ATOM   7722  C  CD1   . ILE A 1  986  ? 160.470 66.311  3.382   1.00 118.59 ? 986  ILE A CD1   1 
ATOM   7723  N  N     . VAL A 1  987  ? 160.087 67.970  -1.934  1.00 107.27 ? 987  VAL A N     1 
ATOM   7724  C  CA    . VAL A 1  987  ? 159.567 68.932  -2.920  1.00 106.20 ? 987  VAL A CA    1 
ATOM   7725  C  C     . VAL A 1  987  ? 159.296 68.304  -4.299  1.00 108.85 ? 987  VAL A C     1 
ATOM   7726  O  O     . VAL A 1  987  ? 158.165 68.380  -4.811  1.00 106.63 ? 987  VAL A O     1 
ATOM   7727  C  CB    . VAL A 1  987  ? 160.365 70.278  -2.923  1.00 110.04 ? 987  VAL A CB    1 
ATOM   7728  C  CG1   . VAL A 1  987  ? 160.224 71.050  -4.234  1.00 109.67 ? 987  VAL A CG1   1 
ATOM   7729  C  CG2   . VAL A 1  987  ? 159.952 71.149  -1.743  1.00 109.89 ? 987  VAL A CG2   1 
ATOM   7730  N  N     . LEU A 1  988  ? 160.306 67.613  -4.836  1.00 105.81 ? 988  LEU A N     1 
ATOM   7731  C  CA    . LEU A 1  988  ? 160.167 66.967  -6.123  1.00 105.25 ? 988  LEU A CA    1 
ATOM   7732  C  C     . LEU A 1  988  ? 159.317 65.729  -6.059  1.00 109.87 ? 988  LEU A C     1 
ATOM   7733  O  O     . LEU A 1  988  ? 158.567 65.486  -7.004  1.00 110.10 ? 988  LEU A O     1 
ATOM   7734  C  CB    . LEU A 1  988  ? 161.516 66.695  -6.755  1.00 106.06 ? 988  LEU A CB    1 
ATOM   7735  C  CG    . LEU A 1  988  ? 162.142 67.941  -7.322  1.00 112.10 ? 988  LEU A CG    1 
ATOM   7736  C  CD1   . LEU A 1  988  ? 163.502 68.198  -6.713  1.00 113.44 ? 988  LEU A CD1   1 
ATOM   7737  C  CD2   . LEU A 1  988  ? 162.151 67.899  -8.838  1.00 115.44 ? 988  LEU A CD2   1 
ATOM   7738  N  N     . GLY A 1  989  ? 159.390 64.999  -4.938  1.00 105.64 ? 989  GLY A N     1 
ATOM   7739  C  CA    . GLY A 1  989  ? 158.627 63.775  -4.692  1.00 103.72 ? 989  GLY A CA    1 
ATOM   7740  C  C     . GLY A 1  989  ? 157.134 63.974  -4.832  1.00 105.15 ? 989  GLY A C     1 
ATOM   7741  O  O     . GLY A 1  989  ? 156.468 63.221  -5.551  1.00 103.12 ? 989  GLY A O     1 
ATOM   7742  N  N     . VAL A 1  990  ? 156.622 65.034  -4.181  1.00 102.24 ? 990  VAL A N     1 
ATOM   7743  C  CA    . VAL A 1  990  ? 155.214 65.434  -4.212  1.00 101.82 ? 990  VAL A CA    1 
ATOM   7744  C  C     . VAL A 1  990  ? 154.850 65.887  -5.639  1.00 105.05 ? 990  VAL A C     1 
ATOM   7745  O  O     . VAL A 1  990  ? 153.813 65.483  -6.169  1.00 103.36 ? 990  VAL A O     1 
ATOM   7746  C  CB    . VAL A 1  990  ? 154.881 66.530  -3.151  1.00 106.95 ? 990  VAL A CB    1 
ATOM   7747  C  CG1   . VAL A 1  990  ? 153.376 66.784  -3.082  1.00 106.21 ? 990  VAL A CG1   1 
ATOM   7748  C  CG2   . VAL A 1  990  ? 155.409 66.157  -1.768  1.00 107.30 ? 990  VAL A CG2   1 
ATOM   7749  N  N     . LYS A 1  991  ? 155.731 66.703  -6.253  1.00 102.66 ? 991  LYS A N     1 
ATOM   7750  C  CA    . LYS A 1  991  ? 155.595 67.238  -7.603  1.00 102.58 ? 991  LYS A CA    1 
ATOM   7751  C  C     . LYS A 1  991  ? 155.453 66.135  -8.654  1.00 108.21 ? 991  LYS A C     1 
ATOM   7752  O  O     . LYS A 1  991  ? 154.701 66.317  -9.608  1.00 107.74 ? 991  LYS A O     1 
ATOM   7753  C  CB    . LYS A 1  991  ? 156.764 68.183  -7.929  1.00 105.69 ? 991  LYS A CB    1 
ATOM   7754  C  CG    . LYS A 1  991  ? 156.311 69.580  -8.356  1.00 116.29 ? 991  LYS A CG    1 
ATOM   7755  C  CD    . LYS A 1  991  ? 157.302 70.676  -7.976  1.00 127.48 ? 991  LYS A CD    1 
ATOM   7756  C  CE    . LYS A 1  991  ? 157.882 71.408  -9.172  1.00 142.74 ? 991  LYS A CE    1 
ATOM   7757  N  NZ    . LYS A 1  991  ? 158.872 72.459  -8.780  1.00 153.06 ? 991  LYS A NZ    1 
ATOM   7758  N  N     . ASP A 1  992  ? 156.126 64.975  -8.451  1.00 106.62 ? 992  ASP A N     1 
ATOM   7759  C  CA    . ASP A 1  992  ? 156.081 63.810  -9.352  1.00 106.43 ? 992  ASP A CA    1 
ATOM   7760  C  C     . ASP A 1  992  ? 154.818 63.006  -9.202  1.00 105.80 ? 992  ASP A C     1 
ATOM   7761  O  O     . ASP A 1  992  ? 154.188 62.719  -10.216 1.00 104.48 ? 992  ASP A O     1 
ATOM   7762  C  CB    . ASP A 1  992  ? 157.311 62.911  -9.182  1.00 110.53 ? 992  ASP A CB    1 
ATOM   7763  C  CG    . ASP A 1  992  ? 158.618 63.544  -9.648  1.00 141.44 ? 992  ASP A CG    1 
ATOM   7764  O  OD1   . ASP A 1  992  ? 158.646 64.795  -9.860  1.00 145.10 ? 992  ASP A OD1   1 
ATOM   7765  O  OD2   . ASP A 1  992  ? 159.623 62.802  -9.779  1.00 155.97 ? 992  ASP A OD2   1 
ATOM   7766  N  N     . LEU A 1  993  ? 154.435 62.652  -7.945  1.00 100.04 ? 993  LEU A N     1 
ATOM   7767  C  CA    . LEU A 1  993  ? 153.203 61.907  -7.633  1.00 97.69  ? 993  LEU A CA    1 
ATOM   7768  C  C     . LEU A 1  993  ? 151.997 62.566  -8.301  1.00 100.60 ? 993  LEU A C     1 
ATOM   7769  O  O     . LEU A 1  993  ? 151.126 61.869  -8.824  1.00 100.54 ? 993  LEU A O     1 
ATOM   7770  C  CB    . LEU A 1  993  ? 152.984 61.791  -6.102  1.00 97.10  ? 993  LEU A CB    1 
ATOM   7771  C  CG    . LEU A 1  993  ? 151.562 61.454  -5.565  1.00 99.52  ? 993  LEU A CG    1 
ATOM   7772  C  CD1   . LEU A 1  993  ? 151.140 60.060  -5.931  1.00 98.45  ? 993  LEU A CD1   1 
ATOM   7773  C  CD2   . LEU A 1  993  ? 151.507 61.562  -4.068  1.00 101.16 ? 993  LEU A CD2   1 
ATOM   7774  N  N     . GLN A 1  994  ? 151.980 63.903  -8.313  1.00 95.52  ? 994  GLN A N     1 
ATOM   7775  C  CA    . GLN A 1  994  ? 150.928 64.706  -8.905  1.00 94.41  ? 994  GLN A CA    1 
ATOM   7776  C  C     . GLN A 1  994  ? 150.687 64.412  -10.389 1.00 98.46  ? 994  GLN A C     1 
ATOM   7777  O  O     . GLN A 1  994  ? 149.530 64.392  -10.836 1.00 96.60  ? 994  GLN A O     1 
ATOM   7778  C  CB    . GLN A 1  994  ? 151.218 66.179  -8.658  1.00 96.31  ? 994  GLN A CB    1 
ATOM   7779  C  CG    . GLN A 1  994  ? 150.852 66.575  -7.249  1.00 106.17 ? 994  GLN A CG    1 
ATOM   7780  C  CD    . GLN A 1  994  ? 150.805 68.055  -7.073  1.00 131.87 ? 994  GLN A CD    1 
ATOM   7781  O  OE1   . GLN A 1  994  ? 151.505 68.603  -6.223  1.00 133.84 ? 994  GLN A OE1   1 
ATOM   7782  N  NE2   . GLN A 1  994  ? 149.969 68.734  -7.855  1.00 121.45 ? 994  GLN A NE2   1 
ATOM   7783  N  N     . GLU A 1  995  ? 151.775 64.152  -11.138 1.00 96.97  ? 995  GLU A N     1 
ATOM   7784  C  CA    . GLU A 1  995  ? 151.738 63.818  -12.565 1.00 97.49  ? 995  GLU A CA    1 
ATOM   7785  C  C     . GLU A 1  995  ? 151.194 62.397  -12.804 1.00 99.57  ? 995  GLU A C     1 
ATOM   7786  O  O     . GLU A 1  995  ? 150.885 62.042  -13.945 1.00 98.46  ? 995  GLU A O     1 
ATOM   7787  C  CB    . GLU A 1  995  ? 153.147 63.948  -13.168 1.00 100.46 ? 995  GLU A CB    1 
ATOM   7788  C  CG    . GLU A 1  995  ? 153.466 65.341  -13.674 1.00 119.82 ? 995  GLU A CG    1 
ATOM   7789  C  CD    . GLU A 1  995  ? 152.968 65.645  -15.075 1.00 163.58 ? 995  GLU A CD    1 
ATOM   7790  O  OE1   . GLU A 1  995  ? 153.490 65.040  -16.042 1.00 167.25 ? 995  GLU A OE1   1 
ATOM   7791  O  OE2   . GLU A 1  995  ? 152.085 66.525  -15.209 1.00 168.54 ? 995  GLU A OE2   1 
ATOM   7792  N  N     . ASN A 1  996  ? 151.083 61.597  -11.723 1.00 95.23  ? 996  ASN A N     1 
ATOM   7793  C  CA    . ASN A 1  996  ? 150.623 60.213  -11.755 1.00 93.84  ? 996  ASN A CA    1 
ATOM   7794  C  C     . ASN A 1  996  ? 149.184 59.923  -11.297 1.00 93.88  ? 996  ASN A C     1 
ATOM   7795  O  O     . ASN A 1  996  ? 148.747 58.777  -11.434 1.00 93.49  ? 996  ASN A O     1 
ATOM   7796  C  CB    . ASN A 1  996  ? 151.632 59.307  -11.068 1.00 97.11  ? 996  ASN A CB    1 
ATOM   7797  C  CG    . ASN A 1  996  ? 152.758 58.957  -11.990 1.00 136.65 ? 996  ASN A CG    1 
ATOM   7798  O  OD1   . ASN A 1  996  ? 152.645 58.045  -12.828 1.00 137.38 ? 996  ASN A OD1   1 
ATOM   7799  N  ND2   . ASN A 1  996  ? 153.837 59.725  -11.910 1.00 130.67 ? 996  ASN A ND2   1 
ATOM   7800  N  N     . LEU A 1  997  ? 148.450 60.932  -10.784 1.00 87.17  ? 997  LEU A N     1 
ATOM   7801  C  CA    . LEU A 1  997  ? 147.057 60.772  -10.342 1.00 85.24  ? 997  LEU A CA    1 
ATOM   7802  C  C     . LEU A 1  997  ? 146.124 60.920  -11.567 1.00 87.93  ? 997  LEU A C     1 
ATOM   7803  O  O     . LEU A 1  997  ? 145.484 61.954  -11.781 1.00 87.11  ? 997  LEU A O     1 
ATOM   7804  C  CB    . LEU A 1  997  ? 146.691 61.770  -9.217  1.00 85.42  ? 997  LEU A CB    1 
ATOM   7805  C  CG    . LEU A 1  997  ? 147.668 61.939  -8.052  1.00 90.77  ? 997  LEU A CG    1 
ATOM   7806  C  CD1   . LEU A 1  997  ? 147.441 63.241  -7.354  1.00 90.54  ? 997  LEU A CD1   1 
ATOM   7807  C  CD2   . LEU A 1  997  ? 147.551 60.809  -7.059  1.00 95.17  ? 997  LEU A CD2   1 
ATOM   7808  N  N     . LEU A 1  998  ? 146.055 59.865  -12.372 1.00 84.00  ? 998  LEU A N     1 
ATOM   7809  C  CA    . LEU A 1  998  ? 145.314 59.885  -13.618 1.00 83.07  ? 998  LEU A CA    1 
ATOM   7810  C  C     . LEU A 1  998  ? 143.878 59.495  -13.616 1.00 88.89  ? 998  LEU A C     1 
ATOM   7811  O  O     . LEU A 1  998  ? 143.536 58.356  -13.276 1.00 89.93  ? 998  LEU A O     1 
ATOM   7812  C  CB    . LEU A 1  998  ? 146.061 59.129  -14.690 1.00 82.51  ? 998  LEU A CB    1 
ATOM   7813  C  CG    . LEU A 1  998  ? 147.153 59.934  -15.271 1.00 87.76  ? 998  LEU A CG    1 
ATOM   7814  C  CD1   . LEU A 1  998  ? 148.511 59.405  -14.844 1.00 87.97  ? 998  LEU A CD1   1 
ATOM   7815  C  CD2   . LEU A 1  998  ? 146.971 60.068  -16.753 1.00 92.35  ? 998  LEU A CD2   1 
ATOM   7816  N  N     . VAL A 1  999  ? 143.044 60.423  -14.110 1.00 85.26  ? 999  VAL A N     1 
ATOM   7817  C  CA    . VAL A 1  999  ? 141.608 60.246  -14.311 1.00 84.49  ? 999  VAL A CA    1 
ATOM   7818  C  C     . VAL A 1  999  ? 141.320 60.114  -15.806 1.00 90.72  ? 999  VAL A C     1 
ATOM   7819  O  O     . VAL A 1  999  ? 140.711 59.138  -16.202 1.00 89.94  ? 999  VAL A O     1 
ATOM   7820  C  CB    . VAL A 1  999  ? 140.763 61.336  -13.642 1.00 87.93  ? 999  VAL A CB    1 
ATOM   7821  C  CG1   . VAL A 1  999  ? 139.299 60.923  -13.610 1.00 86.80  ? 999  VAL A CG1   1 
ATOM   7822  C  CG2   . VAL A 1  999  ? 141.265 61.612  -12.235 1.00 88.24  ? 999  VAL A CG2   1 
ATOM   7823  N  N     . LEU A 1  1000 ? 141.795 61.059  -16.631 1.00 90.65  ? 1000 LEU A N     1 
ATOM   7824  C  CA    . LEU A 1  1000 ? 141.666 61.049  -18.096 1.00 91.99  ? 1000 LEU A CA    1 
ATOM   7825  C  C     . LEU A 1  1000 ? 143.036 60.728  -18.744 1.00 100.33 ? 1000 LEU A C     1 
ATOM   7826  O  O     . LEU A 1  1000 ? 144.072 61.122  -18.205 1.00 100.73 ? 1000 LEU A O     1 
ATOM   7827  C  CB    . LEU A 1  1000 ? 141.104 62.375  -18.597 1.00 92.28  ? 1000 LEU A CB    1 
ATOM   7828  C  CG    . LEU A 1  1000 ? 139.706 62.669  -18.112 1.00 96.31  ? 1000 LEU A CG    1 
ATOM   7829  C  CD1   . LEU A 1  1000 ? 139.713 63.825  -17.174 1.00 96.95  ? 1000 LEU A CD1   1 
ATOM   7830  C  CD2   . LEU A 1  1000 ? 138.775 62.911  -19.271 1.00 99.44  ? 1000 LEU A CD2   1 
ATOM   7831  N  N     . ARG A 1  1001 ? 143.051 59.991  -19.871 1.00 99.20  ? 1001 ARG A N     1 
ATOM   7832  C  CA    . ARG A 1  1001 ? 144.325 59.536  -20.433 1.00 100.12 ? 1001 ARG A CA    1 
ATOM   7833  C  C     . ARG A 1  1001 ? 144.831 60.101  -21.759 1.00 106.18 ? 1001 ARG A C     1 
ATOM   7834  O  O     . ARG A 1  1001 ? 146.046 60.030  -22.006 1.00 106.64 ? 1001 ARG A O     1 
ATOM   7835  C  CB    . ARG A 1  1001 ? 144.432 57.998  -20.366 1.00 98.60  ? 1001 ARG A CB    1 
ATOM   7836  C  CG    . ARG A 1  1001 ? 144.978 57.476  -19.045 1.00 99.33  ? 1001 ARG A CG    1 
ATOM   7837  C  CD    . ARG A 1  1001 ? 144.526 56.063  -18.770 1.00 103.18 ? 1001 ARG A CD    1 
ATOM   7838  N  NE    . ARG A 1  1001 ? 143.805 55.983  -17.499 1.00 110.31 ? 1001 ARG A NE    1 
ATOM   7839  C  CZ    . ARG A 1  1001 ? 144.370 55.708  -16.325 1.00 114.54 ? 1001 ARG A CZ    1 
ATOM   7840  N  NH1   . ARG A 1  1001 ? 145.681 55.457  -16.249 1.00 86.37  ? 1001 ARG A NH1   1 
ATOM   7841  N  NH2   . ARG A 1  1001 ? 143.631 55.681  -15.216 1.00 92.63  ? 1001 ARG A NH2   1 
ATOM   7842  N  N     . GLY A 1  1002 ? 143.929 60.658  -22.572 1.00 103.37 ? 1002 GLY A N     1 
ATOM   7843  C  CA    . GLY A 1  1002 ? 144.245 61.239  -23.882 1.00 104.58 ? 1002 GLY A CA    1 
ATOM   7844  C  C     . GLY A 1  1002 ? 145.477 62.132  -24.076 1.00 110.15 ? 1002 GLY A C     1 
ATOM   7845  O  O     . GLY A 1  1002 ? 145.791 62.994  -23.246 1.00 108.86 ? 1002 GLY A O     1 
ATOM   7846  N  N     . LYS A 1  1003 ? 146.153 61.946  -25.239 1.00 109.29 ? 1003 LYS A N     1 
ATOM   7847  C  CA    . LYS A 1  1003 ? 147.343 62.678  -25.716 1.00 111.05 ? 1003 LYS A CA    1 
ATOM   7848  C  C     . LYS A 1  1003 ? 146.953 63.948  -26.539 1.00 115.04 ? 1003 LYS A C     1 
ATOM   7849  O  O     . LYS A 1  1003 ? 147.105 63.974  -27.771 1.00 114.91 ? 1003 LYS A O     1 
ATOM   7850  C  CB    . LYS A 1  1003 ? 148.238 61.745  -26.569 1.00 114.56 ? 1003 LYS A CB    1 
ATOM   7851  C  CG    . LYS A 1  1003 ? 149.287 60.952  -25.798 1.00 131.82 ? 1003 LYS A CG    1 
ATOM   7852  C  CD    . LYS A 1  1003 ? 149.950 59.895  -26.700 1.00 138.99 ? 1003 LYS A CD    1 
ATOM   7853  C  CE    . LYS A 1  1003 ? 151.089 59.169  -26.020 1.00 143.35 ? 1003 LYS A CE    1 
ATOM   7854  N  NZ    . LYS A 1  1003 ? 151.771 58.217  -26.937 1.00 149.40 ? 1003 LYS A NZ    1 
ATOM   7855  N  N     . ASN A 1  1004 ? 146.438 64.982  -25.844 1.00 110.61 ? 1004 ASN A N     1 
ATOM   7856  C  CA    . ASN A 1  1004 ? 146.018 66.262  -26.417 1.00 110.45 ? 1004 ASN A CA    1 
ATOM   7857  C  C     . ASN A 1  1004 ? 145.683 67.261  -25.331 1.00 114.21 ? 1004 ASN A C     1 
ATOM   7858  O  O     . ASN A 1  1004 ? 145.211 66.868  -24.266 1.00 113.85 ? 1004 ASN A O     1 
ATOM   7859  C  CB    . ASN A 1  1004 ? 144.837 66.109  -27.385 1.00 108.83 ? 1004 ASN A CB    1 
ATOM   7860  C  CG    . ASN A 1  1004 ? 143.528 65.755  -26.751 1.00 122.69 ? 1004 ASN A CG    1 
ATOM   7861  O  OD1   . ASN A 1  1004 ? 142.830 66.603  -26.193 1.00 114.75 ? 1004 ASN A OD1   1 
ATOM   7862  N  ND2   . ASN A 1  1004 ? 143.118 64.519  -26.925 1.00 115.05 ? 1004 ASN A ND2   1 
ATOM   7863  N  N     . GLU A 1  1005 ? 145.858 68.553  -25.631 1.00 110.43 ? 1005 GLU A N     1 
ATOM   7864  C  CA    . GLU A 1  1005 ? 145.604 69.645  -24.704 1.00 109.86 ? 1005 GLU A CA    1 
ATOM   7865  C  C     . GLU A 1  1005 ? 144.218 69.614  -24.062 1.00 107.59 ? 1005 GLU A C     1 
ATOM   7866  O  O     . GLU A 1  1005 ? 144.141 69.684  -22.836 1.00 106.03 ? 1005 GLU A O     1 
ATOM   7867  C  CB    . GLU A 1  1005 ? 145.928 70.998  -25.361 1.00 113.25 ? 1005 GLU A CB    1 
ATOM   7868  C  CG    . GLU A 1  1005 ? 146.274 72.126  -24.387 1.00 134.70 ? 1005 GLU A CG    1 
ATOM   7869  C  CD    . GLU A 1  1005 ? 147.484 72.013  -23.462 1.00 172.31 ? 1005 GLU A CD    1 
ATOM   7870  O  OE1   . GLU A 1  1005 ? 148.108 70.926  -23.381 1.00 170.83 ? 1005 GLU A OE1   1 
ATOM   7871  O  OE2   . GLU A 1  1005 ? 147.787 73.028  -22.790 1.00 169.01 ? 1005 GLU A OE2   1 
ATOM   7872  N  N     . ILE A 1  1006 ? 143.146 69.441  -24.874 1.00 101.12 ? 1006 ILE A N     1 
ATOM   7873  C  CA    . ILE A 1  1006 ? 141.745 69.383  -24.420 1.00 99.09  ? 1006 ILE A CA    1 
ATOM   7874  C  C     . ILE A 1  1006 ? 141.565 68.380  -23.287 1.00 100.86 ? 1006 ILE A C     1 
ATOM   7875  O  O     . ILE A 1  1006 ? 141.025 68.723  -22.221 1.00 100.60 ? 1006 ILE A O     1 
ATOM   7876  C  CB    . ILE A 1  1006 ? 140.732 69.132  -25.586 1.00 101.65 ? 1006 ILE A CB    1 
ATOM   7877  C  CG1   . ILE A 1  1006 ? 140.612 70.368  -26.481 1.00 103.58 ? 1006 ILE A CG1   1 
ATOM   7878  C  CG2   . ILE A 1  1006 ? 139.350 68.708  -25.070 1.00 100.87 ? 1006 ILE A CG2   1 
ATOM   7879  C  CD1   . ILE A 1  1006 ? 139.390 70.418  -27.367 1.00 112.61 ? 1006 ILE A CD1   1 
ATOM   7880  N  N     . ILE A 1  1007 ? 142.010 67.138  -23.531 1.00 95.21  ? 1007 ILE A N     1 
ATOM   7881  C  CA    . ILE A 1  1007 ? 141.877 66.043  -22.576 1.00 92.86  ? 1007 ILE A CA    1 
ATOM   7882  C  C     . ILE A 1  1007 ? 142.830 66.254  -21.422 1.00 98.72  ? 1007 ILE A C     1 
ATOM   7883  O  O     . ILE A 1  1007 ? 142.455 66.031  -20.269 1.00 98.53  ? 1007 ILE A O     1 
ATOM   7884  C  CB    . ILE A 1  1007 ? 141.994 64.650  -23.262 1.00 93.92  ? 1007 ILE A CB    1 
ATOM   7885  C  CG1   . ILE A 1  1007 ? 140.933 64.446  -24.377 1.00 92.41  ? 1007 ILE A CG1   1 
ATOM   7886  C  CG2   . ILE A 1  1007 ? 141.956 63.510  -22.259 1.00 94.48  ? 1007 ILE A CG2   1 
ATOM   7887  C  CD1   . ILE A 1  1007 ? 139.444 64.745  -24.016 1.00 91.37  ? 1007 ILE A CD1   1 
ATOM   7888  N  N     . GLN A 1  1008 ? 144.036 66.745  -21.717 1.00 96.60  ? 1008 GLN A N     1 
ATOM   7889  C  CA    . GLN A 1  1008 ? 145.009 66.976  -20.668 1.00 97.17  ? 1008 GLN A CA    1 
ATOM   7890  C  C     . GLN A 1  1008 ? 144.561 68.027  -19.677 1.00 100.74 ? 1008 GLN A C     1 
ATOM   7891  O  O     . GLN A 1  1008 ? 144.645 67.779  -18.472 1.00 100.15 ? 1008 GLN A O     1 
ATOM   7892  C  CB    . GLN A 1  1008 ? 146.414 67.183  -21.225 1.00 99.68  ? 1008 GLN A CB    1 
ATOM   7893  C  CG    . GLN A 1  1008 ? 147.106 65.846  -21.531 1.00 110.93 ? 1008 GLN A CG    1 
ATOM   7894  C  CD    . GLN A 1  1008 ? 147.564 65.157  -20.269 1.00 133.18 ? 1008 GLN A CD    1 
ATOM   7895  O  OE1   . GLN A 1  1008 ? 148.138 65.787  -19.368 1.00 130.66 ? 1008 GLN A OE1   1 
ATOM   7896  N  NE2   . GLN A 1  1008 ? 147.315 63.852  -20.166 1.00 127.32 ? 1008 GLN A NE2   1 
ATOM   7897  N  N     . ASN A 1  1009 ? 143.959 69.125  -20.168 1.00 97.22  ? 1009 ASN A N     1 
ATOM   7898  C  CA    . ASN A 1  1009 ? 143.410 70.153  -19.283 1.00 97.19  ? 1009 ASN A CA    1 
ATOM   7899  C  C     . ASN A 1  1009 ? 142.291 69.605  -18.441 1.00 98.99  ? 1009 ASN A C     1 
ATOM   7900  O  O     . ASN A 1  1009 ? 142.307 69.833  -17.235 1.00 98.78  ? 1009 ASN A O     1 
ATOM   7901  C  CB    . ASN A 1  1009 ? 142.983 71.401  -20.027 1.00 99.13  ? 1009 ASN A CB    1 
ATOM   7902  C  CG    . ASN A 1  1009 ? 144.163 72.225  -20.443 1.00 124.35 ? 1009 ASN A CG    1 
ATOM   7903  O  OD1   . ASN A 1  1009 ? 144.406 72.419  -21.636 1.00 116.26 ? 1009 ASN A OD1   1 
ATOM   7904  N  ND2   . ASN A 1  1009 ? 144.951 72.687  -19.468 1.00 118.82 ? 1009 ASN A ND2   1 
ATOM   7905  N  N     . ALA A 1  1010 ? 141.389 68.794  -19.038 1.00 93.78  ? 1010 ALA A N     1 
ATOM   7906  C  CA    . ALA A 1  1010 ? 140.310 68.134  -18.295 1.00 92.80  ? 1010 ALA A CA    1 
ATOM   7907  C  C     . ALA A 1  1010 ? 140.888 67.381  -17.094 1.00 94.32  ? 1010 ALA A C     1 
ATOM   7908  O  O     . ALA A 1  1010 ? 140.394 67.550  -15.972 1.00 92.70  ? 1010 ALA A O     1 
ATOM   7909  C  CB    . ALA A 1  1010 ? 139.551 67.172  -19.198 1.00 93.25  ? 1010 ALA A CB    1 
ATOM   7910  N  N     . GLN A 1  1011 ? 141.986 66.615  -17.334 1.00 90.38  ? 1011 GLN A N     1 
ATOM   7911  C  CA    . GLN A 1  1011 ? 142.721 65.878  -16.319 1.00 89.38  ? 1011 GLN A CA    1 
ATOM   7912  C  C     . GLN A 1  1011 ? 143.211 66.857  -15.252 1.00 97.05  ? 1011 GLN A C     1 
ATOM   7913  O  O     . GLN A 1  1011 ? 142.793 66.726  -14.100 1.00 97.81  ? 1011 GLN A O     1 
ATOM   7914  C  CB    . GLN A 1  1011 ? 143.860 65.059  -16.947 1.00 89.49  ? 1011 GLN A CB    1 
ATOM   7915  C  CG    . GLN A 1  1011 ? 144.983 64.658  -15.992 1.00 87.46  ? 1011 GLN A CG    1 
ATOM   7916  C  CD    . GLN A 1  1011 ? 144.574 63.788  -14.823 1.00 100.32 ? 1011 GLN A CD    1 
ATOM   7917  O  OE1   . GLN A 1  1011 ? 144.014 62.710  -14.981 1.00 95.12  ? 1011 GLN A OE1   1 
ATOM   7918  N  NE2   . GLN A 1  1011 ? 144.918 64.205  -13.616 1.00 92.56  ? 1011 GLN A NE2   1 
ATOM   7919  N  N     . ARG A 1  1012 ? 144.007 67.879  -15.636 1.00 94.75  ? 1012 ARG A N     1 
ATOM   7920  C  CA    . ARG A 1  1012 ? 144.524 68.882  -14.701 1.00 96.01  ? 1012 ARG A CA    1 
ATOM   7921  C  C     . ARG A 1  1012 ? 143.436 69.423  -13.796 1.00 100.22 ? 1012 ARG A C     1 
ATOM   7922  O  O     . ARG A 1  1012 ? 143.620 69.458  -12.580 1.00 99.32  ? 1012 ARG A O     1 
ATOM   7923  C  CB    . ARG A 1  1012 ? 145.191 70.044  -15.451 1.00 100.99 ? 1012 ARG A CB    1 
ATOM   7924  C  CG    . ARG A 1  1012 ? 146.626 69.773  -15.902 1.00 122.47 ? 1012 ARG A CG    1 
ATOM   7925  C  CD    . ARG A 1  1012 ? 147.111 70.799  -16.917 1.00 139.99 ? 1012 ARG A CD    1 
ATOM   7926  N  NE    . ARG A 1  1012 ? 147.309 70.196  -18.235 1.00 153.22 ? 1012 ARG A NE    1 
ATOM   7927  C  CZ    . ARG A 1  1012 ? 147.745 70.854  -19.303 1.00 173.78 ? 1012 ARG A CZ    1 
ATOM   7928  N  NH1   . ARG A 1  1012 ? 148.038 72.147  -19.221 1.00 168.16 ? 1012 ARG A NH1   1 
ATOM   7929  N  NH2   . ARG A 1  1012 ? 147.895 70.225  -20.461 1.00 159.60 ? 1012 ARG A NH2   1 
ATOM   7930  N  N     . ASP A 1  1013 ? 142.287 69.797  -14.398 1.00 98.54  ? 1013 ASP A N     1 
ATOM   7931  C  CA    . ASP A 1  1013 ? 141.122 70.389  -13.740 1.00 99.42  ? 1013 ASP A CA    1 
ATOM   7932  C  C     . ASP A 1  1013 ? 140.481 69.446  -12.742 1.00 101.10 ? 1013 ASP A C     1 
ATOM   7933  O  O     . ASP A 1  1013 ? 140.354 69.802  -11.575 1.00 100.28 ? 1013 ASP A O     1 
ATOM   7934  C  CB    . ASP A 1  1013 ? 140.096 70.905  -14.778 1.00 102.95 ? 1013 ASP A CB    1 
ATOM   7935  C  CG    . ASP A 1  1013 ? 140.585 72.043  -15.679 1.00 130.70 ? 1013 ASP A CG    1 
ATOM   7936  O  OD1   . ASP A 1  1013 ? 141.204 73.013  -15.146 1.00 135.38 ? 1013 ASP A OD1   1 
ATOM   7937  O  OD2   . ASP A 1  1013 ? 140.301 71.998  -16.913 1.00 139.54 ? 1013 ASP A OD2   1 
ATOM   7938  N  N     . ALA A 1  1014 ? 140.123 68.234  -13.185 1.00 96.57  ? 1014 ALA A N     1 
ATOM   7939  C  CA    . ALA A 1  1014 ? 139.524 67.186  -12.354 1.00 95.32  ? 1014 ALA A CA    1 
ATOM   7940  C  C     . ALA A 1  1014 ? 140.371 66.836  -11.098 1.00 96.08  ? 1014 ALA A C     1 
ATOM   7941  O  O     . ALA A 1  1014 ? 139.835 66.480  -10.041 1.00 94.93  ? 1014 ALA A O     1 
ATOM   7942  C  CB    . ALA A 1  1014 ? 139.329 65.937  -13.196 1.00 95.69  ? 1014 ALA A CB    1 
ATOM   7943  N  N     . VAL A 1  1015 ? 141.690 66.947  -11.231 1.00 90.77  ? 1015 VAL A N     1 
ATOM   7944  C  CA    . VAL A 1  1015 ? 142.645 66.618  -10.185 1.00 89.15  ? 1015 VAL A CA    1 
ATOM   7945  C  C     . VAL A 1  1015 ? 142.999 67.795  -9.215  1.00 92.29  ? 1015 VAL A C     1 
ATOM   7946  O  O     . VAL A 1  1015 ? 143.482 67.553  -8.110  1.00 90.85  ? 1015 VAL A O     1 
ATOM   7947  C  CB    . VAL A 1  1015 ? 143.821 65.849  -10.839 1.00 91.59  ? 1015 VAL A CB    1 
ATOM   7948  C  CG1   . VAL A 1  1015 ? 145.109 66.638  -10.874 1.00 92.57  ? 1015 VAL A CG1   1 
ATOM   7949  C  CG2   . VAL A 1  1015 ? 144.017 64.494  -10.208 1.00 90.62  ? 1015 VAL A CG2   1 
ATOM   7950  N  N     . THR A 1  1016 ? 142.663 69.042  -9.609  1.00 89.55  ? 1016 THR A N     1 
ATOM   7951  C  CA    . THR A 1  1016 ? 142.904 70.292  -8.870  1.00 90.75  ? 1016 THR A CA    1 
ATOM   7952  C  C     . THR A 1  1016 ? 142.731 70.233  -7.344  1.00 95.26  ? 1016 THR A C     1 
ATOM   7953  O  O     . THR A 1  1016 ? 143.723 70.340  -6.627  1.00 95.86  ? 1016 THR A O     1 
ATOM   7954  C  CB    . THR A 1  1016 ? 142.116 71.465  -9.500  1.00 99.96  ? 1016 THR A CB    1 
ATOM   7955  O  OG1   . THR A 1  1016 ? 142.541 71.674  -10.847 1.00 101.98 ? 1016 THR A OG1   1 
ATOM   7956  C  CG2   . THR A 1  1016 ? 142.216 72.760  -8.696  1.00 96.96  ? 1016 THR A CG2   1 
ATOM   7957  N  N     . LEU A 1  1017 ? 141.479 70.115  -6.861  1.00 91.44  ? 1017 LEU A N     1 
ATOM   7958  C  CA    . LEU A 1  1017 ? 141.141 70.123  -5.446  1.00 91.29  ? 1017 LEU A CA    1 
ATOM   7959  C  C     . LEU A 1  1017 ? 141.903 69.077  -4.678  1.00 97.11  ? 1017 LEU A C     1 
ATOM   7960  O  O     . LEU A 1  1017 ? 142.438 69.394  -3.616  1.00 98.26  ? 1017 LEU A O     1 
ATOM   7961  C  CB    . LEU A 1  1017 ? 139.630 69.963  -5.238  1.00 90.22  ? 1017 LEU A CB    1 
ATOM   7962  C  CG    . LEU A 1  1017 ? 139.079 70.090  -3.821  1.00 93.72  ? 1017 LEU A CG    1 
ATOM   7963  C  CD1   . LEU A 1  1017 ? 139.444 71.435  -3.193  1.00 94.10  ? 1017 LEU A CD1   1 
ATOM   7964  C  CD2   . LEU A 1  1017 ? 137.579 69.861  -3.819  1.00 94.08  ? 1017 LEU A CD2   1 
ATOM   7965  N  N     . PHE A 1  1018 ? 142.008 67.847  -5.221  1.00 92.87  ? 1018 PHE A N     1 
ATOM   7966  C  CA    . PHE A 1  1018 ? 142.759 66.785  -4.539  1.00 92.10  ? 1018 PHE A CA    1 
ATOM   7967  C  C     . PHE A 1  1018 ? 144.215 67.183  -4.287  1.00 97.57  ? 1018 PHE A C     1 
ATOM   7968  O  O     . PHE A 1  1018 ? 144.762 66.929  -3.215  1.00 97.19  ? 1018 PHE A O     1 
ATOM   7969  C  CB    . PHE A 1  1018 ? 142.678 65.456  -5.308  1.00 92.21  ? 1018 PHE A CB    1 
ATOM   7970  C  CG    . PHE A 1  1018 ? 143.409 64.331  -4.619  1.00 92.30  ? 1018 PHE A CG    1 
ATOM   7971  C  CD1   . PHE A 1  1018 ? 142.913 63.775  -3.447  1.00 94.09  ? 1018 PHE A CD1   1 
ATOM   7972  C  CD2   . PHE A 1  1018 ? 144.611 63.854  -5.123  1.00 94.10  ? 1018 PHE A CD2   1 
ATOM   7973  C  CE1   . PHE A 1  1018 ? 143.599 62.756  -2.802  1.00 95.08  ? 1018 PHE A CE1   1 
ATOM   7974  C  CE2   . PHE A 1  1018 ? 145.292 62.828  -4.485  1.00 96.98  ? 1018 PHE A CE2   1 
ATOM   7975  C  CZ    . PHE A 1  1018 ? 144.782 62.283  -3.329  1.00 94.94  ? 1018 PHE A CZ    1 
ATOM   7976  N  N     . CYS A 1  1019 ? 144.815 67.842  -5.270  1.00 95.46  ? 1019 CYS A N     1 
ATOM   7977  C  CA    . CYS A 1  1019 ? 146.184 68.283  -5.180  1.00 96.76  ? 1019 CYS A CA    1 
ATOM   7978  C  C     . CYS A 1  1019 ? 146.376 69.388  -4.203  1.00 100.45 ? 1019 CYS A C     1 
ATOM   7979  O  O     . CYS A 1  1019 ? 147.440 69.450  -3.592  1.00 100.30 ? 1019 CYS A O     1 
ATOM   7980  C  CB    . CYS A 1  1019 ? 146.726 68.618  -6.555  1.00 98.11  ? 1019 CYS A CB    1 
ATOM   7981  S  SG    . CYS A 1  1019 ? 146.783 67.185  -7.656  1.00 101.63 ? 1019 CYS A SG    1 
ATOM   7982  N  N     . CYS A 1  1020 ? 145.322 70.193  -3.965  1.00 97.29  ? 1020 CYS A N     1 
ATOM   7983  C  CA    . CYS A 1  1020 ? 145.350 71.244  -2.945  1.00 98.59  ? 1020 CYS A CA    1 
ATOM   7984  C  C     . CYS A 1  1020 ? 145.488 70.571  -1.594  1.00 99.85  ? 1020 CYS A C     1 
ATOM   7985  O  O     . CYS A 1  1020 ? 146.242 71.061  -0.745  1.00 101.46 ? 1020 CYS A O     1 
ATOM   7986  C  CB    . CYS A 1  1020 ? 144.101 72.115  -2.991  1.00 99.72  ? 1020 CYS A CB    1 
ATOM   7987  S  SG    . CYS A 1  1020 ? 143.984 73.177  -4.446  1.00 104.74 ? 1020 CYS A SG    1 
ATOM   7988  N  N     . LEU A 1  1021 ? 144.765 69.441  -1.402  1.00 91.10  ? 1021 LEU A N     1 
ATOM   7989  C  CA    . LEU A 1  1021 ? 144.855 68.677  -0.175  1.00 89.28  ? 1021 LEU A CA    1 
ATOM   7990  C  C     . LEU A 1  1021 ? 146.254 68.064  -0.114  1.00 94.11  ? 1021 LEU A C     1 
ATOM   7991  O  O     . LEU A 1  1021 ? 146.991 68.332  0.838   1.00 95.18  ? 1021 LEU A O     1 
ATOM   7992  C  CB    . LEU A 1  1021 ? 143.754 67.603  -0.103  1.00 87.31  ? 1021 LEU A CB    1 
ATOM   7993  C  CG    . LEU A 1  1021 ? 143.887 66.527  0.988   1.00 89.99  ? 1021 LEU A CG    1 
ATOM   7994  C  CD1   . LEU A 1  1021 ? 143.492 67.055  2.359   1.00 89.81  ? 1021 LEU A CD1   1 
ATOM   7995  C  CD2   . LEU A 1  1021 ? 143.051 65.333  0.652   1.00 90.44  ? 1021 LEU A CD2   1 
ATOM   7996  N  N     . LEU A 1  1022 ? 146.638 67.320  -1.167  1.00 89.63  ? 1022 LEU A N     1 
ATOM   7997  C  CA    . LEU A 1  1022 ? 147.925 66.651  -1.287  1.00 90.11  ? 1022 LEU A CA    1 
ATOM   7998  C  C     . LEU A 1  1022 ? 149.123 67.552  -0.919  1.00 96.60  ? 1022 LEU A C     1 
ATOM   7999  O  O     . LEU A 1  1022 ? 149.903 67.180  -0.025  1.00 96.73  ? 1022 LEU A O     1 
ATOM   8000  C  CB    . LEU A 1  1022 ? 148.055 66.038  -2.692  1.00 89.66  ? 1022 LEU A CB    1 
ATOM   8001  C  CG    . LEU A 1  1022 ? 149.302 65.202  -3.034  1.00 95.00  ? 1022 LEU A CG    1 
ATOM   8002  C  CD1   . LEU A 1  1022 ? 149.620 64.167  -1.967  1.00 95.16  ? 1022 LEU A CD1   1 
ATOM   8003  C  CD2   . LEU A 1  1022 ? 149.109 64.494  -4.338  1.00 97.35  ? 1022 LEU A CD2   1 
ATOM   8004  N  N     . ARG A 1  1023 ? 149.226 68.751  -1.562  1.00 93.57  ? 1023 ARG A N     1 
ATOM   8005  C  CA    . ARG A 1  1023 ? 150.289 69.744  -1.314  1.00 94.37  ? 1023 ARG A CA    1 
ATOM   8006  C  C     . ARG A 1  1023 ? 150.240 70.297  0.104   1.00 98.84  ? 1023 ARG A C     1 
ATOM   8007  O  O     . ARG A 1  1023 ? 151.296 70.603  0.662   1.00 98.84  ? 1023 ARG A O     1 
ATOM   8008  C  CB    . ARG A 1  1023 ? 150.208 70.915  -2.303  1.00 94.55  ? 1023 ARG A CB    1 
ATOM   8009  C  CG    . ARG A 1  1023 ? 150.618 70.572  -3.722  1.00 100.85 ? 1023 ARG A CG    1 
ATOM   8010  C  CD    . ARG A 1  1023 ? 150.643 71.805  -4.605  1.00 101.14 ? 1023 ARG A CD    1 
ATOM   8011  N  NE    . ARG A 1  1023 ? 149.885 71.603  -5.838  1.00 100.73 ? 1023 ARG A NE    1 
ATOM   8012  C  CZ    . ARG A 1  1023 ? 148.614 71.953  -5.987  1.00 111.80 ? 1023 ARG A CZ    1 
ATOM   8013  N  NH1   . ARG A 1  1023 ? 147.962 72.539  -4.995  1.00 93.06  ? 1023 ARG A NH1   1 
ATOM   8014  N  NH2   . ARG A 1  1023 ? 147.983 71.721  -7.136  1.00 99.39  ? 1023 ARG A NH2   1 
ATOM   8015  N  N     . SER A 1  1024 ? 149.013 70.449  0.672   1.00 95.50  ? 1024 SER A N     1 
ATOM   8016  C  CA    . SER A 1  1024 ? 148.810 70.963  2.028   1.00 96.10  ? 1024 SER A CA    1 
ATOM   8017  C  C     . SER A 1  1024 ? 149.240 69.940  3.071   1.00 100.63 ? 1024 SER A C     1 
ATOM   8018  O  O     . SER A 1  1024 ? 149.985 70.290  3.986   1.00 102.27 ? 1024 SER A O     1 
ATOM   8019  C  CB    . SER A 1  1024 ? 147.370 71.434  2.247   1.00 98.62  ? 1024 SER A CB    1 
ATOM   8020  O  OG    . SER A 1  1024 ? 146.538 70.504  2.921   1.00 102.63 ? 1024 SER A OG    1 
ATOM   8021  N  N     . ARG A 1  1025 ? 148.811 68.674  2.918   1.00 95.04  ? 1025 ARG A N     1 
ATOM   8022  C  CA    . ARG A 1  1025 ? 149.176 67.624  3.870   1.00 94.01  ? 1025 ARG A CA    1 
ATOM   8023  C  C     . ARG A 1  1025 ? 150.619 67.141  3.670   1.00 98.77  ? 1025 ARG A C     1 
ATOM   8024  O  O     . ARG A 1  1025 ? 151.201 66.622  4.618   1.00 97.34  ? 1025 ARG A O     1 
ATOM   8025  C  CB    . ARG A 1  1025 ? 148.145 66.466  3.897   1.00 89.30  ? 1025 ARG A CB    1 
ATOM   8026  C  CG    . ARG A 1  1025 ? 146.701 66.890  4.240   1.00 86.44  ? 1025 ARG A CG    1 
ATOM   8027  C  CD    . ARG A 1  1025 ? 146.146 66.210  5.477   1.00 87.68  ? 1025 ARG A CD    1 
ATOM   8028  N  NE    . ARG A 1  1025 ? 144.717 66.495  5.675   1.00 106.63 ? 1025 ARG A NE    1 
ATOM   8029  C  CZ    . ARG A 1  1025 ? 143.758 65.567  5.809   1.00 139.09 ? 1025 ARG A CZ    1 
ATOM   8030  N  NH1   . ARG A 1  1025 ? 144.061 64.269  5.754   1.00 130.90 ? 1025 ARG A NH1   1 
ATOM   8031  N  NH2   . ARG A 1  1025 ? 142.494 65.929  6.000   1.00 130.21 ? 1025 ARG A NH2   1 
ATOM   8032  N  N     . LEU A 1  1026 ? 151.221 67.377  2.473   1.00 97.54  ? 1026 LEU A N     1 
ATOM   8033  C  CA    . LEU A 1  1026 ? 152.601 66.945  2.190   1.00 98.99  ? 1026 LEU A CA    1 
ATOM   8034  C  C     . LEU A 1  1026 ? 153.698 68.017  2.005   1.00 107.13 ? 1026 LEU A C     1 
ATOM   8035  O  O     . LEU A 1  1026 ? 154.714 67.745  1.347   1.00 107.62 ? 1026 LEU A O     1 
ATOM   8036  C  CB    . LEU A 1  1026 ? 152.668 65.862  1.106   1.00 98.16  ? 1026 LEU A CB    1 
ATOM   8037  C  CG    . LEU A 1  1026 ? 151.983 64.546  1.440   1.00 102.33 ? 1026 LEU A CG    1 
ATOM   8038  C  CD1   . LEU A 1  1026 ? 152.228 63.547  0.369   1.00 102.21 ? 1026 LEU A CD1   1 
ATOM   8039  C  CD2   . LEU A 1  1026 ? 152.471 63.968  2.763   1.00 105.39 ? 1026 LEU A CD2   1 
ATOM   8040  N  N     . ALA A 1  1027 ? 153.520 69.210  2.627   1.00 104.99 ? 1027 ALA A N     1 
ATOM   8041  C  CA    . ALA A 1  1027 ? 154.502 70.300  2.586   1.00 105.98 ? 1027 ALA A CA    1 
ATOM   8042  C  C     . ALA A 1  1027 ? 155.775 69.915  3.387   1.00 111.06 ? 1027 ALA A C     1 
ATOM   8043  O  O     . ALA A 1  1027 ? 155.678 69.147  4.350   1.00 110.16 ? 1027 ALA A O     1 
ATOM   8044  C  CB    . ALA A 1  1027 ? 153.884 71.561  3.156   1.00 107.10 ? 1027 ALA A CB    1 
ATOM   8045  N  N     . THR A 1  1028 ? 156.963 70.444  2.994   1.00 108.47 ? 1028 THR A N     1 
ATOM   8046  C  CA    . THR A 1  1028 ? 158.239 70.114  3.653   1.00 108.47 ? 1028 THR A CA    1 
ATOM   8047  C  C     . THR A 1  1028 ? 158.224 70.247  5.161   1.00 111.71 ? 1028 THR A C     1 
ATOM   8048  O  O     . THR A 1  1028 ? 158.452 69.243  5.830   1.00 110.86 ? 1028 THR A O     1 
ATOM   8049  C  CB    . THR A 1  1028 ? 159.451 70.750  2.971   1.00 114.22 ? 1028 THR A CB    1 
ATOM   8050  O  OG1   . THR A 1  1028 ? 159.341 70.571  1.560   1.00 114.32 ? 1028 THR A OG1   1 
ATOM   8051  C  CG2   . THR A 1  1028 ? 160.759 70.141  3.439   1.00 111.07 ? 1028 THR A CG2   1 
ATOM   8052  N  N     . ARG A 1  1029 ? 157.905 71.448  5.691   1.00 108.86 ? 1029 ARG A N     1 
ATOM   8053  C  CA    . ARG A 1  1029 ? 157.833 71.705  7.139   1.00 109.72 ? 1029 ARG A CA    1 
ATOM   8054  C  C     . ARG A 1  1029 ? 156.990 70.653  7.871   1.00 113.10 ? 1029 ARG A C     1 
ATOM   8055  O  O     . ARG A 1  1029 ? 157.434 70.079  8.865   1.00 113.13 ? 1029 ARG A O     1 
ATOM   8056  C  CB    . ARG A 1  1029 ? 157.273 73.112  7.418   1.00 111.39 ? 1029 ARG A CB    1 
ATOM   8057  C  CG    . ARG A 1  1029 ? 157.146 73.448  8.914   1.00 123.24 ? 1029 ARG A CG    1 
ATOM   8058  C  CD    . ARG A 1  1029 ? 157.883 74.718  9.288   1.00 127.60 ? 1029 ARG A CD    1 
ATOM   8059  N  NE    . ARG A 1  1029 ? 159.195 74.418  9.859   1.00 128.40 ? 1029 ARG A NE    1 
ATOM   8060  C  CZ    . ARG A 1  1029 ? 160.148 75.320  10.051  1.00 146.94 ? 1029 ARG A CZ    1 
ATOM   8061  N  NH1   . ARG A 1  1029 ? 159.953 76.588  9.700   1.00 134.84 ? 1029 ARG A NH1   1 
ATOM   8062  N  NH2   . ARG A 1  1029 ? 161.308 74.964  10.588  1.00 137.39 ? 1029 ARG A NH2   1 
ATOM   8063  N  N     . ARG A 1  1030 ? 155.789 70.397  7.345   1.00 108.59 ? 1030 ARG A N     1 
ATOM   8064  C  CA    . ARG A 1  1030 ? 154.805 69.453  7.854   1.00 107.05 ? 1030 ARG A CA    1 
ATOM   8065  C  C     . ARG A 1  1030 ? 155.370 68.011  7.918   1.00 109.27 ? 1030 ARG A C     1 
ATOM   8066  O  O     . ARG A 1  1030 ? 155.417 67.427  9.002   1.00 108.41 ? 1030 ARG A O     1 
ATOM   8067  C  CB    . ARG A 1  1030 ? 153.527 69.552  6.991   1.00 105.20 ? 1030 ARG A CB    1 
ATOM   8068  C  CG    . ARG A 1  1030 ? 152.354 68.763  7.519   1.00 113.47 ? 1030 ARG A CG    1 
ATOM   8069  C  CD    . ARG A 1  1030 ? 151.048 69.381  7.100   1.00 119.80 ? 1030 ARG A CD    1 
ATOM   8070  N  NE    . ARG A 1  1030 ? 149.991 69.029  8.042   1.00 124.66 ? 1030 ARG A NE    1 
ATOM   8071  C  CZ    . ARG A 1  1030 ? 148.709 69.321  7.871   1.00 136.28 ? 1030 ARG A CZ    1 
ATOM   8072  N  NH1   . ARG A 1  1030 ? 148.308 69.965  6.782   1.00 120.90 ? 1030 ARG A NH1   1 
ATOM   8073  N  NH2   . ARG A 1  1030 ? 147.815 68.960  8.780   1.00 125.29 ? 1030 ARG A NH2   1 
ATOM   8074  N  N     . VAL A 1  1031 ? 155.847 67.478  6.769   1.00 104.34 ? 1031 VAL A N     1 
ATOM   8075  C  CA    . VAL A 1  1031 ? 156.385 66.119  6.645   1.00 103.04 ? 1031 VAL A CA    1 
ATOM   8076  C  C     . VAL A 1  1031 ? 157.497 65.852  7.657   1.00 108.66 ? 1031 VAL A C     1 
ATOM   8077  O  O     . VAL A 1  1031 ? 157.511 64.787  8.279   1.00 109.21 ? 1031 VAL A O     1 
ATOM   8078  C  CB    . VAL A 1  1031 ? 156.813 65.789  5.190   1.00 105.54 ? 1031 VAL A CB    1 
ATOM   8079  C  CG1   . VAL A 1  1031 ? 157.514 64.441  5.106   1.00 104.93 ? 1031 VAL A CG1   1 
ATOM   8080  C  CG2   . VAL A 1  1031 ? 155.616 65.809  4.252   1.00 104.14 ? 1031 VAL A CG2   1 
ATOM   8081  N  N     . LEU A 1  1032 ? 158.394 66.829  7.851   1.00 105.03 ? 1032 LEU A N     1 
ATOM   8082  C  CA    . LEU A 1  1032 ? 159.545 66.680  8.733   1.00 105.25 ? 1032 LEU A CA    1 
ATOM   8083  C  C     . LEU A 1  1032 ? 159.261 66.914  10.197  1.00 110.08 ? 1032 LEU A C     1 
ATOM   8084  O  O     . LEU A 1  1032 ? 159.620 66.067  11.021  1.00 109.75 ? 1032 LEU A O     1 
ATOM   8085  C  CB    . LEU A 1  1032 ? 160.713 67.573  8.274   1.00 105.90 ? 1032 LEU A CB    1 
ATOM   8086  C  CG    . LEU A 1  1032 ? 161.412 67.190  6.990   1.00 109.19 ? 1032 LEU A CG    1 
ATOM   8087  C  CD1   . LEU A 1  1032 ? 162.085 68.371  6.404   1.00 110.39 ? 1032 LEU A CD1   1 
ATOM   8088  C  CD2   . LEU A 1  1032 ? 162.432 66.119  7.226   1.00 110.84 ? 1032 LEU A CD2   1 
ATOM   8089  N  N     . GLN A 1  1033 ? 158.688 68.091  10.529  1.00 107.32 ? 1033 GLN A N     1 
ATOM   8090  C  CA    . GLN A 1  1033 ? 158.431 68.514  11.905  1.00 108.09 ? 1033 GLN A CA    1 
ATOM   8091  C  C     . GLN A 1  1033 ? 157.281 67.771  12.555  1.00 112.11 ? 1033 GLN A C     1 
ATOM   8092  O  O     . GLN A 1  1033 ? 157.453 67.291  13.686  1.00 112.94 ? 1033 GLN A O     1 
ATOM   8093  C  CB    . GLN A 1  1033 ? 158.228 70.027  11.980  1.00 110.06 ? 1033 GLN A CB    1 
ATOM   8094  C  CG    . GLN A 1  1033 ? 158.581 70.646  13.318  1.00 126.47 ? 1033 GLN A CG    1 
ATOM   8095  C  CD    . GLN A 1  1033 ? 158.527 72.142  13.214  1.00 151.25 ? 1033 GLN A CD    1 
ATOM   8096  O  OE1   . GLN A 1  1033 ? 159.550 72.836  13.299  1.00 149.94 ? 1033 GLN A OE1   1 
ATOM   8097  N  NE2   . GLN A 1  1033 ? 157.333 72.671  12.975  1.00 144.52 ? 1033 GLN A NE2   1 
ATOM   8098  N  N     . GLU A 1  1034 ? 156.118 67.661  11.838  1.00 106.41 ? 1034 GLU A N     1 
ATOM   8099  C  CA    . GLU A 1  1034 ? 154.911 66.956  12.296  1.00 104.41 ? 1034 GLU A CA    1 
ATOM   8100  C  C     . GLU A 1  1034 ? 155.039 65.403  12.148  1.00 107.09 ? 1034 GLU A C     1 
ATOM   8101  O  O     . GLU A 1  1034 ? 155.193 64.704  13.160  1.00 106.47 ? 1034 GLU A O     1 
ATOM   8102  C  CB    . GLU A 1  1034 ? 153.644 67.462  11.567  1.00 104.46 ? 1034 GLU A CB    1 
ATOM   8103  C  CG    . GLU A 1  1034 ? 153.426 68.965  11.537  1.00 114.60 ? 1034 GLU A CG    1 
ATOM   8104  C  CD    . GLU A 1  1034 ? 152.075 69.426  11.015  1.00 138.34 ? 1034 GLU A CD    1 
ATOM   8105  O  OE1   . GLU A 1  1034 ? 151.073 68.706  11.233  1.00 136.14 ? 1034 GLU A OE1   1 
ATOM   8106  O  OE2   . GLU A 1  1034 ? 152.010 70.525  10.414  1.00 132.26 ? 1034 GLU A OE2   1 
ATOM   8107  N  N     . TYR A 1  1035 ? 155.007 64.887  10.888  1.00 102.48 ? 1035 TYR A N     1 
ATOM   8108  C  CA    . TYR A 1  1035 ? 155.032 63.455  10.555  1.00 101.69 ? 1035 TYR A CA    1 
ATOM   8109  C  C     . TYR A 1  1035 ? 156.305 62.697  10.908  1.00 104.87 ? 1035 TYR A C     1 
ATOM   8110  O  O     . TYR A 1  1035 ? 156.247 61.489  11.168  1.00 103.47 ? 1035 TYR A O     1 
ATOM   8111  C  CB    . TYR A 1  1035 ? 154.684 63.200  9.077   1.00 102.65 ? 1035 TYR A CB    1 
ATOM   8112  C  CG    . TYR A 1  1035 ? 153.434 63.865  8.546   1.00 105.19 ? 1035 TYR A CG    1 
ATOM   8113  C  CD1   . TYR A 1  1035 ? 152.423 64.289  9.404   1.00 107.17 ? 1035 TYR A CD1   1 
ATOM   8114  C  CD2   . TYR A 1  1035 ? 153.234 64.016  7.182   1.00 106.69 ? 1035 TYR A CD2   1 
ATOM   8115  C  CE1   . TYR A 1  1035 ? 151.284 64.930  8.920   1.00 108.91 ? 1035 TYR A CE1   1 
ATOM   8116  C  CE2   . TYR A 1  1035 ? 152.086 64.625  6.682   1.00 108.01 ? 1035 TYR A CE2   1 
ATOM   8117  C  CZ    . TYR A 1  1035 ? 151.115 65.093  7.554   1.00 119.36 ? 1035 TYR A CZ    1 
ATOM   8118  O  OH    . TYR A 1  1035 ? 149.980 65.700  7.055   1.00 123.87 ? 1035 TYR A OH    1 
ATOM   8119  N  N     . ARG A 1  1036 ? 157.450 63.387  10.852  1.00 101.95 ? 1036 ARG A N     1 
ATOM   8120  C  CA    . ARG A 1  1036 ? 158.772 62.835  11.136  1.00 102.33 ? 1036 ARG A CA    1 
ATOM   8121  C  C     . ARG A 1  1036 ? 159.160 61.624  10.259  1.00 103.67 ? 1036 ARG A C     1 
ATOM   8122  O  O     . ARG A 1  1036 ? 159.957 60.791  10.702  1.00 104.14 ? 1036 ARG A O     1 
ATOM   8123  C  CB    . ARG A 1  1036 ? 158.926 62.530  12.644  1.00 104.15 ? 1036 ARG A CB    1 
ATOM   8124  C  CG    . ARG A 1  1036 ? 159.537 63.652  13.458  1.00 118.20 ? 1036 ARG A CG    1 
ATOM   8125  C  CD    . ARG A 1  1036 ? 161.006 63.898  13.103  1.00 133.17 ? 1036 ARG A CD    1 
ATOM   8126  N  NE    . ARG A 1  1036 ? 161.780 64.512  14.186  1.00 148.77 ? 1036 ARG A NE    1 
ATOM   8127  C  CZ    . ARG A 1  1036 ? 161.451 65.628  14.838  1.00 164.84 ? 1036 ARG A CZ    1 
ATOM   8128  N  NH1   . ARG A 1  1036 ? 160.316 66.264  14.556  1.00 145.77 ? 1036 ARG A NH1   1 
ATOM   8129  N  NH2   . ARG A 1  1036 ? 162.239 66.100  15.795  1.00 154.95 ? 1036 ARG A NH2   1 
ATOM   8130  N  N     . LEU A 1  1037 ? 158.640 61.547  9.016   1.00 97.70  ? 1037 LEU A N     1 
ATOM   8131  C  CA    . LEU A 1  1037 ? 158.912 60.422  8.112   1.00 97.12  ? 1037 LEU A CA    1 
ATOM   8132  C  C     . LEU A 1  1037 ? 160.364 60.260  7.699   1.00 102.06 ? 1037 LEU A C     1 
ATOM   8133  O  O     . LEU A 1  1037 ? 161.098 61.240  7.623   1.00 101.58 ? 1037 LEU A O     1 
ATOM   8134  C  CB    . LEU A 1  1037 ? 158.060 60.476  6.827   1.00 96.25  ? 1037 LEU A CB    1 
ATOM   8135  C  CG    . LEU A 1  1037 ? 156.556 60.687  6.918   1.00 100.29 ? 1037 LEU A CG    1 
ATOM   8136  C  CD1   . LEU A 1  1037 ? 155.914 60.494  5.555   1.00 99.56  ? 1037 LEU A CD1   1 
ATOM   8137  C  CD2   . LEU A 1  1037 ? 155.915 59.767  7.930   1.00 102.01 ? 1037 LEU A CD2   1 
ATOM   8138  N  N     . THR A 1  1038 ? 160.754 59.014  7.379   1.00 99.94  ? 1038 THR A N     1 
ATOM   8139  C  CA    . THR A 1  1038 ? 162.070 58.678  6.829   1.00 101.25 ? 1038 THR A CA    1 
ATOM   8140  C  C     . THR A 1  1038 ? 161.887 58.616  5.317   1.00 104.82 ? 1038 THR A C     1 
ATOM   8141  O  O     . THR A 1  1038 ? 160.738 58.542  4.874   1.00 103.62 ? 1038 THR A O     1 
ATOM   8142  C  CB    . THR A 1  1038 ? 162.612 57.353  7.406   1.00 114.42 ? 1038 THR A CB    1 
ATOM   8143  O  OG1   . THR A 1  1038 ? 161.747 56.255  7.097   1.00 114.56 ? 1038 THR A OG1   1 
ATOM   8144  C  CG2   . THR A 1  1038 ? 162.875 57.434  8.897   1.00 115.68 ? 1038 THR A CG2   1 
ATOM   8145  N  N     . LYS A 1  1039 ? 162.978 58.652  4.521   1.00 102.33 ? 1039 LYS A N     1 
ATOM   8146  C  CA    . LYS A 1  1039 ? 162.859 58.571  3.058   1.00 102.37 ? 1039 LYS A CA    1 
ATOM   8147  C  C     . LYS A 1  1039 ? 162.064 57.304  2.698   1.00 107.41 ? 1039 LYS A C     1 
ATOM   8148  O  O     . LYS A 1  1039 ? 161.099 57.373  1.915   1.00 105.66 ? 1039 LYS A O     1 
ATOM   8149  C  CB    . LYS A 1  1039 ? 164.251 58.630  2.383   1.00 105.92 ? 1039 LYS A CB    1 
ATOM   8150  C  CG    . LYS A 1  1039 ? 164.366 58.092  0.943   1.00 115.80 ? 1039 LYS A CG    1 
ATOM   8151  C  CD    . LYS A 1  1039 ? 163.931 59.068  -0.141  1.00 121.48 ? 1039 LYS A CD    1 
ATOM   8152  C  CE    . LYS A 1  1039 ? 164.271 58.529  -1.512  1.00 130.87 ? 1039 LYS A CE    1 
ATOM   8153  N  NZ    . LYS A 1  1039 ? 163.187 58.794  -2.503  1.00 141.24 ? 1039 LYS A NZ    1 
ATOM   8154  N  N     . GLN A 1  1040 ? 162.419 56.176  3.376   1.00 105.04 ? 1040 GLN A N     1 
ATOM   8155  C  CA    . GLN A 1  1040 ? 161.786 54.858  3.245   1.00 103.30 ? 1040 GLN A CA    1 
ATOM   8156  C  C     . GLN A 1  1040 ? 160.236 54.905  3.419   1.00 101.48 ? 1040 GLN A C     1 
ATOM   8157  O  O     . GLN A 1  1040 ? 159.504 54.463  2.525   1.00 99.04  ? 1040 GLN A O     1 
ATOM   8158  C  CB    . GLN A 1  1040 ? 162.537 53.821  4.134   1.00 105.49 ? 1040 GLN A CB    1 
ATOM   8159  C  CG    . GLN A 1  1040 ? 161.716 53.003  5.131   1.00 120.70 ? 1040 GLN A CG    1 
ATOM   8160  C  CD    . GLN A 1  1040 ? 162.198 51.577  5.280   1.00 131.49 ? 1040 GLN A CD    1 
ATOM   8161  O  OE1   . GLN A 1  1040 ? 162.021 50.731  4.392   1.00 120.27 ? 1040 GLN A OE1   1 
ATOM   8162  N  NE2   . GLN A 1  1040 ? 162.754 51.264  6.441   1.00 126.82 ? 1040 GLN A NE2   1 
ATOM   8163  N  N     . ALA A 1  1041 ? 159.771 55.534  4.518   1.00 96.34  ? 1041 ALA A N     1 
ATOM   8164  C  CA    . ALA A 1  1041 ? 158.362 55.718  4.870   1.00 95.13  ? 1041 ALA A CA    1 
ATOM   8165  C  C     . ALA A 1  1041 ? 157.649 56.659  3.900   1.00 100.82 ? 1041 ALA A C     1 
ATOM   8166  O  O     . ALA A 1  1041 ? 156.484 56.428  3.553   1.00 99.25  ? 1041 ALA A O     1 
ATOM   8167  C  CB    . ALA A 1  1041 ? 158.255 56.270  6.277   1.00 96.09  ? 1041 ALA A CB    1 
ATOM   8168  N  N     . PHE A 1  1042 ? 158.342 57.739  3.488   1.00 99.39  ? 1042 PHE A N     1 
ATOM   8169  C  CA    . PHE A 1  1042 ? 157.806 58.752  2.582   1.00 98.69  ? 1042 PHE A CA    1 
ATOM   8170  C  C     . PHE A 1  1042 ? 157.548 58.154  1.213   1.00 101.90 ? 1042 PHE A C     1 
ATOM   8171  O  O     . PHE A 1  1042 ? 156.512 58.450  0.613   1.00 100.22 ? 1042 PHE A O     1 
ATOM   8172  C  CB    . PHE A 1  1042 ? 158.739 59.975  2.508   1.00 101.17 ? 1042 PHE A CB    1 
ATOM   8173  C  CG    . PHE A 1  1042 ? 158.278 61.080  1.589   1.00 101.94 ? 1042 PHE A CG    1 
ATOM   8174  C  CD1   . PHE A 1  1042 ? 157.304 61.985  1.996   1.00 104.30 ? 1042 PHE A CD1   1 
ATOM   8175  C  CD2   . PHE A 1  1042 ? 158.836 61.232  0.325   1.00 103.70 ? 1042 PHE A CD2   1 
ATOM   8176  C  CE1   . PHE A 1  1042 ? 156.882 63.014  1.148   1.00 104.76 ? 1042 PHE A CE1   1 
ATOM   8177  C  CE2   . PHE A 1  1042 ? 158.420 62.267  -0.520  1.00 106.22 ? 1042 PHE A CE2   1 
ATOM   8178  C  CZ    . PHE A 1  1042 ? 157.442 63.147  -0.104  1.00 103.90 ? 1042 PHE A CZ    1 
ATOM   8179  N  N     . ASP A 1  1043 ? 158.462 57.278  0.747   1.00 99.18  ? 1043 ASP A N     1 
ATOM   8180  C  CA    . ASP A 1  1043 ? 158.338 56.603  -0.543  1.00 98.80  ? 1043 ASP A CA    1 
ATOM   8181  C  C     . ASP A 1  1043 ? 157.103 55.715  -0.555  1.00 100.21 ? 1043 ASP A C     1 
ATOM   8182  O  O     . ASP A 1  1043 ? 156.351 55.700  -1.536  1.00 98.31  ? 1043 ASP A O     1 
ATOM   8183  C  CB    . ASP A 1  1043 ? 159.601 55.792  -0.844  1.00 101.94 ? 1043 ASP A CB    1 
ATOM   8184  C  CG    . ASP A 1  1043 ? 160.823 56.619  -1.212  1.00 118.02 ? 1043 ASP A CG    1 
ATOM   8185  O  OD1   . ASP A 1  1043 ? 160.652 57.694  -1.847  1.00 120.31 ? 1043 ASP A OD1   1 
ATOM   8186  O  OD2   . ASP A 1  1043 ? 161.953 56.167  -0.917  1.00 123.92 ? 1043 ASP A OD2   1 
ATOM   8187  N  N     . TRP A 1  1044 ? 156.870 55.035  0.579   1.00 96.41  ? 1044 TRP A N     1 
ATOM   8188  C  CA    . TRP A 1  1044 ? 155.732 54.159  0.838   1.00 94.82  ? 1044 TRP A CA    1 
ATOM   8189  C  C     . TRP A 1  1044 ? 154.438 54.966  0.858   1.00 94.13  ? 1044 TRP A C     1 
ATOM   8190  O  O     . TRP A 1  1044 ? 153.526 54.620  0.115   1.00 92.15  ? 1044 TRP A O     1 
ATOM   8191  C  CB    . TRP A 1  1044 ? 155.955 53.429  2.152   1.00 94.47  ? 1044 TRP A CB    1 
ATOM   8192  C  CG    . TRP A 1  1044 ? 154.924 52.413  2.511   1.00 95.08  ? 1044 TRP A CG    1 
ATOM   8193  C  CD1   . TRP A 1  1044 ? 154.917 51.100  2.157   1.00 97.59  ? 1044 TRP A CD1   1 
ATOM   8194  C  CD2   . TRP A 1  1044 ? 153.843 52.587  3.427   1.00 94.97  ? 1044 TRP A CD2   1 
ATOM   8195  N  NE1   . TRP A 1  1044 ? 153.869 50.453  2.761   1.00 96.38  ? 1044 TRP A NE1   1 
ATOM   8196  C  CE2   . TRP A 1  1044 ? 153.217 51.332  3.580   1.00 98.06  ? 1044 TRP A CE2   1 
ATOM   8197  C  CE3   . TRP A 1  1044 ? 153.318 53.690  4.118   1.00 96.90  ? 1044 TRP A CE3   1 
ATOM   8198  C  CZ2   . TRP A 1  1044 ? 152.102 51.148  4.404   1.00 97.24  ? 1044 TRP A CZ2   1 
ATOM   8199  C  CZ3   . TRP A 1  1044 ? 152.197 53.508  4.915   1.00 97.96  ? 1044 TRP A CZ3   1 
ATOM   8200  C  CH2   . TRP A 1  1044 ? 151.622 52.245  5.079   1.00 97.84  ? 1044 TRP A CH2   1 
ATOM   8201  N  N     . VAL A 1  1045 ? 154.380 56.076  1.644   1.00 89.41  ? 1045 VAL A N     1 
ATOM   8202  C  CA    . VAL A 1  1045 ? 153.228 57.001  1.682   1.00 87.54  ? 1045 VAL A CA    1 
ATOM   8203  C  C     . VAL A 1  1045 ? 152.860 57.397  0.228   1.00 90.33  ? 1045 VAL A C     1 
ATOM   8204  O  O     . VAL A 1  1045 ? 151.707 57.257  -0.181  1.00 88.21  ? 1045 VAL A O     1 
ATOM   8205  C  CB    . VAL A 1  1045 ? 153.478 58.248  2.596   1.00 90.51  ? 1045 VAL A CB    1 
ATOM   8206  C  CG1   . VAL A 1  1045 ? 152.630 59.437  2.179   1.00 89.49  ? 1045 VAL A CG1   1 
ATOM   8207  C  CG2   . VAL A 1  1045 ? 153.220 57.928  4.054   1.00 90.20  ? 1045 VAL A CG2   1 
ATOM   8208  N  N     . LEU A 1  1046 ? 153.870 57.800  -0.554  1.00 87.85  ? 1046 LEU A N     1 
ATOM   8209  C  CA    . LEU A 1  1046 ? 153.701 58.222  -1.933  1.00 87.64  ? 1046 LEU A CA    1 
ATOM   8210  C  C     . LEU A 1  1046 ? 153.127 57.173  -2.868  1.00 94.15  ? 1046 LEU A C     1 
ATOM   8211  O  O     . LEU A 1  1046 ? 152.207 57.492  -3.624  1.00 93.32  ? 1046 LEU A O     1 
ATOM   8212  C  CB    . LEU A 1  1046 ? 154.988 58.837  -2.495  1.00 87.91  ? 1046 LEU A CB    1 
ATOM   8213  C  CG    . LEU A 1  1046 ? 155.389 60.233  -2.006  1.00 91.57  ? 1046 LEU A CG    1 
ATOM   8214  C  CD1   . LEU A 1  1046 ? 156.165 60.959  -3.063  1.00 91.34  ? 1046 LEU A CD1   1 
ATOM   8215  C  CD2   . LEU A 1  1046 ? 154.195 61.065  -1.651  1.00 92.86  ? 1046 LEU A CD2   1 
ATOM   8216  N  N     . SER A 1  1047 ? 153.631 55.931  -2.809  1.00 93.39  ? 1047 SER A N     1 
ATOM   8217  C  CA    . SER A 1  1047 ? 153.121 54.842  -3.660  1.00 93.94  ? 1047 SER A CA    1 
ATOM   8218  C  C     . SER A 1  1047 ? 151.642 54.502  -3.351  1.00 96.81  ? 1047 SER A C     1 
ATOM   8219  O  O     . SER A 1  1047 ? 150.845 54.264  -4.273  1.00 95.57  ? 1047 SER A O     1 
ATOM   8220  C  CB    . SER A 1  1047 ? 153.968 53.586  -3.484  1.00 99.89  ? 1047 SER A CB    1 
ATOM   8221  O  OG    . SER A 1  1047 ? 153.683 52.951  -2.245  1.00 112.65 ? 1047 SER A OG    1 
ATOM   8222  N  N     . ASN A 1  1048 ? 151.304 54.462  -2.038  1.00 92.45  ? 1048 ASN A N     1 
ATOM   8223  C  CA    . ASN A 1  1048 ? 149.966 54.150  -1.547  1.00 90.45  ? 1048 ASN A CA    1 
ATOM   8224  C  C     . ASN A 1  1048 ? 148.968 55.223  -1.898  1.00 92.80  ? 1048 ASN A C     1 
ATOM   8225  O  O     . ASN A 1  1048 ? 147.840 54.873  -2.237  1.00 92.06  ? 1048 ASN A O     1 
ATOM   8226  C  CB    . ASN A 1  1048 ? 149.963 53.748  -0.072  1.00 89.81  ? 1048 ASN A CB    1 
ATOM   8227  C  CG    . ASN A 1  1048 ? 150.685 52.426  0.169   1.00 117.56 ? 1048 ASN A CG    1 
ATOM   8228  O  OD1   . ASN A 1  1048 ? 150.326 51.364  -0.364  1.00 112.41 ? 1048 ASN A OD1   1 
ATOM   8229  N  ND2   . ASN A 1  1048 ? 151.758 52.467  0.940   1.00 111.77 ? 1048 ASN A ND2   1 
ATOM   8230  N  N     . ILE A 1  1049 ? 149.392 56.514  -1.943  1.00 88.52  ? 1049 ILE A N     1 
ATOM   8231  C  CA    . ILE A 1  1049 ? 148.492 57.586  -2.385  1.00 86.82  ? 1049 ILE A CA    1 
ATOM   8232  C  C     . ILE A 1  1049 ? 148.137 57.291  -3.839  1.00 90.04  ? 1049 ILE A C     1 
ATOM   8233  O  O     . ILE A 1  1049 ? 146.953 57.159  -4.148  1.00 88.99  ? 1049 ILE A O     1 
ATOM   8234  C  CB    . ILE A 1  1049 ? 149.022 59.035  -2.187  1.00 89.70  ? 1049 ILE A CB    1 
ATOM   8235  C  CG1   . ILE A 1  1049 ? 149.271 59.341  -0.711  1.00 89.90  ? 1049 ILE A CG1   1 
ATOM   8236  C  CG2   . ILE A 1  1049 ? 148.017 60.041  -2.758  1.00 89.79  ? 1049 ILE A CG2   1 
ATOM   8237  C  CD1   . ILE A 1  1049 ? 150.028 60.562  -0.448  1.00 97.98  ? 1049 ILE A CD1   1 
ATOM   8238  N  N     . GLU A 1  1050 ? 149.169 57.083  -4.693  1.00 86.86  ? 1050 GLU A N     1 
ATOM   8239  C  CA    . GLU A 1  1050 ? 149.025 56.766  -6.118  1.00 86.25  ? 1050 GLU A CA    1 
ATOM   8240  C  C     . GLU A 1  1050 ? 148.078 55.590  -6.308  1.00 88.62  ? 1050 GLU A C     1 
ATOM   8241  O  O     . GLU A 1  1050 ? 147.062 55.724  -6.997  1.00 87.14  ? 1050 GLU A O     1 
ATOM   8242  C  CB    . GLU A 1  1050 ? 150.393 56.450  -6.762  1.00 88.28  ? 1050 GLU A CB    1 
ATOM   8243  C  CG    . GLU A 1  1050 ? 150.405 56.670  -8.269  1.00 99.73  ? 1050 GLU A CG    1 
ATOM   8244  C  CD    . GLU A 1  1050 ? 151.354 55.819  -9.087  1.00 128.01 ? 1050 GLU A CD    1 
ATOM   8245  O  OE1   . GLU A 1  1050 ? 152.449 55.480  -8.583  1.00 139.93 ? 1050 GLU A OE1   1 
ATOM   8246  O  OE2   . GLU A 1  1050 ? 151.019 55.529  -10.258 1.00 124.18 ? 1050 GLU A OE2   1 
ATOM   8247  N  N     . ALA A 1  1051 ? 148.400 54.454  -5.659  1.00 84.64  ? 1051 ALA A N     1 
ATOM   8248  C  CA    . ALA A 1  1051 ? 147.625 53.225  -5.723  1.00 82.76  ? 1051 ALA A CA    1 
ATOM   8249  C  C     . ALA A 1  1051 ? 146.164 53.455  -5.348  1.00 83.09  ? 1051 ALA A C     1 
ATOM   8250  O  O     . ALA A 1  1051 ? 145.270 53.117  -6.126  1.00 81.81  ? 1051 ALA A O     1 
ATOM   8251  C  CB    . ALA A 1  1051 ? 148.242 52.198  -4.806  1.00 83.68  ? 1051 ALA A CB    1 
ATOM   8252  N  N     . GLN A 1  1052 ? 145.937 54.083  -4.190  1.00 78.12  ? 1052 GLN A N     1 
ATOM   8253  C  CA    . GLN A 1  1052 ? 144.608 54.357  -3.686  1.00 77.45  ? 1052 GLN A CA    1 
ATOM   8254  C  C     . GLN A 1  1052 ? 143.804 55.221  -4.628  1.00 82.18  ? 1052 GLN A C     1 
ATOM   8255  O  O     . GLN A 1  1052 ? 142.658 54.883  -4.933  1.00 80.97  ? 1052 GLN A O     1 
ATOM   8256  C  CB    . GLN A 1  1052 ? 144.671 54.961  -2.282  1.00 79.22  ? 1052 GLN A CB    1 
ATOM   8257  C  CG    . GLN A 1  1052 ? 144.283 53.973  -1.198  1.00 89.59  ? 1052 GLN A CG    1 
ATOM   8258  C  CD    . GLN A 1  1052 ? 144.954 54.298  0.105   1.00 114.29 ? 1052 GLN A CD    1 
ATOM   8259  O  OE1   . GLN A 1  1052 ? 144.512 55.168  0.887   1.00 113.25 ? 1052 GLN A OE1   1 
ATOM   8260  N  NE2   . GLN A 1  1052 ? 146.026 53.575  0.373   1.00 106.28 ? 1052 GLN A NE2   1 
ATOM   8261  N  N     . PHE A 1  1053 ? 144.418 56.314  -5.121  1.00 80.36  ? 1053 PHE A N     1 
ATOM   8262  C  CA    . PHE A 1  1053 ? 143.804 57.257  -6.059  1.00 79.62  ? 1053 PHE A CA    1 
ATOM   8263  C  C     . PHE A 1  1053 ? 143.306 56.512  -7.308  1.00 84.39  ? 1053 PHE A C     1 
ATOM   8264  O  O     . PHE A 1  1053 ? 142.135 56.622  -7.657  1.00 83.83  ? 1053 PHE A O     1 
ATOM   8265  C  CB    . PHE A 1  1053 ? 144.778 58.398  -6.421  1.00 81.55  ? 1053 PHE A CB    1 
ATOM   8266  C  CG    . PHE A 1  1053 ? 144.143 59.410  -7.329  1.00 82.96  ? 1053 PHE A CG    1 
ATOM   8267  C  CD1   . PHE A 1  1053 ? 144.048 59.179  -8.699  1.00 86.18  ? 1053 PHE A CD1   1 
ATOM   8268  C  CD2   . PHE A 1  1053 ? 143.570 60.560  -6.814  1.00 85.73  ? 1053 PHE A CD2   1 
ATOM   8269  C  CE1   . PHE A 1  1053 ? 143.381 60.081  -9.535  1.00 87.26  ? 1053 PHE A CE1   1 
ATOM   8270  C  CE2   . PHE A 1  1053 ? 142.919 61.471  -7.656  1.00 88.63  ? 1053 PHE A CE2   1 
ATOM   8271  C  CZ    . PHE A 1  1053 ? 142.824 61.223  -9.009  1.00 86.27  ? 1053 PHE A CZ    1 
ATOM   8272  N  N     . LEU A 1  1054 ? 144.172 55.714  -7.937  1.00 81.67  ? 1054 LEU A N     1 
ATOM   8273  C  CA    . LEU A 1  1054 ? 143.803 54.952  -9.122  1.00 81.25  ? 1054 LEU A CA    1 
ATOM   8274  C  C     . LEU A 1  1054 ? 142.620 53.981  -8.881  1.00 87.07  ? 1054 LEU A C     1 
ATOM   8275  O  O     . LEU A 1  1054 ? 141.695 53.930  -9.708  1.00 86.46  ? 1054 LEU A O     1 
ATOM   8276  C  CB    . LEU A 1  1054 ? 145.033 54.268  -9.708  1.00 81.26  ? 1054 LEU A CB    1 
ATOM   8277  C  CG    . LEU A 1  1054 ? 146.059 55.224  -10.292 1.00 86.43  ? 1054 LEU A CG    1 
ATOM   8278  C  CD1   . LEU A 1  1054 ? 147.389 54.551  -10.464 1.00 87.15  ? 1054 LEU A CD1   1 
ATOM   8279  C  CD2   . LEU A 1  1054 ? 145.561 55.871  -11.595 1.00 88.74  ? 1054 LEU A CD2   1 
ATOM   8280  N  N     . ARG A 1  1055 ? 142.603 53.302  -7.698  1.00 84.30  ? 1055 ARG A N     1 
ATOM   8281  C  CA    . ARG A 1  1055 ? 141.510 52.413  -7.273  1.00 83.43  ? 1055 ARG A CA    1 
ATOM   8282  C  C     . ARG A 1  1055 ? 140.196 53.203  -7.078  1.00 86.87  ? 1055 ARG A C     1 
ATOM   8283  O  O     . ARG A 1  1055 ? 139.100 52.633  -7.215  1.00 86.96  ? 1055 ARG A O     1 
ATOM   8284  C  CB    . ARG A 1  1055 ? 141.851 51.742  -5.940  1.00 84.19  ? 1055 ARG A CB    1 
ATOM   8285  C  CG    . ARG A 1  1055 ? 142.957 50.700  -6.004  1.00 101.61 ? 1055 ARG A CG    1 
ATOM   8286  C  CD    . ARG A 1  1055 ? 142.958 49.806  -4.767  1.00 116.17 ? 1055 ARG A CD    1 
ATOM   8287  N  NE    . ARG A 1  1055 ? 144.298 49.295  -4.479  1.00 130.97 ? 1055 ARG A NE    1 
ATOM   8288  C  CZ    . ARG A 1  1055 ? 145.080 49.739  -3.499  1.00 151.17 ? 1055 ARG A CZ    1 
ATOM   8289  N  NH1   . ARG A 1  1055 ? 144.647 50.686  -2.669  1.00 133.74 ? 1055 ARG A NH1   1 
ATOM   8290  N  NH2   . ARG A 1  1055 ? 146.292 49.225  -3.325  1.00 145.48 ? 1055 ARG A NH2   1 
ATOM   8291  N  N     . SER A 1  1056 ? 140.324 54.514  -6.762  1.00 80.81  ? 1056 SER A N     1 
ATOM   8292  C  CA    . SER A 1  1056 ? 139.213 55.392  -6.462  1.00 79.20  ? 1056 SER A CA    1 
ATOM   8293  C  C     . SER A 1  1056 ? 138.395 55.894  -7.648  1.00 83.75  ? 1056 SER A C     1 
ATOM   8294  O  O     . SER A 1  1056 ? 137.291 56.401  -7.427  1.00 83.84  ? 1056 SER A O     1 
ATOM   8295  C  CB    . SER A 1  1056 ? 139.658 56.533  -5.550  1.00 81.33  ? 1056 SER A CB    1 
ATOM   8296  O  OG    . SER A 1  1056 ? 140.092 56.095  -4.269  1.00 84.43  ? 1056 SER A OG    1 
ATOM   8297  N  N     . VAL A 1  1057 ? 138.897 55.754  -8.897  1.00 80.40  ? 1057 VAL A N     1 
ATOM   8298  C  CA    . VAL A 1  1057 ? 138.175 56.254  -10.100 1.00 79.77  ? 1057 VAL A CA    1 
ATOM   8299  C  C     . VAL A 1  1057 ? 136.940 55.374  -10.475 1.00 85.93  ? 1057 VAL A C     1 
ATOM   8300  O  O     . VAL A 1  1057 ? 136.945 54.170  -10.154 1.00 87.23  ? 1057 VAL A O     1 
ATOM   8301  C  CB    . VAL A 1  1057 ? 139.151 56.469  -11.286 1.00 81.98  ? 1057 VAL A CB    1 
ATOM   8302  C  CG1   . VAL A 1  1057 ? 138.426 56.935  -12.541 1.00 81.28  ? 1057 VAL A CG1   1 
ATOM   8303  C  CG2   . VAL A 1  1057 ? 140.265 57.446  -10.917 1.00 82.10  ? 1057 VAL A CG2   1 
ATOM   8304  N  N     . VAL A 1  1058 ? 135.886 55.982  -11.123 1.00 80.74  ? 1058 VAL A N     1 
ATOM   8305  C  CA    . VAL A 1  1058 ? 134.652 55.298  -11.584 1.00 79.36  ? 1058 VAL A CA    1 
ATOM   8306  C  C     . VAL A 1  1058 ? 134.981 54.306  -12.649 1.00 84.24  ? 1058 VAL A C     1 
ATOM   8307  O  O     . VAL A 1  1058 ? 135.821 54.590  -13.508 1.00 84.26  ? 1058 VAL A O     1 
ATOM   8308  C  CB    . VAL A 1  1058 ? 133.563 56.214  -12.168 1.00 82.85  ? 1058 VAL A CB    1 
ATOM   8309  C  CG1   . VAL A 1  1058 ? 132.184 55.753  -11.752 1.00 81.66  ? 1058 VAL A CG1   1 
ATOM   8310  C  CG2   . VAL A 1  1058 ? 133.777 57.654  -11.796 1.00 83.87  ? 1058 VAL A CG2   1 
ATOM   8311  N  N     . HIS A 1  1059 ? 134.252 53.177  -12.653 1.00 81.45  ? 1059 HIS A N     1 
ATOM   8312  C  CA    . HIS A 1  1059 ? 134.443 52.107  -13.637 1.00 81.38  ? 1059 HIS A CA    1 
ATOM   8313  C  C     . HIS A 1  1059 ? 133.539 52.241  -14.880 1.00 81.28  ? 1059 HIS A C     1 
ATOM   8314  O  O     . HIS A 1  1059 ? 132.315 52.104  -14.780 1.00 79.48  ? 1059 HIS A O     1 
ATOM   8315  C  CB    . HIS A 1  1059 ? 134.237 50.735  -12.987 1.00 82.58  ? 1059 HIS A CB    1 
ATOM   8316  C  CG    . HIS A 1  1059 ? 135.279 50.356  -11.988 1.00 87.20  ? 1059 HIS A CG    1 
ATOM   8317  N  ND1   . HIS A 1  1059 ? 135.956 49.159  -12.087 1.00 89.36  ? 1059 HIS A ND1   1 
ATOM   8318  C  CD2   . HIS A 1  1059 ? 135.679 50.997  -10.861 1.00 90.45  ? 1059 HIS A CD2   1 
ATOM   8319  C  CE1   . HIS A 1  1059 ? 136.745 49.106  -11.028 1.00 89.77  ? 1059 HIS A CE1   1 
ATOM   8320  N  NE2   . HIS A 1  1059 ? 136.637 50.205  -10.277 1.00 90.56  ? 1059 HIS A NE2   1 
ATOM   8321  N  N     . PRO A 1  1060 ? 134.101 52.450  -16.078 1.00 76.71  ? 1060 PRO A N     1 
ATOM   8322  C  CA    . PRO A 1  1060 ? 133.231 52.517  -17.260 1.00 76.88  ? 1060 PRO A CA    1 
ATOM   8323  C  C     . PRO A 1  1060 ? 132.287 51.302  -17.308 1.00 81.67  ? 1060 PRO A C     1 
ATOM   8324  O  O     . PRO A 1  1060 ? 132.700 50.132  -17.354 1.00 82.39  ? 1060 PRO A O     1 
ATOM   8325  C  CB    . PRO A 1  1060 ? 134.211 52.610  -18.425 1.00 78.95  ? 1060 PRO A CB    1 
ATOM   8326  C  CG    . PRO A 1  1060 ? 135.450 53.160  -17.822 1.00 83.64  ? 1060 PRO A CG    1 
ATOM   8327  C  CD    . PRO A 1  1060 ? 135.522 52.602  -16.436 1.00 78.29  ? 1060 PRO A CD    1 
ATOM   8328  N  N     . GLY A 1  1061 ? 131.019 51.609  -17.142 1.00 76.77  ? 1061 GLY A N     1 
ATOM   8329  C  CA    . GLY A 1  1061 ? 129.959 50.624  -17.071 1.00 75.62  ? 1061 GLY A CA    1 
ATOM   8330  C  C     . GLY A 1  1061 ? 128.934 51.055  -16.051 1.00 79.04  ? 1061 GLY A C     1 
ATOM   8331  O  O     . GLY A 1  1061 ? 127.745 50.761  -16.215 1.00 78.41  ? 1061 GLY A O     1 
ATOM   8332  N  N     . GLU A 1  1062 ? 129.389 51.795  -15.010 1.00 75.63  ? 1062 GLU A N     1 
ATOM   8333  C  CA    . GLU A 1  1062 ? 128.544 52.269  -13.912 1.00 75.70  ? 1062 GLU A CA    1 
ATOM   8334  C  C     . GLU A 1  1062 ? 127.311 52.961  -14.379 1.00 83.96  ? 1062 GLU A C     1 
ATOM   8335  O  O     . GLU A 1  1062 ? 127.390 54.009  -15.025 1.00 85.23  ? 1062 GLU A O     1 
ATOM   8336  C  CB    . GLU A 1  1062 ? 129.282 53.175  -12.927 1.00 77.03  ? 1062 GLU A CB    1 
ATOM   8337  C  CG    . GLU A 1  1062 ? 130.376 52.457  -12.174 1.00 91.24  ? 1062 GLU A CG    1 
ATOM   8338  C  CD    . GLU A 1  1062 ? 130.098 52.000  -10.760 1.00 116.83 ? 1062 GLU A CD    1 
ATOM   8339  O  OE1   . GLU A 1  1062 ? 128.931 51.681  -10.423 1.00 100.29 ? 1062 GLU A OE1   1 
ATOM   8340  O  OE2   . GLU A 1  1062 ? 131.086 51.929  -9.995  1.00 126.10 ? 1062 GLU A OE2   1 
ATOM   8341  N  N     . MET A 1  1063 ? 126.155 52.362  -14.044 1.00 81.55  ? 1063 MET A N     1 
ATOM   8342  C  CA    . MET A 1  1063 ? 124.827 52.903  -14.327 1.00 81.09  ? 1063 MET A CA    1 
ATOM   8343  C  C     . MET A 1  1063 ? 124.522 53.956  -13.252 1.00 87.01  ? 1063 MET A C     1 
ATOM   8344  O  O     . MET A 1  1063 ? 123.745 53.759  -12.306 1.00 87.18  ? 1063 MET A O     1 
ATOM   8345  C  CB    . MET A 1  1063 ? 123.800 51.773  -14.394 1.00 82.13  ? 1063 MET A CB    1 
ATOM   8346  C  CG    . MET A 1  1063 ? 124.153 50.731  -15.430 1.00 84.59  ? 1063 MET A CG    1 
ATOM   8347  S  SD    . MET A 1  1063 ? 124.144 51.317  -17.147 1.00 87.94  ? 1063 MET A SD    1 
ATOM   8348  C  CE    . MET A 1  1063 ? 122.587 52.293  -17.163 1.00 84.27  ? 1063 MET A CE    1 
ATOM   8349  N  N     . VAL A 1  1064 ? 125.230 55.062  -13.384 1.00 84.08  ? 1064 VAL A N     1 
ATOM   8350  C  CA    . VAL A 1  1064 ? 125.194 56.172  -12.460 1.00 84.67  ? 1064 VAL A CA    1 
ATOM   8351  C  C     . VAL A 1  1064 ? 123.877 56.934  -12.459 1.00 89.22  ? 1064 VAL A C     1 
ATOM   8352  O  O     . VAL A 1  1064 ? 123.613 57.670  -11.508 1.00 89.38  ? 1064 VAL A O     1 
ATOM   8353  C  CB    . VAL A 1  1064 ? 126.429 57.065  -12.661 1.00 89.38  ? 1064 VAL A CB    1 
ATOM   8354  C  CG1   . VAL A 1  1064 ? 127.676 56.362  -12.127 1.00 89.34  ? 1064 VAL A CG1   1 
ATOM   8355  C  CG2   . VAL A 1  1064 ? 126.603 57.459  -14.137 1.00 89.20  ? 1064 VAL A CG2   1 
ATOM   8356  N  N     . GLY A 1  1065 ? 123.072 56.739  -13.509 1.00 85.27  ? 1065 GLY A N     1 
ATOM   8357  C  CA    . GLY A 1  1065 ? 121.770 57.373  -13.658 1.00 84.51  ? 1065 GLY A CA    1 
ATOM   8358  C  C     . GLY A 1  1065 ? 120.791 56.783  -12.676 1.00 86.30  ? 1065 GLY A C     1 
ATOM   8359  O  O     . GLY A 1  1065 ? 120.260 57.493  -11.813 1.00 86.19  ? 1065 GLY A O     1 
ATOM   8360  N  N     . VAL A 1  1066 ? 120.601 55.451  -12.770 1.00 80.54  ? 1066 VAL A N     1 
ATOM   8361  C  CA    . VAL A 1  1066 ? 119.723 54.676  -11.876 1.00 78.54  ? 1066 VAL A CA    1 
ATOM   8362  C  C     . VAL A 1  1066 ? 120.182 54.915  -10.454 1.00 79.03  ? 1066 VAL A C     1 
ATOM   8363  O  O     . VAL A 1  1066 ? 119.379 55.324  -9.617  1.00 79.02  ? 1066 VAL A O     1 
ATOM   8364  C  CB    . VAL A 1  1066 ? 119.735 53.173  -12.221 1.00 81.61  ? 1066 VAL A CB    1 
ATOM   8365  C  CG1   . VAL A 1  1066 ? 118.718 52.402  -11.390 1.00 80.31  ? 1066 VAL A CG1   1 
ATOM   8366  C  CG2   . VAL A 1  1066 ? 119.498 52.965  -13.707 1.00 81.80  ? 1066 VAL A CG2   1 
ATOM   8367  N  N     . LEU A 1  1067 ? 121.494 54.735  -10.211 1.00 72.59  ? 1067 LEU A N     1 
ATOM   8368  C  CA    . LEU A 1  1067 ? 122.089 54.974  -8.913  1.00 71.58  ? 1067 LEU A CA    1 
ATOM   8369  C  C     . LEU A 1  1067 ? 121.710 56.372  -8.366  1.00 76.98  ? 1067 LEU A C     1 
ATOM   8370  O  O     . LEU A 1  1067 ? 121.227 56.453  -7.237  1.00 77.02  ? 1067 LEU A O     1 
ATOM   8371  C  CB    . LEU A 1  1067 ? 123.609 54.744  -8.949  1.00 70.98  ? 1067 LEU A CB    1 
ATOM   8372  C  CG    . LEU A 1  1067 ? 124.388 54.994  -7.654  1.00 75.24  ? 1067 LEU A CG    1 
ATOM   8373  C  CD1   . LEU A 1  1067 ? 123.862 54.169  -6.525  1.00 75.22  ? 1067 LEU A CD1   1 
ATOM   8374  C  CD2   . LEU A 1  1067 ? 125.822 54.616  -7.823  1.00 79.40  ? 1067 LEU A CD2   1 
ATOM   8375  N  N     . ALA A 1  1068 ? 121.853 57.442  -9.174  1.00 74.00  ? 1068 ALA A N     1 
ATOM   8376  C  CA    . ALA A 1  1068 ? 121.517 58.791  -8.726  1.00 74.16  ? 1068 ALA A CA    1 
ATOM   8377  C  C     . ALA A 1  1068 ? 120.038 58.861  -8.349  1.00 79.24  ? 1068 ALA A C     1 
ATOM   8378  O  O     . ALA A 1  1068 ? 119.712 59.308  -7.242  1.00 79.66  ? 1068 ALA A O     1 
ATOM   8379  C  CB    . ALA A 1  1068 ? 121.849 59.814  -9.801  1.00 75.05  ? 1068 ALA A CB    1 
ATOM   8380  N  N     . ALA A 1  1069 ? 119.157 58.334  -9.230  1.00 75.24  ? 1069 ALA A N     1 
ATOM   8381  C  CA    . ALA A 1  1069 ? 117.702 58.311  -9.026  1.00 74.53  ? 1069 ALA A CA    1 
ATOM   8382  C  C     . ALA A 1  1069 ? 117.321 57.689  -7.660  1.00 75.64  ? 1069 ALA A C     1 
ATOM   8383  O  O     . ALA A 1  1069 ? 116.649 58.316  -6.830  1.00 73.36  ? 1069 ALA A O     1 
ATOM   8384  C  CB    . ALA A 1  1069 ? 117.041 57.550  -10.163 1.00 74.74  ? 1069 ALA A CB    1 
ATOM   8385  N  N     . GLN A 1  1070 ? 117.837 56.481  -7.430  1.00 71.53  ? 1070 GLN A N     1 
ATOM   8386  C  CA    . GLN A 1  1070 ? 117.650 55.706  -6.221  1.00 71.06  ? 1070 GLN A CA    1 
ATOM   8387  C  C     . GLN A 1  1070 ? 118.255 56.417  -5.010  1.00 75.51  ? 1070 GLN A C     1 
ATOM   8388  O  O     . GLN A 1  1070 ? 117.620 56.466  -3.957  1.00 74.86  ? 1070 GLN A O     1 
ATOM   8389  C  CB    . GLN A 1  1070 ? 118.283 54.317  -6.394  1.00 71.80  ? 1070 GLN A CB    1 
ATOM   8390  C  CG    . GLN A 1  1070 ? 117.622 53.445  -7.444  1.00 77.56  ? 1070 GLN A CG    1 
ATOM   8391  C  CD    . GLN A 1  1070 ? 118.138 52.037  -7.380  1.00 102.20 ? 1070 GLN A CD    1 
ATOM   8392  O  OE1   . GLN A 1  1070 ? 119.275 51.788  -6.935  1.00 99.39  ? 1070 GLN A OE1   1 
ATOM   8393  N  NE2   . GLN A 1  1070 ? 117.302 51.083  -7.813  1.00 94.25  ? 1070 GLN A NE2   1 
ATOM   8394  N  N     . SER A 1  1071 ? 119.464 56.984  -5.167  1.00 73.28  ? 1071 SER A N     1 
ATOM   8395  C  CA    . SER A 1  1071 ? 120.150 57.693  -4.091  1.00 74.48  ? 1071 SER A CA    1 
ATOM   8396  C  C     . SER A 1  1071 ? 119.428 58.950  -3.604  1.00 80.63  ? 1071 SER A C     1 
ATOM   8397  O  O     . SER A 1  1071 ? 119.694 59.378  -2.477  1.00 80.01  ? 1071 SER A O     1 
ATOM   8398  C  CB    . SER A 1  1071 ? 121.597 57.983  -4.457  1.00 77.97  ? 1071 SER A CB    1 
ATOM   8399  O  OG    . SER A 1  1071 ? 122.247 56.743  -4.670  1.00 86.68  ? 1071 SER A OG    1 
ATOM   8400  N  N     . ILE A 1  1072 ? 118.506 59.522  -4.438  1.00 78.40  ? 1072 ILE A N     1 
ATOM   8401  C  CA    . ILE A 1  1072 ? 117.671 60.684  -4.075  1.00 79.12  ? 1072 ILE A CA    1 
ATOM   8402  C  C     . ILE A 1  1072 ? 116.310 60.150  -3.609  1.00 84.77  ? 1072 ILE A C     1 
ATOM   8403  O  O     . ILE A 1  1072 ? 115.772 60.613  -2.603  1.00 84.08  ? 1072 ILE A O     1 
ATOM   8404  C  CB    . ILE A 1  1072 ? 117.473 61.727  -5.227  1.00 81.72  ? 1072 ILE A CB    1 
ATOM   8405  C  CG1   . ILE A 1  1072 ? 118.780 62.117  -5.907  1.00 82.49  ? 1072 ILE A CG1   1 
ATOM   8406  C  CG2   . ILE A 1  1072 ? 116.722 62.967  -4.732  1.00 81.00  ? 1072 ILE A CG2   1 
ATOM   8407  C  CD1   . ILE A 1  1072 ? 118.574 62.871  -7.214  1.00 94.11  ? 1072 ILE A CD1   1 
ATOM   8408  N  N     . GLY A 1  1073 ? 115.772 59.210  -4.390  1.00 82.82  ? 1073 GLY A N     1 
ATOM   8409  C  CA    . GLY A 1  1073 ? 114.468 58.586  -4.201  1.00 83.10  ? 1073 GLY A CA    1 
ATOM   8410  C  C     . GLY A 1  1073 ? 114.248 57.905  -2.871  1.00 87.14  ? 1073 GLY A C     1 
ATOM   8411  O  O     . GLY A 1  1073 ? 113.290 58.251  -2.175  1.00 86.63  ? 1073 GLY A O     1 
ATOM   8412  N  N     . GLU A 1  1074 ? 115.126 56.920  -2.528  1.00 83.62  ? 1074 GLU A N     1 
ATOM   8413  C  CA    . GLU A 1  1074 ? 115.121 56.159  -1.267  1.00 83.21  ? 1074 GLU A CA    1 
ATOM   8414  C  C     . GLU A 1  1074 ? 114.957 57.085  -0.020  1.00 87.35  ? 1074 GLU A C     1 
ATOM   8415  O  O     . GLU A 1  1074 ? 113.957 56.923  0.703   1.00 85.88  ? 1074 GLU A O     1 
ATOM   8416  C  CB    . GLU A 1  1074 ? 116.363 55.251  -1.172  1.00 84.08  ? 1074 GLU A CB    1 
ATOM   8417  C  CG    . GLU A 1  1074 ? 116.318 54.242  -0.042  1.00 93.37  ? 1074 GLU A CG    1 
ATOM   8418  C  CD    . GLU A 1  1074 ? 116.753 54.718  1.331   1.00 118.97 ? 1074 GLU A CD    1 
ATOM   8419  O  OE1   . GLU A 1  1074 ? 117.463 55.747  1.426   1.00 104.55 ? 1074 GLU A OE1   1 
ATOM   8420  O  OE2   . GLU A 1  1074 ? 116.384 54.043  2.321   1.00 134.31 ? 1074 GLU A OE2   1 
ATOM   8421  N  N     . PRO A 1  1075 ? 115.867 58.085  0.198   1.00 85.23  ? 1075 PRO A N     1 
ATOM   8422  C  CA    . PRO A 1  1075 ? 115.690 59.020  1.331   1.00 86.38  ? 1075 PRO A CA    1 
ATOM   8423  C  C     . PRO A 1  1075 ? 114.329 59.727  1.382   1.00 93.08  ? 1075 PRO A C     1 
ATOM   8424  O  O     . PRO A 1  1075 ? 113.780 59.876  2.470   1.00 94.14  ? 1075 PRO A O     1 
ATOM   8425  C  CB    . PRO A 1  1075 ? 116.802 60.055  1.117   1.00 88.36  ? 1075 PRO A CB    1 
ATOM   8426  C  CG    . PRO A 1  1075 ? 117.803 59.370  0.301   1.00 92.16  ? 1075 PRO A CG    1 
ATOM   8427  C  CD    . PRO A 1  1075 ? 117.081 58.420  -0.578  1.00 86.71  ? 1075 PRO A CD    1 
ATOM   8428  N  N     . ALA A 1  1076 ? 113.786 60.158  0.214   1.00 90.09  ? 1076 ALA A N     1 
ATOM   8429  C  CA    . ALA A 1  1076 ? 112.494 60.830  0.094   1.00 90.27  ? 1076 ALA A CA    1 
ATOM   8430  C  C     . ALA A 1  1076 ? 111.396 59.965  0.665   1.00 98.78  ? 1076 ALA A C     1 
ATOM   8431  O  O     . ALA A 1  1076 ? 110.462 60.501  1.236   1.00 98.52  ? 1076 ALA A O     1 
ATOM   8432  C  CB    . ALA A 1  1076 ? 112.196 61.147  -1.357  1.00 90.34  ? 1076 ALA A CB    1 
ATOM   8433  N  N     . THR A 1  1077 ? 111.519 58.627  0.544   1.00 99.39  ? 1077 THR A N     1 
ATOM   8434  C  CA    . THR A 1  1077 ? 110.546 57.669  1.065   1.00 100.83 ? 1077 THR A CA    1 
ATOM   8435  C  C     . THR A 1  1077 ? 110.667 57.575  2.576   1.00 111.96 ? 1077 THR A C     1 
ATOM   8436  O  O     . THR A 1  1077 ? 109.676 57.356  3.277   1.00 111.33 ? 1077 THR A O     1 
ATOM   8437  C  CB    . THR A 1  1077 ? 110.700 56.345  0.345   1.00 102.00 ? 1077 THR A CB    1 
ATOM   8438  O  OG1   . THR A 1  1077 ? 110.656 56.613  -1.054  1.00 100.40 ? 1077 THR A OG1   1 
ATOM   8439  C  CG2   . THR A 1  1077 ? 109.584 55.387  0.666   1.00 101.98 ? 1077 THR A CG2   1 
ATOM   8440  N  N     . GLN A 1  1078 ? 111.883 57.799  3.072   1.00 114.78 ? 1078 GLN A N     1 
ATOM   8441  C  CA    . GLN A 1  1078 ? 112.190 57.763  4.495   1.00 117.75 ? 1078 GLN A CA    1 
ATOM   8442  C  C     . GLN A 1  1078 ? 111.876 59.051  5.246   1.00 125.75 ? 1078 GLN A C     1 
ATOM   8443  O  O     . GLN A 1  1078 ? 111.963 59.070  6.469   1.00 125.53 ? 1078 GLN A O     1 
ATOM   8444  C  CB    . GLN A 1  1078 ? 113.609 57.206  4.753   1.00 119.67 ? 1078 GLN A CB    1 
ATOM   8445  C  CG    . GLN A 1  1078 ? 113.653 55.674  5.002   1.00 143.17 ? 1078 GLN A CG    1 
ATOM   8446  C  CD    . GLN A 1  1078 ? 112.582 54.852  4.289   1.00 161.21 ? 1078 GLN A CD    1 
ATOM   8447  O  OE1   . GLN A 1  1078 ? 112.601 54.674  3.065   1.00 154.79 ? 1078 GLN A OE1   1 
ATOM   8448  N  NE2   . GLN A 1  1078 ? 111.606 54.360  5.044   1.00 153.92 ? 1078 GLN A NE2   1 
ATOM   8449  N  N     . MET A 1  1079 ? 111.462 60.107  4.535   1.00 126.45 ? 1079 MET A N     1 
ATOM   8450  C  CA    . MET A 1  1079 ? 111.026 61.333  5.201   1.00 129.41 ? 1079 MET A CA    1 
ATOM   8451  C  C     . MET A 1  1079 ? 109.492 61.336  5.380   1.00 140.98 ? 1079 MET A C     1 
ATOM   8452  O  O     . MET A 1  1079 ? 108.941 62.273  5.970   1.00 141.43 ? 1079 MET A O     1 
ATOM   8453  C  CB    . MET A 1  1079 ? 111.635 62.629  4.604   1.00 131.78 ? 1079 MET A CB    1 
ATOM   8454  C  CG    . MET A 1  1079 ? 111.138 63.036  3.227   1.00 134.62 ? 1079 MET A CG    1 
ATOM   8455  S  SD    . MET A 1  1079 ? 112.359 63.952  2.218   1.00 138.29 ? 1079 MET A SD    1 
ATOM   8456  C  CE    . MET A 1  1079 ? 112.547 65.477  3.156   1.00 135.87 ? 1079 MET A CE    1 
ATOM   8457  N  N     . THR A 1  1080 ? 108.829 60.213  4.919   1.00 142.18 ? 1080 THR A N     1 
ATOM   8458  C  CA    . THR A 1  1080 ? 107.376 59.890  4.996   1.00 143.81 ? 1080 THR A CA    1 
ATOM   8459  C  C     . THR A 1  1080 ? 107.102 58.662  5.898   1.00 149.90 ? 1080 THR A C     1 
ATOM   8460  O  O     . THR A 1  1080 ? 106.396 58.787  6.910   1.00 150.71 ? 1080 THR A O     1 
ATOM   8461  C  CB    . THR A 1  1080 ? 106.657 59.762  3.590   1.00 152.06 ? 1080 THR A CB    1 
ATOM   8462  O  OG1   . THR A 1  1080 ? 106.036 58.477  3.405   1.00 149.41 ? 1080 THR A OG1   1 
ATOM   8463  C  CG2   . THR A 1  1080 ? 107.550 60.069  2.417   1.00 151.00 ? 1080 THR A CG2   1 
ATOM   8464  N  N     . LEU A 1  1081 ? 107.644 57.480  5.504   1.00 145.77 ? 1081 LEU A N     1 
ATOM   8465  C  CA    . LEU A 1  1081 ? 107.460 56.207  6.208   1.00 155.75 ? 1081 LEU A CA    1 
ATOM   8466  C  C     . LEU A 1  1081 ? 108.195 56.152  7.551   1.00 175.43 ? 1081 LEU A C     1 
ATOM   8467  O  O     . LEU A 1  1081 ? 107.593 56.445  8.588   1.00 128.56 ? 1081 LEU A O     1 
ATOM   8468  C  CB    . LEU A 1  1081 ? 107.838 55.013  5.303   1.00 154.51 ? 1081 LEU A CB    1 
ATOM   8469  C  CG    . LEU A 1  1081 ? 106.855 54.682  4.175   1.00 157.50 ? 1081 LEU A CG    1 
ATOM   8470  C  CD1   . LEU A 1  1081 ? 107.512 53.844  3.122   1.00 156.25 ? 1081 LEU A CD1   1 
ATOM   8471  C  CD2   . LEU A 1  1081 ? 105.630 53.955  4.704   1.00 159.30 ? 1081 LEU A CD2   1 
ATOM   8472  N  N     . LYS A 1  1092 ? 110.842 82.567  8.092   1.00 161.00 ? 1092 LYS A N     1 
ATOM   8473  C  CA    . LYS A 1  1092 ? 109.812 82.369  7.062   1.00 160.42 ? 1092 LYS A CA    1 
ATOM   8474  C  C     . LYS A 1  1092 ? 109.502 80.857  6.824   1.00 162.97 ? 1092 LYS A C     1 
ATOM   8475  O  O     . LYS A 1  1092 ? 110.388 80.111  6.383   1.00 162.26 ? 1092 LYS A O     1 
ATOM   8476  C  CB    . LYS A 1  1092 ? 110.178 83.152  5.761   1.00 162.46 ? 1092 LYS A CB    1 
ATOM   8477  C  CG    . LYS A 1  1092 ? 109.434 82.767  4.462   1.00 163.50 ? 1092 LYS A CG    1 
ATOM   8478  C  CD    . LYS A 1  1092 ? 108.040 83.378  4.292   1.00 162.96 ? 1092 LYS A CD    1 
ATOM   8479  C  CE    . LYS A 1  1092 ? 107.261 82.731  3.161   1.00 155.62 ? 1092 LYS A CE    1 
ATOM   8480  N  NZ    . LYS A 1  1092 ? 107.665 83.230  1.815   1.00 150.58 ? 1092 LYS A NZ    1 
ATOM   8481  N  N     . LYS A 1  1093 ? 108.243 80.417  7.131   1.00 157.83 ? 1093 LYS A N     1 
ATOM   8482  C  CA    . LYS A 1  1093 ? 107.801 79.016  6.984   1.00 155.38 ? 1093 LYS A CA    1 
ATOM   8483  C  C     . LYS A 1  1093 ? 107.489 78.599  5.523   1.00 154.81 ? 1093 LYS A C     1 
ATOM   8484  O  O     . LYS A 1  1093 ? 106.330 78.602  5.088   1.00 154.24 ? 1093 LYS A O     1 
ATOM   8485  C  CB    . LYS A 1  1093 ? 106.691 78.642  7.997   1.00 157.84 ? 1093 LYS A CB    1 
ATOM   8486  C  CG    . LYS A 1  1093 ? 107.212 78.472  9.432   1.00 168.65 ? 1093 LYS A CG    1 
ATOM   8487  C  CD    . LYS A 1  1093 ? 106.322 77.561  10.291  1.00 174.74 ? 1093 LYS A CD    1 
ATOM   8488  C  CE    . LYS A 1  1093 ? 106.891 77.302  11.673  1.00 174.33 ? 1093 LYS A CE    1 
ATOM   8489  N  NZ    . LYS A 1  1093 ? 106.101 76.287  12.424  1.00 173.21 ? 1093 LYS A NZ    1 
ATOM   8490  N  N     . VAL A 1  1094 ? 108.562 78.244  4.781   1.00 147.53 ? 1094 VAL A N     1 
ATOM   8491  C  CA    . VAL A 1  1094 ? 108.541 77.843  3.372   1.00 144.99 ? 1094 VAL A CA    1 
ATOM   8492  C  C     . VAL A 1  1094 ? 108.314 76.330  3.192   1.00 143.59 ? 1094 VAL A C     1 
ATOM   8493  O  O     . VAL A 1  1094 ? 108.778 75.533  4.013   1.00 142.41 ? 1094 VAL A O     1 
ATOM   8494  C  CB    . VAL A 1  1094 ? 109.814 78.387  2.653   1.00 149.03 ? 1094 VAL A CB    1 
ATOM   8495  C  CG1   . VAL A 1  1094 ? 110.252 77.525  1.469   1.00 148.04 ? 1094 VAL A CG1   1 
ATOM   8496  C  CG2   . VAL A 1  1094 ? 109.608 79.826  2.207   1.00 149.73 ? 1094 VAL A CG2   1 
ATOM   8497  N  N     . THR A 1  1095 ? 107.575 75.958  2.115   1.00 136.62 ? 1095 THR A N     1 
ATOM   8498  C  CA    . THR A 1  1095 ? 107.273 74.580  1.719   1.00 133.91 ? 1095 THR A CA    1 
ATOM   8499  C  C     . THR A 1  1095 ? 108.570 73.823  1.545   1.00 135.61 ? 1095 THR A C     1 
ATOM   8500  O  O     . THR A 1  1095 ? 109.476 74.316  0.882   1.00 135.15 ? 1095 THR A O     1 
ATOM   8501  C  CB    . THR A 1  1095 ? 106.420 74.538  0.433   1.00 137.04 ? 1095 THR A CB    1 
ATOM   8502  O  OG1   . THR A 1  1095 ? 106.973 75.400  -0.569  1.00 133.04 ? 1095 THR A OG1   1 
ATOM   8503  C  CG2   . THR A 1  1095 ? 104.982 74.918  0.689   1.00 137.21 ? 1095 THR A CG2   1 
ATOM   8504  N  N     . SER A 1  1096 ? 108.697 72.680  2.220   1.00 131.16 ? 1096 SER A N     1 
ATOM   8505  C  CA    . SER A 1  1096 ? 109.883 71.811  2.171   1.00 129.89 ? 1096 SER A CA    1 
ATOM   8506  C  C     . SER A 1  1096 ? 109.475 70.329  2.209   1.00 130.89 ? 1096 SER A C     1 
ATOM   8507  O  O     . SER A 1  1096 ? 108.272 70.034  2.195   1.00 130.77 ? 1096 SER A O     1 
ATOM   8508  C  CB    . SER A 1  1096 ? 110.895 72.167  3.259   1.00 134.38 ? 1096 SER A CB    1 
ATOM   8509  O  OG    . SER A 1  1096 ? 110.258 72.531  4.473   1.00 147.57 ? 1096 SER A OG    1 
ATOM   8510  N  N     . GLY A 1  1097 ? 110.464 69.423  2.212   1.00 123.81 ? 1097 GLY A N     1 
ATOM   8511  C  CA    . GLY A 1  1097 ? 110.231 67.982  2.208   1.00 120.71 ? 1097 GLY A CA    1 
ATOM   8512  C  C     . GLY A 1  1097 ? 109.645 67.472  0.904   1.00 118.50 ? 1097 GLY A C     1 
ATOM   8513  O  O     . GLY A 1  1097 ? 109.831 68.098  -0.144  1.00 118.69 ? 1097 GLY A O     1 
ATOM   8514  N  N     . VAL A 1  1098 ? 108.909 66.342  0.972   1.00 109.77 ? 1098 VAL A N     1 
ATOM   8515  C  CA    . VAL A 1  1098 ? 108.245 65.663  -0.158  1.00 106.86 ? 1098 VAL A CA    1 
ATOM   8516  C  C     . VAL A 1  1098 ? 107.480 66.651  -1.087  1.00 108.17 ? 1098 VAL A C     1 
ATOM   8517  O  O     . VAL A 1  1098 ? 107.726 66.653  -2.299  1.00 106.28 ? 1098 VAL A O     1 
ATOM   8518  C  CB    . VAL A 1  1098 ? 107.337 64.493  0.315   1.00 109.42 ? 1098 VAL A CB    1 
ATOM   8519  C  CG1   . VAL A 1  1098 ? 106.849 63.654  -0.857  1.00 108.30 ? 1098 VAL A CG1   1 
ATOM   8520  C  CG2   . VAL A 1  1098 ? 108.040 63.619  1.340   1.00 108.96 ? 1098 VAL A CG2   1 
ATOM   8521  N  N     . PRO A 1  1099 ? 106.595 67.524  -0.547  1.00 104.05 ? 1099 PRO A N     1 
ATOM   8522  C  CA    . PRO A 1  1099 ? 105.858 68.450  -1.431  1.00 103.47 ? 1099 PRO A CA    1 
ATOM   8523  C  C     . PRO A 1  1099 ? 106.704 69.492  -2.158  1.00 103.90 ? 1099 PRO A C     1 
ATOM   8524  O  O     . PRO A 1  1099 ? 106.362 69.839  -3.296  1.00 102.95 ? 1099 PRO A O     1 
ATOM   8525  C  CB    . PRO A 1  1099 ? 104.835 69.088  -0.498  1.00 106.32 ? 1099 PRO A CB    1 
ATOM   8526  C  CG    . PRO A 1  1099 ? 105.443 68.967  0.860   1.00 111.36 ? 1099 PRO A CG    1 
ATOM   8527  C  CD    . PRO A 1  1099 ? 106.151 67.663  0.858   1.00 105.87 ? 1099 PRO A CD    1 
ATOM   8528  N  N     . ARG A 1  1100 ? 107.779 70.013  -1.513  1.00 98.30  ? 1100 ARG A N     1 
ATOM   8529  C  CA    . ARG A 1  1100 ? 108.653 70.950  -2.213  1.00 97.49  ? 1100 ARG A CA    1 
ATOM   8530  C  C     . ARG A 1  1100 ? 109.430 70.175  -3.260  1.00 99.47  ? 1100 ARG A C     1 
ATOM   8531  O  O     . ARG A 1  1100 ? 109.570 70.676  -4.372  1.00 101.28 ? 1100 ARG A O     1 
ATOM   8532  C  CB    . ARG A 1  1100 ? 109.610 71.720  -1.295  1.00 97.35  ? 1100 ARG A CB    1 
ATOM   8533  C  CG    . ARG A 1  1100 ? 110.652 72.631  -2.032  1.00 105.20 ? 1100 ARG A CG    1 
ATOM   8534  C  CD    . ARG A 1  1100 ? 110.037 73.776  -2.828  1.00 104.32 ? 1100 ARG A CD    1 
ATOM   8535  N  NE    . ARG A 1  1100 ? 111.026 74.614  -3.505  1.00 106.81 ? 1100 ARG A NE    1 
ATOM   8536  C  CZ    . ARG A 1  1100 ? 110.865 75.082  -4.739  1.00 128.09 ? 1100 ARG A CZ    1 
ATOM   8537  N  NH1   . ARG A 1  1100 ? 109.783 74.771  -5.440  1.00 122.52 ? 1100 ARG A NH1   1 
ATOM   8538  N  NH2   . ARG A 1  1100 ? 111.792 75.854  -5.289  1.00 114.88 ? 1100 ARG A NH2   1 
ATOM   8539  N  N     . LEU A 1  1101 ? 109.904 68.947  -2.935  1.00 90.72  ? 1101 LEU A N     1 
ATOM   8540  C  CA    . LEU A 1  1101 ? 110.613 68.117  -3.908  1.00 87.49  ? 1101 LEU A CA    1 
ATOM   8541  C  C     . LEU A 1  1101 ? 109.709 67.896  -5.118  1.00 91.11  ? 1101 LEU A C     1 
ATOM   8542  O  O     . LEU A 1  1101 ? 110.167 68.031  -6.255  1.00 90.39  ? 1101 LEU A O     1 
ATOM   8543  C  CB    . LEU A 1  1101 ? 111.021 66.785  -3.279  1.00 85.75  ? 1101 LEU A CB    1 
ATOM   8544  C  CG    . LEU A 1  1101 ? 111.528 65.709  -4.224  1.00 87.56  ? 1101 LEU A CG    1 
ATOM   8545  C  CD1   . LEU A 1  1101 ? 112.884 66.072  -4.830  1.00 86.46  ? 1101 LEU A CD1   1 
ATOM   8546  C  CD2   . LEU A 1  1101 ? 111.532 64.374  -3.533  1.00 88.18  ? 1101 LEU A CD2   1 
ATOM   8547  N  N     . LYS A 1  1102 ? 108.408 67.625  -4.850  1.00 87.91  ? 1102 LYS A N     1 
ATOM   8548  C  CA    . LYS A 1  1102 ? 107.344 67.426  -5.835  1.00 87.72  ? 1102 LYS A CA    1 
ATOM   8549  C  C     . LYS A 1  1102 ? 107.216 68.691  -6.703  1.00 89.92  ? 1102 LYS A C     1 
ATOM   8550  O  O     . LYS A 1  1102 ? 107.225 68.593  -7.926  1.00 88.73  ? 1102 LYS A O     1 
ATOM   8551  C  CB    . LYS A 1  1102 ? 106.027 67.068  -5.101  1.00 91.53  ? 1102 LYS A CB    1 
ATOM   8552  C  CG    . LYS A 1  1102 ? 104.822 66.682  -5.981  1.00 112.91 ? 1102 LYS A CG    1 
ATOM   8553  C  CD    . LYS A 1  1102 ? 103.596 66.379  -5.094  1.00 125.80 ? 1102 LYS A CD    1 
ATOM   8554  C  CE    . LYS A 1  1102 ? 102.270 66.397  -5.815  1.00 135.36 ? 1102 LYS A CE    1 
ATOM   8555  N  NZ    . LYS A 1  1102 ? 101.141 66.235  -4.856  1.00 143.08 ? 1102 LYS A NZ    1 
ATOM   8556  N  N     . GLU A 1  1103 ? 107.184 69.869  -6.062  1.00 86.93  ? 1103 GLU A N     1 
ATOM   8557  C  CA    . GLU A 1  1103 ? 107.148 71.185  -6.702  1.00 88.09  ? 1103 GLU A CA    1 
ATOM   8558  C  C     . GLU A 1  1103 ? 108.328 71.292  -7.734  1.00 91.31  ? 1103 GLU A C     1 
ATOM   8559  O  O     . GLU A 1  1103 ? 108.088 71.611  -8.911  1.00 90.63  ? 1103 GLU A O     1 
ATOM   8560  C  CB    . GLU A 1  1103 ? 107.265 72.274  -5.588  1.00 90.44  ? 1103 GLU A CB    1 
ATOM   8561  C  CG    . GLU A 1  1103 ? 106.593 73.619  -5.834  1.00 101.80 ? 1103 GLU A CG    1 
ATOM   8562  C  CD    . GLU A 1  1103 ? 105.903 74.216  -4.613  1.00 128.10 ? 1103 GLU A CD    1 
ATOM   8563  O  OE1   . GLU A 1  1103 ? 104.707 73.904  -4.412  1.00 128.14 ? 1103 GLU A OE1   1 
ATOM   8564  O  OE2   . GLU A 1  1103 ? 106.541 74.998  -3.868  1.00 122.49 ? 1103 GLU A OE2   1 
ATOM   8565  N  N     . ILE A 1  1104 ? 109.579 70.940  -7.279  1.00 86.44  ? 1104 ILE A N     1 
ATOM   8566  C  CA    . ILE A 1  1104 ? 110.845 70.979  -8.027  1.00 85.35  ? 1104 ILE A CA    1 
ATOM   8567  C  C     . ILE A 1  1104 ? 110.811 70.116  -9.287  1.00 91.19  ? 1104 ILE A C     1 
ATOM   8568  O  O     . ILE A 1  1104 ? 110.851 70.658  -10.382 1.00 92.07  ? 1104 ILE A O     1 
ATOM   8569  C  CB    . ILE A 1  1104 ? 112.132 70.693  -7.167  1.00 87.23  ? 1104 ILE A CB    1 
ATOM   8570  C  CG1   . ILE A 1  1104 ? 112.219 71.541  -5.875  1.00 86.85  ? 1104 ILE A CG1   1 
ATOM   8571  C  CG2   . ILE A 1  1104 ? 113.408 70.864  -8.018  1.00 87.83  ? 1104 ILE A CG2   1 
ATOM   8572  C  CD1   . ILE A 1  1104 ? 113.397 71.176  -4.873  1.00 80.29  ? 1104 ILE A CD1   1 
ATOM   8573  N  N     . LEU A 1  1105 ? 110.770 68.790  -9.140  1.00 88.20  ? 1105 LEU A N     1 
ATOM   8574  C  CA    . LEU A 1  1105 ? 110.774 67.854  -10.267 1.00 88.63  ? 1105 LEU A CA    1 
ATOM   8575  C  C     . LEU A 1  1105 ? 109.710 68.163  -11.317 1.00 94.73  ? 1105 LEU A C     1 
ATOM   8576  O  O     . LEU A 1  1105 ? 109.939 67.975  -12.514 1.00 93.65  ? 1105 LEU A O     1 
ATOM   8577  C  CB    . LEU A 1  1105 ? 110.658 66.398  -9.773  1.00 88.17  ? 1105 LEU A CB    1 
ATOM   8578  C  CG    . LEU A 1  1105 ? 111.604 65.975  -8.629  1.00 92.18  ? 1105 LEU A CG    1 
ATOM   8579  C  CD1   . LEU A 1  1105 ? 111.167 64.683  -8.037  1.00 91.35  ? 1105 LEU A CD1   1 
ATOM   8580  C  CD2   . LEU A 1  1105 ? 113.057 65.885  -9.084  1.00 93.93  ? 1105 LEU A CD2   1 
ATOM   8581  N  N     . ASN A 1  1106 ? 108.576 68.694  -10.864 1.00 94.45  ? 1106 ASN A N     1 
ATOM   8582  C  CA    . ASN A 1  1106 ? 107.473 69.089  -11.724 1.00 96.21  ? 1106 ASN A CA    1 
ATOM   8583  C  C     . ASN A 1  1106 ? 107.735 70.388  -12.491 1.00 104.18 ? 1106 ASN A C     1 
ATOM   8584  O  O     . ASN A 1  1106 ? 107.015 70.680  -13.459 1.00 103.26 ? 1106 ASN A O     1 
ATOM   8585  C  CB    . ASN A 1  1106 ? 106.214 69.255  -10.886 1.00 97.85  ? 1106 ASN A CB    1 
ATOM   8586  C  CG    . ASN A 1  1106 ? 105.537 67.965  -10.532 1.00 124.05 ? 1106 ASN A CG    1 
ATOM   8587  O  OD1   . ASN A 1  1106 ? 104.748 67.911  -9.588  1.00 124.90 ? 1106 ASN A OD1   1 
ATOM   8588  N  ND2   . ASN A 1  1106 ? 105.790 66.907  -11.298 1.00 111.69 ? 1106 ASN A ND2   1 
ATOM   8589  N  N     . VAL A 1  1107 ? 108.738 71.185  -12.040 1.00 104.07 ? 1107 VAL A N     1 
ATOM   8590  C  CA    . VAL A 1  1107 ? 109.064 72.520  -12.573 1.00 105.70 ? 1107 VAL A CA    1 
ATOM   8591  C  C     . VAL A 1  1107 ? 107.727 73.261  -12.590 1.00 113.07 ? 1107 VAL A C     1 
ATOM   8592  O  O     . VAL A 1  1107 ? 107.218 73.671  -13.641 1.00 113.34 ? 1107 VAL A O     1 
ATOM   8593  C  CB    . VAL A 1  1107 ? 109.843 72.543  -13.923 1.00 109.18 ? 1107 VAL A CB    1 
ATOM   8594  C  CG1   . VAL A 1  1107 ? 110.248 73.968  -14.300 1.00 109.71 ? 1107 VAL A CG1   1 
ATOM   8595  C  CG2   . VAL A 1  1107 ? 111.077 71.655  -13.854 1.00 108.33 ? 1107 VAL A CG2   1 
ATOM   8596  N  N     . ALA A 1  1108 ? 107.096 73.264  -11.403 1.00 111.19 ? 1108 ALA A N     1 
ATOM   8597  C  CA    . ALA A 1  1108 ? 105.795 73.850  -11.174 1.00 112.40 ? 1108 ALA A CA    1 
ATOM   8598  C  C     . ALA A 1  1108 ? 105.951 75.341  -11.278 1.00 120.62 ? 1108 ALA A C     1 
ATOM   8599  O  O     . ALA A 1  1108 ? 106.887 75.890  -10.673 1.00 121.44 ? 1108 ALA A O     1 
ATOM   8600  C  CB    . ALA A 1  1108 ? 105.302 73.466  -9.792  1.00 112.91 ? 1108 ALA A CB    1 
ATOM   8601  N  N     . LYS A 1  1109 ? 105.101 75.999  -12.099 1.00 119.24 ? 1109 LYS A N     1 
ATOM   8602  C  CA    . LYS A 1  1109 ? 105.211 77.449  -12.218 1.00 120.74 ? 1109 LYS A CA    1 
ATOM   8603  C  C     . LYS A 1  1109 ? 104.619 78.154  -10.994 1.00 127.00 ? 1109 LYS A C     1 
ATOM   8604  O  O     . LYS A 1  1109 ? 105.338 78.893  -10.302 1.00 127.62 ? 1109 LYS A O     1 
ATOM   8605  C  CB    . LYS A 1  1109 ? 104.670 78.000  -13.551 1.00 123.24 ? 1109 LYS A CB    1 
ATOM   8606  C  CG    . LYS A 1  1109 ? 104.814 79.539  -13.684 1.00 139.54 ? 1109 LYS A CG    1 
ATOM   8607  C  CD    . LYS A 1  1109 ? 106.269 80.091  -13.540 1.00 146.80 ? 1109 LYS A CD    1 
ATOM   8608  C  CE    . LYS A 1  1109 ? 106.332 81.597  -13.404 1.00 151.54 ? 1109 LYS A CE    1 
ATOM   8609  N  NZ    . LYS A 1  1109 ? 107.733 82.098  -13.360 1.00 155.81 ? 1109 LYS A NZ    1 
ATOM   8610  N  N     . ASN A 1  1110 ? 103.335 77.884  -10.699 1.00 123.65 ? 1110 ASN A N     1 
ATOM   8611  C  CA    . ASN A 1  1110 ? 102.653 78.491  -9.561  1.00 123.92 ? 1110 ASN A CA    1 
ATOM   8612  C  C     . ASN A 1  1110 ? 103.095 77.822  -8.268  1.00 123.11 ? 1110 ASN A C     1 
ATOM   8613  O  O     . ASN A 1  1110 ? 102.396 76.948  -7.756  1.00 121.70 ? 1110 ASN A O     1 
ATOM   8614  C  CB    . ASN A 1  1110 ? 101.121 78.472  -9.766  1.00 131.09 ? 1110 ASN A CB    1 
ATOM   8615  C  CG    . ASN A 1  1110 ? 100.617 79.333  -10.924 1.00 170.64 ? 1110 ASN A CG    1 
ATOM   8616  O  OD1   . ASN A 1  1110 ? 101.132 80.429  -11.221 1.00 168.98 ? 1110 ASN A OD1   1 
ATOM   8617  N  ND2   . ASN A 1  1110 ? 99.554  78.876  -11.577 1.00 163.99 ? 1110 ASN A ND2   1 
ATOM   8618  N  N     . MET A 1  1111 ? 104.300 78.193  -7.782  1.00 117.63 ? 1111 MET A N     1 
ATOM   8619  C  CA    . MET A 1  1111 ? 104.860 77.602  -6.566  1.00 116.21 ? 1111 MET A CA    1 
ATOM   8620  C  C     . MET A 1  1111 ? 104.196 78.067  -5.290  1.00 119.57 ? 1111 MET A C     1 
ATOM   8621  O  O     . MET A 1  1111 ? 103.574 79.126  -5.294  1.00 119.95 ? 1111 MET A O     1 
ATOM   8622  C  CB    . MET A 1  1111 ? 106.401 77.554  -6.538  1.00 118.10 ? 1111 MET A CB    1 
ATOM   8623  C  CG    . MET A 1  1111 ? 107.106 78.887  -6.542  1.00 122.16 ? 1111 MET A CG    1 
ATOM   8624  S  SD    . MET A 1  1111 ? 108.782 78.756  -5.842  1.00 125.62 ? 1111 MET A SD    1 
ATOM   8625  C  CE    . MET A 1  1111 ? 108.382 78.342  -4.103  1.00 121.97 ? 1111 MET A CE    1 
ATOM   8626  N  N     . LYS A 1  1112 ? 104.232 77.241  -4.239  1.00 116.08 ? 1112 LYS A N     1 
ATOM   8627  C  CA    . LYS A 1  1112 ? 103.507 77.529  -3.002  1.00 117.57 ? 1112 LYS A CA    1 
ATOM   8628  C  C     . LYS A 1  1112 ? 103.960 78.697  -2.160  1.00 123.14 ? 1112 LYS A C     1 
ATOM   8629  O  O     . LYS A 1  1112 ? 103.137 79.570  -1.878  1.00 123.82 ? 1112 LYS A O     1 
ATOM   8630  C  CB    . LYS A 1  1112 ? 103.199 76.268  -2.168  1.00 120.93 ? 1112 LYS A CB    1 
ATOM   8631  C  CG    . LYS A 1  1112 ? 101.930 75.526  -2.634  1.00 140.41 ? 1112 LYS A CG    1 
ATOM   8632  C  CD    . LYS A 1  1112 ? 101.792 74.084  -2.098  1.00 147.60 ? 1112 LYS A CD    1 
ATOM   8633  C  CE    . LYS A 1  1112 ? 100.782 73.305  -2.921  1.00 154.79 ? 1112 LYS A CE    1 
ATOM   8634  N  NZ    . LYS A 1  1112 ? 100.421 71.993  -2.317  1.00 158.91 ? 1112 LYS A NZ    1 
ATOM   8635  N  N     . THR A 1  1113 ? 105.246 78.741  -1.767  1.00 119.83 ? 1113 THR A N     1 
ATOM   8636  C  CA    . THR A 1  1113 ? 105.788 79.826  -0.930  1.00 119.99 ? 1113 THR A CA    1 
ATOM   8637  C  C     . THR A 1  1113 ? 106.852 80.655  -1.693  1.00 122.95 ? 1113 THR A C     1 
ATOM   8638  O  O     . THR A 1  1113 ? 107.997 80.660  -1.228  1.00 123.46 ? 1113 THR A O     1 
ATOM   8639  C  CB    . THR A 1  1113 ? 106.368 79.242  0.394   1.00 128.35 ? 1113 THR A CB    1 
ATOM   8640  O  OG1   . THR A 1  1113 ? 107.312 78.214  0.088   1.00 128.14 ? 1113 THR A OG1   1 
ATOM   8641  C  CG2   . THR A 1  1113 ? 105.304 78.686  1.325   1.00 128.11 ? 1113 THR A CG2   1 
ATOM   8642  N  N     . PRO A 1  1114 ? 106.563 81.343  -2.847  1.00 117.88 ? 1114 PRO A N     1 
ATOM   8643  C  CA    . PRO A 1  1114 ? 107.643 82.089  -3.537  1.00 117.72 ? 1114 PRO A CA    1 
ATOM   8644  C  C     . PRO A 1  1114 ? 108.258 83.162  -2.650  1.00 122.99 ? 1114 PRO A C     1 
ATOM   8645  O  O     . PRO A 1  1114 ? 107.526 83.905  -1.995  1.00 124.15 ? 1114 PRO A O     1 
ATOM   8646  C  CB    . PRO A 1  1114 ? 106.963 82.662  -4.788  1.00 119.44 ? 1114 PRO A CB    1 
ATOM   8647  C  CG    . PRO A 1  1114 ? 105.709 81.873  -4.954  1.00 123.16 ? 1114 PRO A CG    1 
ATOM   8648  C  CD    . PRO A 1  1114 ? 105.284 81.484  -3.572  1.00 118.87 ? 1114 PRO A CD    1 
ATOM   8649  N  N     . SER A 1  1115 ? 109.594 83.157  -2.531  1.00 119.00 ? 1115 SER A N     1 
ATOM   8650  C  CA    . SER A 1  1115 ? 110.314 84.089  -1.661  1.00 119.53 ? 1115 SER A CA    1 
ATOM   8651  C  C     . SER A 1  1115 ? 111.669 84.502  -2.186  1.00 121.96 ? 1115 SER A C     1 
ATOM   8652  O  O     . SER A 1  1115 ? 112.481 83.683  -2.630  1.00 120.94 ? 1115 SER A O     1 
ATOM   8653  C  CB    . SER A 1  1115 ? 110.438 83.550  -0.236  1.00 123.64 ? 1115 SER A CB    1 
ATOM   8654  O  OG    . SER A 1  1115 ? 111.270 84.375  0.569   1.00 133.22 ? 1115 SER A OG    1 
ATOM   8655  N  N     . LEU A 1  1116 ? 111.917 85.787  -2.063  1.00 118.18 ? 1116 LEU A N     1 
ATOM   8656  C  CA    . LEU A 1  1116 ? 113.143 86.415  -2.481  1.00 117.83 ? 1116 LEU A CA    1 
ATOM   8657  C  C     . LEU A 1  1116 ? 113.975 86.739  -1.224  1.00 122.93 ? 1116 LEU A C     1 
ATOM   8658  O  O     . LEU A 1  1116 ? 113.407 86.977  -0.156  1.00 123.31 ? 1116 LEU A O     1 
ATOM   8659  C  CB    . LEU A 1  1116 ? 112.730 87.657  -3.247  1.00 118.30 ? 1116 LEU A CB    1 
ATOM   8660  C  CG    . LEU A 1  1116 ? 113.741 88.241  -4.135  1.00 123.18 ? 1116 LEU A CG    1 
ATOM   8661  C  CD1   . LEU A 1  1116 ? 113.297 88.149  -5.590  1.00 122.80 ? 1116 LEU A CD1   1 
ATOM   8662  C  CD2   . LEU A 1  1116 ? 114.006 89.657  -3.713  1.00 128.13 ? 1116 LEU A CD2   1 
ATOM   8663  N  N     . THR A 1  1117 ? 115.307 86.657  -1.324  1.00 119.59 ? 1117 THR A N     1 
ATOM   8664  C  CA    . THR A 1  1117 ? 116.202 86.940  -0.198  1.00 120.35 ? 1117 THR A CA    1 
ATOM   8665  C  C     . THR A 1  1117 ? 117.151 88.041  -0.657  1.00 127.18 ? 1117 THR A C     1 
ATOM   8666  O  O     . THR A 1  1117 ? 117.974 87.812  -1.551  1.00 126.66 ? 1117 THR A O     1 
ATOM   8667  C  CB    . THR A 1  1117 ? 116.870 85.655  0.347   1.00 126.85 ? 1117 THR A CB    1 
ATOM   8668  O  OG1   . THR A 1  1117 ? 115.905 84.606  0.399   1.00 127.53 ? 1117 THR A OG1   1 
ATOM   8669  C  CG2   . THR A 1  1117 ? 117.478 85.843  1.737   1.00 123.93 ? 1117 THR A CG2   1 
ATOM   8670  N  N     . VAL A 1  1118 ? 116.969 89.263  -0.095  1.00 126.07 ? 1118 VAL A N     1 
ATOM   8671  C  CA    . VAL A 1  1118 ? 117.723 90.480  -0.441  1.00 126.76 ? 1118 VAL A CA    1 
ATOM   8672  C  C     . VAL A 1  1118 ? 118.850 90.845  0.525   1.00 132.21 ? 1118 VAL A C     1 
ATOM   8673  O  O     . VAL A 1  1118 ? 118.607 91.131  1.704   1.00 131.14 ? 1118 VAL A O     1 
ATOM   8674  C  CB    . VAL A 1  1118 ? 116.857 91.702  -0.846  1.00 130.84 ? 1118 VAL A CB    1 
ATOM   8675  C  CG1   . VAL A 1  1118 ? 117.077 92.057  -2.304  1.00 130.47 ? 1118 VAL A CG1   1 
ATOM   8676  C  CG2   . VAL A 1  1118 ? 115.379 91.468  -0.577  1.00 130.37 ? 1118 VAL A CG2   1 
ATOM   8677  N  N     . TYR A 1  1119 ? 120.094 90.809  -0.005  1.00 130.76 ? 1119 TYR A N     1 
ATOM   8678  C  CA    . TYR A 1  1119 ? 121.331 91.124  0.702   1.00 132.00 ? 1119 TYR A CA    1 
ATOM   8679  C  C     . TYR A 1  1119 ? 121.696 92.568  0.410   1.00 140.18 ? 1119 TYR A C     1 
ATOM   8680  O  O     . TYR A 1  1119 ? 121.702 92.989  -0.752  1.00 139.64 ? 1119 TYR A O     1 
ATOM   8681  C  CB    . TYR A 1  1119 ? 122.466 90.185  0.267   1.00 132.10 ? 1119 TYR A CB    1 
ATOM   8682  C  CG    . TYR A 1  1119 ? 122.320 88.764  0.765   1.00 132.21 ? 1119 TYR A CG    1 
ATOM   8683  C  CD1   . TYR A 1  1119 ? 122.787 88.393  2.022   1.00 134.07 ? 1119 TYR A CD1   1 
ATOM   8684  C  CD2   . TYR A 1  1119 ? 121.729 87.783  -0.028  1.00 131.75 ? 1119 TYR A CD2   1 
ATOM   8685  C  CE1   . TYR A 1  1119 ? 122.675 87.081  2.478   1.00 133.67 ? 1119 TYR A CE1   1 
ATOM   8686  C  CE2   . TYR A 1  1119 ? 121.600 86.469  0.422   1.00 131.61 ? 1119 TYR A CE2   1 
ATOM   8687  C  CZ    . TYR A 1  1119 ? 122.072 86.124  1.678   1.00 139.21 ? 1119 TYR A CZ    1 
ATOM   8688  O  OH    . TYR A 1  1119 ? 121.945 84.836  2.138   1.00 139.64 ? 1119 TYR A OH    1 
ATOM   8689  N  N     . LEU A 1  1120 ? 121.977 93.325  1.477   1.00 140.19 ? 1120 LEU A N     1 
ATOM   8690  C  CA    . LEU A 1  1120 ? 122.298 94.751  1.457   1.00 142.58 ? 1120 LEU A CA    1 
ATOM   8691  C  C     . LEU A 1  1120 ? 123.626 95.055  0.774   1.00 149.53 ? 1120 LEU A C     1 
ATOM   8692  O  O     . LEU A 1  1120 ? 124.443 94.153  0.610   1.00 148.31 ? 1120 LEU A O     1 
ATOM   8693  C  CB    . LEU A 1  1120 ? 122.326 95.261  2.908   1.00 143.75 ? 1120 LEU A CB    1 
ATOM   8694  C  CG    . LEU A 1  1120 ? 121.014 95.787  3.510   1.00 149.22 ? 1120 LEU A CG    1 
ATOM   8695  C  CD1   . LEU A 1  1120 ? 119.978 94.681  3.692   1.00 148.29 ? 1120 LEU A CD1   1 
ATOM   8696  C  CD2   . LEU A 1  1120 ? 121.262 96.426  4.864   1.00 153.20 ? 1120 LEU A CD2   1 
ATOM   8697  N  N     . GLU A 1  1121 ? 123.849 96.337  0.407   1.00 149.88 ? 1121 GLU A N     1 
ATOM   8698  C  CA    . GLU A 1  1121 ? 125.072 96.845  -0.234  1.00 151.62 ? 1121 GLU A CA    1 
ATOM   8699  C  C     . GLU A 1  1121 ? 126.317 96.468  0.585   1.00 158.19 ? 1121 GLU A C     1 
ATOM   8700  O  O     . GLU A 1  1121 ? 126.243 96.511  1.818   1.00 158.07 ? 1121 GLU A O     1 
ATOM   8701  C  CB    . GLU A 1  1121 ? 124.996 98.373  -0.401  1.00 154.62 ? 1121 GLU A CB    1 
ATOM   8702  C  CG    . GLU A 1  1121 ? 125.465 98.864  -1.762  1.00 168.06 ? 1121 GLU A CG    1 
ATOM   8703  C  CD    . GLU A 1  1121 ? 124.599 99.939  -2.397  1.00 196.53 ? 1121 GLU A CD    1 
ATOM   8704  O  OE1   . GLU A 1  1121 ? 124.537 101.058 -1.837  1.00 196.00 ? 1121 GLU A OE1   1 
ATOM   8705  O  OE2   . GLU A 1  1121 ? 123.990 99.666  -3.459  1.00 189.05 ? 1121 GLU A OE2   1 
ATOM   8706  N  N     . PRO A 1  1122 ? 127.451 96.085  -0.070  1.00 156.54 ? 1122 PRO A N     1 
ATOM   8707  C  CA    . PRO A 1  1122 ? 128.653 95.657  0.683   1.00 157.13 ? 1122 PRO A CA    1 
ATOM   8708  C  C     . PRO A 1  1122 ? 129.001 96.364  1.997   1.00 163.93 ? 1122 PRO A C     1 
ATOM   8709  O  O     . PRO A 1  1122 ? 129.333 95.688  2.973   1.00 162.98 ? 1122 PRO A O     1 
ATOM   8710  C  CB    . PRO A 1  1122 ? 129.769 95.757  -0.355  1.00 158.98 ? 1122 PRO A CB    1 
ATOM   8711  C  CG    . PRO A 1  1122 ? 129.088 95.451  -1.639  1.00 162.50 ? 1122 PRO A CG    1 
ATOM   8712  C  CD    . PRO A 1  1122 ? 127.668 95.948  -1.529  1.00 157.79 ? 1122 PRO A CD    1 
ATOM   8713  N  N     . GLY A 1  1123 ? 128.890 97.693  2.020   1.00 163.49 ? 1123 GLY A N     1 
ATOM   8714  C  CA    . GLY A 1  1123 ? 129.188 98.506  3.195   1.00 165.30 ? 1123 GLY A CA    1 
ATOM   8715  C  C     . GLY A 1  1123 ? 128.250 98.263  4.358   1.00 170.92 ? 1123 GLY A C     1 
ATOM   8716  O  O     . GLY A 1  1123 ? 128.629 97.624  5.347   1.00 170.01 ? 1123 GLY A O     1 
ATOM   8717  N  N     . HIS A 1  1124 ? 127.006 98.751  4.214   1.00 169.47 ? 1124 HIS A N     1 
ATOM   8718  C  CA    . HIS A 1  1124 ? 125.917 98.673  5.195   1.00 170.29 ? 1124 HIS A CA    1 
ATOM   8719  C  C     . HIS A 1  1124 ? 125.505 97.232  5.521   1.00 171.77 ? 1124 HIS A C     1 
ATOM   8720  O  O     . HIS A 1  1124 ? 124.515 96.720  4.998   1.00 170.17 ? 1124 HIS A O     1 
ATOM   8721  C  CB    . HIS A 1  1124 ? 124.702 99.493  4.723   1.00 172.45 ? 1124 HIS A CB    1 
ATOM   8722  C  CG    . HIS A 1  1124 ? 125.036 100.608 3.782   1.00 177.47 ? 1124 HIS A CG    1 
ATOM   8723  N  ND1   . HIS A 1  1124 ? 125.347 100.361 2.454   1.00 178.92 ? 1124 HIS A ND1   1 
ATOM   8724  C  CD2   . HIS A 1  1124 ? 125.093 101.943 4.006   1.00 181.19 ? 1124 HIS A CD2   1 
ATOM   8725  C  CE1   . HIS A 1  1124 ? 125.587 101.546 1.916   1.00 179.62 ? 1124 HIS A CE1   1 
ATOM   8726  N  NE2   . HIS A 1  1124 ? 125.446 102.529 2.811   1.00 181.27 ? 1124 HIS A NE2   1 
ATOM   8727  N  N     . ALA A 1  1125 ? 126.279 96.579  6.379   1.00 167.69 ? 1125 ALA A N     1 
ATOM   8728  C  CA    . ALA A 1  1125 ? 125.987 95.217  6.796   1.00 165.99 ? 1125 ALA A CA    1 
ATOM   8729  C  C     . ALA A 1  1125 ? 125.177 95.269  8.092   1.00 169.61 ? 1125 ALA A C     1 
ATOM   8730  O  O     . ALA A 1  1125 ? 124.064 94.745  8.125   1.00 167.72 ? 1125 ALA A O     1 
ATOM   8731  C  CB    . ALA A 1  1125 ? 127.281 94.446  6.997   1.00 166.36 ? 1125 ALA A CB    1 
ATOM   8732  N  N     . ALA A 1  1126 ? 125.720 95.959  9.133   1.00 167.66 ? 1126 ALA A N     1 
ATOM   8733  C  CA    . ALA A 1  1126 ? 125.131 96.148  10.467  1.00 167.90 ? 1126 ALA A CA    1 
ATOM   8734  C  C     . ALA A 1  1126 ? 124.172 97.351  10.538  1.00 173.05 ? 1126 ALA A C     1 
ATOM   8735  O  O     . ALA A 1  1126 ? 123.577 97.602  11.595  1.00 173.66 ? 1126 ALA A O     1 
ATOM   8736  C  CB    . ALA A 1  1126 ? 126.234 96.286  11.508  1.00 169.34 ? 1126 ALA A CB    1 
ATOM   8737  N  N     . ASP A 1  1127 ? 124.003 98.075  9.405   1.00 169.20 ? 1127 ASP A N     1 
ATOM   8738  C  CA    . ASP A 1  1127 ? 123.106 99.229  9.282   1.00 169.45 ? 1127 ASP A CA    1 
ATOM   8739  C  C     . ASP A 1  1127 ? 121.643 98.746  9.256   1.00 169.03 ? 1127 ASP A C     1 
ATOM   8740  O  O     . ASP A 1  1127 ? 121.131 98.372  8.193   1.00 167.49 ? 1127 ASP A O     1 
ATOM   8741  C  CB    . ASP A 1  1127 ? 123.461 100.059 8.017   1.00 172.17 ? 1127 ASP A CB    1 
ATOM   8742  C  CG    . ASP A 1  1127 ? 122.943 101.501 7.929   1.00 185.41 ? 1127 ASP A CG    1 
ATOM   8743  O  OD1   . ASP A 1  1127 ? 122.076 101.884 8.757   1.00 187.31 ? 1127 ASP A OD1   1 
ATOM   8744  O  OD2   . ASP A 1  1127 ? 123.365 102.230 6.994   1.00 189.53 ? 1127 ASP A OD2   1 
ATOM   8745  N  N     . GLN A 1  1128 ? 120.987 98.726  10.441  1.00 163.44 ? 1128 GLN A N     1 
ATOM   8746  C  CA    . GLN A 1  1128 ? 119.589 98.304  10.571  1.00 161.67 ? 1128 GLN A CA    1 
ATOM   8747  C  C     . GLN A 1  1128 ? 118.650 99.320  9.919   1.00 164.52 ? 1128 GLN A C     1 
ATOM   8748  O  O     . GLN A 1  1128 ? 117.549 98.964  9.491   1.00 163.19 ? 1128 GLN A O     1 
ATOM   8749  C  CB    . GLN A 1  1128 ? 119.198 98.077  12.038  1.00 163.07 ? 1128 GLN A CB    1 
ATOM   8750  C  CG    . GLN A 1  1128 ? 117.925 97.238  12.161  1.00 172.80 ? 1128 GLN A CG    1 
ATOM   8751  C  CD    . GLN A 1  1128 ? 117.113 97.465  13.409  1.00 192.61 ? 1128 GLN A CD    1 
ATOM   8752  O  OE1   . GLN A 1  1128 ? 116.606 96.515  14.020  1.00 185.36 ? 1128 GLN A OE1   1 
ATOM   8753  N  NE2   . GLN A 1  1128 ? 116.899 98.726  13.777  1.00 188.81 ? 1128 GLN A NE2   1 
ATOM   8754  N  N     . GLU A 1  1129 ? 119.093 100.583 9.846   1.00 161.27 ? 1129 GLU A N     1 
ATOM   8755  C  CA    . GLU A 1  1129 ? 118.319 101.661 9.247   1.00 161.42 ? 1129 GLU A CA    1 
ATOM   8756  C  C     . GLU A 1  1129 ? 118.284 101.562 7.731   1.00 162.33 ? 1129 GLU A C     1 
ATOM   8757  O  O     . GLU A 1  1129 ? 117.237 101.830 7.144   1.00 162.01 ? 1129 GLU A O     1 
ATOM   8758  C  CB    . GLU A 1  1129 ? 118.776 103.040 9.748   1.00 164.72 ? 1129 GLU A CB    1 
ATOM   8759  C  CG    . GLU A 1  1129 ? 118.492 103.285 11.228  1.00 177.52 ? 1129 GLU A CG    1 
ATOM   8760  C  CD    . GLU A 1  1129 ? 117.042 103.188 11.674  1.00 196.68 ? 1129 GLU A CD    1 
ATOM   8761  O  OE1   . GLU A 1  1129 ? 116.250 104.096 11.331  1.00 189.90 ? 1129 GLU A OE1   1 
ATOM   8762  O  OE2   . GLU A 1  1129 ? 116.701 102.206 12.375  1.00 185.83 ? 1129 GLU A OE2   1 
ATOM   8763  N  N     . GLN A 1  1130 ? 119.401 101.128 7.103   1.00 156.68 ? 1130 GLN A N     1 
ATOM   8764  C  CA    . GLN A 1  1130 ? 119.503 100.896 5.652   1.00 154.91 ? 1130 GLN A CA    1 
ATOM   8765  C  C     . GLN A 1  1130 ? 118.541 99.748  5.299   1.00 154.37 ? 1130 GLN A C     1 
ATOM   8766  O  O     . GLN A 1  1130 ? 117.822 99.805  4.297   1.00 152.99 ? 1130 GLN A O     1 
ATOM   8767  C  CB    . GLN A 1  1130 ? 120.955 100.529 5.267   1.00 155.90 ? 1130 GLN A CB    1 
ATOM   8768  C  CG    . GLN A 1  1130 ? 121.158 100.049 3.825   1.00 166.02 ? 1130 GLN A CG    1 
ATOM   8769  C  CD    . GLN A 1  1130 ? 121.402 101.149 2.821   1.00 183.29 ? 1130 GLN A CD    1 
ATOM   8770  O  OE1   . GLN A 1  1130 ? 121.156 102.341 3.067   1.00 179.29 ? 1130 GLN A OE1   1 
ATOM   8771  N  NE2   . GLN A 1  1130 ? 121.882 100.756 1.648   1.00 172.50 ? 1130 GLN A NE2   1 
ATOM   8772  N  N     . ALA A 1  1131 ? 118.515 98.729  6.166   1.00 148.17 ? 1131 ALA A N     1 
ATOM   8773  C  CA    . ALA A 1  1131 ? 117.649 97.579  6.030   1.00 145.83 ? 1131 ALA A CA    1 
ATOM   8774  C  C     . ALA A 1  1131 ? 116.189 98.046  5.994   1.00 148.03 ? 1131 ALA A C     1 
ATOM   8775  O  O     . ALA A 1  1131 ? 115.487 97.730  5.031   1.00 147.18 ? 1131 ALA A O     1 
ATOM   8776  C  CB    . ALA A 1  1131 ? 117.895 96.614  7.178   1.00 146.05 ? 1131 ALA A CB    1 
ATOM   8777  N  N     . LYS A 1  1132 ? 115.782 98.899  6.972   1.00 143.69 ? 1132 LYS A N     1 
ATOM   8778  C  CA    . LYS A 1  1132 ? 114.434 99.481  7.088   1.00 142.89 ? 1132 LYS A CA    1 
ATOM   8779  C  C     . LYS A 1  1132 ? 114.064 100.295 5.853   1.00 144.62 ? 1132 LYS A C     1 
ATOM   8780  O  O     . LYS A 1  1132 ? 112.891 100.321 5.473   1.00 143.43 ? 1132 LYS A O     1 
ATOM   8781  C  CB    . LYS A 1  1132 ? 114.329 100.382 8.331   1.00 146.55 ? 1132 LYS A CB    1 
ATOM   8782  C  CG    . LYS A 1  1132 ? 114.208 99.637  9.647   1.00 158.83 ? 1132 LYS A CG    1 
ATOM   8783  C  CD    . LYS A 1  1132 ? 114.164 100.598 10.823  1.00 169.57 ? 1132 LYS A CD    1 
ATOM   8784  C  CE    . LYS A 1  1132 ? 114.028 99.872  12.137  1.00 179.56 ? 1132 LYS A CE    1 
ATOM   8785  N  NZ    . LYS A 1  1132 ? 114.193 100.787 13.295  1.00 189.17 ? 1132 LYS A NZ    1 
ATOM   8786  N  N     . LEU A 1  1133 ? 115.074 100.970 5.245   1.00 140.49 ? 1133 LEU A N     1 
ATOM   8787  C  CA    . LEU A 1  1133 ? 114.941 101.822 4.058   1.00 140.09 ? 1133 LEU A CA    1 
ATOM   8788  C  C     . LEU A 1  1133 ? 114.575 101.016 2.840   1.00 140.25 ? 1133 LEU A C     1 
ATOM   8789  O  O     . LEU A 1  1133 ? 113.666 101.413 2.109   1.00 139.16 ? 1133 LEU A O     1 
ATOM   8790  C  CB    . LEU A 1  1133 ? 116.230 102.620 3.788   1.00 140.96 ? 1133 LEU A CB    1 
ATOM   8791  C  CG    . LEU A 1  1133 ? 116.419 103.897 4.587   1.00 147.35 ? 1133 LEU A CG    1 
ATOM   8792  C  CD1   . LEU A 1  1133 ? 117.892 104.195 4.784   1.00 147.98 ? 1133 LEU A CD1   1 
ATOM   8793  C  CD2   . LEU A 1  1133 ? 115.717 105.068 3.916   1.00 151.21 ? 1133 LEU A CD2   1 
ATOM   8794  N  N     . ILE A 1  1134 ? 115.285 99.888  2.614   1.00 134.78 ? 1134 ILE A N     1 
ATOM   8795  C  CA    . ILE A 1  1134 ? 115.000 99.016  1.480   1.00 132.92 ? 1134 ILE A CA    1 
ATOM   8796  C  C     . ILE A 1  1134 ? 113.676 98.314  1.746   1.00 135.95 ? 1134 ILE A C     1 
ATOM   8797  O  O     . ILE A 1  1134 ? 112.821 98.306  0.860   1.00 135.32 ? 1134 ILE A O     1 
ATOM   8798  C  CB    . ILE A 1  1134 ? 116.176 98.082  1.082   1.00 134.66 ? 1134 ILE A CB    1 
ATOM   8799  C  CG1   . ILE A 1  1134 ? 117.401 98.913  0.672   1.00 135.55 ? 1134 ILE A CG1   1 
ATOM   8800  C  CG2   . ILE A 1  1134 ? 115.787 97.175  -0.089  1.00 134.44 ? 1134 ILE A CG2   1 
ATOM   8801  C  CD1   . ILE A 1  1134 ? 118.615 98.592  1.399   1.00 143.35 ? 1134 ILE A CD1   1 
ATOM   8802  N  N     . ARG A 1  1135 ? 113.463 97.847  3.002   1.00 131.94 ? 1135 ARG A N     1 
ATOM   8803  C  CA    . ARG A 1  1135 ? 112.223 97.207  3.448   1.00 131.15 ? 1135 ARG A CA    1 
ATOM   8804  C  C     . ARG A 1  1135 ? 111.036 98.011  2.923   1.00 136.42 ? 1135 ARG A C     1 
ATOM   8805  O  O     . ARG A 1  1135 ? 110.273 97.479  2.120   1.00 134.76 ? 1135 ARG A O     1 
ATOM   8806  C  CB    . ARG A 1  1135 ? 112.184 97.088  4.989   1.00 131.57 ? 1135 ARG A CB    1 
ATOM   8807  C  CG    . ARG A 1  1135 ? 111.375 95.902  5.542   1.00 139.65 ? 1135 ARG A CG    1 
ATOM   8808  C  CD    . ARG A 1  1135 ? 109.884 96.179  5.677   1.00 145.85 ? 1135 ARG A CD    1 
ATOM   8809  N  NE    . ARG A 1  1135 ? 109.491 96.481  7.055   1.00 157.18 ? 1135 ARG A NE    1 
ATOM   8810  C  CZ    . ARG A 1  1135 ? 109.477 97.699  7.593   1.00 178.11 ? 1135 ARG A CZ    1 
ATOM   8811  N  NH1   . ARG A 1  1135 ? 109.859 98.754  6.881   1.00 168.82 ? 1135 ARG A NH1   1 
ATOM   8812  N  NH2   . ARG A 1  1135 ? 109.092 97.870  8.849   1.00 167.22 ? 1135 ARG A NH2   1 
ATOM   8813  N  N     . SER A 1  1136 ? 110.961 99.323  3.277   1.00 136.05 ? 1136 SER A N     1 
ATOM   8814  C  CA    . SER A 1  1136 ? 109.910 100.269 2.851   1.00 137.02 ? 1136 SER A CA    1 
ATOM   8815  C  C     . SER A 1  1136 ? 109.892 100.499 1.335   1.00 140.75 ? 1136 SER A C     1 
ATOM   8816  O  O     . SER A 1  1136 ? 108.806 100.530 0.741   1.00 140.68 ? 1136 SER A O     1 
ATOM   8817  C  CB    . SER A 1  1136 ? 110.051 101.605 3.578   1.00 141.62 ? 1136 SER A CB    1 
ATOM   8818  O  OG    . SER A 1  1136 ? 109.940 101.441 4.983   1.00 150.27 ? 1136 SER A OG    1 
ATOM   8819  N  N     . ALA A 1  1137 ? 111.098 100.635 0.721   1.00 136.04 ? 1137 ALA A N     1 
ATOM   8820  C  CA    . ALA A 1  1137 ? 111.310 100.886 -0.705  1.00 135.00 ? 1137 ALA A CA    1 
ATOM   8821  C  C     . ALA A 1  1137 ? 110.884 99.752  -1.613  1.00 137.41 ? 1137 ALA A C     1 
ATOM   8822  O  O     . ALA A 1  1137 ? 110.600 100.015 -2.784  1.00 136.31 ? 1137 ALA A O     1 
ATOM   8823  C  CB    . ALA A 1  1137 ? 112.763 101.225 -0.963  1.00 135.79 ? 1137 ALA A CB    1 
ATOM   8824  N  N     . ILE A 1  1138 ? 110.861 98.496  -1.096  1.00 134.01 ? 1138 ILE A N     1 
ATOM   8825  C  CA    . ILE A 1  1138 ? 110.496 97.297  -1.870  1.00 133.09 ? 1138 ILE A CA    1 
ATOM   8826  C  C     . ILE A 1  1138 ? 109.143 96.664  -1.523  1.00 138.00 ? 1138 ILE A C     1 
ATOM   8827  O  O     . ILE A 1  1138 ? 108.464 96.206  -2.447  1.00 136.81 ? 1138 ILE A O     1 
ATOM   8828  C  CB    . ILE A 1  1138 ? 111.642 96.252  -2.041  1.00 135.06 ? 1138 ILE A CB    1 
ATOM   8829  C  CG1   . ILE A 1  1138 ? 112.079 95.626  -0.688  1.00 135.26 ? 1138 ILE A CG1   1 
ATOM   8830  C  CG2   . ILE A 1  1138 ? 112.820 96.826  -2.849  1.00 135.43 ? 1138 ILE A CG2   1 
ATOM   8831  C  CD1   . ILE A 1  1138 ? 113.113 94.495  -0.761  1.00 139.61 ? 1138 ILE A CD1   1 
ATOM   8832  N  N     . GLU A 1  1139 ? 108.748 96.641  -0.211  1.00 136.11 ? 1139 GLU A N     1 
ATOM   8833  C  CA    . GLU A 1  1139 ? 107.458 96.088  0.256   1.00 135.92 ? 1139 GLU A CA    1 
ATOM   8834  C  C     . GLU A 1  1139 ? 106.307 96.912  -0.291  1.00 142.47 ? 1139 GLU A C     1 
ATOM   8835  O  O     . GLU A 1  1139 ? 106.223 98.122  -0.039  1.00 143.33 ? 1139 GLU A O     1 
ATOM   8836  C  CB    . GLU A 1  1139 ? 107.361 95.989  1.791   1.00 137.31 ? 1139 GLU A CB    1 
ATOM   8837  C  CG    . GLU A 1  1139 ? 106.032 95.422  2.273   1.00 143.92 ? 1139 GLU A CG    1 
ATOM   8838  C  CD    . GLU A 1  1139 ? 105.852 95.230  3.767   1.00 161.97 ? 1139 GLU A CD    1 
ATOM   8839  O  OE1   . GLU A 1  1139 ? 106.834 95.398  4.526   1.00 152.26 ? 1139 GLU A OE1   1 
ATOM   8840  O  OE2   . GLU A 1  1139 ? 104.722 94.875  4.175   1.00 155.61 ? 1139 GLU A OE2   1 
ATOM   8841  N  N     . HIS A 1  1140 ? 105.432 96.233  -1.044  1.00 139.56 ? 1140 HIS A N     1 
ATOM   8842  C  CA    . HIS A 1  1140 ? 104.272 96.786  -1.736  1.00 140.43 ? 1140 HIS A CA    1 
ATOM   8843  C  C     . HIS A 1  1140 ? 103.146 97.246  -0.804  1.00 147.81 ? 1140 HIS A C     1 
ATOM   8844  O  O     . HIS A 1  1140 ? 102.688 96.481  0.063   1.00 147.29 ? 1140 HIS A O     1 
ATOM   8845  C  CB    . HIS A 1  1140 ? 103.772 95.784  -2.781  1.00 139.46 ? 1140 HIS A CB    1 
ATOM   8846  C  CG    . HIS A 1  1140 ? 102.556 96.195  -3.531  1.00 142.53 ? 1140 HIS A CG    1 
ATOM   8847  N  ND1   . HIS A 1  1140 ? 102.643 96.954  -4.678  1.00 144.38 ? 1140 HIS A ND1   1 
ATOM   8848  C  CD2   . HIS A 1  1140 ? 101.263 95.876  -3.307  1.00 143.76 ? 1140 HIS A CD2   1 
ATOM   8849  C  CE1   . HIS A 1  1140 ? 101.403 97.090  -5.107  1.00 143.98 ? 1140 HIS A CE1   1 
ATOM   8850  N  NE2   . HIS A 1  1140 ? 100.538 96.465  -4.308  1.00 144.06 ? 1140 HIS A NE2   1 
ATOM   8851  N  N     . THR A 1  1141 ? 102.702 98.518  -1.024  1.00 146.00 ? 1141 THR A N     1 
ATOM   8852  C  CA    . THR A 1  1141 ? 101.633 99.222  -0.304  1.00 146.44 ? 1141 THR A CA    1 
ATOM   8853  C  C     . THR A 1  1141 ? 100.644 99.846  -1.313  1.00 150.53 ? 1141 THR A C     1 
ATOM   8854  O  O     . THR A 1  1141 ? 101.069 100.506 -2.273  1.00 150.31 ? 1141 THR A O     1 
ATOM   8855  C  CB    . THR A 1  1141 ? 102.225 100.299 0.626   1.00 152.95 ? 1141 THR A CB    1 
ATOM   8856  O  OG1   . THR A 1  1141 ? 103.357 99.780  1.324   1.00 150.68 ? 1141 THR A OG1   1 
ATOM   8857  C  CG2   . THR A 1  1141 ? 101.205 100.847 1.618   1.00 153.25 ? 1141 THR A CG2   1 
ATOM   8858  N  N     . THR A 1  1142 ? 99.326  99.616  -1.089  1.00 146.67 ? 1142 THR A N     1 
ATOM   8859  C  CA    . THR A 1  1142 ? 98.228  100.165 -1.902  1.00 146.50 ? 1142 THR A CA    1 
ATOM   8860  C  C     . THR A 1  1142 ? 97.370  101.090 -1.067  1.00 149.96 ? 1142 THR A C     1 
ATOM   8861  O  O     . THR A 1  1142 ? 97.255  100.913 0.150   1.00 149.72 ? 1142 THR A O     1 
ATOM   8862  C  CB    . THR A 1  1142 ? 97.326  99.078  -2.474  1.00 151.75 ? 1142 THR A CB    1 
ATOM   8863  O  OG1   . THR A 1  1142 ? 97.145  98.061  -1.487  1.00 152.37 ? 1142 THR A OG1   1 
ATOM   8864  C  CG2   . THR A 1  1142 ? 97.835  98.520  -3.793  1.00 147.50 ? 1142 THR A CG2   1 
ATOM   8865  N  N     . LEU A 1  1143 ? 96.719  102.049 -1.737  1.00 145.45 ? 1143 LEU A N     1 
ATOM   8866  C  CA    . LEU A 1  1143 ? 95.838  103.020 -1.112  1.00 145.48 ? 1143 LEU A CA    1 
ATOM   8867  C  C     . LEU A 1  1143 ? 94.773  102.323 -0.275  1.00 147.66 ? 1143 LEU A C     1 
ATOM   8868  O  O     . LEU A 1  1143 ? 94.356  102.884 0.735   1.00 148.76 ? 1143 LEU A O     1 
ATOM   8869  C  CB    . LEU A 1  1143 ? 95.202  103.898 -2.193  1.00 146.12 ? 1143 LEU A CB    1 
ATOM   8870  C  CG    . LEU A 1  1143 ? 94.401  105.094 -1.727  1.00 151.64 ? 1143 LEU A CG    1 
ATOM   8871  C  CD1   . LEU A 1  1143 ? 95.293  106.283 -1.467  1.00 152.78 ? 1143 LEU A CD1   1 
ATOM   8872  C  CD2   . LEU A 1  1143 ? 93.382  105.449 -2.749  1.00 154.53 ? 1143 LEU A CD2   1 
ATOM   8873  N  N     . LYS A 1  1144 ? 94.374  101.086 -0.666  1.00 141.03 ? 1144 LYS A N     1 
ATOM   8874  C  CA    . LYS A 1  1144 ? 93.381  100.278 0.050   1.00 139.94 ? 1144 LYS A CA    1 
ATOM   8875  C  C     . LYS A 1  1144 ? 93.840  99.977  1.484   1.00 142.21 ? 1144 LYS A C     1 
ATOM   8876  O  O     . LYS A 1  1144 ? 93.052  100.140 2.424   1.00 141.41 ? 1144 LYS A O     1 
ATOM   8877  C  CB    . LYS A 1  1144 ? 93.091  98.970  -0.712  1.00 141.12 ? 1144 LYS A CB    1 
ATOM   8878  C  CG    . LYS A 1  1144 ? 91.815  98.260  -0.271  1.00 157.17 ? 1144 LYS A CG    1 
ATOM   8879  C  CD    . LYS A 1  1144 ? 91.636  96.914  -0.956  1.00 166.82 ? 1144 LYS A CD    1 
ATOM   8880  C  CE    . LYS A 1  1144 ? 90.379  96.213  -0.490  1.00 178.18 ? 1144 LYS A CE    1 
ATOM   8881  N  NZ    . LYS A 1  1144 ? 90.096  94.998  -1.296  1.00 186.42 ? 1144 LYS A NZ    1 
ATOM   8882  N  N     . SER A 1  1145 ? 95.128  99.566  1.638   1.00 137.84 ? 1145 SER A N     1 
ATOM   8883  C  CA    . SER A 1  1145 ? 95.758  99.210  2.916   1.00 137.06 ? 1145 SER A CA    1 
ATOM   8884  C  C     . SER A 1  1145 ? 95.685  100.325 3.972   1.00 142.24 ? 1145 SER A C     1 
ATOM   8885  O  O     . SER A 1  1145 ? 95.451  100.044 5.151   1.00 142.35 ? 1145 SER A O     1 
ATOM   8886  C  CB    . SER A 1  1145 ? 97.196  98.743  2.702   1.00 138.16 ? 1145 SER A CB    1 
ATOM   8887  O  OG    . SER A 1  1145 ? 98.000  99.756  2.125   1.00 143.60 ? 1145 SER A OG    1 
ATOM   8888  N  N     . VAL A 1  1146 ? 95.832  101.584 3.537   1.00 138.80 ? 1146 VAL A N     1 
ATOM   8889  C  CA    . VAL A 1  1146 ? 95.787  102.761 4.406   1.00 139.41 ? 1146 VAL A CA    1 
ATOM   8890  C  C     . VAL A 1  1146 ? 94.376  103.305 4.743   1.00 143.51 ? 1146 VAL A C     1 
ATOM   8891  O  O     . VAL A 1  1146 ? 94.222  103.932 5.794   1.00 144.84 ? 1146 VAL A O     1 
ATOM   8892  C  CB    . VAL A 1  1146 ? 96.766  103.882 3.953   1.00 143.77 ? 1146 VAL A CB    1 
ATOM   8893  C  CG1   . VAL A 1  1146 ? 98.168  103.620 4.475   1.00 143.52 ? 1146 VAL A CG1   1 
ATOM   8894  C  CG2   . VAL A 1  1146 ? 96.780  104.060 2.435   1.00 142.77 ? 1146 VAL A CG2   1 
ATOM   8895  N  N     . THR A 1  1147 ? 93.356  103.050 3.873   1.00 137.90 ? 1147 THR A N     1 
ATOM   8896  C  CA    . THR A 1  1147 ? 91.971  103.558 3.984   1.00 137.33 ? 1147 THR A CA    1 
ATOM   8897  C  C     . THR A 1  1147 ? 91.075  102.916 5.041   1.00 138.68 ? 1147 THR A C     1 
ATOM   8898  O  O     . THR A 1  1147 ? 91.036  101.692 5.163   1.00 136.93 ? 1147 THR A O     1 
ATOM   8899  C  CB    . THR A 1  1147 ? 91.266  103.517 2.615   1.00 142.84 ? 1147 THR A CB    1 
ATOM   8900  O  OG1   . THR A 1  1147 ? 92.186  103.830 1.575   1.00 141.40 ? 1147 THR A OG1   1 
ATOM   8901  C  CG2   . THR A 1  1147 ? 90.075  104.462 2.535   1.00 143.48 ? 1147 THR A CG2   1 
ATOM   8902  N  N     . ILE A 1  1148 ? 90.294  103.755 5.746   1.00 135.65 ? 1148 ILE A N     1 
ATOM   8903  C  CA    . ILE A 1  1148 ? 89.304  103.303 6.727   1.00 135.78 ? 1148 ILE A CA    1 
ATOM   8904  C  C     . ILE A 1  1148 ? 87.950  103.112 6.024   1.00 141.84 ? 1148 ILE A C     1 
ATOM   8905  O  O     . ILE A 1  1148 ? 87.334  102.061 6.199   1.00 142.67 ? 1148 ILE A O     1 
ATOM   8906  C  CB    . ILE A 1  1148 ? 89.154  104.186 7.999   1.00 139.80 ? 1148 ILE A CB    1 
ATOM   8907  C  CG1   . ILE A 1  1148 ? 90.492  104.779 8.472   1.00 140.50 ? 1148 ILE A CG1   1 
ATOM   8908  C  CG2   . ILE A 1  1148 ? 88.459  103.394 9.117   1.00 139.56 ? 1148 ILE A CG2   1 
ATOM   8909  C  CD1   . ILE A 1  1148 ? 90.387  105.945 9.513   1.00 148.69 ? 1148 ILE A CD1   1 
ATOM   8910  N  N     . ALA A 1  1149 ? 87.486  104.128 5.245   1.00 138.00 ? 1149 ALA A N     1 
ATOM   8911  C  CA    . ALA A 1  1149 ? 86.219  104.132 4.494   1.00 137.23 ? 1149 ALA A CA    1 
ATOM   8912  C  C     . ALA A 1  1149 ? 86.203  105.245 3.439   1.00 141.37 ? 1149 ALA A C     1 
ATOM   8913  O  O     . ALA A 1  1149 ? 86.753  106.326 3.679   1.00 141.80 ? 1149 ALA A O     1 
ATOM   8914  C  CB    . ALA A 1  1149 ? 85.048  104.335 5.448   1.00 138.83 ? 1149 ALA A CB    1 
ATOM   8915  N  N     . SER A 1  1150 ? 85.557  104.996 2.285   1.00 137.13 ? 1150 SER A N     1 
ATOM   8916  C  CA    . SER A 1  1150 ? 85.385  106.024 1.249   1.00 137.38 ? 1150 SER A CA    1 
ATOM   8917  C  C     . SER A 1  1150 ? 83.911  106.453 1.223   1.00 140.64 ? 1150 SER A C     1 
ATOM   8918  O  O     . SER A 1  1150 ? 83.033  105.621 1.458   1.00 140.51 ? 1150 SER A O     1 
ATOM   8919  C  CB    . SER A 1  1150 ? 85.875  105.550 -0.120  1.00 139.88 ? 1150 SER A CB    1 
ATOM   8920  O  OG    . SER A 1  1150 ? 85.242  104.366 -0.576  1.00 146.42 ? 1150 SER A OG    1 
ATOM   8921  N  N     . GLU A 1  1151 ? 83.640  107.750 1.017   1.00 136.44 ? 1151 GLU A N     1 
ATOM   8922  C  CA    . GLU A 1  1151 ? 82.270  108.283 1.019   1.00 136.34 ? 1151 GLU A CA    1 
ATOM   8923  C  C     . GLU A 1  1151 ? 81.964  109.163 -0.190  1.00 138.36 ? 1151 GLU A C     1 
ATOM   8924  O  O     . GLU A 1  1151 ? 82.844  109.859 -0.705  1.00 137.69 ? 1151 GLU A O     1 
ATOM   8925  C  CB    . GLU A 1  1151 ? 82.002  109.101 2.293   1.00 139.06 ? 1151 GLU A CB    1 
ATOM   8926  C  CG    . GLU A 1  1151 ? 81.897  108.317 3.590   1.00 145.86 ? 1151 GLU A CG    1 
ATOM   8927  C  CD    . GLU A 1  1151 ? 81.704  109.187 4.821   1.00 156.29 ? 1151 GLU A CD    1 
ATOM   8928  O  OE1   . GLU A 1  1151 ? 82.406  110.220 4.952   1.00 133.97 ? 1151 GLU A OE1   1 
ATOM   8929  O  OE2   . GLU A 1  1151 ? 80.845  108.829 5.660   1.00 144.49 ? 1151 GLU A OE2   1 
ATOM   8930  N  N     . ILE A 1  1152 ? 80.698  109.167 -0.611  1.00 134.08 ? 1152 ILE A N     1 
ATOM   8931  C  CA    . ILE A 1  1152 ? 80.252  110.016 -1.707  1.00 134.53 ? 1152 ILE A CA    1 
ATOM   8932  C  C     . ILE A 1  1152 ? 79.220  111.008 -1.170  1.00 140.79 ? 1152 ILE A C     1 
ATOM   8933  O  O     . ILE A 1  1152 ? 78.219  110.604 -0.577  1.00 140.44 ? 1152 ILE A O     1 
ATOM   8934  C  CB    . ILE A 1  1152 ? 79.797  109.225 -2.960  1.00 136.49 ? 1152 ILE A CB    1 
ATOM   8935  C  CG1   . ILE A 1  1152 ? 80.954  108.345 -3.500  1.00 134.90 ? 1152 ILE A CG1   1 
ATOM   8936  C  CG2   . ILE A 1  1152 ? 79.271  110.178 -4.042  1.00 138.20 ? 1152 ILE A CG2   1 
ATOM   8937  C  CD1   . ILE A 1  1152 ? 80.577  107.256 -4.494  1.00 138.77 ? 1152 ILE A CD1   1 
ATOM   8938  N  N     . TYR A 1  1153 ? 79.518  112.305 -1.315  1.00 139.19 ? 1153 TYR A N     1 
ATOM   8939  C  CA    . TYR A 1  1153 ? 78.673  113.395 -0.850  1.00 141.20 ? 1153 TYR A CA    1 
ATOM   8940  C  C     . TYR A 1  1153 ? 78.287  114.283 -1.993  1.00 146.51 ? 1153 TYR A C     1 
ATOM   8941  O  O     . TYR A 1  1153 ? 79.068  114.447 -2.936  1.00 145.46 ? 1153 TYR A O     1 
ATOM   8942  C  CB    . TYR A 1  1153 ? 79.427  114.281 0.157   1.00 143.66 ? 1153 TYR A CB    1 
ATOM   8943  C  CG    . TYR A 1  1153 ? 79.650  113.661 1.511   1.00 145.75 ? 1153 TYR A CG    1 
ATOM   8944  C  CD1   . TYR A 1  1153 ? 78.671  113.722 2.497   1.00 148.58 ? 1153 TYR A CD1   1 
ATOM   8945  C  CD2   . TYR A 1  1153 ? 80.865  113.071 1.834   1.00 145.82 ? 1153 TYR A CD2   1 
ATOM   8946  C  CE1   . TYR A 1  1153 ? 78.879  113.164 3.757   1.00 149.31 ? 1153 TYR A CE1   1 
ATOM   8947  C  CE2   . TYR A 1  1153 ? 81.085  112.505 3.088   1.00 146.63 ? 1153 TYR A CE2   1 
ATOM   8948  C  CZ    . TYR A 1  1153 ? 80.088  112.551 4.046   1.00 155.02 ? 1153 TYR A CZ    1 
ATOM   8949  O  OH    . TYR A 1  1153 ? 80.315  111.996 5.281   1.00 155.95 ? 1153 TYR A OH    1 
ATOM   8950  N  N     . TYR A 1  1154 ? 77.111  114.923 -1.876  1.00 144.89 ? 1154 TYR A N     1 
ATOM   8951  C  CA    . TYR A 1  1154 ? 76.686  115.941 -2.819  1.00 146.04 ? 1154 TYR A CA    1 
ATOM   8952  C  C     . TYR A 1  1154 ? 77.045  117.249 -2.119  1.00 153.51 ? 1154 TYR A C     1 
ATOM   8953  O  O     . TYR A 1  1154 ? 76.350  117.661 -1.189  1.00 154.07 ? 1154 TYR A O     1 
ATOM   8954  C  CB    . TYR A 1  1154 ? 75.181  115.859 -3.167  1.00 147.37 ? 1154 TYR A CB    1 
ATOM   8955  C  CG    . TYR A 1  1154 ? 74.724  116.978 -4.087  1.00 150.45 ? 1154 TYR A CG    1 
ATOM   8956  C  CD1   . TYR A 1  1154 ? 75.039  116.968 -5.441  1.00 152.16 ? 1154 TYR A CD1   1 
ATOM   8957  C  CD2   . TYR A 1  1154 ? 74.008  118.068 -3.594  1.00 152.84 ? 1154 TYR A CD2   1 
ATOM   8958  C  CE1   . TYR A 1  1154 ? 74.660  118.016 -6.282  1.00 154.01 ? 1154 TYR A CE1   1 
ATOM   8959  C  CE2   . TYR A 1  1154 ? 73.603  119.110 -4.431  1.00 154.68 ? 1154 TYR A CE2   1 
ATOM   8960  C  CZ    . TYR A 1  1154 ? 73.942  119.085 -5.773  1.00 158.96 ? 1154 TYR A CZ    1 
ATOM   8961  O  OH    . TYR A 1  1154 ? 73.568  120.108 -6.607  1.00 158.91 ? 1154 TYR A OH    1 
ATOM   8962  N  N     . ASP A 1  1155 ? 78.195  117.832 -2.487  1.00 152.05 ? 1155 ASP A N     1 
ATOM   8963  C  CA    . ASP A 1  1155 ? 78.676  119.104 -1.947  1.00 154.47 ? 1155 ASP A CA    1 
ATOM   8964  C  C     . ASP A 1  1155 ? 78.807  120.050 -3.151  1.00 161.00 ? 1155 ASP A C     1 
ATOM   8965  O  O     . ASP A 1  1155 ? 79.826  120.027 -3.854  1.00 159.83 ? 1155 ASP A O     1 
ATOM   8966  C  CB    . ASP A 1  1155 ? 79.993  118.920 -1.182  1.00 155.68 ? 1155 ASP A CB    1 
ATOM   8967  C  CG    . ASP A 1  1155 ? 80.188  119.890 -0.033  1.00 169.66 ? 1155 ASP A CG    1 
ATOM   8968  O  OD1   . ASP A 1  1155 ? 79.743  121.070 -0.155  1.00 171.82 ? 1155 ASP A OD1   1 
ATOM   8969  O  OD2   . ASP A 1  1155 ? 80.793  119.484 0.982   1.00 175.36 ? 1155 ASP A OD2   1 
ATOM   8970  N  N     . PRO A 1  1156 ? 77.714  120.776 -3.484  1.00 159.82 ? 1156 PRO A N     1 
ATOM   8971  C  CA    . PRO A 1  1156 ? 77.701  121.557 -4.725  1.00 161.14 ? 1156 PRO A CA    1 
ATOM   8972  C  C     . PRO A 1  1156 ? 78.641  122.740 -4.809  1.00 169.02 ? 1156 PRO A C     1 
ATOM   8973  O  O     . PRO A 1  1156 ? 79.338  122.858 -5.812  1.00 168.61 ? 1156 PRO A O     1 
ATOM   8974  C  CB    . PRO A 1  1156 ? 76.229  121.917 -4.911  1.00 164.17 ? 1156 PRO A CB    1 
ATOM   8975  C  CG    . PRO A 1  1156 ? 75.676  121.906 -3.552  1.00 169.04 ? 1156 PRO A CG    1 
ATOM   8976  C  CD    . PRO A 1  1156 ? 76.404  120.837 -2.806  1.00 162.61 ? 1156 PRO A CD    1 
ATOM   8977  N  N     . ASP A 1  1157 ? 78.674  123.605 -3.788  1.00 169.02 ? 1157 ASP A N     1 
ATOM   8978  C  CA    . ASP A 1  1157 ? 79.580  124.751 -3.802  1.00 171.10 ? 1157 ASP A CA    1 
ATOM   8979  C  C     . ASP A 1  1157 ? 80.956  124.235 -3.388  1.00 175.19 ? 1157 ASP A C     1 
ATOM   8980  O  O     . ASP A 1  1157 ? 81.068  123.709 -2.282  1.00 174.30 ? 1157 ASP A O     1 
ATOM   8981  C  CB    . ASP A 1  1157 ? 79.092  125.858 -2.840  1.00 175.38 ? 1157 ASP A CB    1 
ATOM   8982  C  CG    . ASP A 1  1157 ? 79.853  127.185 -2.874  1.00 189.45 ? 1157 ASP A CG    1 
ATOM   8983  O  OD1   . ASP A 1  1157 ? 80.983  127.218 -3.426  1.00 189.99 ? 1157 ASP A OD1   1 
ATOM   8984  O  OD2   . ASP A 1  1157 ? 79.333  128.184 -2.317  1.00 197.98 ? 1157 ASP A OD2   1 
ATOM   8985  N  N     . PRO A 1  1158 ? 82.000  124.313 -4.255  1.00 171.97 ? 1158 PRO A N     1 
ATOM   8986  C  CA    . PRO A 1  1158 ? 83.320  123.800 -3.851  1.00 170.95 ? 1158 PRO A CA    1 
ATOM   8987  C  C     . PRO A 1  1158 ? 84.048  124.721 -2.863  1.00 176.61 ? 1158 PRO A C     1 
ATOM   8988  O  O     . PRO A 1  1158 ? 84.880  124.241 -2.086  1.00 176.05 ? 1158 PRO A O     1 
ATOM   8989  C  CB    . PRO A 1  1158 ? 84.075  123.636 -5.184  1.00 171.75 ? 1158 PRO A CB    1 
ATOM   8990  C  CG    . PRO A 1  1158 ? 83.076  123.969 -6.274  1.00 176.41 ? 1158 PRO A CG    1 
ATOM   8991  C  CD    . PRO A 1  1158 ? 82.050  124.848 -5.628  1.00 173.72 ? 1158 PRO A CD    1 
ATOM   8992  N  N     . ARG A 1  1159 ? 83.717  126.029 -2.867  1.00 174.94 ? 1159 ARG A N     1 
ATOM   8993  C  CA    . ARG A 1  1159 ? 84.322  127.012 -1.964  1.00 176.34 ? 1159 ARG A CA    1 
ATOM   8994  C  C     . ARG A 1  1159 ? 83.800  126.915 -0.510  1.00 180.55 ? 1159 ARG A C     1 
ATOM   8995  O  O     . ARG A 1  1159 ? 84.483  127.365 0.412   1.00 180.85 ? 1159 ARG A O     1 
ATOM   8996  C  CB    . ARG A 1  1159 ? 84.216  128.435 -2.536  1.00 179.03 ? 1159 ARG A CB    1 
ATOM   8997  C  CG    . ARG A 1  1159 ? 85.129  128.673 -3.737  1.00 187.32 ? 1159 ARG A CG    1 
ATOM   8998  C  CD    . ARG A 1  1159 ? 85.666  130.087 -3.747  1.00 197.49 ? 1159 ARG A CD    1 
ATOM   8999  N  NE    . ARG A 1  1159 ? 86.942  130.182 -4.455  1.00 204.68 ? 1159 ARG A NE    1 
ATOM   9000  C  CZ    . ARG A 1  1159 ? 87.634  131.309 -4.608  1.00 215.73 ? 1159 ARG A CZ    1 
ATOM   9001  N  NH1   . ARG A 1  1159 ? 87.179  132.451 -4.105  1.00 208.20 ? 1159 ARG A NH1   1 
ATOM   9002  N  NH2   . ARG A 1  1159 ? 88.785  131.302 -5.267  1.00 206.42 ? 1159 ARG A NH2   1 
ATOM   9003  N  N     . SER A 1  1160 ? 82.598  126.324 -0.314  1.00 176.62 ? 1160 SER A N     1 
ATOM   9004  C  CA    . SER A 1  1160 ? 81.982  126.070 1.000   1.00 176.30 ? 1160 SER A CA    1 
ATOM   9005  C  C     . SER A 1  1160 ? 81.752  124.548 1.152   1.00 177.42 ? 1160 SER A C     1 
ATOM   9006  O  O     . SER A 1  1160 ? 81.877  123.822 0.167   1.00 176.31 ? 1160 SER A O     1 
ATOM   9007  C  CB    . SER A 1  1160 ? 80.692  126.868 1.180   1.00 181.28 ? 1160 SER A CB    1 
ATOM   9008  O  OG    . SER A 1  1160 ? 79.587  126.286 0.509   1.00 189.47 ? 1160 SER A OG    1 
ATOM   9009  N  N     . THR A 1  1161 ? 81.480  124.051 2.375   1.00 172.87 ? 1161 THR A N     1 
ATOM   9010  C  CA    . THR A 1  1161 ? 81.331  122.609 2.590   1.00 170.19 ? 1161 THR A CA    1 
ATOM   9011  C  C     . THR A 1  1161 ? 80.266  122.248 3.608   1.00 172.97 ? 1161 THR A C     1 
ATOM   9012  O  O     . THR A 1  1161 ? 80.258  122.780 4.716   1.00 173.20 ? 1161 THR A O     1 
ATOM   9013  C  CB    . THR A 1  1161 ? 82.733  121.970 2.804   1.00 178.18 ? 1161 THR A CB    1 
ATOM   9014  O  OG1   . THR A 1  1161 ? 83.387  121.908 1.536   1.00 179.40 ? 1161 THR A OG1   1 
ATOM   9015  C  CG2   . THR A 1  1161 ? 82.700  120.573 3.396   1.00 174.29 ? 1161 THR A CG2   1 
ATOM   9016  N  N     . VAL A 1  1162 ? 79.388  121.310 3.223   1.00 168.97 ? 1162 VAL A N     1 
ATOM   9017  C  CA    . VAL A 1  1162 ? 78.316  120.751 4.049   1.00 169.53 ? 1162 VAL A CA    1 
ATOM   9018  C  C     . VAL A 1  1162 ? 78.932  120.062 5.285   1.00 175.02 ? 1162 VAL A C     1 
ATOM   9019  O  O     . VAL A 1  1162 ? 78.368  120.157 6.374   1.00 175.30 ? 1162 VAL A O     1 
ATOM   9020  C  CB    . VAL A 1  1162 ? 77.422  119.777 3.238   1.00 172.41 ? 1162 VAL A CB    1 
ATOM   9021  C  CG1   . VAL A 1  1162 ? 76.138  119.453 3.993   1.00 172.97 ? 1162 VAL A CG1   1 
ATOM   9022  C  CG2   . VAL A 1  1162 ? 77.098  120.338 1.856   1.00 172.70 ? 1162 VAL A CG2   1 
ATOM   9023  N  N     . ILE A 1  1163 ? 80.096  119.387 5.107   1.00 172.61 ? 1163 ILE A N     1 
ATOM   9024  C  CA    . ILE A 1  1163 ? 80.860  118.718 6.170   1.00 172.61 ? 1163 ILE A CA    1 
ATOM   9025  C  C     . ILE A 1  1163 ? 81.543  119.815 7.016   1.00 180.35 ? 1163 ILE A C     1 
ATOM   9026  O  O     . ILE A 1  1163 ? 82.283  120.640 6.465   1.00 181.16 ? 1163 ILE A O     1 
ATOM   9027  C  CB    . ILE A 1  1163 ? 81.887  117.679 5.622   1.00 173.48 ? 1163 ILE A CB    1 
ATOM   9028  C  CG1   . ILE A 1  1163 ? 81.236  116.653 4.661   1.00 172.23 ? 1163 ILE A CG1   1 
ATOM   9029  C  CG2   . ILE A 1  1163 ? 82.627  116.973 6.765   1.00 173.02 ? 1163 ILE A CG2   1 
ATOM   9030  C  CD1   . ILE A 1  1163 ? 81.477  116.914 3.184   1.00 177.78 ? 1163 ILE A CD1   1 
ATOM   9031  N  N     . PRO A 1  1164 ? 81.284  119.871 8.345   1.00 179.12 ? 1164 PRO A N     1 
ATOM   9032  C  CA    . PRO A 1  1164 ? 81.896  120.944 9.157   1.00 180.51 ? 1164 PRO A CA    1 
ATOM   9033  C  C     . PRO A 1  1164 ? 83.371  120.717 9.491   1.00 182.95 ? 1164 PRO A C     1 
ATOM   9034  O  O     . PRO A 1