data_4A3K
# 
_entry.id   4A3K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4A3K         
PDBE  EBI-49852    
WWPDB D_1290049852 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1TWC unspecified 'RNA POLYMERASE II COMPLEXED WITH GTP'                                                                 
PDB 1Y77 unspecified 'COMPLETE RNA POLYMERASE II ELONGATION COMPLEX WITHSUBSTRATE ANALOGUE GMPCPP'                          
PDB 1TWG unspecified 'RNA POLYMERASE II COMPLEXED WITH CTP'                                                                 
PDB 1R9S unspecified 'RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MATCHED NUCLEOTIDE'                            
PDB 1SFO unspecified 'RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX'                                                
PDB 1I50 unspecified 'RNA POLYMERASE II CRYSTAL FORM II AT 2.8 A RESOLUTION'                                                
PDB 4A3F unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 6NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 4A3D unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 6NT DNA-RNA HYBRID'                             
PDB 1R5U unspecified 'RNA POLYMERASE II TFIIB COMPLEX'                                                                      
PDB 1DZF unspecified 'RPB5 FROM S.CEREVISIAE'                                                                               
PDB 4A3E unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 5NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 1Y14 unspecified 'CRYSTAL STRUCTURE OF YEAST SUBCOMPLEX OF RPB4 AND RPB7'                                               
PDB 1Y1W unspecified 'COMPLETE RNA POLYMERASE II ELONGATION COMPLEX'                                                        
PDB 1NT9 unspecified 'COMPLETE 12-SUBUNIT RNA POLYMERASE II'                                                                
PDB 1PQV unspecified 'RNA POLYMERASE II-TFIIS COMPLEX'                                                                      
PDB 1TWF unspecified 'RNA POLYMERASE II COMPLEXED WITH UTP AT 2.3 A RESOLUTION'                                             
PDB 1I3Q unspecified 'RNA POLYMERASE II CRYSTAL FORM I AT 3.1 A RESOLUTION'                                                 
PDB 4A3G unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 2NT DNA-RNA HYBRID'                             
PDB 4A3C unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 5NT DNA-RNA HYBRID'                             
PDB 4A3I unspecified 'RNA POLYMERASE II BINARY COMPLEX WITH DNA'                                                            
PDB 4A3B unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 4NT DNA-RNA HYBRID'                             
PDB 1I6H unspecified 'RNA POLYMERASE II ELONGATION COMPLEX'                                                                 
PDB 1Y1V unspecified 'REFINED RNA POLYMERASE II-TFIIS COMPLEX'                                                              
PDB 1Y1Y unspecified 'RNA POLYMERASE II-TFIIS-DNA/RNA COMPLEX'                                                              
PDB 1WCM unspecified 'COMPLETE 12-SUBUNIT RNA POLYMERASE II AT 3.8 A'                                                       
PDB 4A3M unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 4NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 1TWA unspecified 'RNA POLYMERASE II COMPLEXED WITH ATP'                                                                 
PDB 1NIK unspecified 'WILD TYPE RNA POLYMERASE II'                                                                          
PDB 2VUM unspecified 'ALPHA-AMANITIN INHIBITED COMPLETE RNA POLYMERASE II ELONGATION COMPLEX'                               
PDB 1TWH unspecified 
;RNA POLYMERASE II COMPLEXED WITH 2'DATP
;
PDB 1R9T unspecified 'RNA POLYMERASE II STRAND SEPARATED ELONGATION COMPLEX, MISMATCHED NUCLEOTIDE'                         
PDB 2JA6 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX B'                                         
PDB 2JA7 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX C'                                         
PDB 4A3L unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 7NT DNA-RNA HYBRID AND SOAKED WITH AMPCPP'      
PDB 1A1D unspecified 'YEAST RIBONUCLEIC ACID POLYMERASE SUBUNIT RPB8, NMR, MINIMIZED AVERAGE STRUCTURE, ALPHA CARBONS ONLY' 
PDB 1K83 unspecified 'CRYSTAL STRUCTURE OF YEAST RNA POLYMERASE II COMPLEXED WITHTHE INHIBITOR ALPHA AMANITIN'              
PDB 2B63 unspecified 'COMPLETE RNA POLYMERASE II-RNA INHIBITOR COMPLEX'                                                     
PDB 2B8K unspecified '12-SUBUNIT RNA POLYMERASE II'                                                                         
PDB 4A3J unspecified 'RNA POLYMERASE II INITIAL TRANSCRIBING COMPLEX WITH A 2NT DNA-RNA HYBRID AND SOAKED WITH GMPCPP'      
PDB 2JA5 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX A'                                         
PDB 2JA8 unspecified 'CPD LESION CONTAINING RNA POLYMERASE II ELONGATION COMPLEX D'                                         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A3K 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-09-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheung, A.C.M.' 1 
'Sainsbury, S.'  2 
'Cramer, P.'     3 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis of Initial RNA Polymerase II Transcription.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            30 
_citation.page_first                4755 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22056778 
_citation.pdbx_database_id_DOI      10.1038/EMBOJ.2011.396 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cheung, A.C.M.' 1 ? 
primary 'Sainsbury, S.'  2 ? 
primary 'Cramer, P.'     3 ? 
# 
_cell.entry_id           4A3K 
_cell.length_a           221.910 
_cell.length_b           391.360 
_cell.length_c           283.920 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A3K 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1'                                               191664.391 1 
2.7.7.6 ? 'RESIDUES 1-1732' ? 
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2'                                               138937.297 1 
2.7.7.6 ? ?                 ? 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3'                                               35330.457  1 ? ? ? 
? 
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4'                                               25451.191  1 ? ? ? 
? 
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1'                               25117.094  1 ? ? ? 
? 
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2'                               17931.834  1 ? ? ? 
? 
7  polymer     nat 'RPB7, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7'                                         19081.053  1 ? ? ? 
? 
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3'                               16525.363  1 ? ? ? 
? 
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9'                                               14308.161  1 ? ? ? 
? 
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5'                               8290.732   1 ? ? ? 
? 
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11'                                              13633.493  1 ? ? ? 
? 
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4'                               7729.969   1 ? ? ? 
? 
13 polymer     syn "5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP*AP)-3'"                                                3372.234   1 ? ? ? 
? 
14 polymer     syn "5'-R(*AP*CP*CP*AP*GP*GP*AP)-3'"                                                            2243.435   1 ? ? ? 
? 
15 polymer     syn 
;5'-D(*AP*GP*CP*TP*CP*AP*AP*GP*TP*AP*CP*TP*TP*DTP *TP*TP*CP*CP*BRU*GP*GP*TP*CP*AP*TP*T)-3'
;
7983.981   1 ?       ? ?                 ? 
16 non-polymer syn 'ZINC ION'                                                                                  65.409     8 ? ? ? 
? 
17 non-polymer syn 'MAGNESIUM ION'                                                                             24.305     1 ? ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RPB1, RNA POLYMERASE II SUBUNIT 1, RNA POLYMERASE II SUBUNIT B1, DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT, RNA POLYMERASE II SUBUNIT B220
;
2  'RPB2, RNA POLYMERASE II SUBUNIT 2, B150, DNA-DIRECTED RNA POLYMERASE II 140 KDA POLYPEPTIDE' 
3  'RPB3, RNA POLYMERASE II SUBUNIT 3, RNA POLYMERASE II SUBUNIT B3, B44.5, DNA-DIRECTED RNA POLYMERASE II 45 KDA POLYPEPTIDE' 
4  'RPB4, RNA POLYMERASE II SUBUNIT B4, B32, DNA-DIRECTED RNA POLYMERASE II 32 KDA POLYPEPTIDE' 
5  'RPB5, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC1, ABC27, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 27 KDA POLYPEPTIDE' 
6  'RPB6, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC2, ABC23, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 23 KDA POLYPEPTIDE' 
7  'RNA POLYMERASE II SUBUNIT B7, B16' 
8  
;RPB8, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC3, ABC14.4, ABC14.5, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 14.5 KDA POLYPEPTIDE
;
9  
;RBP9, RNA POLYMERASE II SUBUNIT B9, B12.6, DNA-DIRECTED RNA POLYMERASE II 14.2 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE II SUBUNIT 9
;
10 
;RPB10, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC5, ABC10-BETA, ABC8, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 8.3 KDA POLYPEPTIDE
;
11 'RPB11, RNA POLYMERASE II SUBUNIT B11, B13.6, DNA-DIRECTED RNA POLYMERASE II 13.6 KDA POLYPEPTIDE' 
12 'RPB12, RNA POLYMERASES I\,II\,AND III SUBUNIT ABC4, ABC10-ALPHA' 
13 'NON TEMPLATE DNA' 
14 'TRANSCRIPT RNA' 
15 'TEMPLATE DNA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENS
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENS
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D ? 
5  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G ? 
8  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 polydeoxyribonucleotide no no  '(DT)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DG)(DA)' TAAGTACTTGA N ? 
14 polyribonucleotide      no no  ACCAGGA ACCAGGA P ? 
15 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DC)(BRU)
(DG)(DG)(DT)(DC)(DA)(DT)(DT)
;
AGCTCAAGTACTTTTTCCUGGTCATT T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    DT  n 
13 2    DA  n 
13 3    DA  n 
13 4    DG  n 
13 5    DT  n 
13 6    DA  n 
13 7    DC  n 
13 8    DT  n 
13 9    DT  n 
13 10   DG  n 
13 11   DA  n 
14 1    A   n 
14 2    C   n 
14 3    C   n 
14 4    A   n 
14 5    G   n 
14 6    G   n 
14 7    A   n 
15 1    DA  n 
15 2    DG  n 
15 3    DC  n 
15 4    DT  n 
15 5    DC  n 
15 6    DA  n 
15 7    DA  n 
15 8    DG  n 
15 9    DT  n 
15 10   DA  n 
15 11   DC  n 
15 12   DT  n 
15 13   DT  n 
15 14   DT  n 
15 15   DT  n 
15 16   DT  n 
15 17   DC  n 
15 18   DC  n 
15 19   BRU n 
15 20   DG  n 
15 21   DG  n 
15 22   DT  n 
15 23   DC  n 
15 24   DA  n 
15 25   DT  n 
15 26   DT  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
13 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
14 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
15 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  1  ? ? P04050 ? 
2  UNP RPB2_YEAST  2  ? ? P08518 ? 
3  UNP RPB3_YEAST  3  ? ? P16370 ? 
4  UNP RPB4_YEAST  4  ? ? P20433 ? 
5  UNP RPAB1_YEAST 5  ? ? P20434 ? 
6  UNP RPAB2_YEAST 6  ? ? P20435 ? 
7  UNP RPB7_YEAST  7  ? ? P34087 ? 
8  UNP RPAB3_YEAST 8  ? ? P20436 ? 
9  UNP RPB9_YEAST  9  ? ? P27999 ? 
10 UNP RPAB5_YEAST 10 ? ? P22139 ? 
11 UNP RPB11_YEAST 11 ? ? P38902 ? 
12 UNP RPAB4_YEAST 12 ? ? P40422 ? 
13 PDB 4A3K        13 ? ? 4A3K   ? 
14 PDB 4A3K        14 ? ? 4A3K   ? 
15 PDB 4A3K        15 ? ? 4A3K   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4A3K A 1 ? 1732 ? P04050 1 ? 1732 ? 1 1732 
2  2  4A3K B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  4A3K C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  4A3K D 1 ? 221  ? P20433 1 ? 221  ? 1 221  
5  5  4A3K E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
6  6  4A3K F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
7  7  4A3K G 1 ? 171  ? P34087 1 ? 171  ? 1 171  
8  8  4A3K H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
9  9  4A3K I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
10 10 4A3K J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
11 11 4A3K K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
12 12 4A3K L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
13 13 4A3K N 1 ? 11   ? 4A3K   1 ? 11   ? 1 11   
14 14 4A3K P 1 ? 7    ? 4A3K   4 ? 10   ? 4 10   
15 15 4A3K T 1 ? 26   ? 4A3K   4 ? 29   ? 4 29   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                 ? 'Zn 2'              65.409  
# 
_exptl.entry_id          4A3K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      6.94 
_exptl_crystal.density_percent_sol   82.15 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9188 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.9188 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4A3K 
_reflns.observed_criterion_sigma_I   2.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            3.50 
_reflns.number_obs                   161513 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.116 
_reflns.pdbx_netI_over_sigmaI        18.70 
_reflns.B_iso_Wilson_estimate        72.75 
_reflns.pdbx_redundancy              3 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.50 
_reflns_shell.d_res_low              3.59 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        1.09 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4A3K 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     154638 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.95 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.1588 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1583 
_refine.ls_R_factor_R_free                       0.1849 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.97 
_refine.ls_number_reflns_R_free                  3051 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9403 
_refine.correlation_coeff_Fo_to_Fc_free          0.9256 
_refine.B_iso_mean                               112.51 
_refine.aniso_B[1][1]                            6.6738 
_refine.aniso_B[2][2]                            17.9967 
_refine.aniso_B[3][3]                            -24.6705 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.602 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.293 
_refine.pdbx_overall_SU_R_Blow_DPI               0.534 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.283 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4A3K 
_refine_analyze.Luzzati_coordinate_error_obs    0.733 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        31187 
_refine_hist.pdbx_number_atoms_nucleic_acid   744 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               31940 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        48.95 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  32576 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.33  ? 2.00  44130 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  11649 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  857   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  4565  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 32576 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  1     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           2.93  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           24.09 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  4298  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? 1.00  76    'X-RAY DIFFRACTION' HARMONIC     
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  37883 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.50 
_refine_ls_shell.d_res_low                        3.59 
_refine_ls_shell.number_reflns_R_work             11163 
_refine_ls_shell.R_factor_R_work                  0.2183 
_refine_ls_shell.percent_reflns_obs               99.98 
_refine_ls_shell.R_factor_R_free                  0.2506 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            1.92 
_refine_ls_shell.number_reflns_R_free             218 
_refine_ls_shell.number_reflns_all                11381 
_refine_ls_shell.R_factor_all                     0.2190 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  4A3K 
_struct.title                     'RNA Polymerase II initial transcribing complex with a 7nt DNA-RNA hybrid' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2, RPB7, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A3K 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, TRANSCRIPTION INITIATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 16 ? 
Q N N 16 ? 
R N N 17 ? 
S N N 16 ? 
T N N 16 ? 
U N N 16 ? 
V N N 16 ? 
W N N 16 ? 
X N N 16 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? VAL A 106  ? PHE A 95   VAL A 106  1 ? 12 
HELX_P HELX_P3   3   ASN A 119  ? ALA A 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P4   4   ASP A 130  ? LYS A 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P5   5   SER A 203  ? HIS A 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? TRP A 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   8   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   9   ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  10  HIS A 286  ? ASP A 305  ? HIS A 286  ASP A 305  1 ? 20 
HELX_P HELX_P11  11  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P12  12  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P13  13  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P14  14  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P15  15  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P16  16  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  17  SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P18  18  ALA A 506  ? ILE A 511  ? ALA A 506  ILE A 511  1 ? 6  
HELX_P HELX_P19  19  VAL A 524  ? THR A 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P20  20  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P21  21  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P22  22  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P23  23  GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P24  24  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P25  25  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P26  26  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P27  27  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P28  28  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P29  29  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P30  30  SER A 793  ? GLY A 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P31  31  THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P32  32  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P33  33  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P34  34  ASP A 884  ? GLY A 887  ? ASP A 884  GLY A 887  5 ? 4  
HELX_P HELX_P35  35  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P36  36  GLU A 914  ? SER A 917  ? GLU A 914  SER A 917  5 ? 4  
HELX_P HELX_P37  37  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P38  38  ASN A 959  ? HIS A 972  ? ASN A 959  HIS A 972  1 ? 14 
HELX_P HELX_P39  39  THR A 982  ? LEU A 997  ? THR A 982  LEU A 997  1 ? 16 
HELX_P HELX_P40  40  ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P41  41  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P42  42  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P43  43  MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P44  44  SER A 1096 ? ASN A 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P45  45  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P46  46  LEU A 1143 ? VAL A 1146 ? LEU A 1143 VAL A 1146 1 ? 4  
HELX_P HELX_P47  47  ASP A 1166 ? HIS A 1173 ? ASP A 1166 HIS A 1173 1 ? 8  
HELX_P HELX_P48  48  ASP A 1198 ? LYS A 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P49  49  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P50  50  GLU A 1256 ? ASN A 1270 ? GLU A 1256 ASN A 1270 1 ? 15 
HELX_P HELX_P51  51  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P52  52  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P53  53  GLY A 1340 ? ASP A 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P54  54  ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P55  55  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P56  56  GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P57  57  GLU A 1404 ? ALA A 1416 ? GLU A 1404 ALA A 1416 1 ? 13 
HELX_P HELX_P58  58  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P59  59  ILE A 1436 ? GLY A 1439 ? ILE A 1436 GLY A 1439 5 ? 4  
HELX_P HELX_P60  60  ASP A 1446 ? TYR A 1453 ? ASP A 1446 TYR A 1453 1 ? 8  
HELX_P HELX_P61  61  ASP B 29   ? GLY B 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P62  62  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P63  63  TYR B 57   ? CYS B 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P64  64  TYR B 113  ? ASN B 121  ? TYR B 113  ASN B 121  1 ? 9  
HELX_P HELX_P65  65  TYR B 180  ? ALA B 184  ? TYR B 180  ALA B 184  5 ? 5  
HELX_P HELX_P66  66  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P67  67  ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P68  68  ILE B 297  ? CYS B 302  ? ILE B 297  CYS B 302  1 ? 6  
HELX_P HELX_P69  69  ASP B 307  ? MET B 313  ? ASP B 307  MET B 313  1 ? 7  
HELX_P HELX_P70  70  LEU B 314  ? PHE B 322  ? LEU B 314  PHE B 322  1 ? 9  
HELX_P HELX_P71  71  ASP B 326  ? ARG B 337  ? ASP B 326  ARG B 337  1 ? 12 
HELX_P HELX_P72  72  LYS B 344  ? TYR B 351  ? LYS B 344  TYR B 351  1 ? 8  
HELX_P HELX_P73  73  ALA B 352  ? GLU B 359  ? ALA B 352  GLU B 359  1 ? 8  
HELX_P HELX_P74  74  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P75  75  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P76  76  LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P77  77  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P78  78  THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P79  79  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P80  80  GLU B 529  ? CYS B 533  ? GLU B 529  CYS B 533  5 ? 5  
HELX_P HELX_P81  81  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P82  82  GLU B 567  ? TYR B 569  ? GLU B 567  TYR B 569  5 ? 3  
HELX_P HELX_P83  83  ASN B 592  ? GLY B 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P84  84  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P85  85  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P86  86  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P87  87  PRO B 707  ? GLU B 711  ? PRO B 707  GLU B 711  5 ? 5  
HELX_P HELX_P88  88  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P89  89  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P90  90  PHE B 758  ? HIS B 761  ? PHE B 758  HIS B 761  5 ? 4  
HELX_P HELX_P91  91  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P92  92  LYS B 775  ? ALA B 777  ? LYS B 775  ALA B 777  5 ? 3  
HELX_P HELX_P93  93  LEU B 782  ? ARG B 788  ? LEU B 782  ARG B 788  5 ? 7  
HELX_P HELX_P94  94  ALA B 808  ? LYS B 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P95  95  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P96  96  HIS B 1015 ? MET B 1021 ? HIS B 1015 MET B 1021 1 ? 7  
HELX_P HELX_P97  97  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P98  98  THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P99  99  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P100 100 GLY B 1121 ? ASP B 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P101 101 GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P102 102 ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P103 103 PRO B 1197 ? MET B 1210 ? PRO B 1197 MET B 1210 1 ? 14 
HELX_P HELX_P104 104 ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P105 105 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P106 106 ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P107 107 TYR C 82   ? CYS C 86   ? TYR C 82   CYS C 86   5 ? 5  
HELX_P HELX_P108 108 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P109 109 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P110 110 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P111 111 PRO C 239  ? ASP C 266  ? PRO C 239  ASP C 266  1 ? 28 
HELX_P HELX_P112 112 ASN D 51   ? GLN D 74   ? ASN D 51   GLN D 74   1 ? 24 
HELX_P HELX_P113 113 ARG D 119  ? THR D 134  ? ARG D 119  THR D 134  1 ? 16 
HELX_P HELX_P114 114 ASN D 138  ? SER D 152  ? ASN D 138  SER D 152  1 ? 15 
HELX_P HELX_P115 115 ASP D 156  ? LYS D 168  ? ASP D 156  LYS D 168  1 ? 13 
HELX_P HELX_P116 116 HIS D 173  ? LEU D 183  ? HIS D 173  LEU D 183  1 ? 11 
HELX_P HELX_P117 117 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P118 118 PRO D 196  ? ASN D 199  ? PRO D 196  ASN D 199  5 ? 4  
HELX_P HELX_P119 119 SER D 203  ? GLU D 218  ? SER D 203  GLU D 218  1 ? 16 
HELX_P HELX_P120 120 GLU E 4    ? GLY E 27   ? GLU E 4    GLY E 27   1 ? 24 
HELX_P HELX_P121 121 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P122 122 PRO E 38   ? ALA E 44   ? PRO E 38   ALA E 44   1 ? 7  
HELX_P HELX_P123 123 GLN E 54   ? SER E 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P124 124 GLU E 67   ? PHE E 72   ? GLU E 67   PHE E 72   1 ? 6  
HELX_P HELX_P125 125 GLY E 89   ? LYS E 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P126 126 THR E 117  ? LYS E 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P127 127 GLU E 137  ? VAL E 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P128 128 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P129 129 SER E 157  ? ARG E 169  ? SER E 157  ARG E 169  1 ? 13 
HELX_P HELX_P130 130 LYS E 171  ? LEU E 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P131 131 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P132 132 PRO F 75   ? ARG F 79   ? PRO F 75   ARG F 79   5 ? 5  
HELX_P HELX_P133 133 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P134 134 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P135 135 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P136 136 ARG G 21   ? GLU G 35   ? ARG G 21   GLU G 35   1 ? 15 
HELX_P HELX_P137 137 ASP G 50   ? ILE G 54   ? ASP G 50   ILE G 54   5 ? 5  
HELX_P HELX_P138 138 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P139 139 VAL I 59   ? ASP I 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P140 140 ASP J 16   ? GLU J 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P141 141 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P142 142 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P143 143 LEU J 56   ? LEU J 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P144 144 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P145 145 ASP K 39   ? ASN K 52   ? ASP K 39   ASN K 52   1 ? 14 
HELX_P HELX_P146 146 ASP K 82   ? ASN K 110  ? ASP K 82   ASN K 110  1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 167  SG    ? ? A ZN  2456 A CYS 167  1_555 ? ? ? ? ? ? ?            2.399 
? 
metalc2  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 110  SG    ? ? A ZN  2456 A CYS 110  1_555 ? ? ? ? ? ? ?            2.350 
? 
metalc3  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 148  SG    ? ? A ZN  2456 A CYS 148  1_555 ? ? ? ? ? ? ?            2.316 
? 
metalc4  metalc ?    ? P ZN  .  ZN    ? ? ? 1_555 A CYS 107  SG    ? ? A ZN  2456 A CYS 107  1_555 ? ? ? ? ? ? ?            2.352 
? 
metalc5  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 67   SG    ? ? A ZN  2457 A CYS 67   1_555 ? ? ? ? ? ? ?            2.338 
? 
metalc6  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 70   SG    ? ? A ZN  2457 A CYS 70   1_555 ? ? ? ? ? ? ?            2.353 
? 
metalc7  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A HIS 80   NE2   ? ? A ZN  2457 A HIS 80   1_555 ? ? ? ? ? ? ?            2.128 
? 
metalc8  metalc ?    ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 77   SG    ? ? A ZN  2457 A CYS 77   1_555 ? ? ? ? ? ? ?            2.451 
? 
metalc9  metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 483  OD1   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            1.970 
? 
metalc10 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 481  OD1   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            2.138 
? 
metalc11 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 483  OD2   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            2.410 
? 
metalc12 metalc ?    ? R MG  .  MG    ? ? ? 1_555 N A   7    "O3'" ? ? A MG  2458 P A   10   1_555 ? ? ? ? ? ? ?            1.933 
? 
metalc13 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 481  OD2   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            2.968 
? 
metalc14 metalc ?    ? R MG  .  MG    ? ? ? 1_555 A ASP 485  OD1   ? ? A MG  2458 A ASP 485  1_555 ? ? ? ? ? ? ?            2.204 
? 
metalc15 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1163 SG    ? ? B ZN  2225 B CYS 1163 1_555 ? ? ? ? ? ? ?            2.437 
? 
metalc16 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1166 SG    ? ? B ZN  2225 B CYS 1166 1_555 ? ? ? ? ? ? ?            2.230 
? 
metalc17 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1182 SG    ? ? B ZN  2225 B CYS 1182 1_555 ? ? ? ? ? ? ?            2.344 
? 
metalc18 metalc ?    ? S ZN  .  ZN    ? ? ? 1_555 B CYS 1185 SG    ? ? B ZN  2225 B CYS 1185 1_555 ? ? ? ? ? ? ?            2.359 
? 
metalc19 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 86   SG    ? ? C ZN  1269 C CYS 86   1_555 ? ? ? ? ? ? ?            2.231 
? 
metalc20 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 92   SG    ? ? C ZN  1269 C CYS 92   1_555 ? ? ? ? ? ? ?            2.233 
? 
metalc21 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 95   SG    ? ? C ZN  1269 C CYS 95   1_555 ? ? ? ? ? ? ?            2.305 
? 
metalc22 metalc ?    ? T ZN  .  ZN    ? ? ? 1_555 C CYS 88   SG    ? ? C ZN  1269 C CYS 88   1_555 ? ? ? ? ? ? ?            2.286 
? 
metalc23 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 7    SG    ? ? I ZN  1121 I CYS 7    1_555 ? ? ? ? ? ? ?            2.299 
? 
metalc24 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 29   SG    ? ? I ZN  1121 I CYS 29   1_555 ? ? ? ? ? ? ?            2.262 
? 
metalc25 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 32   SG    ? ? I ZN  1121 I CYS 32   1_555 ? ? ? ? ? ? ?            2.245 
? 
metalc26 metalc ?    ? U ZN  .  ZN    ? ? ? 1_555 I CYS 10   SG    ? ? I ZN  1121 I CYS 10   1_555 ? ? ? ? ? ? ?            2.208 
? 
metalc27 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 75   SG    ? ? I ZN  1122 I CYS 75   1_555 ? ? ? ? ? ? ?            2.362 
? 
metalc28 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 78   SG    ? ? I ZN  1122 I CYS 78   1_555 ? ? ? ? ? ? ?            2.319 
? 
metalc29 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 106  SG    ? ? I ZN  1122 I CYS 106  1_555 ? ? ? ? ? ? ?            2.308 
? 
metalc30 metalc ?    ? V ZN  .  ZN    ? ? ? 1_555 I CYS 103  SG    ? ? I ZN  1122 I CYS 103  1_555 ? ? ? ? ? ? ?            2.397 
? 
metalc31 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 45   SG    ? ? J ZN  1066 J CYS 45   1_555 ? ? ? ? ? ? ?            2.365 
? 
metalc32 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 46   SG    ? ? J ZN  1066 J CYS 46   1_555 ? ? ? ? ? ? ?            2.330 
? 
metalc33 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 10   SG    ? ? J ZN  1066 J CYS 10   1_555 ? ? ? ? ? ? ?            2.422 
? 
metalc34 metalc ?    ? W ZN  .  ZN    ? ? ? 1_555 J CYS 7    SG    ? ? J ZN  1066 J CYS 7    1_555 ? ? ? ? ? ? ?            2.225 
? 
metalc35 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 34   SG    ? ? L ZN  1071 L CYS 34   1_555 ? ? ? ? ? ? ?            2.444 
? 
metalc36 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 51   SG    ? ? L ZN  1071 L CYS 51   1_555 ? ? ? ? ? ? ?            2.382 
? 
metalc37 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 48   SG    ? ? L ZN  1071 L CYS 48   1_555 ? ? ? ? ? ? ?            2.369 
? 
metalc38 metalc ?    ? X ZN  .  ZN    ? ? ? 1_555 L CYS 31   SG    ? ? L ZN  1071 L CYS 31   1_555 ? ? ? ? ? ? ?            2.462 
? 
covale1  covale both ? O BRU 19 "O3'" ? ? ? 1_555 O DG  20   P     ? ? T BRU 22   T DG  23   1_555 ? ? ? ? ? ? ?            1.589 
? 
covale2  covale both ? O BRU 19 P     ? ? ? 1_555 O DC  18   "O3'" ? ? T BRU 22   T DC  21   1_555 ? ? ? ? ? ? ?            1.598 
? 
hydrog1  hydrog ?    ? M DA  2  N1    ? ? ? 1_555 O DT  13   N3    ? ? N DA  2    T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog2  hydrog ?    ? M DA  2  N6    ? ? ? 1_555 O DT  13   O4    ? ? N DA  2    T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog3  hydrog ?    ? M DA  3  N1    ? ? ? 1_555 O DT  12   N3    ? ? N DA  3    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog4  hydrog ?    ? M DA  3  N6    ? ? ? 1_555 O DT  12   O4    ? ? N DA  3    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog5  hydrog ?    ? M DG  4  N1    ? ? ? 1_555 O DC  11   N3    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog6  hydrog ?    ? M DG  4  N2    ? ? ? 1_555 O DC  11   O2    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog7  hydrog ?    ? M DG  4  O6    ? ? ? 1_555 O DC  11   N4    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog8  hydrog ?    ? M DT  5  N3    ? ? ? 1_555 O DA  10   N1    ? ? N DT  5    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog9  hydrog ?    ? M DT  5  O4    ? ? ? 1_555 O DA  10   N6    ? ? N DT  5    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog10 hydrog ?    ? M DA  6  N1    ? ? ? 1_555 O DT  9    N3    ? ? N DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog11 hydrog ?    ? M DA  6  N6    ? ? ? 1_555 O DT  9    O4    ? ? N DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog12 hydrog ?    ? M DC  7  N3    ? ? ? 1_555 O DG  8    N1    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog13 hydrog ?    ? M DC  7  N4    ? ? ? 1_555 O DG  8    O6    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog14 hydrog ?    ? M DC  7  O2    ? ? ? 1_555 O DG  8    N2    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog15 hydrog ?    ? M DT  8  N3    ? ? ? 1_555 O DA  7    N1    ? ? N DT  8    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog16 hydrog ?    ? M DT  8  O4    ? ? ? 1_555 O DA  7    N6    ? ? N DT  8    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog17 hydrog ?    ? M DT  9  N3    ? ? ? 1_555 O DA  6    N1    ? ? N DT  9    T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog18 hydrog ?    ? M DT  9  O4    ? ? ? 1_555 O DA  6    N6    ? ? N DT  9    T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog19 hydrog ?    ? M DG  10 N1    ? ? ? 1_555 O DT  4    O2    ? ? N DG  10   T DT  7    1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? 
hydrog20 hydrog ?    ? M DG  10 O6    ? ? ? 1_555 O DT  4    N3    ? ? N DG  10   T DT  7    1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     
? 
hydrog21 hydrog ?    ? M DG  10 N1    ? ? ? 1_555 O DC  5    N3    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog22 hydrog ?    ? M DG  10 N2    ? ? ? 1_555 O DC  5    O2    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog23 hydrog ?    ? M DG  10 O6    ? ? ? 1_555 O DC  5    N4    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog24 hydrog ?    ? M DA  11 N1    ? ? ? 1_555 O DT  4    N3    ? ? N DA  11   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog25 hydrog ?    ? M DA  11 N6    ? ? ? 1_555 O DT  4    O4    ? ? N DA  11   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog26 hydrog ?    ? N A   1  N1    ? ? ? 1_555 O DT  22   N3    ? ? P A   4    T DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog27 hydrog ?    ? N A   1  N6    ? ? ? 1_555 O DT  22   O4    ? ? P A   4    T DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog28 hydrog ?    ? N C   2  N3    ? ? ? 1_555 O DG  21   N1    ? ? P C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog29 hydrog ?    ? N C   2  N4    ? ? ? 1_555 O DG  21   O6    ? ? P C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog30 hydrog ?    ? N C   2  O2    ? ? ? 1_555 O DG  21   N2    ? ? P C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog31 hydrog ?    ? N C   3  N3    ? ? ? 1_555 O DG  20   N1    ? ? P C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog32 hydrog ?    ? N C   3  N4    ? ? ? 1_555 O DG  20   O6    ? ? P C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog33 hydrog ?    ? N C   3  O2    ? ? ? 1_555 O DG  20   N2    ? ? P C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog34 hydrog ?    ? N A   4  N1    ? ? ? 1_555 O BRU 19   N3    ? ? P A   7    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog35 hydrog ?    ? N A   4  N6    ? ? ? 1_555 O BRU 19   O4    ? ? P A   7    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog36 hydrog ?    ? N G   5  N1    ? ? ? 1_555 O DC  18   N3    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog37 hydrog ?    ? N G   5  N2    ? ? ? 1_555 O DC  18   O2    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog38 hydrog ?    ? N G   5  O6    ? ? ? 1_555 O DC  18   N4    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog39 hydrog ?    ? N G   6  N1    ? ? ? 1_555 O DC  17   N3    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog40 hydrog ?    ? N G   6  N2    ? ? ? 1_555 O DC  17   O2    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog41 hydrog ?    ? N G   6  O6    ? ? ? 1_555 O DC  17   N4    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog42 hydrog ?    ? N A   7  N1    ? ? ? 1_555 O DT  16   N3    ? ? P A   10   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog43 hydrog ?    ? N A   7  N6    ? ? ? 1_555 O DT  16   O4    ? ? P A   10   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 193 A . ? ASP 193 A ALA 194 A ? ALA 194 A 1 3.68  
2  ALA 194 A . ? ALA 194 A ASP 195 A ? ASP 195 A 1 -0.80 
3  GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 11.73 
4  LYS 567 A . ? LYS 567 A PRO 568 A ? PRO 568 A 1 -0.96 
5  GLY 338 B . ? GLY 338 B THR 339 B ? THR 339 B 1 2.41  
6  GLU 468 B . ? GLU 468 B GLN 469 B ? GLN 469 B 1 -7.11 
7  MET 473 B . ? MET 473 B SER 474 B ? SER 474 B 1 -0.58 
8  VAL 18  D . ? VAL 18  D GLU 19  D ? GLU 19  D 1 3.25  
9  PRO 128 E . ? PRO 128 E PRO 129 E ? PRO 129 E 1 1.46  
10 ASN 126 G . ? ASN 126 G PRO 127 G ? PRO 127 G 1 1.57  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 2  ? 
AC ? 2  ? 
AD ? 3  ? 
AE ? 2  ? 
AF ? 14 ? 
AG ? 4  ? 
AH ? 2  ? 
AI ? 2  ? 
AJ ? 3  ? 
AK ? 2  ? 
AL ? 3  ? 
AM ? 2  ? 
AN ? 4  ? 
AO ? 2  ? 
AP ? 5  ? 
AQ ? 2  ? 
DA ? 2  ? 
DB ? 2  ? 
FA ? 6  ? 
FB ? 7  ? 
GA ? 2  ? 
FC ? 7  ? 
BA ? 3  ? 
BB ? 3  ? 
BC ? 4  ? 
BD ? 5  ? 
BE ? 2  ? 
BF ? 2  ? 
BG ? 2  ? 
BH ? 4  ? 
BI ? 4  ? 
BJ ? 5  ? 
BK ? 5  ? 
BL ? 2  ? 
BM ? 16 ? 
BN ? 2  ? 
BO ? 2  ? 
BP ? 2  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
DC ? 2  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 4  ? 
GB ? 12 ? 
GC ? 3  ? 
HA ? 9  ? 
IA ? 3  ? 
IB ? 4  ? 
KA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
FA 4 5 ? anti-parallel 
FA 5 6 ? anti-parallel 
FB 1 2 ? anti-parallel 
FB 2 3 ? anti-parallel 
FB 3 4 ? anti-parallel 
FB 4 5 ? anti-parallel 
FB 5 6 ? anti-parallel 
FB 6 7 ? anti-parallel 
GA 1 2 ? anti-parallel 
FC 1 2 ? anti-parallel 
FC 2 3 ? anti-parallel 
FC 3 4 ? anti-parallel 
FC 4 5 ? anti-parallel 
FC 5 6 ? anti-parallel 
FC 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? parallel      
BC 3 4 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BE 1 2 ? parallel      
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? parallel      
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BI 1 2 ? parallel      
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? parallel      
BJ 4 5 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? anti-parallel 
BK 4 5 ? anti-parallel 
BL 1 2 ? parallel      
BM 1 2 ? anti-parallel 
BM 3 4 ? parallel      
BM 4 5 ? anti-parallel 
BM 6 7 ? anti-parallel 
BM 8 9 ? anti-parallel 
BN 1 2 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? parallel      
GB 1 2 ? anti-parallel 
GB 6 7 ? anti-parallel 
GC 1 2 ? anti-parallel 
GC 2 3 ? anti-parallel 
HA 1 2 ? anti-parallel 
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HA 4 5 ? anti-parallel 
HA 5 6 ? anti-parallel 
HA 6 7 ? anti-parallel 
HA 7 8 ? anti-parallel 
HA 8 9 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA 2 GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
AA 3 ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
AB 1 GLY A 82   ? PHE A 91   ? GLY A 82   PHE A 91   
AB 2 ILE A 235  ? VAL A 241  ? ILE A 235  VAL A 241  
AC 1 ASP A 151  ? PRO A 153  ? ASP A 151  PRO A 153  
AC 2 LEU A 161  ? SER A 163  ? LEU A 161  SER A 163  
AD 1 ARG A 175  ? LYS A 176  ? ARG A 175  LYS A 176  
AD 2 LEU A 181  ? TRP A 185  ? LEU A 181  TRP A 185  
AD 3 GLU A 198  ? LEU A 202  ? GLU A 198  LEU A 202  
AE 1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AE 2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AF 1 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AF 2 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
AF 3 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AF 4 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AF 5 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AF 6 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
AF 7 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AF 8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AG 1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AG 2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AG 3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AG 4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AH 1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AH 2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AI 1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
AI 2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
AJ 1 LEU A 588  ? ARG A 590  ? LEU A 588  ARG A 590  
AJ 2 MET A 605  ? ILE A 607  ? MET A 605  ILE A 607  
AJ 3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
AK 1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AK 2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AL 1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AL 2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AL 3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AM 1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
AM 2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
AN 1 VAL A 1283 ? TYR A 1287 ? VAL A 1283 TYR A 1287 
AN 2 GLU A 1303 ? GLU A 1307 ? GLU A 1303 GLU A 1307 
AN 3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
AN 4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AO 1 THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
AO 2 THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
AP 1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AP 2 ILE A 1237 ? VAL A 1242 ? ILE A 1237 VAL A 1242 
AP 3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AP 4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AP 5 LEU I 42   ? ARG I 45   ? LEU I 42   ARG I 45   
AQ 1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
AQ 2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
DA 1 SER D 6    ? THR D 7    ? SER D 6    THR D 7    
DA 2 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
DB 1 ILE D 48   ? ALA D 49   ? ILE D 48   ALA D 49   
DB 2 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
FA 1 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
FA 2 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
FA 3 PHE A 1441 ? ILE A 1445 ? PHE A 1441 ILE A 1445 
FA 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
FA 5 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
FA 6 TYR G 44   ? VAL G 48   ? TYR G 44   VAL G 48   
FB 1 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
FB 2 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
FB 3 PHE A 1441 ? ILE A 1445 ? PHE A 1441 ILE A 1445 
FB 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
FB 5 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
FB 6 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
FB 7 ILE D 48   ? ALA D 49   ? ILE D 48   ALA D 49   
GA 1 TYR G 44   ? VAL G 48   ? TYR G 44   VAL G 48   
GA 2 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
FC 1 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
FC 2 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
FC 3 PHE A 1441 ? ILE A 1445 ? PHE A 1441 ILE A 1445 
FC 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
FC 5 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
FC 6 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
FC 7 SER D 6    ? THR D 7    ? SER D 6    THR D 7    
BA 1 PHE B 92   ? VAL B 97   ? PHE B 92   VAL B 97   
BA 2 SER B 125  ? VAL B 132  ? SER B 125  VAL B 132  
BA 3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
BB 1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
BB 2 SER B 208  ? LEU B 212  ? SER B 208  LEU B 212  
BB 3 SER B 480  ? VAL B 482  ? SER B 480  VAL B 482  
BC 1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
BC 2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
BC 3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
BC 4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
BD 1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
BD 2 ILE B 234  ? SER B 242  ? ILE B 234  SER B 242  
BD 3 SER B 252  ? TYR B 259  ? SER B 252  TYR B 259  
BD 4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
BD 5 ILE B 280  ? PRO B 281  ? ILE B 280  PRO B 281  
BE 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
BE 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BF 1 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BF 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BG 1 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BG 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BH 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BH 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BH 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BH 4 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BI 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BI 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BI 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 4 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BJ 1 MET B 563  ? PRO B 565  ? MET B 563  PRO B 565  
BJ 2 TRP B 586  ? HIS B 590  ? TRP B 586  HIS B 590  
BJ 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
BJ 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
BJ 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
BK 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
BK 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
BK 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
BK 4 GLY B 947  ? THR B 956  ? GLY B 947  THR B 956  
BK 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
BL 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
BL 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
BM 1 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BM 2 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
BM 3 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
BM 4 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
BM 5 LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
BM 6 PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
BM 7 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
BM 8 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
BM 9 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BN 1 LYS B 865  ? TYR B 866  ? LYS B 865  TYR B 866  
BN 2 ILE B 870  ? THR B 871  ? ILE B 870  THR B 871  
BO 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
BO 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
BP 1 PHE B 1158 ? CYS B 1163 ? PHE B 1158 CYS B 1163 
BP 2 ILE B 1191 ? ILE B 1196 ? ILE B 1191 ILE B 1196 
CA 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
CA 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
CA 3 PHE C 228  ? SER C 234  ? PHE C 228  SER C 234  
CA 4 ALA C 173  ? GLU C 179  ? ALA C 173  GLU C 179  
CB 1 LEU C 118  ? ILE C 120  ? LEU C 118  ILE C 120  
CB 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
CB 3 GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
CB 4 THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
CB 5 VAL L 65   ? GLU L 68   ? VAL L 65   GLU L 68   
CC 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
CC 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
DC 1 LYS D 36   ? ILE D 38   ? LYS D 36   ILE D 38   
DC 2 GLU D 44   ? GLU D 46   ? GLU D 44   GLU D 46   
EA 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
EA 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
EA 3 THR E 107  ? TYR E 112  ? THR E 107  TYR E 112  
EA 4 THR E 131  ? ASN E 136  ? THR E 131  ASN E 136  
EB 1 SER E 87   ? VAL E 88   ? SER E 87   VAL E 88   
EB 2 ASN E 115  ? ILE E 116  ? ASN E 115  ILE E 116  
EC 1 LYS E 152  ? ARG E 155  ? LYS E 152  ARG E 155  
EC 2 VAL E 195  ? ARG E 200  ? VAL E 195  ARG E 200  
EC 3 TYR E 208  ? CYS E 214  ? TYR E 208  CYS E 214  
EC 4 ARG E 177  ? ILE E 178  ? ARG E 177  ILE E 178  
GB 1 VAL G 86   ? SER G 95   ? VAL G 86   SER G 95   
GB 2 ARG G 142  ? GLN G 153  ? ARG G 142  GLN G 153  
GB 3 GLY G 98   ? VAL G 103  ? GLY G 98   VAL G 103  
GB 4 MET G 106  ? THR G 111  ? MET G 106  THR G 111  
GB 5 SER G 156  ? SER G 162  ? SER G 156  SER G 162  
GB 6 GLY G 169  ? ALA G 170  ? GLY G 169  ALA G 170  
GB 7 ARG G 142  ? GLN G 153  ? ARG G 142  GLN G 153  
GC 1 THR G 120  ? ASN G 122  ? THR G 120  ASN G 122  
GC 2 SER G 129  ? GLN G 131  ? SER G 129  GLN G 131  
GC 3 VAL G 136  ? THR G 138  ? VAL G 136  THR G 138  
HA 1 TYR H 95   ? TYR H 98   ? TYR H 95   TYR H 98   
HA 2 TYR H 141  ? ARG H 145  ? TYR H 141  ARG H 145  
HA 3 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
HA 4 ASP H 7    ? ASP H 16   ? ASP H 7    ASP H 16   
HA 5 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
HA 6 LYS H 37   ? ASN H 43   ? LYS H 37   ASN H 43   
HA 7 LEU H 121  ? GLU H 126  ? LEU H 121  GLU H 126  
HA 8 ILE H 112  ? PHE H 118  ? ILE H 112  PHE H 118  
HA 9 THR H 100  ? GLU H 106  ? THR H 100  GLU H 106  
IA 1 TYR I 15   ? ASP I 19   ? TYR I 15   ASP I 19   
IA 2 ARG I 24   ? GLU I 28   ? ARG I 24   GLU I 28   
IA 3 VAL I 35   ? GLU I 37   ? VAL I 35   GLU I 37   
IB 1 ARG I 70   ? SER I 71   ? ARG I 70   SER I 71   
IB 2 ASN I 83   ? GLN I 87   ? ASN I 83   GLN I 87   
IB 3 LEU I 99   ? CYS I 103  ? LEU I 99   CYS I 103  
IB 4 ILE I 109  ? THR I 111  ? ILE I 109  THR I 111  
KA 1 LEU K 19   ? PRO K 23   ? LEU K 19   PRO K 23   
KA 2 ALA K 30   ? GLU K 36   ? ALA K 30   GLU K 36   
KA 3 ARG K 70   ? THR K 77   ? ARG K 70   THR K 77   
KA 4 VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ASP A 1419 ? N ASP A 1419 O VAL A 17   ? O VAL A 17   
AA 2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
AB 1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
AC 1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
AD 1 2 N ARG A 175  ? N ARG A 175  O VAL A 182  ? O VAL A 182  
AD 2 3 N TRP A 185  ? N TRP A 185  O GLU A 198  ? O GLU A 198  
AE 1 2 N VAL A 345  ? N VAL A 345  O LEU B 1128 ? O LEU B 1128 
AF 1 2 N ARG A 350  ? N ARG A 350  O HIS B 1104 ? O HIS B 1104 
AF 3 4 N VAL A 364  ? N VAL A 364  O ARG A 459  ? O ARG A 459  
AF 4 5 N HIS A 458  ? N HIS A 458  O VAL A 442  ? O VAL A 442  
AF 5 6 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AF 6 7 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
AF 7 8 N ARG B 1106 ? N ARG B 1106 O SER A 348  ? O SER A 348  
AG 1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AG 2 3 O GLU A 433  ? O GLU A 433  N LYS A 403  ? N LYS A 403  
AG 3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AH 1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AI 1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AJ 1 2 N ARG A 590  ? N ARG A 590  O MET A 605  ? O MET A 605  
AJ 2 3 O LEU A 606  ? O LEU A 606  N ILE A 613  ? N ILE A 613  
AK 1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AL 1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AL 2 3 O THR A 856  ? O THR A 856  N ILE A 864  ? N ILE A 864  
AM 1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
AN 1 2 N TYR A 1287 ? N TYR A 1287 O GLU A 1303 ? O GLU A 1303 
AN 2 3 N LEU A 1306 ? N LEU A 1306 O VAL A 1118 ? O VAL A 1118 
AN 3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AO 1 2 O THR A 1141 ? O THR A 1141 N LEU A 1273 ? N LEU A 1273 
AP 1 2 N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
AP 2 3 N CYS A 1240 ? N CYS A 1240 O LEU A 1193 ? O LEU A 1193 
AP 3 4 O GLU A 1196 ? O GLU A 1196 N ILE A 1148 ? N ILE A 1148 
AP 4 5 O ILE A 1152 ? O ILE A 1152 N VAL I 43   ? N VAL I 43   
AQ 1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
DA 1 2 N SER D 6    ? N SER D 6    O SER G 8    ? O SER G 8    
DB 1 2 N ILE D 48   ? N ILE D 48   O ILE G 4    ? O ILE G 4    
FA 1 2 N TRP F 146  ? N TRP F 146  O ILE F 134  ? O ILE F 134  
FA 2 3 N ARG F 135  ? N ARG F 135  O ASP A 1442 ? O ASP A 1442 
FA 3 4 N ILE A 1445 ? N ILE A 1445 O GLY G 59   ? O GLY G 59   
FA 4 5 N ARG G 60   ? N ARG G 60   O GLU G 69   ? O GLU G 69   
FA 5 6 N PHE G 79   ? N PHE G 79   O TYR G 44   ? O TYR G 44   
FB 1 2 N TRP F 146  ? N TRP F 146  O ILE F 134  ? O ILE F 134  
FB 2 3 N ARG F 135  ? N ARG F 135  O ASP A 1442 ? O ASP A 1442 
FB 3 4 N ILE A 1445 ? N ILE A 1445 O GLY G 59   ? O GLY G 59   
FB 4 5 N ARG G 60   ? N ARG G 60   O GLU G 69   ? O GLU G 69   
FB 5 6 N VAL G 78   ? N VAL G 78   O PHE G 3    ? O PHE G 3    
FB 6 7 N ILE G 4    ? N ILE G 4    O ILE D 48   ? O ILE D 48   
GA 1 2 N LEU G 46   ? N LEU G 46   O VAL G 77   ? O VAL G 77   
FC 1 2 N TRP F 146  ? N TRP F 146  O ILE F 134  ? O ILE F 134  
FC 2 3 N ARG F 135  ? N ARG F 135  O ASP A 1442 ? O ASP A 1442 
FC 3 4 N ILE A 1445 ? N ILE A 1445 O GLY G 59   ? O GLY G 59   
FC 4 5 N ARG G 60   ? N ARG G 60   O GLU G 69   ? O GLU G 69   
FC 5 6 N VAL G 78   ? N VAL G 78   O PHE G 3    ? O PHE G 3    
FC 6 7 N SER G 8    ? N SER G 8    O SER D 6    ? O SER D 6    
BA 1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
BA 2 3 N VAL B 130  ? N VAL B 130  O VAL B 165  ? O VAL B 165  
BB 1 2 N ILE B 205  ? N ILE B 205  O SER B 208  ? O SER B 208  
BB 2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
BC 1 2 N ASP B 407  ? N ASP B 407  O GLN B 215  ? O GLN B 215  
BC 2 3 N ALA B 214  ? N ALA B 214  O ARG B 497  ? O ARG B 497  
BC 3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
BD 1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
BD 2 3 N SER B 242  ? N SER B 242  O SER B 252  ? O SER B 252  
BD 3 4 N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
BD 4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
BE 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
BF 1 2 N GLU B 650  ? N GLU B 650  O GLU B 641  ? O GLU B 641  
BG 1 2 N ILE B 693  ? N ILE B 693  O ARG B 635  ? O ARG B 635  
BH 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BH 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BH 3 4 N GLU B 641  ? N GLU B 641  O GLU B 650  ? O GLU B 650  
BI 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BI 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BI 3 4 N LEU B 637  ? N LEU B 637  O GLU B 691  ? O GLU B 691  
BJ 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
BJ 2 3 N HIS B 590  ? N HIS B 590  O THR B 578  ? O THR B 578  
BJ 3 4 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
BJ 4 5 N PHE B 627  ? N PHE B 627  O SER B 614  ? O SER B 614  
BK 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
BK 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
BK 3 4 N ARG B 969  ? N ARG B 969  O ILE B 948  ? O ILE B 948  
BK 4 5 N GLY B 947  ? N GLY B 947  O VAL B 905  ? O VAL B 905  
BL 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
BM 1 2 N ILE B 827  ? N ILE B 827  O PHE B 1086 ? O PHE B 1086 
BM 3 4 N MET B 839  ? N MET B 839  O THR B 989  ? O THR B 989  
BM 4 5 N GLY B 988  ? N GLY B 988  O PHE B 980  ? O PHE B 980  
BM 6 7 N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
BM 8 9 N TYR B 1092 ? N TYR B 1092 O GLN B 821  ? O GLN B 821  
BN 1 2 N TYR B 866  ? N TYR B 866  O ILE B 870  ? O ILE B 870  
BO 1 2 N ILE B 911  ? N ILE B 911  O THR B 939  ? O THR B 939  
BP 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
CA 1 2 N GLU C 12   ? N GLU C 12   O ASP C 19   ? O ASP C 19   
CA 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
CA 3 4 O GLU C 233  ? O GLU C 233  N ALA C 174  ? N ALA C 174  
CB 1 2 N VAL C 119  ? N VAL C 119  O THR C 100  ? O THR C 100  
CB 2 3 N ALA C 103  ? N ALA C 103  O LEU C 153  ? O LEU C 153  
CB 3 4 N GLY C 162  ? N GLY C 162  O THR C 43   ? O THR C 43   
CB 4 5 N VAL C 51   ? N VAL C 51   O VAL L 65   ? O VAL L 65   
CC 1 2 O VAL C 113  ? O VAL C 113  N ILE C 144  ? N ILE C 144  
DC 1 2 N GLN D 37   ? N GLN D 37   O GLU D 45   ? O GLU D 45   
EA 1 2 N ALA E 62   ? N ALA E 62   O LEU E 78   ? O LEU E 78   
EA 2 3 N TRP E 79   ? N TRP E 79   O THR E 107  ? O THR E 107  
EA 3 4 N GLY E 108  ? N GLY E 108  O THR E 131  ? O THR E 131  
EB 1 2 N VAL E 88   ? N VAL E 88   O ASN E 115  ? O ASN E 115  
EC 1 2 N ILE E 154  ? N ILE E 154  O LYS E 197  ? O LYS E 197  
EC 2 3 N ARG E 200  ? N ARG E 200  O TYR E 208  ? O TYR E 208  
EC 3 4 O ILE E 213  ? O ILE E 213  N ILE E 178  ? N ILE E 178  
GB 1 2 N GLY G 89   ? N GLY G 89   O ILE G 143  ? O ILE G 143  
GB 6 7 N GLY G 169  ? N GLY G 169  O ARG G 144  ? O ARG G 144  
GC 1 2 N ASN G 122  ? N ASN G 122  O SER G 129  ? O SER G 129  
GC 2 3 N TYR G 130  ? N TYR G 130  O ILE G 137  ? O ILE G 137  
HA 1 2 N MET H 97   ? N MET H 97   O LEU H 142  ? O LEU H 142  
HA 2 3 N ARG H 145  ? N ARG H 145  O THR H 56   ? O THR H 56   
HA 3 4 N VAL H 57   ? N VAL H 57   O ASP H 8    ? O ASP H 8    
HA 4 5 N ASP H 16   ? N ASP H 16   O ARG H 25   ? O ARG H 25   
HA 5 6 N ALA H 28   ? N ALA H 28   O LEU H 38   ? O LEU H 38   
HA 6 7 N ASP H 41   ? N ASP H 41   O LEU H 122  ? O LEU H 122  
HA 7 8 N LEU H 125  ? N LEU H 125  O VAL H 114  ? O VAL H 114  
HA 8 9 N SER H 117  ? N SER H 117  O THR H 100  ? O THR H 100  
IA 1 2 N ASP I 19   ? N ASP I 19   O ARG I 24   ? O ARG I 24   
IA 2 3 N PHE I 27   ? N PHE I 27   O GLU I 36   ? O GLU I 36   
IB 1 2 N SER I 71   ? N SER I 71   O ASN I 83   ? O ASN I 83   
IB 2 3 N PHE I 86   ? N PHE I 86   O PHE I 100  ? O PHE I 100  
IB 3 4 N PHE I 101  ? N PHE I 101  O PHE I 110  ? O PHE I 110  
KA 1 2 N ASP K 22   ? N ASP K 22   O VAL K 32   ? O VAL K 32   
KA 2 3 N PHE K 35   ? N PHE K 35   O PHE K 71   ? O PHE K 71   
KA 3 4 O GLN K 76   ? O GLN K 76   N LEU K 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2456' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2457' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 2458' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 2225' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1269' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1121' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1122' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 1066' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 1071' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4 CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4 CYS A 70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4 CYS A 77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4 HIS A 80   ? HIS A 80   . ? 1_555 ? 
9  AC3 4 ASP A 481  ? ASP A 481  . ? 1_555 ? 
10 AC3 4 ASP A 483  ? ASP A 483  . ? 1_555 ? 
11 AC3 4 ASP A 485  ? ASP A 485  . ? 1_555 ? 
12 AC3 4 A   N 7    ? A   P 10   . ? 1_555 ? 
13 AC4 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
14 AC4 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
15 AC4 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
16 AC4 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
17 AC5 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
18 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
19 AC5 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
20 AC5 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
21 AC6 4 CYS I 7    ? CYS I 7    . ? 1_555 ? 
22 AC6 4 CYS I 10   ? CYS I 10   . ? 1_555 ? 
23 AC6 4 CYS I 29   ? CYS I 29   . ? 1_555 ? 
24 AC6 4 CYS I 32   ? CYS I 32   . ? 1_555 ? 
25 AC7 4 CYS I 75   ? CYS I 75   . ? 1_555 ? 
26 AC7 4 CYS I 78   ? CYS I 78   . ? 1_555 ? 
27 AC7 4 CYS I 103  ? CYS I 103  . ? 1_555 ? 
28 AC7 4 CYS I 106  ? CYS I 106  . ? 1_555 ? 
29 AC8 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
30 AC8 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
31 AC8 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
32 AC8 4 CYS J 46   ? CYS J 46   . ? 1_555 ? 
33 AC9 4 CYS L 31   ? CYS L 31   . ? 1_555 ? 
34 AC9 4 CYS L 34   ? CYS L 34   . ? 1_555 ? 
35 AC9 4 CYS L 48   ? CYS L 48   . ? 1_555 ? 
36 AC9 4 CYS L 51   ? CYS L 51   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4A3K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4A3K 
_atom_sites.fract_transf_matrix[1][1]   0.004506 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002555 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003522 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 109.800 22.370  -24.546 1.00 92.22  ? 3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 111.008 22.615  -25.333 1.00 92.16  ? 3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 110.756 22.827  -26.819 1.00 94.77  ? 3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 109.989 22.073  -27.433 1.00 95.95  ? 3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 111.395 23.858  -27.412 1.00 87.49  ? 4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 111.241 24.170  -28.840 1.00 86.29  ? 4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 112.250 23.402  -29.681 1.00 88.96  ? 4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 113.338 23.128  -29.194 1.00 88.98  ? 4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 111.334 25.678  -29.093 1.00 87.27  ? 4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 110.063 26.430  -28.691 1.00 89.52  ? 4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 110.025 27.824  -29.255 1.00 87.73  ? 4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 110.181 28.819  -28.544 1.00 83.91  ? 4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 109.819 27.924  -30.544 1.00 68.14  ? 4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 111.904 23.040  -30.930 1.00 84.63  ? 5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 112.788 22.227  -31.780 1.00 84.08  ? 5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 113.919 22.935  -32.503 1.00 83.28  ? 5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 113.945 24.156  -32.521 1.00 81.57  ? 5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 111.993 21.263  -32.687 1.00 86.79  ? 5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 111.199 20.165  -31.921 1.00 116.35 ? 5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 111.827 19.564  -30.646 1.00 134.62 ? 5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 111.147 19.410  -29.611 1.00 128.75 ? 5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 113.110 19.170  -30.694 1.00 120.66 ? 5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 114.878 22.180  -33.068 1.00 78.98  ? 6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 116.004 22.807  -33.769 1.00 78.63  ? 6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 115.592 23.459  -35.081 1.00 80.26  ? 6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 114.985 22.803  -35.937 1.00 80.30  ? 6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 117.183 21.828  -34.011 1.00 80.27  ? 6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 118.229 22.353  -34.986 1.00 82.31  ? 6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 119.298 23.129  -34.546 1.00 84.28  ? 6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 118.119 22.117  -36.353 1.00 83.76  ? 6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 120.234 23.651  -35.441 1.00 85.39  ? 6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 119.034 22.653  -37.259 1.00 85.37  ? 6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 120.097 23.408  -36.797 1.00 92.10  ? 6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 121.001 23.924  -37.692 1.00 93.39  ? 6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 116.003 24.722  -35.263 1.00 74.13  ? 7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 115.777 25.431  -36.505 1.00 73.50  ? 7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 117.092 25.864  -37.130 1.00 77.09  ? 7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 117.918 26.543  -36.501 1.00 76.61  ? 7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 114.851 26.617  -36.300 1.00 76.61  ? 7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 114.786 27.409  -37.476 1.00 85.51  ? 7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 117.270 25.459  -38.383 1.00 73.54  ? 8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 118.411 25.746  -39.247 1.00 73.98  ? 8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 118.598 27.251  -39.549 1.00 79.20  ? 8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 119.640 27.648  -40.079 1.00 80.30  ? 8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 118.227 24.995  -40.552 1.00 78.86  ? 8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 116.836 24.820  -40.773 1.00 91.79  ? 8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 117.587 28.079  -39.231 1.00 75.08  ? 9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 117.611 29.526  -39.434 1.00 74.68  ? 9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 118.686 30.205  -38.568 1.00 77.10  ? 9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 118.825 29.869  -37.386 1.00 77.44  ? 9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 116.244 30.115  -39.121 1.00 75.19  ? 9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 119.452 31.156  -39.132 1.00 71.82  ? 10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 120.493 31.832  -38.345 1.00 71.23  ? 10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 119.947 32.651  -37.194 1.00 73.67  ? 10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 119.097 33.516  -37.409 1.00 73.94  ? 10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 121.190 32.731  -39.362 1.00 73.70  ? 10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 120.237 32.890  -40.440 1.00 79.15  ? 10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 119.440 31.640  -40.517 1.00 74.58  ? 10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 120.435 32.370  -35.970 1.00 67.45  ? 11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 119.968 33.091  -34.796 1.00 65.28  ? 11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 120.604 34.446  -34.663 1.00 69.11  ? 11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 121.827 34.527  -34.535 1.00 70.63  ? 11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 120.178 32.292  -33.508 1.00 64.08  ? 11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 119.739 32.992  -32.234 1.00 67.47  ? 11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 118.276 32.723  -31.932 1.00 67.32  ? 11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 120.636 32.635  -31.086 1.00 69.88  ? 11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 119.773 35.499  -34.602 1.00 63.41  ? 12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 120.235 36.859  -34.373 1.00 62.73  ? 12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 119.485 37.583  -33.243 1.00 65.97  ? 12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 118.593 37.011  -32.582 1.00 64.89  ? 12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 120.275 37.668  -35.667 1.00 63.80  ? 12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 121.612 37.592  -36.367 1.00 78.26  ? 12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 121.504 36.880  -37.704 1.00 88.64  ? 12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 122.324 37.544  -38.721 1.00 99.83  ? 12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 121.929 38.592  -39.446 1.00 115.57 ? 12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 120.712 39.095  -39.292 1.00 92.97  ? 12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 122.747 39.136  -40.339 1.00 110.56 ? 12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 119.920 38.826  -32.986 1.00 62.76  ? 13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 119.380 39.745  -31.985 1.00 62.05  ? 13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 118.704 40.901  -32.704 1.00 67.33  ? 13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 119.064 41.194  -33.853 1.00 68.83  ? 13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 120.500 40.255  -31.088 1.00 69.42  ? 13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 121.763 40.133  -31.764 1.00 74.40  ? 13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 120.543 39.530  -29.774 1.00 66.59  ? 13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 117.712 41.541  -32.059 1.00 62.59  ? 14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 117.022 42.673  -32.673 1.00 62.68  ? 14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 117.825 43.942  -32.426 1.00 68.20  ? 14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 118.095 44.302  -31.273 1.00 67.19  ? 14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 115.533 42.789  -32.298 1.00 65.91  ? 14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 114.899 44.021  -32.935 1.00 66.23  ? 14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 114.779 41.536  -32.722 1.00 65.67  ? 14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 118.277 44.565  -33.534 1.00 66.20  ? 15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 119.109 45.769  -33.526 1.00 65.88  ? 15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 118.270 47.016  -33.669 1.00 71.26  ? 15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 118.589 48.028  -33.059 1.00 71.09  ? 15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 120.222 45.697  -34.601 1.00 66.92  ? 15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 121.486 44.940  -34.161 1.00 73.66  ? 15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 121.293 43.413  -34.158 1.00 88.85  ? 15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 122.549 42.571  -34.098 1.00 111.31 ? 15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 122.266 41.124  -34.384 1.00 122.26 ? 15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 117.197 46.949  -34.464 1.00 69.27  ? 16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 116.332 48.098  -34.721 1.00 70.04  ? 16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 114.872 47.707  -34.809 1.00 73.25  ? 16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 114.536 46.654  -35.361 1.00 72.63  ? 16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 116.708 48.770  -36.060 1.00 72.64  ? 16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 118.134 49.286  -36.204 1.00 84.40  ? 16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 118.466 49.891  -37.555 1.00 106.20 ? 16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 117.807 49.542  -38.567 1.00 98.33  ? 16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 119.407 50.718  -37.593 1.00 96.27  ? 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 113.998 48.575  -34.316 1.00 69.86  ? 17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 112.573 48.327  -34.482 1.00 70.09  ? 17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 112.071 49.438  -35.414 1.00 77.25  ? 17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 112.094 50.610  -35.035 1.00 79.19  ? 17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 111.729 48.177  -33.190 1.00 72.33  ? 17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 110.353 47.604  -33.524 1.00 72.03  ? 17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 112.427 47.296  -32.171 1.00 71.18  ? 17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 111.693 49.079  -36.647 1.00 72.64  ? 18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 111.222 50.032  -37.637 1.00 72.72  ? 18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 109.700 50.147  -37.602 1.00 77.01  ? 18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 108.989 49.354  -38.228 1.00 77.60  ? 18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 111.755 49.643  -39.031 1.00 74.70  ? 18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 111.293 50.525  -40.196 1.00 82.68  ? 18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 111.584 51.986  -39.999 1.00 87.61  ? 18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 110.758 52.747  -39.479 1.00 73.96  ? 18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 112.760 52.406  -40.434 1.00 84.46  ? 18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 109.195 51.144  -36.874 1.00 73.41  ? 19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 107.751 51.374  -36.779 1.00 73.50  ? 19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 107.156 51.852  -38.105 1.00 81.34  ? 19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 107.901 52.262  -38.999 1.00 82.82  ? 19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 107.410 52.315  -35.620 1.00 74.19  ? 19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 107.608 51.637  -34.298 1.00 74.22  ? 19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 106.619 50.827  -33.763 1.00 76.48  ? 19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 108.810 51.745  -33.619 1.00 76.01  ? 19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 106.815 50.168  -32.551 1.00 76.54  ? 19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 109.011 51.077  -32.410 1.00 77.95  ? 19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 108.007 50.302  -31.878 1.00 75.48  ? 19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 105.838 51.753  -38.233 1.00 77.90  ? 20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 105.136 52.140  -39.446 1.00 78.53  ? 20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 103.696 51.696  -39.435 1.00 83.21  ? 20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 103.178 51.301  -38.391 1.00 82.84  ? 20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 103.040 51.757  -40.598 1.00 80.88  ? 21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 101.634 51.372  -40.769 1.00 80.51  ? 21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 101.467 50.316  -41.877 1.00 87.67  ? 21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 102.252 50.268  -42.834 1.00 89.17  ? 21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 100.758 52.614  -41.052 1.00 80.35  ? 21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 100.880 53.785  -40.074 1.00 83.36  ? 21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 100.223 54.989  -40.606 1.00 84.19  ? 21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 100.295 53.462  -38.739 1.00 83.58  ? 21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 100.460 49.461  -41.739 1.00 84.34  ? 22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 100.205 48.440  -42.740 1.00 85.24  ? 22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 99.471  49.015  -43.952 1.00 91.19  ? 22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 98.396  49.621  -43.805 1.00 91.42  ? 22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 99.330  47.328  -42.156 1.00 86.95  ? 22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 100.009 46.109  -41.595 1.00 88.13  ? 22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 100.781 45.290  -42.406 1.00 90.92  ? 22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 99.775  45.709  -40.282 1.00 90.40  ? 22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 101.379 44.140  -41.892 1.00 91.42  ? 22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 100.355 44.543  -39.773 1.00 92.54  ? 22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 101.150 43.766  -40.582 1.00 90.48  ? 22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 100.032 48.791  -45.155 1.00 87.91  ? 23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 99.376  49.136  -46.412 1.00 87.83  ? 23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 98.354  48.012  -46.615 1.00 90.20  ? 23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 98.660  46.860  -46.286 1.00 88.84  ? 23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 100.375 49.146  -47.561 1.00 91.59  ? 23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 101.129 47.952  -47.648 1.00 100.96 ? 23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 97.124  48.304  -47.078 1.00 87.27  ? 24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 96.114  47.230  -47.220 1.00 87.25  ? 24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 96.645  46.044  -47.988 1.00 91.42  ? 24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 96.438  44.899  -47.594 1.00 90.41  ? 24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 94.975  47.897  -47.991 1.00 90.42  ? 24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 95.119  49.332  -47.704 1.00 95.83  ? 24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 96.581  49.617  -47.465 1.00 90.48  ? 24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 97.401  46.348  -49.051 1.00 89.31  ? 25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 98.069  45.420  -49.965 1.00 89.32  ? 25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 98.900  44.385  -49.179 1.00 90.59  ? 25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 98.830  43.191  -49.486 1.00 89.28  ? 25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 98.936  46.214  -50.978 1.00 91.52  ? 25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 98.179  47.247  -51.823 1.00 103.23 ? 25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 97.756  48.564  -51.177 1.00 124.12 ? 25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 98.288  48.896  -50.093 1.00 127.37 ? 25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 96.900  49.271  -51.761 1.00 109.14 ? 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 99.621  44.859  -48.119 1.00 86.17  ? 26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 100.464 44.054  -47.226 1.00 84.66  ? 26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 99.611  43.117  -46.415 1.00 87.61  ? 26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 99.920  41.923  -46.361 1.00 86.91  ? 26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 101.341 44.925  -46.294 1.00 85.24  ? 26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 102.392 44.109  -45.545 1.00 95.19  ? 26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 103.571 44.810  -44.886 1.00 114.70 ? 26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 103.524 46.053  -44.712 1.00 112.35 ? 26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 104.535 44.095  -44.512 1.00 96.62  ? 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 98.534  43.655  -45.788 1.00 83.26  ? 27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 97.591  42.887  -44.965 1.00 81.45  ? 27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 97.106  41.681  -45.773 1.00 85.20  ? 27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 97.164  40.562  -45.259 1.00 84.33  ? 27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 96.417  43.743  -44.424 1.00 84.22  ? 27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 95.543  42.935  -43.478 1.00 83.04  ? 27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 96.916  45.019  -43.750 1.00 83.52  ? 27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 96.723  41.909  -47.060 1.00 81.79  ? 28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 96.256  40.862  -47.958 1.00 82.46  ? 28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 97.366  39.862  -48.252 1.00 88.41  ? 28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 97.094  38.654  -48.289 1.00 89.59  ? 28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 95.666  41.442  -49.261 1.00 84.21  ? 28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 94.287  40.850  -49.614 1.00 98.80  ? 28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 93.982  40.615  -51.106 1.00 113.51 ? 28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 94.869  39.654  -51.800 1.00 118.13 ? 28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 94.473  38.773  -52.729 1.00 118.70 ? 28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 93.186  38.659  -53.044 1.00 101.56 ? 28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 95.362  37.985  -53.334 1.00 88.81  ? 28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 98.624  40.360  -48.419 1.00 84.25  ? 29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 99.818  39.561  -48.747 1.00 82.90  ? 29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 100.244 38.595  -47.643 1.00 84.85  ? 29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 100.326 37.379  -47.901 1.00 84.23  ? 29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 100.969 40.464  -49.146 1.00 83.52  ? 29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 100.480 39.133  -46.416 1.00 80.44  ? 30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 100.867 38.366  -45.220 1.00 79.66  ? 30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 99.768  37.362  -44.801 1.00 86.56  ? 30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 100.105 36.257  -44.344 1.00 87.56  ? 30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 101.335 39.243  -44.001 1.00 81.46  ? 30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 100.241 40.180  -43.454 1.00 81.64  ? 30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 102.634 39.985  -44.266 1.00 82.43  ? 30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 100.260 40.314  -41.961 1.00 89.44  ? 30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 98.463  37.757  -44.957 1.00 82.25  ? 31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 97.265  36.986  -44.594 1.00 81.26  ? 31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 97.229  35.560  -45.125 1.00 82.63  ? 31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 97.435  35.359  -46.323 1.00 85.38  ? 31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 96.008  37.720  -45.035 1.00 86.63  ? 31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 94.845  36.961  -44.746 1.00 97.16  ? 31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 96.927  34.589  -44.242 1.00 75.08  ? 32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 96.860  33.156  -44.564 1.00 74.24  ? 32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 95.473  32.671  -44.848 1.00 76.95  ? 32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 95.316  31.533  -45.298 1.00 76.70  ? 32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 97.603  32.208  -43.580 1.00 77.51  ? 32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 99.041  32.675  -43.364 1.00 77.79  ? 32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 96.846  32.007  -42.250 1.00 75.90  ? 32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 94.470  33.510  -44.533 1.00 72.65  ? 33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 93.041  33.262  -44.729 1.00 72.46  ? 33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 92.259  34.590  -44.659 1.00 80.25  ? 33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 92.767  35.587  -44.139 1.00 81.12  ? 33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 92.529  32.292  -43.673 1.00 71.42  ? 33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 91.063  34.609  -45.245 1.00 77.72  ? 34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 90.055  35.666  -45.170 1.00 78.53  ? 34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 88.821  34.821  -45.043 1.00 87.31  ? 34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 88.717  33.899  -45.852 1.00 89.69  ? 34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 90.037  36.613  -46.408 1.00 80.90  ? 34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 89.446  36.160  -47.781 1.00 79.03  ? 34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 87.990  36.660  -48.082 1.00 78.55  ? 34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 87.796  38.110  -48.508 1.00 80.30  ? 34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 86.818  38.838  -47.630 1.00 83.26  ? 34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 88.124  34.772  -43.911 1.00 84.11  ? 35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 87.657  35.607  -42.811 1.00 82.85  ? 35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 86.456  36.336  -43.345 1.00 87.07  ? 35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 86.489  37.517  -43.704 1.00 86.22  ? 35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 88.583  36.225  -41.733 1.00 83.76  ? 35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 89.326  35.086  -41.029 1.00 82.04  ? 35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 87.754  36.925  -40.664 1.00 83.46  ? 35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 90.634  34.838  -41.526 1.00 88.29  ? 35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 85.423  35.464  -43.516 1.00 84.50  ? 36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 84.138  35.586  -44.174 1.00 86.36  ? 36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 82.905  35.354  -43.284 1.00 91.75  ? 36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 81.834  35.905  -43.586 1.00 91.06  ? 36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 84.103  34.539  -45.305 1.00 88.55  ? 36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 84.859  34.931  -46.569 1.00 99.57  ? 36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 84.969  33.805  -47.590 1.00 103.41 ? 36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 86.335  33.729  -48.106 1.00 107.52 ? 36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 87.039  32.610  -48.211 1.00 127.19 ? 36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 86.490  31.441  -47.900 1.00 114.10 ? 36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 88.297  32.646  -48.645 1.00 123.84 ? 36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 83.017  34.494  -42.244 1.00 89.20  ? 37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 81.857  34.182  -41.394 1.00 89.49  ? 37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 82.043  34.483  -39.931 1.00 94.86  ? 37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 83.001  33.985  -39.350 1.00 94.16  ? 37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 81.449  32.725  -41.534 1.00 91.00  ? 37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 81.621  32.227  -42.927 1.00 93.19  ? 37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 80.845  32.729  -43.958 1.00 96.15  ? 37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 82.597  31.296  -43.226 1.00 97.03  ? 37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 81.033  32.292  -45.262 1.00 100.42 ? 37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 82.783  30.852  -44.531 1.00 98.96  ? 37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 82.001  31.355  -45.543 1.00 98.69  ? 37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 81.081  35.173  -39.283 1.00 92.95  ? 38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 81.214  35.453  -37.845 1.00 93.38  ? 38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 81.288  34.209  -36.958 1.00 102.02 ? 38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 81.911  34.263  -35.894 1.00 101.59 ? 38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 79.986  36.303  -37.532 1.00 95.29  ? 38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 79.043  36.015  -38.622 1.00 100.39 ? 38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 79.868  35.800  -39.830 1.00 95.65  ? 38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 80.685  33.092  -37.411 1.00 102.11 ? 39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 80.680  31.799  -36.725 1.00 103.26 ? 39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 82.127  31.363  -36.501 1.00 111.86 ? 39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 82.938  31.465  -37.423 1.00 111.98 ? 39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 79.909  30.759  -37.555 1.00 105.42 ? 39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 78.430  31.088  -37.765 1.00 121.18 ? 39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 78.035  32.083  -38.851 1.00 149.54 ? 39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 78.939  32.701  -39.457 1.00 141.83 ? 39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 76.815  32.247  -39.096 1.00 148.22 ? 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 82.467  30.977  -35.256 1.00 112.05 ? 40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 83.810  30.558  -34.816 1.00 113.19 ? 40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 84.173  29.270  -35.513 1.00 123.38 ? 40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 85.106  29.191  -36.331 1.00 122.81 ? 40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 83.785  30.307  -33.293 1.00 120.50 ? 40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 83.335  31.478  -32.615 1.00 127.87 ? 40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 85.113  29.847  -32.736 1.00 114.21 ? 40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 83.409  28.248  -35.161 1.00 125.28 ? 41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 83.585  26.922  -35.683 1.00 127.84 ? 41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 82.248  26.216  -35.764 1.00 136.61 ? 41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 81.272  26.836  -36.200 1.00 136.42 ? 41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 84.667  26.152  -34.902 1.00 129.54 ? 41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 84.685  26.395  -33.422 1.00 132.13 ? 41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 84.598  24.812  -32.617 1.00 135.78 ? 41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 82.974  24.942  -31.955 1.00 133.00 ? 41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 82.203  24.932  -35.350 1.00 136.75 ? 42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 81.034  24.052  -35.373 1.00 138.57 ? 42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 80.626  23.936  -36.845 1.00 143.47 ? 42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 79.824  24.731  -37.329 1.00 142.79 ? 42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 79.880  24.558  -34.422 1.00 141.03 ? 42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 79.679  23.903  -33.030 1.00 147.50 ? 42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 80.351  22.873  -32.737 1.00 146.23 ? 42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 78.806  24.386  -32.266 1.00 150.52 ? 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 81.280  23.013  -37.572 1.00 142.10 ? 43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 81.031  22.727  -38.992 1.00 144.51 ? 43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 79.580  22.220  -39.099 1.00 151.96 ? 43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 79.342  21.024  -39.306 1.00 152.51 ? 43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 82.011  21.648  -39.511 1.00 146.10 ? 43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 83.466  21.814  -39.104 1.00 157.46 ? 43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 84.396  20.747  -39.646 1.00 176.54 ? 43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 84.321  19.588  -39.174 1.00 169.90 ? 43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 85.221  21.080  -40.527 1.00 166.86 ? 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 78.610  23.156  -38.937 1.00 149.57 ? 44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 77.159  22.933  -38.821 1.00 149.81 ? 44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 76.973  22.156  -37.482 1.00 151.54 ? 44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 76.438  21.045  -37.476 1.00 152.35 ? 44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 76.519  22.304  -40.111 1.00 158.58 ? 44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 77.235  22.702  -41.286 1.00 157.48 ? 44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 75.033  22.641  -40.260 1.00 157.63 ? 44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 77.510  22.733  -36.362 1.00 144.87 ? 45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 77.544  22.203  -34.977 1.00 143.19 ? 45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 78.549  21.056  -34.717 1.00 141.56 ? 45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 78.838  20.710  -33.566 1.00 139.67 ? 45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 76.150  21.976  -34.341 1.00 145.81 ? 45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 76.070  22.363  -32.854 1.00 166.67 ? 45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 74.843  21.803  -32.165 1.00 187.58 ? 45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 74.847  20.674  -31.658 1.00 184.02 ? 45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 73.777  22.592  -32.101 1.00 178.37 ? 45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 79.108  20.507  -35.795 1.00 135.75 ? 46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 80.104  19.448  -35.755 1.00 134.26 ? 46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 81.395  20.080  -35.229 1.00 136.20 ? 46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 82.200  20.587  -36.025 1.00 136.81 ? 46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 80.241  18.849  -37.160 1.00 139.64 ? 46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 78.945  18.466  -37.621 1.00 139.06 ? 46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 81.210  17.675  -37.224 1.00 137.15 ? 46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 81.550  20.099  -33.877 1.00 129.42 ? 47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 82.690  20.685  -33.160 1.00 127.23 ? 47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 84.118  20.373  -33.742 1.00 126.96 ? 47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 84.758  19.362  -33.419 1.00 126.14 ? 47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 82.549  20.493  -31.641 1.00 128.43 ? 47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 83.532  21.308  -30.808 1.00 145.75 ? 47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 84.320  20.431  -29.842 1.00 161.82 ? 47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 85.689  20.915  -29.661 1.00 172.44 ? 47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 86.769  20.140  -29.661 1.00 186.40 ? 47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 86.651  18.824  -29.815 1.00 172.81 ? 47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 87.973  20.670  -29.498 1.00 172.26 ? 47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 84.549  21.278  -34.656 1.00 119.68 ? 48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 85.791  21.360  -35.431 1.00 116.93 ? 48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 85.756  22.751  -36.087 1.00 117.04 ? 48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 84.683  23.185  -36.512 1.00 116.75 ? 48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 85.828  20.269  -36.493 1.00 117.91 ? 48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 86.902  23.468  -36.105 1.00 110.84 ? 49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 87.065  24.850  -36.613 1.00 109.97 ? 49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 86.505  25.110  -38.015 1.00 110.13 ? 49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 86.823  24.344  -38.934 1.00 110.56 ? 49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 88.534  25.318  -36.539 1.00 113.95 ? 49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 89.307  24.982  -35.242 1.00 137.31 ? 49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 90.781  25.476  -35.318 1.00 143.57 ? 49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 91.806  24.404  -35.024 1.00 140.80 ? 49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 93.164  24.799  -35.474 1.00 137.59 ? 49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 85.710  26.204  -38.190 1.00 102.81 ? 50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 85.096  26.548  -39.489 1.00 102.07 ? 50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 86.042  27.296  -40.425 1.00 98.28  ? 50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 86.616  28.284  -39.974 1.00 97.44  ? 50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 83.684  27.234  -39.328 1.00 106.97 ? 50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 82.535  26.157  -39.291 1.00 109.00 ? 50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 83.400  28.393  -40.347 1.00 108.36 ? 50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 81.014  26.613  -39.636 1.00 119.51 ? 50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 86.164  26.843  -41.697 1.00 89.69  ? 51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 86.968  27.480  -42.745 1.00 87.49  ? 51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 86.307  28.788  -43.149 1.00 88.27  ? 51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 85.703  28.865  -44.214 1.00 88.37  ? 51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 86.355  29.781  -42.248 1.00 82.37  ? 52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 85.672  31.070  -42.327 1.00 81.83  ? 52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 86.048  32.080  -41.254 1.00 85.73  ? 52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 86.283  33.208  -41.661 1.00 87.44  ? 52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 86.033  31.754  -39.865 1.00 79.47  ? 53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 86.618  32.541  -38.688 1.00 76.49  ? 53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 87.658  31.643  -38.021 1.00 80.35  ? 53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 87.965  30.615  -38.614 1.00 82.39  ? 53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 85.689  33.217  -37.615 1.00 74.99  ? 53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 86.300  34.469  -36.811 1.00 75.84  ? 53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 85.222  35.468  -36.295 1.00 74.48  ? 53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 87.138  34.053  -35.628 1.00 73.69  ? 53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 88.190  31.966  -36.825 1.00 74.60  ? 54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 89.275  31.174  -36.228 1.00 74.41  ? 54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 89.600  29.708  -36.822 1.00 79.65  ? 54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 88.965  28.691  -36.509 1.00 78.27  ? 54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 89.463  31.377  -34.715 1.00 71.92  ? 54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 88.599  30.635  -33.759 1.00 98.74  ? 54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 87.937  29.664  -34.100 1.00 99.05  ? 54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 88.703  31.008  -32.491 1.00 93.06  ? 54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 90.583  29.738  -37.780 1.00 76.40  ? 55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 91.247  28.778  -38.646 1.00 76.47  ? 55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 90.611  28.405  -39.920 1.00 87.21  ? 55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 90.409  27.219  -40.177 1.00 87.40  ? 55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 92.004  27.595  -38.001 1.00 77.07  ? 55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 92.643  26.600  -39.029 1.00 71.74  ? 55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 93.795  26.891  -39.542 1.00 64.06  ? 55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 91.973  25.553  -39.353 1.00 68.06  ? 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 90.541  29.371  -40.845 1.00 91.11  ? 56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 90.240  29.054  -42.269 1.00 94.39  ? 56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 91.615  28.893  -43.058 1.00 101.08 ? 56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 91.726  29.133  -44.302 1.00 99.73  ? 56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 89.433  30.286  -42.731 1.00 96.99  ? 56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 89.577  31.336  -41.547 1.00 100.82 ? 56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 90.710  30.820  -40.682 1.00 94.47  ? 56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 92.688  28.488  -42.235 1.00 98.47  ? 57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 94.144  28.244  -42.419 1.00 97.45  ? 57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 95.052  28.840  -41.220 1.00 95.66  ? 57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 96.218  28.482  -41.174 1.00 93.28  ? 57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 94.670  28.709  -43.825 1.00 101.76 ? 57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 94.322  27.853  -45.074 1.00 118.79 ? 57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 95.051  28.371  -46.337 1.00 142.99 ? 57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 94.869  27.530  -47.542 1.00 153.97 ? 57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 95.504  27.695  -48.712 1.00 150.90 ? 57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 96.387  28.677  -48.867 1.00 135.79 ? 57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 95.260  26.876  -49.730 1.00 115.84 ? 57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 94.507  29.710  -40.262 1.00 90.76  ? 58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 95.189  30.470  -39.145 1.00 88.68  ? 58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 95.963  29.619  -38.219 1.00 95.05  ? 58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 96.418  28.557  -38.613 1.00 96.91  ? 58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 94.221  31.257  -38.221 1.00 87.31  ? 58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 93.218  32.258  -38.745 1.00 91.10  ? 58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 92.546  32.959  -37.600 1.00 89.68  ? 58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 93.844  33.273  -39.705 1.00 93.73  ? 58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 96.032  30.032  -36.956 1.00 91.77  ? 59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 96.648  29.215  -35.913 1.00 92.43  ? 59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 95.898  27.922  -35.539 1.00 98.45  ? 59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 95.152  27.348  -36.342 1.00 97.34  ? 59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 96.083  27.445  -34.299 1.00 97.59  ? 60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 95.431  26.217  -33.857 1.00 99.07  ? 60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 94.665  26.253  -32.506 1.00 105.86 ? 60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 94.944  27.068  -31.619 1.00 105.97 ? 60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 96.420  25.054  -33.882 1.00 102.91 ? 60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 95.766  23.804  -33.712 1.00 113.78 ? 60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 93.674  25.362  -32.396 1.00 103.32 ? 61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 92.911  25.032  -31.202 1.00 103.23 ? 61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 93.285  23.517  -31.000 1.00 113.22 ? 61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 94.325  23.055  -31.507 1.00 113.29 ? 61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 91.375  25.286  -31.375 1.00 105.48 ? 61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 91.085  26.698  -31.895 1.00 105.08 ? 61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 90.593  25.007  -30.068 1.00 105.58 ? 61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 89.582  26.968  -32.163 1.00 110.23 ? 61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 92.453  22.759  -30.269 1.00 113.24 ? 62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 92.589  21.325  -29.995 1.00 114.37 ? 62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 93.834  20.822  -29.259 1.00 117.11 ? 62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 93.740  19.758  -28.642 1.00 117.99 ? 62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 92.239  20.456  -31.222 1.00 117.94 ? 62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 90.929  19.695  -31.094 1.00 139.17 ? 62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 89.859  20.292  -31.390 1.00 147.97 ? 62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 90.970  18.498  -30.702 1.00 141.62 ? 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 94.970  21.571  -29.283 1.00 111.01 ? 63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 96.269  21.200  -28.687 1.00 109.62 ? 63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 96.806  20.026  -29.484 1.00 112.63 ? 63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 97.786  20.201  -30.205 1.00 113.12 ? 63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 96.242  20.999  -27.154 1.00 109.18 ? 63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 97.630  20.903  -26.529 1.00 120.12 ? 63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 97.745  21.679  -25.225 1.00 140.39 ? 63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 98.267  23.040  -25.421 1.00 162.78 ? 63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 99.560  23.371  -25.441 1.00 181.70 ? 63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 100.496 22.440  -25.285 1.00 173.67 ? 63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 99.926  24.636  -25.623 1.00 163.11 ? 63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 96.088  18.877  -29.472 1.00 108.13 ? 64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 96.335  17.747  -30.372 1.00 108.06 ? 64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 95.811  18.285  -31.706 1.00 110.37 ? 64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 94.992  19.218  -31.692 1.00 110.42 ? 64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 95.593  16.436  -29.963 1.00 110.80 ? 64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 94.326  16.584  -29.147 1.00 141.13 ? 64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 94.325  16.368  -27.931 1.00 138.56 ? 64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 93.206  16.891  -29.797 1.00 133.89 ? 64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 96.328  17.787  -32.847 1.00 104.78 ? 65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 95.938  18.318  -34.159 1.00 103.91 ? 65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 96.789  19.615  -34.439 1.00 103.54 ? 65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 96.646  20.648  -33.765 1.00 102.20 ? 65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 94.388  18.477  -34.214 1.00 104.48 ? 65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 93.738  19.444  -35.148 1.00 110.45 ? 65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 92.437  18.879  -35.624 1.00 114.54 ? 65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 93.465  20.774  -34.452 1.00 110.61 ? 65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 97.751  19.484  -35.374 1.00 97.85  ? 66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 98.735  20.509  -35.749 1.00 96.65  ? 66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 98.102  21.728  -36.407 1.00 97.71  ? 66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 96.910  21.690  -36.735 1.00 98.46  ? 66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 99.773  19.930  -36.726 1.00 100.15 ? 66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 100.362 18.564  -36.374 1.00 122.50 ? 66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 101.200 17.970  -37.548 1.00 138.59 ? 66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 100.426 17.532  -38.787 1.00 146.38 ? 66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 101.331 17.181  -39.920 1.00 149.38 ? 66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 98.910  22.801  -36.642 1.00 90.39  ? 67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 98.450  24.017  -37.341 1.00 88.66  ? 67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 98.255  23.678  -38.824 1.00 91.34  ? 67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 99.005  22.857  -39.354 1.00 91.38  ? 67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 99.427  25.175  -37.144 1.00 87.64  ? 67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 99.348  26.460  -38.423 1.00 91.37  ? 67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 97.232  24.257  -39.480 1.00 86.30  ? 68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 96.990  23.928  -40.880 1.00 85.38  ? 68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 97.978  24.541  -41.880 1.00 86.03  ? 68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 98.132  23.954  -42.944 1.00 86.15  ? 68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 95.508  24.054  -41.283 1.00 87.24  ? 68   GLN A CB    1 
ATOM   514   N  N     . THR A 1  69   ? 98.689  25.664  -41.539 1.00 80.48  ? 69   THR A N     1 
ATOM   515   C  CA    . THR A 1  69   ? 99.676  26.306  -42.441 1.00 80.34  ? 69   THR A CA    1 
ATOM   516   C  C     . THR A 1  69   ? 101.112 25.852  -42.247 1.00 85.18  ? 69   THR A C     1 
ATOM   517   O  O     . THR A 1  69   ? 101.664 25.194  -43.138 1.00 85.05  ? 69   THR A O     1 
ATOM   518   C  CB    . THR A 1  69   ? 99.487  27.807  -42.627 1.00 82.76  ? 69   THR A CB    1 
ATOM   519   O  OG1   . THR A 1  69   ? 99.370  28.447  -41.358 1.00 76.72  ? 69   THR A OG1   1 
ATOM   520   C  CG2   . THR A 1  69   ? 98.330  28.149  -43.604 1.00 81.78  ? 69   THR A CG2   1 
ATOM   521   N  N     . CYS A 1  70   ? 101.723 26.208  -41.093 1.00 82.67  ? 70   CYS A N     1 
ATOM   522   C  CA    . CYS A 1  70   ? 103.043 25.699  -40.665 1.00 82.62  ? 70   CYS A CA    1 
ATOM   523   C  C     . CYS A 1  70   ? 102.647 24.333  -40.123 1.00 92.04  ? 70   CYS A C     1 
ATOM   524   O  O     . CYS A 1  70   ? 101.515 24.210  -39.644 1.00 94.55  ? 70   CYS A O     1 
ATOM   525   C  CB    . CYS A 1  70   ? 103.672 26.575  -39.573 1.00 80.76  ? 70   CYS A CB    1 
ATOM   526   S  SG    . CYS A 1  70   ? 102.990 26.340  -37.902 1.00 82.63  ? 70   CYS A SG    1 
ATOM   527   N  N     . GLN A 1  71   ? 103.476 23.305  -40.196 1.00 88.44  ? 71   GLN A N     1 
ATOM   528   C  CA    . GLN A 1  71   ? 102.897 22.088  -39.649 1.00 88.42  ? 71   GLN A CA    1 
ATOM   529   C  C     . GLN A 1  71   ? 103.121 21.861  -38.165 1.00 92.43  ? 71   GLN A C     1 
ATOM   530   O  O     . GLN A 1  71   ? 102.656 20.882  -37.602 1.00 91.23  ? 71   GLN A O     1 
ATOM   531   C  CB    . GLN A 1  71   ? 103.212 20.887  -40.522 1.00 90.67  ? 71   GLN A CB    1 
ATOM   532   C  CG    . GLN A 1  71   ? 102.422 20.894  -41.827 1.00 105.59 ? 71   GLN A CG    1 
ATOM   533   C  CD    . GLN A 1  71   ? 100.956 21.145  -41.593 1.00 122.68 ? 71   GLN A CD    1 
ATOM   534   O  OE1   . GLN A 1  71   ? 100.445 22.219  -41.917 1.00 118.86 ? 71   GLN A OE1   1 
ATOM   535   N  NE2   . GLN A 1  71   ? 100.268 20.187  -40.966 1.00 113.29 ? 71   GLN A NE2   1 
ATOM   536   N  N     . GLU A 1  72   ? 103.704 22.857  -37.523 1.00 90.75  ? 72   GLU A N     1 
ATOM   537   C  CA    . GLU A 1  72   ? 104.206 22.854  -36.161 1.00 90.91  ? 72   GLU A CA    1 
ATOM   538   C  C     . GLU A 1  72   ? 103.317 22.497  -34.967 1.00 94.54  ? 72   GLU A C     1 
ATOM   539   O  O     . GLU A 1  72   ? 103.766 21.688  -34.145 1.00 94.42  ? 72   GLU A O     1 
ATOM   540   C  CB    . GLU A 1  72   ? 105.118 24.067  -35.882 1.00 92.21  ? 72   GLU A CB    1 
ATOM   541   C  CG    . GLU A 1  72   ? 106.331 24.213  -36.810 1.00 101.56 ? 72   GLU A CG    1 
ATOM   542   C  CD    . GLU A 1  72   ? 107.150 22.967  -37.108 1.00 112.40 ? 72   GLU A CD    1 
ATOM   543   O  OE1   . GLU A 1  72   ? 107.490 22.239  -36.146 1.00 90.48  ? 72   GLU A OE1   1 
ATOM   544   O  OE2   . GLU A 1  72   ? 107.439 22.716  -38.303 1.00 105.80 ? 72   GLU A OE2   1 
ATOM   545   N  N     . GLY A 1  73   ? 102.152 23.116  -34.816 1.00 90.18  ? 73   GLY A N     1 
ATOM   546   C  CA    . GLY A 1  73   ? 101.322 22.822  -33.651 1.00 90.30  ? 73   GLY A CA    1 
ATOM   547   C  C     . GLY A 1  73   ? 101.735 23.441  -32.308 1.00 95.32  ? 73   GLY A C     1 
ATOM   548   O  O     . GLY A 1  73   ? 102.885 23.357  -31.857 1.00 93.76  ? 73   GLY A O     1 
ATOM   549   N  N     . MET A 1  74   ? 100.728 24.022  -31.649 1.00 93.74  ? 74   MET A N     1 
ATOM   550   C  CA    . MET A 1  74   ? 100.654 24.755  -30.384 1.00 93.23  ? 74   MET A CA    1 
ATOM   551   C  C     . MET A 1  74   ? 101.883 25.447  -29.818 1.00 96.78  ? 74   MET A C     1 
ATOM   552   O  O     . MET A 1  74   ? 101.970 26.667  -29.950 1.00 96.34  ? 74   MET A O     1 
ATOM   553   C  CB    . MET A 1  74   ? 99.849  24.003  -29.312 1.00 95.68  ? 74   MET A CB    1 
ATOM   554   C  CG    . MET A 1  74   ? 98.385  23.684  -29.718 1.00 99.98  ? 74   MET A CG    1 
ATOM   555   S  SD    . MET A 1  74   ? 97.055  24.929  -29.502 1.00 104.01 ? 74   MET A SD    1 
ATOM   556   C  CE    . MET A 1  74   ? 97.261  25.380  -27.763 1.00 99.96  ? 74   MET A CE    1 
ATOM   557   N  N     . ASN A 1  75   ? 102.788 24.725  -29.128 1.00 94.17  ? 75   ASN A N     1 
ATOM   558   C  CA    . ASN A 1  75   ? 103.941 25.374  -28.477 1.00 94.00  ? 75   ASN A CA    1 
ATOM   559   C  C     . ASN A 1  75   ? 105.153 25.362  -29.383 1.00 94.89  ? 75   ASN A C     1 
ATOM   560   O  O     . ASN A 1  75   ? 106.167 24.700  -29.113 1.00 95.25  ? 75   ASN A O     1 
ATOM   561   C  CB    . ASN A 1  75   ? 104.208 24.811  -27.050 1.00 100.02 ? 75   ASN A CB    1 
ATOM   562   C  CG    . ASN A 1  75   ? 105.240 25.592  -26.251 1.00 140.57 ? 75   ASN A CG    1 
ATOM   563   O  OD1   . ASN A 1  75   ? 105.034 26.762  -25.871 1.00 136.41 ? 75   ASN A OD1   1 
ATOM   564   N  ND2   . ASN A 1  75   ? 106.384 24.955  -25.986 1.00 135.25 ? 75   ASN A ND2   1 
ATOM   565   N  N     . GLU A 1  76   ? 104.999 26.082  -30.499 1.00 87.50  ? 76   GLU A N     1 
ATOM   566   C  CA    . GLU A 1  76   ? 105.953 26.199  -31.592 1.00 85.60  ? 76   GLU A CA    1 
ATOM   567   C  C     . GLU A 1  76   ? 105.352 27.140  -32.601 1.00 85.17  ? 76   GLU A C     1 
ATOM   568   O  O     . GLU A 1  76   ? 106.011 28.101  -33.012 1.00 86.61  ? 76   GLU A O     1 
ATOM   569   C  CB    . GLU A 1  76   ? 106.218 24.824  -32.239 1.00 87.26  ? 76   GLU A CB    1 
ATOM   570   C  CG    . GLU A 1  76   ? 107.371 24.789  -33.224 1.00 99.32  ? 76   GLU A CG    1 
ATOM   571   C  CD    . GLU A 1  76   ? 108.653 25.474  -32.807 1.00 114.58 ? 76   GLU A CD    1 
ATOM   572   O  OE1   . GLU A 1  76   ? 109.437 24.847  -32.055 1.00 87.03  ? 76   GLU A OE1   1 
ATOM   573   O  OE2   . GLU A 1  76   ? 108.886 26.622  -33.262 1.00 109.29 ? 76   GLU A OE2   1 
ATOM   574   N  N     . CYS A 1  77   ? 104.094 26.877  -32.980 1.00 76.72  ? 77   CYS A N     1 
ATOM   575   C  CA    . CYS A 1  77   ? 103.333 27.694  -33.907 1.00 75.65  ? 77   CYS A CA    1 
ATOM   576   C  C     . CYS A 1  77   ? 103.018 29.074  -33.318 1.00 79.63  ? 77   CYS A C     1 
ATOM   577   O  O     . CYS A 1  77   ? 102.228 29.196  -32.362 1.00 78.99  ? 77   CYS A O     1 
ATOM   578   C  CB    . CYS A 1  77   ? 102.065 26.969  -34.353 1.00 76.00  ? 77   CYS A CB    1 
ATOM   579   S  SG    . CYS A 1  77   ? 100.947 27.957  -35.386 1.00 80.38  ? 77   CYS A SG    1 
ATOM   580   N  N     . PRO A 1  78   ? 103.601 30.152  -33.892 1.00 77.14  ? 78   PRO A N     1 
ATOM   581   C  CA    . PRO A 1  78   ? 103.171 31.497  -33.478 1.00 77.38  ? 78   PRO A CA    1 
ATOM   582   C  C     . PRO A 1  78   ? 101.850 31.663  -34.193 1.00 83.95  ? 78   PRO A C     1 
ATOM   583   O  O     . PRO A 1  78   ? 101.522 30.858  -35.069 1.00 85.36  ? 78   PRO A O     1 
ATOM   584   C  CB    . PRO A 1  78   ? 104.221 32.412  -34.091 1.00 79.14  ? 78   PRO A CB    1 
ATOM   585   C  CG    . PRO A 1  78   ? 104.662 31.697  -35.313 1.00 84.36  ? 78   PRO A CG    1 
ATOM   586   C  CD    . PRO A 1  78   ? 104.475 30.209  -35.080 1.00 79.36  ? 78   PRO A CD    1 
ATOM   587   N  N     . GLY A 1  79   ? 101.083 32.659  -33.893 1.00 80.82  ? 79   GLY A N     1 
ATOM   588   C  CA    . GLY A 1  79   ? 99.846  32.656  -34.661 1.00 82.06  ? 79   GLY A CA    1 
ATOM   589   C  C     . GLY A 1  79   ? 100.040 32.969  -36.128 1.00 88.14  ? 79   GLY A C     1 
ATOM   590   O  O     . GLY A 1  79   ? 101.123 33.421  -36.517 1.00 89.42  ? 79   GLY A O     1 
ATOM   591   N  N     . HIS A 1  80   ? 99.014  32.738  -36.958 1.00 84.40  ? 80   HIS A N     1 
ATOM   592   C  CA    . HIS A 1  80   ? 99.111  33.170  -38.360 1.00 84.39  ? 80   HIS A CA    1 
ATOM   593   C  C     . HIS A 1  80   ? 98.021  34.184  -38.647 1.00 87.47  ? 80   HIS A C     1 
ATOM   594   O  O     . HIS A 1  80   ? 96.863  33.934  -38.311 1.00 89.18  ? 80   HIS A O     1 
ATOM   595   C  CB    . HIS A 1  80   ? 99.110  32.002  -39.348 1.00 85.48  ? 80   HIS A CB    1 
ATOM   596   C  CG    . HIS A 1  80   ? 100.326 31.160  -39.223 1.00 88.06  ? 80   HIS A CG    1 
ATOM   597   N  ND1   . HIS A 1  80   ? 101.568 31.650  -39.554 1.00 89.71  ? 80   HIS A ND1   1 
ATOM   598   C  CD2   . HIS A 1  80   ? 100.457 29.905  -38.737 1.00 89.36  ? 80   HIS A CD2   1 
ATOM   599   C  CE1   . HIS A 1  80   ? 102.417 30.676  -39.275 1.00 89.03  ? 80   HIS A CE1   1 
ATOM   600   N  NE2   . HIS A 1  80   ? 101.792 29.606  -38.781 1.00 89.03  ? 80   HIS A NE2   1 
ATOM   601   N  N     . PHE A 1  81   ? 98.389  35.347  -39.189 1.00 81.24  ? 81   PHE A N     1 
ATOM   602   C  CA    . PHE A 1  81   ? 97.428  36.407  -39.453 1.00 80.66  ? 81   PHE A CA    1 
ATOM   603   C  C     . PHE A 1  81   ? 96.501  36.090  -40.615 1.00 84.25  ? 81   PHE A C     1 
ATOM   604   O  O     . PHE A 1  81   ? 96.865  35.328  -41.509 1.00 83.91  ? 81   PHE A O     1 
ATOM   605   C  CB    . PHE A 1  81   ? 98.134  37.762  -39.650 1.00 82.42  ? 81   PHE A CB    1 
ATOM   606   C  CG    . PHE A 1  81   ? 98.141  38.627  -38.410 1.00 83.22  ? 81   PHE A CG    1 
ATOM   607   C  CD1   . PHE A 1  81   ? 99.111  38.456  -37.425 1.00 85.46  ? 81   PHE A CD1   1 
ATOM   608   C  CD2   . PHE A 1  81   ? 97.180  39.613  -38.225 1.00 85.53  ? 81   PHE A CD2   1 
ATOM   609   C  CE1   . PHE A 1  81   ? 99.105  39.243  -36.261 1.00 85.64  ? 81   PHE A CE1   1 
ATOM   610   C  CE2   . PHE A 1  81   ? 97.188  40.414  -37.070 1.00 87.90  ? 81   PHE A CE2   1 
ATOM   611   C  CZ    . PHE A 1  81   ? 98.145  40.217  -36.093 1.00 84.92  ? 81   PHE A CZ    1 
ATOM   612   N  N     . GLY A 1  82   ? 95.294  36.651  -40.541 1.00 80.14  ? 82   GLY A N     1 
ATOM   613   C  CA    . GLY A 1  82   ? 94.244  36.583  -41.552 1.00 79.61  ? 82   GLY A CA    1 
ATOM   614   C  C     . GLY A 1  82   ? 93.801  37.984  -41.953 1.00 82.03  ? 82   GLY A C     1 
ATOM   615   O  O     . GLY A 1  82   ? 94.469  38.977  -41.608 1.00 82.11  ? 82   GLY A O     1 
ATOM   616   N  N     . HIS A 1  83   ? 92.676  38.091  -42.688 1.00 76.64  ? 83   HIS A N     1 
ATOM   617   C  CA    . HIS A 1  83   ? 92.140  39.393  -43.092 1.00 75.71  ? 83   HIS A CA    1 
ATOM   618   C  C     . HIS A 1  83   ? 90.660  39.417  -43.342 1.00 80.64  ? 83   HIS A C     1 
ATOM   619   O  O     . HIS A 1  83   ? 90.056  38.394  -43.658 1.00 78.69  ? 83   HIS A O     1 
ATOM   620   C  CB    . HIS A 1  83   ? 92.895  39.991  -44.287 1.00 76.44  ? 83   HIS A CB    1 
ATOM   621   C  CG    . HIS A 1  83   ? 92.477  39.493  -45.640 1.00 80.33  ? 83   HIS A CG    1 
ATOM   622   N  ND1   . HIS A 1  83   ? 93.059  38.375  -46.212 1.00 81.69  ? 83   HIS A ND1   1 
ATOM   623   C  CD2   . HIS A 1  83   ? 91.615  40.037  -46.534 1.00 83.15  ? 83   HIS A CD2   1 
ATOM   624   C  CE1   . HIS A 1  83   ? 92.535  38.270  -47.422 1.00 82.30  ? 83   HIS A CE1   1 
ATOM   625   N  NE2   . HIS A 1  83   ? 91.653  39.242  -47.663 1.00 83.49  ? 83   HIS A NE2   1 
ATOM   626   N  N     . ILE A 1  84   ? 90.073  40.606  -43.173 1.00 81.19  ? 84   ILE A N     1 
ATOM   627   C  CA    . ILE A 1  84   ? 88.671  40.908  -43.496 1.00 83.18  ? 84   ILE A CA    1 
ATOM   628   C  C     . ILE A 1  84   ? 88.678  42.126  -44.462 1.00 90.15  ? 84   ILE A C     1 
ATOM   629   O  O     . ILE A 1  84   ? 89.251  43.185  -44.143 1.00 88.67  ? 84   ILE A O     1 
ATOM   630   C  CB    . ILE A 1  84   ? 87.581  40.965  -42.330 1.00 85.40  ? 84   ILE A CB    1 
ATOM   631   C  CG1   . ILE A 1  84   ? 87.018  42.356  -42.080 1.00 87.21  ? 84   ILE A CG1   1 
ATOM   632   C  CG2   . ILE A 1  84   ? 87.969  40.330  -41.025 1.00 82.26  ? 84   ILE A CG2   1 
ATOM   633   C  CD1   . ILE A 1  84   ? 85.785  42.683  -42.941 1.00 106.12 ? 84   ILE A CD1   1 
ATOM   634   N  N     . ASP A 1  85   ? 88.094  41.950  -45.657 1.00 89.70  ? 85   ASP A N     1 
ATOM   635   C  CA    . ASP A 1  85   ? 88.042  43.059  -46.601 1.00 91.68  ? 85   ASP A CA    1 
ATOM   636   C  C     . ASP A 1  85   ? 86.779  43.873  -46.259 1.00 94.82  ? 85   ASP A C     1 
ATOM   637   O  O     . ASP A 1  85   ? 85.666  43.340  -46.352 1.00 95.57  ? 85   ASP A O     1 
ATOM   638   C  CB    . ASP A 1  85   ? 88.086  42.559  -48.069 1.00 95.69  ? 85   ASP A CB    1 
ATOM   639   C  CG    . ASP A 1  85   ? 89.492  42.310  -48.634 1.00 113.27 ? 85   ASP A CG    1 
ATOM   640   O  OD1   . ASP A 1  85   ? 90.281  43.289  -48.725 1.00 117.15 ? 85   ASP A OD1   1 
ATOM   641   O  OD2   . ASP A 1  85   ? 89.781  41.145  -49.056 1.00 114.54 ? 85   ASP A OD2   1 
ATOM   642   N  N     . LEU A 1  86   ? 86.965  45.112  -45.741 1.00 88.69  ? 86   LEU A N     1 
ATOM   643   C  CA    . LEU A 1  86   ? 85.858  45.990  -45.337 1.00 87.62  ? 86   LEU A CA    1 
ATOM   644   C  C     . LEU A 1  86   ? 85.128  46.526  -46.553 1.00 94.58  ? 86   LEU A C     1 
ATOM   645   O  O     . LEU A 1  86   ? 85.774  46.894  -47.531 1.00 94.99  ? 86   LEU A O     1 
ATOM   646   C  CB    . LEU A 1  86   ? 86.335  47.167  -44.476 1.00 86.24  ? 86   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1  86   ? 87.149  46.831  -43.239 1.00 88.46  ? 86   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1  86   ? 87.898  48.043  -42.737 1.00 88.44  ? 86   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1  86   ? 86.284  46.299  -42.151 1.00 88.59  ? 86   LEU A CD2   1 
ATOM   650   N  N     . ALA A 1  87   ? 83.780  46.566  -46.496 1.00 92.70  ? 87   ALA A N     1 
ATOM   651   C  CA    . ALA A 1  87   ? 82.912  47.054  -47.576 1.00 93.82  ? 87   ALA A CA    1 
ATOM   652   C  C     . ALA A 1  87   ? 83.087  48.560  -47.829 1.00 98.14  ? 87   ALA A C     1 
ATOM   653   O  O     . ALA A 1  87   ? 82.946  49.008  -48.972 1.00 99.46  ? 87   ALA A O     1 
ATOM   654   C  CB    . ALA A 1  87   ? 81.456  46.732  -47.270 1.00 94.92  ? 87   ALA A CB    1 
ATOM   655   N  N     . LYS A 1  88   ? 83.408  49.333  -46.769 1.00 92.59  ? 88   LYS A N     1 
ATOM   656   C  CA    . LYS A 1  88   ? 83.645  50.773  -46.867 1.00 91.86  ? 88   LYS A CA    1 
ATOM   657   C  C     . LYS A 1  88   ? 84.859  51.179  -46.038 1.00 93.69  ? 88   LYS A C     1 
ATOM   658   O  O     . LYS A 1  88   ? 85.127  50.513  -45.026 1.00 92.43  ? 88   LYS A O     1 
ATOM   659   C  CB    . LYS A 1  88   ? 82.404  51.570  -46.443 1.00 94.28  ? 88   LYS A CB    1 
ATOM   660   C  CG    . LYS A 1  88   ? 81.832  52.383  -47.597 1.00 117.83 ? 88   LYS A CG    1 
ATOM   661   C  CD    . LYS A 1  88   ? 80.304  52.400  -47.649 1.00 131.30 ? 88   LYS A CD    1 
ATOM   662   C  CE    . LYS A 1  88   ? 79.760  53.334  -48.712 1.00 141.29 ? 88   LYS A CE    1 
ATOM   663   N  NZ    . LYS A 1  88   ? 79.790  54.765  -48.293 1.00 149.06 ? 88   LYS A NZ    1 
ATOM   664   N  N     . PRO A 1  89   ? 85.623  52.236  -46.440 1.00 89.41  ? 89   PRO A N     1 
ATOM   665   C  CA    . PRO A 1  89   ? 86.763  52.668  -45.621 1.00 88.87  ? 89   PRO A CA    1 
ATOM   666   C  C     . PRO A 1  89   ? 86.318  53.192  -44.254 1.00 94.91  ? 89   PRO A C     1 
ATOM   667   O  O     . PRO A 1  89   ? 85.214  53.726  -44.108 1.00 96.24  ? 89   PRO A O     1 
ATOM   668   C  CB    . PRO A 1  89   ? 87.408  53.770  -46.465 1.00 90.87  ? 89   PRO A CB    1 
ATOM   669   C  CG    . PRO A 1  89   ? 86.359  54.267  -47.292 1.00 95.89  ? 89   PRO A CG    1 
ATOM   670   C  CD    . PRO A 1  89   ? 85.492  53.099  -47.624 1.00 91.63  ? 89   PRO A CD    1 
ATOM   671   N  N     . VAL A 1  90   ? 87.174  53.007  -43.250 1.00 90.83  ? 90   VAL A N     1 
ATOM   672   C  CA    . VAL A 1  90   ? 86.910  53.382  -41.869 1.00 90.20  ? 90   VAL A CA    1 
ATOM   673   C  C     . VAL A 1  90   ? 88.156  54.074  -41.253 1.00 92.02  ? 90   VAL A C     1 
ATOM   674   O  O     . VAL A 1  90   ? 89.288  53.755  -41.627 1.00 90.68  ? 90   VAL A O     1 
ATOM   675   C  CB    . VAL A 1  90   ? 86.479  52.080  -41.133 1.00 94.27  ? 90   VAL A CB    1 
ATOM   676   C  CG1   . VAL A 1  90   ? 86.776  52.120  -39.638 1.00 93.58  ? 90   VAL A CG1   1 
ATOM   677   C  CG2   . VAL A 1  90   ? 85.006  51.760  -41.389 1.00 94.88  ? 90   VAL A CG2   1 
ATOM   678   N  N     . PHE A 1  91   ? 87.952  55.015  -40.326 1.00 88.27  ? 91   PHE A N     1 
ATOM   679   C  CA    . PHE A 1  91   ? 89.083  55.659  -39.665 1.00 88.19  ? 91   PHE A CA    1 
ATOM   680   C  C     . PHE A 1  91   ? 89.680  54.759  -38.588 1.00 93.83  ? 91   PHE A C     1 
ATOM   681   O  O     . PHE A 1  91   ? 88.936  54.057  -37.897 1.00 94.92  ? 91   PHE A O     1 
ATOM   682   C  CB    . PHE A 1  91   ? 88.640  56.936  -38.949 1.00 90.08  ? 91   PHE A CB    1 
ATOM   683   C  CG    . PHE A 1  91   ? 88.147  58.081  -39.785 1.00 92.54  ? 91   PHE A CG    1 
ATOM   684   C  CD1   . PHE A 1  91   ? 88.878  58.531  -40.878 1.00 95.73  ? 91   PHE A CD1   1 
ATOM   685   C  CD2   . PHE A 1  91   ? 86.999  58.772  -39.429 1.00 95.50  ? 91   PHE A CD2   1 
ATOM   686   C  CE1   . PHE A 1  91   ? 88.439  59.615  -41.632 1.00 97.97  ? 91   PHE A CE1   1 
ATOM   687   C  CE2   . PHE A 1  91   ? 86.569  59.868  -40.172 1.00 99.80  ? 91   PHE A CE2   1 
ATOM   688   C  CZ    . PHE A 1  91   ? 87.290  60.281  -41.272 1.00 98.27  ? 91   PHE A CZ    1 
ATOM   689   N  N     . HIS A 1  92   ? 91.007  54.831  -38.375 1.00 89.31  ? 92   HIS A N     1 
ATOM   690   C  CA    . HIS A 1  92   ? 91.642  54.117  -37.263 1.00 87.55  ? 92   HIS A CA    1 
ATOM   691   C  C     . HIS A 1  92   ? 91.473  55.079  -36.082 1.00 91.86  ? 92   HIS A C     1 
ATOM   692   O  O     . HIS A 1  92   ? 91.948  56.221  -36.156 1.00 92.14  ? 92   HIS A O     1 
ATOM   693   C  CB    . HIS A 1  92   ? 93.134  53.853  -37.553 1.00 87.34  ? 92   HIS A CB    1 
ATOM   694   C  CG    . HIS A 1  92   ? 93.882  53.107  -36.481 1.00 89.15  ? 92   HIS A CG    1 
ATOM   695   N  ND1   . HIS A 1  92   ? 93.885  53.531  -35.157 1.00 90.09  ? 92   HIS A ND1   1 
ATOM   696   C  CD2   . HIS A 1  92   ? 94.716  52.047  -36.597 1.00 89.79  ? 92   HIS A CD2   1 
ATOM   697   C  CE1   . HIS A 1  92   ? 94.667  52.683  -34.512 1.00 88.33  ? 92   HIS A CE1   1 
ATOM   698   N  NE2   . HIS A 1  92   ? 95.191  51.774  -35.336 1.00 88.52  ? 92   HIS A NE2   1 
ATOM   699   N  N     . VAL A 1  93   ? 90.754  54.644  -35.024 1.00 87.54  ? 93   VAL A N     1 
ATOM   700   C  CA    . VAL A 1  93   ? 90.484  55.453  -33.827 1.00 86.77  ? 93   VAL A CA    1 
ATOM   701   C  C     . VAL A 1  93   ? 91.652  56.304  -33.403 1.00 91.25  ? 93   VAL A C     1 
ATOM   702   O  O     . VAL A 1  93   ? 91.482  57.505  -33.181 1.00 90.73  ? 93   VAL A O     1 
ATOM   703   C  CB    . VAL A 1  93   ? 89.985  54.635  -32.639 1.00 89.45  ? 93   VAL A CB    1 
ATOM   704   C  CG1   . VAL A 1  93   ? 88.542  54.975  -32.326 1.00 89.61  ? 93   VAL A CG1   1 
ATOM   705   C  CG2   . VAL A 1  93   ? 90.188  53.147  -32.864 1.00 88.84  ? 93   VAL A CG2   1 
ATOM   706   N  N     . GLY A 1  94   ? 92.825  55.676  -33.322 1.00 88.42  ? 94   GLY A N     1 
ATOM   707   C  CA    . GLY A 1  94   ? 94.071  56.330  -32.944 1.00 88.60  ? 94   GLY A CA    1 
ATOM   708   C  C     . GLY A 1  94   ? 94.462  57.499  -33.830 1.00 93.65  ? 94   GLY A C     1 
ATOM   709   O  O     . GLY A 1  94   ? 94.817  58.568  -33.326 1.00 94.32  ? 94   GLY A O     1 
ATOM   710   N  N     . PHE A 1  95   ? 94.361  57.323  -35.147 1.00 89.92  ? 95   PHE A N     1 
ATOM   711   C  CA    . PHE A 1  95   ? 94.762  58.362  -36.094 1.00 90.56  ? 95   PHE A CA    1 
ATOM   712   C  C     . PHE A 1  95   ? 93.692  59.384  -36.470 1.00 94.97  ? 95   PHE A C     1 
ATOM   713   O  O     . PHE A 1  95   ? 93.959  60.284  -37.266 1.00 94.94  ? 95   PHE A O     1 
ATOM   714   C  CB    . PHE A 1  95   ? 95.439  57.732  -37.315 1.00 92.44  ? 95   PHE A CB    1 
ATOM   715   C  CG    . PHE A 1  95   ? 96.556  56.824  -36.885 1.00 93.05  ? 95   PHE A CG    1 
ATOM   716   C  CD1   . PHE A 1  95   ? 97.738  57.345  -36.378 1.00 96.17  ? 95   PHE A CD1   1 
ATOM   717   C  CD2   . PHE A 1  95   ? 96.396  55.447  -36.903 1.00 95.18  ? 95   PHE A CD2   1 
ATOM   718   C  CE1   . PHE A 1  95   ? 98.757  56.501  -35.932 1.00 96.66  ? 95   PHE A CE1   1 
ATOM   719   C  CE2   . PHE A 1  95   ? 97.412  54.602  -36.447 1.00 97.38  ? 95   PHE A CE2   1 
ATOM   720   C  CZ    . PHE A 1  95   ? 98.587  55.135  -35.966 1.00 95.20  ? 95   PHE A CZ    1 
ATOM   721   N  N     . ILE A 1  96   ? 92.518  59.286  -35.844 1.00 91.39  ? 96   ILE A N     1 
ATOM   722   C  CA    . ILE A 1  96   ? 91.387  60.172  -36.088 1.00 92.23  ? 96   ILE A CA    1 
ATOM   723   C  C     . ILE A 1  96   ? 91.720  61.672  -36.032 1.00 94.28  ? 96   ILE A C     1 
ATOM   724   O  O     . ILE A 1  96   ? 91.203  62.434  -36.854 1.00 95.17  ? 96   ILE A O     1 
ATOM   725   C  CB    . ILE A 1  96   ? 90.170  59.770  -35.210 1.00 95.74  ? 96   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1  96   ? 88.845  60.037  -35.918 1.00 96.81  ? 96   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1  96   ? 90.218  60.299  -33.750 1.00 96.83  ? 96   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1  96   ? 88.046  58.790  -36.031 1.00 102.68 ? 96   ILE A CD1   1 
ATOM   729   N  N     . ALA A 1  97   ? 92.582  62.091  -35.081 1.00 87.28  ? 97   ALA A N     1 
ATOM   730   C  CA    . ALA A 1  97   ? 92.921  63.500  -34.973 1.00 86.35  ? 97   ALA A CA    1 
ATOM   731   C  C     . ALA A 1  97   ? 94.039  63.893  -35.924 1.00 89.15  ? 97   ALA A C     1 
ATOM   732   O  O     . ALA A 1  97   ? 94.013  65.031  -36.420 1.00 87.79  ? 97   ALA A O     1 
ATOM   733   C  CB    . ALA A 1  97   ? 93.251  63.861  -33.545 1.00 86.32  ? 97   ALA A CB    1 
ATOM   734   N  N     . LYS A 1  98   ? 95.011  62.940  -36.208 1.00 86.03  ? 98   LYS A N     1 
ATOM   735   C  CA    . LYS A 1  98   ? 96.116  63.169  -37.173 1.00 85.79  ? 98   LYS A CA    1 
ATOM   736   C  C     . LYS A 1  98   ? 95.525  63.325  -38.573 1.00 90.83  ? 98   LYS A C     1 
ATOM   737   O  O     . LYS A 1  98   ? 95.951  64.204  -39.325 1.00 92.00  ? 98   LYS A O     1 
ATOM   738   C  CB    . LYS A 1  98   ? 97.260  62.117  -37.136 1.00 85.90  ? 98   LYS A CB    1 
ATOM   739   C  CG    . LYS A 1  98   ? 98.598  62.787  -37.526 1.00 93.36  ? 98   LYS A CG    1 
ATOM   740   C  CD    . LYS A 1  98   ? 99.838  61.900  -37.731 1.00 104.20 ? 98   LYS A CD    1 
ATOM   741   C  CE    . LYS A 1  98   ? 101.112 62.757  -37.710 1.00 119.34 ? 98   LYS A CE    1 
ATOM   742   N  NZ    . LYS A 1  98   ? 102.351 62.058  -38.194 1.00 125.12 ? 98   LYS A NZ    1 
ATOM   743   N  N     . ILE A 1  99   ? 94.481  62.521  -38.874 1.00 85.56  ? 99   ILE A N     1 
ATOM   744   C  CA    . ILE A 1  99   ? 93.707  62.604  -40.097 1.00 85.00  ? 99   ILE A CA    1 
ATOM   745   C  C     . ILE A 1  99   ? 93.153  64.039  -40.122 1.00 89.02  ? 99   ILE A C     1 
ATOM   746   O  O     . ILE A 1  99   ? 93.544  64.803  -41.011 1.00 88.83  ? 99   ILE A O     1 
ATOM   747   C  CB    . ILE A 1  99   ? 92.602  61.501  -40.129 1.00 87.34  ? 99   ILE A CB    1 
ATOM   748   C  CG1   . ILE A 1  99   ? 93.213  60.105  -40.423 1.00 86.13  ? 99   ILE A CG1   1 
ATOM   749   C  CG2   . ILE A 1  99   ? 91.523  61.838  -41.162 1.00 89.86  ? 99   ILE A CG2   1 
ATOM   750   C  CD1   . ILE A 1  99   ? 92.397  58.913  -40.011 1.00 84.51  ? 99   ILE A CD1   1 
ATOM   751   N  N     . LYS A 1  100  ? 92.362  64.437  -39.079 1.00 85.85  ? 100  LYS A N     1 
ATOM   752   C  CA    . LYS A 1  100  ? 91.783  65.785  -38.976 1.00 86.85  ? 100  LYS A CA    1 
ATOM   753   C  C     . LYS A 1  100  ? 92.828  66.840  -39.267 1.00 91.43  ? 100  LYS A C     1 
ATOM   754   O  O     . LYS A 1  100  ? 92.622  67.649  -40.164 1.00 92.50  ? 100  LYS A O     1 
ATOM   755   C  CB    . LYS A 1  100  ? 91.078  66.054  -37.626 1.00 88.87  ? 100  LYS A CB    1 
ATOM   756   C  CG    . LYS A 1  100  ? 90.330  67.399  -37.621 1.00 98.94  ? 100  LYS A CG    1 
ATOM   757   C  CD    . LYS A 1  100  ? 89.847  67.873  -36.246 1.00 105.28 ? 100  LYS A CD    1 
ATOM   758   C  CE    . LYS A 1  100  ? 89.567  69.366  -36.263 1.00 111.83 ? 100  LYS A CE    1 
ATOM   759   N  NZ    . LYS A 1  100  ? 88.721  69.836  -35.132 1.00 116.32 ? 100  LYS A NZ    1 
ATOM   760   N  N     . LYS A 1  101  ? 93.971  66.776  -38.579 1.00 87.43  ? 101  LYS A N     1 
ATOM   761   C  CA    . LYS A 1  101  ? 95.062  67.722  -38.786 1.00 87.82  ? 101  LYS A CA    1 
ATOM   762   C  C     . LYS A 1  101  ? 95.650  67.714  -40.198 1.00 92.88  ? 101  LYS A C     1 
ATOM   763   O  O     . LYS A 1  101  ? 96.019  68.783  -40.681 1.00 93.20  ? 101  LYS A O     1 
ATOM   764   C  CB    . LYS A 1  101  ? 96.157  67.571  -37.729 1.00 88.82  ? 101  LYS A CB    1 
ATOM   765   C  CG    . LYS A 1  101  ? 95.730  68.069  -36.364 1.00 93.33  ? 101  LYS A CG    1 
ATOM   766   C  CD    . LYS A 1  101  ? 96.946  68.485  -35.576 1.00 94.92  ? 101  LYS A CD    1 
ATOM   767   C  CE    . LYS A 1  101  ? 96.615  68.736  -34.133 1.00 95.85  ? 101  LYS A CE    1 
ATOM   768   N  NZ    . LYS A 1  101  ? 97.661  69.559  -33.474 1.00 98.80  ? 101  LYS A NZ    1 
ATOM   769   N  N     . VAL A 1  102  ? 95.731  66.538  -40.864 1.00 89.77  ? 102  VAL A N     1 
ATOM   770   C  CA    . VAL A 1  102  ? 96.283  66.467  -42.226 1.00 90.81  ? 102  VAL A CA    1 
ATOM   771   C  C     . VAL A 1  102  ? 95.349  67.184  -43.193 1.00 98.18  ? 102  VAL A C     1 
ATOM   772   O  O     . VAL A 1  102  ? 95.813  68.006  -43.992 1.00 97.75  ? 102  VAL A O     1 
ATOM   773   C  CB    . VAL A 1  102  ? 96.711  65.045  -42.679 1.00 93.80  ? 102  VAL A CB    1 
ATOM   774   C  CG1   . VAL A 1  102  ? 97.040  65.011  -44.167 1.00 94.45  ? 102  VAL A CG1   1 
ATOM   775   C  CG2   . VAL A 1  102  ? 97.916  64.562  -41.878 1.00 92.26  ? 102  VAL A CG2   1 
ATOM   776   N  N     . CYS A 1  103  ? 94.024  66.947  -43.038 1.00 97.57  ? 103  CYS A N     1 
ATOM   777   C  CA    . CYS A 1  103  ? 92.968  67.620  -43.805 1.00 99.49  ? 103  CYS A CA    1 
ATOM   778   C  C     . CYS A 1  103  ? 93.139  69.130  -43.655 1.00 106.13 ? 103  CYS A C     1 
ATOM   779   O  O     . CYS A 1  103  ? 93.173  69.840  -44.661 1.00 108.04 ? 103  CYS A O     1 
ATOM   780   C  CB    . CYS A 1  103  ? 91.586  67.174  -43.340 1.00 99.62  ? 103  CYS A CB    1 
ATOM   781   S  SG    . CYS A 1  103  ? 91.266  65.409  -43.557 1.00 102.83 ? 103  CYS A SG    1 
ATOM   782   N  N     . GLU A 1  104  ? 93.340  69.598  -42.403 1.00 102.04 ? 104  GLU A N     1 
ATOM   783   C  CA    . GLU A 1  104  ? 93.570  71.001  -42.047 1.00 102.52 ? 104  GLU A CA    1 
ATOM   784   C  C     . GLU A 1  104  ? 94.802  71.652  -42.762 1.00 109.58 ? 104  GLU A C     1 
ATOM   785   O  O     . GLU A 1  104  ? 94.804  72.866  -42.985 1.00 110.54 ? 104  GLU A O     1 
ATOM   786   C  CB    . GLU A 1  104  ? 93.598  71.177  -40.507 1.00 102.37 ? 104  GLU A CB    1 
ATOM   787   C  CG    . GLU A 1  104  ? 92.247  70.882  -39.870 1.00 108.46 ? 104  GLU A CG    1 
ATOM   788   C  CD    . GLU A 1  104  ? 92.119  70.876  -38.358 1.00 128.08 ? 104  GLU A CD    1 
ATOM   789   O  OE1   . GLU A 1  104  ? 92.845  70.104  -37.690 1.00 130.91 ? 104  GLU A OE1   1 
ATOM   790   O  OE2   . GLU A 1  104  ? 91.196  71.555  -37.852 1.00 120.59 ? 104  GLU A OE2   1 
ATOM   791   N  N     . CYS A 1  105  ? 95.787  70.833  -43.185 1.00 106.94 ? 105  CYS A N     1 
ATOM   792   C  CA    . CYS A 1  105  ? 97.027  71.267  -43.843 1.00 108.19 ? 105  CYS A CA    1 
ATOM   793   C  C     . CYS A 1  105  ? 97.002  71.197  -45.362 1.00 113.21 ? 105  CYS A C     1 
ATOM   794   O  O     . CYS A 1  105  ? 97.866  71.777  -46.036 1.00 111.93 ? 105  CYS A O     1 
ATOM   795   C  CB    . CYS A 1  105  ? 98.203  70.457  -43.304 1.00 108.01 ? 105  CYS A CB    1 
ATOM   796   S  SG    . CYS A 1  105  ? 98.593  70.762  -41.568 1.00 111.18 ? 105  CYS A SG    1 
ATOM   797   N  N     . VAL A 1  106  ? 96.098  70.388  -45.891 1.00 112.04 ? 106  VAL A N     1 
ATOM   798   C  CA    . VAL A 1  106  ? 96.051  70.102  -47.313 1.00 113.78 ? 106  VAL A CA    1 
ATOM   799   C  C     . VAL A 1  106  ? 94.762  70.590  -48.010 1.00 120.90 ? 106  VAL A C     1 
ATOM   800   O  O     . VAL A 1  106  ? 93.746  70.842  -47.343 1.00 120.20 ? 106  VAL A O     1 
ATOM   801   C  CB    . VAL A 1  106  ? 96.352  68.584  -47.486 1.00 116.74 ? 106  VAL A CB    1 
ATOM   802   C  CG1   . VAL A 1  106  ? 95.118  67.716  -47.262 1.00 116.39 ? 106  VAL A CG1   1 
ATOM   803   C  CG2   . VAL A 1  106  ? 97.020  68.282  -48.813 1.00 117.12 ? 106  VAL A CG2   1 
ATOM   804   N  N     . CYS A 1  107  ? 94.816  70.750  -49.348 1.00 120.14 ? 107  CYS A N     1 
ATOM   805   C  CA    . CYS A 1  107  ? 93.627  71.155  -50.087 1.00 122.19 ? 107  CYS A CA    1 
ATOM   806   C  C     . CYS A 1  107  ? 92.697  69.972  -50.210 1.00 126.87 ? 107  CYS A C     1 
ATOM   807   O  O     . CYS A 1  107  ? 93.092  68.943  -50.766 1.00 126.98 ? 107  CYS A O     1 
ATOM   808   C  CB    . CYS A 1  107  ? 93.962  71.739  -51.453 1.00 124.09 ? 107  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1  107  ? 92.529  71.887  -52.552 1.00 129.42 ? 107  CYS A SG    1 
ATOM   810   N  N     . MET A 1  108  ? 91.455  70.127  -49.718 1.00 123.10 ? 108  MET A N     1 
ATOM   811   C  CA    . MET A 1  108  ? 90.443  69.071  -49.737 1.00 122.43 ? 108  MET A CA    1 
ATOM   812   C  C     . MET A 1  108  ? 89.889  68.751  -51.130 1.00 126.68 ? 108  MET A C     1 
ATOM   813   O  O     . MET A 1  108  ? 88.851  68.095  -51.254 1.00 126.05 ? 108  MET A O     1 
ATOM   814   C  CB    . MET A 1  108  ? 89.339  69.336  -48.698 1.00 124.57 ? 108  MET A CB    1 
ATOM   815   C  CG    . MET A 1  108  ? 89.781  69.109  -47.260 1.00 126.93 ? 108  MET A CG    1 
ATOM   816   S  SD    . MET A 1  108  ? 90.704  67.566  -46.986 1.00 130.17 ? 108  MET A SD    1 
ATOM   817   C  CE    . MET A 1  108  ? 89.414  66.366  -47.115 1.00 126.78 ? 108  MET A CE    1 
ATOM   818   N  N     . HIS A 1  109  ? 90.616  69.173  -52.175 1.00 123.89 ? 109  HIS A N     1 
ATOM   819   C  CA    . HIS A 1  109  ? 90.253  68.929  -53.559 1.00 124.84 ? 109  HIS A CA    1 
ATOM   820   C  C     . HIS A 1  109  ? 91.458  68.534  -54.413 1.00 127.49 ? 109  HIS A C     1 
ATOM   821   O  O     . HIS A 1  109  ? 91.343  67.574  -55.174 1.00 126.91 ? 109  HIS A O     1 
ATOM   822   C  CB    . HIS A 1  109  ? 89.482  70.115  -54.155 1.00 127.47 ? 109  HIS A CB    1 
ATOM   823   C  CG    . HIS A 1  109  ? 89.151  69.935  -55.600 1.00 132.53 ? 109  HIS A CG    1 
ATOM   824   N  ND1   . HIS A 1  109  ? 88.252  68.968  -56.018 1.00 134.67 ? 109  HIS A ND1   1 
ATOM   825   C  CD2   . HIS A 1  109  ? 89.640  70.578  -56.686 1.00 135.83 ? 109  HIS A CD2   1 
ATOM   826   C  CE1   . HIS A 1  109  ? 88.214  69.062  -57.338 1.00 135.65 ? 109  HIS A CE1   1 
ATOM   827   N  NE2   . HIS A 1  109  ? 89.029  70.021  -57.786 1.00 136.68 ? 109  HIS A NE2   1 
ATOM   828   N  N     . CYS A 1  110  ? 92.603  69.243  -54.295 1.00 123.62 ? 110  CYS A N     1 
ATOM   829   C  CA    . CYS A 1  110  ? 93.787  68.904  -55.096 1.00 123.91 ? 110  CYS A CA    1 
ATOM   830   C  C     . CYS A 1  110  ? 94.924  68.124  -54.390 1.00 125.65 ? 110  CYS A C     1 
ATOM   831   O  O     . CYS A 1  110  ? 95.785  67.539  -55.063 1.00 123.94 ? 110  CYS A O     1 
ATOM   832   C  CB    . CYS A 1  110  ? 94.298  70.099  -55.901 1.00 125.99 ? 110  CYS A CB    1 
ATOM   833   S  SG    . CYS A 1  110  ? 95.276  71.291  -54.953 1.00 129.61 ? 110  CYS A SG    1 
ATOM   834   N  N     . GLY A 1  111  ? 94.871  68.083  -53.056 1.00 122.09 ? 111  GLY A N     1 
ATOM   835   C  CA    . GLY A 1  111  ? 95.828  67.367  -52.220 1.00 120.94 ? 111  GLY A CA    1 
ATOM   836   C  C     . GLY A 1  111  ? 97.183  68.032  -52.165 1.00 126.59 ? 111  GLY A C     1 
ATOM   837   O  O     . GLY A 1  111  ? 98.219  67.353  -52.094 1.00 125.77 ? 111  GLY A O     1 
ATOM   838   N  N     . LYS A 1  112  ? 97.178  69.375  -52.190 1.00 124.76 ? 112  LYS A N     1 
ATOM   839   C  CA    . LYS A 1  112  ? 98.400  70.174  -52.127 1.00 125.08 ? 112  LYS A CA    1 
ATOM   840   C  C     . LYS A 1  112  ? 98.443  70.959  -50.844 1.00 127.26 ? 112  LYS A C     1 
ATOM   841   O  O     . LYS A 1  112  ? 97.400  71.453  -50.388 1.00 126.94 ? 112  LYS A O     1 
ATOM   842   C  CB    . LYS A 1  112  ? 98.553  71.121  -53.344 1.00 130.19 ? 112  LYS A CB    1 
ATOM   843   C  CG    . LYS A 1  112  ? 98.896  70.439  -54.686 1.00 156.40 ? 112  LYS A CG    1 
ATOM   844   C  CD    . LYS A 1  112  ? 99.950  69.295  -54.601 1.00 172.91 ? 112  LYS A CD    1 
ATOM   845   C  CE    . LYS A 1  112  ? 101.388 69.761  -54.562 1.00 187.45 ? 112  LYS A CE    1 
ATOM   846   N  NZ    . LYS A 1  112  ? 102.324 68.629  -54.326 1.00 192.58 ? 112  LYS A NZ    1 
ATOM   847   N  N     . LEU A 1  113  ? 99.658  71.054  -50.252 1.00 121.87 ? 113  LEU A N     1 
ATOM   848   C  CA    . LEU A 1  113  ? 99.931  71.796  -49.020 1.00 120.38 ? 113  LEU A CA    1 
ATOM   849   C  C     . LEU A 1  113  ? 99.410  73.234  -49.183 1.00 125.74 ? 113  LEU A C     1 
ATOM   850   O  O     . LEU A 1  113  ? 99.750  73.912  -50.162 1.00 126.43 ? 113  LEU A O     1 
ATOM   851   C  CB    . LEU A 1  113  ? 101.442 71.798  -48.734 1.00 119.18 ? 113  LEU A CB    1 
ATOM   852   C  CG    . LEU A 1  113  ? 101.972 70.735  -47.791 1.00 120.68 ? 113  LEU A CG    1 
ATOM   853   C  CD1   . LEU A 1  113  ? 103.444 70.494  -48.038 1.00 119.92 ? 113  LEU A CD1   1 
ATOM   854   C  CD2   . LEU A 1  113  ? 101.747 71.130  -46.341 1.00 120.92 ? 113  LEU A CD2   1 
ATOM   855   N  N     . LEU A 1  114  ? 98.533  73.663  -48.257 1.00 121.85 ? 114  LEU A N     1 
ATOM   856   C  CA    . LEU A 1  114  ? 97.889  74.980  -48.283 1.00 122.58 ? 114  LEU A CA    1 
ATOM   857   C  C     . LEU A 1  114  ? 98.843  76.185  -48.295 1.00 126.63 ? 114  LEU A C     1 
ATOM   858   O  O     . LEU A 1  114  ? 98.456  77.275  -48.739 1.00 128.23 ? 114  LEU A O     1 
ATOM   859   C  CB    . LEU A 1  114  ? 96.788  75.099  -47.213 1.00 122.19 ? 114  LEU A CB    1 
ATOM   860   C  CG    . LEU A 1  114  ? 95.639  74.085  -47.320 1.00 126.50 ? 114  LEU A CG    1 
ATOM   861   C  CD1   . LEU A 1  114  ? 94.741  74.138  -46.102 1.00 126.19 ? 114  LEU A CD1   1 
ATOM   862   C  CD2   . LEU A 1  114  ? 94.832  74.289  -48.580 1.00 129.68 ? 114  LEU A CD2   1 
ATOM   863   N  N     . LEU A 1  115  ? 100.094 75.969  -47.847 1.00 120.80 ? 115  LEU A N     1 
ATOM   864   C  CA    . LEU A 1  115  ? 101.189 76.940  -47.852 1.00 120.63 ? 115  LEU A CA    1 
ATOM   865   C  C     . LEU A 1  115  ? 102.430 76.226  -48.407 1.00 125.37 ? 115  LEU A C     1 
ATOM   866   O  O     . LEU A 1  115  ? 102.420 74.998  -48.508 1.00 123.64 ? 115  LEU A O     1 
ATOM   867   C  CB    . LEU A 1  115  ? 101.436 77.521  -46.442 1.00 119.63 ? 115  LEU A CB    1 
ATOM   868   C  CG    . LEU A 1  115  ? 100.337 78.446  -45.879 1.00 124.44 ? 115  LEU A CG    1 
ATOM   869   C  CD1   . LEU A 1  115  ? 100.367 78.506  -44.375 1.00 122.98 ? 115  LEU A CD1   1 
ATOM   870   C  CD2   . LEU A 1  115  ? 100.476 79.837  -46.406 1.00 129.74 ? 115  LEU A CD2   1 
ATOM   871   N  N     . ASP A 1  116  ? 103.466 76.974  -48.828 1.00 124.57 ? 116  ASP A N     1 
ATOM   872   C  CA    . ASP A 1  116  ? 104.677 76.376  -49.408 1.00 125.16 ? 116  ASP A CA    1 
ATOM   873   C  C     . ASP A 1  116  ? 105.923 77.271  -49.296 1.00 132.20 ? 116  ASP A C     1 
ATOM   874   O  O     . ASP A 1  116  ? 105.942 78.222  -48.511 1.00 131.76 ? 116  ASP A O     1 
ATOM   875   C  CB    . ASP A 1  116  ? 104.429 75.943  -50.879 1.00 127.77 ? 116  ASP A CB    1 
ATOM   876   C  CG    . ASP A 1  116  ? 103.942 77.025  -51.839 1.00 137.20 ? 116  ASP A CG    1 
ATOM   877   O  OD1   . ASP A 1  116  ? 103.878 78.206  -51.428 1.00 138.27 ? 116  ASP A OD1   1 
ATOM   878   O  OD2   . ASP A 1  116  ? 103.616 76.687  -52.999 1.00 141.90 ? 116  ASP A OD2   1 
ATOM   879   N  N     . GLU A 1  117  ? 106.948 76.975  -50.126 1.00 131.51 ? 117  GLU A N     1 
ATOM   880   C  CA    . GLU A 1  117  ? 108.235 77.682  -50.249 1.00 132.86 ? 117  GLU A CA    1 
ATOM   881   C  C     . GLU A 1  117  ? 108.053 79.159  -50.668 1.00 139.51 ? 117  GLU A C     1 
ATOM   882   O  O     . GLU A 1  117  ? 109.041 79.896  -50.777 1.00 139.88 ? 117  GLU A O     1 
ATOM   883   C  CB    . GLU A 1  117  ? 109.186 76.965  -51.242 1.00 134.62 ? 117  GLU A CB    1 
ATOM   884   C  CG    . GLU A 1  117  ? 108.882 75.499  -51.539 1.00 147.42 ? 117  GLU A CG    1 
ATOM   885   C  CD    . GLU A 1  117  ? 107.757 75.220  -52.525 1.00 174.77 ? 117  GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1  117  ? 107.601 75.983  -53.509 1.00 167.40 ? 117  GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1  117  ? 107.017 74.236  -52.297 1.00 174.06 ? 117  GLU A OE2   1 
ATOM   888   N  N     . HIS A 1  118  ? 106.792 79.580  -50.910 1.00 136.94 ? 118  HIS A N     1 
ATOM   889   C  CA    . HIS A 1  118  ? 106.460 80.949  -51.277 1.00 138.25 ? 118  HIS A CA    1 
ATOM   890   C  C     . HIS A 1  118  ? 106.101 81.804  -50.059 1.00 141.27 ? 118  HIS A C     1 
ATOM   891   O  O     . HIS A 1  118  ? 106.267 83.023  -50.113 1.00 142.93 ? 118  HIS A O     1 
ATOM   892   C  CB    . HIS A 1  118  ? 105.459 81.019  -52.444 1.00 140.27 ? 118  HIS A CB    1 
ATOM   893   C  CG    . HIS A 1  118  ? 105.993 80.405  -53.709 1.00 144.33 ? 118  HIS A CG    1 
ATOM   894   N  ND1   . HIS A 1  118  ? 107.040 80.985  -54.413 1.00 147.06 ? 118  HIS A ND1   1 
ATOM   895   C  CD2   . HIS A 1  118  ? 105.630 79.260  -54.336 1.00 145.79 ? 118  HIS A CD2   1 
ATOM   896   C  CE1   . HIS A 1  118  ? 107.264 80.186  -55.445 1.00 146.75 ? 118  HIS A CE1   1 
ATOM   897   N  NE2   . HIS A 1  118  ? 106.444 79.135  -55.440 1.00 146.34 ? 118  HIS A NE2   1 
ATOM   898   N  N     . ASN A 1  119  ? 105.680 81.171  -48.943 1.00 134.55 ? 119  ASN A N     1 
ATOM   899   C  CA    . ASN A 1  119  ? 105.470 81.891  -47.688 1.00 133.38 ? 119  ASN A CA    1 
ATOM   900   C  C     . ASN A 1  119  ? 106.798 81.769  -46.942 1.00 137.06 ? 119  ASN A C     1 
ATOM   901   O  O     . ASN A 1  119  ? 107.396 80.688  -46.944 1.00 135.67 ? 119  ASN A O     1 
ATOM   902   C  CB    . ASN A 1  119  ? 104.317 81.307  -46.853 1.00 129.29 ? 119  ASN A CB    1 
ATOM   903   C  CG    . ASN A 1  119  ? 104.067 82.008  -45.515 1.00 136.38 ? 119  ASN A CG    1 
ATOM   904   O  OD1   . ASN A 1  119  ? 104.963 82.197  -44.684 1.00 126.27 ? 119  ASN A OD1   1 
ATOM   905   N  ND2   . ASN A 1  119  ? 102.820 82.360  -45.240 1.00 124.51 ? 119  ASN A ND2   1 
ATOM   906   N  N     . GLU A 1  120  ? 107.254 82.870  -46.308 1.00 134.64 ? 120  GLU A N     1 
ATOM   907   C  CA    . GLU A 1  120  ? 108.517 82.913  -45.560 1.00 134.08 ? 120  GLU A CA    1 
ATOM   908   C  C     . GLU A 1  120  ? 108.495 82.057  -44.282 1.00 134.22 ? 120  GLU A C     1 
ATOM   909   O  O     . GLU A 1  120  ? 109.444 81.297  -44.036 1.00 132.57 ? 120  GLU A O     1 
ATOM   910   C  CB    . GLU A 1  120  ? 108.943 84.361  -45.251 1.00 136.84 ? 120  GLU A CB    1 
ATOM   911   C  CG    . GLU A 1  120  ? 110.441 84.487  -44.988 1.00 152.28 ? 120  GLU A CG    1 
ATOM   912   C  CD    . GLU A 1  120  ? 110.924 85.721  -44.246 1.00 180.77 ? 120  GLU A CD    1 
ATOM   913   O  OE1   . GLU A 1  120  ? 110.424 86.836  -44.530 1.00 179.28 ? 120  GLU A OE1   1 
ATOM   914   O  OE2   . GLU A 1  120  ? 111.829 85.570  -43.391 1.00 172.61 ? 120  GLU A OE2   1 
ATOM   915   N  N     . LEU A 1  121  ? 107.412 82.189  -43.478 1.00 128.58 ? 121  LEU A N     1 
ATOM   916   C  CA    . LEU A 1  121  ? 107.211 81.443  -42.230 1.00 125.94 ? 121  LEU A CA    1 
ATOM   917   C  C     . LEU A 1  121  ? 107.114 79.946  -42.500 1.00 128.46 ? 121  LEU A C     1 
ATOM   918   O  O     . LEU A 1  121  ? 107.544 79.143  -41.669 1.00 126.51 ? 121  LEU A O     1 
ATOM   919   C  CB    . LEU A 1  121  ? 105.960 81.935  -41.492 1.00 125.47 ? 121  LEU A CB    1 
ATOM   920   C  CG    . LEU A 1  121  ? 106.052 83.344  -40.950 1.00 129.90 ? 121  LEU A CG    1 
ATOM   921   C  CD1   . LEU A 1  121  ? 105.196 84.285  -41.752 1.00 131.55 ? 121  LEU A CD1   1 
ATOM   922   C  CD2   . LEU A 1  121  ? 105.700 83.387  -39.488 1.00 130.74 ? 121  LEU A CD2   1 
ATOM   923   N  N     . MET A 1  122  ? 106.574 79.583  -43.678 1.00 125.60 ? 122  MET A N     1 
ATOM   924   C  CA    . MET A 1  122  ? 106.427 78.204  -44.111 1.00 124.92 ? 122  MET A CA    1 
ATOM   925   C  C     . MET A 1  122  ? 107.773 77.577  -44.429 1.00 128.56 ? 122  MET A C     1 
ATOM   926   O  O     . MET A 1  122  ? 108.035 76.483  -43.928 1.00 127.22 ? 122  MET A O     1 
ATOM   927   C  CB    . MET A 1  122  ? 105.457 78.088  -45.290 1.00 128.34 ? 122  MET A CB    1 
ATOM   928   C  CG    . MET A 1  122  ? 105.172 76.657  -45.720 1.00 131.70 ? 122  MET A CG    1 
ATOM   929   S  SD    . MET A 1  122  ? 104.217 75.648  -44.553 1.00 134.94 ? 122  MET A SD    1 
ATOM   930   C  CE    . MET A 1  122  ? 104.119 74.117  -45.487 1.00 131.37 ? 122  MET A CE    1 
ATOM   931   N  N     . ARG A 1  123  ? 108.637 78.255  -45.230 1.00 125.91 ? 123  ARG A N     1 
ATOM   932   C  CA    . ARG A 1  123  ? 109.971 77.703  -45.560 1.00 125.42 ? 123  ARG A CA    1 
ATOM   933   C  C     . ARG A 1  123  ? 110.910 77.592  -44.329 1.00 127.28 ? 123  ARG A C     1 
ATOM   934   O  O     . ARG A 1  123  ? 111.861 76.790  -44.302 1.00 124.75 ? 123  ARG A O     1 
ATOM   935   C  CB    . ARG A 1  123  ? 110.618 78.374  -46.792 1.00 125.93 ? 123  ARG A CB    1 
ATOM   936   C  CG    . ARG A 1  123  ? 110.598 79.893  -46.812 1.00 133.78 ? 123  ARG A CG    1 
ATOM   937   C  CD    . ARG A 1  123  ? 111.093 80.409  -48.148 1.00 140.82 ? 123  ARG A CD    1 
ATOM   938   N  NE    . ARG A 1  123  ? 110.379 81.616  -48.566 1.00 146.42 ? 123  ARG A NE    1 
ATOM   939   C  CZ    . ARG A 1  123  ? 110.827 82.853  -48.378 1.00 160.20 ? 123  ARG A CZ    1 
ATOM   940   N  NH1   . ARG A 1  123  ? 111.994 83.061  -47.776 1.00 143.92 ? 123  ARG A NH1   1 
ATOM   941   N  NH2   . ARG A 1  123  ? 110.110 83.893  -48.787 1.00 148.97 ? 123  ARG A NH2   1 
ATOM   942   N  N     . GLN A 1  124  ? 110.553 78.376  -43.292 1.00 123.73 ? 124  GLN A N     1 
ATOM   943   C  CA    . GLN A 1  124  ? 111.148 78.466  -41.966 1.00 122.42 ? 124  GLN A CA    1 
ATOM   944   C  C     . GLN A 1  124  ? 110.753 77.189  -41.214 1.00 121.97 ? 124  GLN A C     1 
ATOM   945   O  O     . GLN A 1  124  ? 111.624 76.485  -40.683 1.00 120.19 ? 124  GLN A O     1 
ATOM   946   C  CB    . GLN A 1  124  ? 110.565 79.718  -41.278 1.00 124.66 ? 124  GLN A CB    1 
ATOM   947   C  CG    . GLN A 1  124  ? 111.108 80.082  -39.907 1.00 147.76 ? 124  GLN A CG    1 
ATOM   948   C  CD    . GLN A 1  124  ? 110.506 81.397  -39.467 1.00 175.79 ? 124  GLN A CD    1 
ATOM   949   O  OE1   . GLN A 1  124  ? 110.971 82.482  -39.850 1.00 174.12 ? 124  GLN A OE1   1 
ATOM   950   N  NE2   . GLN A 1  124  ? 109.417 81.330  -38.705 1.00 168.17 ? 124  GLN A NE2   1 
ATOM   951   N  N     . ALA A 1  125  ? 109.431 76.890  -41.200 1.00 116.16 ? 125  ALA A N     1 
ATOM   952   C  CA    . ALA A 1  125  ? 108.850 75.711  -40.558 1.00 113.50 ? 125  ALA A CA    1 
ATOM   953   C  C     . ALA A 1  125  ? 109.297 74.426  -41.267 1.00 114.69 ? 125  ALA A C     1 
ATOM   954   O  O     . ALA A 1  125  ? 109.633 73.445  -40.606 1.00 113.12 ? 125  ALA A O     1 
ATOM   955   C  CB    . ALA A 1  125  ? 107.335 75.815  -40.543 1.00 114.17 ? 125  ALA A CB    1 
ATOM   956   N  N     . LEU A 1  126  ? 109.350 74.453  -42.611 1.00 110.42 ? 126  LEU A N     1 
ATOM   957   C  CA    . LEU A 1  126  ? 109.774 73.318  -43.434 1.00 109.23 ? 126  LEU A CA    1 
ATOM   958   C  C     . LEU A 1  126  ? 111.200 72.915  -43.124 1.00 112.96 ? 126  LEU A C     1 
ATOM   959   O  O     . LEU A 1  126  ? 111.535 71.734  -43.212 1.00 110.29 ? 126  LEU A O     1 
ATOM   960   C  CB    . LEU A 1  126  ? 109.651 73.676  -44.919 1.00 110.00 ? 126  LEU A CB    1 
ATOM   961   C  CG    . LEU A 1  126  ? 108.392 73.183  -45.589 1.00 113.80 ? 126  LEU A CG    1 
ATOM   962   C  CD1   . LEU A 1  126  ? 107.852 74.210  -46.529 1.00 114.69 ? 126  LEU A CD1   1 
ATOM   963   C  CD2   . LEU A 1  126  ? 108.628 71.855  -46.279 1.00 115.48 ? 126  LEU A CD2   1 
ATOM   964   N  N     . ALA A 1  127  ? 112.029 73.915  -42.750 1.00 112.37 ? 127  ALA A N     1 
ATOM   965   C  CA    . ALA A 1  127  ? 113.445 73.782  -42.411 1.00 112.61 ? 127  ALA A CA    1 
ATOM   966   C  C     . ALA A 1  127  ? 113.702 72.876  -41.200 1.00 115.34 ? 127  ALA A C     1 
ATOM   967   O  O     . ALA A 1  127  ? 114.747 72.210  -41.167 1.00 114.13 ? 127  ALA A O     1 
ATOM   968   C  CB    . ALA A 1  127  ? 114.057 75.155  -42.188 1.00 114.23 ? 127  ALA A CB    1 
ATOM   969   N  N     . ILE A 1  128  ? 112.738 72.843  -40.223 1.00 110.90 ? 128  ILE A N     1 
ATOM   970   C  CA    . ILE A 1  128  ? 112.776 72.035  -38.986 1.00 108.59 ? 128  ILE A CA    1 
ATOM   971   C  C     . ILE A 1  128  ? 113.216 70.596  -39.275 1.00 112.40 ? 128  ILE A C     1 
ATOM   972   O  O     . ILE A 1  128  ? 112.638 69.931  -40.138 1.00 111.65 ? 128  ILE A O     1 
ATOM   973   C  CB    . ILE A 1  128  ? 111.441 72.111  -38.175 1.00 110.18 ? 128  ILE A CB    1 
ATOM   974   C  CG1   . ILE A 1  128  ? 111.142 73.552  -37.746 1.00 110.42 ? 128  ILE A CG1   1 
ATOM   975   C  CG2   . ILE A 1  128  ? 111.466 71.179  -36.953 1.00 109.45 ? 128  ILE A CG2   1 
ATOM   976   C  CD1   . ILE A 1  128  ? 109.764 73.800  -37.349 1.00 114.36 ? 128  ILE A CD1   1 
ATOM   977   N  N     . LYS A 1  129  ? 114.276 70.148  -38.592 1.00 109.38 ? 129  LYS A N     1 
ATOM   978   C  CA    . LYS A 1  129  ? 114.802 68.799  -38.779 1.00 109.02 ? 129  LYS A CA    1 
ATOM   979   C  C     . LYS A 1  129  ? 113.872 67.790  -38.108 1.00 112.89 ? 129  LYS A C     1 
ATOM   980   O  O     . LYS A 1  129  ? 113.568 66.749  -38.713 1.00 112.29 ? 129  LYS A O     1 
ATOM   981   C  CB    . LYS A 1  129  ? 116.242 68.679  -38.239 1.00 111.36 ? 129  LYS A CB    1 
ATOM   982   C  CG    . LYS A 1  129  ? 117.272 69.607  -38.900 1.00 130.19 ? 129  LYS A CG    1 
ATOM   983   C  CD    . LYS A 1  129  ? 117.761 69.104  -40.265 1.00 144.88 ? 129  LYS A CD    1 
ATOM   984   C  CE    . LYS A 1  129  ? 117.340 70.005  -41.404 1.00 166.01 ? 129  LYS A CE    1 
ATOM   985   N  NZ    . LYS A 1  129  ? 118.138 71.264  -41.456 1.00 181.20 ? 129  LYS A NZ    1 
ATOM   986   N  N     . ASP A 1  130  ? 113.380 68.126  -36.881 1.00 109.08 ? 130  ASP A N     1 
ATOM   987   C  CA    . ASP A 1  130  ? 112.483 67.257  -36.121 1.00 108.10 ? 130  ASP A CA    1 
ATOM   988   C  C     . ASP A 1  130  ? 111.146 67.009  -36.811 1.00 110.21 ? 130  ASP A C     1 
ATOM   989   O  O     . ASP A 1  130  ? 110.341 67.929  -36.950 1.00 110.65 ? 130  ASP A O     1 
ATOM   990   C  CB    . ASP A 1  130  ? 112.282 67.729  -34.667 1.00 110.23 ? 130  ASP A CB    1 
ATOM   991   C  CG    . ASP A 1  130  ? 111.561 66.686  -33.807 1.00 126.28 ? 130  ASP A CG    1 
ATOM   992   O  OD1   . ASP A 1  130  ? 110.309 66.589  -33.899 1.00 127.00 ? 130  ASP A OD1   1 
ATOM   993   O  OD2   . ASP A 1  130  ? 112.248 65.932  -33.088 1.00 135.03 ? 130  ASP A OD2   1 
ATOM   994   N  N     . SER A 1  131  ? 110.910 65.739  -37.185 1.00 104.45 ? 131  SER A N     1 
ATOM   995   C  CA    . SER A 1  131  ? 109.709 65.213  -37.839 1.00 103.67 ? 131  SER A CA    1 
ATOM   996   C  C     . SER A 1  131  ? 108.410 65.630  -37.138 1.00 103.57 ? 131  SER A C     1 
ATOM   997   O  O     . SER A 1  131  ? 107.494 66.114  -37.793 1.00 103.64 ? 131  SER A O     1 
ATOM   998   C  CB    . SER A 1  131  ? 109.786 63.689  -37.922 1.00 108.59 ? 131  SER A CB    1 
ATOM   999   O  OG    . SER A 1  131  ? 111.097 63.240  -38.239 1.00 122.13 ? 131  SER A OG    1 
ATOM   1000  N  N     . LYS A 1  132  ? 108.349 65.476  -35.813 1.00 97.26  ? 132  LYS A N     1 
ATOM   1001  C  CA    . LYS A 1  132  ? 107.162 65.814  -35.031 1.00 96.39  ? 132  LYS A CA    1 
ATOM   1002  C  C     . LYS A 1  132  ? 106.969 67.316  -34.875 1.00 98.24  ? 132  LYS A C     1 
ATOM   1003  O  O     . LYS A 1  132  ? 105.846 67.807  -34.994 1.00 97.42  ? 132  LYS A O     1 
ATOM   1004  C  CB    . LYS A 1  132  ? 107.215 65.126  -33.651 1.00 98.68  ? 132  LYS A CB    1 
ATOM   1005  C  CG    . LYS A 1  132  ? 106.623 63.702  -33.591 1.00 108.63 ? 132  LYS A CG    1 
ATOM   1006  C  CD    . LYS A 1  132  ? 107.620 62.625  -34.010 1.00 111.69 ? 132  LYS A CD    1 
ATOM   1007  C  CE    . LYS A 1  132  ? 107.638 61.488  -33.040 1.00 114.01 ? 132  LYS A CE    1 
ATOM   1008  N  NZ    . LYS A 1  132  ? 108.992 60.900  -32.950 1.00 128.11 ? 132  LYS A NZ    1 
ATOM   1009  N  N     . LYS A 1  133  ? 108.065 68.033  -34.587 1.00 94.22  ? 133  LYS A N     1 
ATOM   1010  C  CA    . LYS A 1  133  ? 108.086 69.481  -34.378 1.00 94.54  ? 133  LYS A CA    1 
ATOM   1011  C  C     . LYS A 1  133  ? 107.780 70.237  -35.657 1.00 99.68  ? 133  LYS A C     1 
ATOM   1012  O  O     . LYS A 1  133  ? 107.105 71.277  -35.613 1.00 100.12 ? 133  LYS A O     1 
ATOM   1013  C  CB    . LYS A 1  133  ? 109.416 69.934  -33.745 1.00 96.01  ? 133  LYS A CB    1 
ATOM   1014  C  CG    . LYS A 1  133  ? 109.394 69.840  -32.216 1.00 101.37 ? 133  LYS A CG    1 
ATOM   1015  C  CD    . LYS A 1  133  ? 110.776 69.733  -31.585 1.00 106.97 ? 133  LYS A CD    1 
ATOM   1016  C  CE    . LYS A 1  133  ? 110.684 69.740  -30.074 1.00 114.42 ? 133  LYS A CE    1 
ATOM   1017  N  NZ    . LYS A 1  133  ? 111.981 69.395  -29.424 1.00 122.63 ? 133  LYS A NZ    1 
ATOM   1018  N  N     . ARG A 1  134  ? 108.259 69.697  -36.799 1.00 95.59  ? 134  ARG A N     1 
ATOM   1019  C  CA    . ARG A 1  134  ? 108.022 70.261  -38.125 1.00 96.09  ? 134  ARG A CA    1 
ATOM   1020  C  C     . ARG A 1  134  ? 106.533 70.198  -38.399 1.00 102.11 ? 134  ARG A C     1 
ATOM   1021  O  O     . ARG A 1  134  ? 105.938 71.258  -38.605 1.00 102.82 ? 134  ARG A O     1 
ATOM   1022  C  CB    . ARG A 1  134  ? 108.833 69.513  -39.185 1.00 92.93  ? 134  ARG A CB    1 
ATOM   1023  C  CG    . ARG A 1  134  ? 108.512 69.844  -40.626 1.00 94.98  ? 134  ARG A CG    1 
ATOM   1024  C  CD    . ARG A 1  134  ? 109.614 69.436  -41.593 1.00 105.26 ? 134  ARG A CD    1 
ATOM   1025  N  NE    . ARG A 1  134  ? 110.534 68.410  -41.084 1.00 114.31 ? 134  ARG A NE    1 
ATOM   1026  C  CZ    . ARG A 1  134  ? 110.396 67.102  -41.286 1.00 131.18 ? 134  ARG A CZ    1 
ATOM   1027  N  NH1   . ARG A 1  134  ? 109.361 66.634  -41.972 1.00 117.58 ? 134  ARG A NH1   1 
ATOM   1028  N  NH2   . ARG A 1  134  ? 111.290 66.248  -40.792 1.00 119.09 ? 134  ARG A NH2   1 
ATOM   1029  N  N     . PHE A 1  135  ? 105.914 68.981  -38.295 1.00 98.54  ? 135  PHE A N     1 
ATOM   1030  C  CA    . PHE A 1  135  ? 104.475 68.788  -38.501 1.00 98.80  ? 135  PHE A CA    1 
ATOM   1031  C  C     . PHE A 1  135  ? 103.693 69.760  -37.625 1.00 103.63 ? 135  PHE A C     1 
ATOM   1032  O  O     . PHE A 1  135  ? 102.737 70.388  -38.088 1.00 103.57 ? 135  PHE A O     1 
ATOM   1033  C  CB    . PHE A 1  135  ? 104.047 67.339  -38.214 1.00 99.78  ? 135  PHE A CB    1 
ATOM   1034  C  CG    . PHE A 1  135  ? 102.573 67.085  -38.456 1.00 101.87 ? 135  PHE A CG    1 
ATOM   1035  C  CD1   . PHE A 1  135  ? 101.625 67.382  -37.480 1.00 103.62 ? 135  PHE A CD1   1 
ATOM   1036  C  CD2   . PHE A 1  135  ? 102.132 66.558  -39.660 1.00 105.78 ? 135  PHE A CD2   1 
ATOM   1037  C  CE1   . PHE A 1  135  ? 100.261 67.183  -37.716 1.00 106.47 ? 135  PHE A CE1   1 
ATOM   1038  C  CE2   . PHE A 1  135  ? 100.766 66.346  -39.889 1.00 106.91 ? 135  PHE A CE2   1 
ATOM   1039  C  CZ    . PHE A 1  135  ? 99.841  66.655  -38.912 1.00 105.09 ? 135  PHE A CZ    1 
ATOM   1040  N  N     . ALA A 1  136  ? 104.138 69.900  -36.369 1.00 101.23 ? 136  ALA A N     1 
ATOM   1041  C  CA    . ALA A 1  136  ? 103.555 70.781  -35.362 1.00 102.28 ? 136  ALA A CA    1 
ATOM   1042  C  C     . ALA A 1  136  ? 103.421 72.213  -35.866 1.00 107.65 ? 136  ALA A C     1 
ATOM   1043  O  O     . ALA A 1  136  ? 102.362 72.832  -35.710 1.00 106.67 ? 136  ALA A O     1 
ATOM   1044  C  CB    . ALA A 1  136  ? 104.416 70.753  -34.105 1.00 102.56 ? 136  ALA A CB    1 
ATOM   1045  N  N     . ALA A 1  137  ? 104.507 72.716  -36.485 1.00 105.74 ? 137  ALA A N     1 
ATOM   1046  C  CA    . ALA A 1  137  ? 104.614 74.066  -37.026 1.00 106.83 ? 137  ALA A CA    1 
ATOM   1047  C  C     . ALA A 1  137  ? 103.842 74.244  -38.330 1.00 109.69 ? 137  ALA A C     1 
ATOM   1048  O  O     . ALA A 1  137  ? 103.221 75.298  -38.514 1.00 109.85 ? 137  ALA A O     1 
ATOM   1049  C  CB    . ALA A 1  137  ? 106.076 74.428  -37.221 1.00 107.91 ? 137  ALA A CB    1 
ATOM   1050  N  N     . ILE A 1  138  ? 103.888 73.222  -39.234 1.00 104.50 ? 138  ILE A N     1 
ATOM   1051  C  CA    . ILE A 1  138  ? 103.189 73.238  -40.524 1.00 104.47 ? 138  ILE A CA    1 
ATOM   1052  C  C     . ILE A 1  138  ? 101.710 73.401  -40.251 1.00 109.68 ? 138  ILE A C     1 
ATOM   1053  O  O     . ILE A 1  138  ? 101.074 74.260  -40.860 1.00 110.60 ? 138  ILE A O     1 
ATOM   1054  C  CB    . ILE A 1  138  ? 103.478 71.990  -41.411 1.00 106.39 ? 138  ILE A CB    1 
ATOM   1055  C  CG1   . ILE A 1  138  ? 104.979 71.877  -41.752 1.00 106.24 ? 138  ILE A CG1   1 
ATOM   1056  C  CG2   . ILE A 1  138  ? 102.615 72.002  -42.693 1.00 107.43 ? 138  ILE A CG2   1 
ATOM   1057  C  CD1   . ILE A 1  138  ? 105.398 70.601  -42.479 1.00 110.32 ? 138  ILE A CD1   1 
ATOM   1058  N  N     . TRP A 1  139  ? 101.184 72.628  -39.288 1.00 105.92 ? 139  TRP A N     1 
ATOM   1059  C  CA    . TRP A 1  139  ? 99.778  72.684  -38.930 1.00 106.61 ? 139  TRP A CA    1 
ATOM   1060  C  C     . TRP A 1  139  ? 99.292  74.039  -38.433 1.00 113.50 ? 139  TRP A C     1 
ATOM   1061  O  O     . TRP A 1  139  ? 98.344  74.574  -39.004 1.00 114.78 ? 139  TRP A O     1 
ATOM   1062  C  CB    . TRP A 1  139  ? 99.387  71.544  -37.999 1.00 104.05 ? 139  TRP A CB    1 
ATOM   1063  C  CG    . TRP A 1  139  ? 97.937  71.556  -37.623 1.00 104.96 ? 139  TRP A CG    1 
ATOM   1064  C  CD1   . TRP A 1  139  ? 96.881  71.155  -38.389 1.00 108.29 ? 139  TRP A CD1   1 
ATOM   1065  C  CD2   . TRP A 1  139  ? 97.389  72.005  -36.384 1.00 104.45 ? 139  TRP A CD2   1 
ATOM   1066  N  NE1   . TRP A 1  139  ? 95.707  71.317  -37.696 1.00 107.81 ? 139  TRP A NE1   1 
ATOM   1067  C  CE2   . TRP A 1  139  ? 95.990  71.824  -36.454 1.00 108.79 ? 139  TRP A CE2   1 
ATOM   1068  C  CE3   . TRP A 1  139  ? 97.952  72.508  -35.198 1.00 105.18 ? 139  TRP A CE3   1 
ATOM   1069  C  CZ2   . TRP A 1  139  ? 95.145  72.123  -35.382 1.00 108.06 ? 139  TRP A CZ2   1 
ATOM   1070  C  CZ3   . TRP A 1  139  ? 97.116  72.815  -34.141 1.00 106.70 ? 139  TRP A CZ3   1 
ATOM   1071  C  CH2   . TRP A 1  139  ? 95.729  72.626  -34.238 1.00 107.82 ? 139  TRP A CH2   1 
ATOM   1072  N  N     . THR A 1  140  ? 99.954  74.611  -37.421 1.00 110.52 ? 140  THR A N     1 
ATOM   1073  C  CA    . THR A 1  140  ? 99.595  75.920  -36.874 1.00 111.40 ? 140  THR A CA    1 
ATOM   1074  C  C     . THR A 1  140  ? 99.592  77.026  -37.939 1.00 118.15 ? 140  THR A C     1 
ATOM   1075  O  O     . THR A 1  140  ? 98.818  77.976  -37.832 1.00 119.12 ? 140  THR A O     1 
ATOM   1076  C  CB    . THR A 1  140  ? 100.406 76.232  -35.624 1.00 117.78 ? 140  THR A CB    1 
ATOM   1077  O  OG1   . THR A 1  140  ? 101.735 75.727  -35.800 1.00 118.65 ? 140  THR A OG1   1 
ATOM   1078  C  CG2   . THR A 1  140  ? 99.774  75.644  -34.359 1.00 113.44 ? 140  THR A CG2   1 
ATOM   1079  N  N     . LEU A 1  141  ? 100.401 76.861  -38.997 1.00 115.67 ? 141  LEU A N     1 
ATOM   1080  C  CA    . LEU A 1  141  ? 100.455 77.790  -40.121 1.00 117.49 ? 141  LEU A CA    1 
ATOM   1081  C  C     . LEU A 1  141  ? 99.275  77.530  -41.067 1.00 122.57 ? 141  LEU A C     1 
ATOM   1082  O  O     . LEU A 1  141  ? 98.468  78.430  -41.309 1.00 123.85 ? 141  LEU A O     1 
ATOM   1083  C  CB    . LEU A 1  141  ? 101.773 77.602  -40.903 1.00 117.98 ? 141  LEU A CB    1 
ATOM   1084  C  CG    . LEU A 1  141  ? 102.856 78.660  -40.733 1.00 123.55 ? 141  LEU A CG    1 
ATOM   1085  C  CD1   . LEU A 1  141  ? 104.231 78.032  -40.796 1.00 123.55 ? 141  LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A 1  141  ? 102.743 79.752  -41.791 1.00 128.10 ? 141  LEU A CD2   1 
ATOM   1087  N  N     . CYS A 1  142  ? 99.194  76.289  -41.604 1.00 117.81 ? 142  CYS A N     1 
ATOM   1088  C  CA    . CYS A 1  142  ? 98.233  75.821  -42.607 1.00 117.47 ? 142  CYS A CA    1 
ATOM   1089  C  C     . CYS A 1  142  ? 96.785  75.719  -42.190 1.00 118.91 ? 142  CYS A C     1 
ATOM   1090  O  O     . CYS A 1  142  ? 95.921  75.745  -43.072 1.00 120.11 ? 142  CYS A O     1 
ATOM   1091  C  CB    . CYS A 1  142  ? 98.712  74.525  -43.254 1.00 117.47 ? 142  CYS A CB    1 
ATOM   1092  S  SG    . CYS A 1  142  ? 100.120 74.724  -44.376 1.00 122.07 ? 142  CYS A SG    1 
ATOM   1093  N  N     . LYS A 1  143  ? 96.505  75.553  -40.884 1.00 111.92 ? 143  LYS A N     1 
ATOM   1094  C  CA    . LYS A 1  143  ? 95.129  75.407  -40.401 1.00 110.87 ? 143  LYS A CA    1 
ATOM   1095  C  C     . LYS A 1  143  ? 94.179  76.534  -40.869 1.00 117.27 ? 143  LYS A C     1 
ATOM   1096  O  O     . LYS A 1  143  ? 93.146  76.266  -41.502 1.00 116.12 ? 143  LYS A O     1 
ATOM   1097  C  CB    . LYS A 1  143  ? 95.069  75.141  -38.881 1.00 110.38 ? 143  LYS A CB    1 
ATOM   1098  C  CG    . LYS A 1  143  ? 95.778  76.141  -37.970 1.00 104.05 ? 143  LYS A CG    1 
ATOM   1099  C  CD    . LYS A 1  143  ? 95.763  75.616  -36.544 1.00 104.02 ? 143  LYS A CD    1 
ATOM   1100  C  CE    . LYS A 1  143  ? 96.261  76.592  -35.511 1.00 107.55 ? 143  LYS A CE    1 
ATOM   1101  N  NZ    . LYS A 1  143  ? 95.828  76.216  -34.134 1.00 111.93 ? 143  LYS A NZ    1 
ATOM   1102  N  N     . THR A 1  144  ? 94.616  77.784  -40.649 1.00 116.31 ? 144  THR A N     1 
ATOM   1103  C  CA    . THR A 1  144  ? 93.932  79.030  -40.982 1.00 118.08 ? 144  THR A CA    1 
ATOM   1104  C  C     . THR A 1  144  ? 93.852  79.358  -42.472 1.00 125.19 ? 144  THR A C     1 
ATOM   1105  O  O     . THR A 1  144  ? 92.973  80.132  -42.853 1.00 126.59 ? 144  THR A O     1 
ATOM   1106  C  CB    . THR A 1  144  ? 94.496  80.182  -40.155 1.00 126.66 ? 144  THR A CB    1 
ATOM   1107  O  OG1   . THR A 1  144  ? 95.895  79.970  -39.934 1.00 125.21 ? 144  THR A OG1   1 
ATOM   1108  C  CG2   . THR A 1  144  ? 93.779  80.334  -38.827 1.00 125.44 ? 144  THR A CG2   1 
ATOM   1109  N  N     . LYS A 1  145  ? 94.749  78.798  -43.317 1.00 122.79 ? 145  LYS A N     1 
ATOM   1110  C  CA    . LYS A 1  145  ? 94.698  79.040  -44.766 1.00 124.53 ? 145  LYS A CA    1 
ATOM   1111  C  C     . LYS A 1  145  ? 93.442  78.357  -45.307 1.00 130.17 ? 145  LYS A C     1 
ATOM   1112  O  O     . LYS A 1  145  ? 93.405  77.129  -45.435 1.00 129.36 ? 145  LYS A O     1 
ATOM   1113  C  CB    . LYS A 1  145  ? 95.971  78.545  -45.483 1.00 126.77 ? 145  LYS A CB    1 
ATOM   1114  C  CG    . LYS A 1  145  ? 96.678  79.631  -46.297 1.00 142.06 ? 145  LYS A CG    1 
ATOM   1115  C  CD    . LYS A 1  145  ? 96.198  79.749  -47.744 1.00 151.51 ? 145  LYS A CD    1 
ATOM   1116  C  CE    . LYS A 1  145  ? 96.763  80.980  -48.421 1.00 160.50 ? 145  LYS A CE    1 
ATOM   1117  N  NZ    . LYS A 1  145  ? 96.433  81.026  -49.870 1.00 168.24 ? 145  LYS A NZ    1 
ATOM   1118  N  N     . MET A 1  146  ? 92.381  79.153  -45.522 1.00 127.99 ? 146  MET A N     1 
ATOM   1119  C  CA    . MET A 1  146  ? 91.090  78.638  -45.953 1.00 128.23 ? 146  MET A CA    1 
ATOM   1120  C  C     . MET A 1  146  ? 90.845  78.601  -47.449 1.00 134.07 ? 146  MET A C     1 
ATOM   1121  O  O     . MET A 1  146  ? 89.728  78.296  -47.863 1.00 133.97 ? 146  MET A O     1 
ATOM   1122  C  CB    . MET A 1  146  ? 89.953  79.326  -45.198 1.00 130.96 ? 146  MET A CB    1 
ATOM   1123  C  CG    . MET A 1  146  ? 89.273  78.412  -44.207 1.00 133.50 ? 146  MET A CG    1 
ATOM   1124  S  SD    . MET A 1  146  ? 90.266  78.107  -42.730 1.00 135.96 ? 146  MET A SD    1 
ATOM   1125  C  CE    . MET A 1  146  ? 89.804  79.501  -41.726 1.00 133.31 ? 146  MET A CE    1 
ATOM   1126  N  N     . VAL A 1  147  ? 91.876  78.887  -48.261 1.00 132.35 ? 147  VAL A N     1 
ATOM   1127  C  CA    . VAL A 1  147  ? 91.782  78.849  -49.725 1.00 134.18 ? 147  VAL A CA    1 
ATOM   1128  C  C     . VAL A 1  147  ? 93.017  78.270  -50.369 1.00 140.23 ? 147  VAL A C     1 
ATOM   1129  O  O     . VAL A 1  147  ? 94.140  78.697  -50.080 1.00 139.59 ? 147  VAL A O     1 
ATOM   1130  C  CB    . VAL A 1  147  ? 91.362  80.171  -50.415 1.00 139.78 ? 147  VAL A CB    1 
ATOM   1131  C  CG1   . VAL A 1  147  ? 89.858  80.404  -50.315 1.00 140.29 ? 147  VAL A CG1   1 
ATOM   1132  C  CG2   . VAL A 1  147  ? 92.161  81.375  -49.906 1.00 139.80 ? 147  VAL A CG2   1 
ATOM   1133  N  N     . CYS A 1  148  ? 92.813  77.297  -51.257 1.00 138.81 ? 148  CYS A N     1 
ATOM   1134  C  CA    . CYS A 1  148  ? 93.929  76.714  -51.980 1.00 139.20 ? 148  CYS A CA    1 
ATOM   1135  C  C     . CYS A 1  148  ? 94.318  77.785  -52.960 1.00 147.41 ? 148  CYS A C     1 
ATOM   1136  O  O     . CYS A 1  148  ? 93.452  78.272  -53.689 1.00 148.44 ? 148  CYS A O     1 
ATOM   1137  C  CB    . CYS A 1  148  ? 93.517  75.429  -52.688 1.00 138.98 ? 148  CYS A CB    1 
ATOM   1138  S  SG    . CYS A 1  148  ? 94.867  74.630  -53.589 1.00 142.34 ? 148  CYS A SG    1 
ATOM   1139  N  N     . GLU A 1  149  ? 95.566  78.250  -52.897 1.00 146.02 ? 149  GLU A N     1 
ATOM   1140  C  CA    . GLU A 1  149  ? 95.972  79.326  -53.794 1.00 148.42 ? 149  GLU A CA    1 
ATOM   1141  C  C     . GLU A 1  149  ? 96.431  78.873  -55.184 1.00 155.17 ? 149  GLU A C     1 
ATOM   1142  O  O     . GLU A 1  149  ? 96.918  77.753  -55.344 1.00 153.97 ? 149  GLU A O     1 
ATOM   1143  C  CB    . GLU A 1  149  ? 96.945  80.298  -53.117 1.00 149.74 ? 149  GLU A CB    1 
ATOM   1144  C  CG    . GLU A 1  149  ? 96.636  81.758  -53.420 1.00 164.03 ? 149  GLU A CG    1 
ATOM   1145  C  CD    . GLU A 1  149  ? 95.228  82.254  -53.140 1.00 187.98 ? 149  GLU A CD    1 
ATOM   1146  O  OE1   . GLU A 1  149  ? 94.704  81.981  -52.034 1.00 174.88 ? 149  GLU A OE1   1 
ATOM   1147  O  OE2   . GLU A 1  149  ? 94.659  82.941  -54.022 1.00 183.86 ? 149  GLU A OE2   1 
ATOM   1148  N  N     . THR A 1  150  ? 96.213  79.736  -56.192 1.00 154.89 ? 150  THR A N     1 
ATOM   1149  C  CA    . THR A 1  150  ? 96.583  79.509  -57.592 1.00 156.47 ? 150  THR A CA    1 
ATOM   1150  C  C     . THR A 1  150  ? 97.799  80.344  -57.949 1.00 164.38 ? 150  THR A C     1 
ATOM   1151  O  O     . THR A 1  150  ? 98.695  79.866  -58.647 1.00 163.52 ? 150  THR A O     1 
ATOM   1152  C  CB    . THR A 1  150  ? 95.415  79.832  -58.518 1.00 161.39 ? 150  THR A CB    1 
ATOM   1153  O  OG1   . THR A 1  150  ? 94.839  81.092  -58.143 1.00 159.09 ? 150  THR A OG1   1 
ATOM   1154  C  CG2   . THR A 1  150  ? 94.373  78.738  -58.523 1.00 158.75 ? 150  THR A CG2   1 
ATOM   1155  N  N     . ASP A 1  151  ? 97.804  81.607  -57.478 1.00 164.69 ? 151  ASP A N     1 
ATOM   1156  C  CA    . ASP A 1  151  ? 98.849  82.601  -57.682 1.00 166.62 ? 151  ASP A CA    1 
ATOM   1157  C  C     . ASP A 1  151  ? 99.113  83.345  -56.368 1.00 170.55 ? 151  ASP A C     1 
ATOM   1158  O  O     . ASP A 1  151  ? 98.193  83.923  -55.775 1.00 169.72 ? 151  ASP A O     1 
ATOM   1159  C  CB    . ASP A 1  151  ? 98.439  83.599  -58.789 1.00 171.53 ? 151  ASP A CB    1 
ATOM   1160  C  CG    . ASP A 1  151  ? 98.414  83.055  -60.213 1.00 189.44 ? 151  ASP A CG    1 
ATOM   1161  O  OD1   . ASP A 1  151  ? 97.661  82.086  -60.470 1.00 191.33 ? 151  ASP A OD1   1 
ATOM   1162  O  OD2   . ASP A 1  151  ? 99.104  83.636  -61.086 1.00 197.13 ? 151  ASP A OD2   1 
ATOM   1163  N  N     . VAL A 1  152  ? 100.371 83.307  -55.915 1.00 167.94 ? 152  VAL A N     1 
ATOM   1164  C  CA    . VAL A 1  152  ? 100.861 83.953  -54.691 1.00 168.11 ? 152  VAL A CA    1 
ATOM   1165  C  C     . VAL A 1  152  ? 101.921 85.009  -55.110 1.00 175.00 ? 152  VAL A C     1 
ATOM   1166  O  O     . VAL A 1  152  ? 102.586 84.787  -56.127 1.00 174.73 ? 152  VAL A O     1 
ATOM   1167  C  CB    . VAL A 1  152  ? 101.382 82.865  -53.686 1.00 170.44 ? 152  VAL A CB    1 
ATOM   1168  C  CG1   . VAL A 1  152  ? 102.550 83.342  -52.818 1.00 169.64 ? 152  VAL A CG1   1 
ATOM   1169  C  CG2   . VAL A 1  152  ? 100.252 82.335  -52.813 1.00 169.36 ? 152  VAL A CG2   1 
ATOM   1170  N  N     . PRO A 1  153  ? 102.075 86.167  -54.402 1.00 173.96 ? 153  PRO A N     1 
ATOM   1171  C  CA    . PRO A 1  153  ? 103.087 87.159  -54.826 1.00 175.73 ? 153  PRO A CA    1 
ATOM   1172  C  C     . PRO A 1  153  ? 104.505 86.588  -54.933 1.00 181.82 ? 153  PRO A C     1 
ATOM   1173  O  O     . PRO A 1  153  ? 104.938 85.842  -54.048 1.00 179.73 ? 153  PRO A O     1 
ATOM   1174  C  CB    . PRO A 1  153  ? 102.982 88.253  -53.756 1.00 177.25 ? 153  PRO A CB    1 
ATOM   1175  C  CG    . PRO A 1  153  ? 102.346 87.577  -52.579 1.00 179.81 ? 153  PRO A CG    1 
ATOM   1176  C  CD    . PRO A 1  153  ? 101.371 86.622  -53.186 1.00 175.13 ? 153  PRO A CD    1 
ATOM   1177  N  N     . SER A 1  154  ? 105.206 86.922  -56.045 1.00 181.74 ? 154  SER A N     1 
ATOM   1178  C  CA    . SER A 1  154  ? 106.565 86.476  -56.399 1.00 182.11 ? 154  SER A CA    1 
ATOM   1179  C  C     . SER A 1  154  ? 107.636 86.692  -55.322 1.00 186.51 ? 154  SER A C     1 
ATOM   1180  O  O     . SER A 1  154  ? 107.465 87.526  -54.426 1.00 185.75 ? 154  SER A O     1 
ATOM   1181  C  CB    . SER A 1  154  ? 107.012 87.092  -57.723 1.00 187.85 ? 154  SER A CB    1 
ATOM   1182  O  OG    . SER A 1  154  ? 106.904 88.506  -57.729 1.00 199.14 ? 154  SER A OG    1 
ATOM   1183  N  N     . GLU A 1  155  ? 108.759 85.944  -55.439 1.00 183.83 ? 155  GLU A N     1 
ATOM   1184  C  CA    . GLU A 1  155  ? 109.897 85.985  -54.513 1.00 183.38 ? 155  GLU A CA    1 
ATOM   1185  C  C     . GLU A 1  155  ? 110.786 87.233  -54.703 1.00 190.85 ? 155  GLU A C     1 
ATOM   1186  O  O     . GLU A 1  155  ? 112.016 87.152  -54.607 1.00 189.82 ? 155  GLU A O     1 
ATOM   1187  C  CB    . GLU A 1  155  ? 110.697 84.673  -54.581 1.00 183.41 ? 155  GLU A CB    1 
ATOM   1188  C  CG    . GLU A 1  155  ? 109.967 83.490  -53.964 1.00 190.64 ? 155  GLU A CG    1 
ATOM   1189  C  CD    . GLU A 1  155  ? 110.556 82.115  -54.219 1.00 207.59 ? 155  GLU A CD    1 
ATOM   1190  O  OE1   . GLU A 1  155  ? 111.738 82.025  -54.624 1.00 203.01 ? 155  GLU A OE1   1 
ATOM   1191  O  OE2   . GLU A 1  155  ? 109.837 81.118  -53.983 1.00 197.97 ? 155  GLU A OE2   1 
ATOM   1192  N  N     . ASP A 1  156  ? 110.131 88.398  -54.945 1.00 191.05 ? 156  ASP A N     1 
ATOM   1193  C  CA    . ASP A 1  156  ? 110.738 89.718  -55.148 1.00 193.16 ? 156  ASP A CA    1 
ATOM   1194  C  C     . ASP A 1  156  ? 109.748 90.899  -55.004 1.00 200.24 ? 156  ASP A C     1 
ATOM   1195  O  O     . ASP A 1  156  ? 110.011 91.800  -54.207 1.00 199.88 ? 156  ASP A O     1 
ATOM   1196  C  CB    . ASP A 1  156  ? 111.522 89.803  -56.483 1.00 196.12 ? 156  ASP A CB    1 
ATOM   1197  C  CG    . ASP A 1  156  ? 110.716 89.451  -57.721 1.00 205.23 ? 156  ASP A CG    1 
ATOM   1198  O  OD1   . ASP A 1  156  ? 110.548 88.243  -57.994 1.00 204.74 ? 156  ASP A OD1   1 
ATOM   1199  O  OD2   . ASP A 1  156  ? 110.262 90.385  -58.419 1.00 211.60 ? 156  ASP A OD2   1 
ATOM   1200  N  N     . ASP A 1  157  ? 108.621 90.896  -55.761 1.00 198.55 ? 157  ASP A N     1 
ATOM   1201  C  CA    . ASP A 1  157  ? 107.662 92.007  -55.771 1.00 199.61 ? 157  ASP A CA    1 
ATOM   1202  C  C     . ASP A 1  157  ? 106.175 91.608  -55.669 1.00 204.76 ? 157  ASP A C     1 
ATOM   1203  O  O     . ASP A 1  157  ? 105.792 90.590  -56.255 1.00 203.81 ? 157  ASP A O     1 
ATOM   1204  C  CB    . ASP A 1  157  ? 107.879 92.838  -57.043 1.00 202.81 ? 157  ASP A CB    1 
ATOM   1205  C  CG    . ASP A 1  157  ? 107.837 94.326  -56.806 1.00 210.55 ? 157  ASP A CG    1 
ATOM   1206  O  OD1   . ASP A 1  157  ? 108.874 94.888  -56.395 1.00 215.40 ? 157  ASP A OD1   1 
ATOM   1207  O  OD2   . ASP A 1  157  ? 106.761 94.927  -57.007 1.00 211.04 ? 157  ASP A OD2   1 
ATOM   1208  N  N     . PRO A 1  158  ? 105.303 92.430  -55.009 1.00 202.47 ? 158  PRO A N     1 
ATOM   1209  C  CA    . PRO A 1  158  ? 103.867 92.085  -54.957 1.00 201.93 ? 158  PRO A CA    1 
ATOM   1210  C  C     . PRO A 1  158  ? 103.103 92.450  -56.241 1.00 204.81 ? 158  PRO A C     1 
ATOM   1211  O  O     . PRO A 1  158  ? 101.959 92.010  -56.399 1.00 204.10 ? 158  PRO A O     1 
ATOM   1212  C  CB    . PRO A 1  158  ? 103.361 92.900  -53.763 1.00 203.84 ? 158  PRO A CB    1 
ATOM   1213  C  CG    . PRO A 1  158  ? 104.206 94.133  -53.786 1.00 209.69 ? 158  PRO A CG    1 
ATOM   1214  C  CD    . PRO A 1  158  ? 105.572 93.682  -54.261 1.00 204.95 ? 158  PRO A CD    1 
ATOM   1215  N  N     . THR A 1  159  ? 103.724 93.269  -57.137 1.00 200.31 ? 159  THR A N     1 
ATOM   1216  C  CA    . THR A 1  159  ? 103.152 93.729  -58.415 1.00 200.79 ? 159  THR A CA    1 
ATOM   1217  C  C     . THR A 1  159  ? 102.894 92.556  -59.383 1.00 201.95 ? 159  THR A C     1 
ATOM   1218  O  O     . THR A 1  159  ? 101.850 92.525  -60.043 1.00 202.34 ? 159  THR A O     1 
ATOM   1219  C  CB    . THR A 1  159  ? 104.004 94.859  -59.030 1.00 208.87 ? 159  THR A CB    1 
ATOM   1220  O  OG1   . THR A 1  159  ? 104.473 95.726  -57.994 1.00 207.25 ? 159  THR A OG1   1 
ATOM   1221  C  CG2   . THR A 1  159  ? 103.242 95.671  -60.082 1.00 207.97 ? 159  THR A CG2   1 
ATOM   1222  N  N     . GLN A 1  160  ? 103.839 91.596  -59.450 1.00 194.46 ? 160  GLN A N     1 
ATOM   1223  C  CA    . GLN A 1  160  ? 103.724 90.388  -60.274 1.00 192.34 ? 160  GLN A CA    1 
ATOM   1224  C  C     . GLN A 1  160  ? 103.512 89.184  -59.344 1.00 191.32 ? 160  GLN A C     1 
ATOM   1225  O  O     . GLN A 1  160  ? 104.320 88.937  -58.442 1.00 189.54 ? 160  GLN A O     1 
ATOM   1226  C  CB    . GLN A 1  160  ? 104.949 90.153  -61.190 1.00 193.74 ? 160  GLN A CB    1 
ATOM   1227  C  CG    . GLN A 1  160  ? 105.742 91.390  -61.600 1.00 200.63 ? 160  GLN A CG    1 
ATOM   1228  C  CD    . GLN A 1  160  ? 106.698 91.832  -60.519 1.00 211.43 ? 160  GLN A CD    1 
ATOM   1229  O  OE1   . GLN A 1  160  ? 107.395 91.028  -59.884 1.00 202.54 ? 160  GLN A OE1   1 
ATOM   1230  N  NE2   . GLN A 1  160  ? 106.723 93.127  -60.266 1.00 205.55 ? 160  GLN A NE2   1 
ATOM   1231  N  N     . LEU A 1  161  ? 102.399 88.471  -59.544 1.00 184.92 ? 161  LEU A N     1 
ATOM   1232  C  CA    . LEU A 1  161  ? 102.034 87.297  -58.763 1.00 181.40 ? 161  LEU A CA    1 
ATOM   1233  C  C     . LEU A 1  161  ? 102.431 86.043  -59.544 1.00 182.69 ? 161  LEU A C     1 
ATOM   1234  O  O     . LEU A 1  161  ? 102.011 85.879  -60.695 1.00 183.39 ? 161  LEU A O     1 
ATOM   1235  C  CB    . LEU A 1  161  ? 100.515 87.305  -58.479 1.00 181.04 ? 161  LEU A CB    1 
ATOM   1236  C  CG    . LEU A 1  161  ? 100.045 87.958  -57.176 1.00 184.41 ? 161  LEU A CG    1 
ATOM   1237  C  CD1   . LEU A 1  161  ? 99.980  89.470  -57.299 1.00 185.89 ? 161  LEU A CD1   1 
ATOM   1238  C  CD2   . LEU A 1  161  ? 98.677  87.446  -56.791 1.00 185.36 ? 161  LEU A CD2   1 
ATOM   1239  N  N     . VAL A 1  162  ? 103.267 85.178  -58.936 1.00 175.81 ? 162  VAL A N     1 
ATOM   1240  C  CA    . VAL A 1  162  ? 103.696 83.920  -59.558 1.00 174.00 ? 162  VAL A CA    1 
ATOM   1241  C  C     . VAL A 1  162  ? 102.655 82.829  -59.254 1.00 174.03 ? 162  VAL A C     1 
ATOM   1242  O  O     . VAL A 1  162  ? 102.170 82.736  -58.122 1.00 171.79 ? 162  VAL A O     1 
ATOM   1243  C  CB    . VAL A 1  162  ? 105.166 83.528  -59.199 1.00 176.80 ? 162  VAL A CB    1 
ATOM   1244  C  CG1   . VAL A 1  162  ? 105.459 82.049  -59.471 1.00 175.34 ? 162  VAL A CG1   1 
ATOM   1245  C  CG2   . VAL A 1  162  ? 106.159 84.406  -59.952 1.00 177.97 ? 162  VAL A CG2   1 
ATOM   1246  N  N     . SER A 1  163  ? 102.274 82.048  -60.285 1.00 169.55 ? 163  SER A N     1 
ATOM   1247  C  CA    . SER A 1  163  ? 101.306 80.971  -60.129 1.00 167.62 ? 163  SER A CA    1 
ATOM   1248  C  C     . SER A 1  163  ? 101.984 79.744  -59.565 1.00 166.98 ? 163  SER A C     1 
ATOM   1249  O  O     . SER A 1  163  ? 102.940 79.232  -60.162 1.00 166.58 ? 163  SER A O     1 
ATOM   1250  C  CB    . SER A 1  163  ? 100.619 80.638  -61.451 1.00 172.71 ? 163  SER A CB    1 
ATOM   1251  O  OG    . SER A 1  163  ? 101.459 79.889  -62.312 1.00 182.93 ? 163  SER A OG    1 
ATOM   1252  N  N     . ARG A 1  164  ? 101.506 79.283  -58.402 1.00 159.48 ? 164  ARG A N     1 
ATOM   1253  C  CA    . ARG A 1  164  ? 102.025 78.075  -57.769 1.00 156.04 ? 164  ARG A CA    1 
ATOM   1254  C  C     . ARG A 1  164  ? 101.217 76.919  -58.358 1.00 157.87 ? 164  ARG A C     1 
ATOM   1255  O  O     . ARG A 1  164  ? 101.010 76.882  -59.572 1.00 158.91 ? 164  ARG A O     1 
ATOM   1256  C  CB    . ARG A 1  164  ? 101.959 78.168  -56.225 1.00 152.23 ? 164  ARG A CB    1 
ATOM   1257  C  CG    . ARG A 1  164  ? 100.661 78.711  -55.623 1.00 154.20 ? 164  ARG A CG    1 
ATOM   1258  C  CD    . ARG A 1  164  ? 100.799 78.806  -54.117 1.00 155.77 ? 164  ARG A CD    1 
ATOM   1259  N  NE    . ARG A 1  164  ? 99.684  78.175  -53.411 1.00 158.16 ? 164  ARG A NE    1 
ATOM   1260  C  CZ    . ARG A 1  164  ? 99.632  77.989  -52.094 1.00 165.31 ? 164  ARG A CZ    1 
ATOM   1261  N  NH1   . ARG A 1  164  ? 100.642 78.370  -51.322 1.00 144.42 ? 164  ARG A NH1   1 
ATOM   1262  N  NH2   . ARG A 1  164  ? 98.570  77.420  -51.541 1.00 153.15 ? 164  ARG A NH2   1 
ATOM   1263  N  N     . GLY A 1  165  ? 100.744 76.011  -57.523 1.00 151.67 ? 165  GLY A N     1 
ATOM   1264  C  CA    . GLY A 1  165  ? 99.872  74.940  -57.973 1.00 150.91 ? 165  GLY A CA    1 
ATOM   1265  C  C     . GLY A 1  165  ? 98.505  75.539  -58.215 1.00 155.23 ? 165  GLY A C     1 
ATOM   1266  O  O     . GLY A 1  165  ? 98.209  76.623  -57.706 1.00 155.07 ? 165  GLY A O     1 
ATOM   1267  N  N     . GLY A 1  166  ? 97.686  74.855  -59.003 1.00 152.40 ? 166  GLY A N     1 
ATOM   1268  C  CA    . GLY A 1  166  ? 96.346  75.323  -59.344 1.00 153.27 ? 166  GLY A CA    1 
ATOM   1269  C  C     . GLY A 1  166  ? 95.348  75.186  -58.215 1.00 155.62 ? 166  GLY A C     1 
ATOM   1270  O  O     . GLY A 1  166  ? 95.724  75.235  -57.039 1.00 153.60 ? 166  GLY A O     1 
ATOM   1271  N  N     . CYS A 1  167  ? 94.060  75.005  -58.582 1.00 152.53 ? 167  CYS A N     1 
ATOM   1272  C  CA    . CYS A 1  167  ? 92.910  74.847  -57.684 1.00 151.27 ? 167  CYS A CA    1 
ATOM   1273  C  C     . CYS A 1  167  ? 92.706  76.081  -56.798 1.00 152.18 ? 167  CYS A C     1 
ATOM   1274  O  O     . CYS A 1  167  ? 93.584  76.456  -56.020 1.00 150.95 ? 167  CYS A O     1 
ATOM   1275  C  CB    . CYS A 1  167  ? 93.010  73.553  -56.871 1.00 150.21 ? 167  CYS A CB    1 
ATOM   1276  S  SG    . CYS A 1  167  ? 91.648  73.288  -55.704 1.00 153.47 ? 167  CYS A SG    1 
ATOM   1277  N  N     . GLY A 1  168  ? 91.571  76.732  -56.964 1.00 147.49 ? 168  GLY A N     1 
ATOM   1278  C  CA    . GLY A 1  168  ? 91.255  77.915  -56.178 1.00 146.96 ? 168  GLY A CA    1 
ATOM   1279  C  C     . GLY A 1  168  ? 90.121  77.667  -55.212 1.00 148.84 ? 168  GLY A C     1 
ATOM   1280  O  O     . GLY A 1  168  ? 89.375  78.591  -54.879 1.00 149.54 ? 168  GLY A O     1 
ATOM   1281  N  N     . ASN A 1  169  ? 89.977  76.415  -54.765 1.00 142.32 ? 169  ASN A N     1 
ATOM   1282  C  CA    . ASN A 1  169  ? 88.876  76.047  -53.894 1.00 140.53 ? 169  ASN A CA    1 
ATOM   1283  C  C     . ASN A 1  169  ? 89.016  76.472  -52.456 1.00 140.39 ? 169  ASN A C     1 
ATOM   1284  O  O     . ASN A 1  169  ? 90.133  76.576  -51.946 1.00 138.54 ? 169  ASN A O     1 
ATOM   1285  C  CB    . ASN A 1  169  ? 88.493  74.586  -54.071 1.00 141.38 ? 169  ASN A CB    1 
ATOM   1286  C  CG    . ASN A 1  169  ? 87.732  74.364  -55.360 1.00 172.76 ? 169  ASN A CG    1 
ATOM   1287  O  OD1   . ASN A 1  169  ? 86.497  74.386  -55.386 1.00 168.89 ? 169  ASN A OD1   1 
ATOM   1288  N  ND2   . ASN A 1  169  ? 88.447  74.214  -56.473 1.00 167.31 ? 169  ASN A ND2   1 
ATOM   1289  N  N     . THR A 1  170  ? 87.863  76.786  -51.831 1.00 135.77 ? 170  THR A N     1 
ATOM   1290  C  CA    . THR A 1  170  ? 87.754  77.205  -50.436 1.00 134.36 ? 170  THR A CA    1 
ATOM   1291  C  C     . THR A 1  170  ? 87.683  75.981  -49.534 1.00 135.46 ? 170  THR A C     1 
ATOM   1292  O  O     . THR A 1  170  ? 86.912  75.048  -49.772 1.00 134.56 ? 170  THR A O     1 
ATOM   1293  C  CB    . THR A 1  170  ? 86.630  78.219  -50.234 1.00 144.52 ? 170  THR A CB    1 
ATOM   1294  O  OG1   . THR A 1  170  ? 86.752  79.240  -51.226 1.00 146.91 ? 170  THR A OG1   1 
ATOM   1295  C  CG2   . THR A 1  170  ? 86.648  78.850  -48.835 1.00 141.89 ? 170  THR A CG2   1 
ATOM   1296  N  N     . GLN A 1  171  ? 88.528  75.993  -48.511 1.00 130.06 ? 171  GLN A N     1 
ATOM   1297  C  CA    . GLN A 1  171  ? 88.719  74.906  -47.570 1.00 127.50 ? 171  GLN A CA    1 
ATOM   1298  C  C     . GLN A 1  171  ? 87.728  74.910  -46.409 1.00 129.04 ? 171  GLN A C     1 
ATOM   1299  O  O     . GLN A 1  171  ? 87.469  75.967  -45.814 1.00 129.12 ? 171  GLN A O     1 
ATOM   1300  C  CB    . GLN A 1  171  ? 90.172  74.903  -47.066 1.00 127.77 ? 171  GLN A CB    1 
ATOM   1301  C  CG    . GLN A 1  171  ? 91.224  74.871  -48.183 1.00 137.82 ? 171  GLN A CG    1 
ATOM   1302  C  CD    . GLN A 1  171  ? 91.198  73.603  -49.005 1.00 153.15 ? 171  GLN A CD    1 
ATOM   1303  O  OE1   . GLN A 1  171  ? 91.093  72.486  -48.477 1.00 150.54 ? 171  GLN A OE1   1 
ATOM   1304  N  NE2   . GLN A 1  171  ? 91.314  73.751  -50.317 1.00 138.51 ? 171  GLN A NE2   1 
ATOM   1305  N  N     . PRO A 1  172  ? 87.185  73.716  -46.064 1.00 122.69 ? 172  PRO A N     1 
ATOM   1306  C  CA    . PRO A 1  172  ? 86.231  73.636  -44.945 1.00 121.50 ? 172  PRO A CA    1 
ATOM   1307  C  C     . PRO A 1  172  ? 86.836  73.921  -43.585 1.00 123.52 ? 172  PRO A C     1 
ATOM   1308  O  O     . PRO A 1  172  ? 88.024  73.695  -43.367 1.00 122.63 ? 172  PRO A O     1 
ATOM   1309  C  CB    . PRO A 1  172  ? 85.759  72.179  -44.979 1.00 122.21 ? 172  PRO A CB    1 
ATOM   1310  C  CG    . PRO A 1  172  ? 86.830  71.448  -45.673 1.00 126.06 ? 172  PRO A CG    1 
ATOM   1311  C  CD    . PRO A 1  172  ? 87.392  72.392  -46.686 1.00 122.92 ? 172  PRO A CD    1 
ATOM   1312  N  N     . THR A 1  173  ? 85.999  74.379  -42.661 1.00 119.29 ? 173  THR A N     1 
ATOM   1313  C  CA    . THR A 1  173  ? 86.393  74.564  -41.276 1.00 117.76 ? 173  THR A CA    1 
ATOM   1314  C  C     . THR A 1  173  ? 85.977  73.232  -40.635 1.00 120.59 ? 173  THR A C     1 
ATOM   1315  O  O     . THR A 1  173  ? 84.776  72.985  -40.434 1.00 120.75 ? 173  THR A O     1 
ATOM   1316  C  CB    . THR A 1  173  ? 85.838  75.893  -40.718 1.00 121.48 ? 173  THR A CB    1 
ATOM   1317  O  OG1   . THR A 1  173  ? 86.714  76.936  -41.148 1.00 120.49 ? 173  THR A OG1   1 
ATOM   1318  C  CG2   . THR A 1  173  ? 85.741  75.921  -39.193 1.00 116.14 ? 173  THR A CG2   1 
ATOM   1319  N  N     . ILE A 1  174  ? 86.973  72.322  -40.447 1.00 114.74 ? 174  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1  174  ? 86.727  70.974  -39.915 1.00 112.28 ? 174  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1  174  ? 86.627  70.917  -38.390 1.00 114.29 ? 174  ILE A C     1 
ATOM   1322  O  O     . ILE A 1  174  ? 87.431  71.533  -37.678 1.00 113.64 ? 174  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1  174  ? 87.651  69.866  -40.498 1.00 113.55 ? 174  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1  174  ? 88.099  70.183  -41.928 1.00 114.18 ? 174  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1  174  ? 86.956  68.503  -40.440 1.00 112.84 ? 174  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1  174  ? 89.479  69.780  -42.201 1.00 117.48 ? 174  ILE A CD1   1 
ATOM   1327  N  N     . ARG A 1  175  ? 85.614  70.176  -37.913 1.00 109.25 ? 175  ARG A N     1 
ATOM   1328  C  CA    . ARG A 1  175  ? 85.349  69.910  -36.508 1.00 108.37 ? 175  ARG A CA    1 
ATOM   1329  C  C     . ARG A 1  175  ? 84.978  68.428  -36.320 1.00 110.77 ? 175  ARG A C     1 
ATOM   1330  O  O     . ARG A 1  175  ? 84.461  67.798  -37.252 1.00 110.51 ? 175  ARG A O     1 
ATOM   1331  C  CB    . ARG A 1  175  ? 84.276  70.859  -35.942 1.00 111.88 ? 175  ARG A CB    1 
ATOM   1332  C  CG    . ARG A 1  175  ? 82.968  70.924  -36.740 1.00 135.57 ? 175  ARG A CG    1 
ATOM   1333  C  CD    . ARG A 1  175  ? 81.742  71.227  -35.877 1.00 158.78 ? 175  ARG A CD    1 
ATOM   1334  N  NE    . ARG A 1  175  ? 81.360  70.097  -35.017 1.00 173.04 ? 175  ARG A NE    1 
ATOM   1335  C  CZ    . ARG A 1  175  ? 80.149  69.917  -34.491 1.00 187.37 ? 175  ARG A CZ    1 
ATOM   1336  N  NH1   . ARG A 1  175  ? 79.172  70.782  -34.740 1.00 177.16 ? 175  ARG A NH1   1 
ATOM   1337  N  NH2   . ARG A 1  175  ? 79.905  68.865  -33.718 1.00 169.58 ? 175  ARG A NH2   1 
ATOM   1338  N  N     . LYS A 1  176  ? 85.282  67.863  -35.140 1.00 105.77 ? 176  LYS A N     1 
ATOM   1339  C  CA    . LYS A 1  176  ? 84.974  66.466  -34.830 1.00 104.93 ? 176  LYS A CA    1 
ATOM   1340  C  C     . LYS A 1  176  ? 83.554  66.354  -34.268 1.00 110.53 ? 176  LYS A C     1 
ATOM   1341  O  O     . LYS A 1  176  ? 83.129  67.201  -33.479 1.00 110.51 ? 176  LYS A O     1 
ATOM   1342  C  CB    . LYS A 1  176  ? 85.996  65.908  -33.814 1.00 105.88 ? 176  LYS A CB    1 
ATOM   1343  C  CG    . LYS A 1  176  ? 85.939  64.398  -33.532 1.00 106.77 ? 176  LYS A CG    1 
ATOM   1344  C  CD    . LYS A 1  176  ? 86.861  64.044  -32.365 1.00 111.86 ? 176  LYS A CD    1 
ATOM   1345  C  CE    . LYS A 1  176  ? 86.836  62.578  -31.978 1.00 126.74 ? 176  LYS A CE    1 
ATOM   1346  N  NZ    . LYS A 1  176  ? 85.698  62.213  -31.080 1.00 133.47 ? 176  LYS A NZ    1 
ATOM   1347  N  N     . ASP A 1  177  ? 82.829  65.300  -34.675 1.00 108.02 ? 177  ASP A N     1 
ATOM   1348  C  CA    . ASP A 1  177  ? 81.484  64.982  -34.194 1.00 108.29 ? 177  ASP A CA    1 
ATOM   1349  C  C     . ASP A 1  177  ? 81.462  63.508  -33.751 1.00 109.60 ? 177  ASP A C     1 
ATOM   1350  O  O     . ASP A 1  177  ? 80.558  62.771  -34.144 1.00 109.28 ? 177  ASP A O     1 
ATOM   1351  C  CB    . ASP A 1  177  ? 80.438  65.255  -35.295 1.00 112.39 ? 177  ASP A CB    1 
ATOM   1352  C  CG    . ASP A 1  177  ? 79.032  65.594  -34.798 1.00 132.85 ? 177  ASP A CG    1 
ATOM   1353  O  OD1   . ASP A 1  177  ? 78.457  64.785  -34.021 1.00 133.81 ? 177  ASP A OD1   1 
ATOM   1354  O  OD2   . ASP A 1  177  ? 78.481  66.638  -35.233 1.00 142.90 ? 177  ASP A OD2   1 
ATOM   1355  N  N     . GLY A 1  178  ? 82.476  63.102  -32.964 1.00 104.06 ? 178  GLY A N     1 
ATOM   1356  C  CA    . GLY A 1  178  ? 82.666  61.747  -32.447 1.00 102.02 ? 178  GLY A CA    1 
ATOM   1357  C  C     . GLY A 1  178  ? 82.721  60.697  -33.538 1.00 104.74 ? 178  GLY A C     1 
ATOM   1358  O  O     . GLY A 1  178  ? 81.673  60.182  -33.950 1.00 105.31 ? 178  GLY A O     1 
ATOM   1359  N  N     . LEU A 1  179  ? 83.936  60.391  -34.036 1.00 99.25  ? 179  LEU A N     1 
ATOM   1360  C  CA    . LEU A 1  179  ? 84.204  59.427  -35.129 1.00 99.05  ? 179  LEU A CA    1 
ATOM   1361  C  C     . LEU A 1  179  ? 83.860  59.945  -36.546 1.00 105.29 ? 179  LEU A C     1 
ATOM   1362  O  O     . LEU A 1  179  ? 84.104  59.246  -37.548 1.00 104.40 ? 179  LEU A O     1 
ATOM   1363  C  CB    . LEU A 1  179  ? 83.562  58.033  -34.915 1.00 98.50  ? 179  LEU A CB    1 
ATOM   1364  C  CG    . LEU A 1  179  ? 83.902  57.205  -33.683 1.00 101.14 ? 179  LEU A CG    1 
ATOM   1365  C  CD1   . LEU A 1  179  ? 83.515  55.743  -33.913 1.00 100.50 ? 179  LEU A CD1   1 
ATOM   1366  C  CD2   . LEU A 1  179  ? 85.374  57.311  -33.317 1.00 102.85 ? 179  LEU A CD2   1 
ATOM   1367  N  N     . LYS A 1  180  ? 83.281  61.152  -36.619 1.00 104.14 ? 180  LYS A N     1 
ATOM   1368  C  CA    . LYS A 1  180  ? 82.893  61.781  -37.873 1.00 105.97 ? 180  LYS A CA    1 
ATOM   1369  C  C     . LYS A 1  180  ? 83.586  63.113  -38.002 1.00 113.84 ? 180  LYS A C     1 
ATOM   1370  O  O     . LYS A 1  180  ? 83.761  63.827  -37.009 1.00 113.35 ? 180  LYS A O     1 
ATOM   1371  C  CB    . LYS A 1  180  ? 81.368  61.971  -37.951 1.00 108.73 ? 180  LYS A CB    1 
ATOM   1372  C  CG    . LYS A 1  180  ? 80.574  60.680  -38.122 1.00 118.30 ? 180  LYS A CG    1 
ATOM   1373  C  CD    . LYS A 1  180  ? 80.018  60.520  -39.535 1.00 126.65 ? 180  LYS A CD    1 
ATOM   1374  C  CE    . LYS A 1  180  ? 78.942  59.458  -39.595 1.00 136.12 ? 180  LYS A CE    1 
ATOM   1375  N  NZ    . LYS A 1  180  ? 78.345  59.312  -40.955 1.00 142.14 ? 180  LYS A NZ    1 
ATOM   1376  N  N     . LEU A 1  181  ? 84.000  63.442  -39.222 1.00 113.81 ? 181  LEU A N     1 
ATOM   1377  C  CA    . LEU A 1  181  ? 84.629  64.726  -39.492 1.00 115.49 ? 181  LEU A CA    1 
ATOM   1378  C  C     . LEU A 1  181  ? 83.653  65.548  -40.331 1.00 125.82 ? 181  LEU A C     1 
ATOM   1379  O  O     . LEU A 1  181  ? 83.300  65.148  -41.447 1.00 126.87 ? 181  LEU A O     1 
ATOM   1380  C  CB    . LEU A 1  181  ? 85.995  64.563  -40.189 1.00 114.64 ? 181  LEU A CB    1 
ATOM   1381  C  CG    . LEU A 1  181  ? 87.145  64.005  -39.355 1.00 116.94 ? 181  LEU A CG    1 
ATOM   1382  C  CD1   . LEU A 1  181  ? 88.386  63.873  -40.187 1.00 116.41 ? 181  LEU A CD1   1 
ATOM   1383  C  CD2   . LEU A 1  181  ? 87.453  64.886  -38.161 1.00 119.02 ? 181  LEU A CD2   1 
ATOM   1384  N  N     . VAL A 1  182  ? 83.162  66.657  -39.767 1.00 125.22 ? 182  VAL A N     1 
ATOM   1385  C  CA    . VAL A 1  182  ? 82.201  67.512  -40.454 1.00 127.59 ? 182  VAL A CA    1 
ATOM   1386  C  C     . VAL A 1  182  ? 82.756  68.929  -40.698 1.00 134.98 ? 182  VAL A C     1 
ATOM   1387  O  O     . VAL A 1  182  ? 83.214  69.593  -39.765 1.00 134.44 ? 182  VAL A O     1 
ATOM   1388  C  CB    . VAL A 1  182  ? 80.791  67.451  -39.806 1.00 131.93 ? 182  VAL A CB    1 
ATOM   1389  C  CG1   . VAL A 1  182  ? 80.823  67.781  -38.314 1.00 130.89 ? 182  VAL A CG1   1 
ATOM   1390  C  CG2   . VAL A 1  182  ? 79.789  68.328  -40.548 1.00 133.51 ? 182  VAL A CG2   1 
ATOM   1391  N  N     . GLY A 1  183  ? 82.755  69.339  -41.965 1.00 134.15 ? 183  GLY A N     1 
ATOM   1392  C  CA    . GLY A 1  183  ? 83.276  70.633  -42.389 1.00 135.58 ? 183  GLY A CA    1 
ATOM   1393  C  C     . GLY A 1  183  ? 82.220  71.698  -42.573 1.00 142.89 ? 183  GLY A C     1 
ATOM   1394  O  O     . GLY A 1  183  ? 81.032  71.381  -42.690 1.00 143.19 ? 183  GLY A O     1 
ATOM   1395  N  N     . SER A 1  184  ? 82.660  72.977  -42.627 1.00 141.24 ? 184  SER A N     1 
ATOM   1396  C  CA    . SER A 1  184  ? 81.808  74.161  -42.809 1.00 142.51 ? 184  SER A CA    1 
ATOM   1397  C  C     . SER A 1  184  ? 82.502  75.265  -43.636 1.00 149.19 ? 184  SER A C     1 
ATOM   1398  O  O     . SER A 1  184  ? 83.175  76.154  -43.093 1.00 148.15 ? 184  SER A O     1 
ATOM   1399  C  CB    . SER A 1  184  ? 81.313  74.688  -41.465 1.00 144.34 ? 184  SER A CB    1 
ATOM   1400  O  OG    . SER A 1  184  ? 80.362  75.722  -41.642 1.00 150.41 ? 184  SER A OG    1 
ATOM   1401  N  N     . TRP A 1  185  ? 82.326  75.181  -44.964 1.00 149.01 ? 185  TRP A N     1 
ATOM   1402  C  CA    . TRP A 1  185  ? 82.863  76.098  -45.970 1.00 151.30 ? 185  TRP A CA    1 
ATOM   1403  C  C     . TRP A 1  185  ? 82.052  77.408  -45.925 1.00 160.55 ? 185  TRP A C     1 
ATOM   1404  O  O     . TRP A 1  185  ? 80.824  77.356  -46.027 1.00 160.37 ? 185  TRP A O     1 
ATOM   1405  C  CB    . TRP A 1  185  ? 82.707  75.489  -47.377 1.00 150.52 ? 185  TRP A CB    1 
ATOM   1406  C  CG    . TRP A 1  185  ? 83.376  74.173  -47.649 1.00 150.19 ? 185  TRP A CG    1 
ATOM   1407  C  CD1   . TRP A 1  185  ? 84.354  73.937  -48.571 1.00 153.12 ? 185  TRP A CD1   1 
ATOM   1408  C  CD2   . TRP A 1  185  ? 82.970  72.888  -47.160 1.00 148.90 ? 185  TRP A CD2   1 
ATOM   1409  N  NE1   . TRP A 1  185  ? 84.633  72.593  -48.634 1.00 151.55 ? 185  TRP A NE1   1 
ATOM   1410  C  CE2   . TRP A 1  185  ? 83.796  71.924  -47.780 1.00 152.20 ? 185  TRP A CE2   1 
ATOM   1411  C  CE3   . TRP A 1  185  ? 82.022  72.458  -46.216 1.00 149.56 ? 185  TRP A CE3   1 
ATOM   1412  C  CZ2   . TRP A 1  185  ? 83.715  70.563  -47.471 1.00 150.29 ? 185  TRP A CZ2   1 
ATOM   1413  C  CZ3   . TRP A 1  185  ? 81.956  71.114  -45.899 1.00 149.81 ? 185  TRP A CZ3   1 
ATOM   1414  C  CH2   . TRP A 1  185  ? 82.788  70.182  -46.527 1.00 149.83 ? 185  TRP A CH2   1 
ATOM   1415  N  N     . LYS A 1  186  ? 82.731  78.568  -45.816 1.00 161.17 ? 186  LYS A N     1 
ATOM   1416  C  CA    . LYS A 1  186  ? 82.073  79.872  -45.746 1.00 164.18 ? 186  LYS A CA    1 
ATOM   1417  C  C     . LYS A 1  186  ? 81.230  80.214  -46.969 1.00 176.38 ? 186  LYS A C     1 
ATOM   1418  O  O     . LYS A 1  186  ? 80.078  80.602  -46.783 1.00 177.80 ? 186  LYS A O     1 
ATOM   1419  C  CB    . LYS A 1  186  ? 83.069  80.997  -45.444 1.00 166.26 ? 186  LYS A CB    1 
ATOM   1420  N  N     . LYS A 1  187  ? 81.776  80.021  -48.206 1.00 177.50 ? 187  LYS A N     1 
ATOM   1421  C  CA    . LYS A 1  187  ? 81.191  80.340  -49.540 1.00 180.83 ? 187  LYS A CA    1 
ATOM   1422  C  C     . LYS A 1  187  ? 81.571  81.780  -49.974 1.00 190.13 ? 187  LYS A C     1 
ATOM   1423  O  O     . LYS A 1  187  ? 82.530  82.336  -49.430 1.00 189.55 ? 187  LYS A O     1 
ATOM   1424  C  CB    . LYS A 1  187  ? 79.657  80.100  -49.631 1.00 183.95 ? 187  LYS A CB    1 
ATOM   1425  C  CG    . LYS A 1  187  ? 79.237  78.640  -49.760 1.00 192.43 ? 187  LYS A CG    1 
ATOM   1426  C  CD    . LYS A 1  187  ? 77.751  78.460  -49.451 1.00 195.63 ? 187  LYS A CD    1 
ATOM   1427  C  CE    . LYS A 1  187  ? 77.221  77.149  -49.972 1.00 195.45 ? 187  LYS A CE    1 
ATOM   1428  N  NZ    . LYS A 1  187  ? 75.863  76.859  -49.448 1.00 196.67 ? 187  LYS A NZ    1 
ATOM   1429  N  N     . ASP A 1  188  ? 80.833  82.384  -50.932 1.00 191.00 ? 188  ASP A N     1 
ATOM   1430  C  CA    . ASP A 1  188  ? 81.124  83.745  -51.396 1.00 193.58 ? 188  ASP A CA    1 
ATOM   1431  C  C     . ASP A 1  188  ? 79.891  84.632  -51.537 1.00 202.85 ? 188  ASP A C     1 
ATOM   1432  O  O     . ASP A 1  188  ? 79.913  85.752  -51.032 1.00 202.68 ? 188  ASP A O     1 
ATOM   1433  C  CB    . ASP A 1  188  ? 81.951  83.735  -52.689 1.00 195.96 ? 188  ASP A CB    1 
ATOM   1434  C  CG    . ASP A 1  188  ? 83.367  83.246  -52.488 1.00 203.48 ? 188  ASP A CG    1 
ATOM   1435  O  OD1   . ASP A 1  188  ? 84.221  84.058  -52.076 1.00 203.54 ? 188  ASP A OD1   1 
ATOM   1436  O  OD2   . ASP A 1  188  ? 83.618  82.045  -52.723 1.00 208.40 ? 188  ASP A OD2   1 
ATOM   1437  N  N     . ARG A 1  189  ? 78.833  84.129  -52.228 1.00 203.54 ? 189  ARG A N     1 
ATOM   1438  C  CA    . ARG A 1  189  ? 77.528  84.763  -52.531 1.00 206.50 ? 189  ARG A CA    1 
ATOM   1439  C  C     . ARG A 1  189  ? 77.393  86.292  -52.283 1.00 214.39 ? 189  ARG A C     1 
ATOM   1440  O  O     . ARG A 1  189  ? 77.039  86.711  -51.174 1.00 213.69 ? 189  ARG A O     1 
ATOM   1441  C  CB    . ARG A 1  189  ? 76.345  83.969  -51.929 1.00 206.64 ? 189  ARG A CB    1 
ATOM   1442  C  CG    . ARG A 1  189  ? 76.143  82.571  -52.516 1.00 216.48 ? 189  ARG A CG    1 
ATOM   1443  C  CD    . ARG A 1  189  ? 74.776  82.004  -52.173 1.00 230.04 ? 189  ARG A CD    1 
ATOM   1444  N  NE    . ARG A 1  189  ? 74.663  81.592  -50.769 1.00 241.10 ? 189  ARG A NE    1 
ATOM   1445  C  CZ    . ARG A 1  189  ? 74.718  80.331  -50.346 1.00 252.91 ? 189  ARG A CZ    1 
ATOM   1446  N  NH1   . ARG A 1  189  ? 74.881  79.338  -51.211 1.00 244.67 ? 189  ARG A NH1   1 
ATOM   1447  N  NH2   . ARG A 1  189  ? 74.603  80.054  -49.053 1.00 244.42 ? 189  ARG A NH2   1 
ATOM   1448  N  N     . ALA A 1  190  ? 77.671  87.107  -53.340 1.00 213.90 ? 190  ALA A N     1 
ATOM   1449  C  CA    . ALA A 1  190  ? 77.655  88.585  -53.367 1.00 215.86 ? 190  ALA A CA    1 
ATOM   1450  C  C     . ALA A 1  190  ? 78.593  89.226  -52.309 1.00 220.58 ? 190  ALA A C     1 
ATOM   1451  O  O     . ALA A 1  190  ? 78.183  90.124  -51.565 1.00 220.94 ? 190  ALA A O     1 
ATOM   1452  C  CB    . ALA A 1  190  ? 76.226  89.125  -53.268 1.00 217.95 ? 190  ALA A CB    1 
ATOM   1453  N  N     . THR A 1  191  ? 79.871  88.744  -52.273 1.00 216.86 ? 191  THR A N     1 
ATOM   1454  C  CA    . THR A 1  191  ? 80.995  89.113  -51.380 1.00 215.95 ? 191  THR A CA    1 
ATOM   1455  C  C     . THR A 1  191  ? 80.889  88.637  -49.914 1.00 219.51 ? 191  THR A C     1 
ATOM   1456  O  O     . THR A 1  191  ? 81.919  88.368  -49.288 1.00 217.78 ? 191  THR A O     1 
ATOM   1457  C  CB    . THR A 1  191  ? 81.518  90.562  -51.563 1.00 224.12 ? 191  THR A CB    1 
ATOM   1458  O  OG1   . THR A 1  191  ? 80.483  91.509  -51.302 1.00 225.51 ? 191  THR A OG1   1 
ATOM   1459  C  CG2   . THR A 1  191  ? 82.135  90.805  -52.937 1.00 222.44 ? 191  THR A CG2   1 
ATOM   1460  N  N     . GLY A 1  192  ? 79.661  88.521  -49.404 1.00 217.29 ? 192  GLY A N     1 
ATOM   1461  C  CA    . GLY A 1  192  ? 79.369  88.076  -48.044 1.00 216.28 ? 192  GLY A CA    1 
ATOM   1462  C  C     . GLY A 1  192  ? 79.501  86.577  -47.860 1.00 219.34 ? 192  GLY A C     1 
ATOM   1463  O  O     . GLY A 1  192  ? 80.601  86.041  -48.024 1.00 217.62 ? 192  GLY A O     1 
ATOM   1464  N  N     . ASP A 1  193  ? 78.364  85.906  -47.500 1.00 216.05 ? 193  ASP A N     1 
ATOM   1465  C  CA    . ASP A 1  193  ? 78.138  84.459  -47.254 1.00 214.71 ? 193  ASP A CA    1 
ATOM   1466  C  C     . ASP A 1  193  ? 79.412  83.603  -46.967 1.00 215.20 ? 193  ASP A C     1 
ATOM   1467  O  O     . ASP A 1  193  ? 80.214  83.438  -47.885 1.00 214.85 ? 193  ASP A O     1 
ATOM   1468  C  CB    . ASP A 1  193  ? 77.295  83.851  -48.401 1.00 217.98 ? 193  ASP A CB    1 
ATOM   1469  C  CG    . ASP A 1  193  ? 76.490  82.610  -48.045 1.00 229.83 ? 193  ASP A CG    1 
ATOM   1470  O  OD1   . ASP A 1  193  ? 77.100  81.517  -47.920 1.00 229.24 ? 193  ASP A OD1   1 
ATOM   1471  O  OD2   . ASP A 1  193  ? 75.244  82.714  -47.965 1.00 237.29 ? 193  ASP A OD2   1 
ATOM   1472  N  N     . ALA A 1  194  ? 79.644  83.063  -45.727 1.00 208.66 ? 194  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1  194  ? 78.835  83.062  -44.491 1.00 206.96 ? 194  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1  194  ? 78.756  84.417  -43.751 1.00 208.52 ? 194  ALA A C     1 
ATOM   1475  O  O     . ALA A 1  194  ? 79.777  85.106  -43.701 1.00 208.02 ? 194  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1  194  ? 79.350  81.987  -43.541 1.00 205.82 ? 194  ALA A CB    1 
ATOM   1477  N  N     . ASP A 1  195  ? 77.593  84.833  -43.150 1.00 203.12 ? 195  ASP A N     1 
ATOM   1478  C  CA    . ASP A 1  195  ? 76.214  84.291  -43.000 1.00 201.58 ? 195  ASP A CA    1 
ATOM   1479  C  C     . ASP A 1  195  ? 75.774  82.943  -43.636 1.00 201.78 ? 195  ASP A C     1 
ATOM   1480  O  O     . ASP A 1  195  ? 75.673  82.838  -44.862 1.00 202.50 ? 195  ASP A O     1 
ATOM   1481  C  CB    . ASP A 1  195  ? 75.166  85.391  -43.264 1.00 204.70 ? 195  ASP A CB    1 
ATOM   1482  C  CG    . ASP A 1  195  ? 75.271  86.569  -42.320 1.00 210.98 ? 195  ASP A CG    1 
ATOM   1483  O  OD1   . ASP A 1  195  ? 74.727  86.481  -41.198 1.00 214.67 ? 195  ASP A OD1   1 
ATOM   1484  O  OD2   . ASP A 1  195  ? 75.910  87.572  -42.696 1.00 211.62 ? 195  ASP A OD2   1 
ATOM   1485  N  N     . GLU A 1  196  ? 75.407  81.961  -42.774 1.00 194.10 ? 196  GLU A N     1 
ATOM   1486  C  CA    . GLU A 1  196  ? 74.956  80.594  -43.104 1.00 191.83 ? 196  GLU A CA    1 
ATOM   1487  C  C     . GLU A 1  196  ? 75.823  79.799  -44.110 1.00 191.38 ? 196  GLU A C     1 
ATOM   1488  O  O     . GLU A 1  196  ? 75.621  79.869  -45.329 1.00 191.81 ? 196  GLU A O     1 
ATOM   1489  C  CB    . GLU A 1  196  ? 73.423  80.418  -43.294 1.00 194.15 ? 196  GLU A CB    1 
ATOM   1490  C  CG    . GLU A 1  196  ? 72.673  81.484  -44.087 1.00 206.59 ? 196  GLU A CG    1 
ATOM   1491  C  CD    . GLU A 1  196  ? 72.802  81.473  -45.600 1.00 226.91 ? 196  GLU A CD    1 
ATOM   1492  O  OE1   . GLU A 1  196  ? 72.812  80.374  -46.201 1.00 219.19 ? 196  GLU A OE1   1 
ATOM   1493  O  OE2   . GLU A 1  196  ? 72.843  82.576  -46.192 1.00 221.75 ? 196  GLU A OE2   1 
ATOM   1494  N  N     . PRO A 1  197  ? 76.808  79.033  -43.590 1.00 183.29 ? 197  PRO A N     1 
ATOM   1495  C  CA    . PRO A 1  197  ? 77.684  78.260  -44.479 1.00 181.20 ? 197  PRO A CA    1 
ATOM   1496  C  C     . PRO A 1  197  ? 77.155  76.854  -44.782 1.00 180.43 ? 197  PRO A C     1 
ATOM   1497  O  O     . PRO A 1  197  ? 76.217  76.383  -44.125 1.00 179.80 ? 197  PRO A O     1 
ATOM   1498  C  CB    . PRO A 1  197  ? 79.009  78.223  -43.706 1.00 181.72 ? 197  PRO A CB    1 
ATOM   1499  C  CG    . PRO A 1  197  ? 78.658  78.525  -42.271 1.00 186.03 ? 197  PRO A CG    1 
ATOM   1500  C  CD    . PRO A 1  197  ? 77.199  78.849  -42.178 1.00 183.01 ? 197  PRO A CD    1 
ATOM   1501  N  N     . GLU A 1  198  ? 77.768  76.187  -45.785 1.00 173.16 ? 198  GLU A N     1 
ATOM   1502  C  CA    . GLU A 1  198  ? 77.447  74.822  -46.227 1.00 170.35 ? 198  GLU A CA    1 
ATOM   1503  C  C     . GLU A 1  198  ? 78.000  73.813  -45.203 1.00 165.32 ? 198  GLU A C     1 
ATOM   1504  O  O     . GLU A 1  198  ? 79.214  73.769  -44.977 1.00 163.99 ? 198  GLU A O     1 
ATOM   1505  C  CB    . GLU A 1  198  ? 78.049  74.576  -47.628 1.00 172.45 ? 198  GLU A CB    1 
ATOM   1506  C  CG    . GLU A 1  198  ? 77.671  73.262  -48.296 1.00 184.57 ? 198  GLU A CG    1 
ATOM   1507  C  CD    . GLU A 1  198  ? 78.342  73.029  -49.638 1.00 206.95 ? 198  GLU A CD    1 
ATOM   1508  O  OE1   . GLU A 1  198  ? 78.140  73.859  -50.556 1.00 203.86 ? 198  GLU A OE1   1 
ATOM   1509  O  OE2   . GLU A 1  198  ? 79.077  72.021  -49.771 1.00 192.51 ? 198  GLU A OE2   1 
ATOM   1510  N  N     . LEU A 1  199  ? 77.113  73.026  -44.573 1.00 155.71 ? 199  LEU A N     1 
ATOM   1511  C  CA    . LEU A 1  199  ? 77.526  72.046  -43.570 1.00 151.28 ? 199  LEU A CA    1 
ATOM   1512  C  C     . LEU A 1  199  ? 77.278  70.612  -43.993 1.00 148.32 ? 199  LEU A C     1 
ATOM   1513  O  O     . LEU A 1  199  ? 76.126  70.192  -44.126 1.00 148.56 ? 199  LEU A O     1 
ATOM   1514  C  CB    . LEU A 1  199  ? 76.901  72.343  -42.208 1.00 150.95 ? 199  LEU A CB    1 
ATOM   1515  C  CG    . LEU A 1  199  ? 77.671  73.344  -41.379 1.00 155.42 ? 199  LEU A CG    1 
ATOM   1516  C  CD1   . LEU A 1  199  ? 76.781  74.487  -40.947 1.00 156.57 ? 199  LEU A CD1   1 
ATOM   1517  C  CD2   . LEU A 1  199  ? 78.364  72.666  -40.206 1.00 156.47 ? 199  LEU A CD2   1 
ATOM   1518  N  N     . ARG A 1  200  ? 78.373  69.864  -44.217 1.00 138.81 ? 200  ARG A N     1 
ATOM   1519  C  CA    . ARG A 1  200  ? 78.336  68.463  -44.640 1.00 135.62 ? 200  ARG A CA    1 
ATOM   1520  C  C     . ARG A 1  200  ? 79.481  67.642  -44.108 1.00 132.77 ? 200  ARG A C     1 
ATOM   1521  O  O     . ARG A 1  200  ? 80.605  68.135  -43.962 1.00 132.01 ? 200  ARG A O     1 
ATOM   1522  C  CB    . ARG A 1  200  ? 78.258  68.318  -46.165 1.00 135.94 ? 200  ARG A CB    1 
ATOM   1523  C  CG    . ARG A 1  200  ? 79.318  69.094  -46.938 1.00 142.12 ? 200  ARG A CG    1 
ATOM   1524  C  CD    . ARG A 1  200  ? 79.391  68.654  -48.376 1.00 143.51 ? 200  ARG A CD    1 
ATOM   1525  N  NE    . ARG A 1  200  ? 79.987  67.329  -48.469 1.00 139.16 ? 200  ARG A NE    1 
ATOM   1526  C  CZ    . ARG A 1  200  ? 81.256  67.106  -48.774 1.00 148.10 ? 200  ARG A CZ    1 
ATOM   1527  N  NH1   . ARG A 1  200  ? 82.066  68.119  -49.055 1.00 131.12 ? 200  ARG A NH1   1 
ATOM   1528  N  NH2   . ARG A 1  200  ? 81.720  65.870  -48.834 1.00 134.64 ? 200  ARG A NH2   1 
ATOM   1529  N  N     . VAL A 1  201  ? 79.188  66.371  -43.843 1.00 124.18 ? 201  VAL A N     1 
ATOM   1530  C  CA    . VAL A 1  201  ? 80.165  65.430  -43.345 1.00 120.49 ? 201  VAL A CA    1 
ATOM   1531  C  C     . VAL A 1  201  ? 81.113  65.041  -44.461 1.00 120.65 ? 201  VAL A C     1 
ATOM   1532  O  O     . VAL A 1  201  ? 80.708  64.895  -45.616 1.00 121.31 ? 201  VAL A O     1 
ATOM   1533  C  CB    . VAL A 1  201  ? 79.496  64.218  -42.663 1.00 123.48 ? 201  VAL A CB    1 
ATOM   1534  C  CG1   . VAL A 1  201  ? 78.971  63.200  -43.676 1.00 123.63 ? 201  VAL A CG1   1 
ATOM   1535  C  CG2   . VAL A 1  201  ? 80.442  63.560  -41.671 1.00 122.11 ? 201  VAL A CG2   1 
ATOM   1536  N  N     . LEU A 1  202  ? 82.379  64.917  -44.114 1.00 113.64 ? 202  LEU A N     1 
ATOM   1537  C  CA    . LEU A 1  202  ? 83.417  64.514  -45.045 1.00 112.43 ? 202  LEU A CA    1 
ATOM   1538  C  C     . LEU A 1  202  ? 83.541  63.001  -44.930 1.00 114.78 ? 202  LEU A C     1 
ATOM   1539  O  O     . LEU A 1  202  ? 83.807  62.486  -43.832 1.00 114.05 ? 202  LEU A O     1 
ATOM   1540  C  CB    . LEU A 1  202  ? 84.739  65.196  -44.672 1.00 111.75 ? 202  LEU A CB    1 
ATOM   1541  C  CG    . LEU A 1  202  ? 84.733  66.716  -44.637 1.00 116.68 ? 202  LEU A CG    1 
ATOM   1542  C  CD1   . LEU A 1  202  ? 85.858  67.240  -43.768 1.00 115.56 ? 202  LEU A CD1   1 
ATOM   1543  C  CD2   . LEU A 1  202  ? 84.806  67.285  -46.037 1.00 119.84 ? 202  LEU A CD2   1 
ATOM   1544  N  N     . SER A 1  203  ? 83.297  62.286  -46.045 1.00 110.39 ? 203  SER A N     1 
ATOM   1545  C  CA    . SER A 1  203  ? 83.337  60.821  -46.102 1.00 109.02 ? 203  SER A CA    1 
ATOM   1546  C  C     . SER A 1  203  ? 84.734  60.254  -45.922 1.00 112.20 ? 203  SER A C     1 
ATOM   1547  O  O     . SER A 1  203  ? 85.714  60.877  -46.352 1.00 112.15 ? 203  SER A O     1 
ATOM   1548  C  CB    . SER A 1  203  ? 82.770  60.326  -47.426 1.00 112.87 ? 203  SER A CB    1 
ATOM   1549  O  OG    . SER A 1  203  ? 83.755  60.298  -48.447 1.00 120.59 ? 203  SER A OG    1 
ATOM   1550  N  N     . THR A 1  204  ? 84.819  59.036  -45.358 1.00 107.44 ? 204  THR A N     1 
ATOM   1551  C  CA    . THR A 1  204  ? 86.093  58.344  -45.189 1.00 106.36 ? 204  THR A CA    1 
ATOM   1552  C  C     . THR A 1  204  ? 86.788  58.239  -46.537 1.00 111.70 ? 204  THR A C     1 
ATOM   1553  O  O     . THR A 1  204  ? 87.952  58.625  -46.641 1.00 112.08 ? 204  THR A O     1 
ATOM   1554  C  CB    . THR A 1  204  ? 85.899  56.961  -44.615 1.00 113.85 ? 204  THR A CB    1 
ATOM   1555  O  OG1   . THR A 1  204  ? 84.534  56.782  -44.245 1.00 117.45 ? 204  THR A OG1   1 
ATOM   1556  C  CG2   . THR A 1  204  ? 86.818  56.698  -43.456 1.00 110.94 ? 204  THR A CG2   1 
ATOM   1557  N  N     . GLU A 1  205  ? 86.050  57.798  -47.582 1.00 108.26 ? 205  GLU A N     1 
ATOM   1558  C  CA    . GLU A 1  205  ? 86.568  57.666  -48.947 1.00 108.31 ? 205  GLU A CA    1 
ATOM   1559  C  C     . GLU A 1  205  ? 87.025  58.973  -49.595 1.00 111.54 ? 205  GLU A C     1 
ATOM   1560  O  O     . GLU A 1  205  ? 88.007  58.942  -50.354 1.00 111.46 ? 205  GLU A O     1 
ATOM   1561  C  CB    . GLU A 1  205  ? 85.650  56.839  -49.873 1.00 110.45 ? 205  GLU A CB    1 
ATOM   1562  C  CG    . GLU A 1  205  ? 84.175  57.177  -49.787 1.00 123.88 ? 205  GLU A CG    1 
ATOM   1563  C  CD    . GLU A 1  205  ? 83.353  56.175  -48.999 1.00 151.54 ? 205  GLU A CD    1 
ATOM   1564  O  OE1   . GLU A 1  205  ? 83.348  56.252  -47.746 1.00 146.54 ? 205  GLU A OE1   1 
ATOM   1565  O  OE2   . GLU A 1  205  ? 82.702  55.317  -49.641 1.00 147.36 ? 205  GLU A OE2   1 
ATOM   1566  N  N     . GLU A 1  206  ? 86.353  60.118  -49.296 1.00 107.00 ? 206  GLU A N     1 
ATOM   1567  C  CA    . GLU A 1  206  ? 86.786  61.389  -49.891 1.00 107.18 ? 206  GLU A CA    1 
ATOM   1568  C  C     . GLU A 1  206  ? 88.112  61.856  -49.302 1.00 107.45 ? 206  GLU A C     1 
ATOM   1569  O  O     . GLU A 1  206  ? 89.017  62.226  -50.067 1.00 107.20 ? 206  GLU A O     1 
ATOM   1570  C  CB    . GLU A 1  206  ? 85.684  62.475  -49.953 1.00 109.86 ? 206  GLU A CB    1 
ATOM   1571  C  CG    . GLU A 1  206  ? 85.395  63.246  -48.675 1.00 122.08 ? 206  GLU A CG    1 
ATOM   1572  C  CD    . GLU A 1  206  ? 84.203  64.182  -48.763 1.00 142.54 ? 206  GLU A CD    1 
ATOM   1573  O  OE1   . GLU A 1  206  ? 83.065  63.720  -48.513 1.00 139.46 ? 206  GLU A OE1   1 
ATOM   1574  O  OE2   . GLU A 1  206  ? 84.404  65.382  -49.061 1.00 128.56 ? 206  GLU A OE2   1 
ATOM   1575  N  N     . ILE A 1  207  ? 88.251  61.719  -47.947 1.00 100.00 ? 207  ILE A N     1 
ATOM   1576  C  CA    . ILE A 1  207  ? 89.465  62.030  -47.176 1.00 97.02  ? 207  ILE A CA    1 
ATOM   1577  C  C     . ILE A 1  207  ? 90.577  61.106  -47.675 1.00 99.14  ? 207  ILE A C     1 
ATOM   1578  O  O     . ILE A 1  207  ? 91.681  61.588  -47.928 1.00 99.00  ? 207  ILE A O     1 
ATOM   1579  C  CB    . ILE A 1  207  ? 89.228  61.944  -45.636 1.00 97.68  ? 207  ILE A CB    1 
ATOM   1580  C  CG1   . ILE A 1  207  ? 88.252  63.039  -45.176 1.00 97.62  ? 207  ILE A CG1   1 
ATOM   1581  C  CG2   . ILE A 1  207  ? 90.546  62.033  -44.849 1.00 96.10  ? 207  ILE A CG2   1 
ATOM   1582  C  CD1   . ILE A 1  207  ? 87.432  62.675  -44.039 1.00 99.06  ? 207  ILE A CD1   1 
ATOM   1583  N  N     . LEU A 1  208  ? 90.249  59.806  -47.900 1.00 94.20  ? 208  LEU A N     1 
ATOM   1584  C  CA    . LEU A 1  208  ? 91.152  58.786  -48.444 1.00 93.34  ? 208  LEU A CA    1 
ATOM   1585  C  C     . LEU A 1  208  ? 91.700  59.241  -49.787 1.00 101.10 ? 208  LEU A C     1 
ATOM   1586  O  O     . LEU A 1  208  ? 92.916  59.190  -49.990 1.00 100.67 ? 208  LEU A O     1 
ATOM   1587  C  CB    . LEU A 1  208  ? 90.413  57.457  -48.653 1.00 92.46  ? 208  LEU A CB    1 
ATOM   1588  C  CG    . LEU A 1  208  ? 91.155  56.170  -48.322 1.00 94.77  ? 208  LEU A CG    1 
ATOM   1589  C  CD1   . LEU A 1  208  ? 90.305  54.980  -48.630 1.00 94.58  ? 208  LEU A CD1   1 
ATOM   1590  C  CD2   . LEU A 1  208  ? 92.446  56.042  -49.072 1.00 96.04  ? 208  LEU A CD2   1 
ATOM   1591  N  N     . ASN A 1  209  ? 90.808  59.692  -50.695 1.00 100.33 ? 209  ASN A N     1 
ATOM   1592  C  CA    . ASN A 1  209  ? 91.218  60.156  -52.013 1.00 101.90 ? 209  ASN A CA    1 
ATOM   1593  C  C     . ASN A 1  209  ? 92.093  61.411  -51.989 1.00 105.97 ? 209  ASN A C     1 
ATOM   1594  O  O     . ASN A 1  209  ? 92.975  61.548  -52.843 1.00 105.95 ? 209  ASN A O     1 
ATOM   1595  C  CB    . ASN A 1  209  ? 90.042  60.320  -52.950 1.00 105.48 ? 209  ASN A CB    1 
ATOM   1596  C  CG    . ASN A 1  209  ? 90.498  60.345  -54.384 1.00 129.68 ? 209  ASN A CG    1 
ATOM   1597  O  OD1   . ASN A 1  209  ? 90.284  61.325  -55.107 1.00 126.71 ? 209  ASN A OD1   1 
ATOM   1598  N  ND2   . ASN A 1  209  ? 91.239  59.310  -54.790 1.00 118.06 ? 209  ASN A ND2   1 
ATOM   1599  N  N     . ILE A 1  210  ? 91.862  62.312  -51.014 1.00 101.83 ? 210  ILE A N     1 
ATOM   1600  C  CA    . ILE A 1  210  ? 92.681  63.514  -50.861 1.00 101.81 ? 210  ILE A CA    1 
ATOM   1601  C  C     . ILE A 1  210  ? 94.057  63.084  -50.369 1.00 105.05 ? 210  ILE A C     1 
ATOM   1602  O  O     . ILE A 1  210  ? 95.068  63.509  -50.931 1.00 105.53 ? 210  ILE A O     1 
ATOM   1603  C  CB    . ILE A 1  210  ? 92.016  64.589  -49.958 1.00 104.94 ? 210  ILE A CB    1 
ATOM   1604  C  CG1   . ILE A 1  210  ? 90.608  65.006  -50.469 1.00 107.16 ? 210  ILE A CG1   1 
ATOM   1605  C  CG2   . ILE A 1  210  ? 92.918  65.807  -49.754 1.00 104.73 ? 210  ILE A CG2   1 
ATOM   1606  C  CD1   . ILE A 1  210  ? 90.424  65.310  -52.014 1.00 117.51 ? 210  ILE A CD1   1 
ATOM   1607  N  N     . PHE A 1  211  ? 94.085  62.176  -49.378 1.00 100.11 ? 211  PHE A N     1 
ATOM   1608  C  CA    . PHE A 1  211  ? 95.311  61.620  -48.815 1.00 98.70  ? 211  PHE A CA    1 
ATOM   1609  C  C     . PHE A 1  211  ? 96.071  60.856  -49.879 1.00 104.33 ? 211  PHE A C     1 
ATOM   1610  O  O     . PHE A 1  211  ? 97.293  60.991  -49.962 1.00 104.44 ? 211  PHE A O     1 
ATOM   1611  C  CB    . PHE A 1  211  ? 95.017  60.736  -47.590 1.00 98.85  ? 211  PHE A CB    1 
ATOM   1612  C  CG    . PHE A 1  211  ? 94.679  61.468  -46.307 1.00 99.78  ? 211  PHE A CG    1 
ATOM   1613  C  CD1   . PHE A 1  211  ? 94.351  62.823  -46.318 1.00 103.53 ? 211  PHE A CD1   1 
ATOM   1614  C  CD2   . PHE A 1  211  ? 94.674  60.803  -45.091 1.00 100.79 ? 211  PHE A CD2   1 
ATOM   1615  C  CE1   . PHE A 1  211  ? 94.022  63.494  -45.134 1.00 103.89 ? 211  PHE A CE1   1 
ATOM   1616  C  CE2   . PHE A 1  211  ? 94.349  61.479  -43.906 1.00 103.27 ? 211  PHE A CE2   1 
ATOM   1617  C  CZ    . PHE A 1  211  ? 94.028  62.820  -43.937 1.00 101.88 ? 211  PHE A CZ    1 
ATOM   1618  N  N     . LYS A 1  212  ? 95.347  60.121  -50.746 1.00 101.94 ? 212  LYS A N     1 
ATOM   1619  C  CA    . LYS A 1  212  ? 95.952  59.372  -51.844 1.00 102.85 ? 212  LYS A CA    1 
ATOM   1620  C  C     . LYS A 1  212  ? 96.684  60.299  -52.816 1.00 111.26 ? 212  LYS A C     1 
ATOM   1621  O  O     . LYS A 1  212  ? 97.751  59.944  -53.321 1.00 111.43 ? 212  LYS A O     1 
ATOM   1622  C  CB    . LYS A 1  212  ? 94.904  58.516  -52.557 1.00 105.25 ? 212  LYS A CB    1 
ATOM   1623  C  CG    . LYS A 1  212  ? 94.751  57.139  -51.920 1.00 114.02 ? 212  LYS A CG    1 
ATOM   1624  C  CD    . LYS A 1  212  ? 93.631  56.333  -52.556 1.00 121.59 ? 212  LYS A CD    1 
ATOM   1625  C  CE    . LYS A 1  212  ? 93.802  54.853  -52.324 1.00 124.67 ? 212  LYS A CE    1 
ATOM   1626  N  NZ    . LYS A 1  212  ? 92.530  54.122  -52.550 1.00 133.88 ? 212  LYS A NZ    1 
ATOM   1627  N  N     . HIS A 1  213  ? 96.147  61.520  -52.993 1.00 110.55 ? 213  HIS A N     1 
ATOM   1628  C  CA    . HIS A 1  213  ? 96.671  62.561  -53.871 1.00 111.99 ? 213  HIS A CA    1 
ATOM   1629  C  C     . HIS A 1  213  ? 97.727  63.474  -53.259 1.00 114.15 ? 213  HIS A C     1 
ATOM   1630  O  O     . HIS A 1  213  ? 98.304  64.289  -53.978 1.00 114.41 ? 213  HIS A O     1 
ATOM   1631  C  CB    . HIS A 1  213  ? 95.515  63.359  -54.484 1.00 114.71 ? 213  HIS A CB    1 
ATOM   1632  C  CG    . HIS A 1  213  ? 94.732  62.595  -55.507 1.00 119.40 ? 213  HIS A CG    1 
ATOM   1633  N  ND1   . HIS A 1  213  ? 94.987  61.255  -55.769 1.00 120.85 ? 213  HIS A ND1   1 
ATOM   1634  C  CD2   . HIS A 1  213  ? 93.733  63.017  -56.316 1.00 123.08 ? 213  HIS A CD2   1 
ATOM   1635  C  CE1   . HIS A 1  213  ? 94.138  60.910  -56.721 1.00 121.70 ? 213  HIS A CE1   1 
ATOM   1636  N  NE2   . HIS A 1  213  ? 93.361  61.937  -57.083 1.00 123.29 ? 213  HIS A NE2   1 
ATOM   1637  N  N     . ILE A 1  214  ? 98.001  63.339  -51.952 1.00 109.48 ? 214  ILE A N     1 
ATOM   1638  C  CA    . ILE A 1  214  ? 99.055  64.130  -51.307 1.00 109.23 ? 214  ILE A CA    1 
ATOM   1639  C  C     . ILE A 1  214  ? 100.404 63.591  -51.827 1.00 114.69 ? 214  ILE A C     1 
ATOM   1640  O  O     . ILE A 1  214  ? 100.672 62.381  -51.721 1.00 113.53 ? 214  ILE A O     1 
ATOM   1641  C  CB    . ILE A 1  214  ? 98.968  64.140  -49.748 1.00 110.62 ? 214  ILE A CB    1 
ATOM   1642  C  CG1   . ILE A 1  214  ? 97.609  64.677  -49.256 1.00 110.69 ? 214  ILE A CG1   1 
ATOM   1643  C  CG2   . ILE A 1  214  ? 100.124 64.947  -49.144 1.00 110.83 ? 214  ILE A CG2   1 
ATOM   1644  C  CD1   . ILE A 1  214  ? 97.317  64.497  -47.773 1.00 111.50 ? 214  ILE A CD1   1 
ATOM   1645  N  N     . SER A 1  215  ? 101.212 64.490  -52.441 1.00 112.81 ? 215  SER A N     1 
ATOM   1646  C  CA    . SER A 1  215  ? 102.516 64.177  -53.043 1.00 112.99 ? 215  SER A CA    1 
ATOM   1647  C  C     . SER A 1  215  ? 103.495 63.625  -52.033 1.00 113.81 ? 215  SER A C     1 
ATOM   1648  O  O     . SER A 1  215  ? 103.434 64.028  -50.873 1.00 112.70 ? 215  SER A O     1 
ATOM   1649  C  CB    . SER A 1  215  ? 103.106 65.416  -53.709 1.00 119.99 ? 215  SER A CB    1 
ATOM   1650  O  OG    . SER A 1  215  ? 104.260 65.896  -53.033 1.00 132.74 ? 215  SER A OG    1 
ATOM   1651  N  N     . VAL A 1  216  ? 104.425 62.746  -52.477 1.00 109.16 ? 216  VAL A N     1 
ATOM   1652  C  CA    . VAL A 1  216  ? 105.441 62.137  -51.600 1.00 107.31 ? 216  VAL A CA    1 
ATOM   1653  C  C     . VAL A 1  216  ? 106.233 63.213  -50.870 1.00 110.21 ? 216  VAL A C     1 
ATOM   1654  O  O     . VAL A 1  216  ? 106.361 63.137  -49.646 1.00 108.32 ? 216  VAL A O     1 
ATOM   1655  C  CB    . VAL A 1  216  ? 106.349 61.106  -52.321 1.00 110.84 ? 216  VAL A CB    1 
ATOM   1656  C  CG1   . VAL A 1  216  ? 107.519 60.677  -51.442 1.00 109.18 ? 216  VAL A CG1   1 
ATOM   1657  C  CG2   . VAL A 1  216  ? 105.549 59.888  -52.764 1.00 110.67 ? 216  VAL A CG2   1 
ATOM   1658  N  N     . LYS A 1  217  ? 106.678 64.248  -51.622 1.00 107.53 ? 217  LYS A N     1 
ATOM   1659  C  CA    . LYS A 1  217  ? 107.437 65.407  -51.139 1.00 107.22 ? 217  LYS A CA    1 
ATOM   1660  C  C     . LYS A 1  217  ? 106.668 66.158  -50.046 1.00 109.66 ? 217  LYS A C     1 
ATOM   1661  O  O     . LYS A 1  217  ? 107.257 66.520  -49.020 1.00 108.02 ? 217  LYS A O     1 
ATOM   1662  C  CB    . LYS A 1  217  ? 107.785 66.355  -52.312 1.00 111.28 ? 217  LYS A CB    1 
ATOM   1663  C  CG    . LYS A 1  217  ? 108.523 65.701  -53.494 1.00 132.51 ? 217  LYS A CG    1 
ATOM   1664  C  CD    . LYS A 1  217  ? 109.935 65.180  -53.137 1.00 146.93 ? 217  LYS A CD    1 
ATOM   1665  C  CE    . LYS A 1  217  ? 110.986 65.473  -54.193 1.00 160.91 ? 217  LYS A CE    1 
ATOM   1666  N  NZ    . LYS A 1  217  ? 111.493 66.877  -54.138 1.00 165.74 ? 217  LYS A NZ    1 
ATOM   1667  N  N     . ASP A 1  218  ? 105.343 66.346  -50.271 1.00 106.19 ? 218  ASP A N     1 
ATOM   1668  C  CA    . ASP A 1  218  ? 104.394 67.020  -49.384 1.00 105.67 ? 218  ASP A CA    1 
ATOM   1669  C  C     . ASP A 1  218  ? 104.205 66.232  -48.072 1.00 105.59 ? 218  ASP A C     1 
ATOM   1670  O  O     . ASP A 1  218  ? 104.476 66.766  -46.992 1.00 104.03 ? 218  ASP A O     1 
ATOM   1671  C  CB    . ASP A 1  218  ? 103.022 67.202  -50.093 1.00 109.24 ? 218  ASP A CB    1 
ATOM   1672  C  CG    . ASP A 1  218  ? 102.834 68.371  -51.061 1.00 127.53 ? 218  ASP A CG    1 
ATOM   1673  O  OD1   . ASP A 1  218  ? 103.855 68.948  -51.513 1.00 130.13 ? 218  ASP A OD1   1 
ATOM   1674  O  OD2   . ASP A 1  218  ? 101.657 68.672  -51.413 1.00 133.76 ? 218  ASP A OD2   1 
ATOM   1675  N  N     . PHE A 1  219  ? 103.734 64.965  -48.160 1.00 100.16 ? 219  PHE A N     1 
ATOM   1676  C  CA    . PHE A 1  219  ? 103.506 64.170  -46.955 1.00 97.80  ? 219  PHE A CA    1 
ATOM   1677  C  C     . PHE A 1  219  ? 104.751 63.916  -46.183 1.00 100.55 ? 219  PHE A C     1 
ATOM   1678  O  O     . PHE A 1  219  ? 104.674 63.779  -44.966 1.00 99.23  ? 219  PHE A O     1 
ATOM   1679  C  CB    . PHE A 1  219  ? 102.666 62.899  -47.173 1.00 98.66  ? 219  PHE A CB    1 
ATOM   1680  C  CG    . PHE A 1  219  ? 103.230 61.732  -47.951 1.00 99.15  ? 219  PHE A CG    1 
ATOM   1681  C  CD1   . PHE A 1  219  ? 104.338 61.040  -47.491 1.00 100.61 ? 219  PHE A CD1   1 
ATOM   1682  C  CD2   . PHE A 1  219  ? 102.561 61.230  -49.058 1.00 101.70 ? 219  PHE A CD2   1 
ATOM   1683  C  CE1   . PHE A 1  219  ? 104.831 59.939  -48.185 1.00 101.15 ? 219  PHE A CE1   1 
ATOM   1684  C  CE2   . PHE A 1  219  ? 103.045 60.115  -49.742 1.00 104.03 ? 219  PHE A CE2   1 
ATOM   1685  C  CZ    . PHE A 1  219  ? 104.176 59.475  -49.300 1.00 100.81 ? 219  PHE A CZ    1 
ATOM   1686  N  N     . THR A 1  220  ? 105.904 63.895  -46.878 1.00 97.46  ? 220  THR A N     1 
ATOM   1687  C  CA    . THR A 1  220  ? 107.199 63.720  -46.244 1.00 97.12  ? 220  THR A CA    1 
ATOM   1688  C  C     . THR A 1  220  ? 107.570 64.972  -45.452 1.00 103.25 ? 220  THR A C     1 
ATOM   1689  O  O     . THR A 1  220  ? 108.307 64.853  -44.471 1.00 102.77 ? 220  THR A O     1 
ATOM   1690  C  CB    . THR A 1  220  ? 108.243 63.193  -47.228 1.00 104.72 ? 220  THR A CB    1 
ATOM   1691  O  OG1   . THR A 1  220  ? 108.773 61.966  -46.733 1.00 100.03 ? 220  THR A OG1   1 
ATOM   1692  C  CG2   . THR A 1  220  ? 109.365 64.198  -47.531 1.00 107.38 ? 220  THR A CG2   1 
ATOM   1693  N  N     . SER A 1  221  ? 107.031 66.160  -45.847 1.00 101.42 ? 221  SER A N     1 
ATOM   1694  C  CA    . SER A 1  221  ? 107.252 67.420  -45.126 1.00 101.57 ? 221  SER A CA    1 
ATOM   1695  C  C     . SER A 1  221  ? 106.502 67.346  -43.795 1.00 104.20 ? 221  SER A C     1 
ATOM   1696  O  O     . SER A 1  221  ? 107.019 67.775  -42.764 1.00 103.02 ? 221  SER A O     1 
ATOM   1697  C  CB    . SER A 1  221  ? 106.818 68.617  -45.963 1.00 106.78 ? 221  SER A CB    1 
ATOM   1698  O  OG    . SER A 1  221  ? 107.637 68.724  -47.117 1.00 116.21 ? 221  SER A OG    1 
ATOM   1699  N  N     . LEU A 1  222  ? 105.333 66.691  -43.812 1.00 100.54 ? 222  LEU A N     1 
ATOM   1700  C  CA    . LEU A 1  222  ? 104.544 66.359  -42.626 1.00 99.39  ? 222  LEU A CA    1 
ATOM   1701  C  C     . LEU A 1  222  ? 105.202 65.064  -42.051 1.00 104.54 ? 222  LEU A C     1 
ATOM   1702  O  O     . LEU A 1  222  ? 106.073 64.489  -42.707 1.00 104.11 ? 222  LEU A O     1 
ATOM   1703  C  CB    . LEU A 1  222  ? 103.098 66.103  -43.060 1.00 99.15  ? 222  LEU A CB    1 
ATOM   1704  C  CG    . LEU A 1  222  ? 102.469 67.166  -43.956 1.00 103.24 ? 222  LEU A CG    1 
ATOM   1705  C  CD1   . LEU A 1  222  ? 101.516 66.539  -44.923 1.00 103.29 ? 222  LEU A CD1   1 
ATOM   1706  C  CD2   . LEU A 1  222  ? 101.779 68.237  -43.138 1.00 104.37 ? 222  LEU A CD2   1 
ATOM   1707  N  N     . GLY A 1  223  ? 104.813 64.617  -40.857 1.00 102.10 ? 223  GLY A N     1 
ATOM   1708  C  CA    . GLY A 1  223  ? 105.434 63.456  -40.194 1.00 101.81 ? 223  GLY A CA    1 
ATOM   1709  C  C     . GLY A 1  223  ? 105.768 62.165  -40.957 1.00 105.48 ? 223  GLY A C     1 
ATOM   1710  O  O     . GLY A 1  223  ? 106.637 61.393  -40.532 1.00 104.47 ? 223  GLY A O     1 
ATOM   1711  N  N     . PHE A 1  224  ? 105.098 61.942  -42.103 1.00 100.84 ? 224  PHE A N     1 
ATOM   1712  C  CA    . PHE A 1  224  ? 105.061 60.739  -42.945 1.00 98.53  ? 224  PHE A CA    1 
ATOM   1713  C  C     . PHE A 1  224  ? 106.338 60.223  -43.562 1.00 98.67  ? 224  PHE A C     1 
ATOM   1714  O  O     . PHE A 1  224  ? 107.349 60.914  -43.541 1.00 97.81  ? 224  PHE A O     1 
ATOM   1715  C  CB    . PHE A 1  224  ? 103.857 60.797  -43.909 1.00 100.68 ? 224  PHE A CB    1 
ATOM   1716  C  CG    . PHE A 1  224  ? 102.622 61.052  -43.085 1.00 101.70 ? 224  PHE A CG    1 
ATOM   1717  C  CD1   . PHE A 1  224  ? 102.273 62.344  -42.711 1.00 104.54 ? 224  PHE A CD1   1 
ATOM   1718  C  CD2   . PHE A 1  224  ? 101.912 59.998  -42.532 1.00 103.79 ? 224  PHE A CD2   1 
ATOM   1719  C  CE1   . PHE A 1  224  ? 101.213 62.574  -41.832 1.00 107.27 ? 224  PHE A CE1   1 
ATOM   1720  C  CE2   . PHE A 1  224  ? 100.830 60.232  -41.680 1.00 104.70 ? 224  PHE A CE2   1 
ATOM   1721  C  CZ    . PHE A 1  224  ? 100.488 61.517  -41.335 1.00 104.43 ? 224  PHE A CZ    1 
ATOM   1722  N  N     . ASN A 1  225  ? 106.290 58.956  -44.027 1.00 93.94  ? 225  ASN A N     1 
ATOM   1723  C  CA    . ASN A 1  225  ? 107.369 58.170  -44.641 1.00 93.76  ? 225  ASN A CA    1 
ATOM   1724  C  C     . ASN A 1  225  ? 106.794 57.354  -45.820 1.00 97.79  ? 225  ASN A C     1 
ATOM   1725  O  O     . ASN A 1  225  ? 105.989 56.435  -45.590 1.00 97.53  ? 225  ASN A O     1 
ATOM   1726  C  CB    . ASN A 1  225  ? 107.989 57.217  -43.586 1.00 92.37  ? 225  ASN A CB    1 
ATOM   1727  C  CG    . ASN A 1  225  ? 109.175 56.375  -44.041 1.00 109.50 ? 225  ASN A CG    1 
ATOM   1728  O  OD1   . ASN A 1  225  ? 109.086 55.524  -44.937 1.00 100.08 ? 225  ASN A OD1   1 
ATOM   1729  N  ND2   . ASN A 1  225  ? 110.298 56.528  -43.360 1.00 100.78 ? 225  ASN A ND2   1 
ATOM   1730  N  N     . GLU A 1  226  ? 107.249 57.651  -47.070 1.00 93.15  ? 226  GLU A N     1 
ATOM   1731  C  CA    . GLU A 1  226  ? 106.776 56.985  -48.295 1.00 92.67  ? 226  GLU A CA    1 
ATOM   1732  C  C     . GLU A 1  226  ? 106.889 55.460  -48.379 1.00 93.13  ? 226  GLU A C     1 
ATOM   1733  O  O     . GLU A 1  226  ? 106.331 54.869  -49.308 1.00 93.52  ? 226  GLU A O     1 
ATOM   1734  C  CB    . GLU A 1  226  ? 107.317 57.658  -49.561 1.00 95.49  ? 226  GLU A CB    1 
ATOM   1735  C  CG    . GLU A 1  226  ? 108.809 57.497  -49.800 1.00 109.83 ? 226  GLU A CG    1 
ATOM   1736  C  CD    . GLU A 1  226  ? 109.195 57.023  -51.190 1.00 136.45 ? 226  GLU A CD    1 
ATOM   1737  O  OE1   . GLU A 1  226  ? 108.509 57.404  -52.169 1.00 128.39 ? 226  GLU A OE1   1 
ATOM   1738  O  OE2   . GLU A 1  226  ? 110.184 56.260  -51.297 1.00 137.22 ? 226  GLU A OE2   1 
ATOM   1739  N  N     . VAL A 1  227  ? 107.581 54.828  -47.418 1.00 86.17  ? 227  VAL A N     1 
ATOM   1740  C  CA    . VAL A 1  227  ? 107.796 53.381  -47.403 1.00 84.73  ? 227  VAL A CA    1 
ATOM   1741  C  C     . VAL A 1  227  ? 107.021 52.700  -46.316 1.00 87.53  ? 227  VAL A C     1 
ATOM   1742  O  O     . VAL A 1  227  ? 106.412 51.659  -46.575 1.00 85.74  ? 227  VAL A O     1 
ATOM   1743  C  CB    . VAL A 1  227  ? 109.287 53.027  -47.246 1.00 88.15  ? 227  VAL A CB    1 
ATOM   1744  C  CG1   . VAL A 1  227  ? 109.587 51.652  -47.834 1.00 87.63  ? 227  VAL A CG1   1 
ATOM   1745  C  CG2   . VAL A 1  227  ? 110.189 54.100  -47.855 1.00 89.01  ? 227  VAL A CG2   1 
ATOM   1746  N  N     . PHE A 1  228  ? 107.111 53.255  -45.076 1.00 85.03  ? 228  PHE A N     1 
ATOM   1747  C  CA    . PHE A 1  228  ? 106.527 52.721  -43.835 1.00 83.61  ? 228  PHE A CA    1 
ATOM   1748  C  C     . PHE A 1  228  ? 105.240 53.362  -43.341 1.00 86.93  ? 228  PHE A C     1 
ATOM   1749  O  O     . PHE A 1  228  ? 104.433 52.635  -42.757 1.00 86.48  ? 228  PHE A O     1 
ATOM   1750  C  CB    . PHE A 1  228  ? 107.566 52.662  -42.717 1.00 84.11  ? 228  PHE A CB    1 
ATOM   1751  C  CG    . PHE A 1  228  ? 108.861 52.004  -43.116 1.00 85.03  ? 228  PHE A CG    1 
ATOM   1752  C  CD1   . PHE A 1  228  ? 108.945 50.622  -43.255 1.00 88.01  ? 228  PHE A CD1   1 
ATOM   1753  C  CD2   . PHE A 1  228  ? 109.999 52.758  -43.337 1.00 86.34  ? 228  PHE A CD2   1 
ATOM   1754  C  CE1   . PHE A 1  228  ? 110.142 50.010  -43.620 1.00 88.14  ? 228  PHE A CE1   1 
ATOM   1755  C  CE2   . PHE A 1  228  ? 111.197 52.145  -43.682 1.00 89.17  ? 228  PHE A CE2   1 
ATOM   1756  C  CZ    . PHE A 1  228  ? 111.260 50.774  -43.824 1.00 86.95  ? 228  PHE A CZ    1 
ATOM   1757  N  N     . SER A 1  229  ? 105.041 54.696  -43.543 1.00 82.56  ? 229  SER A N     1 
ATOM   1758  C  CA    . SER A 1  229  ? 103.787 55.355  -43.151 1.00 82.25  ? 229  SER A CA    1 
ATOM   1759  C  C     . SER A 1  229  ? 103.282 56.540  -44.004 1.00 87.72  ? 229  SER A C     1 
ATOM   1760  O  O     . SER A 1  229  ? 103.538 57.706  -43.698 1.00 88.67  ? 229  SER A O     1 
ATOM   1761  C  CB    . SER A 1  229  ? 103.684 55.607  -41.648 1.00 83.65  ? 229  SER A CB    1 
ATOM   1762  O  OG    . SER A 1  229  ? 104.624 56.550  -41.171 1.00 91.43  ? 229  SER A OG    1 
ATOM   1763  N  N     . ARG A 1  230  ? 102.541 56.219  -45.068 1.00 83.16  ? 230  ARG A N     1 
ATOM   1764  C  CA    . ARG A 1  230  ? 101.884 57.167  -45.958 1.00 83.38  ? 230  ARG A CA    1 
ATOM   1765  C  C     . ARG A 1  230  ? 100.572 57.583  -45.271 1.00 87.69  ? 230  ARG A C     1 
ATOM   1766  O  O     . ARG A 1  230  ? 99.996  56.728  -44.603 1.00 86.97  ? 230  ARG A O     1 
ATOM   1767  C  CB    . ARG A 1  230  ? 101.594 56.475  -47.290 1.00 82.67  ? 230  ARG A CB    1 
ATOM   1768  C  CG    . ARG A 1  230  ? 102.850 56.197  -48.093 1.00 91.44  ? 230  ARG A CG    1 
ATOM   1769  C  CD    . ARG A 1  230  ? 102.522 55.495  -49.378 1.00 105.46 ? 230  ARG A CD    1 
ATOM   1770  N  NE    . ARG A 1  230  ? 103.548 55.710  -50.393 1.00 121.61 ? 230  ARG A NE    1 
ATOM   1771  C  CZ    . ARG A 1  230  ? 103.375 56.461  -51.474 1.00 142.85 ? 230  ARG A CZ    1 
ATOM   1772  N  NH1   . ARG A 1  230  ? 102.213 57.070  -51.692 1.00 131.53 ? 230  ARG A NH1   1 
ATOM   1773  N  NH2   . ARG A 1  230  ? 104.359 56.600  -52.355 1.00 132.90 ? 230  ARG A NH2   1 
ATOM   1774  N  N     . PRO A 1  231  ? 100.063 58.842  -45.387 1.00 85.58  ? 231  PRO A N     1 
ATOM   1775  C  CA    . PRO A 1  231  ? 98.807  59.207  -44.676 1.00 85.85  ? 231  PRO A CA    1 
ATOM   1776  C  C     . PRO A 1  231  ? 97.584  58.355  -45.016 1.00 92.64  ? 231  PRO A C     1 
ATOM   1777  O  O     . PRO A 1  231  ? 96.761  58.086  -44.132 1.00 90.70  ? 231  PRO A O     1 
ATOM   1778  C  CB    . PRO A 1  231  ? 98.587  60.672  -45.043 1.00 88.09  ? 231  PRO A CB    1 
ATOM   1779  C  CG    . PRO A 1  231  ? 99.893  61.146  -45.499 1.00 92.68  ? 231  PRO A CG    1 
ATOM   1780  C  CD    . PRO A 1  231  ? 100.601 59.993  -46.128 1.00 87.88  ? 231  PRO A CD    1 
ATOM   1781  N  N     . GLU A 1  232  ? 97.513  57.876  -46.287 1.00 92.55  ? 232  GLU A N     1 
ATOM   1782  C  CA    . GLU A 1  232  ? 96.470  56.986  -46.822 1.00 93.14  ? 232  GLU A CA    1 
ATOM   1783  C  C     . GLU A 1  232  ? 96.292  55.694  -45.996 1.00 97.83  ? 232  GLU A C     1 
ATOM   1784  O  O     . GLU A 1  232  ? 95.245  55.055  -46.092 1.00 97.56  ? 232  GLU A O     1 
ATOM   1785  C  CB    . GLU A 1  232  ? 96.685  56.675  -48.333 1.00 95.07  ? 232  GLU A CB    1 
ATOM   1786  C  CG    . GLU A 1  232  ? 98.079  56.217  -48.741 1.00 103.05 ? 232  GLU A CG    1 
ATOM   1787  C  CD    . GLU A 1  232  ? 98.843  57.160  -49.659 1.00 132.80 ? 232  GLU A CD    1 
ATOM   1788  O  OE1   . GLU A 1  232  ? 99.148  58.299  -49.232 1.00 123.06 ? 232  GLU A OE1   1 
ATOM   1789  O  OE2   . GLU A 1  232  ? 99.173  56.745  -50.795 1.00 133.42 ? 232  GLU A OE2   1 
ATOM   1790  N  N     . TRP A 1  233  ? 97.296  55.342  -45.162 1.00 94.64  ? 233  TRP A N     1 
ATOM   1791  C  CA    . TRP A 1  233  ? 97.285  54.143  -44.326 1.00 94.25  ? 233  TRP A CA    1 
ATOM   1792  C  C     . TRP A 1  233  ? 96.674  54.322  -42.954 1.00 94.02  ? 233  TRP A C     1 
ATOM   1793  O  O     . TRP A 1  233  ? 96.521  53.340  -42.217 1.00 92.28  ? 233  TRP A O     1 
ATOM   1794  C  CB    . TRP A 1  233  ? 98.671  53.507  -44.249 1.00 93.88  ? 233  TRP A CB    1 
ATOM   1795  C  CG    . TRP A 1  233  ? 99.199  53.061  -45.576 1.00 96.81  ? 233  TRP A CG    1 
ATOM   1796  C  CD1   . TRP A 1  233  ? 98.476  52.650  -46.658 1.00 100.76 ? 233  TRP A CD1   1 
ATOM   1797  C  CD2   . TRP A 1  233  ? 100.570 52.938  -45.940 1.00 97.30  ? 233  TRP A CD2   1 
ATOM   1798  N  NE1   . TRP A 1  233  ? 99.316  52.322  -47.689 1.00 101.05 ? 233  TRP A NE1   1 
ATOM   1799  C  CE2   . TRP A 1  233  ? 100.610 52.489  -47.277 1.00 102.35 ? 233  TRP A CE2   1 
ATOM   1800  C  CE3   . TRP A 1  233  ? 101.778 53.167  -45.267 1.00 98.78  ? 233  TRP A CE3   1 
ATOM   1801  C  CZ2   . TRP A 1  233  ? 101.814 52.276  -47.959 1.00 102.58 ? 233  TRP A CZ2   1 
ATOM   1802  C  CZ3   . TRP A 1  233  ? 102.972 52.989  -45.954 1.00 101.14 ? 233  TRP A CZ3   1 
ATOM   1803  C  CH2   . TRP A 1  233  ? 102.984 52.534  -47.279 1.00 102.66 ? 233  TRP A CH2   1 
ATOM   1804  N  N     . MET A 1  234  ? 96.298  55.565  -42.618 1.00 89.00  ? 234  MET A N     1 
ATOM   1805  C  CA    . MET A 1  234  ? 95.621  55.854  -41.353 1.00 87.32  ? 234  MET A CA    1 
ATOM   1806  C  C     . MET A 1  234  ? 94.132  55.452  -41.488 1.00 90.08  ? 234  MET A C     1 
ATOM   1807  O  O     . MET A 1  234  ? 93.447  55.274  -40.478 1.00 88.69  ? 234  MET A O     1 
ATOM   1808  C  CB    . MET A 1  234  ? 95.767  57.329  -40.969 1.00 89.57  ? 234  MET A CB    1 
ATOM   1809  C  CG    . MET A 1  234  ? 97.181  57.743  -40.736 1.00 92.65  ? 234  MET A CG    1 
ATOM   1810  S  SD    . MET A 1  234  ? 97.290  59.390  -40.017 1.00 97.79  ? 234  MET A SD    1 
ATOM   1811  C  CE    . MET A 1  234  ? 97.110  60.409  -41.482 1.00 96.31  ? 234  MET A CE    1 
ATOM   1812  N  N     . ILE A 1  235  ? 93.648  55.303  -42.748 1.00 86.21  ? 235  ILE A N     1 
ATOM   1813  C  CA    . ILE A 1  235  ? 92.287  54.889  -43.081 1.00 85.85  ? 235  ILE A CA    1 
ATOM   1814  C  C     . ILE A 1  235  ? 92.318  53.407  -43.416 1.00 92.03  ? 235  ILE A C     1 
ATOM   1815  O  O     . ILE A 1  235  ? 93.077  52.998  -44.292 1.00 93.38  ? 235  ILE A O     1 
ATOM   1816  C  CB    . ILE A 1  235  ? 91.671  55.769  -44.196 1.00 89.03  ? 235  ILE A CB    1 
ATOM   1817  C  CG1   . ILE A 1  235  ? 91.435  57.206  -43.659 1.00 89.04  ? 235  ILE A CG1   1 
ATOM   1818  C  CG2   . ILE A 1  235  ? 90.363  55.146  -44.699 1.00 89.31  ? 235  ILE A CG2   1 
ATOM   1819  C  CD1   . ILE A 1  235  ? 91.413  58.290  -44.648 1.00 92.60  ? 235  ILE A CD1   1 
ATOM   1820  N  N     . LEU A 1  236  ? 91.522  52.602  -42.694 1.00 88.25  ? 236  LEU A N     1 
ATOM   1821  C  CA    . LEU A 1  236  ? 91.480  51.142  -42.841 1.00 87.32  ? 236  LEU A CA    1 
ATOM   1822  C  C     . LEU A 1  236  ? 90.544  50.643  -43.947 1.00 94.30  ? 236  LEU A C     1 
ATOM   1823  O  O     . LEU A 1  236  ? 89.397  51.078  -44.059 1.00 94.55  ? 236  LEU A O     1 
ATOM   1824  C  CB    . LEU A 1  236  ? 91.192  50.475  -41.498 1.00 85.62  ? 236  LEU A CB    1 
ATOM   1825  C  CG    . LEU A 1  236  ? 91.879  51.117  -40.295 1.00 88.19  ? 236  LEU A CG    1 
ATOM   1826  C  CD1   . LEU A 1  236  ? 91.152  50.788  -39.036 1.00 87.78  ? 236  LEU A CD1   1 
ATOM   1827  C  CD2   . LEU A 1  236  ? 93.350  50.751  -40.212 1.00 87.67  ? 236  LEU A CD2   1 
ATOM   1828  N  N     . THR A 1  237  ? 91.070  49.737  -44.773 1.00 92.24  ? 237  THR A N     1 
ATOM   1829  C  CA    . THR A 1  237  ? 90.420  49.165  -45.953 1.00 93.36  ? 237  THR A CA    1 
ATOM   1830  C  C     . THR A 1  237  ? 90.327  47.653  -45.769 1.00 97.64  ? 237  THR A C     1 
ATOM   1831  O  O     . THR A 1  237  ? 89.292  47.022  -45.999 1.00 98.02  ? 237  THR A O     1 
ATOM   1832  C  CB    . THR A 1  237  ? 91.350  49.432  -47.161 1.00 101.15 ? 237  THR A CB    1 
ATOM   1833  O  OG1   . THR A 1  237  ? 91.841  50.771  -47.123 1.00 100.47 ? 237  THR A OG1   1 
ATOM   1834  C  CG2   . THR A 1  237  ? 90.719  49.089  -48.505 1.00 100.37 ? 237  THR A CG2   1 
ATOM   1835  N  N     . CYS A 1  238  ? 91.456  47.079  -45.427 1.00 93.06  ? 238  CYS A N     1 
ATOM   1836  C  CA    . CYS A 1  238  ? 91.590  45.668  -45.262 1.00 92.35  ? 238  CYS A CA    1 
ATOM   1837  C  C     . CYS A 1  238  ? 92.046  45.507  -43.828 1.00 92.71  ? 238  CYS A C     1 
ATOM   1838  O  O     . CYS A 1  238  ? 93.082  46.062  -43.442 1.00 93.20  ? 238  CYS A O     1 
ATOM   1839  C  CB    . CYS A 1  238  ? 92.622  45.162  -46.256 1.00 93.71  ? 238  CYS A CB    1 
ATOM   1840  S  SG    . CYS A 1  238  ? 92.841  43.374  -46.240 1.00 97.66  ? 238  CYS A SG    1 
ATOM   1841  N  N     . LEU A 1  239  ? 91.231  44.826  -43.015 1.00 84.39  ? 239  LEU A N     1 
ATOM   1842  C  CA    . LEU A 1  239  ? 91.507  44.673  -41.601 1.00 81.05  ? 239  LEU A CA    1 
ATOM   1843  C  C     . LEU A 1  239  ? 92.234  43.378  -41.237 1.00 83.69  ? 239  LEU A C     1 
ATOM   1844  O  O     . LEU A 1  239  ? 91.692  42.282  -41.435 1.00 83.44  ? 239  LEU A O     1 
ATOM   1845  C  CB    . LEU A 1  239  ? 90.189  44.818  -40.821 1.00 80.61  ? 239  LEU A CB    1 
ATOM   1846  C  CG    . LEU A 1  239  ? 90.230  44.805  -39.293 1.00 83.61  ? 239  LEU A CG    1 
ATOM   1847  C  CD1   . LEU A 1  239  ? 90.949  46.013  -38.760 1.00 83.69  ? 239  LEU A CD1   1 
ATOM   1848  C  CD2   . LEU A 1  239  ? 88.828  44.790  -38.719 1.00 83.84  ? 239  LEU A CD2   1 
ATOM   1849  N  N     . PRO A 1  240  ? 93.441  43.481  -40.636 1.00 79.26  ? 240  PRO A N     1 
ATOM   1850  C  CA    . PRO A 1  240  ? 94.126  42.257  -40.167 1.00 77.85  ? 240  PRO A CA    1 
ATOM   1851  C  C     . PRO A 1  240  ? 93.395  41.570  -39.005 1.00 78.28  ? 240  PRO A C     1 
ATOM   1852  O  O     . PRO A 1  240  ? 92.955  42.217  -38.020 1.00 77.90  ? 240  PRO A O     1 
ATOM   1853  C  CB    . PRO A 1  240  ? 95.515  42.752  -39.746 1.00 79.15  ? 240  PRO A CB    1 
ATOM   1854  C  CG    . PRO A 1  240  ? 95.331  44.193  -39.435 1.00 84.03  ? 240  PRO A CG    1 
ATOM   1855  C  CD    . PRO A 1  240  ? 94.217  44.698  -40.320 1.00 80.62  ? 240  PRO A CD    1 
ATOM   1856  N  N     . VAL A 1  241  ? 93.268  40.239  -39.147 1.00 70.82  ? 241  VAL A N     1 
ATOM   1857  C  CA    . VAL A 1  241  ? 92.645  39.333  -38.182 1.00 68.39  ? 241  VAL A CA    1 
ATOM   1858  C  C     . VAL A 1  241  ? 93.735  38.626  -37.322 1.00 73.39  ? 241  VAL A C     1 
ATOM   1859  O  O     . VAL A 1  241  ? 94.501  37.800  -37.864 1.00 73.94  ? 241  VAL A O     1 
ATOM   1860  C  CB    . VAL A 1  241  ? 91.739  38.310  -38.884 1.00 70.33  ? 241  VAL A CB    1 
ATOM   1861  C  CG1   . VAL A 1  241  ? 90.992  37.466  -37.875 1.00 68.98  ? 241  VAL A CG1   1 
ATOM   1862  C  CG2   . VAL A 1  241  ? 90.769  39.011  -39.787 1.00 71.02  ? 241  VAL A CG2   1 
ATOM   1863  N  N     . PRO A 1  242  ? 93.816  38.926  -35.987 1.00 67.52  ? 242  PRO A N     1 
ATOM   1864  C  CA    . PRO A 1  242  ? 94.837  38.287  -35.152 1.00 65.40  ? 242  PRO A CA    1 
ATOM   1865  C  C     . PRO A 1  242  ? 94.500  36.831  -34.943 1.00 69.65  ? 242  PRO A C     1 
ATOM   1866  O  O     . PRO A 1  242  ? 93.326  36.478  -34.847 1.00 69.01  ? 242  PRO A O     1 
ATOM   1867  C  CB    . PRO A 1  242  ? 94.793  39.081  -33.852 1.00 66.18  ? 242  PRO A CB    1 
ATOM   1868  C  CG    . PRO A 1  242  ? 94.014  40.300  -34.171 1.00 71.60  ? 242  PRO A CG    1 
ATOM   1869  C  CD    . PRO A 1  242  ? 93.029  39.878  -35.189 1.00 68.41  ? 242  PRO A CD    1 
ATOM   1870  N  N     . PRO A 1  243  ? 95.532  35.975  -34.962 1.00 67.71  ? 243  PRO A N     1 
ATOM   1871  C  CA    . PRO A 1  243  ? 95.312  34.522  -34.789 1.00 68.84  ? 243  PRO A CA    1 
ATOM   1872  C  C     . PRO A 1  243  ? 94.864  34.104  -33.382 1.00 78.53  ? 243  PRO A C     1 
ATOM   1873  O  O     . PRO A 1  243  ? 95.126  34.847  -32.435 1.00 80.01  ? 243  PRO A O     1 
ATOM   1874  C  CB    . PRO A 1  243  ? 96.701  33.965  -35.024 1.00 69.55  ? 243  PRO A CB    1 
ATOM   1875  C  CG    . PRO A 1  243  ? 97.608  35.101  -34.540 1.00 72.38  ? 243  PRO A CG    1 
ATOM   1876  C  CD    . PRO A 1  243  ? 96.967  36.293  -35.094 1.00 68.21  ? 243  PRO A CD    1 
ATOM   1877  N  N     . PRO A 1  244  ? 94.315  32.882  -33.188 1.00 77.51  ? 244  PRO A N     1 
ATOM   1878  C  CA    . PRO A 1  244  ? 93.954  32.432  -31.826 1.00 77.40  ? 244  PRO A CA    1 
ATOM   1879  C  C     . PRO A 1  244  ? 94.952  32.759  -30.703 1.00 78.35  ? 244  PRO A C     1 
ATOM   1880  O  O     . PRO A 1  244  ? 94.500  33.365  -29.740 1.00 78.47  ? 244  PRO A O     1 
ATOM   1881  C  CB    . PRO A 1  244  ? 93.714  30.935  -32.004 1.00 79.76  ? 244  PRO A CB    1 
ATOM   1882  C  CG    . PRO A 1  244  ? 93.150  30.862  -33.360 1.00 85.24  ? 244  PRO A CG    1 
ATOM   1883  C  CD    . PRO A 1  244  ? 93.951  31.857  -34.182 1.00 80.61  ? 244  PRO A CD    1 
ATOM   1884  N  N     . PRO A 1  245  ? 96.281  32.526  -30.809 1.00 71.37  ? 245  PRO A N     1 
ATOM   1885  C  CA    . PRO A 1  245  ? 97.194  32.937  -29.717 1.00 69.97  ? 245  PRO A CA    1 
ATOM   1886  C  C     . PRO A 1  245  ? 96.940  34.276  -29.003 1.00 71.87  ? 245  PRO A C     1 
ATOM   1887  O  O     . PRO A 1  245  ? 97.262  34.414  -27.808 1.00 70.65  ? 245  PRO A O     1 
ATOM   1888  C  CB    . PRO A 1  245  ? 98.550  32.933  -30.406 1.00 71.80  ? 245  PRO A CB    1 
ATOM   1889  C  CG    . PRO A 1  245  ? 98.442  31.809  -31.346 1.00 76.96  ? 245  PRO A CG    1 
ATOM   1890  C  CD    . PRO A 1  245  ? 97.021  31.801  -31.858 1.00 72.73  ? 245  PRO A CD    1 
ATOM   1891  N  N     . VAL A 1  246  ? 96.376  35.252  -29.745 1.00 67.85  ? 246  VAL A N     1 
ATOM   1892  C  CA    . VAL A 1  246  ? 96.024  36.606  -29.311 1.00 67.71  ? 246  VAL A CA    1 
ATOM   1893  C  C     . VAL A 1  246  ? 94.675  36.600  -28.559 1.00 75.52  ? 246  VAL A C     1 
ATOM   1894  O  O     . VAL A 1  246  ? 94.513  37.297  -27.557 1.00 74.51  ? 246  VAL A O     1 
ATOM   1895  C  CB    . VAL A 1  246  ? 95.954  37.547  -30.543 1.00 70.91  ? 246  VAL A CB    1 
ATOM   1896  C  CG1   . VAL A 1  246  ? 95.761  38.998  -30.125 1.00 70.57  ? 246  VAL A CG1   1 
ATOM   1897  C  CG2   . VAL A 1  246  ? 97.186  37.403  -31.423 1.00 70.60  ? 246  VAL A CG2   1 
ATOM   1898  N  N     . ARG A 1  247  ? 93.709  35.823  -29.067 1.00 75.53  ? 247  ARG A N     1 
ATOM   1899  C  CA    . ARG A 1  247  ? 92.343  35.709  -28.550 1.00 77.37  ? 247  ARG A CA    1 
ATOM   1900  C  C     . ARG A 1  247  ? 91.953  34.212  -28.228 1.00 88.59  ? 247  ARG A C     1 
ATOM   1901  O  O     . ARG A 1  247  ? 90.971  33.663  -28.789 1.00 89.93  ? 247  ARG A O     1 
ATOM   1902  C  CB    . ARG A 1  247  ? 91.382  36.359  -29.565 1.00 75.46  ? 247  ARG A CB    1 
ATOM   1903  C  CG    . ARG A 1  247  ? 91.817  36.181  -31.021 1.00 72.36  ? 247  ARG A CG    1 
ATOM   1904  C  CD    . ARG A 1  247  ? 90.805  36.755  -31.976 1.00 69.55  ? 247  ARG A CD    1 
ATOM   1905  N  NE    . ARG A 1  247  ? 91.024  36.253  -33.329 1.00 78.98  ? 247  ARG A NE    1 
ATOM   1906  C  CZ    . ARG A 1  247  ? 90.645  35.051  -33.756 1.00 101.32 ? 247  ARG A CZ    1 
ATOM   1907  N  NH1   . ARG A 1  247  ? 90.041  34.204  -32.929 1.00 95.64  ? 247  ARG A NH1   1 
ATOM   1908  N  NH2   . ARG A 1  247  ? 90.873  34.683  -35.012 1.00 86.76  ? 247  ARG A NH2   1 
ATOM   1909  N  N     . PRO A 1  248  ? 92.712  33.546  -27.310 1.00 87.45  ? 248  PRO A N     1 
ATOM   1910  C  CA    . PRO A 1  248  ? 92.435  32.141  -27.020 1.00 89.54  ? 248  PRO A CA    1 
ATOM   1911  C  C     . PRO A 1  248  ? 91.108  31.863  -26.325 1.00 104.26 ? 248  PRO A C     1 
ATOM   1912  O  O     . PRO A 1  248  ? 90.735  32.555  -25.368 1.00 103.99 ? 248  PRO A O     1 
ATOM   1913  C  CB    . PRO A 1  248  ? 93.610  31.747  -26.133 1.00 89.62  ? 248  PRO A CB    1 
ATOM   1914  C  CG    . PRO A 1  248  ? 94.005  33.004  -25.469 1.00 92.04  ? 248  PRO A CG    1 
ATOM   1915  C  CD    . PRO A 1  248  ? 93.875  34.013  -26.532 1.00 87.69  ? 248  PRO A CD    1 
ATOM   1916  N  N     . SER A 1  249  ? 90.413  30.812  -26.800 1.00 108.64 ? 249  SER A N     1 
ATOM   1917  C  CA    . SER A 1  249  ? 89.165  30.340  -26.208 1.00 111.75 ? 249  SER A CA    1 
ATOM   1918  C  C     . SER A 1  249  ? 89.506  29.608  -24.928 1.00 122.81 ? 249  SER A C     1 
ATOM   1919  O  O     . SER A 1  249  ? 90.371  28.728  -24.928 1.00 122.30 ? 249  SER A O     1 
ATOM   1920  C  CB    . SER A 1  249  ? 88.407  29.414  -27.163 1.00 116.33 ? 249  SER A CB    1 
ATOM   1921  O  OG    . SER A 1  249  ? 88.967  28.118  -27.321 1.00 125.52 ? 249  SER A OG    1 
ATOM   1922  N  N     . ILE A 1  250  ? 88.864  29.995  -23.831 1.00 125.85 ? 250  ILE A N     1 
ATOM   1923  C  CA    . ILE A 1  250  ? 89.056  29.332  -22.542 1.00 128.31 ? 250  ILE A CA    1 
ATOM   1924  C  C     . ILE A 1  250  ? 88.054  28.140  -22.488 1.00 142.96 ? 250  ILE A C     1 
ATOM   1925  O  O     . ILE A 1  250  ? 87.052  28.163  -21.758 1.00 143.08 ? 250  ILE A O     1 
ATOM   1926  C  CB    . ILE A 1  250  ? 89.026  30.370  -21.380 1.00 129.96 ? 250  ILE A CB    1 
ATOM   1927  C  CG1   . ILE A 1  250  ? 90.199  31.388  -21.522 1.00 128.36 ? 250  ILE A CG1   1 
ATOM   1928  C  CG2   . ILE A 1  250  ? 88.996  29.716  -19.988 1.00 130.77 ? 250  ILE A CG2   1 
ATOM   1929  C  CD1   . ILE A 1  250  ? 91.635  30.807  -21.797 1.00 123.12 ? 250  ILE A CD1   1 
ATOM   1930  N  N     . SER A 1  251  ? 88.339  27.123  -23.360 1.00 146.72 ? 251  SER A N     1 
ATOM   1931  C  CA    . SER A 1  251  ? 87.577  25.896  -23.648 1.00 150.12 ? 251  SER A CA    1 
ATOM   1932  C  C     . SER A 1  251  ? 87.400  24.887  -22.487 1.00 161.98 ? 251  SER A C     1 
ATOM   1933  O  O     . SER A 1  251  ? 87.997  23.796  -22.496 1.00 161.89 ? 251  SER A O     1 
ATOM   1934  C  CB    . SER A 1  251  ? 88.089  25.229  -24.927 1.00 153.39 ? 251  SER A CB    1 
ATOM   1935  O  OG    . SER A 1  251  ? 89.457  24.865  -24.823 1.00 159.60 ? 251  SER A OG    1 
ATOM   1936  N  N     . PHE A 1  252  ? 86.532  25.262  -21.502 1.00 163.71 ? 252  PHE A N     1 
ATOM   1937  C  CA    . PHE A 1  252  ? 86.168  24.472  -20.307 1.00 165.28 ? 252  PHE A CA    1 
ATOM   1938  C  C     . PHE A 1  252  ? 85.515  23.151  -20.705 1.00 172.70 ? 252  PHE A C     1 
ATOM   1939  O  O     . PHE A 1  252  ? 84.805  23.092  -21.720 1.00 173.11 ? 252  PHE A O     1 
ATOM   1940  C  CB    . PHE A 1  252  ? 85.227  25.242  -19.331 1.00 167.42 ? 252  PHE A CB    1 
ATOM   1941  C  CG    . PHE A 1  252  ? 84.735  26.613  -19.746 1.00 169.23 ? 252  PHE A CG    1 
ATOM   1942  C  CD1   . PHE A 1  252  ? 83.803  26.758  -20.771 1.00 172.35 ? 252  PHE A CD1   1 
ATOM   1943  C  CD2   . PHE A 1  252  ? 85.176  27.756  -19.088 1.00 171.27 ? 252  PHE A CD2   1 
ATOM   1944  C  CE1   . PHE A 1  252  ? 83.352  28.021  -21.155 1.00 173.32 ? 252  PHE A CE1   1 
ATOM   1945  C  CE2   . PHE A 1  252  ? 84.719  29.020  -19.469 1.00 174.18 ? 252  PHE A CE2   1 
ATOM   1946  C  CZ    . PHE A 1  252  ? 83.808  29.143  -20.499 1.00 172.52 ? 252  PHE A CZ    1 
ATOM   1947  N  N     . ASN A 1  253  ? 85.767  22.089  -19.904 1.00 170.46 ? 253  ASN A N     1 
ATOM   1948  C  CA    . ASN A 1  253  ? 85.221  20.741  -20.113 1.00 170.79 ? 253  ASN A CA    1 
ATOM   1949  C  C     . ASN A 1  253  ? 85.624  20.219  -21.526 1.00 174.82 ? 253  ASN A C     1 
ATOM   1950  O  O     . ASN A 1  253  ? 86.742  20.515  -21.975 1.00 173.79 ? 253  ASN A O     1 
ATOM   1951  C  CB    . ASN A 1  253  ? 83.694  20.734  -19.827 1.00 171.18 ? 253  ASN A CB    1 
ATOM   1952  C  CG    . ASN A 1  253  ? 83.298  21.545  -18.598 1.00 188.58 ? 253  ASN A CG    1 
ATOM   1953  O  OD1   . ASN A 1  253  ? 83.703  21.262  -17.459 1.00 181.02 ? 253  ASN A OD1   1 
ATOM   1954  N  ND2   . ASN A 1  253  ? 82.537  22.606  -18.811 1.00 178.80 ? 253  ASN A ND2   1 
ATOM   1955  N  N     . GLU A 1  254  ? 84.746  19.464  -22.217 1.00 171.81 ? 254  GLU A N     1 
ATOM   1956  C  CA    . GLU A 1  254  ? 85.032  18.989  -23.573 1.00 171.48 ? 254  GLU A CA    1 
ATOM   1957  C  C     . GLU A 1  254  ? 84.198  19.784  -24.577 1.00 174.88 ? 254  GLU A C     1 
ATOM   1958  O  O     . GLU A 1  254  ? 84.761  20.392  -25.492 1.00 174.06 ? 254  GLU A O     1 
ATOM   1959  C  CB    . GLU A 1  254  ? 84.847  17.460  -23.712 1.00 173.09 ? 254  GLU A CB    1 
ATOM   1960  C  CG    . GLU A 1  254  ? 85.078  16.906  -25.114 1.00 183.28 ? 254  GLU A CG    1 
ATOM   1961  C  CD    . GLU A 1  254  ? 86.283  17.439  -25.870 1.00 203.26 ? 254  GLU A CD    1 
ATOM   1962  O  OE1   . GLU A 1  254  ? 87.414  17.347  -25.340 1.00 192.90 ? 254  GLU A OE1   1 
ATOM   1963  O  OE2   . GLU A 1  254  ? 86.090  17.970  -26.988 1.00 199.64 ? 254  GLU A OE2   1 
ATOM   1964  N  N     . SER A 1  255  ? 82.865  19.801  -24.382 1.00 171.43 ? 255  SER A N     1 
ATOM   1965  C  CA    . SER A 1  255  ? 81.933  20.544  -25.229 1.00 171.36 ? 255  SER A CA    1 
ATOM   1966  C  C     . SER A 1  255  ? 81.285  21.745  -24.485 1.00 172.83 ? 255  SER A C     1 
ATOM   1967  O  O     . SER A 1  255  ? 80.224  21.616  -23.852 1.00 173.42 ? 255  SER A O     1 
ATOM   1968  C  CB    . SER A 1  255  ? 80.905  19.615  -25.877 1.00 176.16 ? 255  SER A CB    1 
ATOM   1969  O  OG    . SER A 1  255  ? 79.955  19.120  -24.949 1.00 185.29 ? 255  SER A OG    1 
ATOM   1970  N  N     . GLN A 1  256  ? 81.983  22.905  -24.549 1.00 165.62 ? 256  GLN A N     1 
ATOM   1971  C  CA    . GLN A 1  256  ? 81.647  24.225  -23.982 1.00 163.60 ? 256  GLN A CA    1 
ATOM   1972  C  C     . GLN A 1  256  ? 82.703  25.194  -24.583 1.00 161.09 ? 256  GLN A C     1 
ATOM   1973  O  O     . GLN A 1  256  ? 83.888  25.090  -24.233 1.00 160.48 ? 256  GLN A O     1 
ATOM   1974  C  CB    . GLN A 1  256  ? 81.695  24.200  -22.423 1.00 164.80 ? 256  GLN A CB    1 
ATOM   1975  C  CG    . GLN A 1  256  ? 80.679  25.111  -21.700 1.00 178.53 ? 256  GLN A CG    1 
ATOM   1976  C  CD    . GLN A 1  256  ? 80.617  24.857  -20.200 1.00 192.91 ? 256  GLN A CD    1 
ATOM   1977  O  OE1   . GLN A 1  256  ? 80.215  23.782  -19.743 1.00 188.47 ? 256  GLN A OE1   1 
ATOM   1978  N  NE2   . GLN A 1  256  ? 80.979  25.847  -19.390 1.00 180.50 ? 256  GLN A NE2   1 
ATOM   1979  N  N     . ARG A 1  257  ? 82.280  26.067  -25.550 1.00 152.03 ? 257  ARG A N     1 
ATOM   1980  C  CA    . ARG A 1  257  ? 83.133  27.026  -26.289 1.00 148.21 ? 257  ARG A CA    1 
ATOM   1981  C  C     . ARG A 1  257  ? 84.116  27.860  -25.413 1.00 141.10 ? 257  ARG A C     1 
ATOM   1982  O  O     . ARG A 1  257  ? 85.272  27.454  -25.252 1.00 140.18 ? 257  ARG A O     1 
ATOM   1983  C  CB    . ARG A 1  257  ? 82.305  27.909  -27.271 1.00 150.11 ? 257  ARG A CB    1 
ATOM   1984  C  CG    . ARG A 1  257  ? 82.671  27.775  -28.771 1.00 162.25 ? 257  ARG A CG    1 
ATOM   1985  C  CD    . ARG A 1  257  ? 82.033  28.875  -29.631 1.00 174.67 ? 257  ARG A CD    1 
ATOM   1986  N  NE    . ARG A 1  257  ? 81.593  28.404  -30.953 1.00 184.45 ? 257  ARG A NE    1 
ATOM   1987  C  CZ    . ARG A 1  257  ? 80.854  29.114  -31.808 1.00 193.87 ? 257  ARG A CZ    1 
ATOM   1988  N  NH1   . ARG A 1  257  ? 80.482  30.354  -31.507 1.00 176.14 ? 257  ARG A NH1   1 
ATOM   1989  N  NH2   . ARG A 1  257  ? 80.502  28.597  -32.980 1.00 177.15 ? 257  ARG A NH2   1 
ATOM   1990  N  N     . GLY A 1  258  ? 83.650  28.989  -24.874 1.00 128.93 ? 258  GLY A N     1 
ATOM   1991  C  CA    . GLY A 1  258  ? 84.456  29.895  -24.061 1.00 124.14 ? 258  GLY A CA    1 
ATOM   1992  C  C     . GLY A 1  258  ? 85.310  30.882  -24.847 1.00 117.85 ? 258  GLY A C     1 
ATOM   1993  O  O     . GLY A 1  258  ? 86.439  31.171  -24.444 1.00 116.55 ? 258  GLY A O     1 
ATOM   1994  N  N     . GLU A 1  259  ? 84.766  31.438  -25.950 1.00 107.47 ? 259  GLU A N     1 
ATOM   1995  C  CA    . GLU A 1  259  ? 85.465  32.383  -26.823 1.00 103.62 ? 259  GLU A CA    1 
ATOM   1996  C  C     . GLU A 1  259  ? 85.896  33.681  -26.164 1.00 102.23 ? 259  GLU A C     1 
ATOM   1997  O  O     . GLU A 1  259  ? 85.275  34.122  -25.197 1.00 100.22 ? 259  GLU A O     1 
ATOM   1998  C  CB    . GLU A 1  259  ? 84.721  32.616  -28.148 1.00 104.96 ? 259  GLU A CB    1 
ATOM   1999  C  CG    . GLU A 1  259  ? 84.699  31.406  -29.068 1.00 109.35 ? 259  GLU A CG    1 
ATOM   2000  C  CD    . GLU A 1  259  ? 86.030  30.772  -29.440 1.00 127.66 ? 259  GLU A CD    1 
ATOM   2001  O  OE1   . GLU A 1  259  ? 87.030  31.505  -29.632 1.00 122.72 ? 259  GLU A OE1   1 
ATOM   2002  O  OE2   . GLU A 1  259  ? 86.058  29.528  -29.575 1.00 119.97 ? 259  GLU A OE2   1 
ATOM   2003  N  N     . ASP A 1  260  ? 87.013  34.248  -26.664 1.00 97.20  ? 260  ASP A N     1 
ATOM   2004  C  CA    . ASP A 1  260  ? 87.614  35.474  -26.158 1.00 96.32  ? 260  ASP A CA    1 
ATOM   2005  C  C     . ASP A 1  260  ? 86.774  36.694  -26.498 1.00 99.26  ? 260  ASP A C     1 
ATOM   2006  O  O     . ASP A 1  260  ? 85.995  36.671  -27.451 1.00 99.57  ? 260  ASP A O     1 
ATOM   2007  C  CB    . ASP A 1  260  ? 89.034  35.646  -26.716 1.00 98.10  ? 260  ASP A CB    1 
ATOM   2008  C  CG    . ASP A 1  260  ? 89.867  36.707  -25.994 1.00 113.47 ? 260  ASP A CG    1 
ATOM   2009  O  OD1   . ASP A 1  260  ? 89.555  37.919  -26.139 1.00 118.58 ? 260  ASP A OD1   1 
ATOM   2010  O  OD2   . ASP A 1  260  ? 90.828  36.328  -25.283 1.00 115.25 ? 260  ASP A OD2   1 
ATOM   2011  N  N     . ASP A 1  261  ? 86.963  37.773  -25.733 1.00 94.26  ? 261  ASP A N     1 
ATOM   2012  C  CA    . ASP A 1  261  ? 86.278  39.032  -25.959 1.00 94.30  ? 261  ASP A CA    1 
ATOM   2013  C  C     . ASP A 1  261  ? 86.578  39.576  -27.384 1.00 93.58  ? 261  ASP A C     1 
ATOM   2014  O  O     . ASP A 1  261  ? 85.642  39.985  -28.082 1.00 93.94  ? 261  ASP A O     1 
ATOM   2015  C  CB    . ASP A 1  261  ? 86.672  40.040  -24.860 1.00 97.13  ? 261  ASP A CB    1 
ATOM   2016  C  CG    . ASP A 1  261  ? 85.514  40.770  -24.174 1.00 117.53 ? 261  ASP A CG    1 
ATOM   2017  O  OD1   . ASP A 1  261  ? 84.536  40.091  -23.756 1.00 121.34 ? 261  ASP A OD1   1 
ATOM   2018  O  OD2   . ASP A 1  261  ? 85.605  42.010  -24.012 1.00 121.94 ? 261  ASP A OD2   1 
ATOM   2019  N  N     . LEU A 1  262  ? 87.866  39.518  -27.825 1.00 85.16  ? 262  LEU A N     1 
ATOM   2020  C  CA    . LEU A 1  262  ? 88.312  39.978  -29.149 1.00 82.91  ? 262  LEU A CA    1 
ATOM   2021  C  C     . LEU A 1  262  ? 87.638  39.258  -30.282 1.00 83.83  ? 262  LEU A C     1 
ATOM   2022  O  O     . LEU A 1  262  ? 87.313  39.900  -31.277 1.00 83.33  ? 262  LEU A O     1 
ATOM   2023  C  CB    . LEU A 1  262  ? 89.829  39.872  -29.322 1.00 81.94  ? 262  LEU A CB    1 
ATOM   2024  C  CG    . LEU A 1  262  ? 90.688  41.026  -28.792 1.00 85.88  ? 262  LEU A CG    1 
ATOM   2025  C  CD1   . LEU A 1  262  ? 92.069  40.972  -29.408 1.00 85.14  ? 262  LEU A CD1   1 
ATOM   2026  C  CD2   . LEU A 1  262  ? 90.060  42.415  -29.076 1.00 89.38  ? 262  LEU A CD2   1 
ATOM   2027  N  N     . THR A 1  263  ? 87.421  37.931  -30.121 1.00 78.57  ? 263  THR A N     1 
ATOM   2028  C  CA    . THR A 1  263  ? 86.749  37.050  -31.074 1.00 78.37  ? 263  THR A CA    1 
ATOM   2029  C  C     . THR A 1  263  ? 85.311  37.519  -31.277 1.00 83.99  ? 263  THR A C     1 
ATOM   2030  O  O     . THR A 1  263  ? 84.878  37.646  -32.422 1.00 84.92  ? 263  THR A O     1 
ATOM   2031  C  CB    . THR A 1  263  ? 86.839  35.578  -30.641 1.00 83.71  ? 263  THR A CB    1 
ATOM   2032  O  OG1   . THR A 1  263  ? 88.195  35.213  -30.369 1.00 85.54  ? 263  THR A OG1   1 
ATOM   2033  C  CG2   . THR A 1  263  ? 86.274  34.632  -31.676 1.00 80.68  ? 263  THR A CG2   1 
ATOM   2034  N  N     . PHE A 1  264  ? 84.594  37.840  -30.188 1.00 81.53  ? 264  PHE A N     1 
ATOM   2035  C  CA    . PHE A 1  264  ? 83.221  38.343  -30.299 1.00 83.48  ? 264  PHE A CA    1 
ATOM   2036  C  C     . PHE A 1  264  ? 83.162  39.675  -30.999 1.00 83.29  ? 264  PHE A C     1 
ATOM   2037  O  O     . PHE A 1  264  ? 82.432  39.793  -31.981 1.00 82.65  ? 264  PHE A O     1 
ATOM   2038  C  CB    . PHE A 1  264  ? 82.515  38.427  -28.935 1.00 87.36  ? 264  PHE A CB    1 
ATOM   2039  C  CG    . PHE A 1  264  ? 82.275  37.085  -28.272 1.00 90.64  ? 264  PHE A CG    1 
ATOM   2040  C  CD1   . PHE A 1  264  ? 81.707  36.027  -28.985 1.00 94.28  ? 264  PHE A CD1   1 
ATOM   2041  C  CD2   . PHE A 1  264  ? 82.609  36.883  -26.933 1.00 93.82  ? 264  PHE A CD2   1 
ATOM   2042  C  CE1   . PHE A 1  264  ? 81.510  34.787  -28.385 1.00 95.40  ? 264  PHE A CE1   1 
ATOM   2043  C  CE2   . PHE A 1  264  ? 82.411  35.640  -26.331 1.00 96.93  ? 264  PHE A CE2   1 
ATOM   2044  C  CZ    . PHE A 1  264  ? 81.856  34.602  -27.061 1.00 95.23  ? 264  PHE A CZ    1 
ATOM   2045  N  N     . LYS A 1  265  ? 83.976  40.657  -30.531 1.00 77.35  ? 265  LYS A N     1 
ATOM   2046  C  CA    . LYS A 1  265  ? 84.083  41.992  -31.120 1.00 76.39  ? 265  LYS A CA    1 
ATOM   2047  C  C     . LYS A 1  265  ? 84.414  41.896  -32.593 1.00 79.48  ? 265  LYS A C     1 
ATOM   2048  O  O     . LYS A 1  265  ? 83.948  42.740  -33.360 1.00 80.37  ? 265  LYS A O     1 
ATOM   2049  C  CB    . LYS A 1  265  ? 85.125  42.858  -30.397 1.00 77.60  ? 265  LYS A CB    1 
ATOM   2050  C  CG    . LYS A 1  265  ? 85.090  44.355  -30.810 1.00 84.22  ? 265  LYS A CG    1 
ATOM   2051  C  CD    . LYS A 1  265  ? 84.023  45.221  -30.108 1.00 81.99  ? 265  LYS A CD    1 
ATOM   2052  C  CE    . LYS A 1  265  ? 83.239  46.080  -31.066 1.00 75.25  ? 265  LYS A CE    1 
ATOM   2053  N  NZ    . LYS A 1  265  ? 81.842  46.316  -30.603 1.00 68.92  ? 265  LYS A NZ    1 
ATOM   2054  N  N     . LEU A 1  266  ? 85.195  40.861  -32.996 1.00 73.91  ? 266  LEU A N     1 
ATOM   2055  C  CA    . LEU A 1  266  ? 85.523  40.646  -34.406 1.00 73.15  ? 266  LEU A CA    1 
ATOM   2056  C  C     . LEU A 1  266  ? 84.286  40.225  -35.157 1.00 77.57  ? 266  LEU A C     1 
ATOM   2057  O  O     . LEU A 1  266  ? 83.900  40.898  -36.110 1.00 77.15  ? 266  LEU A O     1 
ATOM   2058  C  CB    . LEU A 1  266  ? 86.711  39.686  -34.634 1.00 71.75  ? 266  LEU A CB    1 
ATOM   2059  C  CG    . LEU A 1  266  ? 88.083  40.342  -34.483 1.00 74.26  ? 266  LEU A CG    1 
ATOM   2060  C  CD1   . LEU A 1  266  ? 89.149  39.333  -34.281 1.00 73.67  ? 266  LEU A CD1   1 
ATOM   2061  C  CD2   . LEU A 1  266  ? 88.426  41.189  -35.656 1.00 75.38  ? 266  LEU A CD2   1 
ATOM   2062  N  N     . ALA A 1  267  ? 83.597  39.197  -34.664 1.00 74.65  ? 267  ALA A N     1 
ATOM   2063  C  CA    . ALA A 1  267  ? 82.361  38.750  -35.288 1.00 75.96  ? 267  ALA A CA    1 
ATOM   2064  C  C     . ALA A 1  267  ? 81.338  39.889  -35.400 1.00 80.08  ? 267  ALA A C     1 
ATOM   2065  O  O     . ALA A 1  267  ? 80.573  39.919  -36.355 1.00 79.57  ? 267  ALA A O     1 
ATOM   2066  C  CB    . ALA A 1  267  ? 81.786  37.582  -34.522 1.00 76.83  ? 267  ALA A CB    1 
ATOM   2067  N  N     . ASP A 1  268  ? 81.364  40.847  -34.461 1.00 78.20  ? 268  ASP A N     1 
ATOM   2068  C  CA    . ASP A 1  268  ? 80.500  42.029  -34.496 1.00 80.20  ? 268  ASP A CA    1 
ATOM   2069  C  C     . ASP A 1  268  ? 80.838  42.809  -35.774 1.00 83.17  ? 268  ASP A C     1 
ATOM   2070  O  O     . ASP A 1  268  ? 79.928  43.140  -36.543 1.00 84.02  ? 268  ASP A O     1 
ATOM   2071  C  CB    . ASP A 1  268  ? 80.740  42.941  -33.262 1.00 83.27  ? 268  ASP A CB    1 
ATOM   2072  C  CG    . ASP A 1  268  ? 80.058  42.548  -31.959 1.00 106.81 ? 268  ASP A CG    1 
ATOM   2073  O  OD1   . ASP A 1  268  ? 78.992  41.865  -32.021 1.00 111.61 ? 268  ASP A OD1   1 
ATOM   2074  O  OD2   . ASP A 1  268  ? 80.542  42.989  -30.872 1.00 111.48 ? 268  ASP A OD2   1 
ATOM   2075  N  N     . ILE A 1  269  ? 82.163  43.062  -36.002 1.00 76.83  ? 269  ILE A N     1 
ATOM   2076  C  CA    . ILE A 1  269  ? 82.706  43.767  -37.168 1.00 75.76  ? 269  ILE A CA    1 
ATOM   2077  C  C     . ILE A 1  269  ? 82.259  43.006  -38.401 1.00 80.38  ? 269  ILE A C     1 
ATOM   2078  O  O     . ILE A 1  269  ? 81.659  43.582  -39.309 1.00 80.44  ? 269  ILE A O     1 
ATOM   2079  C  CB    . ILE A 1  269  ? 84.259  43.902  -37.115 1.00 76.97  ? 269  ILE A CB    1 
ATOM   2080  C  CG1   . ILE A 1  269  ? 84.725  44.720  -35.901 1.00 76.04  ? 269  ILE A CG1   1 
ATOM   2081  C  CG2   . ILE A 1  269  ? 84.810  44.482  -38.429 1.00 77.47  ? 269  ILE A CG2   1 
ATOM   2082  C  CD1   . ILE A 1  269  ? 86.184  44.546  -35.561 1.00 81.36  ? 269  ILE A CD1   1 
ATOM   2083  N  N     . LEU A 1  270  ? 82.516  41.694  -38.393 1.00 77.09  ? 270  LEU A N     1 
ATOM   2084  C  CA    . LEU A 1  270  ? 82.156  40.779  -39.457 1.00 77.20  ? 270  LEU A CA    1 
ATOM   2085  C  C     . LEU A 1  270  ? 80.695  40.978  -39.824 1.00 83.58  ? 270  LEU A C     1 
ATOM   2086  O  O     . LEU A 1  270  ? 80.417  41.429  -40.930 1.00 83.97  ? 270  LEU A O     1 
ATOM   2087  C  CB    . LEU A 1  270  ? 82.446  39.338  -39.004 1.00 75.93  ? 270  LEU A CB    1 
ATOM   2088  C  CG    . LEU A 1  270  ? 83.322  38.499  -39.895 1.00 80.16  ? 270  LEU A CG    1 
ATOM   2089  C  CD1   . LEU A 1  270  ? 82.558  37.967  -41.042 1.00 81.68  ? 270  LEU A CD1   1 
ATOM   2090  C  CD2   . LEU A 1  270  ? 84.504  39.275  -40.407 1.00 83.70  ? 270  LEU A CD2   1 
ATOM   2091  N  N     . LYS A 1  271  ? 79.791  40.793  -38.854 1.00 81.73  ? 271  LYS A N     1 
ATOM   2092  C  CA    . LYS A 1  271  ? 78.349  40.963  -39.024 1.00 83.72  ? 271  LYS A CA    1 
ATOM   2093  C  C     . LYS A 1  271  ? 77.968  42.369  -39.568 1.00 89.77  ? 271  LYS A C     1 
ATOM   2094  O  O     . LYS A 1  271  ? 77.229  42.463  -40.562 1.00 89.68  ? 271  LYS A O     1 
ATOM   2095  C  CB    . LYS A 1  271  ? 77.603  40.609  -37.717 1.00 86.16  ? 271  LYS A CB    1 
ATOM   2096  C  CG    . LYS A 1  271  ? 77.566  39.098  -37.408 1.00 93.85  ? 271  LYS A CG    1 
ATOM   2097  C  CD    . LYS A 1  271  ? 76.753  38.709  -36.139 1.00 100.67 ? 271  LYS A CD    1 
ATOM   2098  C  CE    . LYS A 1  271  ? 77.517  38.801  -34.827 1.00 103.78 ? 271  LYS A CE    1 
ATOM   2099  N  NZ    . LYS A 1  271  ? 76.696  38.393  -33.653 1.00 101.49 ? 271  LYS A NZ    1 
ATOM   2100  N  N     . ALA A 1  272  ? 78.551  43.438  -38.963 1.00 86.85  ? 272  ALA A N     1 
ATOM   2101  C  CA    . ALA A 1  272  ? 78.348  44.848  -39.345 1.00 87.58  ? 272  ALA A CA    1 
ATOM   2102  C  C     . ALA A 1  272  ? 78.799  45.140  -40.789 1.00 91.65  ? 272  ALA A C     1 
ATOM   2103  O  O     . ALA A 1  272  ? 78.268  46.057  -41.446 1.00 90.93  ? 272  ALA A O     1 
ATOM   2104  C  CB    . ALA A 1  272  ? 79.085  45.764  -38.371 1.00 87.59  ? 272  ALA A CB    1 
ATOM   2105  N  N     . ASN A 1  273  ? 79.792  44.349  -41.259 1.00 88.50  ? 273  ASN A N     1 
ATOM   2106  C  CA    . ASN A 1  273  ? 80.384  44.441  -42.588 1.00 89.07  ? 273  ASN A CA    1 
ATOM   2107  C  C     . ASN A 1  273  ? 79.501  43.758  -43.607 1.00 95.27  ? 273  ASN A C     1 
ATOM   2108  O  O     . ASN A 1  273  ? 79.234  44.342  -44.662 1.00 96.32  ? 273  ASN A O     1 
ATOM   2109  C  CB    . ASN A 1  273  ? 81.801  43.844  -42.618 1.00 85.42  ? 273  ASN A CB    1 
ATOM   2110  C  CG    . ASN A 1  273  ? 82.600  44.299  -43.807 1.00 98.12  ? 273  ASN A CG    1 
ATOM   2111  O  OD1   . ASN A 1  273  ? 82.896  45.482  -43.960 1.00 92.75  ? 273  ASN A OD1   1 
ATOM   2112  N  ND2   . ASN A 1  273  ? 82.927  43.385  -44.703 1.00 89.41  ? 273  ASN A ND2   1 
ATOM   2113  N  N     . ILE A 1  274  ? 79.033  42.531  -43.290 1.00 92.00  ? 274  ILE A N     1 
ATOM   2114  C  CA    . ILE A 1  274  ? 78.177  41.757  -44.186 1.00 93.30  ? 274  ILE A CA    1 
ATOM   2115  C  C     . ILE A 1  274  ? 76.891  42.512  -44.484 1.00 102.62 ? 274  ILE A C     1 
ATOM   2116  O  O     . ILE A 1  274  ? 76.468  42.524  -45.647 1.00 104.45 ? 274  ILE A O     1 
ATOM   2117  C  CB    . ILE A 1  274  ? 77.920  40.311  -43.720 1.00 95.21  ? 274  ILE A CB    1 
ATOM   2118  C  CG1   . ILE A 1  274  ? 79.231  39.626  -43.300 1.00 94.33  ? 274  ILE A CG1   1 
ATOM   2119  C  CG2   . ILE A 1  274  ? 77.249  39.520  -44.844 1.00 96.55  ? 274  ILE A CG2   1 
ATOM   2120  C  CD1   . ILE A 1  274  ? 79.111  38.673  -42.157 1.00 101.32 ? 274  ILE A CD1   1 
ATOM   2121  N  N     . SER A 1  275  ? 76.304  43.183  -43.452 1.00 99.98  ? 275  SER A N     1 
ATOM   2122  C  CA    . SER A 1  275  ? 75.093  44.001  -43.593 1.00 101.26 ? 275  SER A CA    1 
ATOM   2123  C  C     . SER A 1  275  ? 75.319  45.074  -44.652 1.00 104.53 ? 275  SER A C     1 
ATOM   2124  O  O     . SER A 1  275  ? 74.601  45.110  -45.650 1.00 104.60 ? 275  SER A O     1 
ATOM   2125  C  CB    . SER A 1  275  ? 74.721  44.658  -42.263 1.00 107.14 ? 275  SER A CB    1 
ATOM   2126  O  OG    . SER A 1  275  ? 75.522  45.793  -41.947 1.00 121.99 ? 275  SER A OG    1 
ATOM   2127  N  N     . LEU A 1  276  ? 76.367  45.900  -44.446 1.00 100.69 ? 276  LEU A N     1 
ATOM   2128  C  CA    . LEU A 1  276  ? 76.748  47.005  -45.305 1.00 101.49 ? 276  LEU A CA    1 
ATOM   2129  C  C     . LEU A 1  276  ? 76.917  46.576  -46.752 1.00 110.30 ? 276  LEU A C     1 
ATOM   2130  O  O     . LEU A 1  276  ? 76.253  47.129  -47.633 1.00 111.75 ? 276  LEU A O     1 
ATOM   2131  C  CB    . LEU A 1  276  ? 78.012  47.677  -44.774 1.00 99.97  ? 276  LEU A CB    1 
ATOM   2132  C  CG    . LEU A 1  276  ? 78.390  48.973  -45.458 1.00 104.38 ? 276  LEU A CG    1 
ATOM   2133  C  CD1   . LEU A 1  276  ? 77.410  50.083  -45.130 1.00 104.70 ? 276  LEU A CD1   1 
ATOM   2134  C  CD2   . LEU A 1  276  ? 79.774  49.377  -45.087 1.00 106.27 ? 276  LEU A CD2   1 
ATOM   2135  N  N     . GLU A 1  277  ? 77.768  45.564  -46.983 1.00 108.77 ? 277  GLU A N     1 
ATOM   2136  C  CA    . GLU A 1  277  ? 78.060  44.989  -48.299 1.00 110.60 ? 277  GLU A CA    1 
ATOM   2137  C  C     . GLU A 1  277  ? 76.767  44.571  -49.053 1.00 116.20 ? 277  GLU A C     1 
ATOM   2138  O  O     . GLU A 1  277  ? 76.622  44.890  -50.240 1.00 117.15 ? 277  GLU A O     1 
ATOM   2139  C  CB    . GLU A 1  277  ? 79.073  43.828  -48.138 1.00 111.56 ? 277  GLU A CB    1 
ATOM   2140  C  CG    . GLU A 1  277  ? 79.375  42.995  -49.381 1.00 128.37 ? 277  GLU A CG    1 
ATOM   2141  C  CD    . GLU A 1  277  ? 78.626  41.675  -49.490 1.00 163.20 ? 277  GLU A CD    1 
ATOM   2142  O  OE1   . GLU A 1  277  ? 78.447  40.986  -48.456 1.00 160.96 ? 277  GLU A OE1   1 
ATOM   2143  O  OE2   . GLU A 1  277  ? 78.239  41.319  -50.627 1.00 164.22 ? 277  GLU A OE2   1 
ATOM   2144  N  N     . THR A 1  278  ? 75.825  43.898  -48.353 1.00 112.14 ? 278  THR A N     1 
ATOM   2145  C  CA    . THR A 1  278  ? 74.573  43.465  -48.974 1.00 112.59 ? 278  THR A CA    1 
ATOM   2146  C  C     . THR A 1  278  ? 73.647  44.648  -49.268 1.00 118.04 ? 278  THR A C     1 
ATOM   2147  O  O     . THR A 1  278  ? 72.943  44.608  -50.269 1.00 119.09 ? 278  THR A O     1 
ATOM   2148  C  CB    . THR A 1  278  ? 73.933  42.241  -48.275 1.00 113.22 ? 278  THR A CB    1 
ATOM   2149  O  OG1   . THR A 1  278  ? 73.480  42.604  -46.977 1.00 111.47 ? 278  THR A OG1   1 
ATOM   2150  C  CG2   . THR A 1  278  ? 74.870  41.028  -48.196 1.00 107.14 ? 278  THR A CG2   1 
ATOM   2151  N  N     . LEU A 1  279  ? 73.698  45.722  -48.456 1.00 114.66 ? 279  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  279  ? 72.863  46.900  -48.706 1.00 116.16 ? 279  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  279  ? 73.277  47.602  -49.979 1.00 125.91 ? 279  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  279  ? 72.412  47.928  -50.789 1.00 127.18 ? 279  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  279  ? 72.855  47.897  -47.542 1.00 114.96 ? 279  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  279  ? 72.358  47.424  -46.184 1.00 117.81 ? 279  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  279  ? 72.015  48.602  -45.317 1.00 117.60 ? 279  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  279  ? 71.165  46.488  -46.299 1.00 120.13 ? 279  LEU A CD2   1 
ATOM   2159  N  N     . GLU A 1  280  ? 74.590  47.815  -50.175 1.00 125.53 ? 280  GLU A N     1 
ATOM   2160  C  CA    . GLU A 1  280  ? 75.078  48.466  -51.391 1.00 128.19 ? 280  GLU A CA    1 
ATOM   2161  C  C     . GLU A 1  280  ? 75.003  47.594  -52.644 1.00 137.90 ? 280  GLU A C     1 
ATOM   2162  O  O     . GLU A 1  280  ? 74.744  48.127  -53.730 1.00 138.85 ? 280  GLU A O     1 
ATOM   2163  C  CB    . GLU A 1  280  ? 76.437  49.151  -51.217 1.00 128.67 ? 280  GLU A CB    1 
ATOM   2164  C  CG    . GLU A 1  280  ? 77.516  48.306  -50.579 1.00 138.17 ? 280  GLU A CG    1 
ATOM   2165  C  CD    . GLU A 1  280  ? 78.459  49.151  -49.753 1.00 165.77 ? 280  GLU A CD    1 
ATOM   2166  O  OE1   . GLU A 1  280  ? 77.989  49.780  -48.778 1.00 162.34 ? 280  GLU A OE1   1 
ATOM   2167  O  OE2   . GLU A 1  280  ? 79.655  49.233  -50.114 1.00 168.54 ? 280  GLU A OE2   1 
ATOM   2168  N  N     . HIS A 1  281  ? 75.187  46.260  -52.497 1.00 137.28 ? 281  HIS A N     1 
ATOM   2169  C  CA    . HIS A 1  281  ? 75.069  45.331  -53.626 1.00 139.41 ? 281  HIS A CA    1 
ATOM   2170  C  C     . HIS A 1  281  ? 73.594  45.271  -54.079 1.00 145.43 ? 281  HIS A C     1 
ATOM   2171  O  O     . HIS A 1  281  ? 73.320  45.330  -55.282 1.00 146.38 ? 281  HIS A O     1 
ATOM   2172  C  CB    . HIS A 1  281  ? 75.615  43.929  -53.288 1.00 139.75 ? 281  HIS A CB    1 
ATOM   2173  C  CG    . HIS A 1  281  ? 75.625  42.994  -54.465 1.00 144.53 ? 281  HIS A CG    1 
ATOM   2174  N  ND1   . HIS A 1  281  ? 74.500  42.254  -54.815 1.00 147.34 ? 281  HIS A ND1   1 
ATOM   2175  C  CD2   . HIS A 1  281  ? 76.613  42.731  -55.353 1.00 146.81 ? 281  HIS A CD2   1 
ATOM   2176  C  CE1   . HIS A 1  281  ? 74.844  41.565  -55.892 1.00 147.51 ? 281  HIS A CE1   1 
ATOM   2177  N  NE2   . HIS A 1  281  ? 76.105  41.815  -56.253 1.00 147.54 ? 281  HIS A NE2   1 
ATOM   2178  N  N     . ASN A 1  282  ? 72.657  45.199  -53.108 1.00 141.78 ? 282  ASN A N     1 
ATOM   2179  C  CA    . ASN A 1  282  ? 71.222  45.178  -53.371 1.00 142.91 ? 282  ASN A CA    1 
ATOM   2180  C  C     . ASN A 1  282  ? 70.685  46.592  -53.505 1.00 149.71 ? 282  ASN A C     1 
ATOM   2181  O  O     . ASN A 1  282  ? 71.467  47.547  -53.607 1.00 148.76 ? 282  ASN A O     1 
ATOM   2182  C  CB    . ASN A 1  282  ? 70.478  44.427  -52.266 1.00 140.91 ? 282  ASN A CB    1 
ATOM   2183  C  CG    . ASN A 1  282  ? 70.604  42.930  -52.353 1.00 159.81 ? 282  ASN A CG    1 
ATOM   2184  O  OD1   . ASN A 1  282  ? 71.459  42.381  -53.065 1.00 151.32 ? 282  ASN A OD1   1 
ATOM   2185  N  ND2   . ASN A 1  282  ? 69.744  42.232  -51.625 1.00 151.89 ? 282  ASN A ND2   1 
ATOM   2186  N  N     . GLY A 1  283  ? 69.353  46.701  -53.523 1.00 149.35 ? 283  GLY A N     1 
ATOM   2187  C  CA    . GLY A 1  283  ? 68.631  47.963  -53.614 1.00 151.10 ? 283  GLY A CA    1 
ATOM   2188  C  C     . GLY A 1  283  ? 69.023  48.870  -52.471 1.00 155.84 ? 283  GLY A C     1 
ATOM   2189  O  O     . GLY A 1  283  ? 68.486  48.751  -51.366 1.00 155.11 ? 283  GLY A O     1 
ATOM   2190  N  N     . ALA A 1  284  ? 70.031  49.719  -52.732 1.00 152.91 ? 284  ALA A N     1 
ATOM   2191  C  CA    . ALA A 1  284  ? 70.628  50.647  -51.786 1.00 152.23 ? 284  ALA A CA    1 
ATOM   2192  C  C     . ALA A 1  284  ? 69.650  51.758  -51.324 1.00 158.52 ? 284  ALA A C     1 
ATOM   2193  O  O     . ALA A 1  284  ? 69.475  52.730  -52.063 1.00 159.87 ? 284  ALA A O     1 
ATOM   2194  C  CB    . ALA A 1  284  ? 71.887  51.252  -52.400 1.00 152.74 ? 284  ALA A CB    1 
ATOM   2195  N  N     . PRO A 1  285  ? 69.027  51.679  -50.110 1.00 154.79 ? 285  PRO A N     1 
ATOM   2196  C  CA    . PRO A 1  285  ? 68.115  52.757  -49.682 1.00 155.57 ? 285  PRO A CA    1 
ATOM   2197  C  C     . PRO A 1  285  ? 68.808  54.037  -49.150 1.00 161.20 ? 285  PRO A C     1 
ATOM   2198  O  O     . PRO A 1  285  ? 68.248  54.715  -48.282 1.00 161.37 ? 285  PRO A O     1 
ATOM   2199  C  CB    . PRO A 1  285  ? 67.205  52.068  -48.642 1.00 156.56 ? 285  PRO A CB    1 
ATOM   2200  C  CG    . PRO A 1  285  ? 67.641  50.609  -48.608 1.00 159.97 ? 285  PRO A CG    1 
ATOM   2201  C  CD    . PRO A 1  285  ? 69.055  50.610  -49.097 1.00 154.95 ? 285  PRO A CD    1 
ATOM   2202  N  N     . HIS A 1  286  ? 70.021  54.369  -49.694 1.00 158.20 ? 286  HIS A N     1 
ATOM   2203  C  CA    . HIS A 1  286  ? 70.900  55.548  -49.475 1.00 157.95 ? 286  HIS A CA    1 
ATOM   2204  C  C     . HIS A 1  286  ? 71.208  56.025  -48.061 1.00 156.82 ? 286  HIS A C     1 
ATOM   2205  O  O     . HIS A 1  286  ? 72.355  56.362  -47.790 1.00 155.00 ? 286  HIS A O     1 
ATOM   2206  C  CB    . HIS A 1  286  ? 70.543  56.726  -50.401 1.00 161.46 ? 286  HIS A CB    1 
ATOM   2207  C  CG    . HIS A 1  286  ? 70.242  56.323  -51.819 1.00 167.07 ? 286  HIS A CG    1 
ATOM   2208  N  ND1   . HIS A 1  286  ? 71.230  55.818  -52.659 1.00 169.09 ? 286  HIS A ND1   1 
ATOM   2209  C  CD2   . HIS A 1  286  ? 69.067  56.356  -52.498 1.00 170.76 ? 286  HIS A CD2   1 
ATOM   2210  C  CE1   . HIS A 1  286  ? 70.625  55.563  -53.811 1.00 170.01 ? 286  HIS A CE1   1 
ATOM   2211  N  NE2   . HIS A 1  286  ? 69.324  55.872  -53.764 1.00 171.33 ? 286  HIS A NE2   1 
ATOM   2212  N  N     . HIS A 1  287  ? 70.192  56.134  -47.198 1.00 151.61 ? 287  HIS A N     1 
ATOM   2213  C  CA    . HIS A 1  287  ? 70.346  56.511  -45.799 1.00 149.76 ? 287  HIS A CA    1 
ATOM   2214  C  C     . HIS A 1  287  ? 70.706  55.256  -44.999 1.00 150.25 ? 287  HIS A C     1 
ATOM   2215  O  O     . HIS A 1  287  ? 71.457  55.339  -44.026 1.00 148.52 ? 287  HIS A O     1 
ATOM   2216  C  CB    . HIS A 1  287  ? 69.064  57.163  -45.252 1.00 151.60 ? 287  HIS A CB    1 
ATOM   2217  C  CG    . HIS A 1  287  ? 68.940  57.080  -43.759 1.00 154.30 ? 287  HIS A CG    1 
ATOM   2218  N  ND1   . HIS A 1  287  ? 68.239  56.050  -43.148 1.00 155.83 ? 287  HIS A ND1   1 
ATOM   2219  C  CD2   . HIS A 1  287  ? 69.496  57.855  -42.800 1.00 155.47 ? 287  HIS A CD2   1 
ATOM   2220  C  CE1   . HIS A 1  287  ? 68.366  56.250  -41.845 1.00 154.35 ? 287  HIS A CE1   1 
ATOM   2221  N  NE2   . HIS A 1  287  ? 69.111  57.324  -41.586 1.00 154.44 ? 287  HIS A NE2   1 
ATOM   2222  N  N     . ALA A 1  288  ? 70.162  54.093  -45.410 1.00 145.77 ? 288  ALA A N     1 
ATOM   2223  C  CA    . ALA A 1  288  ? 70.383  52.788  -44.771 1.00 143.88 ? 288  ALA A CA    1 
ATOM   2224  C  C     . ALA A 1  288  ? 71.844  52.403  -44.749 1.00 144.26 ? 288  ALA A C     1 
ATOM   2225  O  O     . ALA A 1  288  ? 72.270  51.650  -43.875 1.00 142.36 ? 288  ALA A O     1 
ATOM   2226  C  CB    . ALA A 1  288  ? 69.590  51.716  -45.494 1.00 145.39 ? 288  ALA A CB    1 
ATOM   2227  N  N     . ILE A 1  289  ? 72.599  52.928  -45.715 1.00 139.97 ? 289  ILE A N     1 
ATOM   2228  C  CA    . ILE A 1  289  ? 74.017  52.680  -45.884 1.00 138.67 ? 289  ILE A CA    1 
ATOM   2229  C  C     . ILE A 1  289  ? 74.849  53.541  -44.934 1.00 141.64 ? 289  ILE A C     1 
ATOM   2230  O  O     . ILE A 1  289  ? 75.637  52.978  -44.173 1.00 140.93 ? 289  ILE A O     1 
ATOM   2231  C  CB    . ILE A 1  289  ? 74.424  52.767  -47.380 1.00 142.55 ? 289  ILE A CB    1 
ATOM   2232  C  CG1   . ILE A 1  289  ? 73.712  51.672  -48.201 1.00 143.65 ? 289  ILE A CG1   1 
ATOM   2233  C  CG2   . ILE A 1  289  ? 75.939  52.665  -47.571 1.00 142.51 ? 289  ILE A CG2   1 
ATOM   2234  C  CD1   . ILE A 1  289  ? 72.421  52.085  -48.777 1.00 152.76 ? 289  ILE A CD1   1 
ATOM   2235  N  N     . GLU A 1  290  ? 74.639  54.881  -44.920 1.00 137.59 ? 290  GLU A N     1 
ATOM   2236  C  CA    . GLU A 1  290  ? 75.354  55.804  -44.014 1.00 136.18 ? 290  GLU A CA    1 
ATOM   2237  C  C     . GLU A 1  290  ? 75.089  55.460  -42.538 1.00 136.41 ? 290  GLU A C     1 
ATOM   2238  O  O     . GLU A 1  290  ? 75.787  55.942  -41.645 1.00 135.29 ? 290  GLU A O     1 
ATOM   2239  C  CB    . GLU A 1  290  ? 75.085  57.297  -44.350 1.00 138.92 ? 290  GLU A CB    1 
ATOM   2240  C  CG    . GLU A 1  290  ? 73.617  57.695  -44.475 1.00 154.95 ? 290  GLU A CG    1 
ATOM   2241  C  CD    . GLU A 1  290  ? 73.294  58.954  -45.265 1.00 183.45 ? 290  GLU A CD    1 
ATOM   2242  O  OE1   . GLU A 1  290  ? 73.732  60.047  -44.839 1.00 181.57 ? 290  GLU A OE1   1 
ATOM   2243  O  OE2   . GLU A 1  290  ? 72.564  58.856  -46.280 1.00 175.79 ? 290  GLU A OE2   1 
ATOM   2244  N  N     . GLU A 1  291  ? 74.110  54.563  -42.321 1.00 130.81 ? 291  GLU A N     1 
ATOM   2245  C  CA    . GLU A 1  291  ? 73.688  54.009  -41.048 1.00 129.00 ? 291  GLU A CA    1 
ATOM   2246  C  C     . GLU A 1  291  ? 74.589  52.810  -40.720 1.00 128.69 ? 291  GLU A C     1 
ATOM   2247  O  O     . GLU A 1  291  ? 75.349  52.883  -39.751 1.00 126.91 ? 291  GLU A O     1 
ATOM   2248  C  CB    . GLU A 1  291  ? 72.213  53.571  -41.150 1.00 131.52 ? 291  GLU A CB    1 
ATOM   2249  C  CG    . GLU A 1  291  ? 71.533  53.298  -39.821 1.00 144.57 ? 291  GLU A CG    1 
ATOM   2250  C  CD    . GLU A 1  291  ? 71.057  54.552  -39.121 1.00 175.32 ? 291  GLU A CD    1 
ATOM   2251  O  OE1   . GLU A 1  291  ? 71.896  55.228  -38.481 1.00 174.64 ? 291  GLU A OE1   1 
ATOM   2252  O  OE2   . GLU A 1  291  ? 69.855  54.883  -39.248 1.00 174.77 ? 291  GLU A OE2   1 
ATOM   2253  N  N     . ALA A 1  292  ? 74.522  51.721  -41.551 1.00 123.46 ? 292  ALA A N     1 
ATOM   2254  C  CA    . ALA A 1  292  ? 75.300  50.470  -41.410 1.00 121.15 ? 292  ALA A CA    1 
ATOM   2255  C  C     . ALA A 1  292  ? 76.800  50.703  -41.490 1.00 121.05 ? 292  ALA A C     1 
ATOM   2256  O  O     . ALA A 1  292  ? 77.564  49.920  -40.907 1.00 119.30 ? 292  ALA A O     1 
ATOM   2257  C  CB    . ALA A 1  292  ? 74.873  49.448  -42.450 1.00 122.47 ? 292  ALA A CB    1 
ATOM   2258  N  N     . GLU A 1  293  ? 77.210  51.795  -42.209 1.00 115.29 ? 293  GLU A N     1 
ATOM   2259  C  CA    . GLU A 1  293  ? 78.587  52.266  -42.342 1.00 112.76 ? 293  GLU A CA    1 
ATOM   2260  C  C     . GLU A 1  293  ? 79.016  52.747  -40.954 1.00 113.09 ? 293  GLU A C     1 
ATOM   2261  O  O     . GLU A 1  293  ? 79.946  52.174  -40.379 1.00 112.39 ? 293  GLU A O     1 
ATOM   2262  C  CB    . GLU A 1  293  ? 78.716  53.389  -43.398 1.00 114.83 ? 293  GLU A CB    1 
ATOM   2263  C  CG    . GLU A 1  293  ? 80.114  53.996  -43.462 1.00 125.98 ? 293  GLU A CG    1 
ATOM   2264  C  CD    . GLU A 1  293  ? 80.593  54.588  -44.778 1.00 148.52 ? 293  GLU A CD    1 
ATOM   2265  O  OE1   . GLU A 1  293  ? 79.746  55.073  -45.564 1.00 143.22 ? 293  GLU A OE1   1 
ATOM   2266  O  OE2   . GLU A 1  293  ? 81.827  54.600  -45.003 1.00 134.00 ? 293  GLU A OE2   1 
ATOM   2267  N  N     . SER A 1  294  ? 78.275  53.720  -40.375 1.00 106.62 ? 294  SER A N     1 
ATOM   2268  C  CA    . SER A 1  294  ? 78.549  54.272  -39.044 1.00 103.96 ? 294  SER A CA    1 
ATOM   2269  C  C     . SER A 1  294  ? 78.624  53.218  -37.932 1.00 102.06 ? 294  SER A C     1 
ATOM   2270  O  O     . SER A 1  294  ? 79.294  53.441  -36.917 1.00 100.07 ? 294  SER A O     1 
ATOM   2271  C  CB    . SER A 1  294  ? 77.553  55.370  -38.701 1.00 108.65 ? 294  SER A CB    1 
ATOM   2272  O  OG    . SER A 1  294  ? 77.674  56.454  -39.607 1.00 119.26 ? 294  SER A OG    1 
ATOM   2273  N  N     . LEU A 1  295  ? 77.972  52.061  -38.145 1.00 96.11  ? 295  LEU A N     1 
ATOM   2274  C  CA    . LEU A 1  295  ? 78.000  50.951  -37.197 1.00 94.01  ? 295  LEU A CA    1 
ATOM   2275  C  C     . LEU A 1  295  ? 79.314  50.167  -37.336 1.00 94.16  ? 295  LEU A C     1 
ATOM   2276  O  O     . LEU A 1  295  ? 79.910  49.765  -36.324 1.00 92.97  ? 295  LEU A O     1 
ATOM   2277  C  CB    . LEU A 1  295  ? 76.782  50.036  -37.391 1.00 94.33  ? 295  LEU A CB    1 
ATOM   2278  C  CG    . LEU A 1  295  ? 76.816  48.702  -36.648 1.00 97.68  ? 295  LEU A CG    1 
ATOM   2279  C  CD1   . LEU A 1  295  ? 76.525  48.872  -35.170 1.00 96.81  ? 295  LEU A CD1   1 
ATOM   2280  C  CD2   . LEU A 1  295  ? 75.888  47.708  -37.292 1.00 101.83 ? 295  LEU A CD2   1 
ATOM   2281  N  N     . LEU A 1  296  ? 79.744  49.933  -38.593 1.00 87.54  ? 296  LEU A N     1 
ATOM   2282  C  CA    . LEU A 1  296  ? 80.992  49.245  -38.884 1.00 84.81  ? 296  LEU A CA    1 
ATOM   2283  C  C     . LEU A 1  296  ? 82.142  50.105  -38.349 1.00 86.75  ? 296  LEU A C     1 
ATOM   2284  O  O     . LEU A 1  296  ? 83.009  49.574  -37.658 1.00 85.32  ? 296  LEU A O     1 
ATOM   2285  C  CB    . LEU A 1  296  ? 81.123  49.013  -40.391 1.00 84.92  ? 296  LEU A CB    1 
ATOM   2286  C  CG    . LEU A 1  296  ? 82.443  48.467  -40.885 1.00 87.72  ? 296  LEU A CG    1 
ATOM   2287  C  CD1   . LEU A 1  296  ? 82.539  46.992  -40.622 1.00 86.99  ? 296  LEU A CD1   1 
ATOM   2288  C  CD2   . LEU A 1  296  ? 82.623  48.753  -42.357 1.00 89.73  ? 296  LEU A CD2   1 
ATOM   2289  N  N     . GLN A 1  297  ? 82.101  51.441  -38.598 1.00 82.53  ? 297  GLN A N     1 
ATOM   2290  C  CA    . GLN A 1  297  ? 83.093  52.383  -38.084 1.00 81.58  ? 297  GLN A CA    1 
ATOM   2291  C  C     . GLN A 1  297  ? 83.140  52.269  -36.573 1.00 86.53  ? 297  GLN A C     1 
ATOM   2292  O  O     . GLN A 1  297  ? 84.227  52.285  -36.010 1.00 86.24  ? 297  GLN A O     1 
ATOM   2293  C  CB    . GLN A 1  297  ? 82.774  53.827  -38.519 1.00 83.49  ? 297  GLN A CB    1 
ATOM   2294  C  CG    . GLN A 1  297  ? 83.561  54.971  -37.822 1.00 87.50  ? 297  GLN A CG    1 
ATOM   2295  C  CD    . GLN A 1  297  ? 85.045  55.000  -38.126 1.00 96.27  ? 297  GLN A CD    1 
ATOM   2296  O  OE1   . GLN A 1  297  ? 85.531  55.672  -39.047 1.00 91.47  ? 297  GLN A OE1   1 
ATOM   2297  N  NE2   . GLN A 1  297  ? 85.804  54.317  -37.313 1.00 84.64  ? 297  GLN A NE2   1 
ATOM   2298  N  N     . PHE A 1  298  ? 81.975  52.097  -35.926 1.00 83.86  ? 298  PHE A N     1 
ATOM   2299  C  CA    . PHE A 1  298  ? 81.896  51.956  -34.481 1.00 83.31  ? 298  PHE A CA    1 
ATOM   2300  C  C     . PHE A 1  298  ? 82.644  50.731  -33.964 1.00 85.45  ? 298  PHE A C     1 
ATOM   2301  O  O     . PHE A 1  298  ? 83.452  50.859  -33.042 1.00 82.79  ? 298  PHE A O     1 
ATOM   2302  C  CB    . PHE A 1  298  ? 80.437  51.928  -34.014 1.00 86.12  ? 298  PHE A CB    1 
ATOM   2303  C  CG    . PHE A 1  298  ? 80.263  51.627  -32.538 1.00 87.53  ? 298  PHE A CG    1 
ATOM   2304  C  CD1   . PHE A 1  298  ? 80.487  52.615  -31.574 1.00 90.44  ? 298  PHE A CD1   1 
ATOM   2305  C  CD2   . PHE A 1  298  ? 79.865  50.363  -32.109 1.00 89.20  ? 298  PHE A CD2   1 
ATOM   2306  C  CE1   . PHE A 1  298  ? 80.307  52.346  -30.214 1.00 90.37  ? 298  PHE A CE1   1 
ATOM   2307  C  CE2   . PHE A 1  298  ? 79.713  50.088  -30.745 1.00 91.25  ? 298  PHE A CE2   1 
ATOM   2308  C  CZ    . PHE A 1  298  ? 79.926  51.084  -29.809 1.00 89.01  ? 298  PHE A CZ    1 
ATOM   2309  N  N     . HIS A 1  299  ? 82.338  49.549  -34.517 1.00 83.85  ? 299  HIS A N     1 
ATOM   2310  C  CA    . HIS A 1  299  ? 82.966  48.294  -34.095 1.00 83.84  ? 299  HIS A CA    1 
ATOM   2311  C  C     . HIS A 1  299  ? 84.478  48.254  -34.336 1.00 88.05  ? 299  HIS A C     1 
ATOM   2312  O  O     . HIS A 1  299  ? 85.215  47.805  -33.455 1.00 87.50  ? 299  HIS A O     1 
ATOM   2313  C  CB    . HIS A 1  299  ? 82.276  47.074  -34.722 1.00 85.05  ? 299  HIS A CB    1 
ATOM   2314  C  CG    . HIS A 1  299  ? 80.918  46.780  -34.176 1.00 88.70  ? 299  HIS A CG    1 
ATOM   2315  N  ND1   . HIS A 1  299  ? 80.551  47.158  -32.896 1.00 89.99  ? 299  HIS A ND1   1 
ATOM   2316  C  CD2   . HIS A 1  299  ? 79.892  46.109  -34.749 1.00 91.17  ? 299  HIS A CD2   1 
ATOM   2317  C  CE1   . HIS A 1  299  ? 79.315  46.724  -32.740 1.00 90.05  ? 299  HIS A CE1   1 
ATOM   2318  N  NE2   . HIS A 1  299  ? 78.879  46.079  -33.826 1.00 91.05  ? 299  HIS A NE2   1 
ATOM   2319  N  N     . VAL A 1  300  ? 84.938  48.754  -35.507 1.00 83.88  ? 300  VAL A N     1 
ATOM   2320  C  CA    . VAL A 1  300  ? 86.356  48.825  -35.857 1.00 82.30  ? 300  VAL A CA    1 
ATOM   2321  C  C     . VAL A 1  300  ? 87.070  49.817  -34.909 1.00 85.97  ? 300  VAL A C     1 
ATOM   2322  O  O     . VAL A 1  300  ? 88.218  49.580  -34.539 1.00 85.78  ? 300  VAL A O     1 
ATOM   2323  C  CB    . VAL A 1  300  ? 86.560  49.100  -37.368 1.00 86.13  ? 300  VAL A CB    1 
ATOM   2324  C  CG1   . VAL A 1  300  ? 88.037  49.204  -37.729 1.00 85.64  ? 300  VAL A CG1   1 
ATOM   2325  C  CG2   . VAL A 1  300  ? 85.898  48.011  -38.200 1.00 85.98  ? 300  VAL A CG2   1 
ATOM   2326  N  N     . ALA A 1  301  ? 86.351  50.854  -34.434 1.00 82.27  ? 301  ALA A N     1 
ATOM   2327  C  CA    . ALA A 1  301  ? 86.864  51.817  -33.459 1.00 81.22  ? 301  ALA A CA    1 
ATOM   2328  C  C     . ALA A 1  301  ? 86.950  51.160  -32.061 1.00 84.42  ? 301  ALA A C     1 
ATOM   2329  O  O     . ALA A 1  301  ? 88.045  51.001  -31.513 1.00 82.11  ? 301  ALA A O     1 
ATOM   2330  C  CB    . ALA A 1  301  ? 85.970  53.048  -33.413 1.00 82.38  ? 301  ALA A CB    1 
ATOM   2331  N  N     . THR A 1  302  ? 85.801  50.718  -31.523 1.00 82.61  ? 302  THR A N     1 
ATOM   2332  C  CA    . THR A 1  302  ? 85.716  50.082  -30.208 1.00 82.50  ? 302  THR A CA    1 
ATOM   2333  C  C     . THR A 1  302  ? 86.560  48.818  -30.012 1.00 89.39  ? 302  THR A C     1 
ATOM   2334  O  O     . THR A 1  302  ? 86.951  48.546  -28.878 1.00 90.07  ? 302  THR A O     1 
ATOM   2335  C  CB    . THR A 1  302  ? 84.283  50.005  -29.691 1.00 84.54  ? 302  THR A CB    1 
ATOM   2336  O  OG1   . THR A 1  302  ? 83.454  49.374  -30.667 1.00 80.61  ? 302  THR A OG1   1 
ATOM   2337  C  CG2   . THR A 1  302  ? 83.733  51.378  -29.304 1.00 82.90  ? 302  THR A CG2   1 
ATOM   2338  N  N     . TYR A 1  303  ? 86.873  48.073  -31.101 1.00 86.18  ? 303  TYR A N     1 
ATOM   2339  C  CA    . TYR A 1  303  ? 87.720  46.869  -31.084 1.00 84.81  ? 303  TYR A CA    1 
ATOM   2340  C  C     . TYR A 1  303  ? 89.135  47.249  -30.654 1.00 87.89  ? 303  TYR A C     1 
ATOM   2341  O  O     . TYR A 1  303  ? 89.712  46.588  -29.784 1.00 86.75  ? 303  TYR A O     1 
ATOM   2342  C  CB    . TYR A 1  303  ? 87.675  46.202  -32.477 1.00 85.82  ? 303  TYR A CB    1 
ATOM   2343  C  CG    . TYR A 1  303  ? 88.814  45.299  -32.908 1.00 86.00  ? 303  TYR A CG    1 
ATOM   2344  C  CD1   . TYR A 1  303  ? 88.924  43.999  -32.418 1.00 86.56  ? 303  TYR A CD1   1 
ATOM   2345  C  CD2   . TYR A 1  303  ? 89.655  45.666  -33.953 1.00 87.24  ? 303  TYR A CD2   1 
ATOM   2346  C  CE1   . TYR A 1  303  ? 89.912  43.128  -32.883 1.00 85.74  ? 303  TYR A CE1   1 
ATOM   2347  C  CE2   . TYR A 1  303  ? 90.642  44.804  -34.430 1.00 87.96  ? 303  TYR A CE2   1 
ATOM   2348  C  CZ    . TYR A 1  303  ? 90.772  43.536  -33.891 1.00 92.51  ? 303  TYR A CZ    1 
ATOM   2349  O  OH    . TYR A 1  303  ? 91.776  42.718  -34.358 1.00 90.56  ? 303  TYR A OH    1 
ATOM   2350  N  N     . MET A 1  304  ? 89.629  48.379  -31.193 1.00 84.70  ? 304  MET A N     1 
ATOM   2351  C  CA    . MET A 1  304  ? 90.951  48.919  -30.918 1.00 84.65  ? 304  MET A CA    1 
ATOM   2352  C  C     . MET A 1  304  ? 91.001  49.717  -29.613 1.00 92.00  ? 304  MET A C     1 
ATOM   2353  O  O     . MET A 1  304  ? 91.841  49.422  -28.768 1.00 91.27  ? 304  MET A O     1 
ATOM   2354  C  CB    . MET A 1  304  ? 91.493  49.684  -32.137 1.00 87.21  ? 304  MET A CB    1 
ATOM   2355  C  CG    . MET A 1  304  ? 91.612  48.782  -33.377 1.00 90.71  ? 304  MET A CG    1 
ATOM   2356  S  SD    . MET A 1  304  ? 92.495  49.409  -34.827 1.00 94.70  ? 304  MET A SD    1 
ATOM   2357  C  CE    . MET A 1  304  ? 91.356  50.716  -35.345 1.00 92.57  ? 304  MET A CE    1 
ATOM   2358  N  N     . ASP A 1  305  ? 90.078  50.677  -29.415 1.00 91.10  ? 305  ASP A N     1 
ATOM   2359  C  CA    . ASP A 1  305  ? 89.985  51.470  -28.179 1.00 90.90  ? 305  ASP A CA    1 
ATOM   2360  C  C     . ASP A 1  305  ? 88.511  51.611  -27.778 1.00 93.95  ? 305  ASP A C     1 
ATOM   2361  O  O     . ASP A 1  305  ? 87.740  52.170  -28.544 1.00 93.28  ? 305  ASP A O     1 
ATOM   2362  C  CB    . ASP A 1  305  ? 90.681  52.835  -28.340 1.00 93.25  ? 305  ASP A CB    1 
ATOM   2363  C  CG    . ASP A 1  305  ? 90.466  53.817  -27.197 1.00 107.75 ? 305  ASP A CG    1 
ATOM   2364  O  OD1   . ASP A 1  305  ? 90.119  53.368  -26.077 1.00 108.30 ? 305  ASP A OD1   1 
ATOM   2365  O  OD2   . ASP A 1  305  ? 90.703  55.029  -27.404 1.00 116.41 ? 305  ASP A OD2   1 
ATOM   2366  N  N     . ASN A 1  306  ? 88.125  51.090  -26.593 1.00 91.02  ? 306  ASN A N     1 
ATOM   2367  C  CA    . ASN A 1  306  ? 86.734  51.112  -26.124 1.00 92.06  ? 306  ASN A CA    1 
ATOM   2368  C  C     . ASN A 1  306  ? 86.365  52.322  -25.300 1.00 100.78 ? 306  ASN A C     1 
ATOM   2369  O  O     . ASN A 1  306  ? 85.190  52.717  -25.259 1.00 102.06 ? 306  ASN A O     1 
ATOM   2370  C  CB    . ASN A 1  306  ? 86.376  49.856  -25.346 1.00 87.76  ? 306  ASN A CB    1 
ATOM   2371  C  CG    . ASN A 1  306  ? 84.891  49.574  -25.373 1.00 104.14 ? 306  ASN A CG    1 
ATOM   2372  O  OD1   . ASN A 1  306  ? 84.136  50.144  -26.168 1.00 97.08  ? 306  ASN A OD1   1 
ATOM   2373  N  ND2   . ASN A 1  306  ? 84.430  48.671  -24.523 1.00 96.99  ? 306  ASN A ND2   1 
ATOM   2374  N  N     . ASP A 1  307  ? 87.375  52.904  -24.649 1.00 98.53  ? 307  ASP A N     1 
ATOM   2375  C  CA    . ASP A 1  307  ? 87.301  54.051  -23.742 1.00 98.83  ? 307  ASP A CA    1 
ATOM   2376  C  C     . ASP A 1  307  ? 87.545  55.401  -24.501 1.00 98.83  ? 307  ASP A C     1 
ATOM   2377  O  O     . ASP A 1  307  ? 88.493  56.146  -24.218 1.00 98.03  ? 307  ASP A O     1 
ATOM   2378  C  CB    . ASP A 1  307  ? 88.260  53.800  -22.549 1.00 101.44 ? 307  ASP A CB    1 
ATOM   2379  C  CG    . ASP A 1  307  ? 88.807  52.361  -22.495 1.00 122.44 ? 307  ASP A CG    1 
ATOM   2380  O  OD1   . ASP A 1  307  ? 87.979  51.405  -22.421 1.00 124.03 ? 307  ASP A OD1   1 
ATOM   2381  O  OD2   . ASP A 1  307  ? 90.059  52.187  -22.610 1.00 130.38 ? 307  ASP A OD2   1 
ATOM   2382  N  N     . ILE A 1  308  ? 86.655  55.675  -25.483 1.00 92.57  ? 308  ILE A N     1 
ATOM   2383  C  CA    . ILE A 1  308  ? 86.630  56.845  -26.360 1.00 91.76  ? 308  ILE A CA    1 
ATOM   2384  C  C     . ILE A 1  308  ? 85.862  57.964  -25.665 1.00 97.21  ? 308  ILE A C     1 
ATOM   2385  O  O     . ILE A 1  308  ? 84.886  57.678  -24.975 1.00 97.02  ? 308  ILE A O     1 
ATOM   2386  C  CB    . ILE A 1  308  ? 85.965  56.461  -27.725 1.00 94.70  ? 308  ILE A CB    1 
ATOM   2387  C  CG1   . ILE A 1  308  ? 86.741  55.362  -28.477 1.00 93.98  ? 308  ILE A CG1   1 
ATOM   2388  C  CG2   . ILE A 1  308  ? 85.742  57.667  -28.637 1.00 96.33  ? 308  ILE A CG2   1 
ATOM   2389  C  CD1   . ILE A 1  308  ? 85.934  54.659  -29.580 1.00 97.14  ? 308  ILE A CD1   1 
ATOM   2390  N  N     . ALA A 1  309  ? 86.293  59.228  -25.879 1.00 96.26  ? 309  ALA A N     1 
ATOM   2391  C  CA    . ALA A 1  309  ? 85.716  60.491  -25.399 1.00 98.41  ? 309  ALA A CA    1 
ATOM   2392  C  C     . ALA A 1  309  ? 84.166  60.613  -25.593 1.00 108.83 ? 309  ALA A C     1 
ATOM   2393  O  O     . ALA A 1  309  ? 83.451  60.798  -24.599 1.00 108.32 ? 309  ALA A O     1 
ATOM   2394  C  CB    . ALA A 1  309  ? 86.432  61.661  -26.067 1.00 99.54  ? 309  ALA A CB    1 
ATOM   2395  N  N     . GLY A 1  310  ? 83.679  60.501  -26.851 1.00 110.29 ? 310  GLY A N     1 
ATOM   2396  C  CA    . GLY A 1  310  ? 82.257  60.488  -27.233 1.00 112.34 ? 310  GLY A CA    1 
ATOM   2397  C  C     . GLY A 1  310  ? 81.627  59.224  -26.683 1.00 118.71 ? 310  GLY A C     1 
ATOM   2398  O  O     . GLY A 1  310  ? 81.344  58.240  -27.391 1.00 116.24 ? 310  GLY A O     1 
ATOM   2399  N  N     . GLN A 1  311  ? 81.498  59.290  -25.361 1.00 119.41 ? 311  GLN A N     1 
ATOM   2400  C  CA    . GLN A 1  311  ? 81.141  58.329  -24.336 1.00 121.04 ? 311  GLN A CA    1 
ATOM   2401  C  C     . GLN A 1  311  ? 80.634  56.906  -24.697 1.00 127.01 ? 311  GLN A C     1 
ATOM   2402  O  O     . GLN A 1  311  ? 81.341  55.974  -24.293 1.00 127.43 ? 311  GLN A O     1 
ATOM   2403  C  CB    . GLN A 1  311  ? 80.339  58.994  -23.197 1.00 123.50 ? 311  GLN A CB    1 
ATOM   2404  C  CG    . GLN A 1  311  ? 80.751  58.552  -21.789 1.00 147.12 ? 311  GLN A CG    1 
ATOM   2405  C  CD    . GLN A 1  311  ? 79.756  59.016  -20.749 1.00 173.70 ? 311  GLN A CD    1 
ATOM   2406  O  OE1   . GLN A 1  311  ? 78.656  58.463  -20.606 1.00 169.47 ? 311  GLN A OE1   1 
ATOM   2407  N  NE2   . GLN A 1  311  ? 80.119  60.047  -19.999 1.00 168.95 ? 311  GLN A NE2   1 
ATOM   2408  N  N     . PRO A 1  312  ? 79.435  56.697  -25.340 1.00 122.86 ? 312  PRO A N     1 
ATOM   2409  C  CA    . PRO A 1  312  ? 78.902  55.336  -25.568 1.00 121.54 ? 312  PRO A CA    1 
ATOM   2410  C  C     . PRO A 1  312  ? 79.884  54.190  -25.698 1.00 122.50 ? 312  PRO A C     1 
ATOM   2411  O  O     . PRO A 1  312  ? 80.372  53.920  -26.794 1.00 123.49 ? 312  PRO A O     1 
ATOM   2412  C  CB    . PRO A 1  312  ? 78.032  55.501  -26.817 1.00 124.48 ? 312  PRO A CB    1 
ATOM   2413  C  CG    . PRO A 1  312  ? 78.026  57.003  -27.116 1.00 130.37 ? 312  PRO A CG    1 
ATOM   2414  C  CD    . PRO A 1  312  ? 78.482  57.682  -25.875 1.00 125.56 ? 312  PRO A CD    1 
ATOM   2415  N  N     . GLN A 1  313  ? 80.200  53.545  -24.561 1.00 114.85 ? 313  GLN A N     1 
ATOM   2416  C  CA    . GLN A 1  313  ? 81.148  52.440  -24.497 1.00 112.03 ? 313  GLN A CA    1 
ATOM   2417  C  C     . GLN A 1  313  ? 80.485  51.195  -25.040 1.00 115.27 ? 313  GLN A C     1 
ATOM   2418  O  O     . GLN A 1  313  ? 79.309  50.971  -24.770 1.00 115.83 ? 313  GLN A O     1 
ATOM   2419  C  CB    . GLN A 1  313  ? 81.593  52.223  -23.053 1.00 111.99 ? 313  GLN A CB    1 
ATOM   2420  C  CG    . GLN A 1  313  ? 82.959  51.581  -22.940 1.00 114.41 ? 313  GLN A CG    1 
ATOM   2421  C  CD    . GLN A 1  313  ? 83.561  51.800  -21.579 1.00 118.13 ? 313  GLN A CD    1 
ATOM   2422  O  OE1   . GLN A 1  313  ? 83.038  51.344  -20.563 1.00 105.98 ? 313  GLN A OE1   1 
ATOM   2423  N  NE2   . GLN A 1  313  ? 84.690  52.492  -21.533 1.00 111.16 ? 313  GLN A NE2   1 
ATOM   2424  N  N     . ALA A 1  314  ? 81.204  50.415  -25.849 1.00 111.09 ? 314  ALA A N     1 
ATOM   2425  C  CA    . ALA A 1  314  ? 80.646  49.191  -26.406 1.00 111.13 ? 314  ALA A CA    1 
ATOM   2426  C  C     . ALA A 1  314  ? 80.600  48.172  -25.278 1.00 116.48 ? 314  ALA A C     1 
ATOM   2427  O  O     . ALA A 1  314  ? 81.646  47.808  -24.730 1.00 115.47 ? 314  ALA A O     1 
ATOM   2428  C  CB    . ALA A 1  314  ? 81.499  48.691  -27.557 1.00 111.44 ? 314  ALA A CB    1 
ATOM   2429  N  N     . LEU A 1  315  ? 79.383  47.792  -24.863 1.00 114.79 ? 315  LEU A N     1 
ATOM   2430  C  CA    . LEU A 1  315  ? 79.211  46.861  -23.750 1.00 114.75 ? 315  LEU A CA    1 
ATOM   2431  C  C     . LEU A 1  315  ? 78.830  45.473  -24.217 1.00 120.15 ? 315  LEU A C     1 
ATOM   2432  O  O     . LEU A 1  315  ? 77.973  45.329  -25.090 1.00 120.27 ? 315  LEU A O     1 
ATOM   2433  C  CB    . LEU A 1  315  ? 78.171  47.352  -22.727 1.00 115.27 ? 315  LEU A CB    1 
ATOM   2434  C  CG    . LEU A 1  315  ? 78.010  48.845  -22.533 1.00 120.73 ? 315  LEU A CG    1 
ATOM   2435  C  CD1   . LEU A 1  315  ? 76.742  49.352  -23.221 1.00 122.05 ? 315  LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A 1  315  ? 77.959  49.188  -21.075 1.00 123.36 ? 315  LEU A CD2   1 
ATOM   2437  N  N     . GLN A 1  316  ? 79.455  44.448  -23.607 1.00 117.40 ? 316  GLN A N     1 
ATOM   2438  C  CA    . GLN A 1  316  ? 79.181  43.028  -23.842 1.00 117.64 ? 316  GLN A CA    1 
ATOM   2439  C  C     . GLN A 1  316  ? 77.796  42.745  -23.219 1.00 123.58 ? 316  GLN A C     1 
ATOM   2440  O  O     . GLN A 1  316  ? 77.434  43.409  -22.241 1.00 123.30 ? 316  GLN A O     1 
ATOM   2441  C  CB    . GLN A 1  316  ? 80.324  42.167  -23.217 1.00 117.92 ? 316  GLN A CB    1 
ATOM   2442  C  CG    . GLN A 1  316  ? 80.006  40.702  -22.875 1.00 136.27 ? 316  GLN A CG    1 
ATOM   2443  C  CD    . GLN A 1  316  ? 79.745  39.816  -24.075 1.00 161.07 ? 316  GLN A CD    1 
ATOM   2444  O  OE1   . GLN A 1  316  ? 80.492  39.818  -25.068 1.00 159.64 ? 316  GLN A OE1   1 
ATOM   2445  N  NE2   . GLN A 1  316  ? 78.705  38.991  -23.981 1.00 149.22 ? 316  GLN A NE2   1 
ATOM   2446  N  N     . LYS A 1  317  ? 76.998  41.821  -23.812 1.00 121.65 ? 317  LYS A N     1 
ATOM   2447  C  CA    . LYS A 1  317  ? 75.669  41.477  -23.278 1.00 122.30 ? 317  LYS A CA    1 
ATOM   2448  C  C     . LYS A 1  317  ? 75.898  40.807  -21.929 1.00 124.54 ? 317  LYS A C     1 
ATOM   2449  O  O     . LYS A 1  317  ? 76.274  39.636  -21.876 1.00 123.45 ? 317  LYS A O     1 
ATOM   2450  C  CB    . LYS A 1  317  ? 74.884  40.576  -24.253 1.00 125.89 ? 317  LYS A CB    1 
ATOM   2451  C  CG    . LYS A 1  317  ? 73.359  40.659  -24.093 1.00 144.79 ? 317  LYS A CG    1 
ATOM   2452  C  CD    . LYS A 1  317  ? 72.635  39.952  -25.262 1.00 155.71 ? 317  LYS A CD    1 
ATOM   2453  C  CE    . LYS A 1  317  ? 71.174  39.642  -25.006 1.00 163.28 ? 317  LYS A CE    1 
ATOM   2454  N  NZ    . LYS A 1  317  ? 70.572  38.851  -26.118 1.00 167.64 ? 317  LYS A NZ    1 
ATOM   2455  N  N     . SER A 1  318  ? 75.827  41.630  -20.860 1.00 120.50 ? 318  SER A N     1 
ATOM   2456  C  CA    . SER A 1  318  ? 76.075  41.350  -19.433 1.00 119.60 ? 318  SER A CA    1 
ATOM   2457  C  C     . SER A 1  318  ? 76.139  42.691  -18.690 1.00 125.48 ? 318  SER A C     1 
ATOM   2458  O  O     . SER A 1  318  ? 76.181  42.719  -17.455 1.00 125.65 ? 318  SER A O     1 
ATOM   2459  C  CB    . SER A 1  318  ? 77.405  40.614  -19.222 1.00 119.85 ? 318  SER A CB    1 
ATOM   2460  O  OG    . SER A 1  318  ? 78.556  41.390  -19.519 1.00 121.04 ? 318  SER A OG    1 
ATOM   2461  N  N     . GLY A 1  319  ? 76.194  43.783  -19.457 1.00 122.29 ? 319  GLY A N     1 
ATOM   2462  C  CA    . GLY A 1  319  ? 76.336  45.139  -18.937 1.00 121.88 ? 319  GLY A CA    1 
ATOM   2463  C  C     . GLY A 1  319  ? 77.797  45.552  -18.887 1.00 123.55 ? 319  GLY A C     1 
ATOM   2464  O  O     . GLY A 1  319  ? 78.119  46.735  -19.033 1.00 123.86 ? 319  GLY A O     1 
ATOM   2465  N  N     . ARG A 1  320  ? 78.692  44.557  -18.694 1.00 116.77 ? 320  ARG A N     1 
ATOM   2466  C  CA    . ARG A 1  320  ? 80.144  44.694  -18.606 1.00 114.37 ? 320  ARG A CA    1 
ATOM   2467  C  C     . ARG A 1  320  ? 80.714  45.141  -19.973 1.00 112.10 ? 320  ARG A C     1 
ATOM   2468  O  O     . ARG A 1  320  ? 80.326  44.577  -20.994 1.00 111.71 ? 320  ARG A O     1 
ATOM   2469  C  CB    . ARG A 1  320  ? 80.734  43.347  -18.146 1.00 116.93 ? 320  ARG A CB    1 
ATOM   2470  C  CG    . ARG A 1  320  ? 82.175  43.376  -17.647 1.00 136.51 ? 320  ARG A CG    1 
ATOM   2471  C  CD    . ARG A 1  320  ? 83.191  42.931  -18.705 1.00 159.78 ? 320  ARG A CD    1 
ATOM   2472  N  NE    . ARG A 1  320  ? 82.825  41.686  -19.394 1.00 173.94 ? 320  ARG A NE    1 
ATOM   2473  C  CZ    . ARG A 1  320  ? 83.445  41.209  -20.471 1.00 185.98 ? 320  ARG A CZ    1 
ATOM   2474  N  NH1   . ARG A 1  320  ? 84.481  41.858  -20.992 1.00 172.06 ? 320  ARG A NH1   1 
ATOM   2475  N  NH2   . ARG A 1  320  ? 83.036  40.082  -21.034 1.00 171.01 ? 320  ARG A NH2   1 
ATOM   2476  N  N     . PRO A 1  321  ? 81.596  46.161  -20.034 1.00 104.02 ? 321  PRO A N     1 
ATOM   2477  C  CA    . PRO A 1  321  ? 82.111  46.591  -21.342 1.00 102.70 ? 321  PRO A CA    1 
ATOM   2478  C  C     . PRO A 1  321  ? 83.197  45.689  -21.935 1.00 102.60 ? 321  PRO A C     1 
ATOM   2479  O  O     . PRO A 1  321  ? 83.778  44.865  -21.224 1.00 100.65 ? 321  PRO A O     1 
ATOM   2480  C  CB    . PRO A 1  321  ? 82.576  48.027  -21.093 1.00 104.41 ? 321  PRO A CB    1 
ATOM   2481  C  CG    . PRO A 1  321  ? 82.860  48.092  -19.651 1.00 108.51 ? 321  PRO A CG    1 
ATOM   2482  C  CD    . PRO A 1  321  ? 82.162  46.970  -18.940 1.00 104.40 ? 321  PRO A CD    1 
ATOM   2483  N  N     . VAL A 1  322  ? 83.467  45.864  -23.250 1.00 97.42  ? 322  VAL A N     1 
ATOM   2484  C  CA    . VAL A 1  322  ? 84.434  45.092  -24.029 1.00 95.89  ? 322  VAL A CA    1 
ATOM   2485  C  C     . VAL A 1  322  ? 85.910  45.478  -23.859 1.00 98.96  ? 322  VAL A C     1 
ATOM   2486  O  O     . VAL A 1  322  ? 86.267  46.649  -23.994 1.00 99.12  ? 322  VAL A O     1 
ATOM   2487  C  CB    . VAL A 1  322  ? 83.967  44.941  -25.494 1.00 99.64  ? 322  VAL A CB    1 
ATOM   2488  C  CG1   . VAL A 1  322  ? 85.131  44.837  -26.482 1.00 98.89  ? 322  VAL A CG1   1 
ATOM   2489  C  CG2   . VAL A 1  322  ? 83.038  43.744  -25.619 1.00 99.66  ? 322  VAL A CG2   1 
ATOM   2490  N  N     . LYS A 1  323  ? 86.765  44.476  -23.569 1.00 94.17  ? 323  LYS A N     1 
ATOM   2491  C  CA    . LYS A 1  323  ? 88.208  44.663  -23.374 1.00 93.27  ? 323  LYS A CA    1 
ATOM   2492  C  C     . LYS A 1  323  ? 88.846  45.034  -24.720 1.00 95.66  ? 323  LYS A C     1 
ATOM   2493  O  O     . LYS A 1  323  ? 88.923  44.189  -25.610 1.00 96.85  ? 323  LYS A O     1 
ATOM   2494  C  CB    . LYS A 1  323  ? 88.870  43.387  -22.788 1.00 96.20  ? 323  LYS A CB    1 
ATOM   2495  C  CG    . LYS A 1  323  ? 87.954  42.485  -21.896 1.00 125.31 ? 323  LYS A CG    1 
ATOM   2496  C  CD    . LYS A 1  323  ? 88.458  40.998  -21.778 1.00 136.75 ? 323  LYS A CD    1 
ATOM   2497  C  CE    . LYS A 1  323  ? 87.457  39.982  -21.241 1.00 132.17 ? 323  LYS A CE    1 
ATOM   2498  N  NZ    . LYS A 1  323  ? 87.680  38.619  -21.815 1.00 126.56 ? 323  LYS A NZ    1 
ATOM   2499  N  N     . SER A 1  324  ? 89.236  46.309  -24.900 1.00 88.88  ? 324  SER A N     1 
ATOM   2500  C  CA    . SER A 1  324  ? 89.869  46.788  -26.148 1.00 86.56  ? 324  SER A CA    1 
ATOM   2501  C  C     . SER A 1  324  ? 91.335  46.297  -26.280 1.00 84.23  ? 324  SER A C     1 
ATOM   2502  O  O     . SER A 1  324  ? 91.924  45.852  -25.284 1.00 83.52  ? 324  SER A O     1 
ATOM   2503  C  CB    . SER A 1  324  ? 89.817  48.319  -26.234 1.00 89.68  ? 324  SER A CB    1 
ATOM   2504  O  OG    . SER A 1  324  ? 89.655  49.025  -25.007 1.00 94.17  ? 324  SER A OG    1 
ATOM   2505  N  N     . ILE A 1  325  ? 91.930  46.383  -27.494 1.00 75.56  ? 325  ILE A N     1 
ATOM   2506  C  CA    . ILE A 1  325  ? 93.346  46.027  -27.672 1.00 71.94  ? 325  ILE A CA    1 
ATOM   2507  C  C     . ILE A 1  325  ? 94.161  47.114  -26.940 1.00 75.45  ? 325  ILE A C     1 
ATOM   2508  O  O     . ILE A 1  325  ? 95.115  46.783  -26.229 1.00 73.75  ? 325  ILE A O     1 
ATOM   2509  C  CB    . ILE A 1  325  ? 93.777  45.844  -29.150 1.00 73.45  ? 325  ILE A CB    1 
ATOM   2510  C  CG1   . ILE A 1  325  ? 92.884  44.844  -29.857 1.00 73.17  ? 325  ILE A CG1   1 
ATOM   2511  C  CG2   . ILE A 1  325  ? 95.230  45.388  -29.241 1.00 72.68  ? 325  ILE A CG2   1 
ATOM   2512  C  CD1   . ILE A 1  325  ? 93.033  44.862  -31.309 1.00 80.19  ? 325  ILE A CD1   1 
ATOM   2513  N  N     . ARG A 1  326  ? 93.724  48.408  -27.056 1.00 73.46  ? 326  ARG A N     1 
ATOM   2514  C  CA    . ARG A 1  326  ? 94.345  49.555  -26.371 1.00 73.31  ? 326  ARG A CA    1 
ATOM   2515  C  C     . ARG A 1  326  ? 94.395  49.241  -24.885 1.00 78.08  ? 326  ARG A C     1 
ATOM   2516  O  O     . ARG A 1  326  ? 95.467  49.290  -24.284 1.00 77.35  ? 326  ARG A O     1 
ATOM   2517  C  CB    . ARG A 1  326  ? 93.618  50.901  -26.635 1.00 72.52  ? 326  ARG A CB    1 
ATOM   2518  C  CG    . ARG A 1  326  ? 94.051  51.955  -25.628 1.00 81.95  ? 326  ARG A CG    1 
ATOM   2519  C  CD    . ARG A 1  326  ? 93.837  53.388  -26.024 1.00 96.37  ? 326  ARG A CD    1 
ATOM   2520  N  NE    . ARG A 1  326  ? 94.333  54.286  -24.976 1.00 111.78 ? 326  ARG A NE    1 
ATOM   2521  C  CZ    . ARG A 1  326  ? 93.647  54.644  -23.891 1.00 132.27 ? 326  ARG A CZ    1 
ATOM   2522  N  NH1   . ARG A 1  326  ? 92.420  54.175  -23.685 1.00 126.06 ? 326  ARG A NH1   1 
ATOM   2523  N  NH2   . ARG A 1  326  ? 94.184  55.473  -23.002 1.00 115.28 ? 326  ARG A NH2   1 
ATOM   2524  N  N     . ALA A 1  327  ? 93.244  48.833  -24.326 1.00 75.74  ? 327  ALA A N     1 
ATOM   2525  C  CA    . ALA A 1  327  ? 93.101  48.449  -22.932 1.00 75.43  ? 327  ALA A CA    1 
ATOM   2526  C  C     . ALA A 1  327  ? 94.112  47.385  -22.517 1.00 78.35  ? 327  ALA A C     1 
ATOM   2527  O  O     . ALA A 1  327  ? 94.707  47.549  -21.444 1.00 79.04  ? 327  ALA A O     1 
ATOM   2528  C  CB    . ALA A 1  327  ? 91.695  47.965  -22.670 1.00 76.76  ? 327  ALA A CB    1 
ATOM   2529  N  N     . ARG A 1  328  ? 94.350  46.334  -23.378 1.00 72.49  ? 328  ARG A N     1 
ATOM   2530  C  CA    . ARG A 1  328  ? 95.307  45.234  -23.128 1.00 70.34  ? 328  ARG A CA    1 
ATOM   2531  C  C     . ARG A 1  328  ? 96.709  45.758  -22.798 1.00 74.93  ? 328  ARG A C     1 
ATOM   2532  O  O     . ARG A 1  328  ? 97.339  45.286  -21.850 1.00 73.98  ? 328  ARG A O     1 
ATOM   2533  C  CB    . ARG A 1  328  ? 95.428  44.302  -24.346 1.00 65.63  ? 328  ARG A CB    1 
ATOM   2534  C  CG    . ARG A 1  328  ? 94.238  43.415  -24.635 1.00 67.68  ? 328  ARG A CG    1 
ATOM   2535  C  CD    . ARG A 1  328  ? 94.699  42.090  -25.219 1.00 70.80  ? 328  ARG A CD    1 
ATOM   2536  N  NE    . ARG A 1  328  ? 93.591  41.176  -25.529 1.00 78.77  ? 328  ARG A NE    1 
ATOM   2537  C  CZ    . ARG A 1  328  ? 93.720  40.042  -26.219 1.00 88.60  ? 328  ARG A CZ    1 
ATOM   2538  N  NH1   . ARG A 1  328  ? 94.905  39.680  -26.702 1.00 59.42  ? 328  ARG A NH1   1 
ATOM   2539  N  NH2   . ARG A 1  328  ? 92.663  39.270  -26.442 1.00 80.18  ? 328  ARG A NH2   1 
ATOM   2540  N  N     . LEU A 1  329  ? 97.176  46.754  -23.572 1.00 71.99  ? 329  LEU A N     1 
ATOM   2541  C  CA    . LEU A 1  329  ? 98.518  47.309  -23.460 1.00 71.78  ? 329  LEU A CA    1 
ATOM   2542  C  C     . LEU A 1  329  ? 98.753  48.360  -22.371 1.00 78.05  ? 329  LEU A C     1 
ATOM   2543  O  O     . LEU A 1  329  ? 99.888  48.460  -21.894 1.00 77.84  ? 329  LEU A O     1 
ATOM   2544  C  CB    . LEU A 1  329  ? 99.012  47.801  -24.830 1.00 71.91  ? 329  LEU A CB    1 
ATOM   2545  C  CG    . LEU A 1  329  ? 98.546  47.041  -26.082 1.00 76.78  ? 329  LEU A CG    1 
ATOM   2546  C  CD1   . LEU A 1  329  ? 99.183  47.608  -27.294 1.00 77.98  ? 329  LEU A CD1   1 
ATOM   2547  C  CD2   . LEU A 1  329  ? 98.937  45.590  -26.048 1.00 78.99  ? 329  LEU A CD2   1 
ATOM   2548  N  N     . LYS A 1  330  ? 97.704  49.139  -21.986 1.00 76.34  ? 330  LYS A N     1 
ATOM   2549  C  CA    . LYS A 1  330  ? 97.762  50.219  -20.983 1.00 76.96  ? 330  LYS A CA    1 
ATOM   2550  C  C     . LYS A 1  330  ? 98.376  49.818  -19.658 1.00 84.24  ? 330  LYS A C     1 
ATOM   2551  O  O     . LYS A 1  330  ? 98.122  48.723  -19.139 1.00 83.88  ? 330  LYS A O     1 
ATOM   2552  C  CB    . LYS A 1  330  ? 96.401  50.847  -20.746 1.00 79.36  ? 330  LYS A CB    1 
ATOM   2553  C  CG    . LYS A 1  330  ? 96.124  52.101  -21.558 1.00 92.70  ? 330  LYS A CG    1 
ATOM   2554  C  CD    . LYS A 1  330  ? 94.907  52.859  -20.991 1.00 109.18 ? 330  LYS A CD    1 
ATOM   2555  C  CE    . LYS A 1  330  ? 93.552  52.172  -21.179 1.00 128.40 ? 330  LYS A CE    1 
ATOM   2556  N  NZ    . LYS A 1  330  ? 93.067  51.477  -19.945 1.00 133.22 ? 330  LYS A NZ    1 
ATOM   2557  N  N     . GLY A 1  331  ? 99.170  50.748  -19.142 1.00 83.12  ? 331  GLY A N     1 
ATOM   2558  C  CA    . GLY A 1  331  ? 100.012 50.653  -17.950 1.00 83.26  ? 331  GLY A CA    1 
ATOM   2559  C  C     . GLY A 1  331  ? 99.589  49.892  -16.708 1.00 85.41  ? 331  GLY A C     1 
ATOM   2560  O  O     . GLY A 1  331  ? 98.409  49.901  -16.355 1.00 85.26  ? 331  GLY A O     1 
ATOM   2561  N  N     . LYS A 1  332  ? 100.629 49.347  -15.984 1.00 79.98  ? 332  LYS A N     1 
ATOM   2562  C  CA    . LYS A 1  332  ? 100.696 48.552  -14.743 1.00 78.55  ? 332  LYS A CA    1 
ATOM   2563  C  C     . LYS A 1  332  ? 99.636  47.570  -14.790 1.00 85.97  ? 332  LYS A C     1 
ATOM   2564  O  O     . LYS A 1  332  ? 98.489  47.943  -14.581 1.00 88.24  ? 332  LYS A O     1 
ATOM   2565  C  CB    . LYS A 1  332  ? 100.574 49.395  -13.477 1.00 79.17  ? 332  LYS A CB    1 
ATOM   2566  C  CG    . LYS A 1  332  ? 101.024 48.626  -12.244 1.00 84.33  ? 332  LYS A CG    1 
ATOM   2567  C  CD    . LYS A 1  332  ? 100.558 49.297  -10.969 1.00 95.30  ? 332  LYS A CD    1 
ATOM   2568  C  CE    . LYS A 1  332  ? 101.387 48.871  -9.784  1.00 108.63 ? 332  LYS A CE    1 
ATOM   2569  N  NZ    . LYS A 1  332  ? 100.791 49.323  -8.498  1.00 119.86 ? 332  LYS A NZ    1 
ATOM   2570  N  N     . GLU A 1  333  ? 99.973  46.316  -15.072 1.00 83.14  ? 333  GLU A N     1 
ATOM   2571  C  CA    . GLU A 1  333  ? 99.021  45.223  -15.338 1.00 83.70  ? 333  GLU A CA    1 
ATOM   2572  C  C     . GLU A 1  333  ? 98.717  45.463  -16.805 1.00 89.48  ? 333  GLU A C     1 
ATOM   2573  O  O     . GLU A 1  333  ? 98.189  46.512  -17.183 1.00 91.26  ? 333  GLU A O     1 
ATOM   2574  C  CB    . GLU A 1  333  ? 97.705  45.260  -14.499 1.00 85.39  ? 333  GLU A CB    1 
ATOM   2575  C  CG    . GLU A 1  333  ? 97.870  45.339  -12.989 1.00 101.89 ? 333  GLU A CG    1 
ATOM   2576  C  CD    . GLU A 1  333  ? 97.069  44.341  -12.186 1.00 144.27 ? 333  GLU A CD    1 
ATOM   2577  O  OE1   . GLU A 1  333  ? 95.818  44.418  -12.209 1.00 142.02 ? 333  GLU A OE1   1 
ATOM   2578  O  OE2   . GLU A 1  333  ? 97.699  43.498  -11.505 1.00 155.09 ? 333  GLU A OE2   1 
ATOM   2579  N  N     . GLY A 1  334  ? 99.154  44.565  -17.649 1.00 85.15  ? 334  GLY A N     1 
ATOM   2580  C  CA    . GLY A 1  334  ? 98.942  44.811  -19.060 1.00 84.86  ? 334  GLY A CA    1 
ATOM   2581  C  C     . GLY A 1  334  ? 100.238 45.019  -19.794 1.00 85.02  ? 334  GLY A C     1 
ATOM   2582  O  O     . GLY A 1  334  ? 100.995 45.962  -19.511 1.00 85.12  ? 334  GLY A O     1 
ATOM   2583  N  N     . ARG A 1  335  ? 100.431 44.102  -20.764 1.00 77.02  ? 335  ARG A N     1 
ATOM   2584  C  CA    . ARG A 1  335  ? 101.534 43.851  -21.667 1.00 74.22  ? 335  ARG A CA    1 
ATOM   2585  C  C     . ARG A 1  335  ? 102.850 44.505  -21.318 1.00 75.08  ? 335  ARG A C     1 
ATOM   2586  O  O     . ARG A 1  335  ? 103.645 43.871  -20.642 1.00 73.71  ? 335  ARG A O     1 
ATOM   2587  C  CB    . ARG A 1  335  ? 101.129 43.910  -23.156 1.00 70.81  ? 335  ARG A CB    1 
ATOM   2588  C  CG    . ARG A 1  335  ? 101.629 42.684  -23.948 1.00 72.55  ? 335  ARG A CG    1 
ATOM   2589  C  CD    . ARG A 1  335  ? 100.658 41.501  -24.046 1.00 73.65  ? 335  ARG A CD    1 
ATOM   2590  N  NE    . ARG A 1  335  ? 99.963  41.222  -22.792 1.00 83.08  ? 335  ARG A NE    1 
ATOM   2591  C  CZ    . ARG A 1  335  ? 98.669  40.943  -22.689 1.00 101.78 ? 335  ARG A CZ    1 
ATOM   2592  N  NH1   . ARG A 1  335  ? 97.915  40.846  -23.776 1.00 92.18  ? 335  ARG A NH1   1 
ATOM   2593  N  NH2   . ARG A 1  335  ? 98.118  40.753  -21.495 1.00 88.60  ? 335  ARG A NH2   1 
ATOM   2594  N  N     . ILE A 1  336  ? 103.056 45.775  -21.695 1.00 70.36  ? 336  ILE A N     1 
ATOM   2595  C  CA    . ILE A 1  336  ? 104.299 46.500  -21.437 1.00 68.78  ? 336  ILE A CA    1 
ATOM   2596  C  C     . ILE A 1  336  ? 104.736 46.412  -19.973 1.00 72.27  ? 336  ILE A C     1 
ATOM   2597  O  O     . ILE A 1  336  ? 105.644 45.652  -19.603 1.00 70.97  ? 336  ILE A O     1 
ATOM   2598  C  CB    . ILE A 1  336  ? 104.197 47.964  -21.956 1.00 71.29  ? 336  ILE A CB    1 
ATOM   2599  C  CG1   . ILE A 1  336  ? 103.711 47.989  -23.417 1.00 72.18  ? 336  ILE A CG1   1 
ATOM   2600  C  CG2   . ILE A 1  336  ? 105.531 48.758  -21.763 1.00 70.20  ? 336  ILE A CG2   1 
ATOM   2601  C  CD1   . ILE A 1  336  ? 104.763 47.688  -24.449 1.00 83.54  ? 336  ILE A CD1   1 
ATOM   2602  N  N     . ARG A 1  337  ? 104.057 47.178  -19.152 1.00 68.81  ? 337  ARG A N     1 
ATOM   2603  C  CA    . ARG A 1  337  ? 104.356 47.312  -17.752 1.00 67.69  ? 337  ARG A CA    1 
ATOM   2604  C  C     . ARG A 1  337  ? 104.201 46.032  -16.915 1.00 71.13  ? 337  ARG A C     1 
ATOM   2605  O  O     . ARG A 1  337  ? 105.011 45.791  -16.023 1.00 69.69  ? 337  ARG A O     1 
ATOM   2606  C  CB    . ARG A 1  337  ? 103.477 48.431  -17.238 1.00 65.23  ? 337  ARG A CB    1 
ATOM   2607  C  CG    . ARG A 1  337  ? 104.223 49.712  -17.086 1.00 64.46  ? 337  ARG A CG    1 
ATOM   2608  C  CD    . ARG A 1  337  ? 104.142 50.103  -15.645 1.00 64.75  ? 337  ARG A CD    1 
ATOM   2609  N  NE    . ARG A 1  337  ? 103.317 51.286  -15.449 1.00 73.92  ? 337  ARG A NE    1 
ATOM   2610  C  CZ    . ARG A 1  337  ? 103.092 51.843  -14.268 1.00 91.59  ? 337  ARG A CZ    1 
ATOM   2611  N  NH1   . ARG A 1  337  ? 103.617 51.315  -13.165 1.00 62.90  ? 337  ARG A NH1   1 
ATOM   2612  N  NH2   . ARG A 1  337  ? 102.349 52.940  -14.178 1.00 94.90  ? 337  ARG A NH2   1 
ATOM   2613  N  N     . GLY A 1  338  ? 103.178 45.235  -17.220 1.00 67.99  ? 338  GLY A N     1 
ATOM   2614  C  CA    . GLY A 1  338  ? 102.864 44.034  -16.465 1.00 67.60  ? 338  GLY A CA    1 
ATOM   2615  C  C     . GLY A 1  338  ? 103.390 42.700  -16.959 1.00 71.89  ? 338  GLY A C     1 
ATOM   2616  O  O     . GLY A 1  338  ? 103.477 41.742  -16.172 1.00 73.94  ? 338  GLY A O     1 
ATOM   2617  N  N     . ASN A 1  339  ? 103.690 42.578  -18.250 1.00 64.99  ? 339  ASN A N     1 
ATOM   2618  C  CA    . ASN A 1  339  ? 104.184 41.291  -18.747 1.00 62.14  ? 339  ASN A CA    1 
ATOM   2619  C  C     . ASN A 1  339  ? 105.591 41.354  -19.266 1.00 61.81  ? 339  ASN A C     1 
ATOM   2620  O  O     . ASN A 1  339  ? 106.204 40.307  -19.427 1.00 59.56  ? 339  ASN A O     1 
ATOM   2621  C  CB    . ASN A 1  339  ? 103.250 40.725  -19.810 1.00 57.63  ? 339  ASN A CB    1 
ATOM   2622  C  CG    . ASN A 1  339  ? 101.887 40.435  -19.285 1.00 67.38  ? 339  ASN A CG    1 
ATOM   2623  O  OD1   . ASN A 1  339  ? 100.907 41.064  -19.685 1.00 67.89  ? 339  ASN A OD1   1 
ATOM   2624  N  ND2   . ASN A 1  339  ? 101.800 39.512  -18.337 1.00 55.42  ? 339  ASN A ND2   1 
ATOM   2625  N  N     . LEU A 1  340  ? 106.104 42.574  -19.518 1.00 58.33  ? 340  LEU A N     1 
ATOM   2626  C  CA    . LEU A 1  340  ? 107.414 42.800  -20.112 1.00 58.35  ? 340  LEU A CA    1 
ATOM   2627  C  C     . LEU A 1  340  ? 108.430 43.498  -19.222 1.00 65.01  ? 340  LEU A C     1 
ATOM   2628  O  O     . LEU A 1  340  ? 109.550 42.993  -19.087 1.00 64.49  ? 340  LEU A O     1 
ATOM   2629  C  CB    . LEU A 1  340  ? 107.281 43.455  -21.499 1.00 58.11  ? 340  LEU A CB    1 
ATOM   2630  C  CG    . LEU A 1  340  ? 106.721 42.536  -22.594 1.00 61.76  ? 340  LEU A CG    1 
ATOM   2631  C  CD1   . LEU A 1  340  ? 106.013 43.316  -23.648 1.00 62.62  ? 340  LEU A CD1   1 
ATOM   2632  C  CD2   . LEU A 1  340  ? 107.802 41.689  -23.211 1.00 62.77  ? 340  LEU A CD2   1 
ATOM   2633  N  N     . MET A 1  341  ? 108.046 44.620  -18.591 1.00 64.05  ? 341  MET A N     1 
ATOM   2634  C  CA    . MET A 1  341  ? 108.924 45.340  -17.660 1.00 65.62  ? 341  MET A CA    1 
ATOM   2635  C  C     . MET A 1  341  ? 109.049 44.568  -16.321 1.00 69.30  ? 341  MET A C     1 
ATOM   2636  O  O     . MET A 1  341  ? 110.023 44.728  -15.589 1.00 69.29  ? 341  MET A O     1 
ATOM   2637  C  CB    . MET A 1  341  ? 108.418 46.773  -17.418 1.00 69.27  ? 341  MET A CB    1 
ATOM   2638  C  CG    . MET A 1  341  ? 108.464 47.652  -18.654 1.00 75.13  ? 341  MET A CG    1 
ATOM   2639  S  SD    . MET A 1  341  ? 110.033 47.659  -19.593 1.00 81.09  ? 341  MET A SD    1 
ATOM   2640  C  CE    . MET A 1  341  ? 111.031 48.602  -18.522 1.00 77.87  ? 341  MET A CE    1 
ATOM   2641  N  N     . GLY A 1  342  ? 108.028 43.768  -16.027 1.00 64.50  ? 342  GLY A N     1 
ATOM   2642  C  CA    . GLY A 1  342  ? 107.886 42.915  -14.857 1.00 62.72  ? 342  GLY A CA    1 
ATOM   2643  C  C     . GLY A 1  342  ? 107.242 41.634  -15.337 1.00 64.46  ? 342  GLY A C     1 
ATOM   2644  O  O     . GLY A 1  342  ? 106.519 41.630  -16.343 1.00 63.36  ? 342  GLY A O     1 
ATOM   2645  N  N     . LYS A 1  343  ? 107.527 40.537  -14.638 1.00 59.69  ? 343  LYS A N     1 
ATOM   2646  C  CA    . LYS A 1  343  ? 107.107 39.194  -15.004 1.00 58.47  ? 343  LYS A CA    1 
ATOM   2647  C  C     . LYS A 1  343  ? 107.012 38.357  -13.735 1.00 61.56  ? 343  LYS A C     1 
ATOM   2648  O  O     . LYS A 1  343  ? 107.813 38.528  -12.800 1.00 58.81  ? 343  LYS A O     1 
ATOM   2649  C  CB    . LYS A 1  343  ? 108.259 38.574  -15.865 1.00 60.16  ? 343  LYS A CB    1 
ATOM   2650  C  CG    . LYS A 1  343  ? 107.934 38.157  -17.293 1.00 60.87  ? 343  LYS A CG    1 
ATOM   2651  C  CD    . LYS A 1  343  ? 109.163 38.054  -18.210 1.00 60.93  ? 343  LYS A CD    1 
ATOM   2652  C  CE    . LYS A 1  343  ? 109.313 39.370  -18.961 1.00 78.81  ? 343  LYS A CE    1 
ATOM   2653  N  NZ    . LYS A 1  343  ? 110.099 39.298  -20.223 1.00 88.25  ? 343  LYS A NZ    1 
ATOM   2654  N  N     . ARG A 1  344  ? 106.103 37.376  -13.746 1.00 60.08  ? 344  ARG A N     1 
ATOM   2655  C  CA    . ARG A 1  344  ? 106.063 36.355  -12.698 1.00 60.18  ? 344  ARG A CA    1 
ATOM   2656  C  C     . ARG A 1  344  ? 107.188 35.391  -13.130 1.00 63.43  ? 344  ARG A C     1 
ATOM   2657  O  O     . ARG A 1  344  ? 107.396 35.215  -14.328 1.00 63.51  ? 344  ARG A O     1 
ATOM   2658  C  CB    . ARG A 1  344  ? 104.691 35.655  -12.624 1.00 61.39  ? 344  ARG A CB    1 
ATOM   2659  C  CG    . ARG A 1  344  ? 104.009 35.915  -11.290 1.00 72.63  ? 344  ARG A CG    1 
ATOM   2660  C  CD    . ARG A 1  344  ? 102.510 36.219  -11.347 1.00 86.50  ? 344  ARG A CD    1 
ATOM   2661  N  NE    . ARG A 1  344  ? 102.122 37.110  -10.241 1.00 110.62 ? 344  ARG A NE    1 
ATOM   2662  C  CZ    . ARG A 1  344  ? 102.061 36.762  -8.948  1.00 139.71 ? 344  ARG A CZ    1 
ATOM   2663  N  NH1   . ARG A 1  344  ? 102.329 35.518  -8.571  1.00 131.70 ? 344  ARG A NH1   1 
ATOM   2664  N  NH2   . ARG A 1  344  ? 101.710 37.654  -8.029  1.00 131.77 ? 344  ARG A NH2   1 
ATOM   2665  N  N     . VAL A 1  345  ? 107.993 34.885  -12.208 1.00 59.15  ? 345  VAL A N     1 
ATOM   2666  C  CA    . VAL A 1  345  ? 109.118 34.048  -12.615 1.00 59.11  ? 345  VAL A CA    1 
ATOM   2667  C  C     . VAL A 1  345  ? 109.185 32.699  -11.917 1.00 65.77  ? 345  VAL A C     1 
ATOM   2668  O  O     . VAL A 1  345  ? 108.697 32.576  -10.795 1.00 67.12  ? 345  VAL A O     1 
ATOM   2669  C  CB    . VAL A 1  345  ? 110.452 34.821  -12.476 1.00 63.16  ? 345  VAL A CB    1 
ATOM   2670  C  CG1   . VAL A 1  345  ? 110.462 36.053  -13.365 1.00 63.37  ? 345  VAL A CG1   1 
ATOM   2671  C  CG2   . VAL A 1  345  ? 110.753 35.200  -11.021 1.00 63.03  ? 345  VAL A CG2   1 
ATOM   2672  N  N     . ASP A 1  346  ? 109.818 31.694  -12.553 1.00 63.04  ? 346  ASP A N     1 
ATOM   2673  C  CA    . ASP A 1  346  ? 110.075 30.385  -11.924 1.00 63.76  ? 346  ASP A CA    1 
ATOM   2674  C  C     . ASP A 1  346  ? 111.385 30.549  -11.096 1.00 66.80  ? 346  ASP A C     1 
ATOM   2675  O  O     . ASP A 1  346  ? 112.106 31.534  -11.304 1.00 65.77  ? 346  ASP A O     1 
ATOM   2676  C  CB    . ASP A 1  346  ? 110.301 29.284  -12.981 1.00 66.63  ? 346  ASP A CB    1 
ATOM   2677  C  CG    . ASP A 1  346  ? 109.230 29.050  -14.035 1.00 79.38  ? 346  ASP A CG    1 
ATOM   2678  O  OD1   . ASP A 1  346  ? 108.023 29.114  -13.682 1.00 78.86  ? 346  ASP A OD1   1 
ATOM   2679  O  OD2   . ASP A 1  346  ? 109.602 28.641  -15.185 1.00 85.45  ? 346  ASP A OD2   1 
ATOM   2680  N  N     . PHE A 1  347  ? 111.729 29.566  -10.223 1.00 63.46  ? 347  PHE A N     1 
ATOM   2681  C  CA    . PHE A 1  347  ? 112.947 29.588  -9.367  1.00 63.35  ? 347  PHE A CA    1 
ATOM   2682  C  C     . PHE A 1  347  ? 112.900 30.740  -8.397  1.00 67.02  ? 347  PHE A C     1 
ATOM   2683  O  O     . PHE A 1  347  ? 113.838 31.531  -8.224  1.00 67.38  ? 347  PHE A O     1 
ATOM   2684  C  CB    . PHE A 1  347  ? 114.261 29.513  -10.174 1.00 65.16  ? 347  PHE A CB    1 
ATOM   2685  C  CG    . PHE A 1  347  ? 114.229 28.305  -11.059 1.00 67.28  ? 347  PHE A CG    1 
ATOM   2686  C  CD1   . PHE A 1  347  ? 114.603 27.063  -10.573 1.00 70.69  ? 347  PHE A CD1   1 
ATOM   2687  C  CD2   . PHE A 1  347  ? 113.708 28.381  -12.346 1.00 71.09  ? 347  PHE A CD2   1 
ATOM   2688  C  CE1   . PHE A 1  347  ? 114.496 25.925  -11.366 1.00 72.46  ? 347  PHE A CE1   1 
ATOM   2689  C  CE2   . PHE A 1  347  ? 113.586 27.240  -13.138 1.00 74.67  ? 347  PHE A CE2   1 
ATOM   2690  C  CZ    . PHE A 1  347  ? 113.988 26.020  -12.644 1.00 72.91  ? 347  PHE A CZ    1 
ATOM   2691  N  N     . SER A 1  348  ? 111.746 30.847  -7.792  1.00 62.32  ? 348  SER A N     1 
ATOM   2692  C  CA    . SER A 1  348  ? 111.460 31.890  -6.848  1.00 62.19  ? 348  SER A CA    1 
ATOM   2693  C  C     . SER A 1  348  ? 110.767 31.230  -5.653  1.00 64.18  ? 348  SER A C     1 
ATOM   2694  O  O     . SER A 1  348  ? 110.046 30.238  -5.823  1.00 65.07  ? 348  SER A O     1 
ATOM   2695  C  CB    . SER A 1  348  ? 110.579 32.957  -7.501  1.00 66.69  ? 348  SER A CB    1 
ATOM   2696  O  OG    . SER A 1  348  ? 109.395 32.389  -8.048  1.00 77.46  ? 348  SER A OG    1 
ATOM   2697  N  N     . ALA A 1  349  ? 111.016 31.758  -4.449  1.00 56.22  ? 349  ALA A N     1 
ATOM   2698  C  CA    . ALA A 1  349  ? 110.413 31.281  -3.226  1.00 54.00  ? 349  ALA A CA    1 
ATOM   2699  C  C     . ALA A 1  349  ? 110.118 32.455  -2.307  1.00 57.45  ? 349  ALA A C     1 
ATOM   2700  O  O     . ALA A 1  349  ? 110.833 33.467  -2.321  1.00 58.48  ? 349  ALA A O     1 
ATOM   2701  C  CB    . ALA A 1  349  ? 111.357 30.326  -2.549  1.00 54.51  ? 349  ALA A CB    1 
ATOM   2702  N  N     . ARG A 1  350  ? 109.067 32.342  -1.510  1.00 52.72  ? 350  ARG A N     1 
ATOM   2703  C  CA    . ARG A 1  350  ? 108.733 33.394  -0.551  1.00 52.65  ? 350  ARG A CA    1 
ATOM   2704  C  C     . ARG A 1  350  ? 108.178 32.816  0.744   1.00 58.49  ? 350  ARG A C     1 
ATOM   2705  O  O     . ARG A 1  350  ? 107.327 31.919  0.721   1.00 58.34  ? 350  ARG A O     1 
ATOM   2706  C  CB    . ARG A 1  350  ? 107.791 34.422  -1.179  1.00 50.04  ? 350  ARG A CB    1 
ATOM   2707  C  CG    . ARG A 1  350  ? 107.146 35.407  -0.248  1.00 54.79  ? 350  ARG A CG    1 
ATOM   2708  C  CD    . ARG A 1  350  ? 106.075 36.142  -1.014  1.00 64.57  ? 350  ARG A CD    1 
ATOM   2709  N  NE    . ARG A 1  350  ? 105.377 37.103  -0.170  1.00 78.35  ? 350  ARG A NE    1 
ATOM   2710  C  CZ    . ARG A 1  350  ? 105.634 38.405  -0.125  1.00 93.33  ? 350  ARG A CZ    1 
ATOM   2711  N  NH1   . ARG A 1  350  ? 106.575 38.933  -0.902  1.00 72.70  ? 350  ARG A NH1   1 
ATOM   2712  N  NH2   . ARG A 1  350  ? 104.950 39.191  0.694   1.00 89.27  ? 350  ARG A NH2   1 
ATOM   2713  N  N     . THR A 1  351  ? 108.708 33.301  1.875   1.00 55.35  ? 351  THR A N     1 
ATOM   2714  C  CA    . THR A 1  351  ? 108.264 32.911  3.211   1.00 55.13  ? 351  THR A CA    1 
ATOM   2715  C  C     . THR A 1  351  ? 108.543 34.009  4.179   1.00 60.01  ? 351  THR A C     1 
ATOM   2716  O  O     . THR A 1  351  ? 109.154 35.015  3.813   1.00 59.44  ? 351  THR A O     1 
ATOM   2717  C  CB    . THR A 1  351  ? 108.772 31.524  3.693   1.00 55.33  ? 351  THR A CB    1 
ATOM   2718  O  OG1   . THR A 1  351  ? 108.084 31.228  4.900   1.00 46.25  ? 351  THR A OG1   1 
ATOM   2719  C  CG2   . THR A 1  351  ? 110.251 31.490  3.989   1.00 54.12  ? 351  THR A CG2   1 
ATOM   2720  N  N     . VAL A 1  352  ? 108.091 33.794  5.423   1.00 57.29  ? 352  VAL A N     1 
ATOM   2721  C  CA    . VAL A 1  352  ? 108.252 34.662  6.580   1.00 57.04  ? 352  VAL A CA    1 
ATOM   2722  C  C     . VAL A 1  352  ? 109.718 34.713  6.980   1.00 63.98  ? 352  VAL A C     1 
ATOM   2723  O  O     . VAL A 1  352  ? 110.402 33.683  6.977   1.00 64.84  ? 352  VAL A O     1 
ATOM   2724  C  CB    . VAL A 1  352  ? 107.367 34.127  7.712   1.00 59.24  ? 352  VAL A CB    1 
ATOM   2725  C  CG1   . VAL A 1  352  ? 107.775 34.673  9.063   1.00 59.08  ? 352  VAL A CG1   1 
ATOM   2726  C  CG2   . VAL A 1  352  ? 105.924 34.443  7.424   1.00 59.11  ? 352  VAL A CG2   1 
ATOM   2727  N  N     . ILE A 1  353  ? 110.201 35.909  7.300   1.00 60.95  ? 353  ILE A N     1 
ATOM   2728  C  CA    . ILE A 1  353  ? 111.570 36.054  7.745   1.00 61.77  ? 353  ILE A CA    1 
ATOM   2729  C  C     . ILE A 1  353  ? 111.655 36.170  9.228   1.00 69.15  ? 353  ILE A C     1 
ATOM   2730  O  O     . ILE A 1  353  ? 110.739 36.703  9.861   1.00 71.03  ? 353  ILE A O     1 
ATOM   2731  C  CB    . ILE A 1  353  ? 112.336 37.187  7.040   1.00 65.17  ? 353  ILE A CB    1 
ATOM   2732  C  CG1   . ILE A 1  353  ? 111.581 38.527  7.049   1.00 65.60  ? 353  ILE A CG1   1 
ATOM   2733  C  CG2   . ILE A 1  353  ? 112.652 36.770  5.650   1.00 67.17  ? 353  ILE A CG2   1 
ATOM   2734  C  CD1   . ILE A 1  353  ? 112.328 39.652  7.567   1.00 65.67  ? 353  ILE A CD1   1 
ATOM   2735  N  N     . SER A 1  354  ? 112.749 35.659  9.787   1.00 66.83  ? 354  SER A N     1 
ATOM   2736  C  CA    . SER A 1  354  ? 113.105 35.775  11.199  1.00 68.39  ? 354  SER A CA    1 
ATOM   2737  C  C     . SER A 1  354  ? 114.635 35.835  11.353  1.00 73.13  ? 354  SER A C     1 
ATOM   2738  O  O     . SER A 1  354  ? 115.358 35.147  10.642  1.00 72.84  ? 354  SER A O     1 
ATOM   2739  C  CB    . SER A 1  354  ? 112.391 34.758  12.099  1.00 73.61  ? 354  SER A CB    1 
ATOM   2740  O  OG    . SER A 1  354  ? 112.317 33.441  11.578  1.00 83.83  ? 354  SER A OG    1 
ATOM   2741  N  N     . GLY A 1  355  ? 115.106 36.749  12.186  1.00 70.12  ? 355  GLY A N     1 
ATOM   2742  C  CA    . GLY A 1  355  ? 116.530 36.962  12.407  1.00 69.69  ? 355  GLY A CA    1 
ATOM   2743  C  C     . GLY A 1  355  ? 117.198 35.871  13.205  1.00 71.98  ? 355  GLY A C     1 
ATOM   2744  O  O     . GLY A 1  355  ? 116.554 35.200  14.025  1.00 72.91  ? 355  GLY A O     1 
ATOM   2745  N  N     . ASP A 1  356  ? 118.503 35.709  12.964  1.00 65.76  ? 356  ASP A N     1 
ATOM   2746  C  CA    . ASP A 1  356  ? 119.327 34.694  13.587  1.00 65.31  ? 356  ASP A CA    1 
ATOM   2747  C  C     . ASP A 1  356  ? 120.711 35.260  13.922  1.00 71.56  ? 356  ASP A C     1 
ATOM   2748  O  O     . ASP A 1  356  ? 121.384 35.736  13.007  1.00 71.48  ? 356  ASP A O     1 
ATOM   2749  C  CB    . ASP A 1  356  ? 119.461 33.525  12.626  1.00 66.00  ? 356  ASP A CB    1 
ATOM   2750  C  CG    . ASP A 1  356  ? 119.929 32.257  13.272  1.00 78.37  ? 356  ASP A CG    1 
ATOM   2751  O  OD1   . ASP A 1  356  ? 120.879 32.319  14.090  1.00 79.77  ? 356  ASP A OD1   1 
ATOM   2752  O  OD2   . ASP A 1  356  ? 119.393 31.191  12.921  1.00 85.22  ? 356  ASP A OD2   1 
ATOM   2753  N  N     . PRO A 1  357  ? 121.177 35.236  15.204  1.00 69.56  ? 357  PRO A N     1 
ATOM   2754  C  CA    . PRO A 1  357  ? 122.515 35.785  15.497  1.00 70.21  ? 357  PRO A CA    1 
ATOM   2755  C  C     . PRO A 1  357  ? 123.639 34.807  15.131  1.00 74.85  ? 357  PRO A C     1 
ATOM   2756  O  O     . PRO A 1  357  ? 124.813 35.203  15.058  1.00 75.27  ? 357  PRO A O     1 
ATOM   2757  C  CB    . PRO A 1  357  ? 122.466 36.085  17.005  1.00 72.53  ? 357  PRO A CB    1 
ATOM   2758  C  CG    . PRO A 1  357  ? 121.136 35.549  17.513  1.00 75.83  ? 357  PRO A CG    1 
ATOM   2759  C  CD    . PRO A 1  357  ? 120.524 34.740  16.434  1.00 70.82  ? 357  PRO A CD    1 
ATOM   2760  N  N     . ASN A 1  358  ? 123.271 33.537  14.869  1.00 70.37  ? 358  ASN A N     1 
ATOM   2761  C  CA    . ASN A 1  358  ? 124.221 32.499  14.519  1.00 70.23  ? 358  ASN A CA    1 
ATOM   2762  C  C     . ASN A 1  358  ? 124.473 32.307  13.045  1.00 76.50  ? 358  ASN A C     1 
ATOM   2763  O  O     . ASN A 1  358  ? 125.357 31.535  12.672  1.00 77.58  ? 358  ASN A O     1 
ATOM   2764  C  CB    . ASN A 1  358  ? 123.917 31.235  15.236  1.00 67.72  ? 358  ASN A CB    1 
ATOM   2765  C  CG    . ASN A 1  358  ? 124.196 31.422  16.676  1.00 86.64  ? 358  ASN A CG    1 
ATOM   2766  O  OD1   . ASN A 1  358  ? 125.306 31.832  17.062  1.00 75.50  ? 358  ASN A OD1   1 
ATOM   2767  N  ND2   . ASN A 1  358  ? 123.152 31.262  17.478  1.00 80.69  ? 358  ASN A ND2   1 
ATOM   2768  N  N     . LEU A 1  359  ? 123.744 33.041  12.197  1.00 72.29  ? 359  LEU A N     1 
ATOM   2769  C  CA    . LEU A 1  359  ? 124.032 33.036  10.775  1.00 70.92  ? 359  LEU A CA    1 
ATOM   2770  C  C     . LEU A 1  359  ? 125.124 34.096  10.546  1.00 76.74  ? 359  LEU A C     1 
ATOM   2771  O  O     . LEU A 1  359  ? 125.327 34.993  11.385  1.00 76.76  ? 359  LEU A O     1 
ATOM   2772  C  CB    . LEU A 1  359  ? 122.793 33.361  9.942   1.00 69.91  ? 359  LEU A CB    1 
ATOM   2773  C  CG    . LEU A 1  359  ? 121.768 32.253  9.733   1.00 74.12  ? 359  LEU A CG    1 
ATOM   2774  C  CD1   . LEU A 1  359  ? 120.938 32.541  8.510   1.00 73.05  ? 359  LEU A CD1   1 
ATOM   2775  C  CD2   . LEU A 1  359  ? 122.424 30.870  9.608   1.00 77.17  ? 359  LEU A CD2   1 
ATOM   2776  N  N     . GLU A 1  360  ? 125.867 33.948  9.440   1.00 73.16  ? 360  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1  360  ? 126.920 34.868  9.043   1.00 72.10  ? 360  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1  360  ? 126.253 36.045  8.334   1.00 72.85  ? 360  GLU A C     1 
ATOM   2779  O  O     . GLU A 1  360  ? 125.097 35.890  7.937   1.00 73.01  ? 360  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1  360  ? 127.952 34.125  8.189   1.00 73.48  ? 360  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1  360  ? 129.111 33.605  9.029   1.00 89.15  ? 360  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1  360  ? 129.982 34.663  9.706   1.00 131.36 ? 360  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1  360  ? 130.135 35.782  9.150   1.00 133.11 ? 360  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1  360  ? 130.517 34.360  10.800  1.00 129.46 ? 360  GLU A OE2   1 
ATOM   2785  N  N     . LEU A 1  361  ? 126.899 37.233  8.249   1.00 66.43  ? 361  LEU A N     1 
ATOM   2786  C  CA    . LEU A 1  361  ? 126.236 38.392  7.621   1.00 64.97  ? 361  LEU A CA    1 
ATOM   2787  C  C     . LEU A 1  361  ? 125.618 38.078  6.217   1.00 67.73  ? 361  LEU A C     1 
ATOM   2788  O  O     . LEU A 1  361  ? 124.411 38.329  5.970   1.00 66.97  ? 361  LEU A O     1 
ATOM   2789  C  CB    . LEU A 1  361  ? 127.187 39.611  7.579   1.00 64.92  ? 361  LEU A CB    1 
ATOM   2790  C  CG    . LEU A 1  361  ? 126.657 40.925  6.943   1.00 68.02  ? 361  LEU A CG    1 
ATOM   2791  C  CD1   . LEU A 1  361  ? 125.911 41.786  7.963   1.00 68.41  ? 361  LEU A CD1   1 
ATOM   2792  C  CD2   . LEU A 1  361  ? 127.788 41.725  6.284   1.00 67.21  ? 361  LEU A CD2   1 
ATOM   2793  N  N     . ASP A 1  362  ? 126.457 37.446  5.354   1.00 62.54  ? 362  ASP A N     1 
ATOM   2794  C  CA    . ASP A 1  362  ? 126.168 37.075  3.975   1.00 61.60  ? 362  ASP A CA    1 
ATOM   2795  C  C     . ASP A 1  362  ? 125.393 35.779  3.745   1.00 62.74  ? 362  ASP A C     1 
ATOM   2796  O  O     . ASP A 1  362  ? 125.158 35.414  2.590   1.00 62.53  ? 362  ASP A O     1 
ATOM   2797  C  CB    . ASP A 1  362  ? 127.429 37.156  3.088   1.00 64.66  ? 362  ASP A CB    1 
ATOM   2798  C  CG    . ASP A 1  362  ? 128.505 36.094  3.301   1.00 82.88  ? 362  ASP A CG    1 
ATOM   2799  O  OD1   . ASP A 1  362  ? 128.513 35.456  4.377   1.00 84.75  ? 362  ASP A OD1   1 
ATOM   2800  O  OD2   . ASP A 1  362  ? 129.371 35.938  2.409   1.00 90.87  ? 362  ASP A OD2   1 
ATOM   2801  N  N     . GLN A 1  363  ? 124.990 35.072  4.795   1.00 56.62  ? 363  GLN A N     1 
ATOM   2802  C  CA    . GLN A 1  363  ? 124.167 33.908  4.506   1.00 54.49  ? 363  GLN A CA    1 
ATOM   2803  C  C     . GLN A 1  363  ? 122.696 34.178  4.760   1.00 57.80  ? 363  GLN A C     1 
ATOM   2804  O  O     . GLN A 1  363  ? 122.309 35.282  5.237   1.00 57.57  ? 363  GLN A O     1 
ATOM   2805  C  CB    . GLN A 1  363  ? 124.683 32.578  5.076   1.00 55.39  ? 363  GLN A CB    1 
ATOM   2806  C  CG    . GLN A 1  363  ? 124.981 32.554  6.570   1.00 65.82  ? 363  GLN A CG    1 
ATOM   2807  C  CD    . GLN A 1  363  ? 125.839 31.370  6.976   1.00 86.15  ? 363  GLN A CD    1 
ATOM   2808  O  OE1   . GLN A 1  363  ? 125.974 31.045  8.170   1.00 78.33  ? 363  GLN A OE1   1 
ATOM   2809  N  NE2   . GLN A 1  363  ? 126.422 30.676  5.989   1.00 82.28  ? 363  GLN A NE2   1 
ATOM   2810  N  N     . VAL A 1  364  ? 121.879 33.195  4.327   1.00 52.42  ? 364  VAL A N     1 
ATOM   2811  C  CA    . VAL A 1  364  ? 120.423 33.149  4.421   1.00 50.50  ? 364  VAL A CA    1 
ATOM   2812  C  C     . VAL A 1  364  ? 119.987 31.725  4.715   1.00 54.82  ? 364  VAL A C     1 
ATOM   2813  O  O     . VAL A 1  364  ? 120.359 30.773  4.010   1.00 53.71  ? 364  VAL A O     1 
ATOM   2814  C  CB    . VAL A 1  364  ? 119.668 33.790  3.208   1.00 51.46  ? 364  VAL A CB    1 
ATOM   2815  C  CG1   . VAL A 1  364  ? 120.126 33.203  1.867   1.00 50.24  ? 364  VAL A CG1   1 
ATOM   2816  C  CG2   . VAL A 1  364  ? 118.155 33.667  3.371   1.00 50.40  ? 364  VAL A CG2   1 
ATOM   2817  N  N     . GLY A 1  365  ? 119.210 31.607  5.772   1.00 53.08  ? 365  GLY A N     1 
ATOM   2818  C  CA    . GLY A 1  365  ? 118.638 30.347  6.216   1.00 53.97  ? 365  GLY A CA    1 
ATOM   2819  C  C     . GLY A 1  365  ? 117.550 29.869  5.279   1.00 58.27  ? 365  GLY A C     1 
ATOM   2820  O  O     . GLY A 1  365  ? 116.532 30.544  5.099   1.00 58.38  ? 365  GLY A O     1 
ATOM   2821  N  N     . VAL A 1  366  ? 117.757 28.718  4.654   1.00 54.04  ? 366  VAL A N     1 
ATOM   2822  C  CA    . VAL A 1  366  ? 116.746 28.245  3.736   1.00 53.24  ? 366  VAL A CA    1 
ATOM   2823  C  C     . VAL A 1  366  ? 116.015 27.036  4.259   1.00 56.29  ? 366  VAL A C     1 
ATOM   2824  O  O     . VAL A 1  366  ? 116.628 25.991  4.427   1.00 55.32  ? 366  VAL A O     1 
ATOM   2825  C  CB    . VAL A 1  366  ? 117.217 28.099  2.269   1.00 56.93  ? 366  VAL A CB    1 
ATOM   2826  C  CG1   . VAL A 1  366  ? 116.025 27.834  1.347   1.00 56.40  ? 366  VAL A CG1   1 
ATOM   2827  C  CG2   . VAL A 1  366  ? 118.000 29.334  1.801   1.00 56.60  ? 366  VAL A CG2   1 
ATOM   2828  N  N     . PRO A 1  367  ? 114.695 27.160  4.510   1.00 54.12  ? 367  PRO A N     1 
ATOM   2829  C  CA    . PRO A 1  367  ? 113.915 25.990  4.965   1.00 54.92  ? 367  PRO A CA    1 
ATOM   2830  C  C     . PRO A 1  367  ? 114.078 24.801  4.007   1.00 59.24  ? 367  PRO A C     1 
ATOM   2831  O  O     . PRO A 1  367  ? 113.928 25.008  2.801   1.00 57.16  ? 367  PRO A O     1 
ATOM   2832  C  CB    . PRO A 1  367  ? 112.471 26.506  4.947   1.00 56.65  ? 367  PRO A CB    1 
ATOM   2833  C  CG    . PRO A 1  367  ? 112.577 27.975  5.028   1.00 60.48  ? 367  PRO A CG    1 
ATOM   2834  C  CD    . PRO A 1  367  ? 113.847 28.364  4.371   1.00 55.39  ? 367  PRO A CD    1 
ATOM   2835  N  N     . LYS A 1  368  ? 114.421 23.575  4.538   1.00 57.85  ? 368  LYS A N     1 
ATOM   2836  C  CA    . LYS A 1  368  ? 114.639 22.305  3.786   1.00 57.92  ? 368  LYS A CA    1 
ATOM   2837  C  C     . LYS A 1  368  ? 113.645 22.132  2.641   1.00 62.67  ? 368  LYS A C     1 
ATOM   2838  O  O     . LYS A 1  368  ? 114.082 21.970  1.506   1.00 62.09  ? 368  LYS A O     1 
ATOM   2839  C  CB    . LYS A 1  368  ? 114.607 21.067  4.722   1.00 60.31  ? 368  LYS A CB    1 
ATOM   2840  C  CG    . LYS A 1  368  ? 115.414 19.826  4.291   1.00 65.89  ? 368  LYS A CG    1 
ATOM   2841  C  CD    . LYS A 1  368  ? 114.729 18.507  4.823   1.00 87.99  ? 368  LYS A CD    1 
ATOM   2842  C  CE    . LYS A 1  368  ? 115.568 17.211  4.805   1.00 105.72 ? 368  LYS A CE    1 
ATOM   2843  N  NZ    . LYS A 1  368  ? 114.849 15.977  4.285   1.00 99.98  ? 368  LYS A NZ    1 
ATOM   2844  N  N     . SER A 1  369  ? 112.313 22.253  2.934   1.00 59.94  ? 369  SER A N     1 
ATOM   2845  C  CA    . SER A 1  369  ? 111.192 22.155  1.977   1.00 59.39  ? 369  SER A CA    1 
ATOM   2846  C  C     . SER A 1  369  ? 111.405 23.031  0.754   1.00 62.31  ? 369  SER A C     1 
ATOM   2847  O  O     . SER A 1  369  ? 111.128 22.597  -0.364  1.00 60.45  ? 369  SER A O     1 
ATOM   2848  C  CB    . SER A 1  369  ? 109.850 22.476  2.649   1.00 62.51  ? 369  SER A CB    1 
ATOM   2849  O  OG    . SER A 1  369  ? 109.467 23.842  2.720   1.00 65.91  ? 369  SER A OG    1 
ATOM   2850  N  N     . ILE A 1  370  ? 111.923 24.259  0.983   1.00 59.57  ? 370  ILE A N     1 
ATOM   2851  C  CA    . ILE A 1  370  ? 112.228 25.224  -0.068  1.00 58.84  ? 370  ILE A CA    1 
ATOM   2852  C  C     . ILE A 1  370  ? 113.437 24.758  -0.863  1.00 63.76  ? 370  ILE A C     1 
ATOM   2853  O  O     . ILE A 1  370  ? 113.356 24.723  -2.088  1.00 64.62  ? 370  ILE A O     1 
ATOM   2854  C  CB    . ILE A 1  370  ? 112.303 26.688  0.433   1.00 61.10  ? 370  ILE A CB    1 
ATOM   2855  C  CG1   . ILE A 1  370  ? 110.888 27.182  0.859   1.00 61.06  ? 370  ILE A CG1   1 
ATOM   2856  C  CG2   . ILE A 1  370  ? 112.912 27.587  -0.641  1.00 60.38  ? 370  ILE A CG2   1 
ATOM   2857  C  CD1   . ILE A 1  370  ? 110.785 28.574  1.538   1.00 68.36  ? 370  ILE A CD1   1 
ATOM   2858  N  N     . ALA A 1  371  ? 114.515 24.322  -0.183  1.00 59.93  ? 371  ALA A N     1 
ATOM   2859  C  CA    . ALA A 1  371  ? 115.707 23.812  -0.858  1.00 59.33  ? 371  ALA A CA    1 
ATOM   2860  C  C     . ALA A 1  371  ? 115.369 22.572  -1.684  1.00 64.75  ? 371  ALA A C     1 
ATOM   2861  O  O     . ALA A 1  371  ? 115.866 22.425  -2.799  1.00 64.99  ? 371  ALA A O     1 
ATOM   2862  C  CB    . ALA A 1  371  ? 116.780 23.489  0.150   1.00 59.96  ? 371  ALA A CB    1 
ATOM   2863  N  N     . LYS A 1  372  ? 114.457 21.730  -1.173  1.00 61.46  ? 372  LYS A N     1 
ATOM   2864  C  CA    . LYS A 1  372  ? 114.022 20.502  -1.832  1.00 61.06  ? 372  LYS A CA    1 
ATOM   2865  C  C     . LYS A 1  372  ? 113.154 20.754  -3.095  1.00 66.56  ? 372  LYS A C     1 
ATOM   2866  O  O     . LYS A 1  372  ? 112.903 19.810  -3.858  1.00 67.78  ? 372  LYS A O     1 
ATOM   2867  C  CB    . LYS A 1  372  ? 113.303 19.574  -0.834  1.00 62.62  ? 372  LYS A CB    1 
ATOM   2868  C  CG    . LYS A 1  372  ? 114.192 18.903  0.232   1.00 63.10  ? 372  LYS A CG    1 
ATOM   2869  C  CD    . LYS A 1  372  ? 113.822 17.414  0.514   1.00 71.78  ? 372  LYS A CD    1 
ATOM   2870  C  CE    . LYS A 1  372  ? 112.363 17.053  0.818   1.00 78.29  ? 372  LYS A CE    1 
ATOM   2871  N  NZ    . LYS A 1  372  ? 111.893 17.570  2.134   1.00 92.86  ? 372  LYS A NZ    1 
ATOM   2872  N  N     . THR A 1  373  ? 112.699 22.012  -3.309  1.00 62.25  ? 373  THR A N     1 
ATOM   2873  C  CA    . THR A 1  373  ? 111.850 22.412  -4.443  1.00 61.62  ? 373  THR A CA    1 
ATOM   2874  C  C     . THR A 1  373  ? 112.716 23.143  -5.469  1.00 66.69  ? 373  THR A C     1 
ATOM   2875  O  O     . THR A 1  373  ? 112.673 22.841  -6.673  1.00 67.03  ? 373  THR A O     1 
ATOM   2876  C  CB    . THR A 1  373  ? 110.717 23.352  -3.954  1.00 63.80  ? 373  THR A CB    1 
ATOM   2877  O  OG1   . THR A 1  373  ? 109.904 22.688  -3.009  1.00 63.30  ? 373  THR A OG1   1 
ATOM   2878  C  CG2   . THR A 1  373  ? 109.835 23.834  -5.058  1.00 62.93  ? 373  THR A CG2   1 
ATOM   2879  N  N     . LEU A 1  374  ? 113.453 24.151  -4.976  1.00 62.58  ? 374  LEU A N     1 
ATOM   2880  C  CA    . LEU A 1  374  ? 114.319 25.009  -5.768  1.00 61.85  ? 374  LEU A CA    1 
ATOM   2881  C  C     . LEU A 1  374  ? 115.510 24.235  -6.319  1.00 66.45  ? 374  LEU A C     1 
ATOM   2882  O  O     . LEU A 1  374  ? 116.066 23.378  -5.639  1.00 67.55  ? 374  LEU A O     1 
ATOM   2883  C  CB    . LEU A 1  374  ? 114.726 26.255  -4.973  1.00 61.25  ? 374  LEU A CB    1 
ATOM   2884  C  CG    . LEU A 1  374  ? 113.615 27.244  -4.668  1.00 63.70  ? 374  LEU A CG    1 
ATOM   2885  C  CD1   . LEU A 1  374  ? 114.138 28.329  -3.796  1.00 63.73  ? 374  LEU A CD1   1 
ATOM   2886  C  CD2   . LEU A 1  374  ? 113.026 27.831  -5.945  1.00 62.78  ? 374  LEU A CD2   1 
ATOM   2887  N  N     . THR A 1  375  ? 115.865 24.509  -7.565  1.00 61.59  ? 375  THR A N     1 
ATOM   2888  C  CA    . THR A 1  375  ? 116.828 23.721  -8.273  1.00 61.92  ? 375  THR A CA    1 
ATOM   2889  C  C     . THR A 1  375  ? 117.944 24.478  -9.008  1.00 70.91  ? 375  THR A C     1 
ATOM   2890  O  O     . THR A 1  375  ? 117.756 25.611  -9.457  1.00 72.21  ? 375  THR A O     1 
ATOM   2891  C  CB    . THR A 1  375  ? 115.966 22.773  -9.146  1.00 63.62  ? 375  THR A CB    1 
ATOM   2892  O  OG1   . THR A 1  375  ? 116.099 21.452  -8.647  1.00 63.62  ? 375  THR A OG1   1 
ATOM   2893  C  CG2   . THR A 1  375  ? 116.191 22.891  -10.688 1.00 58.13  ? 375  THR A CG2   1 
ATOM   2894  N  N     . TYR A 1  376  ? 119.098 23.823  -9.175  1.00 68.27  ? 376  TYR A N     1 
ATOM   2895  C  CA    . TYR A 1  376  ? 120.157 24.365  -10.011 1.00 68.03  ? 376  TYR A CA    1 
ATOM   2896  C  C     . TYR A 1  376  ? 120.461 23.312  -11.075 1.00 72.76  ? 376  TYR A C     1 
ATOM   2897  O  O     . TYR A 1  376  ? 120.625 22.138  -10.702 1.00 73.69  ? 376  TYR A O     1 
ATOM   2898  C  CB    . TYR A 1  376  ? 121.411 24.714  -9.217  1.00 69.29  ? 376  TYR A CB    1 
ATOM   2899  C  CG    . TYR A 1  376  ? 122.488 25.320  -10.089 1.00 70.66  ? 376  TYR A CG    1 
ATOM   2900  C  CD1   . TYR A 1  376  ? 122.412 26.643  -10.505 1.00 72.49  ? 376  TYR A CD1   1 
ATOM   2901  C  CD2   . TYR A 1  376  ? 123.573 24.563  -10.514 1.00 71.82  ? 376  TYR A CD2   1 
ATOM   2902  C  CE1   . TYR A 1  376  ? 123.384 27.196  -11.335 1.00 74.64  ? 376  TYR A CE1   1 
ATOM   2903  C  CE2   . TYR A 1  376  ? 124.553 25.104  -11.341 1.00 73.24  ? 376  TYR A CE2   1 
ATOM   2904  C  CZ    . TYR A 1  376  ? 124.461 26.425  -11.745 1.00 83.84  ? 376  TYR A CZ    1 
ATOM   2905  O  OH    . TYR A 1  376  ? 125.436 26.961  -12.557 1.00 88.72  ? 376  TYR A OH    1 
ATOM   2906  N  N     . PRO A 1  377  ? 120.535 23.690  -12.385 1.00 67.45  ? 377  PRO A N     1 
ATOM   2907  C  CA    . PRO A 1  377  ? 120.820 22.698  -13.442 1.00 66.60  ? 377  PRO A CA    1 
ATOM   2908  C  C     . PRO A 1  377  ? 122.307 22.591  -13.669 1.00 69.76  ? 377  PRO A C     1 
ATOM   2909  O  O     . PRO A 1  377  ? 122.888 23.424  -14.357 1.00 70.04  ? 377  PRO A O     1 
ATOM   2910  C  CB    . PRO A 1  377  ? 120.114 23.275  -14.659 1.00 68.47  ? 377  PRO A CB    1 
ATOM   2911  C  CG    . PRO A 1  377  ? 119.871 24.726  -14.333 1.00 73.26  ? 377  PRO A CG    1 
ATOM   2912  C  CD    . PRO A 1  377  ? 120.363 25.027  -12.965 1.00 68.64  ? 377  PRO A CD    1 
ATOM   2913  N  N     . GLU A 1  378  ? 122.937 21.619  -13.002 1.00 65.82  ? 378  GLU A N     1 
ATOM   2914  C  CA    . GLU A 1  378  ? 124.388 21.430  -13.015 1.00 64.89  ? 378  GLU A CA    1 
ATOM   2915  C  C     . GLU A 1  378  ? 124.786 20.506  -14.140 1.00 69.19  ? 378  GLU A C     1 
ATOM   2916  O  O     . GLU A 1  378  ? 124.163 19.457  -14.309 1.00 69.44  ? 378  GLU A O     1 
ATOM   2917  C  CB    . GLU A 1  378  ? 124.868 20.910  -11.646 1.00 65.68  ? 378  GLU A CB    1 
ATOM   2918  C  CG    . GLU A 1  378  ? 126.369 20.980  -11.465 1.00 74.60  ? 378  GLU A CG    1 
ATOM   2919  C  CD    . GLU A 1  378  ? 126.826 20.992  -10.023 1.00 101.85 ? 378  GLU A CD    1 
ATOM   2920  O  OE1   . GLU A 1  378  ? 126.716 19.931  -9.370  1.00 78.97  ? 378  GLU A OE1   1 
ATOM   2921  O  OE2   . GLU A 1  378  ? 127.295 22.054  -9.542  1.00 112.33 ? 378  GLU A OE2   1 
ATOM   2922  N  N     . VAL A 1  379  ? 125.811 20.894  -14.921 1.00 65.05  ? 379  VAL A N     1 
ATOM   2923  C  CA    . VAL A 1  379  ? 126.296 20.070  -16.041 1.00 63.99  ? 379  VAL A CA    1 
ATOM   2924  C  C     . VAL A 1  379  ? 127.290 18.971  -15.650 1.00 68.30  ? 379  VAL A C     1 
ATOM   2925  O  O     . VAL A 1  379  ? 128.326 19.264  -15.049 1.00 66.89  ? 379  VAL A O     1 
ATOM   2926  C  CB    . VAL A 1  379  ? 126.761 20.904  -17.245 1.00 65.68  ? 379  VAL A CB    1 
ATOM   2927  C  CG1   . VAL A 1  379  ? 127.497 20.053  -18.267 1.00 65.14  ? 379  VAL A CG1   1 
ATOM   2928  C  CG2   . VAL A 1  379  ? 125.569 21.573  -17.881 1.00 64.88  ? 379  VAL A CG2   1 
ATOM   2929  N  N     . VAL A 1  380  ? 126.963 17.710  -16.034 1.00 66.48  ? 380  VAL A N     1 
ATOM   2930  C  CA    . VAL A 1  380  ? 127.781 16.524  -15.803 1.00 67.31  ? 380  VAL A CA    1 
ATOM   2931  C  C     . VAL A 1  380  ? 129.114 16.735  -16.485 1.00 75.85  ? 380  VAL A C     1 
ATOM   2932  O  O     . VAL A 1  380  ? 129.220 16.889  -17.710 1.00 77.13  ? 380  VAL A O     1 
ATOM   2933  C  CB    . VAL A 1  380  ? 127.123 15.192  -16.191 1.00 70.43  ? 380  VAL A CB    1 
ATOM   2934  C  CG1   . VAL A 1  380  ? 128.089 14.052  -15.959 1.00 70.82  ? 380  VAL A CG1   1 
ATOM   2935  C  CG2   . VAL A 1  380  ? 125.850 14.959  -15.403 1.00 69.72  ? 380  VAL A CG2   1 
ATOM   2936  N  N     . THR A 1  381  ? 130.112 16.842  -15.636 1.00 73.30  ? 381  THR A N     1 
ATOM   2937  C  CA    . THR A 1  381  ? 131.477 17.158  -15.951 1.00 73.33  ? 381  THR A CA    1 
ATOM   2938  C  C     . THR A 1  381  ? 132.299 16.113  -15.234 1.00 76.61  ? 381  THR A C     1 
ATOM   2939  O  O     . THR A 1  381  ? 131.785 15.506  -14.304 1.00 75.46  ? 381  THR A O     1 
ATOM   2940  C  CB    . THR A 1  381  ? 131.705 18.621  -15.509 1.00 85.53  ? 381  THR A CB    1 
ATOM   2941  O  OG1   . THR A 1  381  ? 132.550 19.284  -16.436 1.00 91.77  ? 381  THR A OG1   1 
ATOM   2942  C  CG2   . THR A 1  381  ? 132.190 18.771  -14.066 1.00 81.70  ? 381  THR A CG2   1 
ATOM   2943  N  N     . PRO A 1  382  ? 133.559 15.857  -15.613 1.00 74.83  ? 382  PRO A N     1 
ATOM   2944  C  CA    . PRO A 1  382  ? 134.319 14.829  -14.908 1.00 75.94  ? 382  PRO A CA    1 
ATOM   2945  C  C     . PRO A 1  382  ? 134.573 15.212  -13.462 1.00 84.03  ? 382  PRO A C     1 
ATOM   2946  O  O     . PRO A 1  382  ? 134.556 14.327  -12.602 1.00 83.06  ? 382  PRO A O     1 
ATOM   2947  C  CB    . PRO A 1  382  ? 135.591 14.728  -15.739 1.00 77.92  ? 382  PRO A CB    1 
ATOM   2948  C  CG    . PRO A 1  382  ? 135.218 15.306  -17.095 1.00 81.34  ? 382  PRO A CG    1 
ATOM   2949  C  CD    . PRO A 1  382  ? 134.372 16.444  -16.694 1.00 76.35  ? 382  PRO A CD    1 
ATOM   2950  N  N     . TYR A 1  383  ? 134.693 16.542  -13.190 1.00 84.84  ? 383  TYR A N     1 
ATOM   2951  C  CA    . TYR A 1  383  ? 134.903 17.113  -11.850 1.00 86.58  ? 383  TYR A CA    1 
ATOM   2952  C  C     . TYR A 1  383  ? 133.776 16.765  -10.870 1.00 90.37  ? 383  TYR A C     1 
ATOM   2953  O  O     . TYR A 1  383  ? 134.053 16.562  -9.684  1.00 89.91  ? 383  TYR A O     1 
ATOM   2954  C  CB    . TYR A 1  383  ? 135.096 18.651  -11.869 1.00 89.07  ? 383  TYR A CB    1 
ATOM   2955  C  CG    . TYR A 1  383  ? 135.702 19.240  -13.120 1.00 93.76  ? 383  TYR A CG    1 
ATOM   2956  C  CD1   . TYR A 1  383  ? 137.011 18.945  -13.493 1.00 97.05  ? 383  TYR A CD1   1 
ATOM   2957  C  CD2   . TYR A 1  383  ? 135.012 20.181  -13.870 1.00 95.44  ? 383  TYR A CD2   1 
ATOM   2958  C  CE1   . TYR A 1  383  ? 137.583 19.502  -14.642 1.00 99.62  ? 383  TYR A CE1   1 
ATOM   2959  C  CE2   . TYR A 1  383  ? 135.564 20.736  -15.026 1.00 97.72  ? 383  TYR A CE2   1 
ATOM   2960  C  CZ    . TYR A 1  383  ? 136.854 20.401  -15.408 1.00 108.18 ? 383  TYR A CZ    1 
ATOM   2961  O  OH    . TYR A 1  383  ? 137.384 20.973  -16.547 1.00 110.16 ? 383  TYR A OH    1 
ATOM   2962  N  N     . ASN A 1  384  ? 132.518 16.684  -11.354 1.00 86.13  ? 384  ASN A N     1 
ATOM   2963  C  CA    . ASN A 1  384  ? 131.381 16.427  -10.467 1.00 85.35  ? 384  ASN A CA    1 
ATOM   2964  C  C     . ASN A 1  384  ? 130.569 15.157  -10.744 1.00 86.54  ? 384  ASN A C     1 
ATOM   2965  O  O     . ASN A 1  384  ? 129.527 14.936  -10.108 1.00 85.52  ? 384  ASN A O     1 
ATOM   2966  C  CB    . ASN A 1  384  ? 130.463 17.651  -10.479 1.00 86.46  ? 384  ASN A CB    1 
ATOM   2967  C  CG    . ASN A 1  384  ? 129.719 17.851  -11.771 1.00 95.26  ? 384  ASN A CG    1 
ATOM   2968  O  OD1   . ASN A 1  384  ? 129.762 17.024  -12.683 1.00 73.31  ? 384  ASN A OD1   1 
ATOM   2969  N  ND2   . ASN A 1  384  ? 128.992 18.953  -11.861 1.00 93.73  ? 384  ASN A ND2   1 
ATOM   2970  N  N     . ILE A 1  385  ? 131.008 14.360  -11.719 1.00 81.32  ? 385  ILE A N     1 
ATOM   2971  C  CA    . ILE A 1  385  ? 130.265 13.178  -12.135 1.00 79.96  ? 385  ILE A CA    1 
ATOM   2972  C  C     . ILE A 1  385  ? 129.848 12.305  -10.978 1.00 83.28  ? 385  ILE A C     1 
ATOM   2973  O  O     . ILE A 1  385  ? 128.669 12.000  -10.869 1.00 81.99  ? 385  ILE A O     1 
ATOM   2974  C  CB    . ILE A 1  385  ? 130.911 12.445  -13.346 1.00 82.77  ? 385  ILE A CB    1 
ATOM   2975  C  CG1   . ILE A 1  385  ? 129.919 11.723  -14.302 1.00 81.54  ? 385  ILE A CG1   1 
ATOM   2976  C  CG2   . ILE A 1  385  ? 132.169 11.669  -13.011 1.00 85.91  ? 385  ILE A CG2   1 
ATOM   2977  C  CD1   . ILE A 1  385  ? 129.178 10.526  -13.850 1.00 84.66  ? 385  ILE A CD1   1 
ATOM   2978  N  N     . ASP A 1  386  ? 130.762 12.043  -10.041 1.00 80.82  ? 386  ASP A N     1 
ATOM   2979  C  CA    . ASP A 1  386  ? 130.468 11.172  -8.905  1.00 80.86  ? 386  ASP A CA    1 
ATOM   2980  C  C     . ASP A 1  386  ? 129.517 11.762  -7.909  1.00 79.27  ? 386  ASP A C     1 
ATOM   2981  O  O     . ASP A 1  386  ? 128.638 11.048  -7.411  1.00 77.40  ? 386  ASP A O     1 
ATOM   2982  C  CB    . ASP A 1  386  ? 131.748 10.669  -8.233  1.00 84.83  ? 386  ASP A CB    1 
ATOM   2983  C  CG    . ASP A 1  386  ? 132.771 10.135  -9.218  1.00 104.86 ? 386  ASP A CG    1 
ATOM   2984  O  OD1   . ASP A 1  386  ? 132.609 8.971   -9.678  1.00 106.30 ? 386  ASP A OD1   1 
ATOM   2985  O  OD2   . ASP A 1  386  ? 133.704 10.897  -9.571  1.00 115.48 ? 386  ASP A OD2   1 
ATOM   2986  N  N     . ARG A 1  387  ? 129.674 13.062  -7.629  1.00 74.11  ? 387  ARG A N     1 
ATOM   2987  C  CA    . ARG A 1  387  ? 128.797 13.751  -6.682  1.00 73.27  ? 387  ARG A CA    1 
ATOM   2988  C  C     . ARG A 1  387  ? 127.368 13.707  -7.193  1.00 71.55  ? 387  ARG A C     1 
ATOM   2989  O  O     . ARG A 1  387  ? 126.472 13.177  -6.529  1.00 69.67  ? 387  ARG A O     1 
ATOM   2990  C  CB    . ARG A 1  387  ? 129.257 15.201  -6.475  1.00 75.91  ? 387  ARG A CB    1 
ATOM   2991  C  CG    . ARG A 1  387  ? 128.352 16.013  -5.538  1.00 88.62  ? 387  ARG A CG    1 
ATOM   2992  C  CD    . ARG A 1  387  ? 128.976 17.345  -5.167  1.00 102.03 ? 387  ARG A CD    1 
ATOM   2993  N  NE    . ARG A 1  387  ? 129.357 18.125  -6.343  1.00 104.80 ? 387  ARG A NE    1 
ATOM   2994  C  CZ    . ARG A 1  387  ? 128.570 19.015  -6.934  1.00 110.56 ? 387  ARG A CZ    1 
ATOM   2995  N  NH1   . ARG A 1  387  ? 127.354 19.266  -6.448  1.00 80.52  ? 387  ARG A NH1   1 
ATOM   2996  N  NH2   . ARG A 1  387  ? 128.990 19.667  -8.009  1.00 100.41 ? 387  ARG A NH2   1 
ATOM   2997  N  N     . LEU A 1  388  ? 127.197 14.215  -8.409  1.00 65.24  ? 388  LEU A N     1 
ATOM   2998  C  CA    . LEU A 1  388  ? 125.935 14.260  -9.102  1.00 63.79  ? 388  LEU A CA    1 
ATOM   2999  C  C     . LEU A 1  388  ? 125.273 12.903  -9.193  1.00 67.36  ? 388  LEU A C     1 
ATOM   3000  O  O     . LEU A 1  388  ? 124.061 12.840  -9.001  1.00 66.20  ? 388  LEU A O     1 
ATOM   3001  C  CB    . LEU A 1  388  ? 126.137 14.831  -10.497 1.00 63.32  ? 388  LEU A CB    1 
ATOM   3002  C  CG    . LEU A 1  388  ? 126.297 16.314  -10.602 1.00 66.60  ? 388  LEU A CG    1 
ATOM   3003  C  CD1   . LEU A 1  388  ? 126.487 16.687  -12.021 1.00 67.14  ? 388  LEU A CD1   1 
ATOM   3004  C  CD2   . LEU A 1  388  ? 125.070 17.019  -10.093 1.00 66.79  ? 388  LEU A CD2   1 
ATOM   3005  N  N     . THR A 1  389  ? 126.056 11.808  -9.441  1.00 64.43  ? 389  THR A N     1 
ATOM   3006  C  CA    . THR A 1  389  ? 125.473 10.461  -9.529  1.00 64.34  ? 389  THR A CA    1 
ATOM   3007  C  C     . THR A 1  389  ? 124.862 10.043  -8.237  1.00 68.56  ? 389  THR A C     1 
ATOM   3008  O  O     . THR A 1  389  ? 123.813 9.397   -8.272  1.00 68.53  ? 389  THR A O     1 
ATOM   3009  C  CB    . THR A 1  389  ? 126.372 9.401   -10.144 1.00 71.08  ? 389  THR A CB    1 
ATOM   3010  O  OG1   . THR A 1  389  ? 127.432 10.018  -10.859 1.00 75.23  ? 389  THR A OG1   1 
ATOM   3011  C  CG2   . THR A 1  389  ? 125.607 8.488   -11.087 1.00 67.59  ? 389  THR A CG2   1 
ATOM   3012  N  N     . GLN A 1  390  ? 125.457 10.491  -7.101  1.00 64.78  ? 390  GLN A N     1 
ATOM   3013  C  CA    . GLN A 1  390  ? 124.924 10.220  -5.777  1.00 64.65  ? 390  GLN A CA    1 
ATOM   3014  C  C     . GLN A 1  390  ? 123.688 11.073  -5.502  1.00 68.89  ? 390  GLN A C     1 
ATOM   3015  O  O     . GLN A 1  390  ? 122.712 10.558  -4.959  1.00 69.97  ? 390  GLN A O     1 
ATOM   3016  C  CB    . GLN A 1  390  ? 125.986 10.378  -4.675  1.00 66.29  ? 390  GLN A CB    1 
ATOM   3017  C  CG    . GLN A 1  390  ? 125.543 9.864   -3.286  1.00 86.89  ? 390  GLN A CG    1 
ATOM   3018  C  CD    . GLN A 1  390  ? 124.985 8.447   -3.295  1.00 129.40 ? 390  GLN A CD    1 
ATOM   3019  O  OE1   . GLN A 1  390  ? 125.613 7.493   -3.782  1.00 132.05 ? 390  GLN A OE1   1 
ATOM   3020  N  NE2   . GLN A 1  390  ? 123.787 8.273   -2.748  1.00 126.90 ? 390  GLN A NE2   1 
ATOM   3021  N  N     . LEU A 1  391  ? 123.706 12.359  -5.873  1.00 63.92  ? 391  LEU A N     1 
ATOM   3022  C  CA    . LEU A 1  391  ? 122.552 13.221  -5.634  1.00 62.83  ? 391  LEU A CA    1 
ATOM   3023  C  C     . LEU A 1  391  ? 121.348 12.656  -6.360  1.00 67.34  ? 391  LEU A C     1 
ATOM   3024  O  O     . LEU A 1  391  ? 120.250 12.674  -5.808  1.00 67.35  ? 391  LEU A O     1 
ATOM   3025  C  CB    . LEU A 1  391  ? 122.829 14.618  -6.154  1.00 62.50  ? 391  LEU A CB    1 
ATOM   3026  C  CG    . LEU A 1  391  ? 123.653 15.519  -5.286  1.00 67.52  ? 391  LEU A CG    1 
ATOM   3027  C  CD1   . LEU A 1  391  ? 124.592 16.351  -6.133  1.00 67.69  ? 391  LEU A CD1   1 
ATOM   3028  C  CD2   . LEU A 1  391  ? 122.769 16.454  -4.523  1.00 71.69  ? 391  LEU A CD2   1 
ATOM   3029  N  N     . VAL A 1  392  ? 121.556 12.138  -7.595  1.00 64.26  ? 392  VAL A N     1 
ATOM   3030  C  CA    . VAL A 1  392  ? 120.498 11.534  -8.404  1.00 64.84  ? 392  VAL A CA    1 
ATOM   3031  C  C     . VAL A 1  392  ? 119.985 10.292  -7.669  1.00 74.00  ? 392  VAL A C     1 
ATOM   3032  O  O     . VAL A 1  392  ? 118.766 10.153  -7.471  1.00 73.80  ? 392  VAL A O     1 
ATOM   3033  C  CB    . VAL A 1  392  ? 120.962 11.224  -9.839  1.00 68.17  ? 392  VAL A CB    1 
ATOM   3034  C  CG1   . VAL A 1  392  ? 119.848 10.584  -10.638 1.00 67.76  ? 392  VAL A CG1   1 
ATOM   3035  C  CG2   . VAL A 1  392  ? 121.410 12.490  -10.535 1.00 67.83  ? 392  VAL A CG2   1 
ATOM   3036  N  N     . ARG A 1  393  ? 120.940 9.432   -7.197  1.00 72.96  ? 393  ARG A N     1 
ATOM   3037  C  CA    . ARG A 1  393  ? 120.690 8.217   -6.414  1.00 72.81  ? 393  ARG A CA    1 
ATOM   3038  C  C     . ARG A 1  393  ? 119.818 8.631   -5.242  1.00 76.96  ? 393  ARG A C     1 
ATOM   3039  O  O     . ARG A 1  393  ? 118.759 8.047   -5.062  1.00 77.91  ? 393  ARG A O     1 
ATOM   3040  C  CB    . ARG A 1  393  ? 122.014 7.592   -5.927  1.00 73.17  ? 393  ARG A CB    1 
ATOM   3041  C  CG    . ARG A 1  393  ? 122.074 6.067   -5.999  1.00 92.84  ? 393  ARG A CG    1 
ATOM   3042  C  CD    . ARG A 1  393  ? 123.064 5.563   -7.045  1.00 117.42 ? 393  ARG A CD    1 
ATOM   3043  N  NE    . ARG A 1  393  ? 122.585 5.834   -8.405  1.00 140.67 ? 393  ARG A NE    1 
ATOM   3044  C  CZ    . ARG A 1  393  ? 123.204 5.456   -9.519  1.00 158.72 ? 393  ARG A CZ    1 
ATOM   3045  N  NH1   . ARG A 1  393  ? 124.344 4.772   -9.456  1.00 145.59 ? 393  ARG A NH1   1 
ATOM   3046  N  NH2   . ARG A 1  393  ? 122.690 5.757   -10.705 1.00 143.62 ? 393  ARG A NH2   1 
ATOM   3047  N  N     . ASN A 1  394  ? 120.184 9.725   -4.548  1.00 72.98  ? 394  ASN A N     1 
ATOM   3048  C  CA    . ASN A 1  394  ? 119.441 10.279  -3.426  1.00 73.20  ? 394  ASN A CA    1 
ATOM   3049  C  C     . ASN A 1  394  ? 117.976 10.622  -3.697  1.00 79.53  ? 394  ASN A C     1 
ATOM   3050  O  O     . ASN A 1  394  ? 117.131 10.475  -2.802  1.00 80.66  ? 394  ASN A O     1 
ATOM   3051  C  CB    . ASN A 1  394  ? 120.173 11.445  -2.828  1.00 71.85  ? 394  ASN A CB    1 
ATOM   3052  C  CG    . ASN A 1  394  ? 121.020 10.990  -1.712  1.00 102.10 ? 394  ASN A CG    1 
ATOM   3053  O  OD1   . ASN A 1  394  ? 122.185 10.655  -1.918  1.00 95.54  ? 394  ASN A OD1   1 
ATOM   3054  N  ND2   . ASN A 1  394  ? 120.407 10.841  -0.533  1.00 101.29 ? 394  ASN A ND2   1 
ATOM   3055  N  N     . GLY A 1  395  ? 117.682 11.081  -4.905  1.00 75.80  ? 395  GLY A N     1 
ATOM   3056  C  CA    . GLY A 1  395  ? 116.307 11.369  -5.283  1.00 75.71  ? 395  GLY A CA    1 
ATOM   3057  C  C     . GLY A 1  395  ? 115.697 12.667  -4.799  1.00 79.00  ? 395  GLY A C     1 
ATOM   3058  O  O     . GLY A 1  395  ? 116.303 13.396  -4.013  1.00 79.41  ? 395  GLY A O     1 
ATOM   3059  N  N     . PRO A 1  396  ? 114.469 12.965  -5.269  1.00 74.34  ? 396  PRO A N     1 
ATOM   3060  C  CA    . PRO A 1  396  ? 113.848 14.256  -4.954  1.00 74.32  ? 396  PRO A CA    1 
ATOM   3061  C  C     . PRO A 1  396  ? 113.315 14.456  -3.551  1.00 80.30  ? 396  PRO A C     1 
ATOM   3062  O  O     . PRO A 1  396  ? 112.987 15.591  -3.186  1.00 78.28  ? 396  PRO A O     1 
ATOM   3063  C  CB    . PRO A 1  396  ? 112.722 14.332  -5.974  1.00 75.81  ? 396  PRO A CB    1 
ATOM   3064  C  CG    . PRO A 1  396  ? 112.383 12.932  -6.266  1.00 79.55  ? 396  PRO A CG    1 
ATOM   3065  C  CD    . PRO A 1  396  ? 113.673 12.226  -6.268  1.00 75.18  ? 396  PRO A CD    1 
ATOM   3066  N  N     . ASN A 1  397  ? 113.215 13.355  -2.788  1.00 80.52  ? 397  ASN A N     1 
ATOM   3067  C  CA    . ASN A 1  397  ? 112.656 13.302  -1.438  1.00 81.70  ? 397  ASN A CA    1 
ATOM   3068  C  C     . ASN A 1  397  ? 113.627 13.503  -0.290  1.00 87.76  ? 397  ASN A C     1 
ATOM   3069  O  O     . ASN A 1  397  ? 113.210 13.942  0.783   1.00 88.51  ? 397  ASN A O     1 
ATOM   3070  C  CB    . ASN A 1  397  ? 111.910 12.003  -1.271  1.00 83.61  ? 397  ASN A CB    1 
ATOM   3071  C  CG    . ASN A 1  397  ? 110.688 11.928  -2.145  1.00 122.82 ? 397  ASN A CG    1 
ATOM   3072  O  OD1   . ASN A 1  397  ? 110.356 12.858  -2.913  1.00 114.13 ? 397  ASN A OD1   1 
ATOM   3073  N  ND2   . ASN A 1  397  ? 109.983 10.813  -2.037  1.00 123.18 ? 397  ASN A ND2   1 
ATOM   3074  N  N     . GLU A 1  398  ? 114.903 13.150  -0.495  1.00 84.46  ? 398  GLU A N     1 
ATOM   3075  C  CA    . GLU A 1  398  ? 115.958 13.272  0.518   1.00 84.32  ? 398  GLU A CA    1 
ATOM   3076  C  C     . GLU A 1  398  ? 116.617 14.621  0.391   1.00 80.98  ? 398  GLU A C     1 
ATOM   3077  O  O     . GLU A 1  398  ? 116.613 15.087  -0.743  1.00 77.99  ? 398  GLU A O     1 
ATOM   3078  C  CB    . GLU A 1  398  ? 116.986 12.118  0.347   1.00 87.14  ? 398  GLU A CB    1 
ATOM   3079  C  CG    . GLU A 1  398  ? 116.518 10.787  0.941   1.00 109.58 ? 398  GLU A CG    1 
ATOM   3080  C  CD    . GLU A 1  398  ? 115.460 10.878  2.041   1.00 161.93 ? 398  GLU A CD    1 
ATOM   3081  O  OE1   . GLU A 1  398  ? 115.772 11.407  3.136   1.00 167.98 ? 398  GLU A OE1   1 
ATOM   3082  O  OE2   . GLU A 1  398  ? 114.298 10.483  1.781   1.00 166.02 ? 398  GLU A OE2   1 
ATOM   3083  N  N     . HIS A 1  399  ? 117.179 15.270  1.494   1.00 75.42  ? 399  HIS A N     1 
ATOM   3084  C  CA    . HIS A 1  399  ? 117.789 16.555  1.185   1.00 74.38  ? 399  HIS A CA    1 
ATOM   3085  C  C     . HIS A 1  399  ? 118.817 16.590  0.102   1.00 83.19  ? 399  HIS A C     1 
ATOM   3086  O  O     . HIS A 1  399  ? 118.395 16.975  -0.998  1.00 88.15  ? 399  HIS A O     1 
ATOM   3087  C  CB    . HIS A 1  399  ? 118.125 17.598  2.245   1.00 73.79  ? 399  HIS A CB    1 
ATOM   3088  C  CG    . HIS A 1  399  ? 118.511 18.897  1.534   1.00 74.95  ? 399  HIS A CG    1 
ATOM   3089  N  ND1   . HIS A 1  399  ? 119.818 19.363  1.527   1.00 75.52  ? 399  HIS A ND1   1 
ATOM   3090  C  CD2   . HIS A 1  399  ? 117.790 19.650  0.657   1.00 74.33  ? 399  HIS A CD2   1 
ATOM   3091  C  CE1   . HIS A 1  399  ? 119.820 20.428  0.738   1.00 73.50  ? 399  HIS A CE1   1 
ATOM   3092  N  NE2   . HIS A 1  399  ? 118.634 20.619  0.168   1.00 73.33  ? 399  HIS A NE2   1 
ATOM   3093  N  N     . PRO A 1  400  ? 120.141 16.438  0.292   1.00 74.82  ? 400  PRO A N     1 
ATOM   3094  C  CA    . PRO A 1  400  ? 121.011 16.630  -0.882  1.00 73.50  ? 400  PRO A CA    1 
ATOM   3095  C  C     . PRO A 1  400  ? 120.620 15.549  -1.902  1.00 79.17  ? 400  PRO A C     1 
ATOM   3096  O  O     . PRO A 1  400  ? 120.895 14.352  -1.698  1.00 81.05  ? 400  PRO A O     1 
ATOM   3097  C  CB    . PRO A 1  400  ? 122.417 16.580  -0.310  1.00 74.82  ? 400  PRO A CB    1 
ATOM   3098  C  CG    . PRO A 1  400  ? 122.215 16.656  1.183   1.00 79.37  ? 400  PRO A CG    1 
ATOM   3099  C  CD    . PRO A 1  400  ? 120.903 16.039  1.477   1.00 74.88  ? 400  PRO A CD    1 
ATOM   3100  N  N     . GLY A 1  401  ? 119.784 15.971  -2.869  1.00 72.27  ? 401  GLY A N     1 
ATOM   3101  C  CA    . GLY A 1  401  ? 119.207 15.113  -3.893  1.00 70.51  ? 401  GLY A CA    1 
ATOM   3102  C  C     . GLY A 1  401  ? 118.935 15.886  -5.149  1.00 71.48  ? 401  GLY A C     1 
ATOM   3103  O  O     . GLY A 1  401  ? 119.322 17.047  -5.237  1.00 71.42  ? 401  GLY A O     1 
ATOM   3104  N  N     . ALA A 1  402  ? 118.281 15.265  -6.122  1.00 67.13  ? 402  ALA A N     1 
ATOM   3105  C  CA    . ALA A 1  402  ? 117.947 15.942  -7.381  1.00 66.89  ? 402  ALA A CA    1 
ATOM   3106  C  C     . ALA A 1  402  ? 116.490 15.656  -7.806  1.00 71.15  ? 402  ALA A C     1 
ATOM   3107  O  O     . ALA A 1  402  ? 115.908 14.682  -7.340  1.00 71.34  ? 402  ALA A O     1 
ATOM   3108  C  CB    . ALA A 1  402  ? 118.925 15.530  -8.477  1.00 67.70  ? 402  ALA A CB    1 
ATOM   3109  N  N     . LYS A 1  403  ? 115.903 16.496  -8.676  1.00 67.43  ? 403  LYS A N     1 
ATOM   3110  C  CA    . LYS A 1  403  ? 114.524 16.321  -9.161  1.00 67.02  ? 403  LYS A CA    1 
ATOM   3111  C  C     . LYS A 1  403  ? 114.446 15.746  -10.590 1.00 69.38  ? 403  LYS A C     1 
ATOM   3112  O  O     . LYS A 1  403  ? 113.525 14.968  -10.866 1.00 69.60  ? 403  LYS A O     1 
ATOM   3113  C  CB    . LYS A 1  403  ? 113.722 17.640  -9.078  1.00 69.31  ? 403  LYS A CB    1 
ATOM   3114  C  CG    . LYS A 1  403  ? 113.492 18.172  -7.656  1.00 76.14  ? 403  LYS A CG    1 
ATOM   3115  C  CD    . LYS A 1  403  ? 112.833 19.553  -7.635  1.00 79.81  ? 403  LYS A CD    1 
ATOM   3116  C  CE    . LYS A 1  403  ? 111.349 19.484  -7.899  1.00 95.94  ? 403  LYS A CE    1 
ATOM   3117  N  NZ    . LYS A 1  403  ? 110.636 20.652  -7.326  1.00 111.26 ? 403  LYS A NZ    1 
ATOM   3118  N  N     . TYR A 1  404  ? 115.376 16.161  -11.493 1.00 63.83  ? 404  TYR A N     1 
ATOM   3119  C  CA    . TYR A 1  404  ? 115.411 15.755  -12.902 1.00 63.68  ? 404  TYR A CA    1 
ATOM   3120  C  C     . TYR A 1  404  ? 116.801 15.500  -13.436 1.00 65.96  ? 404  TYR A C     1 
ATOM   3121  O  O     . TYR A 1  404  ? 117.770 16.051  -12.915 1.00 66.22  ? 404  TYR A O     1 
ATOM   3122  C  CB    . TYR A 1  404  ? 114.806 16.849  -13.792 1.00 65.89  ? 404  TYR A CB    1 
ATOM   3123  C  CG    . TYR A 1  404  ? 113.333 17.078  -13.592 1.00 70.17  ? 404  TYR A CG    1 
ATOM   3124  C  CD1   . TYR A 1  404  ? 112.391 16.361  -14.321 1.00 72.13  ? 404  TYR A CD1   1 
ATOM   3125  C  CD2   . TYR A 1  404  ? 112.874 18.030  -12.691 1.00 73.07  ? 404  TYR A CD2   1 
ATOM   3126  C  CE1   . TYR A 1  404  ? 111.022 16.562  -14.132 1.00 73.95  ? 404  TYR A CE1   1 
ATOM   3127  C  CE2   . TYR A 1  404  ? 111.509 18.230  -12.480 1.00 76.93  ? 404  TYR A CE2   1 
ATOM   3128  C  CZ    . TYR A 1  404  ? 110.583 17.504  -13.212 1.00 85.49  ? 404  TYR A CZ    1 
ATOM   3129  O  OH    . TYR A 1  404  ? 109.235 17.727  -13.023 1.00 89.64  ? 404  TYR A OH    1 
ATOM   3130  N  N     . VAL A 1  405  ? 116.888 14.719  -14.533 1.00 60.84  ? 405  VAL A N     1 
ATOM   3131  C  CA    . VAL A 1  405  ? 118.125 14.458  -15.268 1.00 60.75  ? 405  VAL A CA    1 
ATOM   3132  C  C     . VAL A 1  405  ? 117.825 14.836  -16.723 1.00 72.17  ? 405  VAL A C     1 
ATOM   3133  O  O     . VAL A 1  405  ? 116.837 14.352  -17.277 1.00 72.40  ? 405  VAL A O     1 
ATOM   3134  C  CB    . VAL A 1  405  ? 118.673 13.017  -15.127 1.00 62.11  ? 405  VAL A CB    1 
ATOM   3135  C  CG1   . VAL A 1  405  ? 119.807 12.775  -16.107 1.00 61.60  ? 405  VAL A CG1   1 
ATOM   3136  C  CG2   . VAL A 1  405  ? 119.152 12.743  -13.712 1.00 61.37  ? 405  VAL A CG2   1 
ATOM   3137  N  N     . ILE A 1  406  ? 118.620 15.754  -17.318 1.00 73.78  ? 406  ILE A N     1 
ATOM   3138  C  CA    . ILE A 1  406  ? 118.398 16.195  -18.698 1.00 75.95  ? 406  ILE A CA    1 
ATOM   3139  C  C     . ILE A 1  406  ? 119.404 15.559  -19.621 1.00 85.34  ? 406  ILE A C     1 
ATOM   3140  O  O     . ILE A 1  406  ? 120.608 15.781  -19.499 1.00 84.65  ? 406  ILE A O     1 
ATOM   3141  C  CB    . ILE A 1  406  ? 118.286 17.732  -18.874 1.00 79.15  ? 406  ILE A CB    1 
ATOM   3142  C  CG1   . ILE A 1  406  ? 117.114 18.295  -18.065 1.00 79.78  ? 406  ILE A CG1   1 
ATOM   3143  C  CG2   . ILE A 1  406  ? 118.105 18.097  -20.344 1.00 80.60  ? 406  ILE A CG2   1 
ATOM   3144  C  CD1   . ILE A 1  406  ? 117.483 19.413  -17.206 1.00 90.15  ? 406  ILE A CD1   1 
ATOM   3145  N  N     . ARG A 1  407  ? 118.898 14.760  -20.546 1.00 87.04  ? 407  ARG A N     1 
ATOM   3146  C  CA    . ARG A 1  407  ? 119.722 14.045  -21.496 1.00 89.66  ? 407  ARG A CA    1 
ATOM   3147  C  C     . ARG A 1  407  ? 120.185 14.929  -22.639 1.00 101.58 ? 407  ARG A C     1 
ATOM   3148  O  O     . ARG A 1  407  ? 119.621 16.008  -22.860 1.00 101.42 ? 407  ARG A O     1 
ATOM   3149  C  CB    . ARG A 1  407  ? 118.944 12.849  -22.027 1.00 87.79  ? 407  ARG A CB    1 
ATOM   3150  C  CG    . ARG A 1  407  ? 119.355 11.576  -21.353 1.00 92.13  ? 407  ARG A CG    1 
ATOM   3151  C  CD    . ARG A 1  407  ? 118.229 10.580  -21.222 1.00 105.10 ? 407  ARG A CD    1 
ATOM   3152  N  NE    . ARG A 1  407  ? 117.792 10.023  -22.498 1.00 116.51 ? 407  ARG A NE    1 
ATOM   3153  C  CZ    . ARG A 1  407  ? 116.631 10.305  -23.076 1.00 144.04 ? 407  ARG A CZ    1 
ATOM   3154  N  NH1   . ARG A 1  407  ? 115.777 11.145  -22.495 1.00 132.20 ? 407  ARG A NH1   1 
ATOM   3155  N  NH2   . ARG A 1  407  ? 116.312 9.756   -24.239 1.00 143.18 ? 407  ARG A NH2   1 
ATOM   3156  N  N     . ASP A 1  408  ? 121.220 14.447  -23.380 1.00 103.86 ? 408  ASP A N     1 
ATOM   3157  C  CA    . ASP A 1  408  ? 121.792 15.055  -24.593 1.00 105.97 ? 408  ASP A CA    1 
ATOM   3158  C  C     . ASP A 1  408  ? 120.627 15.375  -25.541 1.00 112.62 ? 408  ASP A C     1 
ATOM   3159  O  O     . ASP A 1  408  ? 120.476 16.529  -25.954 1.00 111.66 ? 408  ASP A O     1 
ATOM   3160  C  CB    . ASP A 1  408  ? 122.854 14.121  -25.263 1.00 109.32 ? 408  ASP A CB    1 
ATOM   3161  C  CG    . ASP A 1  408  ? 122.683 12.590  -25.105 1.00 131.55 ? 408  ASP A CG    1 
ATOM   3162  O  OD1   . ASP A 1  408  ? 121.542 12.080  -25.312 1.00 134.64 ? 408  ASP A OD1   1 
ATOM   3163  O  OD2   . ASP A 1  408  ? 123.704 11.894  -24.840 1.00 139.12 ? 408  ASP A OD2   1 
ATOM   3164  N  N     . SER A 1  409  ? 119.721 14.360  -25.730 1.00 112.10 ? 409  SER A N     1 
ATOM   3165  C  CA    . SER A 1  409  ? 118.472 14.334  -26.513 1.00 112.95 ? 409  SER A CA    1 
ATOM   3166  C  C     . SER A 1  409  ? 117.542 15.534  -26.216 1.00 118.57 ? 409  SER A C     1 
ATOM   3167  O  O     . SER A 1  409  ? 116.679 15.874  -27.035 1.00 118.56 ? 409  SER A O     1 
ATOM   3168  C  CB    . SER A 1  409  ? 117.729 13.014  -26.272 1.00 116.11 ? 409  SER A CB    1 
ATOM   3169  O  OG    . SER A 1  409  ? 116.689 13.123  -25.308 1.00 123.70 ? 409  SER A OG    1 
ATOM   3170  N  N     . GLY A 1  410  ? 117.724 16.139  -25.046 1.00 115.47 ? 410  GLY A N     1 
ATOM   3171  C  CA    . GLY A 1  410  ? 116.922 17.265  -24.599 1.00 115.15 ? 410  GLY A CA    1 
ATOM   3172  C  C     . GLY A 1  410  ? 115.720 16.865  -23.757 1.00 118.89 ? 410  GLY A C     1 
ATOM   3173  O  O     . GLY A 1  410  ? 115.162 17.739  -23.067 1.00 119.50 ? 410  GLY A O     1 
ATOM   3174  N  N     . ASP A 1  411  ? 115.298 15.538  -23.793 1.00 112.13 ? 411  ASP A N     1 
ATOM   3175  C  CA    . ASP A 1  411  ? 114.126 15.077  -23.023 1.00 109.64 ? 411  ASP A CA    1 
ATOM   3176  C  C     . ASP A 1  411  ? 114.330 14.739  -21.538 1.00 105.78 ? 411  ASP A C     1 
ATOM   3177  O  O     . ASP A 1  411  ? 115.098 13.831  -21.199 1.00 106.96 ? 411  ASP A O     1 
ATOM   3178  C  CB    . ASP A 1  411  ? 113.242 14.052  -23.755 1.00 112.27 ? 411  ASP A CB    1 
ATOM   3179  C  CG    . ASP A 1  411  ? 111.767 14.105  -23.321 1.00 124.58 ? 411  ASP A CG    1 
ATOM   3180  O  OD1   . ASP A 1  411  ? 111.413 14.974  -22.471 1.00 123.16 ? 411  ASP A OD1   1 
ATOM   3181  O  OD2   . ASP A 1  411  ? 110.965 13.297  -23.841 1.00 133.24 ? 411  ASP A OD2   1 
ATOM   3182  N  N     . ARG A 1  412  ? 113.570 15.466  -20.677 1.00 93.18  ? 412  ARG A N     1 
ATOM   3183  C  CA    . ARG A 1  412  ? 113.548 15.463  -19.212 1.00 88.73  ? 412  ARG A CA    1 
ATOM   3184  C  C     . ARG A 1  412  ? 113.187 14.135  -18.546 1.00 85.08  ? 412  ARG A C     1 
ATOM   3185  O  O     . ARG A 1  412  ? 112.113 13.601  -18.828 1.00 84.92  ? 412  ARG A O     1 
ATOM   3186  C  CB    . ARG A 1  412  ? 112.540 16.516  -18.758 1.00 86.43  ? 412  ARG A CB    1 
ATOM   3187  C  CG    . ARG A 1  412  ? 113.104 17.495  -17.778 1.00 88.58  ? 412  ARG A CG    1 
ATOM   3188  C  CD    . ARG A 1  412  ? 112.352 18.803  -17.839 1.00 91.04  ? 412  ARG A CD    1 
ATOM   3189  N  NE    . ARG A 1  412  ? 113.310 19.904  -17.843 1.00 102.35 ? 412  ARG A NE    1 
ATOM   3190  C  CZ    . ARG A 1  412  ? 113.031 21.156  -18.180 1.00 121.18 ? 412  ARG A CZ    1 
ATOM   3191  N  NH1   . ARG A 1  412  ? 111.798 21.496  -18.538 1.00 106.08 ? 412  ARG A NH1   1 
ATOM   3192  N  NH2   . ARG A 1  412  ? 113.983 22.081  -18.159 1.00 114.76 ? 412  ARG A NH2   1 
ATOM   3193  N  N     . ILE A 1  413  ? 114.041 13.647  -17.600 1.00 75.40  ? 413  ILE A N     1 
ATOM   3194  C  CA    . ILE A 1  413  ? 113.813 12.414  -16.813 1.00 72.23  ? 413  ILE A CA    1 
ATOM   3195  C  C     . ILE A 1  413  ? 113.336 12.809  -15.424 1.00 74.63  ? 413  ILE A C     1 
ATOM   3196  O  O     . ILE A 1  413  ? 114.093 13.438  -14.691 1.00 73.53  ? 413  ILE A O     1 
ATOM   3197  C  CB    . ILE A 1  413  ? 115.054 11.480  -16.693 1.00 73.53  ? 413  ILE A CB    1 
ATOM   3198  C  CG1   . ILE A 1  413  ? 115.658 11.098  -18.040 1.00 72.62  ? 413  ILE A CG1   1 
ATOM   3199  C  CG2   . ILE A 1  413  ? 114.707 10.241  -15.898 1.00 73.42  ? 413  ILE A CG2   1 
ATOM   3200  C  CD1   . ILE A 1  413  ? 117.101 10.754  -17.928 1.00 73.33  ? 413  ILE A CD1   1 
ATOM   3201  N  N     . ASP A 1  414  ? 112.116 12.406  -15.044 1.00 71.57  ? 414  ASP A N     1 
ATOM   3202  C  CA    . ASP A 1  414  ? 111.575 12.734  -13.724 1.00 71.46  ? 414  ASP A CA    1 
ATOM   3203  C  C     . ASP A 1  414  ? 111.945 11.670  -12.740 1.00 76.64  ? 414  ASP A C     1 
ATOM   3204  O  O     . ASP A 1  414  ? 111.351 10.588  -12.761 1.00 77.23  ? 414  ASP A O     1 
ATOM   3205  C  CB    . ASP A 1  414  ? 110.046 12.897  -13.747 1.00 73.25  ? 414  ASP A CB    1 
ATOM   3206  C  CG    . ASP A 1  414  ? 109.445 13.523  -12.497 1.00 83.23  ? 414  ASP A CG    1 
ATOM   3207  O  OD1   . ASP A 1  414  ? 110.174 13.633  -11.462 1.00 82.32  ? 414  ASP A OD1   1 
ATOM   3208  O  OD2   . ASP A 1  414  ? 108.272 13.954  -12.562 1.00 90.85  ? 414  ASP A OD2   1 
ATOM   3209  N  N     . LEU A 1  415  ? 112.877 11.990  -11.830 1.00 72.98  ? 415  LEU A N     1 
ATOM   3210  C  CA    . LEU A 1  415  ? 113.333 11.045  -10.806 1.00 72.78  ? 415  LEU A CA    1 
ATOM   3211  C  C     . LEU A 1  415  ? 112.209 10.635  -9.869  1.00 76.66  ? 415  LEU A C     1 
ATOM   3212  O  O     . LEU A 1  415  ? 112.186 9.499   -9.409  1.00 77.31  ? 415  LEU A O     1 
ATOM   3213  C  CB    . LEU A 1  415  ? 114.558 11.571  -10.052 1.00 72.48  ? 415  LEU A CB    1 
ATOM   3214  C  CG    . LEU A 1  415  ? 115.705 12.054  -10.947 1.00 76.77  ? 415  LEU A CG    1 
ATOM   3215  C  CD1   . LEU A 1  415  ? 116.763 12.771  -10.141 1.00 77.14  ? 415  LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A 1  415  ? 116.289 10.921  -11.803 1.00 78.09  ? 415  LEU A CD2   1 
ATOM   3217  N  N     . ARG A 1  416  ? 111.217 11.513  -9.685  1.00 72.03  ? 416  ARG A N     1 
ATOM   3218  C  CA    . ARG A 1  416  ? 110.038 11.231  -8.879  1.00 71.39  ? 416  ARG A CA    1 
ATOM   3219  C  C     . ARG A 1  416  ? 109.294 9.997   -9.401  1.00 74.07  ? 416  ARG A C     1 
ATOM   3220  O  O     . ARG A 1  416  ? 108.726 9.289   -8.584  1.00 73.88  ? 416  ARG A O     1 
ATOM   3221  C  CB    . ARG A 1  416  ? 109.091 12.439  -8.927  1.00 71.67  ? 416  ARG A CB    1 
ATOM   3222  C  CG    . ARG A 1  416  ? 108.207 12.665  -7.702  1.00 87.59  ? 416  ARG A CG    1 
ATOM   3223  C  CD    . ARG A 1  416  ? 107.344 13.918  -7.879  1.00 102.58 ? 416  ARG A CD    1 
ATOM   3224  N  NE    . ARG A 1  416  ? 108.106 15.021  -8.476  1.00 112.65 ? 416  ARG A NE    1 
ATOM   3225  C  CZ    . ARG A 1  416  ? 107.720 15.746  -9.524  1.00 123.40 ? 416  ARG A CZ    1 
ATOM   3226  N  NH1   . ARG A 1  416  ? 106.533 15.538  -10.087 1.00 91.50  ? 416  ARG A NH1   1 
ATOM   3227  N  NH2   . ARG A 1  416  ? 108.505 16.708  -9.998  1.00 120.16 ? 416  ARG A NH2   1 
ATOM   3228  N  N     . TYR A 1  417  ? 109.286 9.747   -10.749 1.00 69.87  ? 417  TYR A N     1 
ATOM   3229  C  CA    . TYR A 1  417  ? 108.512 8.675   -11.382 1.00 69.62  ? 417  TYR A CA    1 
ATOM   3230  C  C     . TYR A 1  417  ? 109.220 7.751   -12.312 1.00 71.70  ? 417  TYR A C     1 
ATOM   3231  O  O     . TYR A 1  417  ? 108.784 6.620   -12.441 1.00 72.42  ? 417  TYR A O     1 
ATOM   3232  C  CB    . TYR A 1  417  ? 107.290 9.228   -12.119 1.00 72.37  ? 417  TYR A CB    1 
ATOM   3233  C  CG    . TYR A 1  417  ? 106.445 10.182  -11.308 1.00 78.37  ? 417  TYR A CG    1 
ATOM   3234  C  CD1   . TYR A 1  417  ? 105.732 9.742   -10.196 1.00 81.99  ? 417  TYR A CD1   1 
ATOM   3235  C  CD2   . TYR A 1  417  ? 106.347 11.527  -11.655 1.00 80.11  ? 417  TYR A CD2   1 
ATOM   3236  C  CE1   . TYR A 1  417  ? 104.972 10.629  -9.423  1.00 85.55  ? 417  TYR A CE1   1 
ATOM   3237  C  CE2   . TYR A 1  417  ? 105.581 12.421  -10.897 1.00 81.70  ? 417  TYR A CE2   1 
ATOM   3238  C  CZ    . TYR A 1  417  ? 104.885 11.966  -9.785  1.00 92.38  ? 417  TYR A CZ    1 
ATOM   3239  O  OH    . TYR A 1  417  ? 104.119 12.836  -9.032  1.00 94.09  ? 417  TYR A OH    1 
ATOM   3240  N  N     . SER A 1  418  ? 110.260 8.189   -13.006 1.00 67.29  ? 418  SER A N     1 
ATOM   3241  C  CA    . SER A 1  418  ? 110.943 7.300   -13.963 1.00 66.84  ? 418  SER A CA    1 
ATOM   3242  C  C     . SER A 1  418  ? 111.182 5.903   -13.445 1.00 70.48  ? 418  SER A C     1 
ATOM   3243  O  O     . SER A 1  418  ? 111.678 5.723   -12.328 1.00 70.29  ? 418  SER A O     1 
ATOM   3244  C  CB    . SER A 1  418  ? 112.270 7.888   -14.427 1.00 68.37  ? 418  SER A CB    1 
ATOM   3245  O  OG    . SER A 1  418  ? 112.980 6.937   -15.203 1.00 68.93  ? 418  SER A OG    1 
ATOM   3246  N  N     . LYS A 1  419  ? 110.835 4.915   -14.254 1.00 67.21  ? 419  LYS A N     1 
ATOM   3247  C  CA    . LYS A 1  419  ? 111.078 3.518   -13.886 1.00 67.93  ? 419  LYS A CA    1 
ATOM   3248  C  C     . LYS A 1  419  ? 112.613 3.202   -13.708 1.00 74.54  ? 419  LYS A C     1 
ATOM   3249  O  O     . LYS A 1  419  ? 112.963 2.305   -12.942 1.00 76.20  ? 419  LYS A O     1 
ATOM   3250  C  CB    . LYS A 1  419  ? 110.424 2.570   -14.908 1.00 68.95  ? 419  LYS A CB    1 
ATOM   3251  C  CG    . LYS A 1  419  ? 111.127 2.571   -16.266 1.00 61.50  ? 419  LYS A CG    1 
ATOM   3252  C  CD    . LYS A 1  419  ? 110.865 1.360   -17.105 1.00 64.33  ? 419  LYS A CD    1 
ATOM   3253  C  CE    . LYS A 1  419  ? 109.503 1.294   -17.749 1.00 62.75  ? 419  LYS A CE    1 
ATOM   3254  N  NZ    . LYS A 1  419  ? 109.437 2.084   -19.001 1.00 66.18  ? 419  LYS A NZ    1 
ATOM   3255  N  N     . ARG A 1  420  ? 113.500 3.968   -14.394 1.00 69.94  ? 420  ARG A N     1 
ATOM   3256  C  CA    . ARG A 1  420  ? 114.957 3.807   -14.394 1.00 69.45  ? 420  ARG A CA    1 
ATOM   3257  C  C     . ARG A 1  420  ? 115.661 4.815   -13.481 1.00 74.75  ? 420  ARG A C     1 
ATOM   3258  O  O     . ARG A 1  420  ? 116.848 5.108   -13.694 1.00 73.02  ? 420  ARG A O     1 
ATOM   3259  C  CB    . ARG A 1  420  ? 115.492 3.978   -15.830 1.00 67.80  ? 420  ARG A CB    1 
ATOM   3260  C  CG    . ARG A 1  420  ? 115.072 2.912   -16.854 1.00 70.00  ? 420  ARG A CG    1 
ATOM   3261  C  CD    . ARG A 1  420  ? 115.999 2.826   -18.060 1.00 57.74  ? 420  ARG A CD    1 
ATOM   3262  N  NE    . ARG A 1  420  ? 117.372 3.158   -17.702 1.00 66.69  ? 420  ARG A NE    1 
ATOM   3263  C  CZ    . ARG A 1  420  ? 118.415 3.020   -18.508 1.00 101.33 ? 420  ARG A CZ    1 
ATOM   3264  N  NH1   . ARG A 1  420  ? 118.259 2.515   -19.727 1.00 99.31  ? 420  ARG A NH1   1 
ATOM   3265  N  NH2   . ARG A 1  420  ? 119.626 3.381   -18.103 1.00 95.63  ? 420  ARG A NH2   1 
ATOM   3266  N  N     . ALA A 1  421  ? 114.939 5.346   -12.468 1.00 74.53  ? 421  ALA A N     1 
ATOM   3267  C  CA    . ALA A 1  421  ? 115.469 6.365   -11.547 1.00 75.51  ? 421  ALA A CA    1 
ATOM   3268  C  C     . ALA A 1  421  ? 116.670 5.913   -10.693 1.00 82.78  ? 421  ALA A C     1 
ATOM   3269  O  O     . ALA A 1  421  ? 117.502 6.752   -10.300 1.00 81.01  ? 421  ALA A O     1 
ATOM   3270  C  CB    . ALA A 1  421  ? 114.362 6.933   -10.683 1.00 75.89  ? 421  ALA A CB    1 
ATOM   3271  N  N     . GLY A 1  422  ? 116.746 4.599   -10.441 1.00 82.52  ? 422  GLY A N     1 
ATOM   3272  C  CA    . GLY A 1  422  ? 117.852 3.983   -9.719  1.00 83.77  ? 422  GLY A CA    1 
ATOM   3273  C  C     . GLY A 1  422  ? 119.028 3.763   -10.649 1.00 90.87  ? 422  GLY A C     1 
ATOM   3274  O  O     . GLY A 1  422  ? 120.066 4.419   -10.513 1.00 89.93  ? 422  GLY A O     1 
ATOM   3275  N  N     . ASP A 1  423  ? 118.828 2.894   -11.666 1.00 91.29  ? 423  ASP A N     1 
ATOM   3276  C  CA    . ASP A 1  423  ? 119.811 2.524   -12.702 1.00 92.90  ? 423  ASP A CA    1 
ATOM   3277  C  C     . ASP A 1  423  ? 120.131 3.634   -13.714 1.00 95.56  ? 423  ASP A C     1 
ATOM   3278  O  O     . ASP A 1  423  ? 120.612 3.355   -14.815 1.00 96.53  ? 423  ASP A O     1 
ATOM   3279  C  CB    . ASP A 1  423  ? 119.455 1.180   -13.398 1.00 96.70  ? 423  ASP A CB    1 
ATOM   3280  C  CG    . ASP A 1  423  ? 118.326 1.217   -14.428 1.00 116.46 ? 423  ASP A CG    1 
ATOM   3281  O  OD1   . ASP A 1  423  ? 118.626 1.402   -15.636 1.00 117.76 ? 423  ASP A OD1   1 
ATOM   3282  O  OD2   . ASP A 1  423  ? 117.155 0.956   -14.041 1.00 126.29 ? 423  ASP A OD2   1 
ATOM   3283  N  N     . ILE A 1  424  ? 119.914 4.888   -13.319 1.00 89.55  ? 424  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1  424  ? 120.227 6.045   -14.139 1.00 88.02  ? 424  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1  424  ? 121.739 6.146   -14.338 1.00 88.93  ? 424  ILE A C     1 
ATOM   3286  O  O     . ILE A 1  424  ? 122.512 6.021   -13.385 1.00 87.89  ? 424  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1  424  ? 119.614 7.307   -13.509 1.00 90.77  ? 424  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1  424  ? 119.419 8.405   -14.539 1.00 89.97  ? 424  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1  424  ? 120.357 7.770   -12.235 1.00 93.29  ? 424  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1  424  ? 118.027 8.472   -14.968 1.00 92.44  ? 424  ILE A CD1   1 
ATOM   3291  N  N     . GLN A 1  425  ? 122.164 6.276   -15.574 1.00 84.81  ? 425  GLN A N     1 
ATOM   3292  C  CA    . GLN A 1  425  ? 123.589 6.353   -15.767 1.00 85.00  ? 425  GLN A CA    1 
ATOM   3293  C  C     . GLN A 1  425  ? 124.105 7.553   -16.529 1.00 87.50  ? 425  GLN A C     1 
ATOM   3294  O  O     . GLN A 1  425  ? 124.199 7.547   -17.771 1.00 87.31  ? 425  GLN A O     1 
ATOM   3295  C  CB    . GLN A 1  425  ? 124.261 5.017   -16.120 1.00 87.49  ? 425  GLN A CB    1 
ATOM   3296  C  CG    . GLN A 1  425  ? 125.482 4.761   -15.227 1.00 121.11 ? 425  GLN A CG    1 
ATOM   3297  C  CD    . GLN A 1  425  ? 126.233 6.038   -14.818 1.00 152.58 ? 425  GLN A CD    1 
ATOM   3298  O  OE1   . GLN A 1  425  ? 127.059 6.573   -15.567 1.00 150.77 ? 425  GLN A OE1   1 
ATOM   3299  N  NE2   . GLN A 1  425  ? 125.883 6.622   -13.670 1.00 142.61 ? 425  GLN A NE2   1 
ATOM   3300  N  N     . LEU A 1  426  ? 124.496 8.570   -15.725 1.00 82.04  ? 426  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1  426  ? 125.012 9.886   -16.110 1.00 80.55  ? 426  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1  426  ? 126.050 9.898   -17.220 1.00 85.35  ? 426  LEU A C     1 
ATOM   3303  O  O     . LEU A 1  426  ? 126.837 8.961   -17.316 1.00 87.14  ? 426  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1  426  ? 125.534 10.623  -14.877 1.00 79.56  ? 426  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1  426  ? 124.463 11.206  -13.982 1.00 82.55  ? 426  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1  426  ? 125.060 12.096  -12.932 1.00 81.91  ? 426  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1  426  ? 123.465 12.003  -14.779 1.00 84.61  ? 426  LEU A CD2   1 
ATOM   3308  N  N     . GLN A 1  427  ? 126.032 10.938  -18.075 1.00 79.71  ? 427  GLN A N     1 
ATOM   3309  C  CA    . GLN A 1  427  ? 126.991 11.096  -19.176 1.00 79.10  ? 427  GLN A CA    1 
ATOM   3310  C  C     . GLN A 1  427  ? 127.431 12.535  -19.241 1.00 81.33  ? 427  GLN A C     1 
ATOM   3311  O  O     . GLN A 1  427  ? 126.585 13.411  -19.044 1.00 80.29  ? 427  GLN A O     1 
ATOM   3312  C  CB    . GLN A 1  427  ? 126.372 10.672  -20.506 1.00 80.50  ? 427  GLN A CB    1 
ATOM   3313  C  CG    . GLN A 1  427  ? 126.624 9.217   -20.829 1.00 101.39 ? 427  GLN A CG    1 
ATOM   3314  C  CD    . GLN A 1  427  ? 125.400 8.587   -21.447 1.00 133.98 ? 427  GLN A CD    1 
ATOM   3315  O  OE1   . GLN A 1  427  ? 125.006 8.918   -22.583 1.00 133.21 ? 427  GLN A OE1   1 
ATOM   3316  N  NE2   . GLN A 1  427  ? 124.750 7.680   -20.698 1.00 124.39 ? 427  GLN A NE2   1 
ATOM   3317  N  N     . TYR A 1  428  ? 128.739 12.803  -19.511 1.00 77.52  ? 428  TYR A N     1 
ATOM   3318  C  CA    . TYR A 1  428  ? 129.227 14.185  -19.574 1.00 77.28  ? 428  TYR A CA    1 
ATOM   3319  C  C     . TYR A 1  428  ? 128.376 14.956  -20.536 1.00 82.90  ? 428  TYR A C     1 
ATOM   3320  O  O     . TYR A 1  428  ? 128.011 14.415  -21.585 1.00 83.97  ? 428  TYR A O     1 
ATOM   3321  C  CB    . TYR A 1  428  ? 130.705 14.294  -19.969 1.00 78.96  ? 428  TYR A CB    1 
ATOM   3322  C  CG    . TYR A 1  428  ? 131.658 13.550  -19.065 1.00 82.33  ? 428  TYR A CG    1 
ATOM   3323  C  CD1   . TYR A 1  428  ? 131.429 13.466  -17.695 1.00 85.27  ? 428  TYR A CD1   1 
ATOM   3324  C  CD2   . TYR A 1  428  ? 132.823 12.983  -19.565 1.00 83.68  ? 428  TYR A CD2   1 
ATOM   3325  C  CE1   . TYR A 1  428  ? 132.295 12.760  -16.860 1.00 87.85  ? 428  TYR A CE1   1 
ATOM   3326  C  CE2   . TYR A 1  428  ? 133.705 12.289  -18.737 1.00 84.95  ? 428  TYR A CE2   1 
ATOM   3327  C  CZ    . TYR A 1  428  ? 133.437 12.179  -17.385 1.00 92.48  ? 428  TYR A CZ    1 
ATOM   3328  O  OH    . TYR A 1  428  ? 134.291 11.490  -16.561 1.00 92.91  ? 428  TYR A OH    1 
ATOM   3329  N  N     . GLY A 1  429  ? 127.978 16.160  -20.140 1.00 79.07  ? 429  GLY A N     1 
ATOM   3330  C  CA    . GLY A 1  429  ? 127.113 16.993  -20.971 1.00 78.72  ? 429  GLY A CA    1 
ATOM   3331  C  C     . GLY A 1  429  ? 125.638 16.907  -20.632 1.00 81.19  ? 429  GLY A C     1 
ATOM   3332  O  O     . GLY A 1  429  ? 124.812 17.638  -21.185 1.00 81.10  ? 429  GLY A O     1 
ATOM   3333  N  N     . TRP A 1  430  ? 125.287 16.027  -19.729 1.00 76.49  ? 430  TRP A N     1 
ATOM   3334  C  CA    . TRP A 1  430  ? 123.914 15.992  -19.312 1.00 75.69  ? 430  TRP A CA    1 
ATOM   3335  C  C     . TRP A 1  430  ? 123.821 17.022  -18.211 1.00 75.78  ? 430  TRP A C     1 
ATOM   3336  O  O     . TRP A 1  430  ? 124.830 17.426  -17.636 1.00 74.54  ? 430  TRP A O     1 
ATOM   3337  C  CB    . TRP A 1  430  ? 123.571 14.612  -18.762 1.00 75.55  ? 430  TRP A CB    1 
ATOM   3338  C  CG    . TRP A 1  430  ? 123.415 13.550  -19.806 1.00 77.69  ? 430  TRP A CG    1 
ATOM   3339  C  CD1   . TRP A 1  430  ? 123.794 13.614  -21.110 1.00 81.03  ? 430  TRP A CD1   1 
ATOM   3340  C  CD2   . TRP A 1  430  ? 122.869 12.240  -19.614 1.00 78.04  ? 430  TRP A CD2   1 
ATOM   3341  N  NE1   . TRP A 1  430  ? 123.524 12.422  -21.738 1.00 80.98  ? 430  TRP A NE1   1 
ATOM   3342  C  CE2   . TRP A 1  430  ? 122.915 11.580  -20.854 1.00 81.92  ? 430  TRP A CE2   1 
ATOM   3343  C  CE3   . TRP A 1  430  ? 122.314 11.569  -18.515 1.00 79.67  ? 430  TRP A CE3   1 
ATOM   3344  C  CZ2   . TRP A 1  430  ? 122.448 10.286  -21.023 1.00 81.79  ? 430  TRP A CZ2   1 
ATOM   3345  C  CZ3   . TRP A 1  430  ? 121.817 10.293  -18.693 1.00 81.38  ? 430  TRP A CZ3   1 
ATOM   3346  C  CH2   . TRP A 1  430  ? 121.916 9.654   -19.926 1.00 82.36  ? 430  TRP A CH2   1 
ATOM   3347  N  N     . LYS A 1  431  ? 122.628 17.467  -17.935 1.00 70.43  ? 431  LYS A N     1 
ATOM   3348  C  CA    . LYS A 1  431  ? 122.411 18.372  -16.833 1.00 68.76  ? 431  LYS A CA    1 
ATOM   3349  C  C     . LYS A 1  431  ? 121.637 17.567  -15.757 1.00 70.24  ? 431  LYS A C     1 
ATOM   3350  O  O     . LYS A 1  431  ? 120.771 16.742  -16.078 1.00 69.52  ? 431  LYS A O     1 
ATOM   3351  C  CB    . LYS A 1  431  ? 121.586 19.608  -17.261 1.00 70.33  ? 431  LYS A CB    1 
ATOM   3352  C  CG    . LYS A 1  431  ? 122.180 20.530  -18.316 1.00 72.80  ? 431  LYS A CG    1 
ATOM   3353  C  CD    . LYS A 1  431  ? 121.291 21.789  -18.490 1.00 80.36  ? 431  LYS A CD    1 
ATOM   3354  C  CE    . LYS A 1  431  ? 121.500 22.549  -19.784 1.00 97.51  ? 431  LYS A CE    1 
ATOM   3355  N  NZ    . LYS A 1  431  ? 120.904 21.853  -20.967 1.00 111.59 ? 431  LYS A NZ    1 
ATOM   3356  N  N     . VAL A 1  432  ? 121.959 17.811  -14.492 1.00 64.55  ? 432  VAL A N     1 
ATOM   3357  C  CA    . VAL A 1  432  ? 121.246 17.232  -13.375 1.00 63.41  ? 432  VAL A CA    1 
ATOM   3358  C  C     . VAL A 1  432  ? 120.608 18.404  -12.662 1.00 66.32  ? 432  VAL A C     1 
ATOM   3359  O  O     . VAL A 1  432  ? 121.308 19.337  -12.262 1.00 66.15  ? 432  VAL A O     1 
ATOM   3360  C  CB    . VAL A 1  432  ? 122.181 16.469  -12.445 1.00 67.83  ? 432  VAL A CB    1 
ATOM   3361  C  CG1   . VAL A 1  432  ? 121.476 16.114  -11.138 1.00 67.80  ? 432  VAL A CG1   1 
ATOM   3362  C  CG2   . VAL A 1  432  ? 122.704 15.229  -13.133 1.00 68.23  ? 432  VAL A CG2   1 
ATOM   3363  N  N     . GLU A 1  433  ? 119.286 18.390  -12.536 1.00 61.65  ? 433  GLU A N     1 
ATOM   3364  C  CA    . GLU A 1  433  ? 118.610 19.471  -11.848 1.00 60.57  ? 433  GLU A CA    1 
ATOM   3365  C  C     . GLU A 1  433  ? 118.575 19.129  -10.367 1.00 64.39  ? 433  GLU A C     1 
ATOM   3366  O  O     . GLU A 1  433  ? 117.625 18.524  -9.882  1.00 64.16  ? 433  GLU A O     1 
ATOM   3367  C  CB    . GLU A 1  433  ? 117.232 19.737  -12.462 1.00 61.75  ? 433  GLU A CB    1 
ATOM   3368  C  CG    . GLU A 1  433  ? 117.284 20.659  -13.667 1.00 71.60  ? 433  GLU A CG    1 
ATOM   3369  C  CD    . GLU A 1  433  ? 115.983 21.273  -14.148 1.00 100.95 ? 433  GLU A CD    1 
ATOM   3370  O  OE1   . GLU A 1  433  ? 114.975 21.235  -13.405 1.00 97.54  ? 433  GLU A OE1   1 
ATOM   3371  O  OE2   . GLU A 1  433  ? 115.983 21.828  -15.270 1.00 106.46 ? 433  GLU A OE2   1 
ATOM   3372  N  N     . ARG A 1  434  ? 119.664 19.445  -9.667  1.00 61.79  ? 434  ARG A N     1 
ATOM   3373  C  CA    . ARG A 1  434  ? 119.823 19.153  -8.239  1.00 62.34  ? 434  ARG A CA    1 
ATOM   3374  C  C     . ARG A 1  434  ? 119.166 20.177  -7.338  1.00 67.10  ? 434  ARG A C     1 
ATOM   3375  O  O     . ARG A 1  434  ? 118.888 21.300  -7.769  1.00 66.83  ? 434  ARG A O     1 
ATOM   3376  C  CB    . ARG A 1  434  ? 121.313 19.025  -7.864  1.00 63.69  ? 434  ARG A CB    1 
ATOM   3377  C  CG    . ARG A 1  434  ? 122.196 20.212  -8.285  1.00 71.78  ? 434  ARG A CG    1 
ATOM   3378  C  CD    . ARG A 1  434  ? 123.404 20.351  -7.387  1.00 72.75  ? 434  ARG A CD    1 
ATOM   3379  N  NE    . ARG A 1  434  ? 123.284 21.565  -6.591  1.00 74.03  ? 434  ARG A NE    1 
ATOM   3380  C  CZ    . ARG A 1  434  ? 124.037 22.644  -6.750  1.00 85.30  ? 434  ARG A CZ    1 
ATOM   3381  N  NH1   . ARG A 1  434  ? 125.019 22.654  -7.644  1.00 74.68  ? 434  ARG A NH1   1 
ATOM   3382  N  NH2   . ARG A 1  434  ? 123.829 23.715  -6.008  1.00 68.56  ? 434  ARG A NH2   1 
ATOM   3383  N  N     . HIS A 1  435  ? 119.007 19.816  -6.052  1.00 64.19  ? 435  HIS A N     1 
ATOM   3384  C  CA    . HIS A 1  435  ? 118.461 20.707  -5.032  1.00 63.89  ? 435  HIS A CA    1 
ATOM   3385  C  C     . HIS A 1  435  ? 119.396 21.886  -4.790  1.00 70.49  ? 435  HIS A C     1 
ATOM   3386  O  O     . HIS A 1  435  ? 120.568 21.886  -5.198  1.00 71.58  ? 435  HIS A O     1 
ATOM   3387  C  CB    . HIS A 1  435  ? 118.196 19.973  -3.694  1.00 64.19  ? 435  HIS A CB    1 
ATOM   3388  C  CG    . HIS A 1  435  ? 117.060 19.003  -3.743  1.00 67.21  ? 435  HIS A CG    1 
ATOM   3389  N  ND1   . HIS A 1  435  ? 117.189 17.724  -3.248  1.00 69.09  ? 435  HIS A ND1   1 
ATOM   3390  C  CD2   . HIS A 1  435  ? 115.833 19.132  -4.298  1.00 68.66  ? 435  HIS A CD2   1 
ATOM   3391  C  CE1   . HIS A 1  435  ? 116.026 17.130  -3.470  1.00 68.59  ? 435  HIS A CE1   1 
ATOM   3392  N  NE2   . HIS A 1  435  ? 115.172 17.942  -4.091  1.00 68.59  ? 435  HIS A NE2   1 
ATOM   3393  N  N     . ILE A 1  436  ? 118.836 22.912  -4.157  1.00 66.45  ? 436  ILE A N     1 
ATOM   3394  C  CA    . ILE A 1  436  ? 119.525 24.099  -3.723  1.00 65.33  ? 436  ILE A CA    1 
ATOM   3395  C  C     . ILE A 1  436  ? 120.353 23.622  -2.524  1.00 73.35  ? 436  ILE A C     1 
ATOM   3396  O  O     . ILE A 1  436  ? 119.829 22.915  -1.650  1.00 73.28  ? 436  ILE A O     1 
ATOM   3397  C  CB    . ILE A 1  436  ? 118.442 25.218  -3.523  1.00 66.62  ? 436  ILE A CB    1 
ATOM   3398  C  CG1   . ILE A 1  436  ? 118.461 26.111  -4.714  1.00 66.49  ? 436  ILE A CG1   1 
ATOM   3399  C  CG2   . ILE A 1  436  ? 118.513 26.042  -2.258  1.00 66.16  ? 436  ILE A CG2   1 
ATOM   3400  C  CD1   . ILE A 1  436  ? 119.742 25.943  -5.509  1.00 75.90  ? 436  ILE A CD1   1 
ATOM   3401  N  N     . MET A 1  437  ? 121.676 23.808  -2.598  1.00 72.49  ? 437  MET A N     1 
ATOM   3402  C  CA    . MET A 1  437  ? 122.553 23.328  -1.526  1.00 74.26  ? 437  MET A CA    1 
ATOM   3403  C  C     . MET A 1  437  ? 123.329 24.455  -0.824  1.00 75.81  ? 437  MET A C     1 
ATOM   3404  O  O     . MET A 1  437  ? 123.492 25.557  -1.368  1.00 75.06  ? 437  MET A O     1 
ATOM   3405  C  CB    . MET A 1  437  ? 123.517 22.280  -2.050  1.00 78.59  ? 437  MET A CB    1 
ATOM   3406  C  CG    . MET A 1  437  ? 122.884 21.278  -2.979  1.00 85.30  ? 437  MET A CG    1 
ATOM   3407  S  SD    . MET A 1  437  ? 123.813 19.723  -3.063  1.00 93.43  ? 437  MET A SD    1 
ATOM   3408  C  CE    . MET A 1  437  ? 125.516 20.345  -3.780  1.00 90.53  ? 437  MET A CE    1 
ATOM   3409  N  N     . ASP A 1  438  ? 123.815 24.175  0.398   1.00 69.89  ? 438  ASP A N     1 
ATOM   3410  C  CA    . ASP A 1  438  ? 124.567 25.145  1.182   1.00 67.67  ? 438  ASP A CA    1 
ATOM   3411  C  C     . ASP A 1  438  ? 125.626 25.818  0.348   1.00 66.76  ? 438  ASP A C     1 
ATOM   3412  O  O     . ASP A 1  438  ? 126.314 25.181  -0.446  1.00 65.64  ? 438  ASP A O     1 
ATOM   3413  C  CB    . ASP A 1  438  ? 125.179 24.494  2.444   1.00 70.30  ? 438  ASP A CB    1 
ATOM   3414  C  CG    . ASP A 1  438  ? 124.212 24.347  3.604   1.00 87.69  ? 438  ASP A CG    1 
ATOM   3415  O  OD1   . ASP A 1  438  ? 123.157 24.988  3.573   1.00 90.04  ? 438  ASP A OD1   1 
ATOM   3416  O  OD2   . ASP A 1  438  ? 124.522 23.593  4.549   1.00 95.69  ? 438  ASP A OD2   1 
ATOM   3417  N  N     . ASN A 1  439  ? 125.689 27.122  0.485   1.00 62.06  ? 439  ASN A N     1 
ATOM   3418  C  CA    . ASN A 1  439  ? 126.663 27.990  -0.134  1.00 61.43  ? 439  ASN A CA    1 
ATOM   3419  C  C     . ASN A 1  439  ? 126.436 28.380  -1.593  1.00 69.02  ? 439  ASN A C     1 
ATOM   3420  O  O     . ASN A 1  439  ? 127.227 29.139  -2.155  1.00 69.17  ? 439  ASN A O     1 
ATOM   3421  C  CB    . ASN A 1  439  ? 128.090 27.595  0.249   1.00 55.23  ? 439  ASN A CB    1 
ATOM   3422  C  CG    . ASN A 1  439  ? 128.511 28.331  1.487   1.00 90.34  ? 439  ASN A CG    1 
ATOM   3423  O  OD1   . ASN A 1  439  ? 127.773 28.433  2.490   1.00 81.65  ? 439  ASN A OD1   1 
ATOM   3424  N  ND2   . ASN A 1  439  ? 129.638 29.012  1.387   1.00 94.57  ? 439  ASN A ND2   1 
ATOM   3425  N  N     . ASP A 1  440  ? 125.303 27.970  -2.182  1.00 67.98  ? 440  ASP A N     1 
ATOM   3426  C  CA    . ASP A 1  440  ? 124.964 28.416  -3.537  1.00 68.39  ? 440  ASP A CA    1 
ATOM   3427  C  C     . ASP A 1  440  ? 124.610 29.898  -3.438  1.00 71.43  ? 440  ASP A C     1 
ATOM   3428  O  O     . ASP A 1  440  ? 124.047 30.324  -2.416  1.00 71.95  ? 440  ASP A O     1 
ATOM   3429  C  CB    . ASP A 1  440  ? 123.735 27.665  -4.082  1.00 71.04  ? 440  ASP A CB    1 
ATOM   3430  C  CG    . ASP A 1  440  ? 123.927 26.177  -4.281  1.00 90.78  ? 440  ASP A CG    1 
ATOM   3431  O  OD1   . ASP A 1  440  ? 125.105 25.716  -4.267  1.00 94.18  ? 440  ASP A OD1   1 
ATOM   3432  O  OD2   . ASP A 1  440  ? 122.896 25.457  -4.442  1.00 95.50  ? 440  ASP A OD2   1 
ATOM   3433  N  N     . PRO A 1  441  ? 124.933 30.720  -4.443  1.00 66.20  ? 441  PRO A N     1 
ATOM   3434  C  CA    . PRO A 1  441  ? 124.539 32.122  -4.352  1.00 65.63  ? 441  PRO A CA    1 
ATOM   3435  C  C     . PRO A 1  441  ? 123.073 32.303  -4.783  1.00 67.94  ? 441  PRO A C     1 
ATOM   3436  O  O     . PRO A 1  441  ? 122.617 31.725  -5.793  1.00 68.18  ? 441  PRO A O     1 
ATOM   3437  C  CB    . PRO A 1  441  ? 125.546 32.824  -5.258  1.00 67.54  ? 441  PRO A CB    1 
ATOM   3438  C  CG    . PRO A 1  441  ? 125.920 31.802  -6.270  1.00 72.23  ? 441  PRO A CG    1 
ATOM   3439  C  CD    . PRO A 1  441  ? 125.565 30.433  -5.740  1.00 67.70  ? 441  PRO A CD    1 
ATOM   3440  N  N     . VAL A 1  442  ? 122.318 33.045  -3.965  1.00 61.04  ? 442  VAL A N     1 
ATOM   3441  C  CA    . VAL A 1  442  ? 120.914 33.316  -4.234  1.00 59.24  ? 442  VAL A CA    1 
ATOM   3442  C  C     . VAL A 1  442  ? 120.615 34.784  -4.030  1.00 60.74  ? 442  VAL A C     1 
ATOM   3443  O  O     . VAL A 1  442  ? 121.285 35.439  -3.221  1.00 59.38  ? 442  VAL A O     1 
ATOM   3444  C  CB    . VAL A 1  442  ? 119.956 32.426  -3.417  1.00 63.06  ? 442  VAL A CB    1 
ATOM   3445  C  CG1   . VAL A 1  442  ? 119.966 30.990  -3.920  1.00 62.75  ? 442  VAL A CG1   1 
ATOM   3446  C  CG2   . VAL A 1  442  ? 120.277 32.489  -1.932  1.00 63.36  ? 442  VAL A CG2   1 
ATOM   3447  N  N     . LEU A 1  443  ? 119.595 35.298  -4.770  1.00 55.87  ? 443  LEU A N     1 
ATOM   3448  C  CA    . LEU A 1  443  ? 119.144 36.684  -4.686  1.00 54.17  ? 443  LEU A CA    1 
ATOM   3449  C  C     . LEU A 1  443  ? 118.081 36.769  -3.635  1.00 59.25  ? 443  LEU A C     1 
ATOM   3450  O  O     . LEU A 1  443  ? 117.074 36.074  -3.744  1.00 59.59  ? 443  LEU A O     1 
ATOM   3451  C  CB    . LEU A 1  443  ? 118.588 37.196  -6.020  1.00 52.84  ? 443  LEU A CB    1 
ATOM   3452  C  CG    . LEU A 1  443  ? 119.041 38.600  -6.501  1.00 56.46  ? 443  LEU A CG    1 
ATOM   3453  C  CD1   . LEU A 1  443  ? 117.903 39.377  -6.994  1.00 56.17  ? 443  LEU A CD1   1 
ATOM   3454  C  CD2   . LEU A 1  443  ? 119.702 39.428  -5.436  1.00 57.69  ? 443  LEU A CD2   1 
ATOM   3455  N  N     . PHE A 1  444  ? 118.317 37.575  -2.594  1.00 55.82  ? 444  PHE A N     1 
ATOM   3456  C  CA    . PHE A 1  444  ? 117.347 37.759  -1.525  1.00 56.15  ? 444  PHE A CA    1 
ATOM   3457  C  C     . PHE A 1  444  ? 116.787 39.143  -1.647  1.00 63.09  ? 444  PHE A C     1 
ATOM   3458  O  O     . PHE A 1  444  ? 117.552 40.092  -1.867  1.00 64.52  ? 444  PHE A O     1 
ATOM   3459  C  CB    . PHE A 1  444  ? 117.992 37.571  -0.159  1.00 58.14  ? 444  PHE A CB    1 
ATOM   3460  C  CG    . PHE A 1  444  ? 117.036 37.163  0.932   1.00 59.72  ? 444  PHE A CG    1 
ATOM   3461  C  CD1   . PHE A 1  444  ? 116.020 36.235  0.683   1.00 62.74  ? 444  PHE A CD1   1 
ATOM   3462  C  CD2   . PHE A 1  444  ? 117.200 37.633  2.230   1.00 62.04  ? 444  PHE A CD2   1 
ATOM   3463  C  CE1   . PHE A 1  444  ? 115.164 35.817  1.704   1.00 63.85  ? 444  PHE A CE1   1 
ATOM   3464  C  CE2   . PHE A 1  444  ? 116.355 37.202  3.256   1.00 65.50  ? 444  PHE A CE2   1 
ATOM   3465  C  CZ    . PHE A 1  444  ? 115.339 36.299  2.985   1.00 63.64  ? 444  PHE A CZ    1 
ATOM   3466  N  N     . ASN A 1  445  ? 115.464 39.285  -1.493  1.00 59.80  ? 445  ASN A N     1 
ATOM   3467  C  CA    . ASN A 1  445  ? 114.820 40.577  -1.695  1.00 59.99  ? 445  ASN A CA    1 
ATOM   3468  C  C     . ASN A 1  445  ? 113.716 40.886  -0.721  1.00 64.79  ? 445  ASN A C     1 
ATOM   3469  O  O     . ASN A 1  445  ? 112.976 39.975  -0.365  1.00 65.98  ? 445  ASN A O     1 
ATOM   3470  C  CB    . ASN A 1  445  ? 114.272 40.603  -3.148  1.00 59.26  ? 445  ASN A CB    1 
ATOM   3471  C  CG    . ASN A 1  445  ? 113.271 41.677  -3.510  1.00 80.22  ? 445  ASN A CG    1 
ATOM   3472  O  OD1   . ASN A 1  445  ? 113.529 42.879  -3.386  1.00 76.67  ? 445  ASN A OD1   1 
ATOM   3473  N  ND2   . ASN A 1  445  ? 112.130 41.257  -4.031  1.00 69.81  ? 445  ASN A ND2   1 
ATOM   3474  N  N     . ARG A 1  446  ? 113.541 42.174  -0.364  1.00 61.16  ? 446  ARG A N     1 
ATOM   3475  C  CA    . ARG A 1  446  ? 112.387 42.614  0.413   1.00 62.35  ? 446  ARG A CA    1 
ATOM   3476  C  C     . ARG A 1  446  ? 111.716 43.787  -0.257  1.00 70.30  ? 446  ARG A C     1 
ATOM   3477  O  O     . ARG A 1  446  ? 112.224 44.927  -0.180  1.00 71.23  ? 446  ARG A O     1 
ATOM   3478  C  CB    . ARG A 1  446  ? 112.702 42.951  1.866   1.00 62.65  ? 446  ARG A CB    1 
ATOM   3479  C  CG    . ARG A 1  446  ? 111.430 43.042  2.725   1.00 66.38  ? 446  ARG A CG    1 
ATOM   3480  C  CD    . ARG A 1  446  ? 111.638 43.924  3.936   1.00 68.19  ? 446  ARG A CD    1 
ATOM   3481  N  NE    . ARG A 1  446  ? 110.414 44.616  4.328   1.00 76.89  ? 446  ARG A NE    1 
ATOM   3482  C  CZ    . ARG A 1  446  ? 110.121 45.870  4.004   1.00 101.42 ? 446  ARG A CZ    1 
ATOM   3483  N  NH1   . ARG A 1  446  ? 110.976 46.598  3.289   1.00 101.21 ? 446  ARG A NH1   1 
ATOM   3484  N  NH2   . ARG A 1  446  ? 108.977 46.412  4.398   1.00 90.52  ? 446  ARG A NH2   1 
ATOM   3485  N  N     . GLN A 1  447  ? 110.547 43.519  -0.881  1.00 68.23  ? 447  GLN A N     1 
ATOM   3486  C  CA    . GLN A 1  447  ? 109.767 44.559  -1.560  1.00 69.25  ? 447  GLN A CA    1 
ATOM   3487  C  C     . GLN A 1  447  ? 109.153 45.562  -0.527  1.00 77.50  ? 447  GLN A C     1 
ATOM   3488  O  O     . GLN A 1  447  ? 108.770 45.095  0.557   1.00 79.07  ? 447  GLN A O     1 
ATOM   3489  C  CB    . GLN A 1  447  ? 108.668 43.955  -2.441  1.00 69.92  ? 447  GLN A CB    1 
ATOM   3490  C  CG    . GLN A 1  447  ? 109.136 43.017  -3.536  1.00 77.73  ? 447  GLN A CG    1 
ATOM   3491  C  CD    . GLN A 1  447  ? 108.181 41.853  -3.659  1.00 106.11 ? 447  GLN A CD    1 
ATOM   3492  O  OE1   . GLN A 1  447  ? 107.611 41.377  -2.660  1.00 108.08 ? 447  GLN A OE1   1 
ATOM   3493  N  NE2   . GLN A 1  447  ? 108.010 41.337  -4.876  1.00 93.82  ? 447  GLN A NE2   1 
ATOM   3494  N  N     . PRO A 1  448  ? 109.093 46.909  -0.757  1.00 74.11  ? 448  PRO A N     1 
ATOM   3495  C  CA    . PRO A 1  448  ? 109.325 47.667  -1.982  1.00 74.72  ? 448  PRO A CA    1 
ATOM   3496  C  C     . PRO A 1  448  ? 110.514 47.409  -2.911  1.00 83.16  ? 448  PRO A C     1 
ATOM   3497  O  O     . PRO A 1  448  ? 110.264 46.888  -4.009  1.00 84.52  ? 448  PRO A O     1 
ATOM   3498  C  CB    . PRO A 1  448  ? 109.085 49.101  -1.538  1.00 76.22  ? 448  PRO A CB    1 
ATOM   3499  C  CG    . PRO A 1  448  ? 107.963 48.941  -0.623  1.00 79.98  ? 448  PRO A CG    1 
ATOM   3500  C  CD    . PRO A 1  448  ? 108.426 47.787  0.217   1.00 75.56  ? 448  PRO A CD    1 
ATOM   3501  N  N     . SER A 1  449  ? 111.762 47.747  -2.538  1.00 79.49  ? 449  SER A N     1 
ATOM   3502  C  CA    . SER A 1  449  ? 112.946 47.614  -3.432  1.00 78.87  ? 449  SER A CA    1 
ATOM   3503  C  C     . SER A 1  449  ? 113.198 48.961  -4.049  1.00 84.13  ? 449  SER A C     1 
ATOM   3504  O  O     . SER A 1  449  ? 113.110 49.122  -5.276  1.00 84.56  ? 449  SER A O     1 
ATOM   3505  C  CB    . SER A 1  449  ? 112.785 46.579  -4.554  1.00 80.09  ? 449  SER A CB    1 
ATOM   3506  O  OG    . SER A 1  449  ? 112.605 45.250  -4.105  1.00 87.48  ? 449  SER A OG    1 
ATOM   3507  N  N     . LEU A 1  450  ? 113.489 49.936  -3.186  1.00 81.29  ? 450  LEU A N     1 
ATOM   3508  C  CA    . LEU A 1  450  ? 113.793 51.320  -3.556  1.00 82.36  ? 450  LEU A CA    1 
ATOM   3509  C  C     . LEU A 1  450  ? 115.325 51.521  -3.651  1.00 87.73  ? 450  LEU A C     1 
ATOM   3510  O  O     . LEU A 1  450  ? 115.811 52.623  -3.930  1.00 87.84  ? 450  LEU A O     1 
ATOM   3511  C  CB    . LEU A 1  450  ? 113.220 52.269  -2.483  1.00 82.84  ? 450  LEU A CB    1 
ATOM   3512  C  CG    . LEU A 1  450  ? 111.973 51.824  -1.726  1.00 86.81  ? 450  LEU A CG    1 
ATOM   3513  C  CD1   . LEU A 1  450  ? 111.847 52.580  -0.394  1.00 86.96  ? 450  LEU A CD1   1 
ATOM   3514  C  CD2   . LEU A 1  450  ? 110.737 52.005  -2.579  1.00 88.94  ? 450  LEU A CD2   1 
ATOM   3515  N  N     . HIS A 1  451  ? 116.060 50.423  -3.459  1.00 84.24  ? 451  HIS A N     1 
ATOM   3516  C  CA    . HIS A 1  451  ? 117.496 50.340  -3.345  1.00 84.34  ? 451  HIS A CA    1 
ATOM   3517  C  C     . HIS A 1  451  ? 118.170 49.330  -4.215  1.00 86.88  ? 451  HIS A C     1 
ATOM   3518  O  O     . HIS A 1  451  ? 117.607 48.252  -4.445  1.00 86.59  ? 451  HIS A O     1 
ATOM   3519  C  CB    . HIS A 1  451  ? 117.725 49.752  -1.972  1.00 85.84  ? 451  HIS A CB    1 
ATOM   3520  C  CG    . HIS A 1  451  ? 118.094 50.722  -0.951  1.00 90.32  ? 451  HIS A CG    1 
ATOM   3521  N  ND1   . HIS A 1  451  ? 118.030 50.394  0.375   1.00 92.74  ? 451  HIS A ND1   1 
ATOM   3522  C  CD2   . HIS A 1  451  ? 118.540 51.988  -1.090  1.00 93.43  ? 451  HIS A CD2   1 
ATOM   3523  C  CE1   . HIS A 1  451  ? 118.440 51.471  1.017   1.00 93.57  ? 451  HIS A CE1   1 
ATOM   3524  N  NE2   . HIS A 1  451  ? 118.765 52.455  0.170   1.00 94.12  ? 451  HIS A NE2   1 
ATOM   3525  N  N     . LYS A 1  452  ? 119.481 49.566  -4.474  1.00 80.99  ? 452  LYS A N     1 
ATOM   3526  C  CA    . LYS A 1  452  ? 120.406 48.593  -5.063  1.00 78.61  ? 452  LYS A CA    1 
ATOM   3527  C  C     . LYS A 1  452  ? 120.361 47.461  -3.995  1.00 81.58  ? 452  LYS A C     1 
ATOM   3528  O  O     . LYS A 1  452  ? 120.079 46.313  -4.315  1.00 80.95  ? 452  LYS A O     1 
ATOM   3529  C  CB    . LYS A 1  452  ? 121.818 49.215  -5.067  1.00 79.19  ? 452  LYS A CB    1 
ATOM   3530  C  CG    . LYS A 1  452  ? 122.730 48.893  -6.225  1.00 71.95  ? 452  LYS A CG    1 
ATOM   3531  C  CD    . LYS A 1  452  ? 124.032 49.726  -6.119  1.00 74.86  ? 452  LYS A CD    1 
ATOM   3532  C  CE    . LYS A 1  452  ? 125.253 48.852  -5.910  1.00 93.34  ? 452  LYS A CE    1 
ATOM   3533  N  NZ    . LYS A 1  452  ? 126.420 49.589  -5.331  1.00 102.31 ? 452  LYS A NZ    1 
ATOM   3534  N  N     . MET A 1  453  ? 120.463 47.875  -2.703  1.00 77.91  ? 453  MET A N     1 
ATOM   3535  C  CA    . MET A 1  453  ? 120.497 47.121  -1.447  1.00 77.15  ? 453  MET A CA    1 
ATOM   3536  C  C     . MET A 1  453  ? 119.294 46.325  -1.087  1.00 76.28  ? 453  MET A C     1 
ATOM   3537  O  O     . MET A 1  453  ? 119.383 45.544  -0.147  1.00 75.76  ? 453  MET A O     1 
ATOM   3538  C  CB    . MET A 1  453  ? 120.793 48.064  -0.284  1.00 80.86  ? 453  MET A CB    1 
ATOM   3539  C  CG    . MET A 1  453  ? 122.238 48.474  -0.214  1.00 86.59  ? 453  MET A CG    1 
ATOM   3540  S  SD    . MET A 1  453  ? 122.671 49.883  -1.281  1.00 92.25  ? 453  MET A SD    1 
ATOM   3541  C  CE    . MET A 1  453  ? 121.960 51.291  -0.297  1.00 89.31  ? 453  MET A CE    1 
ATOM   3542  N  N     . SER A 1  454  ? 118.160 46.535  -1.746  1.00 70.56  ? 454  SER A N     1 
ATOM   3543  C  CA    . SER A 1  454  ? 116.969 45.765  -1.407  1.00 69.71  ? 454  SER A CA    1 
ATOM   3544  C  C     . SER A 1  454  ? 117.022 44.357  -1.980  1.00 74.64  ? 454  SER A C     1 
ATOM   3545  O  O     . SER A 1  454  ? 116.221 43.511  -1.599  1.00 75.29  ? 454  SER A O     1 
ATOM   3546  C  CB    . SER A 1  454  ? 115.714 46.489  -1.846  1.00 71.56  ? 454  SER A CB    1 
ATOM   3547  O  OG    . SER A 1  454  ? 115.289 47.306  -0.773  1.00 81.89  ? 454  SER A OG    1 
ATOM   3548  N  N     . MET A 1  455  ? 117.979 44.120  -2.891  1.00 69.98  ? 455  MET A N     1 
ATOM   3549  C  CA    . MET A 1  455  ? 118.245 42.865  -3.551  1.00 68.78  ? 455  MET A CA    1 
ATOM   3550  C  C     . MET A 1  455  ? 119.704 42.551  -3.340  1.00 72.06  ? 455  MET A C     1 
ATOM   3551  O  O     . MET A 1  455  ? 120.578 43.212  -3.920  1.00 73.30  ? 455  MET A O     1 
ATOM   3552  C  CB    . MET A 1  455  ? 117.962 42.988  -5.033  1.00 71.41  ? 455  MET A CB    1 
ATOM   3553  C  CG    . MET A 1  455  ? 116.531 43.093  -5.315  1.00 77.18  ? 455  MET A CG    1 
ATOM   3554  S  SD    . MET A 1  455  ? 116.203 42.631  -7.014  1.00 84.13  ? 455  MET A SD    1 
ATOM   3555  C  CE    . MET A 1  455  ? 114.972 41.357  -6.764  1.00 80.68  ? 455  MET A CE    1 
ATOM   3556  N  N     . MET A 1  456  ? 119.994 41.588  -2.463  1.00 65.57  ? 456  MET A N     1 
ATOM   3557  C  CA    . MET A 1  456  ? 121.387 41.216  -2.239  1.00 63.82  ? 456  MET A CA    1 
ATOM   3558  C  C     . MET A 1  456  ? 121.606 39.727  -2.413  1.00 63.68  ? 456  MET A C     1 
ATOM   3559  O  O     . MET A 1  456  ? 120.689 38.916  -2.225  1.00 61.18  ? 456  MET A O     1 
ATOM   3560  C  CB    . MET A 1  456  ? 121.933 41.745  -0.902  1.00 66.56  ? 456  MET A CB    1 
ATOM   3561  C  CG    . MET A 1  456  ? 122.244 43.252  -0.904  1.00 70.27  ? 456  MET A CG    1 
ATOM   3562  S  SD    . MET A 1  456  ? 122.906 43.850  0.686   1.00 74.49  ? 456  MET A SD    1 
ATOM   3563  C  CE    . MET A 1  456  ? 121.537 43.671  1.682   1.00 70.97  ? 456  MET A CE    1 
ATOM   3564  N  N     . ALA A 1  457  ? 122.812 39.379  -2.851  1.00 60.15  ? 457  ALA A N     1 
ATOM   3565  C  CA    . ALA A 1  457  ? 123.190 37.996  -3.080  1.00 59.53  ? 457  ALA A CA    1 
ATOM   3566  C  C     . ALA A 1  457  ? 123.735 37.406  -1.753  1.00 63.79  ? 457  ALA A C     1 
ATOM   3567  O  O     . ALA A 1  457  ? 124.591 38.020  -1.104  1.00 64.20  ? 457  ALA A O     1 
ATOM   3568  C  CB    . ALA A 1  457  ? 124.212 37.909  -4.211  1.00 59.81  ? 457  ALA A CB    1 
ATOM   3569  N  N     . HIS A 1  458  ? 123.175 36.255  -1.323  1.00 58.30  ? 458  HIS A N     1 
ATOM   3570  C  CA    . HIS A 1  458  ? 123.559 35.573  -0.088  1.00 57.64  ? 458  HIS A CA    1 
ATOM   3571  C  C     . HIS A 1  458  ? 124.022 34.146  -0.366  1.00 61.88  ? 458  HIS A C     1 
ATOM   3572  O  O     . HIS A 1  458  ? 123.686 33.595  -1.424  1.00 61.68  ? 458  HIS A O     1 
ATOM   3573  C  CB    . HIS A 1  458  ? 122.344 35.471  0.836   1.00 58.45  ? 458  HIS A CB    1 
ATOM   3574  C  CG    . HIS A 1  458  ? 121.855 36.760  1.418   1.00 62.26  ? 458  HIS A CG    1 
ATOM   3575  N  ND1   . HIS A 1  458  ? 121.902 36.997  2.783   1.00 64.66  ? 458  HIS A ND1   1 
ATOM   3576  C  CD2   . HIS A 1  458  ? 121.264 37.815  0.815   1.00 63.50  ? 458  HIS A CD2   1 
ATOM   3577  C  CE1   . HIS A 1  458  ? 121.376 38.196  2.956   1.00 63.88  ? 458  HIS A CE1   1 
ATOM   3578  N  NE2   . HIS A 1  458  ? 120.965 38.719  1.804   1.00 63.58  ? 458  HIS A NE2   1 
ATOM   3579  N  N     . ARG A 1  459  ? 124.736 33.517  0.618   1.00 58.39  ? 459  ARG A N     1 
ATOM   3580  C  CA    . ARG A 1  459  ? 125.171 32.099  0.593   1.00 57.39  ? 459  ARG A CA    1 
ATOM   3581  C  C     . ARG A 1  459  ? 123.980 31.279  1.091   1.00 61.67  ? 459  ARG A C     1 
ATOM   3582  O  O     . ARG A 1  459  ? 123.255 31.743  1.980   1.00 62.78  ? 459  ARG A O     1 
ATOM   3583  C  CB    . ARG A 1  459  ? 126.349 31.865  1.565   1.00 54.57  ? 459  ARG A CB    1 
ATOM   3584  C  CG    . ARG A 1  459  ? 127.740 32.257  1.045   1.00 53.20  ? 459  ARG A CG    1 
ATOM   3585  C  CD    . ARG A 1  459  ? 128.639 32.836  2.131   1.00 52.99  ? 459  ARG A CD    1 
ATOM   3586  N  NE    . ARG A 1  459  ? 129.345 31.830  2.927   1.00 74.10  ? 459  ARG A NE    1 
ATOM   3587  C  CZ    . ARG A 1  459  ? 129.376 31.805  4.263   1.00 104.42 ? 459  ARG A CZ    1 
ATOM   3588  N  NH1   . ARG A 1  459  ? 128.736 32.730  4.969   1.00 87.27  ? 459  ARG A NH1   1 
ATOM   3589  N  NH2   . ARG A 1  459  ? 130.046 30.853  4.901   1.00 107.84 ? 459  ARG A NH2   1 
ATOM   3590  N  N     . VAL A 1  460  ? 123.745 30.096  0.545   1.00 57.05  ? 460  VAL A N     1 
ATOM   3591  C  CA    . VAL A 1  460  ? 122.616 29.328  1.085   1.00 57.77  ? 460  VAL A CA    1 
ATOM   3592  C  C     . VAL A 1  460  ? 122.985 28.671  2.458   1.00 64.20  ? 460  VAL A C     1 
ATOM   3593  O  O     . VAL A 1  460  ? 124.172 28.485  2.800   1.00 66.26  ? 460  VAL A O     1 
ATOM   3594  C  CB    . VAL A 1  460  ? 122.028 28.315  0.053   1.00 61.57  ? 460  VAL A CB    1 
ATOM   3595  C  CG1   . VAL A 1  460  ? 121.102 27.281  0.702   1.00 61.07  ? 460  VAL A CG1   1 
ATOM   3596  C  CG2   . VAL A 1  460  ? 121.285 29.046  -1.048  1.00 61.35  ? 460  VAL A CG2   1 
ATOM   3597  N  N     . LYS A 1  461  ? 121.962 28.389  3.256   1.00 57.84  ? 461  LYS A N     1 
ATOM   3598  C  CA    . LYS A 1  461  ? 122.131 27.663  4.484   1.00 57.02  ? 461  LYS A CA    1 
ATOM   3599  C  C     . LYS A 1  461  ? 120.859 26.903  4.746   1.00 62.93  ? 461  LYS A C     1 
ATOM   3600  O  O     . LYS A 1  461  ? 119.937 27.443  5.368   1.00 64.81  ? 461  LYS A O     1 
ATOM   3601  C  CB    . LYS A 1  461  ? 122.517 28.544  5.670   1.00 58.60  ? 461  LYS A CB    1 
ATOM   3602  C  CG    . LYS A 1  461  ? 123.575 27.929  6.574   1.00 71.47  ? 461  LYS A CG    1 
ATOM   3603  C  CD    . LYS A 1  461  ? 123.165 26.662  7.332   1.00 80.58  ? 461  LYS A CD    1 
ATOM   3604  C  CE    . LYS A 1  461  ? 124.212 26.297  8.354   1.00 94.88  ? 461  LYS A CE    1 
ATOM   3605  N  NZ    . LYS A 1  461  ? 124.100 27.144  9.580   1.00 105.39 ? 461  LYS A NZ    1 
ATOM   3606  N  N     . VAL A 1  462  ? 120.785 25.642  4.260   1.00 57.10  ? 462  VAL A N     1 
ATOM   3607  C  CA    . VAL A 1  462  ? 119.619 24.794  4.511   1.00 54.92  ? 462  VAL A CA    1 
ATOM   3608  C  C     . VAL A 1  462  ? 119.504 24.510  6.015   1.00 60.96  ? 462  VAL A C     1 
ATOM   3609  O  O     . VAL A 1  462  ? 120.487 24.097  6.663   1.00 61.65  ? 462  VAL A O     1 
ATOM   3610  C  CB    . VAL A 1  462  ? 119.545 23.526  3.663   1.00 55.84  ? 462  VAL A CB    1 
ATOM   3611  C  CG1   . VAL A 1  462  ? 118.111 23.036  3.594   1.00 54.48  ? 462  VAL A CG1   1 
ATOM   3612  C  CG2   . VAL A 1  462  ? 120.100 23.772  2.272   1.00 55.13  ? 462  VAL A CG2   1 
ATOM   3613  N  N     . ILE A 1  463  ? 118.318 24.829  6.563   1.00 56.80  ? 463  ILE A N     1 
ATOM   3614  C  CA    . ILE A 1  463  ? 117.989 24.735  7.978   1.00 56.40  ? 463  ILE A CA    1 
ATOM   3615  C  C     . ILE A 1  463  ? 116.565 24.180  8.194   1.00 61.42  ? 463  ILE A C     1 
ATOM   3616  O  O     . ILE A 1  463  ? 115.738 24.204  7.264   1.00 58.94  ? 463  ILE A O     1 
ATOM   3617  C  CB    . ILE A 1  463  ? 118.171 26.140  8.667   1.00 58.44  ? 463  ILE A CB    1 
ATOM   3618  C  CG1   . ILE A 1  463  ? 117.595 27.300  7.842   1.00 57.30  ? 463  ILE A CG1   1 
ATOM   3619  C  CG2   . ILE A 1  463  ? 119.607 26.401  9.042   1.00 59.10  ? 463  ILE A CG2   1 
ATOM   3620  C  CD1   . ILE A 1  463  ? 116.247 27.764  8.280   1.00 63.71  ? 463  ILE A CD1   1 
ATOM   3621  N  N     . PRO A 1  464  ? 116.235 23.739  9.439   1.00 60.95  ? 464  PRO A N     1 
ATOM   3622  C  CA    . PRO A 1  464  ? 114.857 23.297  9.711   1.00 62.25  ? 464  PRO A CA    1 
ATOM   3623  C  C     . PRO A 1  464  ? 113.931 24.504  9.871   1.00 72.10  ? 464  PRO A C     1 
ATOM   3624  O  O     . PRO A 1  464  ? 114.409 25.644  9.939   1.00 73.71  ? 464  PRO A O     1 
ATOM   3625  C  CB    . PRO A 1  464  ? 114.996 22.534  11.023  1.00 63.80  ? 464  PRO A CB    1 
ATOM   3626  C  CG    . PRO A 1  464  ? 116.119 23.202  11.705  1.00 67.25  ? 464  PRO A CG    1 
ATOM   3627  C  CD    . PRO A 1  464  ? 117.070 23.653  10.657  1.00 62.34  ? 464  PRO A CD    1 
ATOM   3628  N  N     . TYR A 1  465  ? 112.613 24.258  9.989   1.00 70.68  ? 465  TYR A N     1 
ATOM   3629  C  CA    . TYR A 1  465  ? 111.572 25.286  10.178  1.00 71.44  ? 465  TYR A CA    1 
ATOM   3630  C  C     . TYR A 1  465  ? 111.343 26.161  8.954   1.00 76.84  ? 465  TYR A C     1 
ATOM   3631  O  O     . TYR A 1  465  ? 112.264 26.490  8.183   1.00 77.27  ? 465  TYR A O     1 
ATOM   3632  C  CB    . TYR A 1  465  ? 111.710 26.090  11.487  1.00 72.78  ? 465  TYR A CB    1 
ATOM   3633  C  CG    . TYR A 1  465  ? 112.192 25.242  12.639  1.00 74.42  ? 465  TYR A CG    1 
ATOM   3634  C  CD1   . TYR A 1  465  ? 111.341 24.338  13.267  1.00 76.71  ? 465  TYR A CD1   1 
ATOM   3635  C  CD2   . TYR A 1  465  ? 113.511 25.305  13.071  1.00 75.36  ? 465  TYR A CD2   1 
ATOM   3636  C  CE1   . TYR A 1  465  ? 111.786 23.529  14.311  1.00 78.68  ? 465  TYR A CE1   1 
ATOM   3637  C  CE2   . TYR A 1  465  ? 113.972 24.492  14.104  1.00 77.24  ? 465  TYR A CE2   1 
ATOM   3638  C  CZ    . TYR A 1  465  ? 113.105 23.608  14.728  1.00 86.20  ? 465  TYR A CZ    1 
ATOM   3639  O  OH    . TYR A 1  465  ? 113.548 22.800  15.753  1.00 88.12  ? 465  TYR A OH    1 
ATOM   3640  N  N     . SER A 1  466  ? 110.076 26.526  8.796   1.00 71.06  ? 466  SER A N     1 
ATOM   3641  C  CA    . SER A 1  466  ? 109.530 27.217  7.647   1.00 68.41  ? 466  SER A CA    1 
ATOM   3642  C  C     . SER A 1  466  ? 109.884 28.719  7.400   1.00 68.24  ? 466  SER A C     1 
ATOM   3643  O  O     . SER A 1  466  ? 109.301 29.330  6.510   1.00 68.15  ? 466  SER A O     1 
ATOM   3644  C  CB    . SER A 1  466  ? 108.035 26.921  7.575   1.00 70.94  ? 466  SER A CB    1 
ATOM   3645  O  OG    . SER A 1  466  ? 107.753 25.618  8.078   1.00 75.59  ? 466  SER A OG    1 
ATOM   3646  N  N     . THR A 1  467  ? 110.871 29.296  8.102   1.00 61.89  ? 467  THR A N     1 
ATOM   3647  C  CA    . THR A 1  467  ? 111.208 30.709  7.873   1.00 60.52  ? 467  THR A CA    1 
ATOM   3648  C  C     . THR A 1  467  ? 112.547 30.919  7.203   1.00 65.94  ? 467  THR A C     1 
ATOM   3649  O  O     . THR A 1  467  ? 113.485 30.139  7.445   1.00 67.63  ? 467  THR A O     1 
ATOM   3650  C  CB    . THR A 1  467  ? 111.345 31.466  9.188   1.00 59.88  ? 467  THR A CB    1 
ATOM   3651  O  OG1   . THR A 1  467  ? 112.205 30.736  10.065  1.00 63.45  ? 467  THR A OG1   1 
ATOM   3652  C  CG2   . THR A 1  467  ? 110.035 31.801  9.826   1.00 54.40  ? 467  THR A CG2   1 
ATOM   3653  N  N     . PHE A 1  468  ? 112.672 32.036  6.444   1.00 60.29  ? 468  PHE A N     1 
ATOM   3654  C  CA    . PHE A 1  468  ? 113.952 32.468  5.898   1.00 59.15  ? 468  PHE A CA    1 
ATOM   3655  C  C     . PHE A 1  468  ? 114.648 33.135  7.074   1.00 63.52  ? 468  PHE A C     1 
ATOM   3656  O  O     . PHE A 1  468  ? 114.033 33.948  7.757   1.00 64.44  ? 468  PHE A O     1 
ATOM   3657  C  CB    . PHE A 1  468  ? 113.800 33.504  4.769   1.00 60.13  ? 468  PHE A CB    1 
ATOM   3658  C  CG    . PHE A 1  468  ? 113.459 32.968  3.408   1.00 61.17  ? 468  PHE A CG    1 
ATOM   3659  C  CD1   . PHE A 1  468  ? 114.072 31.822  2.919   1.00 64.81  ? 468  PHE A CD1   1 
ATOM   3660  C  CD2   . PHE A 1  468  ? 112.551 33.623  2.598   1.00 63.06  ? 468  PHE A CD2   1 
ATOM   3661  C  CE1   . PHE A 1  468  ? 113.744 31.317  1.662   1.00 65.16  ? 468  PHE A CE1   1 
ATOM   3662  C  CE2   . PHE A 1  468  ? 112.215 33.111  1.345   1.00 65.72  ? 468  PHE A CE2   1 
ATOM   3663  C  CZ    . PHE A 1  468  ? 112.810 31.961  0.889   1.00 63.75  ? 468  PHE A CZ    1 
ATOM   3664  N  N     . ARG A 1  469  ? 115.894 32.774  7.337   1.00 59.48  ? 469  ARG A N     1 
ATOM   3665  C  CA    . ARG A 1  469  ? 116.663 33.328  8.444   1.00 59.87  ? 469  ARG A CA    1 
ATOM   3666  C  C     . ARG A 1  469  ? 117.718 34.298  7.942   1.00 65.24  ? 469  ARG A C     1 
ATOM   3667  O  O     . ARG A 1  469  ? 118.434 33.965  7.000   1.00 64.74  ? 469  ARG A O     1 
ATOM   3668  C  CB    . ARG A 1  469  ? 117.338 32.205  9.235   1.00 59.49  ? 469  ARG A CB    1 
ATOM   3669  C  CG    . ARG A 1  469  ? 116.415 31.103  9.638   1.00 64.88  ? 469  ARG A CG    1 
ATOM   3670  C  CD    . ARG A 1  469  ? 116.648 30.764  11.077  1.00 72.24  ? 469  ARG A CD    1 
ATOM   3671  N  NE    . ARG A 1  469  ? 115.383 30.778  11.791  1.00 75.81  ? 469  ARG A NE    1 
ATOM   3672  C  CZ    . ARG A 1  469  ? 115.202 31.324  12.981  1.00 89.79  ? 469  ARG A CZ    1 
ATOM   3673  N  NH1   . ARG A 1  469  ? 116.221 31.886  13.624  1.00 68.90  ? 469  ARG A NH1   1 
ATOM   3674  N  NH2   . ARG A 1  469  ? 114.007 31.305  13.547  1.00 89.36  ? 469  ARG A NH2   1 
ATOM   3675  N  N     . LEU A 1  470  ? 117.848 35.477  8.564   1.00 64.07  ? 470  LEU A N     1 
ATOM   3676  C  CA    . LEU A 1  470  ? 118.879 36.425  8.116   1.00 65.74  ? 470  LEU A CA    1 
ATOM   3677  C  C     . LEU A 1  470  ? 119.664 37.042  9.238   1.00 69.98  ? 470  LEU A C     1 
ATOM   3678  O  O     . LEU A 1  470  ? 119.115 37.186  10.337  1.00 70.25  ? 470  LEU A O     1 
ATOM   3679  C  CB    . LEU A 1  470  ? 118.334 37.521  7.175   1.00 66.35  ? 470  LEU A CB    1 
ATOM   3680  C  CG    . LEU A 1  470  ? 117.108 38.275  7.654   1.00 72.42  ? 470  LEU A CG    1 
ATOM   3681  C  CD1   . LEU A 1  470  ? 117.352 39.769  7.667   1.00 73.05  ? 470  LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A 1  470  ? 115.922 37.908  6.826   1.00 74.89  ? 470  LEU A CD2   1 
ATOM   3683  N  N     . ASN A 1  471  ? 120.939 37.444  8.963   1.00 65.79  ? 471  ASN A N     1 
ATOM   3684  C  CA    . ASN A 1  471  ? 121.740 38.083  10.008  1.00 66.03  ? 471  ASN A CA    1 
ATOM   3685  C  C     . ASN A 1  471  ? 121.137 39.411  10.415  1.00 69.85  ? 471  ASN A C     1 
ATOM   3686  O  O     . ASN A 1  471  ? 120.746 40.215  9.558   1.00 68.99  ? 471  ASN A O     1 
ATOM   3687  C  CB    . ASN A 1  471  ? 123.225 38.248  9.648   1.00 65.23  ? 471  ASN A CB    1 
ATOM   3688  C  CG    . ASN A 1  471  ? 124.016 38.802  10.831  1.00 76.78  ? 471  ASN A CG    1 
ATOM   3689  O  OD1   . ASN A 1  471  ? 124.317 39.990  10.916  1.00 56.16  ? 471  ASN A OD1   1 
ATOM   3690  N  ND2   . ASN A 1  471  ? 124.195 38.003  11.869  1.00 76.57  ? 471  ASN A ND2   1 
ATOM   3691  N  N     . LEU A 1  472  ? 121.062 39.652  11.720  1.00 67.11  ? 472  LEU A N     1 
ATOM   3692  C  CA    . LEU A 1  472  ? 120.471 40.908  12.167  1.00 67.42  ? 472  LEU A CA    1 
ATOM   3693  C  C     . LEU A 1  472  ? 121.027 42.259  11.597  1.00 72.27  ? 472  LEU A C     1 
ATOM   3694  O  O     . LEU A 1  472  ? 120.257 43.187  11.356  1.00 70.44  ? 472  LEU A O     1 
ATOM   3695  C  CB    . LEU A 1  472  ? 120.232 40.921  13.677  1.00 67.42  ? 472  LEU A CB    1 
ATOM   3696  C  CG    . LEU A 1  472  ? 118.769 40.957  13.951  1.00 71.08  ? 472  LEU A CG    1 
ATOM   3697  C  CD1   . LEU A 1  472  ? 118.301 39.729  14.649  1.00 71.28  ? 472  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU A 1  472  ? 118.355 42.252  14.543  1.00 74.17  ? 472  LEU A CD2   1 
ATOM   3699  N  N     . SER A 1  473  ? 122.332 42.335  11.328  1.00 70.81  ? 473  SER A N     1 
ATOM   3700  C  CA    . SER A 1  473  ? 122.938 43.561  10.830  1.00 71.80  ? 473  SER A CA    1 
ATOM   3701  C  C     . SER A 1  473  ? 122.541 43.919  9.407   1.00 76.24  ? 473  SER A C     1 
ATOM   3702  O  O     . SER A 1  473  ? 122.618 45.104  9.054   1.00 77.09  ? 473  SER A O     1 
ATOM   3703  C  CB    . SER A 1  473  ? 124.446 43.554  11.045  1.00 76.69  ? 473  SER A CB    1 
ATOM   3704  O  OG    . SER A 1  473  ? 124.732 43.750  12.424  1.00 88.82  ? 473  SER A OG    1 
ATOM   3705  N  N     . VAL A 1  474  ? 122.039 42.910  8.630   1.00 71.09  ? 474  VAL A N     1 
ATOM   3706  C  CA    . VAL A 1  474  ? 121.557 43.024  7.240   1.00 69.91  ? 474  VAL A CA    1 
ATOM   3707  C  C     . VAL A 1  474  ? 120.089 43.458  7.164   1.00 73.14  ? 474  VAL A C     1 
ATOM   3708  O  O     . VAL A 1  474  ? 119.546 43.684  6.088   1.00 69.83  ? 474  VAL A O     1 
ATOM   3709  C  CB    . VAL A 1  474  ? 121.854 41.744  6.423   1.00 73.45  ? 474  VAL A CB    1 
ATOM   3710  C  CG1   . VAL A 1  474  ? 120.630 40.841  6.270   1.00 72.64  ? 474  VAL A CG1   1 
ATOM   3711  C  CG2   . VAL A 1  474  ? 122.402 42.110  5.071   1.00 73.23  ? 474  VAL A CG2   1 
ATOM   3712  N  N     . THR A 1  475  ? 119.470 43.594  8.336   1.00 73.41  ? 475  THR A N     1 
ATOM   3713  C  CA    . THR A 1  475  ? 118.089 44.018  8.546   1.00 74.27  ? 475  THR A CA    1 
ATOM   3714  C  C     . THR A 1  475  ? 117.789 45.380  7.869   1.00 78.50  ? 475  THR A C     1 
ATOM   3715  O  O     . THR A 1  475  ? 116.932 45.431  6.987   1.00 77.51  ? 475  THR A O     1 
ATOM   3716  C  CB    . THR A 1  475  ? 117.744 43.840  10.057  1.00 86.63  ? 475  THR A CB    1 
ATOM   3717  O  OG1   . THR A 1  475  ? 116.588 43.007  10.258  1.00 84.78  ? 475  THR A OG1   1 
ATOM   3718  C  CG2   . THR A 1  475  ? 117.774 45.153  10.891  1.00 85.68  ? 475  THR A CG2   1 
ATOM   3719  N  N     . SER A 1  476  ? 118.557 46.441  8.227   1.00 76.52  ? 476  SER A N     1 
ATOM   3720  C  CA    . SER A 1  476  ? 118.449 47.816  7.709   1.00 76.81  ? 476  SER A CA    1 
ATOM   3721  C  C     . SER A 1  476  ? 118.413 47.994  6.186   1.00 79.66  ? 476  SER A C     1 
ATOM   3722  O  O     . SER A 1  476  ? 117.422 48.572  5.743   1.00 79.75  ? 476  SER A O     1 
ATOM   3723  C  CB    . SER A 1  476  ? 119.455 48.764  8.359   1.00 82.32  ? 476  SER A CB    1 
ATOM   3724  O  OG    . SER A 1  476  ? 120.611 48.081  8.825   1.00 98.13  ? 476  SER A OG    1 
ATOM   3725  N  N     . PRO A 1  477  ? 119.399 47.532  5.351   1.00 74.97  ? 477  PRO A N     1 
ATOM   3726  C  CA    . PRO A 1  477  ? 119.289 47.758  3.894   1.00 73.92  ? 477  PRO A CA    1 
ATOM   3727  C  C     . PRO A 1  477  ? 117.957 47.342  3.277   1.00 77.59  ? 477  PRO A C     1 
ATOM   3728  O  O     . PRO A 1  477  ? 117.401 48.128  2.494   1.00 77.03  ? 477  PRO A O     1 
ATOM   3729  C  CB    . PRO A 1  477  ? 120.483 46.994  3.302   1.00 75.17  ? 477  PRO A CB    1 
ATOM   3730  C  CG    . PRO A 1  477  ? 120.985 46.135  4.393   1.00 80.05  ? 477  PRO A CG    1 
ATOM   3731  C  CD    . PRO A 1  477  ? 120.654 46.824  5.668   1.00 76.45  ? 477  PRO A CD    1 
ATOM   3732  N  N     . TYR A 1  478  ? 117.425 46.144  3.672   1.00 74.01  ? 478  TYR A N     1 
ATOM   3733  C  CA    . TYR A 1  478  ? 116.145 45.577  3.210   1.00 73.03  ? 478  TYR A CA    1 
ATOM   3734  C  C     . TYR A 1  478  ? 114.946 46.342  3.729   1.00 77.71  ? 478  TYR A C     1 
ATOM   3735  O  O     . TYR A 1  478  ? 113.928 46.449  3.026   1.00 76.82  ? 478  TYR A O     1 
ATOM   3736  C  CB    . TYR A 1  478  ? 116.003 44.125  3.656   1.00 73.38  ? 478  TYR A CB    1 
ATOM   3737  C  CG    . TYR A 1  478  ? 116.954 43.196  2.958   1.00 75.58  ? 478  TYR A CG    1 
ATOM   3738  C  CD1   . TYR A 1  478  ? 116.805 42.898  1.606   1.00 77.89  ? 478  TYR A CD1   1 
ATOM   3739  C  CD2   . TYR A 1  478  ? 117.978 42.571  3.653   1.00 77.10  ? 478  TYR A CD2   1 
ATOM   3740  C  CE1   . TYR A 1  478  ? 117.689 42.040  0.951   1.00 79.35  ? 478  TYR A CE1   1 
ATOM   3741  C  CE2   . TYR A 1  478  ? 118.857 41.695  3.016   1.00 78.19  ? 478  TYR A CE2   1 
ATOM   3742  C  CZ    . TYR A 1  478  ? 118.715 41.441  1.663   1.00 84.61  ? 478  TYR A CZ    1 
ATOM   3743  O  OH    . TYR A 1  478  ? 119.599 40.607  1.041   1.00 83.73  ? 478  TYR A OH    1 
ATOM   3744  N  N     . ASN A 1  479  ? 115.096 46.881  4.965   1.00 75.51  ? 479  ASN A N     1 
ATOM   3745  C  CA    . ASN A 1  479  ? 114.130 47.594  5.799   1.00 76.37  ? 479  ASN A CA    1 
ATOM   3746  C  C     . ASN A 1  479  ? 113.192 46.583  6.413   1.00 83.15  ? 479  ASN A C     1 
ATOM   3747  O  O     . ASN A 1  479  ? 111.977 46.808  6.508   1.00 85.02  ? 479  ASN A O     1 
ATOM   3748  C  CB    . ASN A 1  479  ? 113.376 48.698  5.064   1.00 76.14  ? 479  ASN A CB    1 
ATOM   3749  C  CG    . ASN A 1  479  ? 113.063 49.808  6.006   1.00 104.13 ? 479  ASN A CG    1 
ATOM   3750  O  OD1   . ASN A 1  479  ? 112.047 49.769  6.703   1.00 88.15  ? 479  ASN A OD1   1 
ATOM   3751  N  ND2   . ASN A 1  479  ? 113.997 50.765  6.128   1.00 106.52 ? 479  ASN A ND2   1 
ATOM   3752  N  N     . ALA A 1  480  ? 113.771 45.449  6.824   1.00 78.45  ? 480  ALA A N     1 
ATOM   3753  C  CA    . ALA A 1  480  ? 113.049 44.342  7.408   1.00 77.78  ? 480  ALA A CA    1 
ATOM   3754  C  C     . ALA A 1  480  ? 113.054 44.338  8.934   1.00 83.82  ? 480  ALA A C     1 
ATOM   3755  O  O     . ALA A 1  480  ? 113.957 44.886  9.572   1.00 83.92  ? 480  ALA A O     1 
ATOM   3756  C  CB    . ALA A 1  480  ? 113.629 43.053  6.894   1.00 77.89  ? 480  ALA A CB    1 
ATOM   3757  N  N     . ASP A 1  481  ? 111.991 43.748  9.498   1.00 81.76  ? 481  ASP A N     1 
ATOM   3758  C  CA    . ASP A 1  481  ? 111.737 43.464  10.911  1.00 82.82  ? 481  ASP A CA    1 
ATOM   3759  C  C     . ASP A 1  481  ? 110.935 42.157  10.951  1.00 85.89  ? 481  ASP A C     1 
ATOM   3760  O  O     . ASP A 1  481  ? 110.560 41.657  9.884   1.00 85.79  ? 481  ASP A O     1 
ATOM   3761  C  CB    . ASP A 1  481  ? 111.081 44.638  11.674  1.00 86.22  ? 481  ASP A CB    1 
ATOM   3762  C  CG    . ASP A 1  481  ? 109.692 45.095  11.250  1.00 105.88 ? 481  ASP A CG    1 
ATOM   3763  O  OD1   . ASP A 1  481  ? 109.415 45.126  10.015  1.00 107.64 ? 481  ASP A OD1   1 
ATOM   3764  O  OD2   . ASP A 1  481  ? 108.926 45.546  12.136  1.00 114.26 ? 481  ASP A OD2   1 
ATOM   3765  N  N     . PHE A 1  482  ? 110.760 41.535  12.122  1.00 80.72  ? 482  PHE A N     1 
ATOM   3766  C  CA    . PHE A 1  482  ? 110.095 40.241  12.116  1.00 79.31  ? 482  PHE A CA    1 
ATOM   3767  C  C     . PHE A 1  482  ? 108.710 40.211  12.715  1.00 84.94  ? 482  PHE A C     1 
ATOM   3768  O  O     . PHE A 1  482  ? 108.298 39.198  13.279  1.00 85.00  ? 482  PHE A O     1 
ATOM   3769  C  CB    . PHE A 1  482  ? 111.027 39.135  12.610  1.00 80.59  ? 482  PHE A CB    1 
ATOM   3770  C  CG    . PHE A 1  482  ? 112.469 39.382  12.239  1.00 81.64  ? 482  PHE A CG    1 
ATOM   3771  C  CD1   . PHE A 1  482  ? 112.901 39.232  10.931  1.00 84.22  ? 482  PHE A CD1   1 
ATOM   3772  C  CD2   . PHE A 1  482  ? 113.384 39.808  13.189  1.00 84.66  ? 482  PHE A CD2   1 
ATOM   3773  C  CE1   . PHE A 1  482  ? 114.235 39.473  10.585  1.00 85.51  ? 482  PHE A CE1   1 
ATOM   3774  C  CE2   . PHE A 1  482  ? 114.711 40.068  12.839  1.00 87.63  ? 482  PHE A CE2   1 
ATOM   3775  C  CZ    . PHE A 1  482  ? 115.122 39.924  11.532  1.00 85.14  ? 482  PHE A CZ    1 
ATOM   3776  N  N     . ASP A 1  483  ? 107.954 41.314  12.519  1.00 82.86  ? 483  ASP A N     1 
ATOM   3777  C  CA    . ASP A 1  483  ? 106.561 41.456  12.950  1.00 83.63  ? 483  ASP A CA    1 
ATOM   3778  C  C     . ASP A 1  483  ? 105.653 40.702  11.959  1.00 86.89  ? 483  ASP A C     1 
ATOM   3779  O  O     . ASP A 1  483  ? 104.436 40.814  12.036  1.00 87.27  ? 483  ASP A O     1 
ATOM   3780  C  CB    . ASP A 1  483  ? 106.155 42.956  13.071  1.00 86.73  ? 483  ASP A CB    1 
ATOM   3781  C  CG    . ASP A 1  483  ? 106.280 43.760  11.784  1.00 107.34 ? 483  ASP A CG    1 
ATOM   3782  O  OD1   . ASP A 1  483  ? 106.581 43.158  10.731  1.00 109.07 ? 483  ASP A OD1   1 
ATOM   3783  O  OD2   . ASP A 1  483  ? 106.104 44.996  11.830  1.00 116.48 ? 483  ASP A OD2   1 
ATOM   3784  N  N     . GLY A 1  484  ? 106.257 39.967  11.028  1.00 82.86  ? 484  GLY A N     1 
ATOM   3785  C  CA    . GLY A 1  484  ? 105.535 39.192  10.028  1.00 82.26  ? 484  GLY A CA    1 
ATOM   3786  C  C     . GLY A 1  484  ? 105.894 39.516  8.598   1.00 84.63  ? 484  GLY A C     1 
ATOM   3787  O  O     . GLY A 1  484  ? 105.105 39.245  7.680   1.00 84.98  ? 484  GLY A O     1 
ATOM   3788  N  N     . ASP A 1  485  ? 107.094 40.081  8.397   1.00 78.69  ? 485  ASP A N     1 
ATOM   3789  C  CA    . ASP A 1  485  ? 107.567 40.435  7.065   1.00 77.03  ? 485  ASP A CA    1 
ATOM   3790  C  C     . ASP A 1  485  ? 107.868 39.122  6.330   1.00 79.01  ? 485  ASP A C     1 
ATOM   3791  O  O     . ASP A 1  485  ? 108.302 38.155  6.979   1.00 80.17  ? 485  ASP A O     1 
ATOM   3792  C  CB    . ASP A 1  485  ? 108.864 41.281  7.157   1.00 78.57  ? 485  ASP A CB    1 
ATOM   3793  C  CG    . ASP A 1  485  ? 108.771 42.737  7.620   1.00 88.83  ? 485  ASP A CG    1 
ATOM   3794  O  OD1   . ASP A 1  485  ? 107.871 43.057  8.421   1.00 89.96  ? 485  ASP A OD1   1 
ATOM   3795  O  OD2   . ASP A 1  485  ? 109.679 43.524  7.285   1.00 95.59  ? 485  ASP A OD2   1 
ATOM   3796  N  N     . GLU A 1  486  ? 107.586 39.070  5.003   1.00 70.69  ? 486  GLU A N     1 
ATOM   3797  C  CA    . GLU A 1  486  ? 107.942 37.940  4.135   1.00 67.54  ? 486  GLU A CA    1 
ATOM   3798  C  C     . GLU A 1  486  ? 109.054 38.453  3.182   1.00 68.60  ? 486  GLU A C     1 
ATOM   3799  O  O     . GLU A 1  486  ? 109.158 39.661  2.919   1.00 67.69  ? 486  GLU A O     1 
ATOM   3800  C  CB    . GLU A 1  486  ? 106.750 37.413  3.307   1.00 68.15  ? 486  GLU A CB    1 
ATOM   3801  C  CG    . GLU A 1  486  ? 105.703 36.577  4.037   1.00 81.06  ? 486  GLU A CG    1 
ATOM   3802  C  CD    . GLU A 1  486  ? 104.462 36.207  3.213   1.00 120.23 ? 486  GLU A CD    1 
ATOM   3803  O  OE1   . GLU A 1  486  ? 104.608 35.861  2.018   1.00 121.02 ? 486  GLU A OE1   1 
ATOM   3804  O  OE2   . GLU A 1  486  ? 103.339 36.241  3.769   1.00 117.71 ? 486  GLU A OE2   1 
ATOM   3805  N  N     . MET A 1  487  ? 109.897 37.551  2.674   1.00 63.42  ? 487  MET A N     1 
ATOM   3806  C  CA    . MET A 1  487  ? 110.930 37.943  1.715   1.00 61.77  ? 487  MET A CA    1 
ATOM   3807  C  C     . MET A 1  487  ? 111.037 37.010  0.508   1.00 64.84  ? 487  MET A C     1 
ATOM   3808  O  O     . MET A 1  487  ? 110.568 35.863  0.546   1.00 64.22  ? 487  MET A O     1 
ATOM   3809  C  CB    . MET A 1  487  ? 112.265 38.154  2.380   1.00 64.02  ? 487  MET A CB    1 
ATOM   3810  C  CG    . MET A 1  487  ? 112.348 39.432  3.130   1.00 68.35  ? 487  MET A CG    1 
ATOM   3811  S  SD    . MET A 1  487  ? 114.076 39.904  3.163   1.00 73.57  ? 487  MET A SD    1 
ATOM   3812  C  CE    . MET A 1  487  ? 114.262 40.124  4.821   1.00 70.65  ? 487  MET A CE    1 
ATOM   3813  N  N     . ASN A 1  488  ? 111.600 37.529  -0.587  1.00 60.96  ? 488  ASN A N     1 
ATOM   3814  C  CA    . ASN A 1  488  ? 111.714 36.771  -1.823  1.00 60.42  ? 488  ASN A CA    1 
ATOM   3815  C  C     . ASN A 1  488  ? 113.110 36.227  -2.109  1.00 62.95  ? 488  ASN A C     1 
ATOM   3816  O  O     . ASN A 1  488  ? 114.118 36.903  -1.894  1.00 63.93  ? 488  ASN A O     1 
ATOM   3817  C  CB    . ASN A 1  488  ? 111.177 37.595  -2.985  1.00 62.10  ? 488  ASN A CB    1 
ATOM   3818  C  CG    . ASN A 1  488  ? 109.681 37.789  -2.914  1.00 92.77  ? 488  ASN A CG    1 
ATOM   3819  O  OD1   . ASN A 1  488  ? 109.014 37.288  -2.008  1.00 75.96  ? 488  ASN A OD1   1 
ATOM   3820  N  ND2   . ASN A 1  488  ? 109.109 38.500  -3.885  1.00 95.19  ? 488  ASN A ND2   1 
ATOM   3821  N  N     . LEU A 1  489  ? 113.165 35.004  -2.584  1.00 56.06  ? 489  LEU A N     1 
ATOM   3822  C  CA    . LEU A 1  489  ? 114.423 34.410  -2.930  1.00 55.18  ? 489  LEU A CA    1 
ATOM   3823  C  C     . LEU A 1  489  ? 114.378 34.018  -4.413  1.00 61.67  ? 489  LEU A C     1 
ATOM   3824  O  O     . LEU A 1  489  ? 113.377 33.472  -4.868  1.00 62.31  ? 489  LEU A O     1 
ATOM   3825  C  CB    . LEU A 1  489  ? 114.658 33.203  -2.035  1.00 54.84  ? 489  LEU A CB    1 
ATOM   3826  C  CG    . LEU A 1  489  ? 116.064 32.648  -2.016  1.00 59.33  ? 489  LEU A CG    1 
ATOM   3827  C  CD1   . LEU A 1  489  ? 116.471 32.314  -0.615  1.00 60.25  ? 489  LEU A CD1   1 
ATOM   3828  C  CD2   . LEU A 1  489  ? 116.181 31.413  -2.899  1.00 59.82  ? 489  LEU A CD2   1 
ATOM   3829  N  N     . HIS A 1  490  ? 115.448 34.307  -5.169  1.00 58.76  ? 490  HIS A N     1 
ATOM   3830  C  CA    . HIS A 1  490  ? 115.567 33.931  -6.583  1.00 58.06  ? 490  HIS A CA    1 
ATOM   3831  C  C     . HIS A 1  490  ? 116.856 33.140  -6.778  1.00 60.90  ? 490  HIS A C     1 
ATOM   3832  O  O     . HIS A 1  490  ? 117.920 33.578  -6.325  1.00 61.56  ? 490  HIS A O     1 
ATOM   3833  C  CB    . HIS A 1  490  ? 115.559 35.161  -7.493  1.00 58.90  ? 490  HIS A CB    1 
ATOM   3834  C  CG    . HIS A 1  490  ? 114.287 35.932  -7.436  1.00 62.30  ? 490  HIS A CG    1 
ATOM   3835  N  ND1   . HIS A 1  490  ? 113.204 35.587  -8.221  1.00 64.06  ? 490  HIS A ND1   1 
ATOM   3836  C  CD2   . HIS A 1  490  ? 113.957 36.997  -6.664  1.00 63.76  ? 490  HIS A CD2   1 
ATOM   3837  C  CE1   . HIS A 1  490  ? 112.261 36.470  -7.925  1.00 63.47  ? 490  HIS A CE1   1 
ATOM   3838  N  NE2   . HIS A 1  490  ? 112.669 37.338  -6.987  1.00 63.54  ? 490  HIS A NE2   1 
ATOM   3839  N  N     . VAL A 1  491  ? 116.760 31.973  -7.436  1.00 55.02  ? 491  VAL A N     1 
ATOM   3840  C  CA    . VAL A 1  491  ? 117.898 31.083  -7.704  1.00 53.45  ? 491  VAL A CA    1 
ATOM   3841  C  C     . VAL A 1  491  ? 118.443 31.259  -9.138  1.00 59.54  ? 491  VAL A C     1 
ATOM   3842  O  O     . VAL A 1  491  ? 117.753 30.859  -10.079 1.00 60.14  ? 491  VAL A O     1 
ATOM   3843  C  CB    . VAL A 1  491  ? 117.513 29.601  -7.465  1.00 54.51  ? 491  VAL A CB    1 
ATOM   3844  C  CG1   . VAL A 1  491  ? 118.725 28.687  -7.638  1.00 53.45  ? 491  VAL A CG1   1 
ATOM   3845  C  CG2   . VAL A 1  491  ? 116.849 29.410  -6.108  1.00 53.79  ? 491  VAL A CG2   1 
ATOM   3846  N  N     . PRO A 1  492  ? 119.684 31.746  -9.355  1.00 57.25  ? 492  PRO A N     1 
ATOM   3847  C  CA    . PRO A 1  492  ? 120.222 31.786  -10.740 1.00 58.00  ? 492  PRO A CA    1 
ATOM   3848  C  C     . PRO A 1  492  ? 120.365 30.353  -11.319 1.00 64.06  ? 492  PRO A C     1 
ATOM   3849  O  O     . PRO A 1  492  ? 120.586 29.411  -10.536 1.00 66.34  ? 492  PRO A O     1 
ATOM   3850  C  CB    . PRO A 1  492  ? 121.588 32.454  -10.571 1.00 59.90  ? 492  PRO A CB    1 
ATOM   3851  C  CG    . PRO A 1  492  ? 121.979 32.113  -9.153  1.00 64.75  ? 492  PRO A CG    1 
ATOM   3852  C  CD    . PRO A 1  492  ? 120.687 32.192  -8.371  1.00 59.50  ? 492  PRO A CD    1 
ATOM   3853  N  N     . GLN A 1  493  ? 120.211 30.170  -12.659 1.00 57.58  ? 493  GLN A N     1 
ATOM   3854  C  CA    . GLN A 1  493  ? 120.296 28.845  -13.296 1.00 56.28  ? 493  GLN A CA    1 
ATOM   3855  C  C     . GLN A 1  493  ? 121.607 28.554  -14.061 1.00 62.96  ? 493  GLN A C     1 
ATOM   3856  O  O     . GLN A 1  493  ? 121.802 27.429  -14.542 1.00 62.06  ? 493  GLN A O     1 
ATOM   3857  C  CB    . GLN A 1  493  ? 119.073 28.588  -14.217 1.00 56.51  ? 493  GLN A CB    1 
ATOM   3858  C  CG    . GLN A 1  493  ? 117.696 28.671  -13.580 1.00 44.77  ? 493  GLN A CG    1 
ATOM   3859  C  CD    . GLN A 1  493  ? 117.596 27.787  -12.380 1.00 65.73  ? 493  GLN A CD    1 
ATOM   3860  O  OE1   . GLN A 1  493  ? 117.546 26.547  -12.483 1.00 67.08  ? 493  GLN A OE1   1 
ATOM   3861  N  NE2   . GLN A 1  493  ? 117.634 28.411  -11.211 1.00 50.80  ? 493  GLN A NE2   1 
ATOM   3862  N  N     . SER A 1  494  ? 122.498 29.558  -14.170 1.00 63.19  ? 494  SER A N     1 
ATOM   3863  C  CA    . SER A 1  494  ? 123.740 29.529  -14.962 1.00 64.59  ? 494  SER A CA    1 
ATOM   3864  C  C     . SER A 1  494  ? 124.975 29.843  -14.137 1.00 68.40  ? 494  SER A C     1 
ATOM   3865  O  O     . SER A 1  494  ? 124.881 30.520  -13.118 1.00 67.54  ? 494  SER A O     1 
ATOM   3866  C  CB    . SER A 1  494  ? 123.620 30.546  -16.110 1.00 70.65  ? 494  SER A CB    1 
ATOM   3867  O  OG    . SER A 1  494  ? 124.666 30.542  -17.071 1.00 82.49  ? 494  SER A OG    1 
ATOM   3868  N  N     . GLU A 1  495  ? 126.147 29.400  -14.614 1.00 66.49  ? 495  GLU A N     1 
ATOM   3869  C  CA    . GLU A 1  495  ? 127.433 29.712  -13.976 1.00 66.43  ? 495  GLU A CA    1 
ATOM   3870  C  C     . GLU A 1  495  ? 127.699 31.212  -14.117 1.00 68.17  ? 495  GLU A C     1 
ATOM   3871  O  O     . GLU A 1  495  ? 128.191 31.854  -13.187 1.00 67.08  ? 495  GLU A O     1 
ATOM   3872  C  CB    . GLU A 1  495  ? 128.578 28.873  -14.588 1.00 68.06  ? 495  GLU A CB    1 
ATOM   3873  C  CG    . GLU A 1  495  ? 128.700 27.484  -13.974 1.00 79.37  ? 495  GLU A CG    1 
ATOM   3874  C  CD    . GLU A 1  495  ? 128.850 27.380  -12.460 1.00 111.75 ? 495  GLU A CD    1 
ATOM   3875  O  OE1   . GLU A 1  495  ? 129.554 28.223  -11.851 1.00 110.35 ? 495  GLU A OE1   1 
ATOM   3876  O  OE2   . GLU A 1  495  ? 128.263 26.436  -11.881 1.00 110.73 ? 495  GLU A OE2   1 
ATOM   3877  N  N     . GLU A 1  496  ? 127.286 31.753  -15.269 1.00 64.07  ? 496  GLU A N     1 
ATOM   3878  C  CA    . GLU A 1  496  ? 127.375 33.131  -15.697 1.00 64.52  ? 496  GLU A CA    1 
ATOM   3879  C  C     . GLU A 1  496  ? 126.627 34.047  -14.726 1.00 68.70  ? 496  GLU A C     1 
ATOM   3880  O  O     . GLU A 1  496  ? 127.194 35.050  -14.267 1.00 69.20  ? 496  GLU A O     1 
ATOM   3881  C  CB    . GLU A 1  496  ? 126.764 33.233  -17.099 1.00 66.46  ? 496  GLU A CB    1 
ATOM   3882  C  CG    . GLU A 1  496  ? 127.691 33.758  -18.192 1.00 85.43  ? 496  GLU A CG    1 
ATOM   3883  C  CD    . GLU A 1  496  ? 126.991 34.630  -19.224 1.00 123.95 ? 496  GLU A CD    1 
ATOM   3884  O  OE1   . GLU A 1  496  ? 125.859 34.272  -19.634 1.00 127.84 ? 496  GLU A OE1   1 
ATOM   3885  O  OE2   . GLU A 1  496  ? 127.550 35.697  -19.581 1.00 122.11 ? 496  GLU A OE2   1 
ATOM   3886  N  N     . THR A 1  497  ? 125.357 33.707  -14.420 1.00 64.26  ? 497  THR A N     1 
ATOM   3887  C  CA    . THR A 1  497  ? 124.524 34.500  -13.512 1.00 63.89  ? 497  THR A CA    1 
ATOM   3888  C  C     . THR A 1  497  ? 124.959 34.347  -12.095 1.00 69.01  ? 497  THR A C     1 
ATOM   3889  O  O     . THR A 1  497  ? 124.878 35.296  -11.328 1.00 69.21  ? 497  THR A O     1 
ATOM   3890  C  CB    . THR A 1  497  ? 123.057 34.156  -13.649 1.00 71.37  ? 497  THR A CB    1 
ATOM   3891  O  OG1   . THR A 1  497  ? 122.922 32.770  -13.910 1.00 71.31  ? 497  THR A OG1   1 
ATOM   3892  C  CG2   . THR A 1  497  ? 122.417 34.904  -14.740 1.00 71.45  ? 497  THR A CG2   1 
ATOM   3893  N  N     . ARG A 1  498  ? 125.421 33.156  -11.731 1.00 66.79  ? 498  ARG A N     1 
ATOM   3894  C  CA    . ARG A 1  498  ? 125.904 32.890  -10.381 1.00 67.41  ? 498  ARG A CA    1 
ATOM   3895  C  C     . ARG A 1  498  ? 127.026 33.836  -10.050 1.00 71.33  ? 498  ARG A C     1 
ATOM   3896  O  O     . ARG A 1  498  ? 127.053 34.386  -8.942  1.00 71.92  ? 498  ARG A O     1 
ATOM   3897  C  CB    . ARG A 1  498  ? 126.448 31.469  -10.282 1.00 68.26  ? 498  ARG A CB    1 
ATOM   3898  C  CG    . ARG A 1  498  ? 125.453 30.522  -9.732  1.00 73.29  ? 498  ARG A CG    1 
ATOM   3899  C  CD    . ARG A 1  498  ? 126.002 29.153  -9.846  1.00 73.71  ? 498  ARG A CD    1 
ATOM   3900  N  NE    . ARG A 1  498  ? 125.456 28.357  -8.766  1.00 82.59  ? 498  ARG A NE    1 
ATOM   3901  C  CZ    . ARG A 1  498  ? 126.182 27.892  -7.765  1.00 94.27  ? 498  ARG A CZ    1 
ATOM   3902  N  NH1   . ARG A 1  498  ? 127.489 28.138  -7.714  1.00 75.53  ? 498  ARG A NH1   1 
ATOM   3903  N  NH2   . ARG A 1  498  ? 125.613 27.177  -6.803  1.00 79.54  ? 498  ARG A NH2   1 
ATOM   3904  N  N     . ALA A 1  499  ? 127.950 34.019  -11.027 1.00 65.59  ? 499  ALA A N     1 
ATOM   3905  C  CA    . ALA A 1  499  ? 129.115 34.871  -10.883 1.00 64.70  ? 499  ALA A CA    1 
ATOM   3906  C  C     . ALA A 1  499  ? 128.669 36.297  -10.704 1.00 65.23  ? 499  ALA A C     1 
ATOM   3907  O  O     . ALA A 1  499  ? 129.077 36.930  -9.731  1.00 64.28  ? 499  ALA A O     1 
ATOM   3908  C  CB    . ALA A 1  499  ? 130.035 34.728  -12.083 1.00 65.78  ? 499  ALA A CB    1 
ATOM   3909  N  N     . GLU A 1  500  ? 127.738 36.759  -11.562 1.00 60.01  ? 500  GLU A N     1 
ATOM   3910  C  CA    . GLU A 1  500  ? 127.174 38.109  -11.491 1.00 59.26  ? 500  GLU A CA    1 
ATOM   3911  C  C     . GLU A 1  500  ? 126.738 38.428  -10.068 1.00 59.82  ? 500  GLU A C     1 
ATOM   3912  O  O     . GLU A 1  500  ? 127.071 39.490  -9.544  1.00 60.12  ? 500  GLU A O     1 
ATOM   3913  C  CB    . GLU A 1  500  ? 125.976 38.239  -12.438 1.00 60.64  ? 500  GLU A CB    1 
ATOM   3914  C  CG    . GLU A 1  500  ? 125.935 39.542  -13.204 1.00 70.29  ? 500  GLU A CG    1 
ATOM   3915  C  CD    . GLU A 1  500  ? 125.553 39.325  -14.649 1.00 98.60  ? 500  GLU A CD    1 
ATOM   3916  O  OE1   . GLU A 1  500  ? 126.376 38.766  -15.414 1.00 103.20 ? 500  GLU A OE1   1 
ATOM   3917  O  OE2   . GLU A 1  500  ? 124.393 39.631  -14.992 1.00 90.76  ? 500  GLU A OE2   1 
ATOM   3918  N  N     . LEU A 1  501  ? 126.058 37.473  -9.434  1.00 53.02  ? 501  LEU A N     1 
ATOM   3919  C  CA    . LEU A 1  501  ? 125.576 37.611  -8.088  1.00 52.23  ? 501  LEU A CA    1 
ATOM   3920  C  C     . LEU A 1  501  ? 126.707 37.700  -7.065  1.00 54.86  ? 501  LEU A C     1 
ATOM   3921  O  O     . LEU A 1  501  ? 126.846 38.714  -6.373  1.00 53.46  ? 501  LEU A O     1 
ATOM   3922  C  CB    . LEU A 1  501  ? 124.602 36.464  -7.795  1.00 52.30  ? 501  LEU A CB    1 
ATOM   3923  C  CG    . LEU A 1  501  ? 123.172 36.657  -8.336  1.00 57.48  ? 501  LEU A CG    1 
ATOM   3924  C  CD1   . LEU A 1  501  ? 122.259 35.570  -7.834  1.00 56.97  ? 501  LEU A CD1   1 
ATOM   3925  C  CD2   . LEU A 1  501  ? 122.580 38.017  -7.901  1.00 61.76  ? 501  LEU A CD2   1 
ATOM   3926  N  N     . SER A 1  502  ? 127.552 36.668  -7.031  1.00 51.98  ? 502  SER A N     1 
ATOM   3927  C  CA    . SER A 1  502  ? 128.673 36.534  -6.106  1.00 52.18  ? 502  SER A CA    1 
ATOM   3928  C  C     . SER A 1  502  ? 129.698 37.625  -6.278  1.00 57.43  ? 502  SER A C     1 
ATOM   3929  O  O     . SER A 1  502  ? 130.292 38.069  -5.286  1.00 57.26  ? 502  SER A O     1 
ATOM   3930  C  CB    . SER A 1  502  ? 129.332 35.166  -6.269  1.00 55.84  ? 502  SER A CB    1 
ATOM   3931  O  OG    . SER A 1  502  ? 129.945 35.005  -7.536  1.00 63.01  ? 502  SER A OG    1 
ATOM   3932  N  N     . GLN A 1  503  ? 129.915 38.049  -7.538  1.00 55.18  ? 503  GLN A N     1 
ATOM   3933  C  CA    . GLN A 1  503  ? 130.908 39.070  -7.863  1.00 56.12  ? 503  GLN A CA    1 
ATOM   3934  C  C     . GLN A 1  503  ? 130.473 40.513  -7.741  1.00 63.78  ? 503  GLN A C     1 
ATOM   3935  O  O     . GLN A 1  503  ? 131.344 41.364  -7.511  1.00 65.79  ? 503  GLN A O     1 
ATOM   3936  C  CB    . GLN A 1  503  ? 131.607 38.807  -9.201  1.00 56.96  ? 503  GLN A CB    1 
ATOM   3937  C  CG    . GLN A 1  503  ? 132.329 37.466  -9.257  1.00 68.25  ? 503  GLN A CG    1 
ATOM   3938  C  CD    . GLN A 1  503  ? 133.120 37.174  -8.007  1.00 74.70  ? 503  GLN A CD    1 
ATOM   3939  O  OE1   . GLN A 1  503  ? 134.163 37.789  -7.748  1.00 68.42  ? 503  GLN A OE1   1 
ATOM   3940  N  NE2   . GLN A 1  503  ? 132.612 36.250  -7.191  1.00 57.45  ? 503  GLN A NE2   1 
ATOM   3941  N  N     . LEU A 1  504  ? 129.153 40.807  -7.871  1.00 59.08  ? 504  LEU A N     1 
ATOM   3942  C  CA    . LEU A 1  504  ? 128.668 42.189  -7.823  1.00 57.83  ? 504  LEU A CA    1 
ATOM   3943  C  C     . LEU A 1  504  ? 127.666 42.489  -6.716  1.00 63.02  ? 504  LEU A C     1 
ATOM   3944  O  O     . LEU A 1  504  ? 127.728 43.556  -6.105  1.00 63.25  ? 504  LEU A O     1 
ATOM   3945  C  CB    . LEU A 1  504  ? 128.051 42.592  -9.179  1.00 56.75  ? 504  LEU A CB    1 
ATOM   3946  C  CG    . LEU A 1  504  ? 128.839 42.335  -10.460 1.00 60.61  ? 504  LEU A CG    1 
ATOM   3947  C  CD1   . LEU A 1  504  ? 127.992 42.617  -11.671 1.00 60.59  ? 504  LEU A CD1   1 
ATOM   3948  C  CD2   . LEU A 1  504  ? 130.076 43.202  -10.545 1.00 63.70  ? 504  LEU A CD2   1 
ATOM   3949  N  N     . CYS A 1  505  ? 126.723 41.581  -6.491  1.00 60.16  ? 505  CYS A N     1 
ATOM   3950  C  CA    . CYS A 1  505  ? 125.616 41.817  -5.576  1.00 61.13  ? 505  CYS A CA    1 
ATOM   3951  C  C     . CYS A 1  505  ? 125.772 41.291  -4.174  1.00 63.52  ? 505  CYS A C     1 
ATOM   3952  O  O     . CYS A 1  505  ? 124.898 41.537  -3.340  1.00 63.86  ? 505  CYS A O     1 
ATOM   3953  C  CB    . CYS A 1  505  ? 124.308 41.341  -6.197  1.00 62.60  ? 505  CYS A CB    1 
ATOM   3954  S  SG    . CYS A 1  505  ? 124.242 41.485  -8.001  1.00 67.28  ? 505  CYS A SG    1 
ATOM   3955  N  N     . ALA A 1  506  ? 126.829 40.539  -3.910  1.00 57.95  ? 506  ALA A N     1 
ATOM   3956  C  CA    . ALA A 1  506  ? 127.040 39.968  -2.597  1.00 57.04  ? 506  ALA A CA    1 
ATOM   3957  C  C     . ALA A 1  506  ? 127.008 40.987  -1.481  1.00 60.23  ? 506  ALA A C     1 
ATOM   3958  O  O     . ALA A 1  506  ? 127.622 42.044  -1.584  1.00 60.74  ? 506  ALA A O     1 
ATOM   3959  C  CB    . ALA A 1  506  ? 128.347 39.230  -2.569  1.00 58.28  ? 506  ALA A CB    1 
ATOM   3960  N  N     . VAL A 1  507  ? 126.268 40.653  -0.410  1.00 55.95  ? 507  VAL A N     1 
ATOM   3961  C  CA    . VAL A 1  507  ? 126.095 41.404  0.844   1.00 54.57  ? 507  VAL A CA    1 
ATOM   3962  C  C     . VAL A 1  507  ? 127.403 42.061  1.282   1.00 59.94  ? 507  VAL A C     1 
ATOM   3963  O  O     . VAL A 1  507  ? 127.361 43.268  1.507   1.00 60.30  ? 507  VAL A O     1 
ATOM   3964  C  CB    . VAL A 1  507  ? 125.543 40.496  1.967   1.00 56.64  ? 507  VAL A CB    1 
ATOM   3965  C  CG1   . VAL A 1  507  ? 125.477 41.235  3.290   1.00 56.51  ? 507  VAL A CG1   1 
ATOM   3966  C  CG2   . VAL A 1  507  ? 124.199 39.892  1.592   1.00 55.58  ? 507  VAL A CG2   1 
ATOM   3967  N  N     . PRO A 1  508  ? 128.568 41.349  1.389   1.00 57.48  ? 508  PRO A N     1 
ATOM   3968  C  CA    . PRO A 1  508  ? 129.787 42.028  1.845   1.00 58.68  ? 508  PRO A CA    1 
ATOM   3969  C  C     . PRO A 1  508  ? 130.163 43.223  0.993   1.00 63.32  ? 508  PRO A C     1 
ATOM   3970  O  O     . PRO A 1  508  ? 130.422 44.289  1.560   1.00 62.99  ? 508  PRO A O     1 
ATOM   3971  C  CB    . PRO A 1  508  ? 130.834 40.917  1.831   1.00 60.60  ? 508  PRO A CB    1 
ATOM   3972  C  CG    . PRO A 1  508  ? 130.046 39.695  2.027   1.00 64.19  ? 508  PRO A CG    1 
ATOM   3973  C  CD    . PRO A 1  508  ? 128.847 39.916  1.180   1.00 58.71  ? 508  PRO A CD    1 
ATOM   3974  N  N     . LEU A 1  509  ? 130.078 43.081  -0.350  1.00 60.23  ? 509  LEU A N     1 
ATOM   3975  C  CA    . LEU A 1  509  ? 130.344 44.172  -1.301  1.00 60.58  ? 509  LEU A CA    1 
ATOM   3976  C  C     . LEU A 1  509  ? 129.439 45.388  -1.029  1.00 67.72  ? 509  LEU A C     1 
ATOM   3977  O  O     . LEU A 1  509  ? 129.910 46.537  -1.028  1.00 68.83  ? 509  LEU A O     1 
ATOM   3978  C  CB    . LEU A 1  509  ? 130.159 43.705  -2.741  1.00 59.62  ? 509  LEU A CB    1 
ATOM   3979  C  CG    . LEU A 1  509  ? 130.828 42.390  -3.110  1.00 63.99  ? 509  LEU A CG    1 
ATOM   3980  C  CD1   . LEU A 1  509  ? 130.245 41.813  -4.389  1.00 63.07  ? 509  LEU A CD1   1 
ATOM   3981  C  CD2   . LEU A 1  509  ? 132.347 42.543  -3.221  1.00 68.70  ? 509  LEU A CD2   1 
ATOM   3982  N  N     . GLN A 1  510  ? 128.178 45.115  -0.692  1.00 64.79  ? 510  GLN A N     1 
ATOM   3983  C  CA    . GLN A 1  510  ? 127.191 46.144  -0.405  1.00 65.68  ? 510  GLN A CA    1 
ATOM   3984  C  C     . GLN A 1  510  ? 127.349 46.990  0.881   1.00 70.23  ? 510  GLN A C     1 
ATOM   3985  O  O     . GLN A 1  510  ? 126.643 48.004  0.972   1.00 70.35  ? 510  GLN A O     1 
ATOM   3986  C  CB    . GLN A 1  510  ? 125.767 45.590  -0.556  1.00 66.89  ? 510  GLN A CB    1 
ATOM   3987  C  CG    . GLN A 1  510  ? 125.481 44.998  -1.931  1.00 81.91  ? 510  GLN A CG    1 
ATOM   3988  C  CD    . GLN A 1  510  ? 125.594 46.029  -3.012  1.00 100.75 ? 510  GLN A CD    1 
ATOM   3989  O  OE1   . GLN A 1  510  ? 125.102 47.160  -2.869  1.00 98.34  ? 510  GLN A OE1   1 
ATOM   3990  N  NE2   . GLN A 1  510  ? 126.269 45.665  -4.103  1.00 86.98  ? 510  GLN A NE2   1 
ATOM   3991  N  N     . ILE A 1  511  ? 128.274 46.614  1.833   1.00 65.81  ? 511  ILE A N     1 
ATOM   3992  C  CA    . ILE A 1  511  ? 128.519 47.306  3.128   1.00 65.47  ? 511  ILE A CA    1 
ATOM   3993  C  C     . ILE A 1  511  ? 128.641 48.823  3.058   1.00 70.35  ? 511  ILE A C     1 
ATOM   3994  O  O     . ILE A 1  511  ? 127.808 49.496  3.643   1.00 68.98  ? 511  ILE A O     1 
ATOM   3995  C  CB    . ILE A 1  511  ? 129.561 46.641  4.077   1.00 68.33  ? 511  ILE A CB    1 
ATOM   3996  C  CG1   . ILE A 1  511  ? 129.137 45.209  4.458   1.00 67.94  ? 511  ILE A CG1   1 
ATOM   3997  C  CG2   . ILE A 1  511  ? 129.777 47.488  5.343   1.00 68.39  ? 511  ILE A CG2   1 
ATOM   3998  C  CD1   . ILE A 1  511  ? 130.238 44.365  4.959   1.00 70.99  ? 511  ILE A CD1   1 
ATOM   3999  N  N     . VAL A 1  512  ? 129.643 49.368  2.355   1.00 70.23  ? 512  VAL A N     1 
ATOM   4000  C  CA    . VAL A 1  512  ? 129.747 50.828  2.205   1.00 72.11  ? 512  VAL A CA    1 
ATOM   4001  C  C     . VAL A 1  512  ? 128.892 51.199  0.981   1.00 78.62  ? 512  VAL A C     1 
ATOM   4002  O  O     . VAL A 1  512  ? 129.148 50.685  -0.105  1.00 78.77  ? 512  VAL A O     1 
ATOM   4003  C  CB    . VAL A 1  512  ? 131.212 51.326  2.109   1.00 76.88  ? 512  VAL A CB    1 
ATOM   4004  C  CG1   . VAL A 1  512  ? 131.293 52.706  1.456   1.00 77.45  ? 512  VAL A CG1   1 
ATOM   4005  C  CG2   . VAL A 1  512  ? 131.872 51.340  3.486   1.00 76.91  ? 512  VAL A CG2   1 
ATOM   4006  N  N     . SER A 1  513  ? 127.834 52.016  1.180   1.00 75.71  ? 513  SER A N     1 
ATOM   4007  C  CA    . SER A 1  513  ? 126.874 52.390  0.135   1.00 74.63  ? 513  SER A CA    1 
ATOM   4008  C  C     . SER A 1  513  ? 127.193 53.716  -0.520  1.00 77.53  ? 513  SER A C     1 
ATOM   4009  O  O     . SER A 1  513  ? 127.467 54.694  0.192   1.00 78.28  ? 513  SER A O     1 
ATOM   4010  C  CB    . SER A 1  513  ? 125.450 52.404  0.680   1.00 77.90  ? 513  SER A CB    1 
ATOM   4011  O  OG    . SER A 1  513  ? 124.587 53.172  -0.142  1.00 85.32  ? 513  SER A OG    1 
ATOM   4012  N  N     . PRO A 1  514  ? 127.047 53.774  -1.876  1.00 71.56  ? 514  PRO A N     1 
ATOM   4013  C  CA    . PRO A 1  514  ? 127.329 55.014  -2.611  1.00 71.11  ? 514  PRO A CA    1 
ATOM   4014  C  C     . PRO A 1  514  ? 126.275 56.100  -2.405  1.00 75.55  ? 514  PRO A C     1 
ATOM   4015  O  O     . PRO A 1  514  ? 126.485 57.244  -2.792  1.00 75.18  ? 514  PRO A O     1 
ATOM   4016  C  CB    . PRO A 1  514  ? 127.332 54.541  -4.065  1.00 71.92  ? 514  PRO A CB    1 
ATOM   4017  C  CG    . PRO A 1  514  ? 126.357 53.451  -4.080  1.00 75.46  ? 514  PRO A CG    1 
ATOM   4018  C  CD    . PRO A 1  514  ? 126.652 52.704  -2.813  1.00 71.55  ? 514  PRO A CD    1 
ATOM   4019  N  N     . GLN A 1  515  ? 125.136 55.743  -1.819  1.00 72.68  ? 515  GLN A N     1 
ATOM   4020  C  CA    . GLN A 1  515  ? 124.046 56.676  -1.598  1.00 73.28  ? 515  GLN A CA    1 
ATOM   4021  C  C     . GLN A 1  515  ? 124.514 57.845  -0.763  1.00 78.08  ? 515  GLN A C     1 
ATOM   4022  O  O     . GLN A 1  515  ? 124.177 58.986  -1.073  1.00 79.29  ? 515  GLN A O     1 
ATOM   4023  C  CB    . GLN A 1  515  ? 122.879 55.948  -0.915  1.00 74.83  ? 515  GLN A CB    1 
ATOM   4024  C  CG    . GLN A 1  515  ? 121.588 56.744  -0.793  1.00 93.12  ? 515  GLN A CG    1 
ATOM   4025  C  CD    . GLN A 1  515  ? 120.467 55.818  -0.428  1.00 113.55 ? 515  GLN A CD    1 
ATOM   4026  O  OE1   . GLN A 1  515  ? 120.260 54.774  -1.071  1.00 107.86 ? 515  GLN A OE1   1 
ATOM   4027  N  NE2   . GLN A 1  515  ? 119.733 56.173  0.622   1.00 105.15 ? 515  GLN A NE2   1 
ATOM   4028  N  N     . SER A 1  516  ? 125.326 57.572  0.258   1.00 73.75  ? 516  SER A N     1 
ATOM   4029  C  CA    . SER A 1  516  ? 125.768 58.614  1.170   1.00 74.24  ? 516  SER A CA    1 
ATOM   4030  C  C     . SER A 1  516  ? 127.216 58.429  1.563   1.00 76.12  ? 516  SER A C     1 
ATOM   4031  O  O     . SER A 1  516  ? 127.663 58.982  2.578   1.00 75.76  ? 516  SER A O     1 
ATOM   4032  C  CB    . SER A 1  516  ? 124.886 58.579  2.402   1.00 81.00  ? 516  SER A CB    1 
ATOM   4033  O  OG    . SER A 1  516  ? 124.731 57.200  2.705   1.00 101.69 ? 516  SER A OG    1 
ATOM   4034  N  N     . ASN A 1  517  ? 127.959 57.668  0.743   1.00 71.42  ? 517  ASN A N     1 
ATOM   4035  C  CA    . ASN A 1  517  ? 129.381 57.386  0.912   1.00 71.76  ? 517  ASN A CA    1 
ATOM   4036  C  C     . ASN A 1  517  ? 129.757 56.872  2.314   1.00 78.34  ? 517  ASN A C     1 
ATOM   4037  O  O     . ASN A 1  517  ? 130.812 57.204  2.851   1.00 80.26  ? 517  ASN A O     1 
ATOM   4038  C  CB    . ASN A 1  517  ? 130.257 58.561  0.432   1.00 70.80  ? 517  ASN A CB    1 
ATOM   4039  C  CG    . ASN A 1  517  ? 130.169 59.832  1.224   1.00 91.01  ? 517  ASN A CG    1 
ATOM   4040  O  OD1   . ASN A 1  517  ? 129.488 60.787  0.834   1.00 84.09  ? 517  ASN A OD1   1 
ATOM   4041  N  ND2   . ASN A 1  517  ? 130.882 59.886  2.335   1.00 86.69  ? 517  ASN A ND2   1 
ATOM   4042  N  N     . LYS A 1  518  ? 128.880 56.070  2.907   1.00 73.55  ? 518  LYS A N     1 
ATOM   4043  C  CA    . LYS A 1  518  ? 129.101 55.512  4.231   1.00 72.71  ? 518  LYS A CA    1 
ATOM   4044  C  C     . LYS A 1  518  ? 128.382 54.168  4.303   1.00 78.00  ? 518  LYS A C     1 
ATOM   4045  O  O     . LYS A 1  518  ? 127.480 53.914  3.484   1.00 78.18  ? 518  LYS A O     1 
ATOM   4046  C  CB    . LYS A 1  518  ? 128.628 56.485  5.343   1.00 73.70  ? 518  LYS A CB    1 
ATOM   4047  C  CG    . LYS A 1  518  ? 127.124 56.754  5.372   1.00 72.25  ? 518  LYS A CG    1 
ATOM   4048  C  CD    . LYS A 1  518  ? 126.496 56.425  6.716   1.00 77.76  ? 518  LYS A CD    1 
ATOM   4049  C  CE    . LYS A 1  518  ? 124.973 56.378  6.688   1.00 91.32  ? 518  LYS A CE    1 
ATOM   4050  N  NZ    . LYS A 1  518  ? 124.405 55.159  6.010   1.00 101.84 ? 518  LYS A NZ    1 
ATOM   4051  N  N     . PRO A 1  519  ? 128.752 53.314  5.283   1.00 74.25  ? 519  PRO A N     1 
ATOM   4052  C  CA    . PRO A 1  519  ? 128.084 52.016  5.426   1.00 73.28  ? 519  PRO A CA    1 
ATOM   4053  C  C     . PRO A 1  519  ? 126.572 52.071  5.601   1.00 75.58  ? 519  PRO A C     1 
ATOM   4054  O  O     . PRO A 1  519  ? 126.067 52.950  6.288   1.00 76.30  ? 519  PRO A O     1 
ATOM   4055  C  CB    . PRO A 1  519  ? 128.734 51.435  6.686   1.00 75.84  ? 519  PRO A CB    1 
ATOM   4056  C  CG    . PRO A 1  519  ? 129.307 52.607  7.402   1.00 81.43  ? 519  PRO A CG    1 
ATOM   4057  C  CD    . PRO A 1  519  ? 129.795 53.476  6.313   1.00 76.71  ? 519  PRO A CD    1 
ATOM   4058  N  N     . CYS A 1  520  ? 125.866 51.099  5.018   1.00 70.36  ? 520  CYS A N     1 
ATOM   4059  C  CA    . CYS A 1  520  ? 124.413 50.958  5.122   1.00 69.89  ? 520  CYS A CA    1 
ATOM   4060  C  C     . CYS A 1  520  ? 123.986 49.769  6.025   1.00 70.52  ? 520  CYS A C     1 
ATOM   4061  O  O     . CYS A 1  520  ? 122.823 49.349  6.033   1.00 68.73  ? 520  CYS A O     1 
ATOM   4062  C  CB    . CYS A 1  520  ? 123.805 50.848  3.731   1.00 70.27  ? 520  CYS A CB    1 
ATOM   4063  S  SG    . CYS A 1  520  ? 124.264 49.341  2.858   1.00 73.77  ? 520  CYS A SG    1 
ATOM   4064  N  N     . MET A 1  521  ? 124.941 49.259  6.777   1.00 67.08  ? 521  MET A N     1 
ATOM   4065  C  CA    . MET A 1  521  ? 124.809 48.150  7.688   1.00 67.80  ? 521  MET A CA    1 
ATOM   4066  C  C     . MET A 1  521  ? 125.690 48.443  8.878   1.00 77.63  ? 521  MET A C     1 
ATOM   4067  O  O     . MET A 1  521  ? 126.868 48.798  8.708   1.00 79.12  ? 521  MET A O     1 
ATOM   4068  C  CB    . MET A 1  521  ? 125.314 46.875  7.013   1.00 69.28  ? 521  MET A CB    1 
ATOM   4069  C  CG    . MET A 1  521  ? 124.260 46.176  6.260   1.00 72.66  ? 521  MET A CG    1 
ATOM   4070  S  SD    . MET A 1  521  ? 124.951 44.966  5.132   1.00 77.10  ? 521  MET A SD    1 
ATOM   4071  C  CE    . MET A 1  521  ? 125.201 45.934  3.671   1.00 73.25  ? 521  MET A CE    1 
ATOM   4072  N  N     . GLY A 1  522  ? 125.137 48.281  10.074  1.00 74.93  ? 522  GLY A N     1 
ATOM   4073  C  CA    . GLY A 1  522  ? 125.908 48.456  11.300  1.00 74.81  ? 522  GLY A CA    1 
ATOM   4074  C  C     . GLY A 1  522  ? 125.443 47.487  12.354  1.00 76.99  ? 522  GLY A C     1 
ATOM   4075  O  O     . GLY A 1  522  ? 124.555 46.669  12.080  1.00 76.46  ? 522  GLY A O     1 
ATOM   4076  N  N     . ILE A 1  523  ? 126.006 47.600  13.570  1.00 72.52  ? 523  ILE A N     1 
ATOM   4077  C  CA    . ILE A 1  523  ? 125.573 46.787  14.710  1.00 72.21  ? 523  ILE A CA    1 
ATOM   4078  C  C     . ILE A 1  523  ? 124.261 47.411  15.254  1.00 76.79  ? 523  ILE A C     1 
ATOM   4079  O  O     . ILE A 1  523  ? 124.124 48.639  15.283  1.00 76.96  ? 523  ILE A O     1 
ATOM   4080  C  CB    . ILE A 1  523  ? 126.725 46.568  15.743  1.00 75.37  ? 523  ILE A CB    1 
ATOM   4081  C  CG1   . ILE A 1  523  ? 127.582 45.370  15.331  1.00 75.49  ? 523  ILE A CG1   1 
ATOM   4082  C  CG2   . ILE A 1  523  ? 126.227 46.325  17.162  1.00 75.54  ? 523  ILE A CG2   1 
ATOM   4083  C  CD1   . ILE A 1  523  ? 128.529 45.543  14.184  1.00 82.36  ? 523  ILE A CD1   1 
ATOM   4084  N  N     . VAL A 1  524  ? 123.280 46.566  15.603  1.00 72.80  ? 524  VAL A N     1 
ATOM   4085  C  CA    . VAL A 1  524  ? 121.940 46.986  16.031  1.00 72.54  ? 524  VAL A CA    1 
ATOM   4086  C  C     . VAL A 1  524  ? 121.395 46.306  17.308  1.00 80.20  ? 524  VAL A C     1 
ATOM   4087  O  O     . VAL A 1  524  ? 122.005 45.359  17.831  1.00 82.22  ? 524  VAL A O     1 
ATOM   4088  C  CB    . VAL A 1  524  ? 121.010 46.652  14.865  1.00 74.75  ? 524  VAL A CB    1 
ATOM   4089  C  CG1   . VAL A 1  524  ? 121.108 47.707  13.790  1.00 74.47  ? 524  VAL A CG1   1 
ATOM   4090  C  CG2   . VAL A 1  524  ? 121.325 45.263  14.300  1.00 74.01  ? 524  VAL A CG2   1 
ATOM   4091  N  N     . GLN A 1  525  ? 120.190 46.736  17.741  1.00 75.90  ? 525  GLN A N     1 
ATOM   4092  C  CA    . GLN A 1  525  ? 119.423 46.159  18.856  1.00 75.71  ? 525  GLN A CA    1 
ATOM   4093  C  C     . GLN A 1  525  ? 120.238 45.562  20.024  1.00 80.63  ? 525  GLN A C     1 
ATOM   4094  O  O     . GLN A 1  525  ? 120.983 46.317  20.656  1.00 81.85  ? 525  GLN A O     1 
ATOM   4095  C  CB    . GLN A 1  525  ? 118.343 45.189  18.341  1.00 75.72  ? 525  GLN A CB    1 
ATOM   4096  C  CG    . GLN A 1  525  ? 117.135 45.915  17.783  1.00 86.17  ? 525  GLN A CG    1 
ATOM   4097  C  CD    . GLN A 1  525  ? 115.811 45.398  18.280  1.00 106.14 ? 525  GLN A CD    1 
ATOM   4098  O  OE1   . GLN A 1  525  ? 115.669 44.236  18.693  1.00 100.31 ? 525  GLN A OE1   1 
ATOM   4099  N  NE2   . GLN A 1  525  ? 114.784 46.240  18.177  1.00 101.92 ? 525  GLN A NE2   1 
ATOM   4100  N  N     . ASP A 1  526  ? 120.102 44.231  20.309  1.00 75.18  ? 526  ASP A N     1 
ATOM   4101  C  CA    . ASP A 1  526  ? 120.799 43.557  21.402  1.00 74.94  ? 526  ASP A CA    1 
ATOM   4102  C  C     . ASP A 1  526  ? 122.266 43.824  21.364  1.00 80.94  ? 526  ASP A C     1 
ATOM   4103  O  O     . ASP A 1  526  ? 122.808 44.255  22.377  1.00 82.35  ? 526  ASP A O     1 
ATOM   4104  C  CB    . ASP A 1  526  ? 120.562 42.040  21.416  1.00 76.01  ? 526  ASP A CB    1 
ATOM   4105  C  CG    . ASP A 1  526  ? 119.185 41.625  21.875  1.00 87.36  ? 526  ASP A CG    1 
ATOM   4106  O  OD1   . ASP A 1  526  ? 118.295 42.510  21.951  1.00 87.15  ? 526  ASP A OD1   1 
ATOM   4107  O  OD2   . ASP A 1  526  ? 118.980 40.396  22.132  1.00 94.51  ? 526  ASP A OD2   1 
ATOM   4108  N  N     . THR A 1  527  ? 122.914 43.625  20.201  1.00 77.65  ? 527  THR A N     1 
ATOM   4109  C  CA    . THR A 1  527  ? 124.359 43.824  20.101  1.00 78.28  ? 527  THR A CA    1 
ATOM   4110  C  C     . THR A 1  527  ? 124.784 45.254  20.364  1.00 84.49  ? 527  THR A C     1 
ATOM   4111  O  O     . THR A 1  527  ? 125.769 45.455  21.072  1.00 84.88  ? 527  THR A O     1 
ATOM   4112  C  CB    . THR A 1  527  ? 124.966 43.162  18.881  1.00 83.21  ? 527  THR A CB    1 
ATOM   4113  O  OG1   . THR A 1  527  ? 124.187 42.022  18.522  1.00 85.33  ? 527  THR A OG1   1 
ATOM   4114  C  CG2   . THR A 1  527  ? 126.395 42.742  19.117  1.00 77.76  ? 527  THR A CG2   1 
ATOM   4115  N  N     . LEU A 1  528  ? 124.002 46.243  19.882  1.00 81.99  ? 528  LEU A N     1 
ATOM   4116  C  CA    . LEU A 1  528  ? 124.310 47.648  20.148  1.00 82.84  ? 528  LEU A CA    1 
ATOM   4117  C  C     . LEU A 1  528  ? 124.168 47.967  21.625  1.00 89.82  ? 528  LEU A C     1 
ATOM   4118  O  O     . LEU A 1  528  ? 124.996 48.691  22.173  1.00 90.56  ? 528  LEU A O     1 
ATOM   4119  C  CB    . LEU A 1  528  ? 123.472 48.618  19.301  1.00 82.13  ? 528  LEU A CB    1 
ATOM   4120  C  CG    . LEU A 1  528  ? 123.947 50.080  19.360  1.00 87.13  ? 528  LEU A CG    1 
ATOM   4121  C  CD1   . LEU A 1  528  ? 125.431 50.210  18.997  1.00 86.80  ? 528  LEU A CD1   1 
ATOM   4122  C  CD2   . LEU A 1  528  ? 123.113 50.963  18.476  1.00 90.39  ? 528  LEU A CD2   1 
ATOM   4123  N  N     . CYS A 1  529  ? 123.143 47.385  22.265  1.00 87.49  ? 529  CYS A N     1 
ATOM   4124  C  CA    . CYS A 1  529  ? 122.820 47.562  23.680  1.00 88.46  ? 529  CYS A CA    1 
ATOM   4125  C  C     . CYS A 1  529  ? 123.859 46.950  24.613  1.00 86.76  ? 529  CYS A C     1 
ATOM   4126  O  O     . CYS A 1  529  ? 124.283 47.592  25.575  1.00 86.43  ? 529  CYS A O     1 
ATOM   4127  C  CB    . CYS A 1  529  ? 121.421 47.029  23.973  1.00 90.17  ? 529  CYS A CB    1 
ATOM   4128  S  SG    . CYS A 1  529  ? 120.723 47.625  25.532  1.00 96.15  ? 529  CYS A SG    1 
ATOM   4129  N  N     . GLY A 1  530  ? 124.234 45.714  24.319  1.00 79.66  ? 530  GLY A N     1 
ATOM   4130  C  CA    . GLY A 1  530  ? 125.212 44.969  25.089  1.00 79.13  ? 530  GLY A CA    1 
ATOM   4131  C  C     . GLY A 1  530  ? 126.623 45.443  24.837  1.00 82.02  ? 530  GLY A C     1 
ATOM   4132  O  O     . GLY A 1  530  ? 127.498 45.216  25.674  1.00 82.62  ? 530  GLY A O     1 
ATOM   4133  N  N     . ILE A 1  531  ? 126.871 46.083  23.672  1.00 76.54  ? 531  ILE A N     1 
ATOM   4134  C  CA    . ILE A 1  531  ? 128.216 46.562  23.383  1.00 75.67  ? 531  ILE A CA    1 
ATOM   4135  C  C     . ILE A 1  531  ? 128.613 47.733  24.296  1.00 82.31  ? 531  ILE A C     1 
ATOM   4136  O  O     . ILE A 1  531  ? 129.764 47.782  24.733  1.00 83.98  ? 531  ILE A O     1 
ATOM   4137  C  CB    . ILE A 1  531  ? 128.597 46.675  21.879  1.00 76.45  ? 531  ILE A CB    1 
ATOM   4138  C  CG1   . ILE A 1  531  ? 130.103 46.463  21.682  1.00 75.70  ? 531  ILE A CG1   1 
ATOM   4139  C  CG2   . ILE A 1  531  ? 128.098 47.969  21.240  1.00 76.92  ? 531  ILE A CG2   1 
ATOM   4140  C  CD1   . ILE A 1  531  ? 130.532 46.155  20.365  1.00 73.05  ? 531  ILE A CD1   1 
ATOM   4141  N  N     . ARG A 1  532  ? 127.642 48.608  24.665  1.00 78.31  ? 532  ARG A N     1 
ATOM   4142  C  CA    . ARG A 1  532  ? 127.882 49.713  25.602  1.00 79.02  ? 532  ARG A CA    1 
ATOM   4143  C  C     . ARG A 1  532  ? 128.212 49.088  26.955  1.00 84.98  ? 532  ARG A C     1 
ATOM   4144  O  O     . ARG A 1  532  ? 129.328 49.248  27.473  1.00 84.33  ? 532  ARG A O     1 
ATOM   4145  C  CB    . ARG A 1  532  ? 126.639 50.610  25.737  1.00 77.55  ? 532  ARG A CB    1 
ATOM   4146  C  CG    . ARG A 1  532  ? 126.951 51.888  26.478  1.00 86.90  ? 532  ARG A CG    1 
ATOM   4147  C  CD    . ARG A 1  532  ? 125.723 52.662  26.836  1.00 97.55  ? 532  ARG A CD    1 
ATOM   4148  N  NE    . ARG A 1  532  ? 125.695 52.967  28.265  1.00 112.99 ? 532  ARG A NE    1 
ATOM   4149  C  CZ    . ARG A 1  532  ? 125.091 52.208  29.173  1.00 133.27 ? 532  ARG A CZ    1 
ATOM   4150  N  NH1   . ARG A 1  532  ? 124.467 51.091  28.807  1.00 124.76 ? 532  ARG A NH1   1 
ATOM   4151  N  NH2   . ARG A 1  532  ? 125.100 52.560  30.454  1.00 117.29 ? 532  ARG A NH2   1 
ATOM   4152  N  N     . LYS A 1  533  ? 127.235 48.300  27.462  1.00 83.14  ? 533  LYS A N     1 
ATOM   4153  C  CA    . LYS A 1  533  ? 127.231 47.539  28.710  1.00 83.98  ? 533  LYS A CA    1 
ATOM   4154  C  C     . LYS A 1  533  ? 128.516 46.748  28.893  1.00 91.33  ? 533  LYS A C     1 
ATOM   4155  O  O     . LYS A 1  533  ? 129.017 46.682  30.012  1.00 94.63  ? 533  LYS A O     1 
ATOM   4156  C  CB    . LYS A 1  533  ? 126.015 46.587  28.777  1.00 84.56  ? 533  LYS A CB    1 
ATOM   4157  C  CG    . LYS A 1  533  ? 124.657 47.278  28.894  1.00 85.90  ? 533  LYS A CG    1 
ATOM   4158  C  CD    . LYS A 1  533  ? 123.669 46.487  29.734  1.00 91.15  ? 533  LYS A CD    1 
ATOM   4159  C  CE    . LYS A 1  533  ? 124.008 46.522  31.217  1.00 105.36 ? 533  LYS A CE    1 
ATOM   4160  N  NZ    . LYS A 1  533  ? 122.949 45.885  32.048  1.00 113.85 ? 533  LYS A NZ    1 
ATOM   4161  N  N     . LEU A 1  534  ? 129.059 46.159  27.818  1.00 86.66  ? 534  LEU A N     1 
ATOM   4162  C  CA    . LEU A 1  534  ? 130.284 45.368  27.919  1.00 87.08  ? 534  LEU A CA    1 
ATOM   4163  C  C     . LEU A 1  534  ? 131.516 46.241  28.107  1.00 93.34  ? 534  LEU A C     1 
ATOM   4164  O  O     . LEU A 1  534  ? 132.434 45.852  28.830  1.00 93.11  ? 534  LEU A O     1 
ATOM   4165  C  CB    . LEU A 1  534  ? 130.439 44.473  26.666  1.00 85.84  ? 534  LEU A CB    1 
ATOM   4166  C  CG    . LEU A 1  534  ? 131.772 43.751  26.434  1.00 89.97  ? 534  LEU A CG    1 
ATOM   4167  C  CD1   . LEU A 1  534  ? 132.009 42.655  27.465  1.00 90.75  ? 534  LEU A CD1   1 
ATOM   4168  C  CD2   . LEU A 1  534  ? 131.835 43.190  25.044  1.00 89.86  ? 534  LEU A CD2   1 
ATOM   4169  N  N     . THR A 1  535  ? 131.533 47.414  27.454  1.00 91.44  ? 535  THR A N     1 
ATOM   4170  C  CA    . THR A 1  535  ? 132.705 48.280  27.412  1.00 92.34  ? 535  THR A CA    1 
ATOM   4171  C  C     . THR A 1  535  ? 132.796 49.458  28.365  1.00 98.63  ? 535  THR A C     1 
ATOM   4172  O  O     . THR A 1  535  ? 133.527 50.411  28.068  1.00 100.24 ? 535  THR A O     1 
ATOM   4173  C  CB    . THR A 1  535  ? 133.079 48.613  25.970  1.00 96.92  ? 535  THR A CB    1 
ATOM   4174  O  OG1   . THR A 1  535  ? 132.023 49.365  25.361  1.00 94.17  ? 535  THR A OG1   1 
ATOM   4175  C  CG2   . THR A 1  535  ? 133.428 47.368  25.166  1.00 92.76  ? 535  THR A CG2   1 
ATOM   4176  N  N     . LEU A 1  536  ? 132.147 49.382  29.535  1.00 94.29  ? 536  LEU A N     1 
ATOM   4177  C  CA    . LEU A 1  536  ? 132.276 50.445  30.538  1.00 94.50  ? 536  LEU A CA    1 
ATOM   4178  C  C     . LEU A 1  536  ? 133.540 50.123  31.337  1.00 102.30 ? 536  LEU A C     1 
ATOM   4179  O  O     . LEU A 1  536  ? 133.961 48.952  31.319  1.00 102.52 ? 536  LEU A O     1 
ATOM   4180  C  CB    . LEU A 1  536  ? 131.055 50.449  31.453  1.00 93.91  ? 536  LEU A CB    1 
ATOM   4181  C  CG    . LEU A 1  536  ? 129.716 50.271  30.749  1.00 96.16  ? 536  LEU A CG    1 
ATOM   4182  C  CD1   . LEU A 1  536  ? 128.755 49.555  31.614  1.00 96.32  ? 536  LEU A CD1   1 
ATOM   4183  C  CD2   . LEU A 1  536  ? 129.131 51.587  30.319  1.00 97.43  ? 536  LEU A CD2   1 
ATOM   4184  N  N     . ARG A 1  537  ? 134.179 51.132  32.006  1.00 100.46 ? 537  ARG A N     1 
ATOM   4185  C  CA    . ARG A 1  537  ? 135.395 50.849  32.817  1.00 101.00 ? 537  ARG A CA    1 
ATOM   4186  C  C     . ARG A 1  537  ? 135.078 49.836  33.923  1.00 104.91 ? 537  ARG A C     1 
ATOM   4187  O  O     . ARG A 1  537  ? 135.807 48.859  34.087  1.00 104.74 ? 537  ARG A O     1 
ATOM   4188  C  CB    . ARG A 1  537  ? 136.081 52.115  33.366  1.00 99.69  ? 537  ARG A CB    1 
ATOM   4189  C  CG    . ARG A 1  537  ? 137.165 52.633  32.435  1.00 105.01 ? 537  ARG A CG    1 
ATOM   4190  C  CD    . ARG A 1  537  ? 138.082 53.666  33.066  1.00 114.61 ? 537  ARG A CD    1 
ATOM   4191  N  NE    . ARG A 1  537  ? 137.588 55.039  32.920  1.00 124.56 ? 537  ARG A NE    1 
ATOM   4192  C  CZ    . ARG A 1  537  ? 137.856 55.843  31.892  1.00 140.15 ? 537  ARG A CZ    1 
ATOM   4193  N  NH1   . ARG A 1  537  ? 138.602 55.413  30.877  1.00 126.19 ? 537  ARG A NH1   1 
ATOM   4194  N  NH2   . ARG A 1  537  ? 137.360 57.071  31.857  1.00 128.11 ? 537  ARG A NH2   1 
ATOM   4195  N  N     . ASP A 1  538  ? 133.906 50.015  34.558  1.00 100.69 ? 538  ASP A N     1 
ATOM   4196  C  CA    . ASP A 1  538  ? 133.271 49.194  35.582  1.00 101.18 ? 538  ASP A CA    1 
ATOM   4197  C  C     . ASP A 1  538  ? 133.164 47.677  35.245  1.00 104.58 ? 538  ASP A C     1 
ATOM   4198  O  O     . ASP A 1  538  ? 133.046 46.844  36.154  1.00 104.69 ? 538  ASP A O     1 
ATOM   4199  C  CB    . ASP A 1  538  ? 131.844 49.728  35.731  1.00 103.27 ? 538  ASP A CB    1 
ATOM   4200  C  CG    . ASP A 1  538  ? 131.500 50.315  37.076  1.00 124.46 ? 538  ASP A CG    1 
ATOM   4201  O  OD1   . ASP A 1  538  ? 132.415 50.855  37.746  1.00 127.56 ? 538  ASP A OD1   1 
ATOM   4202  O  OD2   . ASP A 1  538  ? 130.305 50.277  37.447  1.00 134.66 ? 538  ASP A OD2   1 
ATOM   4203  N  N     . THR A 1  539  ? 133.138 47.337  33.938  1.00 99.47  ? 539  THR A N     1 
ATOM   4204  C  CA    . THR A 1  539  ? 132.919 45.985  33.411  1.00 97.67  ? 539  THR A CA    1 
ATOM   4205  C  C     . THR A 1  539  ? 134.189 45.120  33.298  1.00 99.16  ? 539  THR A C     1 
ATOM   4206  O  O     . THR A 1  539  ? 135.051 45.390  32.459  1.00 97.85  ? 539  THR A O     1 
ATOM   4207  C  CB    . THR A 1  539  ? 132.053 46.058  32.124  1.00 104.39 ? 539  THR A CB    1 
ATOM   4208  O  OG1   . THR A 1  539  ? 131.005 47.018  32.287  1.00 101.17 ? 539  THR A OG1   1 
ATOM   4209  C  CG2   . THR A 1  539  ? 131.430 44.728  31.757  1.00 103.95 ? 539  THR A CG2   1 
ATOM   4210  N  N     . PHE A 1  540  ? 134.269 44.058  34.133  1.00 94.93  ? 540  PHE A N     1 
ATOM   4211  C  CA    . PHE A 1  540  ? 135.393 43.112  34.175  1.00 94.20  ? 540  PHE A CA    1 
ATOM   4212  C  C     . PHE A 1  540  ? 134.928 41.698  34.042  1.00 96.04  ? 540  PHE A C     1 
ATOM   4213  O  O     . PHE A 1  540  ? 133.836 41.374  34.481  1.00 96.47  ? 540  PHE A O     1 
ATOM   4214  C  CB    . PHE A 1  540  ? 136.187 43.252  35.467  1.00 97.42  ? 540  PHE A CB    1 
ATOM   4215  C  CG    . PHE A 1  540  ? 136.788 44.620  35.649  1.00 99.52  ? 540  PHE A CG    1 
ATOM   4216  C  CD1   . PHE A 1  540  ? 138.035 44.923  35.122  1.00 101.82 ? 540  PHE A CD1   1 
ATOM   4217  C  CD2   . PHE A 1  540  ? 136.098 45.613  36.339  1.00 102.99 ? 540  PHE A CD2   1 
ATOM   4218  C  CE1   . PHE A 1  540  ? 138.578 46.196  35.276  1.00 105.80 ? 540  PHE A CE1   1 
ATOM   4219  C  CE2   . PHE A 1  540  ? 136.651 46.878  36.513  1.00 104.71 ? 540  PHE A CE2   1 
ATOM   4220  C  CZ    . PHE A 1  540  ? 137.890 47.162  35.986  1.00 104.58 ? 540  PHE A CZ    1 
ATOM   4221  N  N     . ILE A 1  541  ? 135.744 40.844  33.442  1.00 90.95  ? 541  ILE A N     1 
ATOM   4222  C  CA    . ILE A 1  541  ? 135.342 39.461  33.221  1.00 89.99  ? 541  ILE A CA    1 
ATOM   4223  C  C     . ILE A 1  541  ? 136.324 38.464  33.836  1.00 96.83  ? 541  ILE A C     1 
ATOM   4224  O  O     . ILE A 1  541  ? 137.530 38.558  33.594  1.00 96.89  ? 541  ILE A O     1 
ATOM   4225  C  CB    . ILE A 1  541  ? 135.077 39.159  31.720  1.00 90.63  ? 541  ILE A CB    1 
ATOM   4226  C  CG1   . ILE A 1  541  ? 134.424 40.306  30.973  1.00 88.81  ? 541  ILE A CG1   1 
ATOM   4227  C  CG2   . ILE A 1  541  ? 134.260 37.919  31.568  1.00 91.77  ? 541  ILE A CG2   1 
ATOM   4228  C  CD1   . ILE A 1  541  ? 135.237 40.723  29.862  1.00 90.98  ? 541  ILE A CD1   1 
ATOM   4229  N  N     . GLU A 1  542  ? 135.793 37.496  34.610  1.00 94.96  ? 542  GLU A N     1 
ATOM   4230  C  CA    . GLU A 1  542  ? 136.574 36.440  35.245  1.00 96.64  ? 542  GLU A CA    1 
ATOM   4231  C  C     . GLU A 1  542  ? 137.009 35.431  34.178  1.00 101.01 ? 542  GLU A C     1 
ATOM   4232  O  O     . GLU A 1  542  ? 136.306 35.293  33.174  1.00 99.63  ? 542  GLU A O     1 
ATOM   4233  C  CB    . GLU A 1  542  ? 135.737 35.755  36.324  1.00 99.17  ? 542  GLU A CB    1 
ATOM   4234  C  CG    . GLU A 1  542  ? 135.616 36.544  37.616  1.00 116.14 ? 542  GLU A CG    1 
ATOM   4235  C  CD    . GLU A 1  542  ? 134.623 35.958  38.601  1.00 153.38 ? 542  GLU A CD    1 
ATOM   4236  O  OE1   . GLU A 1  542  ? 133.403 36.171  38.411  1.00 151.68 ? 542  GLU A OE1   1 
ATOM   4237  O  OE2   . GLU A 1  542  ? 135.061 35.266  39.549  1.00 159.17 ? 542  GLU A OE2   1 
ATOM   4238  N  N     . LEU A 1  543  ? 138.159 34.726  34.398  1.00 98.91  ? 543  LEU A N     1 
ATOM   4239  C  CA    . LEU A 1  543  ? 138.774 33.742  33.481  1.00 98.28  ? 543  LEU A CA    1 
ATOM   4240  C  C     . LEU A 1  543  ? 137.825 32.766  32.819  1.00 101.89 ? 543  LEU A C     1 
ATOM   4241  O  O     . LEU A 1  543  ? 137.851 32.649  31.595  1.00 100.29 ? 543  LEU A O     1 
ATOM   4242  C  CB    . LEU A 1  543  ? 139.939 32.980  34.134  1.00 99.54  ? 543  LEU A CB    1 
ATOM   4243  C  CG    . LEU A 1  543  ? 140.488 31.788  33.336  1.00 103.97 ? 543  LEU A CG    1 
ATOM   4244  C  CD1   . LEU A 1  543  ? 141.597 32.204  32.433  1.00 103.66 ? 543  LEU A CD1   1 
ATOM   4245  C  CD2   . LEU A 1  543  ? 140.959 30.691  34.239  1.00 108.44 ? 543  LEU A CD2   1 
ATOM   4246  N  N     . ASP A 1  544  ? 137.028 32.042  33.629  1.00 100.41 ? 544  ASP A N     1 
ATOM   4247  C  CA    . ASP A 1  544  ? 136.036 31.038  33.199  1.00 100.50 ? 544  ASP A CA    1 
ATOM   4248  C  C     . ASP A 1  544  ? 135.245 31.474  31.954  1.00 102.06 ? 544  ASP A C     1 
ATOM   4249  O  O     . ASP A 1  544  ? 135.245 30.761  30.931  1.00 101.25 ? 544  ASP A O     1 
ATOM   4250  C  CB    . ASP A 1  544  ? 135.080 30.684  34.359  1.00 103.66 ? 544  ASP A CB    1 
ATOM   4251  C  CG    . ASP A 1  544  ? 134.718 31.873  35.228  1.00 123.59 ? 544  ASP A CG    1 
ATOM   4252  O  OD1   . ASP A 1  544  ? 134.076 32.824  34.703  1.00 123.31 ? 544  ASP A OD1   1 
ATOM   4253  O  OD2   . ASP A 1  544  ? 135.117 31.880  36.426  1.00 136.36 ? 544  ASP A OD2   1 
ATOM   4254  N  N     . GLN A 1  545  ? 134.634 32.680  32.043  1.00 95.75  ? 545  GLN A N     1 
ATOM   4255  C  CA    . GLN A 1  545  ? 133.853 33.317  30.996  1.00 93.06  ? 545  GLN A CA    1 
ATOM   4256  C  C     . GLN A 1  545  ? 134.778 33.817  29.895  1.00 93.25  ? 545  GLN A C     1 
ATOM   4257  O  O     . GLN A 1  545  ? 134.522 33.502  28.745  1.00 92.85  ? 545  GLN A O     1 
ATOM   4258  C  CB    . GLN A 1  545  ? 133.029 34.461  31.581  1.00 94.83  ? 545  GLN A CB    1 
ATOM   4259  C  CG    . GLN A 1  545  ? 131.808 34.894  30.756  1.00 110.17 ? 545  GLN A CG    1 
ATOM   4260  C  CD    . GLN A 1  545  ? 131.154 36.181  31.279  1.00 130.64 ? 545  GLN A CD    1 
ATOM   4261  O  OE1   . GLN A 1  545  ? 130.474 36.903  30.540  1.00 126.30 ? 545  GLN A OE1   1 
ATOM   4262  N  NE2   . GLN A 1  545  ? 131.329 36.514  32.565  1.00 119.48 ? 545  GLN A NE2   1 
ATOM   4263  N  N     . VAL A 1  546  ? 135.872 34.535  30.221  1.00 87.55  ? 546  VAL A N     1 
ATOM   4264  C  CA    . VAL A 1  546  ? 136.827 35.028  29.207  1.00 85.76  ? 546  VAL A CA    1 
ATOM   4265  C  C     . VAL A 1  546  ? 137.155 33.909  28.206  1.00 87.60  ? 546  VAL A C     1 
ATOM   4266  O  O     . VAL A 1  546  ? 137.056 34.117  26.997  1.00 85.43  ? 546  VAL A O     1 
ATOM   4267  C  CB    . VAL A 1  546  ? 138.109 35.643  29.837  1.00 89.98  ? 546  VAL A CB    1 
ATOM   4268  C  CG1   . VAL A 1  546  ? 139.179 35.925  28.786  1.00 88.88  ? 546  VAL A CG1   1 
ATOM   4269  C  CG2   . VAL A 1  546  ? 137.782 36.908  30.609  1.00 90.49  ? 546  VAL A CG2   1 
ATOM   4270  N  N     . LEU A 1  547  ? 137.457 32.707  28.724  1.00 84.37  ? 547  LEU A N     1 
ATOM   4271  C  CA    . LEU A 1  547  ? 137.784 31.555  27.903  1.00 83.58  ? 547  LEU A CA    1 
ATOM   4272  C  C     . LEU A 1  547  ? 136.697 31.235  26.870  1.00 87.69  ? 547  LEU A C     1 
ATOM   4273  O  O     . LEU A 1  547  ? 137.040 30.985  25.708  1.00 87.28  ? 547  LEU A O     1 
ATOM   4274  C  CB    . LEU A 1  547  ? 138.153 30.328  28.764  1.00 84.13  ? 547  LEU A CB    1 
ATOM   4275  C  CG    . LEU A 1  547  ? 139.488 30.365  29.551  1.00 88.85  ? 547  LEU A CG    1 
ATOM   4276  C  CD1   . LEU A 1  547  ? 140.000 28.961  29.814  1.00 88.95  ? 547  LEU A CD1   1 
ATOM   4277  C  CD2   . LEU A 1  547  ? 140.573 31.163  28.826  1.00 89.09  ? 547  LEU A CD2   1 
ATOM   4278  N  N     . ASN A 1  548  ? 135.392 31.289  27.277  1.00 83.74  ? 548  ASN A N     1 
ATOM   4279  C  CA    . ASN A 1  548  ? 134.236 31.021  26.387  1.00 81.57  ? 548  ASN A CA    1 
ATOM   4280  C  C     . ASN A 1  548  ? 134.049 32.143  25.389  1.00 83.91  ? 548  ASN A C     1 
ATOM   4281  O  O     . ASN A 1  548  ? 133.823 31.879  24.210  1.00 82.87  ? 548  ASN A O     1 
ATOM   4282  C  CB    . ASN A 1  548  ? 132.940 30.771  27.162  1.00 77.93  ? 548  ASN A CB    1 
ATOM   4283  C  CG    . ASN A 1  548  ? 132.942 29.481  27.923  1.00 108.91 ? 548  ASN A CG    1 
ATOM   4284  O  OD1   . ASN A 1  548  ? 133.060 28.388  27.349  1.00 104.87 ? 548  ASN A OD1   1 
ATOM   4285  N  ND2   . ASN A 1  548  ? 132.819 29.583  29.237  1.00 106.67 ? 548  ASN A ND2   1 
ATOM   4286  N  N     . MET A 1  549  ? 134.195 33.393  25.862  1.00 79.69  ? 549  MET A N     1 
ATOM   4287  C  CA    . MET A 1  549  ? 134.108 34.617  25.080  1.00 78.30  ? 549  MET A CA    1 
ATOM   4288  C  C     . MET A 1  549  ? 135.140 34.527  23.968  1.00 80.92  ? 549  MET A C     1 
ATOM   4289  O  O     . MET A 1  549  ? 134.848 34.914  22.840  1.00 80.40  ? 549  MET A O     1 
ATOM   4290  C  CB    . MET A 1  549  ? 134.444 35.807  25.972  1.00 81.55  ? 549  MET A CB    1 
ATOM   4291  C  CG    . MET A 1  549  ? 133.526 35.984  27.123  1.00 86.23  ? 549  MET A CG    1 
ATOM   4292  S  SD    . MET A 1  549  ? 132.569 37.459  26.827  1.00 91.35  ? 549  MET A SD    1 
ATOM   4293  C  CE    . MET A 1  549  ? 133.097 38.441  28.124  1.00 89.32  ? 549  MET A CE    1 
ATOM   4294  N  N     . LEU A 1  550  ? 136.329 33.962  24.284  1.00 76.46  ? 550  LEU A N     1 
ATOM   4295  C  CA    . LEU A 1  550  ? 137.424 33.773  23.346  1.00 75.66  ? 550  LEU A CA    1 
ATOM   4296  C  C     . LEU A 1  550  ? 137.124 32.682  22.331  1.00 80.57  ? 550  LEU A C     1 
ATOM   4297  O  O     . LEU A 1  550  ? 137.210 32.939  21.132  1.00 79.61  ? 550  LEU A O     1 
ATOM   4298  C  CB    . LEU A 1  550  ? 138.726 33.450  24.082  1.00 76.44  ? 550  LEU A CB    1 
ATOM   4299  C  CG    . LEU A 1  550  ? 139.458 34.582  24.776  1.00 81.16  ? 550  LEU A CG    1 
ATOM   4300  C  CD1   . LEU A 1  550  ? 140.501 34.029  25.720  1.00 82.13  ? 550  LEU A CD1   1 
ATOM   4301  C  CD2   . LEU A 1  550  ? 140.095 35.527  23.770  1.00 82.80  ? 550  LEU A CD2   1 
ATOM   4302  N  N     . TYR A 1  551  ? 136.764 31.477  22.790  1.00 79.44  ? 551  TYR A N     1 
ATOM   4303  C  CA    . TYR A 1  551  ? 136.465 30.358  21.898  1.00 80.55  ? 551  TYR A CA    1 
ATOM   4304  C  C     . TYR A 1  551  ? 135.349 30.666  20.891  1.00 85.13  ? 551  TYR A C     1 
ATOM   4305  O  O     . TYR A 1  551  ? 135.316 30.064  19.811  1.00 82.80  ? 551  TYR A O     1 
ATOM   4306  C  CB    . TYR A 1  551  ? 136.146 29.090  22.705  1.00 83.57  ? 551  TYR A CB    1 
ATOM   4307  C  CG    . TYR A 1  551  ? 136.075 27.828  21.869  1.00 86.65  ? 551  TYR A CG    1 
ATOM   4308  C  CD1   . TYR A 1  551  ? 137.029 27.561  20.891  1.00 89.36  ? 551  TYR A CD1   1 
ATOM   4309  C  CD2   . TYR A 1  551  ? 135.064 26.892  22.066  1.00 87.23  ? 551  TYR A CD2   1 
ATOM   4310  C  CE1   . TYR A 1  551  ? 136.949 26.419  20.096  1.00 91.32  ? 551  TYR A CE1   1 
ATOM   4311  C  CE2   . TYR A 1  551  ? 134.990 25.731  21.295  1.00 87.48  ? 551  TYR A CE2   1 
ATOM   4312  C  CZ    . TYR A 1  551  ? 135.931 25.504  20.305  1.00 95.44  ? 551  TYR A CZ    1 
ATOM   4313  O  OH    . TYR A 1  551  ? 135.858 24.394  19.507  1.00 94.87  ? 551  TYR A OH    1 
ATOM   4314  N  N     . TRP A 1  552  ? 134.466 31.637  21.246  1.00 83.96  ? 552  TRP A N     1 
ATOM   4315  C  CA    . TRP A 1  552  ? 133.333 32.099  20.440  1.00 83.67  ? 552  TRP A CA    1 
ATOM   4316  C  C     . TRP A 1  552  ? 133.732 32.844  19.212  1.00 87.92  ? 552  TRP A C     1 
ATOM   4317  O  O     . TRP A 1  552  ? 133.021 32.713  18.213  1.00 86.46  ? 552  TRP A O     1 
ATOM   4318  C  CB    . TRP A 1  552  ? 132.289 32.863  21.259  1.00 82.89  ? 552  TRP A CB    1 
ATOM   4319  C  CG    . TRP A 1  552  ? 131.136 31.987  21.667  1.00 83.73  ? 552  TRP A CG    1 
ATOM   4320  C  CD1   . TRP A 1  552  ? 130.938 31.398  22.882  1.00 87.31  ? 552  TRP A CD1   1 
ATOM   4321  C  CD2   . TRP A 1  552  ? 130.076 31.537  20.828  1.00 82.66  ? 552  TRP A CD2   1 
ATOM   4322  N  NE1   . TRP A 1  552  ? 129.806 30.628  22.855  1.00 86.14  ? 552  TRP A NE1   1 
ATOM   4323  C  CE2   . TRP A 1  552  ? 129.251 30.700  21.607  1.00 86.61  ? 552  TRP A CE2   1 
ATOM   4324  C  CE3   . TRP A 1  552  ? 129.719 31.792  19.497  1.00 83.39  ? 552  TRP A CE3   1 
ATOM   4325  C  CZ2   . TRP A 1  552  ? 128.103 30.095  21.095  1.00 85.73  ? 552  TRP A CZ2   1 
ATOM   4326  C  CZ3   . TRP A 1  552  ? 128.565 31.214  18.995  1.00 84.60  ? 552  TRP A CZ3   1 
ATOM   4327  C  CH2   . TRP A 1  552  ? 127.772 30.373  19.788  1.00 85.51  ? 552  TRP A CH2   1 
ATOM   4328  N  N     . VAL A 1  553  ? 134.878 33.596  19.260  1.00 86.44  ? 553  VAL A N     1 
ATOM   4329  C  CA    . VAL A 1  553  ? 135.474 34.279  18.091  1.00 86.60  ? 553  VAL A CA    1 
ATOM   4330  C  C     . VAL A 1  553  ? 136.019 33.148  17.199  1.00 92.53  ? 553  VAL A C     1 
ATOM   4331  O  O     . VAL A 1  553  ? 136.952 32.431  17.612  1.00 93.20  ? 553  VAL A O     1 
ATOM   4332  C  CB    . VAL A 1  553  ? 136.577 35.322  18.418  1.00 90.68  ? 553  VAL A CB    1 
ATOM   4333  C  CG1   . VAL A 1  553  ? 137.270 35.808  17.145  1.00 90.06  ? 553  VAL A CG1   1 
ATOM   4334  C  CG2   . VAL A 1  553  ? 136.012 36.499  19.187  1.00 90.48  ? 553  VAL A CG2   1 
ATOM   4335  N  N     . PRO A 1  554  ? 135.402 32.942  16.010  1.00 88.96  ? 554  PRO A N     1 
ATOM   4336  C  CA    . PRO A 1  554  ? 135.785 31.795  15.169  1.00 89.29  ? 554  PRO A CA    1 
ATOM   4337  C  C     . PRO A 1  554  ? 137.203 31.777  14.629  1.00 96.36  ? 554  PRO A C     1 
ATOM   4338  O  O     . PRO A 1  554  ? 137.701 30.704  14.304  1.00 96.45  ? 554  PRO A O     1 
ATOM   4339  C  CB    . PRO A 1  554  ? 134.742 31.805  14.048  1.00 89.99  ? 554  PRO A CB    1 
ATOM   4340  C  CG    . PRO A 1  554  ? 133.615 32.634  14.575  1.00 94.01  ? 554  PRO A CG    1 
ATOM   4341  C  CD    . PRO A 1  554  ? 134.263 33.670  15.423  1.00 89.78  ? 554  PRO A CD    1 
ATOM   4342  N  N     . ASP A 1  555  ? 137.844 32.945  14.543  1.00 95.26  ? 555  ASP A N     1 
ATOM   4343  C  CA    . ASP A 1  555  ? 139.194 33.074  14.012  1.00 96.30  ? 555  ASP A CA    1 
ATOM   4344  C  C     . ASP A 1  555  ? 140.147 33.548  15.102  1.00 101.18 ? 555  ASP A C     1 
ATOM   4345  O  O     . ASP A 1  555  ? 141.139 34.221  14.810  1.00 103.31 ? 555  ASP A O     1 
ATOM   4346  C  CB    . ASP A 1  555  ? 139.216 34.023  12.796  1.00 98.67  ? 555  ASP A CB    1 
ATOM   4347  C  CG    . ASP A 1  555  ? 137.863 34.254  12.142  1.00 114.70 ? 555  ASP A CG    1 
ATOM   4348  O  OD1   . ASP A 1  555  ? 137.497 33.461  11.232  1.00 117.47 ? 555  ASP A OD1   1 
ATOM   4349  O  OD2   . ASP A 1  555  ? 137.156 35.207  12.559  1.00 116.72 ? 555  ASP A OD2   1 
ATOM   4350  N  N     . TRP A 1  556  ? 139.859 33.194  16.364  1.00 95.67  ? 556  TRP A N     1 
ATOM   4351  C  CA    . TRP A 1  556  ? 140.732 33.558  17.474  1.00 95.35  ? 556  TRP A CA    1 
ATOM   4352  C  C     . TRP A 1  556  ? 142.071 32.814  17.345  1.00 98.75  ? 556  TRP A C     1 
ATOM   4353  O  O     . TRP A 1  556  ? 142.079 31.607  17.116  1.00 99.28  ? 556  TRP A O     1 
ATOM   4354  C  CB    . TRP A 1  556  ? 140.048 33.265  18.814  1.00 94.14  ? 556  TRP A CB    1 
ATOM   4355  C  CG    . TRP A 1  556  ? 140.967 33.311  20.000  1.00 96.21  ? 556  TRP A CG    1 
ATOM   4356  C  CD1   . TRP A 1  556  ? 141.737 34.362  20.407  1.00 99.77  ? 556  TRP A CD1   1 
ATOM   4357  C  CD2   . TRP A 1  556  ? 141.180 32.265  20.952  1.00 96.82  ? 556  TRP A CD2   1 
ATOM   4358  N  NE1   . TRP A 1  556  ? 142.445 34.023  21.533  1.00 100.27 ? 556  TRP A NE1   1 
ATOM   4359  C  CE2   . TRP A 1  556  ? 142.102 32.750  21.907  1.00 101.90 ? 556  TRP A CE2   1 
ATOM   4360  C  CE3   . TRP A 1  556  ? 140.660 30.968  21.106  1.00 98.00  ? 556  TRP A CE3   1 
ATOM   4361  C  CZ2   . TRP A 1  556  ? 142.498 31.990  23.015  1.00 102.41 ? 556  TRP A CZ2   1 
ATOM   4362  C  CZ3   . TRP A 1  556  ? 141.084 30.204  22.179  1.00 100.62 ? 556  TRP A CZ3   1 
ATOM   4363  C  CH2   . TRP A 1  556  ? 142.005 30.708  23.111  1.00 102.49 ? 556  TRP A CH2   1 
ATOM   4364  N  N     . ASP A 1  557  ? 143.188 33.541  17.471  1.00 94.08  ? 557  ASP A N     1 
ATOM   4365  C  CA    . ASP A 1  557  ? 144.550 33.015  17.373  1.00 94.03  ? 557  ASP A CA    1 
ATOM   4366  C  C     . ASP A 1  557  ? 144.925 31.875  18.346  1.00 97.97  ? 557  ASP A C     1 
ATOM   4367  O  O     . ASP A 1  557  ? 145.976 31.262  18.173  1.00 98.83  ? 557  ASP A O     1 
ATOM   4368  C  CB    . ASP A 1  557  ? 145.574 34.165  17.468  1.00 96.88  ? 557  ASP A CB    1 
ATOM   4369  C  CG    . ASP A 1  557  ? 145.439 35.116  18.655  1.00 111.92 ? 557  ASP A CG    1 
ATOM   4370  O  OD1   . ASP A 1  557  ? 144.745 34.761  19.638  1.00 113.82 ? 557  ASP A OD1   1 
ATOM   4371  O  OD2   . ASP A 1  557  ? 146.056 36.195  18.617  1.00 119.09 ? 557  ASP A OD2   1 
ATOM   4372  N  N     . GLY A 1  558  ? 144.091 31.601  19.346  1.00 93.70  ? 558  GLY A N     1 
ATOM   4373  C  CA    . GLY A 1  558  ? 144.362 30.554  20.329  1.00 94.03  ? 558  GLY A CA    1 
ATOM   4374  C  C     . GLY A 1  558  ? 145.259 31.050  21.446  1.00 98.50  ? 558  GLY A C     1 
ATOM   4375  O  O     . GLY A 1  558  ? 145.771 30.259  22.253  1.00 99.04  ? 558  GLY A O     1 
ATOM   4376  N  N     . VAL A 1  559  ? 145.401 32.390  21.513  1.00 94.43  ? 559  VAL A N     1 
ATOM   4377  C  CA    . VAL A 1  559  ? 146.237 33.141  22.451  1.00 94.91  ? 559  VAL A CA    1 
ATOM   4378  C  C     . VAL A 1  559  ? 145.400 33.925  23.453  1.00 98.83  ? 559  VAL A C     1 
ATOM   4379  O  O     . VAL A 1  559  ? 144.740 34.902  23.061  1.00 98.85  ? 559  VAL A O     1 
ATOM   4380  C  CB    . VAL A 1  559  ? 147.164 34.097  21.669  1.00 98.11  ? 559  VAL A CB    1 
ATOM   4381  C  CG1   . VAL A 1  559  ? 148.033 34.926  22.610  1.00 98.80  ? 559  VAL A CG1   1 
ATOM   4382  C  CG2   . VAL A 1  559  ? 148.006 33.332  20.657  1.00 97.74  ? 559  VAL A CG2   1 
ATOM   4383  N  N     . ILE A 1  560  ? 145.474 33.533  24.748  1.00 94.12  ? 560  ILE A N     1 
ATOM   4384  C  CA    . ILE A 1  560  ? 144.770 34.218  25.829  1.00 93.43  ? 560  ILE A CA    1 
ATOM   4385  C  C     . ILE A 1  560  ? 145.471 35.549  26.121  1.00 98.16  ? 560  ILE A C     1 
ATOM   4386  O  O     . ILE A 1  560  ? 146.613 35.535  26.600  1.00 98.38  ? 560  ILE A O     1 
ATOM   4387  C  CB    . ILE A 1  560  ? 144.675 33.375  27.117  1.00 97.15  ? 560  ILE A CB    1 
ATOM   4388  C  CG1   . ILE A 1  560  ? 144.123 31.975  26.853  1.00 97.24  ? 560  ILE A CG1   1 
ATOM   4389  C  CG2   . ILE A 1  560  ? 143.870 34.122  28.189  1.00 98.22  ? 560  ILE A CG2   1 
ATOM   4390  C  CD1   . ILE A 1  560  ? 144.344 30.962  28.041  1.00 107.68 ? 560  ILE A CD1   1 
ATOM   4391  N  N     . PRO A 1  561  ? 144.805 36.708  25.899  1.00 95.02  ? 561  PRO A N     1 
ATOM   4392  C  CA    . PRO A 1  561  ? 145.456 37.987  26.228  1.00 95.87  ? 561  PRO A CA    1 
ATOM   4393  C  C     . PRO A 1  561  ? 145.731 38.118  27.728  1.00 101.35 ? 561  PRO A C     1 
ATOM   4394  O  O     . PRO A 1  561  ? 145.053 37.489  28.551  1.00 100.32 ? 561  PRO A O     1 
ATOM   4395  C  CB    . PRO A 1  561  ? 144.470 39.042  25.716  1.00 96.67  ? 561  PRO A CB    1 
ATOM   4396  C  CG    . PRO A 1  561  ? 143.170 38.359  25.652  1.00 100.10 ? 561  PRO A CG    1 
ATOM   4397  C  CD    . PRO A 1  561  ? 143.449 36.921  25.352  1.00 95.38  ? 561  PRO A CD    1 
ATOM   4398  N  N     . THR A 1  562  ? 146.766 38.892  28.075  1.00 99.58  ? 562  THR A N     1 
ATOM   4399  C  CA    . THR A 1  562  ? 147.141 39.075  29.474  1.00 100.73 ? 562  THR A CA    1 
ATOM   4400  C  C     . THR A 1  562  ? 146.084 39.958  30.150  1.00 102.49 ? 562  THR A C     1 
ATOM   4401  O  O     . THR A 1  562  ? 145.746 40.981  29.547  1.00 101.30 ? 562  THR A O     1 
ATOM   4402  C  CB    . THR A 1  562  ? 148.601 39.554  29.589  1.00 111.10 ? 562  THR A CB    1 
ATOM   4403  O  OG1   . THR A 1  562  ? 149.446 38.644  28.874  1.00 111.97 ? 562  THR A OG1   1 
ATOM   4404  C  CG2   . THR A 1  562  ? 149.083 39.641  31.036  1.00 110.28 ? 562  THR A CG2   1 
ATOM   4405  N  N     . PRO A 1  563  ? 145.504 39.550  31.332  1.00 97.80  ? 563  PRO A N     1 
ATOM   4406  C  CA    . PRO A 1  563  ? 144.460 40.376  31.970  1.00 96.86  ? 563  PRO A CA    1 
ATOM   4407  C  C     . PRO A 1  563  ? 144.960 41.753  32.361  1.00 100.41 ? 563  PRO A C     1 
ATOM   4408  O  O     . PRO A 1  563  ? 146.128 41.900  32.730  1.00 100.68 ? 563  PRO A O     1 
ATOM   4409  C  CB    . PRO A 1  563  ? 144.068 39.570  33.219  1.00 99.18  ? 563  PRO A CB    1 
ATOM   4410  C  CG    . PRO A 1  563  ? 145.217 38.690  33.494  1.00 104.37 ? 563  PRO A CG    1 
ATOM   4411  C  CD    . PRO A 1  563  ? 145.786 38.347  32.147  1.00 99.51  ? 563  PRO A CD    1 
ATOM   4412  N  N     . ALA A 1  564  ? 144.070 42.759  32.288  1.00 95.86  ? 564  ALA A N     1 
ATOM   4413  C  CA    . ALA A 1  564  ? 144.398 44.129  32.670  1.00 95.75  ? 564  ALA A CA    1 
ATOM   4414  C  C     . ALA A 1  564  ? 144.688 44.196  34.162  1.00 100.53 ? 564  ALA A C     1 
ATOM   4415  O  O     . ALA A 1  564  ? 145.255 45.173  34.616  1.00 101.85 ? 564  ALA A O     1 
ATOM   4416  C  CB    . ALA A 1  564  ? 143.269 45.067  32.302  1.00 95.69  ? 564  ALA A CB    1 
ATOM   4417  N  N     . ILE A 1  565  ? 144.326 43.144  34.917  1.00 96.84  ? 565  ILE A N     1 
ATOM   4418  C  CA    . ILE A 1  565  ? 144.605 42.993  36.342  1.00 97.89  ? 565  ILE A CA    1 
ATOM   4419  C  C     . ILE A 1  565  ? 145.101 41.569  36.572  1.00 105.72 ? 565  ILE A C     1 
ATOM   4420  O  O     . ILE A 1  565  ? 144.331 40.621  36.372  1.00 104.43 ? 565  ILE A O     1 
ATOM   4421  C  CB    . ILE A 1  565  ? 143.384 43.313  37.256  1.00 99.94  ? 565  ILE A CB    1 
ATOM   4422  C  CG1   . ILE A 1  565  ? 142.897 44.756  37.098  1.00 99.25  ? 565  ILE A CG1   1 
ATOM   4423  C  CG2   . ILE A 1  565  ? 143.700 43.014  38.718  1.00 101.34 ? 565  ILE A CG2   1 
ATOM   4424  C  CD1   . ILE A 1  565  ? 141.663 44.848  36.383  1.00 100.58 ? 565  ILE A CD1   1 
ATOM   4425  N  N     . ILE A 1  566  ? 146.390 41.423  36.971  1.00 106.07 ? 566  ILE A N     1 
ATOM   4426  C  CA    . ILE A 1  566  ? 147.017 40.144  37.359  1.00 107.66 ? 566  ILE A CA    1 
ATOM   4427  C  C     . ILE A 1  566  ? 147.218 40.343  38.823  1.00 116.77 ? 566  ILE A C     1 
ATOM   4428  O  O     . ILE A 1  566  ? 148.100 41.116  39.186  1.00 118.26 ? 566  ILE A O     1 
ATOM   4429  C  CB    . ILE A 1  566  ? 148.407 39.838  36.729  1.00 110.48 ? 566  ILE A CB    1 
ATOM   4430  C  CG1   . ILE A 1  566  ? 148.579 40.355  35.297  1.00 109.08 ? 566  ILE A CG1   1 
ATOM   4431  C  CG2   . ILE A 1  566  ? 148.797 38.360  36.918  1.00 111.47 ? 566  ILE A CG2   1 
ATOM   4432  C  CD1   . ILE A 1  566  ? 149.450 41.543  35.247  1.00 115.00 ? 566  ILE A CD1   1 
ATOM   4433  N  N     . LYS A 1  567  ? 146.409 39.708  39.668  1.00 115.56 ? 567  LYS A N     1 
ATOM   4434  C  CA    . LYS A 1  567  ? 146.494 39.897  41.126  1.00 118.01 ? 567  LYS A CA    1 
ATOM   4435  C  C     . LYS A 1  567  ? 146.170 41.330  41.682  1.00 120.25 ? 567  LYS A C     1 
ATOM   4436  O  O     . LYS A 1  567  ? 146.665 42.347  41.191  1.00 118.78 ? 567  LYS A O     1 
ATOM   4437  C  CB    . LYS A 1  567  ? 147.720 39.215  41.787  1.00 123.58 ? 567  LYS A CB    1 
ATOM   4438  C  CG    . LYS A 1  567  ? 147.546 37.692  41.980  1.00 146.93 ? 567  LYS A CG    1 
ATOM   4439  C  CD    . LYS A 1  567  ? 148.071 36.838  40.799  1.00 154.92 ? 567  LYS A CD    1 
ATOM   4440  C  CE    . LYS A 1  567  ? 148.339 35.410  41.234  1.00 161.07 ? 567  LYS A CE    1 
ATOM   4441  N  NZ    . LYS A 1  567  ? 149.132 34.646  40.230  1.00 167.62 ? 567  LYS A NZ    1 
ATOM   4442  N  N     . PRO A 1  568  ? 145.289 41.419  42.691  1.00 116.63 ? 568  PRO A N     1 
ATOM   4443  C  CA    . PRO A 1  568  ? 144.557 40.315  43.344  1.00 116.96 ? 568  PRO A CA    1 
ATOM   4444  C  C     . PRO A 1  568  ? 143.547 39.729  42.341  1.00 121.82 ? 568  PRO A C     1 
ATOM   4445  O  O     . PRO A 1  568  ? 142.766 40.505  41.789  1.00 123.47 ? 568  PRO A O     1 
ATOM   4446  C  CB    . PRO A 1  568  ? 143.930 41.011  44.551  1.00 119.34 ? 568  PRO A CB    1 
ATOM   4447  C  CG    . PRO A 1  568  ? 143.724 42.432  44.112  1.00 122.78 ? 568  PRO A CG    1 
ATOM   4448  C  CD    . PRO A 1  568  ? 144.890 42.737  43.219  1.00 117.93 ? 568  PRO A CD    1 
ATOM   4449  N  N     . LYS A 1  569  ? 143.642 38.419  41.984  1.00 115.38 ? 569  LYS A N     1 
ATOM   4450  C  CA    . LYS A 1  569  ? 142.774 37.776  40.963  1.00 112.29 ? 569  LYS A CA    1 
ATOM   4451  C  C     . LYS A 1  569  ? 142.865 38.290  39.488  1.00 111.75 ? 569  LYS A C     1 
ATOM   4452  O  O     . LYS A 1  569  ? 142.795 39.491  39.229  1.00 109.13 ? 569  LYS A O     1 
ATOM   4453  C  CB    . LYS A 1  569  ? 141.313 37.553  41.446  1.00 114.01 ? 569  LYS A CB    1 
ATOM   4454  C  CG    . LYS A 1  569  ? 140.229 38.444  40.816  1.00 114.79 ? 569  LYS A CG    1 
ATOM   4455  C  CD    . LYS A 1  569  ? 138.828 38.088  41.309  1.00 119.59 ? 569  LYS A CD    1 
ATOM   4456  C  CE    . LYS A 1  569  ? 138.176 37.006  40.477  1.00 128.72 ? 569  LYS A CE    1 
ATOM   4457  N  NZ    . LYS A 1  569  ? 136.913 36.523  41.091  1.00 137.99 ? 569  LYS A NZ    1 
ATOM   4458  N  N     . PRO A 1  570  ? 142.973 37.382  38.498  1.00 108.39 ? 570  PRO A N     1 
ATOM   4459  C  CA    . PRO A 1  570  ? 143.024 37.839  37.106  1.00 107.14 ? 570  PRO A CA    1 
ATOM   4460  C  C     . PRO A 1  570  ? 141.653 38.282  36.621  1.00 109.46 ? 570  PRO A C     1 
ATOM   4461  O  O     . PRO A 1  570  ? 140.672 37.531  36.704  1.00 109.49 ? 570  PRO A O     1 
ATOM   4462  C  CB    . PRO A 1  570  ? 143.534 36.617  36.346  1.00 108.45 ? 570  PRO A CB    1 
ATOM   4463  C  CG    . PRO A 1  570  ? 143.058 35.456  37.146  1.00 113.39 ? 570  PRO A CG    1 
ATOM   4464  C  CD    . PRO A 1  570  ? 143.044 35.907  38.583  1.00 110.45 ? 570  PRO A CD    1 
ATOM   4465  N  N     . LEU A 1  571  ? 141.591 39.512  36.139  1.00 103.51 ? 571  LEU A N     1 
ATOM   4466  C  CA    . LEU A 1  571  ? 140.355 40.076  35.643  1.00 101.54 ? 571  LEU A CA    1 
ATOM   4467  C  C     . LEU A 1  571  ? 140.652 40.813  34.352  1.00 106.13 ? 571  LEU A C     1 
ATOM   4468  O  O     . LEU A 1  571  ? 141.547 41.664  34.330  1.00 108.11 ? 571  LEU A O     1 
ATOM   4469  C  CB    . LEU A 1  571  ? 139.781 41.028  36.705  1.00 101.84 ? 571  LEU A CB    1 
ATOM   4470  C  CG    . LEU A 1  571  ? 138.429 40.702  37.357  1.00 105.49 ? 571  LEU A CG    1 
ATOM   4471  C  CD1   . LEU A 1  571  ? 138.045 39.251  37.229  1.00 104.91 ? 571  LEU A CD1   1 
ATOM   4472  C  CD2   . LEU A 1  571  ? 138.427 41.096  38.816  1.00 108.57 ? 571  LEU A CD2   1 
ATOM   4473  N  N     . TRP A 1  572  ? 139.947 40.456  33.263  1.00 99.53  ? 572  TRP A N     1 
ATOM   4474  C  CA    . TRP A 1  572  ? 140.085 41.102  31.957  1.00 97.14  ? 572  TRP A CA    1 
ATOM   4475  C  C     . TRP A 1  572  ? 138.980 42.123  31.861  1.00 99.36  ? 572  TRP A C     1 
ATOM   4476  O  O     . TRP A 1  572  ? 137.938 41.943  32.489  1.00 98.89  ? 572  TRP A O     1 
ATOM   4477  C  CB    . TRP A 1  572  ? 139.886 40.090  30.834  1.00 94.41  ? 572  TRP A CB    1 
ATOM   4478  C  CG    . TRP A 1  572  ? 140.988 39.096  30.686  1.00 95.46  ? 572  TRP A CG    1 
ATOM   4479  C  CD1   . TRP A 1  572  ? 141.884 39.018  29.662  1.00 97.97  ? 572  TRP A CD1   1 
ATOM   4480  C  CD2   . TRP A 1  572  ? 141.254 37.979  31.539  1.00 96.08  ? 572  TRP A CD2   1 
ATOM   4481  N  NE1   . TRP A 1  572  ? 142.718 37.943  29.844  1.00 97.98  ? 572  TRP A NE1   1 
ATOM   4482  C  CE2   . TRP A 1  572  ? 142.343 37.276  30.981  1.00 100.25 ? 572  TRP A CE2   1 
ATOM   4483  C  CE3   . TRP A 1  572  ? 140.694 37.515  32.742  1.00 98.11  ? 572  TRP A CE3   1 
ATOM   4484  C  CZ2   . TRP A 1  572  ? 142.884 36.133  31.584  1.00 100.50 ? 572  TRP A CZ2   1 
ATOM   4485  C  CZ3   . TRP A 1  572  ? 141.239 36.393  33.345  1.00 100.48 ? 572  TRP A CZ3   1 
ATOM   4486  C  CH2   . TRP A 1  572  ? 142.318 35.713  32.769  1.00 101.21 ? 572  TRP A CH2   1 
ATOM   4487  N  N     . SER A 1  573  ? 139.179 43.180  31.079  1.00 95.28  ? 573  SER A N     1 
ATOM   4488  C  CA    . SER A 1  573  ? 138.134 44.186  30.912  1.00 95.02  ? 573  SER A CA    1 
ATOM   4489  C  C     . SER A 1  573  ? 137.310 43.880  29.650  1.00 98.60  ? 573  SER A C     1 
ATOM   4490  O  O     . SER A 1  573  ? 137.757 43.089  28.804  1.00 99.05  ? 573  SER A O     1 
ATOM   4491  C  CB    . SER A 1  573  ? 138.742 45.580  30.826  1.00 98.77  ? 573  SER A CB    1 
ATOM   4492  O  OG    . SER A 1  573  ? 139.344 45.790  29.560  1.00 105.75 ? 573  SER A OG    1 
ATOM   4493  N  N     . GLY A 1  574  ? 136.126 44.496  29.538  1.00 92.86  ? 574  GLY A N     1 
ATOM   4494  C  CA    . GLY A 1  574  ? 135.250 44.329  28.382  1.00 90.09  ? 574  GLY A CA    1 
ATOM   4495  C  C     . GLY A 1  574  ? 135.980 44.706  27.117  1.00 89.86  ? 574  GLY A C     1 
ATOM   4496  O  O     . GLY A 1  574  ? 136.167 43.865  26.225  1.00 87.39  ? 574  GLY A O     1 
ATOM   4497  N  N     . LYS A 1  575  ? 136.494 45.957  27.117  1.00 85.73  ? 575  LYS A N     1 
ATOM   4498  C  CA    . LYS A 1  575  ? 137.299 46.578  26.062  1.00 84.79  ? 575  LYS A CA    1 
ATOM   4499  C  C     . LYS A 1  575  ? 138.337 45.585  25.525  1.00 88.53  ? 575  LYS A C     1 
ATOM   4500  O  O     . LYS A 1  575  ? 138.307 45.245  24.340  1.00 88.22  ? 575  LYS A O     1 
ATOM   4501  C  CB    . LYS A 1  575  ? 138.000 47.852  26.586  1.00 87.12  ? 575  LYS A CB    1 
ATOM   4502  C  CG    . LYS A 1  575  ? 137.052 48.923  27.105  1.00 88.48  ? 575  LYS A CG    1 
ATOM   4503  C  CD    . LYS A 1  575  ? 137.672 50.293  26.973  1.00 91.59  ? 575  LYS A CD    1 
ATOM   4504  C  CE    . LYS A 1  575  ? 136.703 51.406  27.273  1.00 103.32 ? 575  LYS A CE    1 
ATOM   4505  N  NZ    . LYS A 1  575  ? 136.343 51.470  28.713  1.00 119.23 ? 575  LYS A NZ    1 
ATOM   4506  N  N     . GLN A 1  576  ? 139.186 45.064  26.425  1.00 84.23  ? 576  GLN A N     1 
ATOM   4507  C  CA    . GLN A 1  576  ? 140.236 44.078  26.167  1.00 83.23  ? 576  GLN A CA    1 
ATOM   4508  C  C     . GLN A 1  576  ? 139.732 42.882  25.336  1.00 85.51  ? 576  GLN A C     1 
ATOM   4509  O  O     . GLN A 1  576  ? 140.291 42.572  24.269  1.00 84.47  ? 576  GLN A O     1 
ATOM   4510  C  CB    . GLN A 1  576  ? 140.778 43.598  27.520  1.00 85.06  ? 576  GLN A CB    1 
ATOM   4511  C  CG    . GLN A 1  576  ? 142.011 42.721  27.490  1.00 87.46  ? 576  GLN A CG    1 
ATOM   4512  C  CD    . GLN A 1  576  ? 142.739 42.817  28.818  1.00 107.59 ? 576  GLN A CD    1 
ATOM   4513  O  OE1   . GLN A 1  576  ? 142.143 42.938  29.913  1.00 94.85  ? 576  GLN A OE1   1 
ATOM   4514  N  NE2   . GLN A 1  576  ? 144.063 42.796  28.741  1.00 108.69 ? 576  GLN A NE2   1 
ATOM   4515  N  N     . ILE A 1  577  ? 138.661 42.236  25.804  1.00 80.77  ? 577  ILE A N     1 
ATOM   4516  C  CA    . ILE A 1  577  ? 138.198 41.055  25.099  1.00 79.18  ? 577  ILE A CA    1 
ATOM   4517  C  C     . ILE A 1  577  ? 137.361 41.327  23.837  1.00 81.25  ? 577  ILE A C     1 
ATOM   4518  O  O     . ILE A 1  577  ? 137.328 40.477  22.937  1.00 80.57  ? 577  ILE A O     1 
ATOM   4519  C  CB    . ILE A 1  577  ? 137.718 39.901  26.015  1.00 82.06  ? 577  ILE A CB    1 
ATOM   4520  C  CG1   . ILE A 1  577  ? 136.220 39.961  26.280  1.00 81.56  ? 577  ILE A CG1   1 
ATOM   4521  C  CG2   . ILE A 1  577  ? 138.575 39.755  27.302  1.00 83.10  ? 577  ILE A CG2   1 
ATOM   4522  C  CD1   . ILE A 1  577  ? 135.515 39.028  25.434  1.00 81.78  ? 577  ILE A CD1   1 
ATOM   4523  N  N     . LEU A 1  578  ? 136.715 42.507  23.745  1.00 75.85  ? 578  LEU A N     1 
ATOM   4524  C  CA    . LEU A 1  578  ? 135.995 42.865  22.518  1.00 73.53  ? 578  LEU A CA    1 
ATOM   4525  C  C     . LEU A 1  578  ? 137.064 43.074  21.411  1.00 79.55  ? 578  LEU A C     1 
ATOM   4526  O  O     . LEU A 1  578  ? 136.881 42.641  20.270  1.00 77.50  ? 578  LEU A O     1 
ATOM   4527  C  CB    . LEU A 1  578  ? 135.148 44.141  22.727  1.00 72.43  ? 578  LEU A CB    1 
ATOM   4528  C  CG    . LEU A 1  578  ? 134.729 44.932  21.473  1.00 74.51  ? 578  LEU A CG    1 
ATOM   4529  C  CD1   . LEU A 1  578  ? 133.688 44.205  20.661  1.00 73.55  ? 578  LEU A CD1   1 
ATOM   4530  C  CD2   . LEU A 1  578  ? 134.163 46.244  21.835  1.00 75.18  ? 578  LEU A CD2   1 
ATOM   4531  N  N     . SER A 1  579  ? 138.215 43.663  21.802  1.00 78.68  ? 579  SER A N     1 
ATOM   4532  C  CA    . SER A 1  579  ? 139.348 43.969  20.938  1.00 79.35  ? 579  SER A CA    1 
ATOM   4533  C  C     . SER A 1  579  ? 139.946 42.759  20.204  1.00 84.80  ? 579  SER A C     1 
ATOM   4534  O  O     . SER A 1  579  ? 140.659 42.918  19.193  1.00 83.83  ? 579  SER A O     1 
ATOM   4535  C  CB    . SER A 1  579  ? 140.397 44.743  21.717  1.00 84.47  ? 579  SER A CB    1 
ATOM   4536  O  OG    . SER A 1  579  ? 139.823 45.946  22.205  1.00 94.20  ? 579  SER A OG    1 
ATOM   4537  N  N     . VAL A 1  580  ? 139.595 41.546  20.685  1.00 82.52  ? 580  VAL A N     1 
ATOM   4538  C  CA    . VAL A 1  580  ? 139.981 40.269  20.078  1.00 81.99  ? 580  VAL A CA    1 
ATOM   4539  C  C     . VAL A 1  580  ? 139.247 40.166  18.731  1.00 87.29  ? 580  VAL A C     1 
ATOM   4540  O  O     . VAL A 1  580  ? 139.811 39.629  17.780  1.00 87.63  ? 580  VAL A O     1 
ATOM   4541  C  CB    . VAL A 1  580  ? 139.740 39.046  21.012  1.00 84.96  ? 580  VAL A CB    1 
ATOM   4542  C  CG1   . VAL A 1  580  ? 140.170 37.745  20.350  1.00 83.85  ? 580  VAL A CG1   1 
ATOM   4543  C  CG2   . VAL A 1  580  ? 140.462 39.219  22.350  1.00 85.87  ? 580  VAL A CG2   1 
ATOM   4544  N  N     . ALA A 1  581  ? 138.032 40.751  18.622  1.00 84.27  ? 581  ALA A N     1 
ATOM   4545  C  CA    . ALA A 1  581  ? 137.298 40.743  17.348  1.00 83.64  ? 581  ALA A CA    1 
ATOM   4546  C  C     . ALA A 1  581  ? 137.834 41.791  16.375  1.00 87.39  ? 581  ALA A C     1 
ATOM   4547  O  O     . ALA A 1  581  ? 137.753 41.559  15.160  1.00 87.25  ? 581  ALA A O     1 
ATOM   4548  C  CB    . ALA A 1  581  ? 135.800 40.944  17.562  1.00 84.02  ? 581  ALA A CB    1 
ATOM   4549  N  N     . ILE A 1  582  ? 138.356 42.948  16.900  1.00 82.59  ? 582  ILE A N     1 
ATOM   4550  C  CA    . ILE A 1  582  ? 138.888 44.043  16.072  1.00 81.19  ? 582  ILE A CA    1 
ATOM   4551  C  C     . ILE A 1  582  ? 140.234 43.626  15.502  1.00 87.58  ? 582  ILE A C     1 
ATOM   4552  O  O     . ILE A 1  582  ? 141.177 43.381  16.278  1.00 87.89  ? 582  ILE A O     1 
ATOM   4553  C  CB    . ILE A 1  582  ? 138.903 45.453  16.732  1.00 83.67  ? 582  ILE A CB    1 
ATOM   4554  C  CG1   . ILE A 1  582  ? 137.573 45.782  17.416  1.00 82.93  ? 582  ILE A CG1   1 
ATOM   4555  C  CG2   . ILE A 1  582  ? 139.203 46.521  15.697  1.00 83.54  ? 582  ILE A CG2   1 
ATOM   4556  C  CD1   . ILE A 1  582  ? 137.712 46.518  18.650  1.00 85.65  ? 582  ILE A CD1   1 
ATOM   4557  N  N     . PRO A 1  583  ? 140.298 43.493  14.141  1.00 85.70  ? 583  PRO A N     1 
ATOM   4558  C  CA    . PRO A 1  583  ? 141.540 43.020  13.489  1.00 86.63  ? 583  PRO A CA    1 
ATOM   4559  C  C     . PRO A 1  583  ? 142.714 43.983  13.539  1.00 95.03  ? 583  PRO A C     1 
ATOM   4560  O  O     . PRO A 1  583  ? 142.531 45.196  13.646  1.00 95.31  ? 583  PRO A O     1 
ATOM   4561  C  CB    . PRO A 1  583  ? 141.109 42.747  12.045  1.00 86.95  ? 583  PRO A CB    1 
ATOM   4562  C  CG    . PRO A 1  583  ? 139.942 43.633  11.828  1.00 90.37  ? 583  PRO A CG    1 
ATOM   4563  C  CD    . PRO A 1  583  ? 139.228 43.728  13.144  1.00 86.11  ? 583  PRO A CD    1 
ATOM   4564  N  N     . ASN A 1  584  ? 143.928 43.433  13.429  1.00 94.22  ? 584  ASN A N     1 
ATOM   4565  C  CA    . ASN A 1  584  ? 145.154 44.219  13.457  1.00 95.66  ? 584  ASN A CA    1 
ATOM   4566  C  C     . ASN A 1  584  ? 145.231 45.254  12.334  1.00 101.33 ? 584  ASN A C     1 
ATOM   4567  O  O     . ASN A 1  584  ? 144.566 45.095  11.300  1.00 100.50 ? 584  ASN A O     1 
ATOM   4568  C  CB    . ASN A 1  584  ? 146.359 43.297  13.511  1.00 95.59  ? 584  ASN A CB    1 
ATOM   4569  C  CG    . ASN A 1  584  ? 146.507 42.699  14.883  1.00 132.38 ? 584  ASN A CG    1 
ATOM   4570  O  OD1   . ASN A 1  584  ? 145.525 42.490  15.619  1.00 130.29 ? 584  ASN A OD1   1 
ATOM   4571  N  ND2   . ASN A 1  584  ? 147.745 42.493  15.295  1.00 129.90 ? 584  ASN A ND2   1 
ATOM   4572  N  N     . GLY A 1  585  ? 145.953 46.343  12.594  1.00 98.94  ? 585  GLY A N     1 
ATOM   4573  C  CA    . GLY A 1  585  ? 146.128 47.426  11.634  1.00 99.25  ? 585  GLY A CA    1 
ATOM   4574  C  C     . GLY A 1  585  ? 144.916 48.317  11.451  1.00 103.85 ? 585  GLY A C     1 
ATOM   4575  O  O     . GLY A 1  585  ? 144.782 49.010  10.429  1.00 103.61 ? 585  GLY A O     1 
ATOM   4576  N  N     . ILE A 1  586  ? 144.025 48.296  12.445  1.00 99.90  ? 586  ILE A N     1 
ATOM   4577  C  CA    . ILE A 1  586  ? 142.846 49.136  12.437  1.00 98.47  ? 586  ILE A CA    1 
ATOM   4578  C  C     . ILE A 1  586  ? 143.123 50.292  13.373  1.00 105.54 ? 586  ILE A C     1 
ATOM   4579  O  O     . ILE A 1  586  ? 143.396 50.092  14.560  1.00 105.48 ? 586  ILE A O     1 
ATOM   4580  C  CB    . ILE A 1  586  ? 141.564 48.333  12.754  1.00 99.39  ? 586  ILE A CB    1 
ATOM   4581  C  CG1   . ILE A 1  586  ? 141.177 47.399  11.578  1.00 97.36  ? 586  ILE A CG1   1 
ATOM   4582  C  CG2   . ILE A 1  586  ? 140.408 49.239  13.179  1.00 99.91  ? 586  ILE A CG2   1 
ATOM   4583  C  CD1   . ILE A 1  586  ? 140.916 48.040  10.211  1.00 96.10  ? 586  ILE A CD1   1 
ATOM   4584  N  N     . HIS A 1  587  ? 143.156 51.491  12.813  1.00 104.40 ? 587  HIS A N     1 
ATOM   4585  C  CA    . HIS A 1  587  ? 143.411 52.659  13.628  1.00 106.23 ? 587  HIS A CA    1 
ATOM   4586  C  C     . HIS A 1  587  ? 142.219 53.595  13.579  1.00 105.45 ? 587  HIS A C     1 
ATOM   4587  O  O     . HIS A 1  587  ? 141.787 54.024  12.503  1.00 103.27 ? 587  HIS A O     1 
ATOM   4588  C  CB    . HIS A 1  587  ? 144.746 53.352  13.276  1.00 109.45 ? 587  HIS A CB    1 
ATOM   4589  C  CG    . HIS A 1  587  ? 145.192 54.339  14.321  1.00 115.20 ? 587  HIS A CG    1 
ATOM   4590  N  ND1   . HIS A 1  587  ? 144.560 55.574  14.480  1.00 117.67 ? 587  HIS A ND1   1 
ATOM   4591  C  CD2   . HIS A 1  587  ? 146.171 54.234  15.250  1.00 118.86 ? 587  HIS A CD2   1 
ATOM   4592  C  CE1   . HIS A 1  587  ? 145.173 56.169  15.493  1.00 118.44 ? 587  HIS A CE1   1 
ATOM   4593  N  NE2   . HIS A 1  587  ? 146.150 55.407  15.989  1.00 119.48 ? 587  HIS A NE2   1 
ATOM   4594  N  N     . LEU A 1  588  ? 141.684 53.893  14.763  1.00 100.59 ? 588  LEU A N     1 
ATOM   4595  C  CA    . LEU A 1  588  ? 140.524 54.750  14.915  1.00 99.47  ? 588  LEU A CA    1 
ATOM   4596  C  C     . LEU A 1  588  ? 140.663 55.723  16.088  1.00 104.52 ? 588  LEU A C     1 
ATOM   4597  O  O     . LEU A 1  588  ? 140.981 55.314  17.206  1.00 105.24 ? 588  LEU A O     1 
ATOM   4598  C  CB    . LEU A 1  588  ? 139.275 53.874  15.057  1.00 98.19  ? 588  LEU A CB    1 
ATOM   4599  C  CG    . LEU A 1  588  ? 137.933 54.544  14.976  1.00 101.34 ? 588  LEU A CG    1 
ATOM   4600  C  CD1   . LEU A 1  588  ? 137.831 55.403  13.760  1.00 101.35 ? 588  LEU A CD1   1 
ATOM   4601  C  CD2   . LEU A 1  588  ? 136.865 53.522  14.894  1.00 102.43 ? 588  LEU A CD2   1 
ATOM   4602  N  N     . GLN A 1  589  ? 140.443 57.012  15.808  1.00 100.24 ? 589  GLN A N     1 
ATOM   4603  C  CA    . GLN A 1  589  ? 140.502 58.099  16.778  1.00 100.83 ? 589  GLN A CA    1 
ATOM   4604  C  C     . GLN A 1  589  ? 139.223 58.891  16.663  1.00 104.08 ? 589  GLN A C     1 
ATOM   4605  O  O     . GLN A 1  589  ? 138.775 59.117  15.536  1.00 104.31 ? 589  GLN A O     1 
ATOM   4606  C  CB    . GLN A 1  589  ? 141.651 59.044  16.425  1.00 103.13 ? 589  GLN A CB    1 
ATOM   4607  C  CG    . GLN A 1  589  ? 142.991 58.673  17.030  1.00 124.83 ? 589  GLN A CG    1 
ATOM   4608  C  CD    . GLN A 1  589  ? 143.742 59.885  17.545  1.00 139.48 ? 589  GLN A CD    1 
ATOM   4609  O  OE1   . GLN A 1  589  ? 143.146 60.925  17.893  1.00 127.98 ? 589  GLN A OE1   1 
ATOM   4610  N  NE2   . GLN A 1  589  ? 145.072 59.757  17.638  1.00 131.24 ? 589  GLN A NE2   1 
ATOM   4611  N  N     . ARG A 1  590  ? 138.648 59.346  17.799  1.00 99.43  ? 590  ARG A N     1 
ATOM   4612  C  CA    . ARG A 1  590  ? 137.442 60.196  17.826  1.00 98.58  ? 590  ARG A CA    1 
ATOM   4613  C  C     . ARG A 1  590  ? 137.342 61.005  19.105  1.00 107.12 ? 590  ARG A C     1 
ATOM   4614  O  O     . ARG A 1  590  ? 137.436 60.441  20.201  1.00 108.04 ? 590  ARG A O     1 
ATOM   4615  C  CB    . ARG A 1  590  ? 136.138 59.402  17.597  1.00 92.61  ? 590  ARG A CB    1 
ATOM   4616  C  CG    . ARG A 1  590  ? 134.856 60.154  17.991  1.00 90.03  ? 590  ARG A CG    1 
ATOM   4617  C  CD    . ARG A 1  590  ? 133.604 59.564  17.399  1.00 94.75  ? 590  ARG A CD    1 
ATOM   4618  N  NE    . ARG A 1  590  ? 133.406 58.173  17.794  1.00 101.48 ? 590  ARG A NE    1 
ATOM   4619  C  CZ    . ARG A 1  590  ? 132.718 57.800  18.862  1.00 113.48 ? 590  ARG A CZ    1 
ATOM   4620  N  NH1   . ARG A 1  590  ? 132.141 58.708  19.638  1.00 104.30 ? 590  ARG A NH1   1 
ATOM   4621  N  NH2   . ARG A 1  590  ? 132.590 56.516  19.159  1.00 92.98  ? 590  ARG A NH2   1 
ATOM   4622  N  N     . PHE A 1  591  ? 137.079 62.312  18.967  1.00 105.37 ? 591  PHE A N     1 
ATOM   4623  C  CA    . PHE A 1  591  ? 136.888 63.160  20.127  1.00 106.92 ? 591  PHE A CA    1 
ATOM   4624  C  C     . PHE A 1  591  ? 135.445 63.627  20.249  1.00 111.32 ? 591  PHE A C     1 
ATOM   4625  O  O     . PHE A 1  591  ? 134.908 64.244  19.322  1.00 109.70 ? 591  PHE A O     1 
ATOM   4626  C  CB    . PHE A 1  591  ? 137.894 64.317  20.124  1.00 110.21 ? 591  PHE A CB    1 
ATOM   4627  C  CG    . PHE A 1  591  ? 139.281 63.849  20.480  1.00 112.72 ? 591  PHE A CG    1 
ATOM   4628  C  CD1   . PHE A 1  591  ? 140.137 63.350  19.504  1.00 115.24 ? 591  PHE A CD1   1 
ATOM   4629  C  CD2   . PHE A 1  591  ? 139.713 63.849  21.799  1.00 116.59 ? 591  PHE A CD2   1 
ATOM   4630  C  CE1   . PHE A 1  591  ? 141.406 62.865  19.845  1.00 118.63 ? 591  PHE A CE1   1 
ATOM   4631  C  CE2   . PHE A 1  591  ? 140.978 63.364  22.139  1.00 118.18 ? 591  PHE A CE2   1 
ATOM   4632  C  CZ    . PHE A 1  591  ? 141.818 62.880  21.159  1.00 117.26 ? 591  PHE A CZ    1 
ATOM   4633  N  N     . ASP A 1  592  ? 134.798 63.261  21.368  1.00 110.37 ? 592  ASP A N     1 
ATOM   4634  C  CA    . ASP A 1  592  ? 133.421 63.665  21.675  1.00 111.62 ? 592  ASP A CA    1 
ATOM   4635  C  C     . ASP A 1  592  ? 133.498 64.862  22.641  1.00 117.42 ? 592  ASP A C     1 
ATOM   4636  O  O     . ASP A 1  592  ? 134.609 65.290  22.971  1.00 117.84 ? 592  ASP A O     1 
ATOM   4637  C  CB    . ASP A 1  592  ? 132.587 62.495  22.279  1.00 113.92 ? 592  ASP A CB    1 
ATOM   4638  C  CG    . ASP A 1  592  ? 132.180 61.331  21.361  1.00 125.19 ? 592  ASP A CG    1 
ATOM   4639  O  OD1   . ASP A 1  592  ? 132.332 61.459  20.110  1.00 124.91 ? 592  ASP A OD1   1 
ATOM   4640  O  OD2   . ASP A 1  592  ? 131.710 60.287  21.894  1.00 129.74 ? 592  ASP A OD2   1 
ATOM   4641  N  N     . GLU A 1  593  ? 132.340 65.401  23.086  1.00 114.80 ? 593  GLU A N     1 
ATOM   4642  C  CA    . GLU A 1  593  ? 132.271 66.559  23.986  1.00 116.16 ? 593  GLU A CA    1 
ATOM   4643  C  C     . GLU A 1  593  ? 133.194 66.488  25.214  1.00 119.06 ? 593  GLU A C     1 
ATOM   4644  O  O     . GLU A 1  593  ? 132.914 65.788  26.192  1.00 118.00 ? 593  GLU A O     1 
ATOM   4645  C  CB    . GLU A 1  593  ? 130.809 67.050  24.236  1.00 118.24 ? 593  GLU A CB    1 
ATOM   4646  C  CG    . GLU A 1  593  ? 130.261 67.097  25.666  1.00 138.09 ? 593  GLU A CG    1 
ATOM   4647  C  CD    . GLU A 1  593  ? 130.373 68.404  26.446  1.00 181.69 ? 593  GLU A CD    1 
ATOM   4648  O  OE1   . GLU A 1  593  ? 130.086 69.482  25.872  1.00 180.73 ? 593  GLU A OE1   1 
ATOM   4649  O  OE2   . GLU A 1  593  ? 130.696 68.340  27.656  1.00 188.38 ? 593  GLU A OE2   1 
ATOM   4650  N  N     . GLY A 1  594  ? 134.331 67.168  25.084  1.00 115.96 ? 594  GLY A N     1 
ATOM   4651  C  CA    . GLY A 1  594  ? 135.361 67.249  26.110  1.00 116.99 ? 594  GLY A CA    1 
ATOM   4652  C  C     . GLY A 1  594  ? 136.112 65.953  26.297  1.00 120.60 ? 594  GLY A C     1 
ATOM   4653  O  O     . GLY A 1  594  ? 136.044 65.338  27.367  1.00 121.05 ? 594  GLY A O     1 
ATOM   4654  N  N     . THR A 1  595  ? 136.807 65.514  25.250  1.00 115.95 ? 595  THR A N     1 
ATOM   4655  C  CA    . THR A 1  595  ? 137.567 64.286  25.355  1.00 115.31 ? 595  THR A CA    1 
ATOM   4656  C  C     . THR A 1  595  ? 139.036 64.616  25.501  1.00 120.21 ? 595  THR A C     1 
ATOM   4657  O  O     . THR A 1  595  ? 139.646 65.162  24.586  1.00 120.31 ? 595  THR A O     1 
ATOM   4658  C  CB    . THR A 1  595  ? 137.232 63.311  24.230  1.00 119.25 ? 595  THR A CB    1 
ATOM   4659  O  OG1   . THR A 1  595  ? 135.817 63.195  24.110  1.00 116.05 ? 595  THR A OG1   1 
ATOM   4660  C  CG2   . THR A 1  595  ? 137.835 61.940  24.461  1.00 117.95 ? 595  THR A CG2   1 
ATOM   4661  N  N     . THR A 1  596  ? 139.583 64.333  26.682  1.00 116.86 ? 596  THR A N     1 
ATOM   4662  C  CA    . THR A 1  596  ? 140.996 64.503  27.008  1.00 117.19 ? 596  THR A CA    1 
ATOM   4663  C  C     . THR A 1  596  ? 141.691 63.258  26.433  1.00 118.92 ? 596  THR A C     1 
ATOM   4664  O  O     . THR A 1  596  ? 141.027 62.245  26.185  1.00 116.76 ? 596  THR A O     1 
ATOM   4665  C  CB    . THR A 1  596  ? 141.146 64.552  28.554  1.00 128.77 ? 596  THR A CB    1 
ATOM   4666  O  OG1   . THR A 1  596  ? 140.248 65.523  29.088  1.00 129.65 ? 596  THR A OG1   1 
ATOM   4667  C  CG2   . THR A 1  596  ? 142.571 64.864  29.026  1.00 129.01 ? 596  THR A CG2   1 
ATOM   4668  N  N     . LEU A 1  597  ? 143.021 63.310  26.253  1.00 115.75 ? 597  LEU A N     1 
ATOM   4669  C  CA    . LEU A 1  597  ? 143.793 62.152  25.808  1.00 115.04 ? 597  LEU A CA    1 
ATOM   4670  C  C     . LEU A 1  597  ? 143.842 61.134  26.973  1.00 120.45 ? 597  LEU A C     1 
ATOM   4671  O  O     . LEU A 1  597  ? 144.386 60.040  26.852  1.00 120.35 ? 597  LEU A O     1 
ATOM   4672  C  CB    . LEU A 1  597  ? 145.203 62.598  25.392  1.00 115.62 ? 597  LEU A CB    1 
ATOM   4673  C  CG    . LEU A 1  597  ? 145.777 62.076  24.066  1.00 119.22 ? 597  LEU A CG    1 
ATOM   4674  C  CD1   . LEU A 1  597  ? 146.096 60.609  24.121  1.00 118.71 ? 597  LEU A CD1   1 
ATOM   4675  C  CD2   . LEU A 1  597  ? 144.896 62.411  22.885  1.00 121.15 ? 597  LEU A CD2   1 
ATOM   4676  N  N     . LEU A 1  598  ? 143.243 61.524  28.098  1.00 117.91 ? 598  LEU A N     1 
ATOM   4677  C  CA    . LEU A 1  598  ? 143.051 60.756  29.311  1.00 118.44 ? 598  LEU A CA    1 
ATOM   4678  C  C     . LEU A 1  598  ? 141.526 60.840  29.509  1.00 122.22 ? 598  LEU A C     1 
ATOM   4679  O  O     . LEU A 1  598  ? 141.083 61.465  30.478  1.00 122.46 ? 598  LEU A O     1 
ATOM   4680  C  CB    . LEU A 1  598  ? 143.774 61.494  30.456  1.00 120.21 ? 598  LEU A CB    1 
ATOM   4681  C  CG    . LEU A 1  598  ? 144.309 60.718  31.672  1.00 126.08 ? 598  LEU A CG    1 
ATOM   4682  C  CD1   . LEU A 1  598  ? 144.309 61.598  32.897  1.00 127.68 ? 598  LEU A CD1   1 
ATOM   4683  C  CD2   . LEU A 1  598  ? 143.511 59.486  31.982  1.00 127.78 ? 598  LEU A CD2   1 
ATOM   4684  N  N     . SER A 1  599  ? 140.730 60.265  28.543  1.00 117.73 ? 599  SER A N     1 
ATOM   4685  C  CA    . SER A 1  599  ? 139.246 60.277  28.506  1.00 116.28 ? 599  SER A CA    1 
ATOM   4686  C  C     . SER A 1  599  ? 138.643 60.005  29.869  1.00 119.16 ? 599  SER A C     1 
ATOM   4687  O  O     . SER A 1  599  ? 138.713 58.877  30.377  1.00 119.21 ? 599  SER A O     1 
ATOM   4688  C  CB    . SER A 1  599  ? 138.679 59.316  27.465  1.00 117.64 ? 599  SER A CB    1 
ATOM   4689  O  OG    . SER A 1  599  ? 137.277 59.496  27.359  1.00 123.21 ? 599  SER A OG    1 
ATOM   4690  N  N     . PRO A 1  600  ? 138.142 61.070  30.513  1.00 113.74 ? 600  PRO A N     1 
ATOM   4691  C  CA    . PRO A 1  600  ? 137.653 60.915  31.884  1.00 113.41 ? 600  PRO A CA    1 
ATOM   4692  C  C     . PRO A 1  600  ? 136.218 60.460  31.977  1.00 113.87 ? 600  PRO A C     1 
ATOM   4693  O  O     . PRO A 1  600  ? 135.829 59.866  32.981  1.00 114.97 ? 600  PRO A O     1 
ATOM   4694  C  CB    . PRO A 1  600  ? 137.865 62.297  32.489  1.00 116.37 ? 600  PRO A CB    1 
ATOM   4695  C  CG    . PRO A 1  600  ? 137.976 63.235  31.317  1.00 120.36 ? 600  PRO A CG    1 
ATOM   4696  C  CD    . PRO A 1  600  ? 138.033 62.467  30.050  1.00 114.84 ? 600  PRO A CD    1 
ATOM   4697  N  N     . LYS A 1  601  ? 135.443 60.735  30.944  1.00 106.10 ? 601  LYS A N     1 
ATOM   4698  C  CA    . LYS A 1  601  ? 134.050 60.377  30.929  1.00 104.73 ? 601  LYS A CA    1 
ATOM   4699  C  C     . LYS A 1  601  ? 133.853 59.035  30.219  1.00 108.16 ? 601  LYS A C     1 
ATOM   4700  O  O     . LYS A 1  601  ? 132.739 58.493  30.232  1.00 107.75 ? 601  LYS A O     1 
ATOM   4701  C  CB    . LYS A 1  601  ? 133.278 61.496  30.217  1.00 106.56 ? 601  LYS A CB    1 
ATOM   4702  C  CG    . LYS A 1  601  ? 133.163 62.779  31.028  1.00 121.37 ? 601  LYS A CG    1 
ATOM   4703  C  CD    . LYS A 1  601  ? 133.168 64.020  30.144  1.00 131.91 ? 601  LYS A CD    1 
ATOM   4704  C  CE    . LYS A 1  601  ? 131.850 64.755  30.180  1.00 142.36 ? 601  LYS A CE    1 
ATOM   4705  N  NZ    . LYS A 1  601  ? 131.942 66.075  29.502  1.00 151.34 ? 601  LYS A NZ    1 
ATOM   4706  N  N     . ASP A 1  602  ? 134.954 58.479  29.639  1.00 103.77 ? 602  ASP A N     1 
ATOM   4707  C  CA    . ASP A 1  602  ? 134.993 57.303  28.752  1.00 101.75 ? 602  ASP A CA    1 
ATOM   4708  C  C     . ASP A 1  602  ? 134.114 57.727  27.554  1.00 105.14 ? 602  ASP A C     1 
ATOM   4709  O  O     . ASP A 1  602  ? 133.070 57.153  27.254  1.00 103.34 ? 602  ASP A O     1 
ATOM   4710  C  CB    . ASP A 1  602  ? 134.558 55.985  29.439  1.00 102.68 ? 602  ASP A CB    1 
ATOM   4711  C  CG    . ASP A 1  602  ? 135.356 54.714  29.114  1.00 104.37 ? 602  ASP A CG    1 
ATOM   4712  O  OD1   . ASP A 1  602  ? 136.548 54.833  28.674  1.00 102.48 ? 602  ASP A OD1   1 
ATOM   4713  O  OD2   . ASP A 1  602  ? 134.831 53.599  29.385  1.00 105.99 ? 602  ASP A OD2   1 
ATOM   4714  N  N     . ASN A 1  603  ? 134.512 58.876  26.997  1.00 103.39 ? 603  ASN A N     1 
ATOM   4715  C  CA    . ASN A 1  603  ? 133.956 59.609  25.870  1.00 102.68 ? 603  ASN A CA    1 
ATOM   4716  C  C     . ASN A 1  603  ? 134.746 59.186  24.657  1.00 106.83 ? 603  ASN A C     1 
ATOM   4717  O  O     . ASN A 1  603  ? 135.756 58.488  24.797  1.00 107.57 ? 603  ASN A O     1 
ATOM   4718  C  CB    . ASN A 1  603  ? 134.234 61.101  26.089  1.00 103.48 ? 603  ASN A CB    1 
ATOM   4719  C  CG    . ASN A 1  603  ? 133.028 61.977  26.219  1.00 132.63 ? 603  ASN A CG    1 
ATOM   4720  O  OD1   . ASN A 1  603  ? 133.075 62.991  26.910  1.00 136.13 ? 603  ASN A OD1   1 
ATOM   4721  N  ND2   . ASN A 1  603  ? 131.930 61.637  25.551  1.00 121.78 ? 603  ASN A ND2   1 
ATOM   4722  N  N     . GLY A 1  604  ? 134.334 59.661  23.490  1.00 102.12 ? 604  GLY A N     1 
ATOM   4723  C  CA    . GLY A 1  604  ? 135.037 59.399  22.243  1.00 101.12 ? 604  GLY A CA    1 
ATOM   4724  C  C     . GLY A 1  604  ? 135.394 57.949  21.991  1.00 104.32 ? 604  GLY A C     1 
ATOM   4725  O  O     . GLY A 1  604  ? 134.644 57.037  22.378  1.00 104.30 ? 604  GLY A O     1 
ATOM   4726  N  N     . MET A 1  605  ? 136.565 57.743  21.345  1.00 99.34  ? 605  MET A N     1 
ATOM   4727  C  CA    . MET A 1  605  ? 137.066 56.437  20.925  1.00 98.04  ? 605  MET A CA    1 
ATOM   4728  C  C     . MET A 1  605  ? 138.517 56.500  20.496  1.00 100.59 ? 605  MET A C     1 
ATOM   4729  O  O     . MET A 1  605  ? 138.909 57.382  19.729  1.00 100.13 ? 605  MET A O     1 
ATOM   4730  C  CB    . MET A 1  605  ? 136.231 55.917  19.723  1.00 99.14  ? 605  MET A CB    1 
ATOM   4731  C  CG    . MET A 1  605  ? 136.421 54.457  19.418  1.00 102.24 ? 605  MET A CG    1 
ATOM   4732  S  SD    . MET A 1  605  ? 135.729 53.435  20.733  1.00 107.03 ? 605  MET A SD    1 
ATOM   4733  C  CE    . MET A 1  605  ? 137.145 52.678  21.294  1.00 104.35 ? 605  MET A CE    1 
ATOM   4734  N  N     . LEU A 1  606  ? 139.293 55.513  20.929  1.00 96.26  ? 606  LEU A N     1 
ATOM   4735  C  CA    . LEU A 1  606  ? 140.676 55.371  20.516  1.00 95.98  ? 606  LEU A CA    1 
ATOM   4736  C  C     . LEU A 1  606  ? 141.034 53.906  20.361  1.00 98.60  ? 606  LEU A C     1 
ATOM   4737  O  O     . LEU A 1  606  ? 141.175 53.190  21.360  1.00 99.22  ? 606  LEU A O     1 
ATOM   4738  C  CB    . LEU A 1  606  ? 141.670 56.135  21.425  1.00 97.33  ? 606  LEU A CB    1 
ATOM   4739  C  CG    . LEU A 1  606  ? 143.186 56.003  21.105  1.00 101.88 ? 606  LEU A CG    1 
ATOM   4740  C  CD1   . LEU A 1  606  ? 143.501 56.291  19.629  1.00 101.21 ? 606  LEU A CD1   1 
ATOM   4741  C  CD2   . LEU A 1  606  ? 144.003 56.900  21.992  1.00 104.12 ? 606  LEU A CD2   1 
ATOM   4742  N  N     . ILE A 1  607  ? 141.161 53.467  19.095  1.00 92.50  ? 607  ILE A N     1 
ATOM   4743  C  CA    . ILE A 1  607  ? 141.548 52.100  18.739  1.00 90.90  ? 607  ILE A CA    1 
ATOM   4744  C  C     . ILE A 1  607  ? 142.879 52.179  18.019  1.00 94.60  ? 607  ILE A C     1 
ATOM   4745  O  O     . ILE A 1  607  ? 142.979 52.880  17.007  1.00 93.57  ? 607  ILE A O     1 
ATOM   4746  C  CB    . ILE A 1  607  ? 140.463 51.299  17.928  1.00 91.73  ? 607  ILE A CB    1 
ATOM   4747  C  CG1   . ILE A 1  607  ? 139.120 51.272  18.660  1.00 90.74  ? 607  ILE A CG1   1 
ATOM   4748  C  CG2   . ILE A 1  607  ? 140.915 49.858  17.628  1.00 91.27  ? 607  ILE A CG2   1 
ATOM   4749  C  CD1   . ILE A 1  607  ? 138.032 51.588  17.845  1.00 89.19  ? 607  ILE A CD1   1 
ATOM   4750  N  N     . ILE A 1  608  ? 143.905 51.495  18.571  1.00 91.58  ? 608  ILE A N     1 
ATOM   4751  C  CA    . ILE A 1  608  ? 145.248 51.414  17.993  1.00 91.64  ? 608  ILE A CA    1 
ATOM   4752  C  C     . ILE A 1  608  ? 145.584 49.944  17.742  1.00 99.04  ? 608  ILE A C     1 
ATOM   4753  O  O     . ILE A 1  608  ? 145.577 49.135  18.680  1.00 98.87  ? 608  ILE A O     1 
ATOM   4754  C  CB    . ILE A 1  608  ? 146.345 52.145  18.817  1.00 94.84  ? 608  ILE A CB    1 
ATOM   4755  C  CG1   . ILE A 1  608  ? 145.917 53.572  19.198  1.00 95.14  ? 608  ILE A CG1   1 
ATOM   4756  C  CG2   . ILE A 1  608  ? 147.645 52.179  18.031  1.00 95.30  ? 608  ILE A CG2   1 
ATOM   4757  C  CD1   . ILE A 1  608  ? 146.582 54.154  20.428  1.00 102.19 ? 608  ILE A CD1   1 
ATOM   4758  N  N     . ASP A 1  609  ? 145.861 49.604  16.460  1.00 97.72  ? 609  ASP A N     1 
ATOM   4759  C  CA    . ASP A 1  609  ? 146.218 48.250  16.002  1.00 98.12  ? 609  ASP A CA    1 
ATOM   4760  C  C     . ASP A 1  609  ? 145.128 47.221  16.379  1.00 103.05 ? 609  ASP A C     1 
ATOM   4761  O  O     . ASP A 1  609  ? 145.418 46.107  16.838  1.00 104.22 ? 609  ASP A O     1 
ATOM   4762  C  CB    . ASP A 1  609  ? 147.638 47.847  16.504  1.00 100.97 ? 609  ASP A CB    1 
ATOM   4763  C  CG    . ASP A 1  609  ? 148.272 46.661  15.795  1.00 113.74 ? 609  ASP A CG    1 
ATOM   4764  O  OD1   . ASP A 1  609  ? 148.084 46.531  14.562  1.00 114.32 ? 609  ASP A OD1   1 
ATOM   4765  O  OD2   . ASP A 1  609  ? 148.955 45.859  16.473  1.00 121.56 ? 609  ASP A OD2   1 
ATOM   4766  N  N     . GLY A 1  610  ? 143.876 47.626  16.199  1.00 98.21  ? 610  GLY A N     1 
ATOM   4767  C  CA    . GLY A 1  610  ? 142.727 46.792  16.525  1.00 97.00  ? 610  GLY A CA    1 
ATOM   4768  C  C     . GLY A 1  610  ? 142.620 46.432  17.996  1.00 99.23  ? 610  GLY A C     1 
ATOM   4769  O  O     . GLY A 1  610  ? 142.323 45.270  18.322  1.00 98.97  ? 610  GLY A O     1 
ATOM   4770  N  N     . GLN A 1  611  ? 142.935 47.430  18.885  1.00 93.15  ? 611  GLN A N     1 
ATOM   4771  C  CA    . GLN A 1  611  ? 142.883 47.365  20.356  1.00 91.77  ? 611  GLN A CA    1 
ATOM   4772  C  C     . GLN A 1  611  ? 142.292 48.663  20.888  1.00 92.68  ? 611  GLN A C     1 
ATOM   4773  O  O     . GLN A 1  611  ? 142.777 49.746  20.560  1.00 91.37  ? 611  GLN A O     1 
ATOM   4774  C  CB    . GLN A 1  611  ? 144.266 47.124  20.993  1.00 93.69  ? 611  GLN A CB    1 
ATOM   4775  C  CG    . GLN A 1  611  ? 144.934 45.798  20.642  1.00 114.56 ? 611  GLN A CG    1 
ATOM   4776  C  CD    . GLN A 1  611  ? 144.161 44.554  21.037  1.00 136.32 ? 611  GLN A CD    1 
ATOM   4777  O  OE1   . GLN A 1  611  ? 143.846 43.704  20.190  1.00 135.95 ? 611  GLN A OE1   1 
ATOM   4778  N  NE2   . GLN A 1  611  ? 143.870 44.396  22.325  1.00 121.63 ? 611  GLN A NE2   1 
ATOM   4779  N  N     . ILE A 1  612  ? 141.236 48.555  21.699  1.00 88.45  ? 612  ILE A N     1 
ATOM   4780  C  CA    . ILE A 1  612  ? 140.556 49.714  22.277  1.00 88.42  ? 612  ILE A CA    1 
ATOM   4781  C  C     . ILE A 1  612  ? 141.362 50.270  23.451  1.00 97.58  ? 612  ILE A C     1 
ATOM   4782  O  O     . ILE A 1  612  ? 141.531 49.583  24.471  1.00 99.70  ? 612  ILE A O     1 
ATOM   4783  C  CB    . ILE A 1  612  ? 139.102 49.382  22.708  1.00 89.72  ? 612  ILE A CB    1 
ATOM   4784  C  CG1   . ILE A 1  612  ? 138.221 48.977  21.525  1.00 87.10  ? 612  ILE A CG1   1 
ATOM   4785  C  CG2   . ILE A 1  612  ? 138.491 50.541  23.492  1.00 91.11  ? 612  ILE A CG2   1 
ATOM   4786  C  CD1   . ILE A 1  612  ? 137.149 48.055  21.891  1.00 81.23  ? 612  ILE A CD1   1 
ATOM   4787  N  N     . ILE A 1  613  ? 141.820 51.524  23.321  1.00 94.65  ? 613  ILE A N     1 
ATOM   4788  C  CA    . ILE A 1  613  ? 142.551 52.203  24.381  1.00 95.52  ? 613  ILE A CA    1 
ATOM   4789  C  C     . ILE A 1  613  ? 141.553 52.858  25.323  1.00 101.37 ? 613  ILE A C     1 
ATOM   4790  O  O     . ILE A 1  613  ? 141.612 52.609  26.526  1.00 102.60 ? 613  ILE A O     1 
ATOM   4791  C  CB    . ILE A 1  613  ? 143.632 53.148  23.812  1.00 98.58  ? 613  ILE A CB    1 
ATOM   4792  C  CG1   . ILE A 1  613  ? 144.934 52.385  23.582  1.00 98.85  ? 613  ILE A CG1   1 
ATOM   4793  C  CG2   . ILE A 1  613  ? 143.891 54.337  24.717  1.00 100.84 ? 613  ILE A CG2   1 
ATOM   4794  C  CD1   . ILE A 1  613  ? 144.975 51.632  22.344  1.00 105.97 ? 613  ILE A CD1   1 
ATOM   4795  N  N     . PHE A 1  614  ? 140.621 53.662  24.792  1.00 97.96  ? 614  PHE A N     1 
ATOM   4796  C  CA    . PHE A 1  614  ? 139.611 54.301  25.633  1.00 98.82  ? 614  PHE A CA    1 
ATOM   4797  C  C     . PHE A 1  614  ? 138.295 54.532  24.907  1.00 102.85 ? 614  PHE A C     1 
ATOM   4798  O  O     . PHE A 1  614  ? 138.247 54.539  23.673  1.00 101.34 ? 614  PHE A O     1 
ATOM   4799  C  CB    . PHE A 1  614  ? 140.129 55.621  26.274  1.00 101.75 ? 614  PHE A CB    1 
ATOM   4800  C  CG    . PHE A 1  614  ? 140.428 56.804  25.362  1.00 102.72 ? 614  PHE A CG    1 
ATOM   4801  C  CD1   . PHE A 1  614  ? 139.409 57.434  24.647  1.00 104.75 ? 614  PHE A CD1   1 
ATOM   4802  C  CD2   . PHE A 1  614  ? 141.706 57.345  25.296  1.00 104.46 ? 614  PHE A CD2   1 
ATOM   4803  C  CE1   . PHE A 1  614  ? 139.679 58.535  23.833  1.00 105.11 ? 614  PHE A CE1   1 
ATOM   4804  C  CE2   . PHE A 1  614  ? 141.971 58.453  24.492  1.00 106.89 ? 614  PHE A CE2   1 
ATOM   4805  C  CZ    . PHE A 1  614  ? 140.958 59.039  23.765  1.00 104.34 ? 614  PHE A CZ    1 
ATOM   4806  N  N     . GLY A 1  615  ? 137.259 54.794  25.697  1.00 100.02 ? 615  GLY A N     1 
ATOM   4807  C  CA    . GLY A 1  615  ? 135.937 55.129  25.193  1.00 98.62  ? 615  GLY A CA    1 
ATOM   4808  C  C     . GLY A 1  615  ? 134.972 53.975  25.119  1.00 99.44  ? 615  GLY A C     1 
ATOM   4809  O  O     . GLY A 1  615  ? 135.363 52.850  24.802  1.00 98.44  ? 615  GLY A O     1 
ATOM   4810  N  N     . VAL A 1  616  ? 133.695 54.266  25.393  1.00 93.95  ? 616  VAL A N     1 
ATOM   4811  C  CA    . VAL A 1  616  ? 132.650 53.267  25.307  1.00 92.27  ? 616  VAL A CA    1 
ATOM   4812  C  C     . VAL A 1  616  ? 132.244 53.135  23.828  1.00 95.43  ? 616  VAL A C     1 
ATOM   4813  O  O     . VAL A 1  616  ? 132.104 54.139  23.090  1.00 95.20  ? 616  VAL A O     1 
ATOM   4814  C  CB    . VAL A 1  616  ? 131.440 53.520  26.244  1.00 95.82  ? 616  VAL A CB    1 
ATOM   4815  C  CG1   . VAL A 1  616  ? 130.600 52.258  26.401  1.00 94.82  ? 616  VAL A CG1   1 
ATOM   4816  C  CG2   . VAL A 1  616  ? 131.894 54.003  27.613  1.00 97.13  ? 616  VAL A CG2   1 
ATOM   4817  N  N     . VAL A 1  617  ? 132.121 51.865  23.402  1.00 89.32  ? 617  VAL A N     1 
ATOM   4818  C  CA    . VAL A 1  617  ? 131.695 51.486  22.072  1.00 86.38  ? 617  VAL A CA    1 
ATOM   4819  C  C     . VAL A 1  617  ? 130.178 51.508  22.076  1.00 88.74  ? 617  VAL A C     1 
ATOM   4820  O  O     . VAL A 1  617  ? 129.541 50.861  22.914  1.00 87.63  ? 617  VAL A O     1 
ATOM   4821  C  CB    . VAL A 1  617  ? 132.241 50.104  21.672  1.00 88.51  ? 617  VAL A CB    1 
ATOM   4822  C  CG1   . VAL A 1  617  ? 131.809 49.733  20.248  1.00 86.83  ? 617  VAL A CG1   1 
ATOM   4823  C  CG2   . VAL A 1  617  ? 133.759 50.061  21.824  1.00 88.51  ? 617  VAL A CG2   1 
ATOM   4824  N  N     . GLU A 1  618  ? 129.614 52.299  21.161  1.00 84.82  ? 618  GLU A N     1 
ATOM   4825  C  CA    . GLU A 1  618  ? 128.176 52.449  20.931  1.00 83.86  ? 618  GLU A CA    1 
ATOM   4826  C  C     . GLU A 1  618  ? 127.898 52.905  19.461  1.00 84.85  ? 618  GLU A C     1 
ATOM   4827  O  O     . GLU A 1  618  ? 128.764 52.713  18.589  1.00 83.58  ? 618  GLU A O     1 
ATOM   4828  C  CB    . GLU A 1  618  ? 127.507 53.338  22.004  1.00 86.04  ? 618  GLU A CB    1 
ATOM   4829  C  CG    . GLU A 1  618  ? 128.255 54.626  22.301  1.00 100.10 ? 618  GLU A CG    1 
ATOM   4830  C  CD    . GLU A 1  618  ? 128.597 55.457  21.079  1.00 120.35 ? 618  GLU A CD    1 
ATOM   4831  O  OE1   . GLU A 1  618  ? 127.656 56.008  20.458  1.00 95.34  ? 618  GLU A OE1   1 
ATOM   4832  O  OE2   . GLU A 1  618  ? 129.784 55.439  20.671  1.00 116.45 ? 618  GLU A OE2   1 
ATOM   4833  N  N     . LYS A 1  619  ? 126.706 53.503  19.194  1.00 78.95  ? 619  LYS A N     1 
ATOM   4834  C  CA    . LYS A 1  619  ? 126.281 53.918  17.853  1.00 76.49  ? 619  LYS A CA    1 
ATOM   4835  C  C     . LYS A 1  619  ? 127.355 54.633  17.010  1.00 79.61  ? 619  LYS A C     1 
ATOM   4836  O  O     . LYS A 1  619  ? 127.759 54.099  15.977  1.00 77.62  ? 619  LYS A O     1 
ATOM   4837  C  CB    . LYS A 1  619  ? 124.930 54.647  17.887  1.00 77.17  ? 619  LYS A CB    1 
ATOM   4838  C  CG    . LYS A 1  619  ? 124.023 54.353  16.700  1.00 80.86  ? 619  LYS A CG    1 
ATOM   4839  C  CD    . LYS A 1  619  ? 122.677 55.069  16.856  1.00 94.80  ? 619  LYS A CD    1 
ATOM   4840  C  CE    . LYS A 1  619  ? 121.735 54.928  15.680  1.00 110.11 ? 619  LYS A CE    1 
ATOM   4841  N  NZ    . LYS A 1  619  ? 120.398 55.527  15.971  1.00 120.82 ? 619  LYS A NZ    1 
ATOM   4842  N  N     . LYS A 1  620  ? 127.891 55.768  17.506  1.00 77.64  ? 620  LYS A N     1 
ATOM   4843  C  CA    . LYS A 1  620  ? 128.930 56.566  16.835  1.00 77.66  ? 620  LYS A CA    1 
ATOM   4844  C  C     . LYS A 1  620  ? 130.094 55.704  16.311  1.00 84.36  ? 620  LYS A C     1 
ATOM   4845  O  O     . LYS A 1  620  ? 130.536 55.913  15.181  1.00 85.23  ? 620  LYS A O     1 
ATOM   4846  C  CB    . LYS A 1  620  ? 129.459 57.687  17.753  1.00 79.35  ? 620  LYS A CB    1 
ATOM   4847  C  CG    . LYS A 1  620  ? 128.422 58.736  18.120  1.00 86.94  ? 620  LYS A CG    1 
ATOM   4848  C  CD    . LYS A 1  620  ? 128.879 59.616  19.266  1.00 95.87  ? 620  LYS A CD    1 
ATOM   4849  C  CE    . LYS A 1  620  ? 128.084 59.364  20.524  1.00 111.97 ? 620  LYS A CE    1 
ATOM   4850  N  NZ    . LYS A 1  620  ? 128.939 59.410  21.749  1.00 124.94 ? 620  LYS A NZ    1 
ATOM   4851  N  N     . THR A 1  621  ? 130.535 54.702  17.104  1.00 80.69  ? 621  THR A N     1 
ATOM   4852  C  CA    . THR A 1  621  ? 131.657 53.816  16.795  1.00 79.93  ? 621  THR A CA    1 
ATOM   4853  C  C     . THR A 1  621  ? 131.307 52.672  15.852  1.00 83.84  ? 621  THR A C     1 
ATOM   4854  O  O     . THR A 1  621  ? 131.939 52.512  14.809  1.00 83.84  ? 621  THR A O     1 
ATOM   4855  C  CB    . THR A 1  621  ? 132.208 53.194  18.107  1.00 82.10  ? 621  THR A CB    1 
ATOM   4856  O  OG1   . THR A 1  621  ? 132.433 54.195  19.103  1.00 82.74  ? 621  THR A OG1   1 
ATOM   4857  C  CG2   . THR A 1  621  ? 133.447 52.324  17.886  1.00 74.67  ? 621  THR A CG2   1 
ATOM   4858  N  N     . VAL A 1  622  ? 130.347 51.840  16.275  1.00 79.29  ? 622  VAL A N     1 
ATOM   4859  C  CA    . VAL A 1  622  ? 129.993 50.572  15.678  1.00 77.30  ? 622  VAL A CA    1 
ATOM   4860  C  C     . VAL A 1  622  ? 128.671 50.527  14.918  1.00 80.30  ? 622  VAL A C     1 
ATOM   4861  O  O     . VAL A 1  622  ? 128.225 49.461  14.507  1.00 78.58  ? 622  VAL A O     1 
ATOM   4862  C  CB    . VAL A 1  622  ? 130.143 49.514  16.796  1.00 81.32  ? 622  VAL A CB    1 
ATOM   4863  C  CG1   . VAL A 1  622  ? 128.915 49.438  17.711  1.00 81.21  ? 622  VAL A CG1   1 
ATOM   4864  C  CG2   . VAL A 1  622  ? 130.519 48.161  16.238  1.00 80.62  ? 622  VAL A CG2   1 
ATOM   4865  N  N     . GLY A 1  623  ? 128.065 51.681  14.709  1.00 79.30  ? 623  GLY A N     1 
ATOM   4866  C  CA    . GLY A 1  623  ? 126.839 51.775  13.922  1.00 80.11  ? 623  GLY A CA    1 
ATOM   4867  C  C     . GLY A 1  623  ? 127.208 51.965  12.466  1.00 88.60  ? 623  GLY A C     1 
ATOM   4868  O  O     . GLY A 1  623  ? 128.381 51.766  12.103  1.00 89.62  ? 623  GLY A O     1 
ATOM   4869  N  N     . SER A 1  624  ? 126.226 52.368  11.616  1.00 86.78  ? 624  SER A N     1 
ATOM   4870  C  CA    . SER A 1  624  ? 126.461 52.629  10.178  1.00 86.63  ? 624  SER A CA    1 
ATOM   4871  C  C     . SER A 1  624  ? 126.756 54.119  10.011  1.00 90.53  ? 624  SER A C     1 
ATOM   4872  O  O     . SER A 1  624  ? 125.995 54.869  9.408   1.00 88.74  ? 624  SER A O     1 
ATOM   4873  C  CB    . SER A 1  624  ? 125.295 52.140  9.316   1.00 90.75  ? 624  SER A CB    1 
ATOM   4874  O  OG    . SER A 1  624  ? 124.153 52.979  9.375   1.00 102.23 ? 624  SER A OG    1 
ATOM   4875  N  N     . SER A 1  625  ? 127.871 54.528  10.634  1.00 89.52  ? 625  SER A N     1 
ATOM   4876  C  CA    . SER A 1  625  ? 128.406 55.883  10.772  1.00 90.34  ? 625  SER A CA    1 
ATOM   4877  C  C     . SER A 1  625  ? 129.487 56.181  9.752   1.00 92.62  ? 625  SER A C     1 
ATOM   4878  O  O     . SER A 1  625  ? 130.177 55.252  9.317   1.00 92.08  ? 625  SER A O     1 
ATOM   4879  C  CB    . SER A 1  625  ? 128.973 56.069  12.181  1.00 95.50  ? 625  SER A CB    1 
ATOM   4880  O  OG    . SER A 1  625  ? 128.061 55.641  13.184  1.00 105.73 ? 625  SER A OG    1 
ATOM   4881  N  N     . ASN A 1  626  ? 129.665 57.485  9.416   1.00 88.24  ? 626  ASN A N     1 
ATOM   4882  C  CA    . ASN A 1  626  ? 130.658 57.946  8.449   1.00 88.12  ? 626  ASN A CA    1 
ATOM   4883  C  C     . ASN A 1  626  ? 132.096 57.557  8.823   1.00 93.98  ? 626  ASN A C     1 
ATOM   4884  O  O     . ASN A 1  626  ? 132.781 56.904  8.026   1.00 94.31  ? 626  ASN A O     1 
ATOM   4885  C  CB    . ASN A 1  626  ? 130.524 59.435  8.149   1.00 88.35  ? 626  ASN A CB    1 
ATOM   4886  C  CG    . ASN A 1  626  ? 130.750 59.778  6.685   1.00 120.04 ? 626  ASN A CG    1 
ATOM   4887  O  OD1   . ASN A 1  626  ? 131.888 59.766  6.177   1.00 117.12 ? 626  ASN A OD1   1 
ATOM   4888  N  ND2   . ASN A 1  626  ? 129.668 60.111  5.972   1.00 111.03 ? 626  ASN A ND2   1 
ATOM   4889  N  N     . GLY A 1  627  ? 132.527 57.889  10.035  1.00 90.53  ? 627  GLY A N     1 
ATOM   4890  C  CA    . GLY A 1  627  ? 133.878 57.531  10.469  1.00 90.61  ? 627  GLY A CA    1 
ATOM   4891  C  C     . GLY A 1  627  ? 133.981 56.183  11.145  1.00 93.53  ? 627  GLY A C     1 
ATOM   4892  O  O     . GLY A 1  627  ? 135.020 55.853  11.713  1.00 93.12  ? 627  GLY A O     1 
ATOM   4893  N  N     . GLY A 1  628  ? 132.892 55.418  11.066  1.00 89.70  ? 628  GLY A N     1 
ATOM   4894  C  CA    . GLY A 1  628  ? 132.681 54.119  11.694  1.00 88.52  ? 628  GLY A CA    1 
ATOM   4895  C  C     . GLY A 1  628  ? 133.824 53.130  11.690  1.00 88.63  ? 628  GLY A C     1 
ATOM   4896  O  O     . GLY A 1  628  ? 134.660 53.115  10.775  1.00 87.18  ? 628  GLY A O     1 
ATOM   4897  N  N     . LEU A 1  629  ? 133.829 52.270  12.737  1.00 82.10  ? 629  LEU A N     1 
ATOM   4898  C  CA    . LEU A 1  629  ? 134.743 51.146  12.903  1.00 79.42  ? 629  LEU A CA    1 
ATOM   4899  C  C     . LEU A 1  629  ? 134.536 50.286  11.672  1.00 81.44  ? 629  LEU A C     1 
ATOM   4900  O  O     . LEU A 1  629  ? 135.519 49.829  11.104  1.00 80.46  ? 629  LEU A O     1 
ATOM   4901  C  CB    . LEU A 1  629  ? 134.414 50.369  14.196  1.00 78.56  ? 629  LEU A CB    1 
ATOM   4902  C  CG    . LEU A 1  629  ? 135.302 49.191  14.652  1.00 81.48  ? 629  LEU A CG    1 
ATOM   4903  C  CD1   . LEU A 1  629  ? 134.671 47.891  14.375  1.00 80.17  ? 629  LEU A CD1   1 
ATOM   4904  C  CD2   . LEU A 1  629  ? 136.724 49.259  14.147  1.00 82.64  ? 629  LEU A CD2   1 
ATOM   4905  N  N     . ILE A 1  630  ? 133.262 50.179  11.198  1.00 77.74  ? 630  ILE A N     1 
ATOM   4906  C  CA    . ILE A 1  630  ? 132.876 49.451  9.981   1.00 76.23  ? 630  ILE A CA    1 
ATOM   4907  C  C     . ILE A 1  630  ? 133.455 50.114  8.710   1.00 78.43  ? 630  ILE A C     1 
ATOM   4908  O  O     . ILE A 1  630  ? 134.227 49.461  7.994   1.00 76.36  ? 630  ILE A O     1 
ATOM   4909  C  CB    . ILE A 1  630  ? 131.347 49.157  9.940   1.00 77.77  ? 630  ILE A CB    1 
ATOM   4910  C  CG1   . ILE A 1  630  ? 131.020 48.001  10.874  1.00 76.82  ? 630  ILE A CG1   1 
ATOM   4911  C  CG2   . ILE A 1  630  ? 130.821 48.873  8.521   1.00 76.90  ? 630  ILE A CG2   1 
ATOM   4912  C  CD1   . ILE A 1  630  ? 130.090 48.390  11.821  1.00 82.77  ? 630  ILE A CD1   1 
ATOM   4913  N  N     . HIS A 1  631  ? 133.142 51.413  8.476   1.00 74.93  ? 631  HIS A N     1 
ATOM   4914  C  CA    . HIS A 1  631  ? 133.655 52.155  7.318   1.00 74.67  ? 631  HIS A CA    1 
ATOM   4915  C  C     . HIS A 1  631  ? 135.198 52.011  7.133   1.00 74.93  ? 631  HIS A C     1 
ATOM   4916  O  O     . HIS A 1  631  ? 135.682 51.848  6.007   1.00 72.47  ? 631  HIS A O     1 
ATOM   4917  C  CB    . HIS A 1  631  ? 133.241 53.637  7.398   1.00 76.51  ? 631  HIS A CB    1 
ATOM   4918  C  CG    . HIS A 1  631  ? 133.287 54.358  6.079   1.00 80.37  ? 631  HIS A CG    1 
ATOM   4919  N  ND1   . HIS A 1  631  ? 132.701 55.598  5.923   1.00 82.52  ? 631  HIS A ND1   1 
ATOM   4920  C  CD2   . HIS A 1  631  ? 133.827 53.980  4.889   1.00 82.49  ? 631  HIS A CD2   1 
ATOM   4921  C  CE1   . HIS A 1  631  ? 132.910 55.941  4.661   1.00 82.20  ? 631  HIS A CE1   1 
ATOM   4922  N  NE2   . HIS A 1  631  ? 133.575 54.994  3.994   1.00 82.34  ? 631  HIS A NE2   1 
ATOM   4923  N  N     . VAL A 1  632  ? 135.941 52.040  8.251   1.00 71.07  ? 632  VAL A N     1 
ATOM   4924  C  CA    . VAL A 1  632  ? 137.397 51.895  8.288   1.00 71.18  ? 632  VAL A CA    1 
ATOM   4925  C  C     . VAL A 1  632  ? 137.789 50.451  7.930   1.00 76.33  ? 632  VAL A C     1 
ATOM   4926  O  O     . VAL A 1  632  ? 138.630 50.245  7.052   1.00 75.60  ? 632  VAL A O     1 
ATOM   4927  C  CB    . VAL A 1  632  ? 137.946 52.299  9.674   1.00 74.99  ? 632  VAL A CB    1 
ATOM   4928  C  CG1   . VAL A 1  632  ? 139.430 51.999  9.793   1.00 75.03  ? 632  VAL A CG1   1 
ATOM   4929  C  CG2   . VAL A 1  632  ? 137.675 53.761  9.965   1.00 75.28  ? 632  VAL A CG2   1 
ATOM   4930  N  N     . VAL A 1  633  ? 137.186 49.460  8.626   1.00 73.20  ? 633  VAL A N     1 
ATOM   4931  C  CA    . VAL A 1  633  ? 137.456 48.047  8.397   1.00 72.45  ? 633  VAL A CA    1 
ATOM   4932  C  C     . VAL A 1  633  ? 137.192 47.703  6.929   1.00 76.26  ? 633  VAL A C     1 
ATOM   4933  O  O     . VAL A 1  633  ? 138.099 47.184  6.281   1.00 76.89  ? 633  VAL A O     1 
ATOM   4934  C  CB    . VAL A 1  633  ? 136.766 47.089  9.418   1.00 75.80  ? 633  VAL A CB    1 
ATOM   4935  C  CG1   . VAL A 1  633  ? 136.993 45.624  9.051   1.00 75.23  ? 633  VAL A CG1   1 
ATOM   4936  C  CG2   . VAL A 1  633  ? 137.267 47.346  10.838  1.00 76.25  ? 633  VAL A CG2   1 
ATOM   4937  N  N     . THR A 1  634  ? 136.016 48.083  6.376   1.00 71.47  ? 634  THR A N     1 
ATOM   4938  C  CA    . THR A 1  634  ? 135.685 47.786  4.970   1.00 70.24  ? 634  THR A CA    1 
ATOM   4939  C  C     . THR A 1  634  ? 136.684 48.367  4.024   1.00 74.75  ? 634  THR A C     1 
ATOM   4940  O  O     . THR A 1  634  ? 137.067 47.691  3.071   1.00 74.27  ? 634  THR A O     1 
ATOM   4941  C  CB    . THR A 1  634  ? 134.295 48.244  4.577   1.00 77.41  ? 634  THR A CB    1 
ATOM   4942  O  OG1   . THR A 1  634  ? 133.492 48.399  5.738   1.00 86.33  ? 634  THR A OG1   1 
ATOM   4943  C  CG2   . THR A 1  634  ? 133.632 47.291  3.608   1.00 71.99  ? 634  THR A CG2   1 
ATOM   4944  N  N     . ARG A 1  635  ? 137.110 49.616  4.285   1.00 72.68  ? 635  ARG A N     1 
ATOM   4945  C  CA    . ARG A 1  635  ? 138.102 50.279  3.465   1.00 73.46  ? 635  ARG A CA    1 
ATOM   4946  C  C     . ARG A 1  635  ? 139.456 49.621  3.719   1.00 80.93  ? 635  ARG A C     1 
ATOM   4947  O  O     . ARG A 1  635  ? 139.900 48.864  2.870   1.00 81.63  ? 635  ARG A O     1 
ATOM   4948  C  CB    . ARG A 1  635  ? 138.126 51.803  3.701   1.00 73.21  ? 635  ARG A CB    1 
ATOM   4949  C  CG    . ARG A 1  635  ? 137.032 52.592  2.979   1.00 81.10  ? 635  ARG A CG    1 
ATOM   4950  C  CD    . ARG A 1  635  ? 137.402 52.991  1.552   1.00 90.08  ? 635  ARG A CD    1 
ATOM   4951  N  NE    . ARG A 1  635  ? 136.263 52.838  0.648   1.00 101.22 ? 635  ARG A NE    1 
ATOM   4952  C  CZ    . ARG A 1  635  ? 135.925 51.696  0.048   1.00 118.60 ? 635  ARG A CZ    1 
ATOM   4953  N  NH1   . ARG A 1  635  ? 136.656 50.599  0.229   1.00 104.57 ? 635  ARG A NH1   1 
ATOM   4954  N  NH2   . ARG A 1  635  ? 134.845 51.640  -0.727  1.00 105.10 ? 635  ARG A NH2   1 
ATOM   4955  N  N     . GLU A 1  636  ? 140.043 49.794  4.910   1.00 79.55  ? 636  GLU A N     1 
ATOM   4956  C  CA    . GLU A 1  636  ? 141.367 49.257  5.246   1.00 80.80  ? 636  GLU A CA    1 
ATOM   4957  C  C     . GLU A 1  636  ? 141.595 47.740  5.090   1.00 83.49  ? 636  GLU A C     1 
ATOM   4958  O  O     . GLU A 1  636  ? 142.665 47.339  4.632   1.00 82.76  ? 636  GLU A O     1 
ATOM   4959  C  CB    . GLU A 1  636  ? 141.844 49.763  6.623   1.00 83.56  ? 636  GLU A CB    1 
ATOM   4960  C  CG    . GLU A 1  636  ? 143.358 49.916  6.760   1.00 101.88 ? 636  GLU A CG    1 
ATOM   4961  C  CD    . GLU A 1  636  ? 143.963 51.142  6.096   1.00 142.07 ? 636  GLU A CD    1 
ATOM   4962  O  OE1   . GLU A 1  636  ? 143.397 52.248  6.265   1.00 138.44 ? 636  GLU A OE1   1 
ATOM   4963  O  OE2   . GLU A 1  636  ? 145.018 51.001  5.428   1.00 147.60 ? 636  GLU A OE2   1 
ATOM   4964  N  N     . LYS A 1  637  ? 140.620 46.904  5.469   1.00 79.54  ? 637  LYS A N     1 
ATOM   4965  C  CA    . LYS A 1  637  ? 140.828 45.454  5.428   1.00 78.72  ? 637  LYS A CA    1 
ATOM   4966  C  C     . LYS A 1  637  ? 140.110 44.630  4.366   1.00 82.69  ? 637  LYS A C     1 
ATOM   4967  O  O     . LYS A 1  637  ? 140.566 43.527  4.077   1.00 82.58  ? 637  LYS A O     1 
ATOM   4968  C  CB    . LYS A 1  637  ? 140.750 44.820  6.830   1.00 80.45  ? 637  LYS A CB    1 
ATOM   4969  C  CG    . LYS A 1  637  ? 141.866 45.289  7.785   1.00 89.94  ? 637  LYS A CG    1 
ATOM   4970  C  CD    . LYS A 1  637  ? 143.188 44.512  7.681   1.00 93.42  ? 637  LYS A CD    1 
ATOM   4971  C  CE    . LYS A 1  637  ? 144.387 45.266  8.223   1.00 99.04  ? 637  LYS A CE    1 
ATOM   4972  N  NZ    . LYS A 1  637  ? 144.771 46.445  7.384   1.00 108.53 ? 637  LYS A NZ    1 
ATOM   4973  N  N     . GLY A 1  638  ? 139.043 45.154  3.771   1.00 79.24  ? 638  GLY A N     1 
ATOM   4974  C  CA    . GLY A 1  638  ? 138.317 44.431  2.729   1.00 79.08  ? 638  GLY A CA    1 
ATOM   4975  C  C     . GLY A 1  638  ? 136.844 44.241  3.022   1.00 84.97  ? 638  GLY A C     1 
ATOM   4976  O  O     . GLY A 1  638  ? 136.424 44.482  4.155   1.00 86.17  ? 638  GLY A O     1 
ATOM   4977  N  N     . PRO A 1  639  ? 135.996 43.848  2.042   1.00 81.08  ? 639  PRO A N     1 
ATOM   4978  C  CA    . PRO A 1  639  ? 134.572 43.682  2.354   1.00 80.40  ? 639  PRO A CA    1 
ATOM   4979  C  C     . PRO A 1  639  ? 134.308 42.335  3.004   1.00 85.00  ? 639  PRO A C     1 
ATOM   4980  O  O     . PRO A 1  639  ? 133.316 42.186  3.720   1.00 84.21  ? 639  PRO A O     1 
ATOM   4981  C  CB    . PRO A 1  639  ? 133.898 43.804  0.993   1.00 81.31  ? 639  PRO A CB    1 
ATOM   4982  C  CG    . PRO A 1  639  ? 134.890 43.250  0.059   1.00 86.28  ? 639  PRO A CG    1 
ATOM   4983  C  CD    . PRO A 1  639  ? 136.270 43.505  0.635   1.00 82.68  ? 639  PRO A CD    1 
ATOM   4984  N  N     . GLN A 1  640  ? 135.208 41.360  2.753   1.00 82.30  ? 640  GLN A N     1 
ATOM   4985  C  CA    . GLN A 1  640  ? 135.097 40.019  3.292   1.00 82.05  ? 640  GLN A CA    1 
ATOM   4986  C  C     . GLN A 1  640  ? 135.498 39.990  4.772   1.00 83.69  ? 640  GLN A C     1 
ATOM   4987  O  O     . GLN A 1  640  ? 134.832 39.344  5.599   1.00 82.68  ? 640  GLN A O     1 
ATOM   4988  C  CB    . GLN A 1  640  ? 135.891 39.046  2.430   1.00 84.04  ? 640  GLN A CB    1 
ATOM   4989  C  CG    . GLN A 1  640  ? 134.986 38.146  1.580   1.00 120.88 ? 640  GLN A CG    1 
ATOM   4990  C  CD    . GLN A 1  640  ? 134.471 36.904  2.310   1.00 159.96 ? 640  GLN A CD    1 
ATOM   4991  O  OE1   . GLN A 1  640  ? 135.131 36.330  3.196   1.00 158.13 ? 640  GLN A OE1   1 
ATOM   4992  N  NE2   . GLN A 1  640  ? 133.292 36.423  1.913   1.00 156.45 ? 640  GLN A NE2   1 
ATOM   4993  N  N     . VAL A 1  641  ? 136.537 40.762  5.110   1.00 78.65  ? 641  VAL A N     1 
ATOM   4994  C  CA    . VAL A 1  641  ? 137.019 40.894  6.483   1.00 78.34  ? 641  VAL A CA    1 
ATOM   4995  C  C     . VAL A 1  641  ? 136.016 41.679  7.334   1.00 81.07  ? 641  VAL A C     1 
ATOM   4996  O  O     . VAL A 1  641  ? 135.846 41.377  8.514   1.00 81.58  ? 641  VAL A O     1 
ATOM   4997  C  CB    . VAL A 1  641  ? 138.414 41.539  6.500   1.00 82.91  ? 641  VAL A CB    1 
ATOM   4998  C  CG1   . VAL A 1  641  ? 138.957 41.673  7.920   1.00 83.45  ? 641  VAL A CG1   1 
ATOM   4999  C  CG2   . VAL A 1  641  ? 139.372 40.749  5.625   1.00 82.94  ? 641  VAL A CG2   1 
ATOM   5000  N  N     . CYS A 1  642  ? 135.359 42.682  6.744   1.00 75.78  ? 642  CYS A N     1 
ATOM   5001  C  CA    . CYS A 1  642  ? 134.396 43.487  7.472   1.00 75.13  ? 642  CYS A CA    1 
ATOM   5002  C  C     . CYS A 1  642  ? 133.146 42.688  7.770   1.00 77.23  ? 642  CYS A C     1 
ATOM   5003  O  O     . CYS A 1  642  ? 132.557 42.848  8.839   1.00 77.28  ? 642  CYS A O     1 
ATOM   5004  C  CB    . CYS A 1  642  ? 134.069 44.766  6.715   1.00 75.49  ? 642  CYS A CB    1 
ATOM   5005  S  SG    . CYS A 1  642  ? 133.029 45.919  7.647   1.00 79.91  ? 642  CYS A SG    1 
ATOM   5006  N  N     . ALA A 1  643  ? 132.747 41.821  6.824   1.00 71.01  ? 643  ALA A N     1 
ATOM   5007  C  CA    . ALA A 1  643  ? 131.556 40.996  6.938   1.00 69.32  ? 643  ALA A CA    1 
ATOM   5008  C  C     . ALA A 1  643  ? 131.754 39.956  8.066   1.00 73.54  ? 643  ALA A C     1 
ATOM   5009  O  O     . ALA A 1  643  ? 130.811 39.621  8.830   1.00 73.28  ? 643  ALA A O     1 
ATOM   5010  C  CB    . ALA A 1  643  ? 131.280 40.327  5.597   1.00 69.07  ? 643  ALA A CB    1 
ATOM   5011  N  N     . LYS A 1  644  ? 133.019 39.485  8.184   1.00 69.17  ? 644  LYS A N     1 
ATOM   5012  C  CA    . LYS A 1  644  ? 133.417 38.547  9.220   1.00 68.77  ? 644  LYS A CA    1 
ATOM   5013  C  C     . LYS A 1  644  ? 133.312 39.267  10.604  1.00 73.62  ? 644  LYS A C     1 
ATOM   5014  O  O     . LYS A 1  644  ? 132.687 38.731  11.525  1.00 73.97  ? 644  LYS A O     1 
ATOM   5015  C  CB    . LYS A 1  644  ? 134.814 37.976  8.904   1.00 70.61  ? 644  LYS A CB    1 
ATOM   5016  C  CG    . LYS A 1  644  ? 135.254 36.801  9.784   1.00 93.14  ? 644  LYS A CG    1 
ATOM   5017  C  CD    . LYS A 1  644  ? 134.429 35.493  9.616   1.00 106.77 ? 644  LYS A CD    1 
ATOM   5018  C  CE    . LYS A 1  644  ? 133.993 34.887  10.945  1.00 112.39 ? 644  LYS A CE    1 
ATOM   5019  N  NZ    . LYS A 1  644  ? 134.198 33.414  11.011  1.00 113.75 ? 644  LYS A NZ    1 
ATOM   5020  N  N     . LEU A 1  645  ? 133.805 40.534  10.686  1.00 69.45  ? 645  LEU A N     1 
ATOM   5021  C  CA    . LEU A 1  645  ? 133.782 41.416  11.864  1.00 68.37  ? 645  LEU A CA    1 
ATOM   5022  C  C     . LEU A 1  645  ? 132.404 41.551  12.470  1.00 71.31  ? 645  LEU A C     1 
ATOM   5023  O  O     . LEU A 1  645  ? 132.280 41.541  13.689  1.00 71.52  ? 645  LEU A O     1 
ATOM   5024  C  CB    . LEU A 1  645  ? 134.327 42.808  11.513  1.00 67.93  ? 645  LEU A CB    1 
ATOM   5025  C  CG    . LEU A 1  645  ? 134.178 43.882  12.588  1.00 72.01  ? 645  LEU A CG    1 
ATOM   5026  C  CD1   . LEU A 1  645  ? 135.134 43.635  13.748  1.00 72.25  ? 645  LEU A CD1   1 
ATOM   5027  C  CD2   . LEU A 1  645  ? 134.300 45.277  11.990  1.00 74.18  ? 645  LEU A CD2   1 
ATOM   5028  N  N     . PHE A 1  646  ? 131.380 41.714  11.625  1.00 67.84  ? 646  PHE A N     1 
ATOM   5029  C  CA    . PHE A 1  646  ? 129.988 41.817  12.057  1.00 67.86  ? 646  PHE A CA    1 
ATOM   5030  C  C     . PHE A 1  646  ? 129.696 40.632  12.941  1.00 72.48  ? 646  PHE A C     1 
ATOM   5031  O  O     . PHE A 1  646  ? 129.521 40.809  14.154  1.00 72.06  ? 646  PHE A O     1 
ATOM   5032  C  CB    . PHE A 1  646  ? 129.036 41.806  10.839  1.00 68.65  ? 646  PHE A CB    1 
ATOM   5033  C  CG    . PHE A 1  646  ? 128.849 43.171  10.251  1.00 69.61  ? 646  PHE A CG    1 
ATOM   5034  C  CD1   . PHE A 1  646  ? 129.722 43.650  9.279   1.00 70.99  ? 646  PHE A CD1   1 
ATOM   5035  C  CD2   . PHE A 1  646  ? 127.841 44.009  10.713  1.00 73.02  ? 646  PHE A CD2   1 
ATOM   5036  C  CE1   . PHE A 1  646  ? 129.593 44.945  8.781   1.00 74.53  ? 646  PHE A CE1   1 
ATOM   5037  C  CE2   . PHE A 1  646  ? 127.697 45.303  10.206  1.00 74.35  ? 646  PHE A CE2   1 
ATOM   5038  C  CZ    . PHE A 1  646  ? 128.575 45.766  9.243   1.00 73.34  ? 646  PHE A CZ    1 
ATOM   5039  N  N     . GLY A 1  647  ? 129.781 39.441  12.323  1.00 69.02  ? 647  GLY A N     1 
ATOM   5040  C  CA    . GLY A 1  647  ? 129.546 38.133  12.924  1.00 68.84  ? 647  GLY A CA    1 
ATOM   5041  C  C     . GLY A 1  647  ? 130.266 37.943  14.229  1.00 72.81  ? 647  GLY A C     1 
ATOM   5042  O  O     . GLY A 1  647  ? 129.645 37.580  15.233  1.00 73.49  ? 647  GLY A O     1 
ATOM   5043  N  N     . ASN A 1  648  ? 131.566 38.276  14.220  1.00 68.32  ? 648  ASN A N     1 
ATOM   5044  C  CA    . ASN A 1  648  ? 132.454 38.208  15.368  1.00 68.38  ? 648  ASN A CA    1 
ATOM   5045  C  C     . ASN A 1  648  ? 131.986 39.041  16.554  1.00 70.50  ? 648  ASN A C     1 
ATOM   5046  O  O     . ASN A 1  648  ? 131.676 38.460  17.602  1.00 68.39  ? 648  ASN A O     1 
ATOM   5047  C  CB    . ASN A 1  648  ? 133.903 38.435  14.944  1.00 69.64  ? 648  ASN A CB    1 
ATOM   5048  C  CG    . ASN A 1  648  ? 134.418 37.183  14.284  1.00 98.32  ? 648  ASN A CG    1 
ATOM   5049  O  OD1   . ASN A 1  648  ? 133.637 36.302  13.880  1.00 97.52  ? 648  ASN A OD1   1 
ATOM   5050  N  ND2   . ASN A 1  648  ? 135.726 37.030  14.226  1.00 90.05  ? 648  ASN A ND2   1 
ATOM   5051  N  N     . ILE A 1  649  ? 131.815 40.370  16.354  1.00 67.68  ? 649  ILE A N     1 
ATOM   5052  C  CA    . ILE A 1  649  ? 131.294 41.284  17.380  1.00 67.99  ? 649  ILE A CA    1 
ATOM   5053  C  C     . ILE A 1  649  ? 129.981 40.696  17.961  1.00 73.51  ? 649  ILE A C     1 
ATOM   5054  O  O     . ILE A 1  649  ? 129.863 40.542  19.190  1.00 74.97  ? 649  ILE A O     1 
ATOM   5055  C  CB    . ILE A 1  649  ? 131.114 42.728  16.840  1.00 69.79  ? 649  ILE A CB    1 
ATOM   5056  C  CG1   . ILE A 1  649  ? 132.462 43.391  16.553  1.00 69.47  ? 649  ILE A CG1   1 
ATOM   5057  C  CG2   . ILE A 1  649  ? 130.287 43.584  17.799  1.00 70.39  ? 649  ILE A CG2   1 
ATOM   5058  C  CD1   . ILE A 1  649  ? 132.312 44.648  15.704  1.00 69.38  ? 649  ILE A CD1   1 
ATOM   5059  N  N     . GLN A 1  650  ? 129.043 40.294  17.076  1.00 67.56  ? 650  GLN A N     1 
ATOM   5060  C  CA    . GLN A 1  650  ? 127.804 39.711  17.565  1.00 66.24  ? 650  GLN A CA    1 
ATOM   5061  C  C     . GLN A 1  650  ? 127.965 38.405  18.347  1.00 68.82  ? 650  GLN A C     1 
ATOM   5062  O  O     . GLN A 1  650  ? 127.517 38.365  19.489  1.00 68.54  ? 650  GLN A O     1 
ATOM   5063  C  CB    . GLN A 1  650  ? 126.621 39.778  16.579  1.00 66.19  ? 650  GLN A CB    1 
ATOM   5064  C  CG    . GLN A 1  650  ? 126.957 39.582  15.122  1.00 70.91  ? 650  GLN A CG    1 
ATOM   5065  C  CD    . GLN A 1  650  ? 125.834 39.999  14.212  1.00 85.32  ? 650  GLN A CD    1 
ATOM   5066  O  OE1   . GLN A 1  650  ? 124.804 39.317  14.084  1.00 84.48  ? 650  GLN A OE1   1 
ATOM   5067  N  NE2   . GLN A 1  650  ? 126.022 41.113  13.532  1.00 72.99  ? 650  GLN A NE2   1 
ATOM   5068  N  N     . LYS A 1  651  ? 128.723 37.426  17.836  1.00 65.39  ? 651  LYS A N     1 
ATOM   5069  C  CA    . LYS A 1  651  ? 128.959 36.166  18.577  1.00 66.75  ? 651  LYS A CA    1 
ATOM   5070  C  C     . LYS A 1  651  ? 129.432 36.400  20.057  1.00 74.17  ? 651  LYS A C     1 
ATOM   5071  O  O     . LYS A 1  651  ? 128.943 35.730  20.989  1.00 73.89  ? 651  LYS A O     1 
ATOM   5072  C  CB    . LYS A 1  651  ? 129.932 35.215  17.825  1.00 67.96  ? 651  LYS A CB    1 
ATOM   5073  C  CG    . LYS A 1  651  ? 129.305 34.459  16.655  1.00 70.48  ? 651  LYS A CG    1 
ATOM   5074  C  CD    . LYS A 1  651  ? 130.306 34.107  15.541  1.00 78.11  ? 651  LYS A CD    1 
ATOM   5075  C  CE    . LYS A 1  651  ? 129.753 34.194  14.122  1.00 87.34  ? 651  LYS A CE    1 
ATOM   5076  N  NZ    . LYS A 1  651  ? 128.495 33.397  13.921  1.00 92.27  ? 651  LYS A NZ    1 
ATOM   5077  N  N     . VAL A 1  652  ? 130.343 37.392  20.250  1.00 71.51  ? 652  VAL A N     1 
ATOM   5078  C  CA    . VAL A 1  652  ? 130.916 37.754  21.555  1.00 71.71  ? 652  VAL A CA    1 
ATOM   5079  C  C     . VAL A 1  652  ? 129.897 38.485  22.379  1.00 77.13  ? 652  VAL A C     1 
ATOM   5080  O  O     . VAL A 1  652  ? 129.543 38.031  23.474  1.00 77.64  ? 652  VAL A O     1 
ATOM   5081  C  CB    . VAL A 1  652  ? 132.192 38.625  21.454  1.00 74.35  ? 652  VAL A CB    1 
ATOM   5082  C  CG1   . VAL A 1  652  ? 132.813 38.818  22.822  1.00 74.62  ? 652  VAL A CG1   1 
ATOM   5083  C  CG2   . VAL A 1  652  ? 133.197 38.031  20.496  1.00 73.59  ? 652  VAL A CG2   1 
ATOM   5084  N  N     . VAL A 1  653  ? 129.497 39.671  21.881  1.00 73.04  ? 653  VAL A N     1 
ATOM   5085  C  CA    . VAL A 1  653  ? 128.595 40.574  22.575  1.00 72.67  ? 653  VAL A CA    1 
ATOM   5086  C  C     . VAL A 1  653  ? 127.305 39.897  22.998  1.00 73.10  ? 653  VAL A C     1 
ATOM   5087  O  O     . VAL A 1  653  ? 126.947 39.966  24.187  1.00 72.58  ? 653  VAL A O     1 
ATOM   5088  C  CB    . VAL A 1  653  ? 128.410 41.926  21.848  1.00 76.59  ? 653  VAL A CB    1 
ATOM   5089  C  CG1   . VAL A 1  653  ? 127.492 42.854  22.635  1.00 77.05  ? 653  VAL A CG1   1 
ATOM   5090  C  CG2   . VAL A 1  653  ? 129.759 42.601  21.614  1.00 76.65  ? 653  VAL A CG2   1 
ATOM   5091  N  N     . ASN A 1  654  ? 126.671 39.165  22.058  1.00 67.05  ? 654  ASN A N     1 
ATOM   5092  C  CA    . ASN A 1  654  ? 125.426 38.458  22.338  1.00 66.08  ? 654  ASN A CA    1 
ATOM   5093  C  C     . ASN A 1  654  ? 125.632 37.433  23.402  1.00 71.32  ? 654  ASN A C     1 
ATOM   5094  O  O     . ASN A 1  654  ? 124.805 37.354  24.318  1.00 71.33  ? 654  ASN A O     1 
ATOM   5095  C  CB    . ASN A 1  654  ? 124.841 37.819  21.101  1.00 62.85  ? 654  ASN A CB    1 
ATOM   5096  C  CG    . ASN A 1  654  ? 124.386 38.789  20.064  1.00 84.29  ? 654  ASN A CG    1 
ATOM   5097  O  OD1   . ASN A 1  654  ? 123.877 39.874  20.377  1.00 84.08  ? 654  ASN A OD1   1 
ATOM   5098  N  ND2   . ASN A 1  654  ? 124.525 38.388  18.803  1.00 71.49  ? 654  ASN A ND2   1 
ATOM   5099  N  N     . PHE A 1  655  ? 126.756 36.673  23.316  1.00 68.90  ? 655  PHE A N     1 
ATOM   5100  C  CA    . PHE A 1  655  ? 127.079 35.655  24.316  1.00 69.74  ? 655  PHE A CA    1 
ATOM   5101  C  C     . PHE A 1  655  ? 127.137 36.295  25.704  1.00 73.17  ? 655  PHE A C     1 
ATOM   5102  O  O     . PHE A 1  655  ? 126.436 35.854  26.623  1.00 70.22  ? 655  PHE A O     1 
ATOM   5103  C  CB    . PHE A 1  655  ? 128.397 34.930  23.986  1.00 71.86  ? 655  PHE A CB    1 
ATOM   5104  C  CG    . PHE A 1  655  ? 128.872 34.089  25.145  1.00 74.57  ? 655  PHE A CG    1 
ATOM   5105  C  CD1   . PHE A 1  655  ? 128.404 32.794  25.320  1.00 77.94  ? 655  PHE A CD1   1 
ATOM   5106  C  CD2   . PHE A 1  655  ? 129.744 34.612  26.095  1.00 77.73  ? 655  PHE A CD2   1 
ATOM   5107  C  CE1   . PHE A 1  655  ? 128.805 32.036  26.418  1.00 80.20  ? 655  PHE A CE1   1 
ATOM   5108  C  CE2   . PHE A 1  655  ? 130.135 33.857  27.201  1.00 81.99  ? 655  PHE A CE2   1 
ATOM   5109  C  CZ    . PHE A 1  655  ? 129.668 32.572  27.353  1.00 80.45  ? 655  PHE A CZ    1 
ATOM   5110  N  N     . TRP A 1  656  ? 127.962 37.367  25.818  1.00 72.39  ? 656  TRP A N     1 
ATOM   5111  C  CA    . TRP A 1  656  ? 128.146 38.133  27.039  1.00 73.96  ? 656  TRP A CA    1 
ATOM   5112  C  C     . TRP A 1  656  ? 126.813 38.634  27.580  1.00 76.40  ? 656  TRP A C     1 
ATOM   5113  O  O     . TRP A 1  656  ? 126.549 38.433  28.777  1.00 77.59  ? 656  TRP A O     1 
ATOM   5114  C  CB    . TRP A 1  656  ? 129.149 39.270  26.848  1.00 73.72  ? 656  TRP A CB    1 
ATOM   5115  C  CG    . TRP A 1  656  ? 129.337 40.057  28.111  1.00 76.94  ? 656  TRP A CG    1 
ATOM   5116  C  CD1   . TRP A 1  656  ? 130.152 39.750  29.161  1.00 81.13  ? 656  TRP A CD1   1 
ATOM   5117  C  CD2   . TRP A 1  656  ? 128.596 41.212  28.505  1.00 77.48  ? 656  TRP A CD2   1 
ATOM   5118  N  NE1   . TRP A 1  656  ? 130.000 40.674  30.168  1.00 81.67  ? 656  TRP A NE1   1 
ATOM   5119  C  CE2   . TRP A 1  656  ? 129.053 41.585  29.790  1.00 82.91  ? 656  TRP A CE2   1 
ATOM   5120  C  CE3   . TRP A 1  656  ? 127.590 41.975  27.891  1.00 78.47  ? 656  TRP A CE3   1 
ATOM   5121  C  CZ2   . TRP A 1  656  ? 128.545 42.691  30.467  1.00 83.39  ? 656  TRP A CZ2   1 
ATOM   5122  C  CZ3   . TRP A 1  656  ? 127.083 43.072  28.564  1.00 81.02  ? 656  TRP A CZ3   1 
ATOM   5123  C  CH2   . TRP A 1  656  ? 127.559 43.422  29.836  1.00 83.13  ? 656  TRP A CH2   1 
ATOM   5124  N  N     . LEU A 1  657  ? 125.972 39.245  26.695  1.00 69.28  ? 657  LEU A N     1 
ATOM   5125  C  CA    . LEU A 1  657  ? 124.650 39.730  27.057  1.00 68.58  ? 657  LEU A CA    1 
ATOM   5126  C  C     . LEU A 1  657  ? 123.718 38.595  27.488  1.00 74.27  ? 657  LEU A C     1 
ATOM   5127  O  O     . LEU A 1  657  ? 122.982 38.798  28.447  1.00 74.56  ? 657  LEU A O     1 
ATOM   5128  C  CB    . LEU A 1  657  ? 124.015 40.598  25.959  1.00 67.65  ? 657  LEU A CB    1 
ATOM   5129  C  CG    . LEU A 1  657  ? 122.732 41.391  26.355  1.00 72.74  ? 657  LEU A CG    1 
ATOM   5130  C  CD1   . LEU A 1  657  ? 123.068 42.654  27.103  1.00 74.63  ? 657  LEU A CD1   1 
ATOM   5131  C  CD2   . LEU A 1  657  ? 121.908 41.770  25.157  1.00 72.23  ? 657  LEU A CD2   1 
ATOM   5132  N  N     . LEU A 1  658  ? 123.769 37.391  26.845  1.00 71.78  ? 658  LEU A N     1 
ATOM   5133  C  CA    . LEU A 1  658  ? 122.918 36.256  27.268  1.00 72.34  ? 658  LEU A CA    1 
ATOM   5134  C  C     . LEU A 1  658  ? 123.101 36.034  28.749  1.00 79.20  ? 658  LEU A C     1 
ATOM   5135  O  O     . LEU A 1  658  ? 122.125 35.963  29.487  1.00 77.76  ? 658  LEU A O     1 
ATOM   5136  C  CB    . LEU A 1  658  ? 123.233 34.941  26.506  1.00 71.64  ? 658  LEU A CB    1 
ATOM   5137  C  CG    . LEU A 1  658  ? 122.618 33.619  27.067  1.00 75.84  ? 658  LEU A CG    1 
ATOM   5138  C  CD1   . LEU A 1  658  ? 121.265 33.354  26.501  1.00 74.64  ? 658  LEU A CD1   1 
ATOM   5139  C  CD2   . LEU A 1  658  ? 123.432 32.433  26.673  1.00 79.10  ? 658  LEU A CD2   1 
ATOM   5140  N  N     . HIS A 1  659  ? 124.369 36.016  29.168  1.00 80.28  ? 659  HIS A N     1 
ATOM   5141  C  CA    . HIS A 1  659  ? 124.817 35.802  30.532  1.00 83.18  ? 659  HIS A CA    1 
ATOM   5142  C  C     . HIS A 1  659  ? 124.713 36.978  31.469  1.00 87.57  ? 659  HIS A C     1 
ATOM   5143  O  O     . HIS A 1  659  ? 124.589 36.759  32.671  1.00 89.33  ? 659  HIS A O     1 
ATOM   5144  C  CB    . HIS A 1  659  ? 126.191 35.139  30.556  1.00 85.37  ? 659  HIS A CB    1 
ATOM   5145  C  CG    . HIS A 1  659  ? 126.147 33.804  29.897  1.00 88.93  ? 659  HIS A CG    1 
ATOM   5146  N  ND1   . HIS A 1  659  ? 125.712 32.691  30.576  1.00 91.56  ? 659  HIS A ND1   1 
ATOM   5147  C  CD2   . HIS A 1  659  ? 126.356 33.474  28.602  1.00 90.37  ? 659  HIS A CD2   1 
ATOM   5148  C  CE1   . HIS A 1  659  ? 125.698 31.711  29.683  1.00 90.60  ? 659  HIS A CE1   1 
ATOM   5149  N  NE2   . HIS A 1  659  ? 126.104 32.130  28.489  1.00 90.09  ? 659  HIS A NE2   1 
ATOM   5150  N  N     . ASN A 1  660  ? 124.715 38.203  30.954  1.00 82.85  ? 660  ASN A N     1 
ATOM   5151  C  CA    . ASN A 1  660  ? 124.544 39.381  31.805  1.00 83.74  ? 660  ASN A CA    1 
ATOM   5152  C  C     . ASN A 1  660  ? 123.045 39.697  31.980  1.00 86.30  ? 660  ASN A C     1 
ATOM   5153  O  O     . ASN A 1  660  ? 122.592 40.073  33.073  1.00 84.29  ? 660  ASN A O     1 
ATOM   5154  C  CB    . ASN A 1  660  ? 125.259 40.588  31.193  1.00 86.26  ? 660  ASN A CB    1 
ATOM   5155  C  CG    . ASN A 1  660  ? 125.408 41.741  32.151  1.00 104.12 ? 660  ASN A CG    1 
ATOM   5156  O  OD1   . ASN A 1  660  ? 126.382 41.815  32.912  1.00 100.61 ? 660  ASN A OD1   1 
ATOM   5157  N  ND2   . ASN A 1  660  ? 124.441 42.655  32.138  1.00 88.52  ? 660  ASN A ND2   1 
ATOM   5158  N  N     . GLY A 1  661  ? 122.317 39.560  30.868  1.00 83.38  ? 661  GLY A N     1 
ATOM   5159  C  CA    . GLY A 1  661  ? 120.899 39.870  30.733  1.00 82.81  ? 661  GLY A CA    1 
ATOM   5160  C  C     . GLY A 1  661  ? 120.675 41.366  30.617  1.00 85.30  ? 661  GLY A C     1 
ATOM   5161  O  O     . GLY A 1  661  ? 121.564 42.169  30.940  1.00 86.09  ? 661  GLY A O     1 
ATOM   5162  N  N     . PHE A 1  662  ? 119.492 41.745  30.132  1.00 78.83  ? 662  PHE A N     1 
ATOM   5163  C  CA    . PHE A 1  662  ? 119.046 43.128  30.033  1.00 78.30  ? 662  PHE A CA    1 
ATOM   5164  C  C     . PHE A 1  662  ? 117.531 43.092  29.953  1.00 81.56  ? 662  PHE A C     1 
ATOM   5165  O  O     . PHE A 1  662  ? 116.988 42.183  29.326  1.00 79.56  ? 662  PHE A O     1 
ATOM   5166  C  CB    . PHE A 1  662  ? 119.684 43.863  28.843  1.00 79.61  ? 662  PHE A CB    1 
ATOM   5167  C  CG    . PHE A 1  662  ? 119.296 45.320  28.728  1.00 81.85  ? 662  PHE A CG    1 
ATOM   5168  C  CD1   . PHE A 1  662  ? 119.951 46.292  29.472  1.00 86.81  ? 662  PHE A CD1   1 
ATOM   5169  C  CD2   . PHE A 1  662  ? 118.277 45.721  27.868  1.00 83.47  ? 662  PHE A CD2   1 
ATOM   5170  C  CE1   . PHE A 1  662  ? 119.578 47.642  29.372  1.00 88.17  ? 662  PHE A CE1   1 
ATOM   5171  C  CE2   . PHE A 1  662  ? 117.899 47.065  27.776  1.00 86.59  ? 662  PHE A CE2   1 
ATOM   5172  C  CZ    . PHE A 1  662  ? 118.553 48.018  28.526  1.00 85.78  ? 662  PHE A CZ    1 
ATOM   5173  N  N     . SER A 1  663  ? 116.846 44.032  30.639  1.00 79.83  ? 663  SER A N     1 
ATOM   5174  C  CA    . SER A 1  663  ? 115.375 44.093  30.699  1.00 79.70  ? 663  SER A CA    1 
ATOM   5175  C  C     . SER A 1  663  ? 114.876 45.548  30.672  1.00 85.92  ? 663  SER A C     1 
ATOM   5176  O  O     . SER A 1  663  ? 115.688 46.441  30.475  1.00 86.16  ? 663  SER A O     1 
ATOM   5177  C  CB    . SER A 1  663  ? 114.895 43.388  31.962  1.00 82.73  ? 663  SER A CB    1 
ATOM   5178  O  OG    . SER A 1  663  ? 113.485 43.276  32.026  1.00 87.67  ? 663  SER A OG    1 
ATOM   5179  N  N     . THR A 1  664  ? 113.546 45.780  30.825  1.00 83.81  ? 664  THR A N     1 
ATOM   5180  C  CA    . THR A 1  664  ? 112.883 47.101  30.893  1.00 84.28  ? 664  THR A CA    1 
ATOM   5181  C  C     . THR A 1  664  ? 111.447 46.995  31.468  1.00 89.34  ? 664  THR A C     1 
ATOM   5182  O  O     . THR A 1  664  ? 110.650 46.198  30.976  1.00 88.42  ? 664  THR A O     1 
ATOM   5183  C  CB    . THR A 1  664  ? 113.066 47.919  29.604  1.00 92.02  ? 664  THR A CB    1 
ATOM   5184  O  OG1   . THR A 1  664  ? 112.934 49.304  29.905  1.00 94.64  ? 664  THR A OG1   1 
ATOM   5185  C  CG2   . THR A 1  664  ? 112.124 47.514  28.501  1.00 89.73  ? 664  THR A CG2   1 
ATOM   5186  N  N     . GLY A 1  665  ? 111.163 47.739  32.536  1.00 88.12  ? 665  GLY A N     1 
ATOM   5187  C  CA    . GLY A 1  665  ? 109.874 47.685  33.230  1.00 89.25  ? 665  GLY A CA    1 
ATOM   5188  C  C     . GLY A 1  665  ? 109.280 49.033  33.565  1.00 94.97  ? 665  GLY A C     1 
ATOM   5189  O  O     . GLY A 1  665  ? 109.924 50.054  33.296  1.00 95.29  ? 665  GLY A O     1 
ATOM   5190  N  N     . ILE A 1  666  ? 108.043 49.063  34.154  1.00 92.16  ? 666  ILE A N     1 
ATOM   5191  C  CA    . ILE A 1  666  ? 107.376 50.344  34.512  1.00 93.02  ? 666  ILE A CA    1 
ATOM   5192  C  C     . ILE A 1  666  ? 108.258 51.176  35.397  1.00 99.33  ? 666  ILE A C     1 
ATOM   5193  O  O     . ILE A 1  666  ? 108.265 52.398  35.252  1.00 99.70  ? 666  ILE A O     1 
ATOM   5194  C  CB    . ILE A 1  666  ? 105.936 50.307  35.099  1.00 96.29  ? 666  ILE A CB    1 
ATOM   5195  C  CG1   . ILE A 1  666  ? 105.495 48.928  35.553  1.00 97.57  ? 666  ILE A CG1   1 
ATOM   5196  C  CG2   . ILE A 1  666  ? 104.911 51.074  34.262  1.00 94.45  ? 666  ILE A CG2   1 
ATOM   5197  C  CD1   . ILE A 1  666  ? 106.171 48.538  36.882  1.00 113.16 ? 666  ILE A CD1   1 
ATOM   5198  N  N     . GLY A 1  667  ? 109.031 50.508  36.259  1.00 96.54  ? 667  GLY A N     1 
ATOM   5199  C  CA    . GLY A 1  667  ? 109.997 51.154  37.138  1.00 97.21  ? 667  GLY A CA    1 
ATOM   5200  C  C     . GLY A 1  667  ? 110.927 52.126  36.425  1.00 99.57  ? 667  GLY A C     1 
ATOM   5201  O  O     . GLY A 1  667  ? 111.321 53.142  37.011  1.00 100.53 ? 667  GLY A O     1 
ATOM   5202  N  N     . ASP A 1  668  ? 111.265 51.830  35.142  1.00 93.02  ? 668  ASP A N     1 
ATOM   5203  C  CA    . ASP A 1  668  ? 112.111 52.672  34.297  1.00 91.60  ? 668  ASP A CA    1 
ATOM   5204  C  C     . ASP A 1  668  ? 111.418 53.974  33.856  1.00 96.29  ? 668  ASP A C     1 
ATOM   5205  O  O     . ASP A 1  668  ? 112.105 54.910  33.432  1.00 95.89  ? 668  ASP A O     1 
ATOM   5206  C  CB    . ASP A 1  668  ? 112.645 51.890  33.094  1.00 91.47  ? 668  ASP A CB    1 
ATOM   5207  C  CG    . ASP A 1  668  ? 113.615 50.791  33.464  1.00 95.97  ? 668  ASP A CG    1 
ATOM   5208  O  OD1   . ASP A 1  668  ? 114.726 51.114  33.940  1.00 95.67  ? 668  ASP A OD1   1 
ATOM   5209  O  OD2   . ASP A 1  668  ? 113.283 49.611  33.238  1.00 99.32  ? 668  ASP A OD2   1 
ATOM   5210  N  N     . THR A 1  669  ? 110.072 54.041  33.959  1.00 93.50  ? 669  THR A N     1 
ATOM   5211  C  CA    . THR A 1  669  ? 109.308 55.247  33.616  1.00 93.91  ? 669  THR A CA    1 
ATOM   5212  C  C     . THR A 1  669  ? 109.040 56.100  34.860  1.00 101.12 ? 669  THR A C     1 
ATOM   5213  O  O     . THR A 1  669  ? 108.841 57.312  34.745  1.00 102.69 ? 669  THR A O     1 
ATOM   5214  C  CB    . THR A 1  669  ? 108.031 54.929  32.825  1.00 99.78  ? 669  THR A CB    1 
ATOM   5215  O  OG1   . THR A 1  669  ? 107.112 54.203  33.642  1.00 97.60  ? 669  THR A OG1   1 
ATOM   5216  C  CG2   . THR A 1  669  ? 108.311 54.187  31.524  1.00 98.76  ? 669  THR A CG2   1 
ATOM   5217  N  N     . ILE A 1  670  ? 109.053 55.481  36.049  1.00 97.95  ? 670  ILE A N     1 
ATOM   5218  C  CA    . ILE A 1  670  ? 108.829 56.193  37.298  1.00 99.19  ? 670  ILE A CA    1 
ATOM   5219  C  C     . ILE A 1  670  ? 109.921 57.215  37.542  1.00 104.70 ? 670  ILE A C     1 
ATOM   5220  O  O     . ILE A 1  670  ? 111.109 56.872  37.561  1.00 103.94 ? 670  ILE A O     1 
ATOM   5221  C  CB    . ILE A 1  670  ? 108.613 55.221  38.476  1.00 103.01 ? 670  ILE A CB    1 
ATOM   5222  C  CG1   . ILE A 1  670  ? 107.184 54.686  38.459  1.00 103.47 ? 670  ILE A CG1   1 
ATOM   5223  C  CG2   . ILE A 1  670  ? 108.915 55.868  39.827  1.00 105.50 ? 670  ILE A CG2   1 
ATOM   5224  C  CD1   . ILE A 1  670  ? 107.105 53.222  38.362  1.00 114.65 ? 670  ILE A CD1   1 
ATOM   5225  N  N     . ALA A 1  671  ? 109.504 58.481  37.664  1.00 102.82 ? 671  ALA A N     1 
ATOM   5226  C  CA    . ALA A 1  671  ? 110.393 59.597  37.945  1.00 103.70 ? 671  ALA A CA    1 
ATOM   5227  C  C     . ALA A 1  671  ? 110.324 59.891  39.435  1.00 110.25 ? 671  ALA A C     1 
ATOM   5228  O  O     . ALA A 1  671  ? 109.228 59.977  40.002  1.00 110.41 ? 671  ALA A O     1 
ATOM   5229  C  CB    . ALA A 1  671  ? 109.969 60.815  37.146  1.00 104.14 ? 671  ALA A CB    1 
ATOM   5230  N  N     . ASP A 1  672  ? 111.498 60.014  40.072  1.00 108.47 ? 672  ASP A N     1 
ATOM   5231  C  CA    . ASP A 1  672  ? 111.649 60.272  41.510  1.00 110.33 ? 672  ASP A CA    1 
ATOM   5232  C  C     . ASP A 1  672  ? 110.751 61.427  42.028  1.00 114.00 ? 672  ASP A C     1 
ATOM   5233  O  O     . ASP A 1  672  ? 110.636 62.447  41.352  1.00 113.14 ? 672  ASP A O     1 
ATOM   5234  C  CB    . ASP A 1  672  ? 113.157 60.347  41.880  1.00 113.06 ? 672  ASP A CB    1 
ATOM   5235  C  CG    . ASP A 1  672  ? 113.624 61.320  42.946  1.00 128.10 ? 672  ASP A CG    1 
ATOM   5236  O  OD1   . ASP A 1  672  ? 114.030 62.444  42.585  1.00 132.83 ? 672  ASP A OD1   1 
ATOM   5237  O  OD2   . ASP A 1  672  ? 113.742 60.902  44.117  1.00 131.44 ? 672  ASP A OD2   1 
ATOM   5238  N  N     . GLY A 1  673  ? 110.040 61.163  43.138  1.00 111.04 ? 673  GLY A N     1 
ATOM   5239  C  CA    . GLY A 1  673  ? 109.081 62.029  43.841  1.00 111.96 ? 673  GLY A CA    1 
ATOM   5240  C  C     . GLY A 1  673  ? 109.239 63.543  43.793  1.00 115.98 ? 673  GLY A C     1 
ATOM   5241  O  O     . GLY A 1  673  ? 108.305 64.237  43.372  1.00 114.38 ? 673  GLY A O     1 
ATOM   5242  N  N     . PRO A 1  674  ? 110.389 64.110  44.234  1.00 114.20 ? 674  PRO A N     1 
ATOM   5243  C  CA    . PRO A 1  674  ? 110.566 65.564  44.141  1.00 115.19 ? 674  PRO A CA    1 
ATOM   5244  C  C     . PRO A 1  674  ? 110.582 66.108  42.709  1.00 119.83 ? 674  PRO A C     1 
ATOM   5245  O  O     . PRO A 1  674  ? 110.085 67.218  42.488  1.00 120.66 ? 674  PRO A O     1 
ATOM   5246  C  CB    . PRO A 1  674  ? 111.880 65.808  44.885  1.00 117.78 ? 674  PRO A CB    1 
ATOM   5247  C  CG    . PRO A 1  674  ? 112.624 64.553  44.756  1.00 121.16 ? 674  PRO A CG    1 
ATOM   5248  C  CD    . PRO A 1  674  ? 111.589 63.475  44.815  1.00 116.33 ? 674  PRO A CD    1 
ATOM   5249  N  N     . THR A 1  675  ? 111.116 65.329  41.735  1.00 115.55 ? 675  THR A N     1 
ATOM   5250  C  CA    . THR A 1  675  ? 111.137 65.725  40.322  1.00 114.49 ? 675  THR A CA    1 
ATOM   5251  C  C     . THR A 1  675  ? 109.704 65.883  39.852  1.00 120.03 ? 675  THR A C     1 
ATOM   5252  O  O     . THR A 1  675  ? 109.416 66.811  39.104  1.00 119.86 ? 675  THR A O     1 
ATOM   5253  C  CB    . THR A 1  675  ? 111.913 64.739  39.448  1.00 120.22 ? 675  THR A CB    1 
ATOM   5254  O  OG1   . THR A 1  675  ? 112.913 64.107  40.236  1.00 123.19 ? 675  THR A OG1   1 
ATOM   5255  C  CG2   . THR A 1  675  ? 112.559 65.410  38.248  1.00 117.23 ? 675  THR A CG2   1 
ATOM   5256  N  N     . MET A 1  676  ? 108.790 65.035  40.356  1.00 118.05 ? 676  MET A N     1 
ATOM   5257  C  CA    . MET A 1  676  ? 107.368 65.128  40.032  1.00 118.18 ? 676  MET A CA    1 
ATOM   5258  C  C     . MET A 1  676  ? 106.728 66.438  40.507  1.00 122.94 ? 676  MET A C     1 
ATOM   5259  O  O     . MET A 1  676  ? 105.989 67.055  39.739  1.00 121.64 ? 676  MET A O     1 
ATOM   5260  C  CB    . MET A 1  676  ? 106.593 63.869  40.447  1.00 120.55 ? 676  MET A CB    1 
ATOM   5261  C  CG    . MET A 1  676  ? 106.826 62.709  39.508  1.00 123.02 ? 676  MET A CG    1 
ATOM   5262  S  SD    . MET A 1  676  ? 106.734 63.193  37.752  1.00 126.37 ? 676  MET A SD    1 
ATOM   5263  C  CE    . MET A 1  676  ? 105.515 61.965  37.124  1.00 122.34 ? 676  MET A CE    1 
ATOM   5264  N  N     . ARG A 1  677  ? 107.084 66.906  41.725  1.00 121.20 ? 677  ARG A N     1 
ATOM   5265  C  CA    . ARG A 1  677  ? 106.627 68.202  42.245  1.00 122.32 ? 677  ARG A CA    1 
ATOM   5266  C  C     . ARG A 1  677  ? 107.205 69.298  41.344  1.00 122.41 ? 677  ARG A C     1 
ATOM   5267  O  O     . ARG A 1  677  ? 106.449 70.139  40.848  1.00 121.98 ? 677  ARG A O     1 
ATOM   5268  C  CB    . ARG A 1  677  ? 107.089 68.414  43.699  1.00 127.38 ? 677  ARG A CB    1 
ATOM   5269  C  CG    . ARG A 1  677  ? 106.022 68.084  44.734  1.00 148.16 ? 677  ARG A CG    1 
ATOM   5270  C  CD    . ARG A 1  677  ? 106.623 67.920  46.121  1.00 168.50 ? 677  ARG A CD    1 
ATOM   5271  N  NE    . ARG A 1  677  ? 107.135 66.563  46.346  1.00 180.80 ? 677  ARG A NE    1 
ATOM   5272  C  CZ    . ARG A 1  677  ? 108.385 66.270  46.700  1.00 191.15 ? 677  ARG A CZ    1 
ATOM   5273  N  NH1   . ARG A 1  677  ? 109.282 67.237  46.858  1.00 177.41 ? 677  ARG A NH1   1 
ATOM   5274  N  NH2   . ARG A 1  677  ? 108.751 65.006  46.883  1.00 171.99 ? 677  ARG A NH2   1 
ATOM   5275  N  N     . GLU A 1  678  ? 108.534 69.213  41.074  1.00 115.59 ? 678  GLU A N     1 
ATOM   5276  C  CA    . GLU A 1  678  ? 109.311 70.110  40.226  1.00 113.89 ? 678  GLU A CA    1 
ATOM   5277  C  C     . GLU A 1  678  ? 108.739 70.215  38.797  1.00 114.14 ? 678  GLU A C     1 
ATOM   5278  O  O     . GLU A 1  678  ? 108.740 71.306  38.231  1.00 113.71 ? 678  GLU A O     1 
ATOM   5279  C  CB    . GLU A 1  678  ? 110.785 69.681  40.219  1.00 115.08 ? 678  GLU A CB    1 
ATOM   5280  C  CG    . GLU A 1  678  ? 111.749 70.770  39.768  1.00 131.55 ? 678  GLU A CG    1 
ATOM   5281  C  CD    . GLU A 1  678  ? 113.226 70.411  39.711  1.00 165.51 ? 678  GLU A CD    1 
ATOM   5282  O  OE1   . GLU A 1  678  ? 113.555 69.201  39.705  1.00 166.86 ? 678  GLU A OE1   1 
ATOM   5283  O  OE2   . GLU A 1  678  ? 114.058 71.349  39.659  1.00 161.04 ? 678  GLU A OE2   1 
ATOM   5284  N  N     . ILE A 1  679  ? 108.224 69.100  38.237  1.00 108.24 ? 679  ILE A N     1 
ATOM   5285  C  CA    . ILE A 1  679  ? 107.612 69.058  36.899  1.00 105.94 ? 679  ILE A CA    1 
ATOM   5286  C  C     . ILE A 1  679  ? 106.208 69.680  36.955  1.00 112.36 ? 679  ILE A C     1 
ATOM   5287  O  O     . ILE A 1  679  ? 105.897 70.560  36.154  1.00 111.11 ? 679  ILE A O     1 
ATOM   5288  C  CB    . ILE A 1  679  ? 107.642 67.618  36.306  1.00 106.31 ? 679  ILE A CB    1 
ATOM   5289  C  CG1   . ILE A 1  679  ? 109.046 67.279  35.793  1.00 105.56 ? 679  ILE A CG1   1 
ATOM   5290  C  CG2   . ILE A 1  679  ? 106.613 67.428  35.196  1.00 104.74 ? 679  ILE A CG2   1 
ATOM   5291  C  CD1   . ILE A 1  679  ? 109.463 65.821  35.938  1.00 112.84 ? 679  ILE A CD1   1 
ATOM   5292  N  N     . THR A 1  680  ? 105.381 69.245  37.926  1.00 111.96 ? 680  THR A N     1 
ATOM   5293  C  CA    . THR A 1  680  ? 104.025 69.749  38.133  1.00 113.51 ? 680  THR A CA    1 
ATOM   5294  C  C     . THR A 1  680  ? 104.037 71.258  38.321  1.00 120.16 ? 680  THR A C     1 
ATOM   5295  O  O     . THR A 1  680  ? 103.189 71.942  37.746  1.00 120.39 ? 680  THR A O     1 
ATOM   5296  C  CB    . THR A 1  680  ? 103.314 68.958  39.233  1.00 126.30 ? 680  THR A CB    1 
ATOM   5297  O  OG1   . THR A 1  680  ? 103.233 67.591  38.817  1.00 125.05 ? 680  THR A OG1   1 
ATOM   5298  C  CG2   . THR A 1  680  ? 101.908 69.473  39.521  1.00 127.65 ? 680  THR A CG2   1 
ATOM   5299  N  N     . GLU A 1  681  ? 105.030 71.784  39.054  1.00 118.51 ? 681  GLU A N     1 
ATOM   5300  C  CA    . GLU A 1  681  ? 105.158 73.231  39.196  1.00 120.09 ? 681  GLU A CA    1 
ATOM   5301  C  C     . GLU A 1  681  ? 105.697 73.904  37.908  1.00 121.26 ? 681  GLU A C     1 
ATOM   5302  O  O     . GLU A 1  681  ? 105.352 75.058  37.658  1.00 121.74 ? 681  GLU A O     1 
ATOM   5303  C  CB    . GLU A 1  681  ? 105.875 73.668  40.505  1.00 123.61 ? 681  GLU A CB    1 
ATOM   5304  C  CG    . GLU A 1  681  ? 107.378 73.409  40.584  1.00 139.82 ? 681  GLU A CG    1 
ATOM   5305  C  CD    . GLU A 1  681  ? 108.024 73.453  41.963  1.00 169.25 ? 681  GLU A CD    1 
ATOM   5306  O  OE1   . GLU A 1  681  ? 107.347 73.131  42.969  1.00 167.53 ? 681  GLU A OE1   1 
ATOM   5307  O  OE2   . GLU A 1  681  ? 109.241 73.747  42.026  1.00 163.45 ? 681  GLU A OE2   1 
ATOM   5308  N  N     . THR A 1  682  ? 106.476 73.170  37.069  1.00 114.50 ? 682  THR A N     1 
ATOM   5309  C  CA    . THR A 1  682  ? 107.003 73.689  35.797  1.00 112.82 ? 682  THR A CA    1 
ATOM   5310  C  C     . THR A 1  682  ? 105.856 73.928  34.818  1.00 114.84 ? 682  THR A C     1 
ATOM   5311  O  O     . THR A 1  682  ? 105.833 74.960  34.143  1.00 113.89 ? 682  THR A O     1 
ATOM   5312  C  CB    . THR A 1  682  ? 108.150 72.802  35.265  1.00 120.69 ? 682  THR A CB    1 
ATOM   5313  O  OG1   . THR A 1  682  ? 109.345 73.169  35.946  1.00 125.92 ? 682  THR A OG1   1 
ATOM   5314  C  CG2   . THR A 1  682  ? 108.387 72.938  33.759  1.00 116.04 ? 682  THR A CG2   1 
ATOM   5315  N  N     . ILE A 1  683  ? 104.896 72.988  34.763  1.00 110.92 ? 683  ILE A N     1 
ATOM   5316  C  CA    . ILE A 1  683  ? 103.722 73.101  33.897  1.00 110.33 ? 683  ILE A CA    1 
ATOM   5317  C  C     . ILE A 1  683  ? 102.872 74.262  34.400  1.00 115.33 ? 683  ILE A C     1 
ATOM   5318  O  O     . ILE A 1  683  ? 102.488 75.127  33.607  1.00 114.48 ? 683  ILE A O     1 
ATOM   5319  C  CB    . ILE A 1  683  ? 102.928 71.769  33.812  1.00 112.97 ? 683  ILE A CB    1 
ATOM   5320  C  CG1   . ILE A 1  683  ? 103.784 70.658  33.173  1.00 112.86 ? 683  ILE A CG1   1 
ATOM   5321  C  CG2   . ILE A 1  683  ? 101.622 71.952  33.035  1.00 112.87 ? 683  ILE A CG2   1 
ATOM   5322  C  CD1   . ILE A 1  683  ? 103.361 69.190  33.580  1.00 126.18 ? 683  ILE A CD1   1 
ATOM   5323  N  N     . ALA A 1  684  ? 102.644 74.301  35.732  1.00 113.42 ? 684  ALA A N     1 
ATOM   5324  C  CA    . ALA A 1  684  ? 101.879 75.326  36.438  1.00 114.73 ? 684  ALA A CA    1 
ATOM   5325  C  C     . ALA A 1  684  ? 102.352 76.758  36.107  1.00 119.04 ? 684  ALA A C     1 
ATOM   5326  O  O     . ALA A 1  684  ? 101.533 77.578  35.674  1.00 118.18 ? 684  ALA A O     1 
ATOM   5327  C  CB    . ALA A 1  684  ? 101.928 75.072  37.936  1.00 116.62 ? 684  ALA A CB    1 
ATOM   5328  N  N     . GLU A 1  685  ? 103.672 77.037  36.258  1.00 116.37 ? 685  GLU A N     1 
ATOM   5329  C  CA    . GLU A 1  685  ? 104.247 78.357  35.950  1.00 117.04 ? 685  GLU A CA    1 
ATOM   5330  C  C     . GLU A 1  685  ? 104.098 78.729  34.464  1.00 117.67 ? 685  GLU A C     1 
ATOM   5331  O  O     . GLU A 1  685  ? 103.889 79.907  34.157  1.00 118.71 ? 685  GLU A O     1 
ATOM   5332  C  CB    . GLU A 1  685  ? 105.703 78.535  36.467  1.00 119.47 ? 685  GLU A CB    1 
ATOM   5333  C  CG    . GLU A 1  685  ? 106.734 77.543  35.921  1.00 136.17 ? 685  GLU A CG    1 
ATOM   5334  C  CD    . GLU A 1  685  ? 107.947 78.050  35.148  1.00 162.60 ? 685  GLU A CD    1 
ATOM   5335  O  OE1   . GLU A 1  685  ? 108.354 79.218  35.350  1.00 172.50 ? 685  GLU A OE1   1 
ATOM   5336  O  OE2   . GLU A 1  685  ? 108.526 77.247  34.377  1.00 145.88 ? 685  GLU A OE2   1 
ATOM   5337  N  N     . ALA A 1  686  ? 104.168 77.725  33.556  1.00 109.56 ? 686  ALA A N     1 
ATOM   5338  C  CA    . ALA A 1  686  ? 103.999 77.930  32.116  1.00 106.55 ? 686  ALA A CA    1 
ATOM   5339  C  C     . ALA A 1  686  ? 102.521 78.198  31.783  1.00 105.96 ? 686  ALA A C     1 
ATOM   5340  O  O     . ALA A 1  686  ? 102.216 78.984  30.884  1.00 103.53 ? 686  ALA A O     1 
ATOM   5341  C  CB    . ALA A 1  686  ? 104.515 76.725  31.351  1.00 105.68 ? 686  ALA A CB    1 
ATOM   5342  N  N     . LYS A 1  687  ? 101.610 77.575  32.545  1.00 101.76 ? 687  LYS A N     1 
ATOM   5343  C  CA    . LYS A 1  687  ? 100.176 77.767  32.374  1.00 101.73 ? 687  LYS A CA    1 
ATOM   5344  C  C     . LYS A 1  687  ? 99.782  79.186  32.764  1.00 107.68 ? 687  LYS A C     1 
ATOM   5345  O  O     . LYS A 1  687  ? 98.840  79.739  32.186  1.00 106.97 ? 687  LYS A O     1 
ATOM   5346  C  CB    . LYS A 1  687  ? 99.386  76.736  33.182  1.00 103.99 ? 687  LYS A CB    1 
ATOM   5347  C  CG    . LYS A 1  687  ? 99.302  75.368  32.519  1.00 107.33 ? 687  LYS A CG    1 
ATOM   5348  C  CD    . LYS A 1  687  ? 98.503  74.393  33.367  1.00 112.18 ? 687  LYS A CD    1 
ATOM   5349  C  CE    . LYS A 1  687  ? 97.103  74.177  32.854  1.00 116.03 ? 687  LYS A CE    1 
ATOM   5350  N  NZ    . LYS A 1  687  ? 96.330  73.353  33.812  1.00 125.79 ? 687  LYS A NZ    1 
ATOM   5351  N  N     . LYS A 1  688  ? 100.521 79.771  33.740  1.00 106.21 ? 688  LYS A N     1 
ATOM   5352  C  CA    . LYS A 1  688  ? 100.342 81.147  34.205  1.00 107.88 ? 688  LYS A CA    1 
ATOM   5353  C  C     . LYS A 1  688  ? 100.820 82.087  33.109  1.00 112.02 ? 688  LYS A C     1 
ATOM   5354  O  O     . LYS A 1  688  ? 100.083 82.996  32.741  1.00 112.59 ? 688  LYS A O     1 
ATOM   5355  C  CB    . LYS A 1  688  ? 101.117 81.411  35.507  1.00 111.85 ? 688  LYS A CB    1 
ATOM   5356  C  CG    . LYS A 1  688  ? 100.534 82.555  36.340  1.00 127.65 ? 688  LYS A CG    1 
ATOM   5357  C  CD    . LYS A 1  688  ? 101.387 83.811  36.296  1.00 137.16 ? 688  LYS A CD    1 
ATOM   5358  C  CE    . LYS A 1  688  ? 100.781 84.917  37.133  1.00 150.72 ? 688  LYS A CE    1 
ATOM   5359  N  NZ    . LYS A 1  688  ? 101.618 86.152  37.136  1.00 160.11 ? 688  LYS A NZ    1 
ATOM   5360  N  N     . LYS A 1  689  ? 102.028 81.832  32.550  1.00 107.87 ? 689  LYS A N     1 
ATOM   5361  C  CA    . LYS A 1  689  ? 102.637 82.588  31.444  1.00 107.29 ? 689  LYS A CA    1 
ATOM   5362  C  C     . LYS A 1  689  ? 101.590 82.783  30.333  1.00 111.11 ? 689  LYS A C     1 
ATOM   5363  O  O     . LYS A 1  689  ? 101.389 83.912  29.876  1.00 111.24 ? 689  LYS A O     1 
ATOM   5364  C  CB    . LYS A 1  689  ? 103.865 81.825  30.905  1.00 108.14 ? 689  LYS A CB    1 
ATOM   5365  C  CG    . LYS A 1  689  ? 105.026 82.684  30.440  1.00 120.82 ? 689  LYS A CG    1 
ATOM   5366  C  CD    . LYS A 1  689  ? 106.295 81.836  30.277  1.00 134.91 ? 689  LYS A CD    1 
ATOM   5367  C  CE    . LYS A 1  689  ? 107.571 82.656  30.236  1.00 152.68 ? 689  LYS A CE    1 
ATOM   5368  N  NZ    . LYS A 1  689  ? 108.802 81.811  30.285  1.00 160.71 ? 689  LYS A NZ    1 
ATOM   5369  N  N     . VAL A 1  690  ? 100.869 81.687  29.980  1.00 106.74 ? 690  VAL A N     1 
ATOM   5370  C  CA    . VAL A 1  690  ? 99.805  81.653  28.974  1.00 105.64 ? 690  VAL A CA    1 
ATOM   5371  C  C     . VAL A 1  690  ? 98.587  82.481  29.406  1.00 111.81 ? 690  VAL A C     1 
ATOM   5372  O  O     . VAL A 1  690  ? 98.112  83.289  28.610  1.00 111.59 ? 690  VAL A O     1 
ATOM   5373  C  CB    . VAL A 1  690  ? 99.469  80.205  28.519  1.00 107.28 ? 690  VAL A CB    1 
ATOM   5374  C  CG1   . VAL A 1  690  ? 98.108  80.114  27.826  1.00 106.72 ? 690  VAL A CG1   1 
ATOM   5375  C  CG2   . VAL A 1  690  ? 100.567 79.662  27.614  1.00 105.37 ? 690  VAL A CG2   1 
ATOM   5376  N  N     . LEU A 1  691  ? 98.117  82.323  30.664  1.00 110.41 ? 691  LEU A N     1 
ATOM   5377  C  CA    . LEU A 1  691  ? 96.975  83.084  31.209  1.00 112.09 ? 691  LEU A CA    1 
ATOM   5378  C  C     . LEU A 1  691  ? 97.230  84.592  31.212  1.00 119.10 ? 691  LEU A C     1 
ATOM   5379  O  O     . LEU A 1  691  ? 96.303  85.375  30.990  1.00 119.53 ? 691  LEU A O     1 
ATOM   5380  C  CB    . LEU A 1  691  ? 96.601  82.592  32.620  1.00 112.80 ? 691  LEU A CB    1 
ATOM   5381  C  CG    . LEU A 1  691  ? 95.417  83.255  33.349  1.00 118.49 ? 691  LEU A CG    1 
ATOM   5382  C  CD1   . LEU A 1  691  ? 94.159  83.366  32.462  1.00 118.16 ? 691  LEU A CD1   1 
ATOM   5383  C  CD2   . LEU A 1  691  ? 95.089  82.495  34.612  1.00 122.25 ? 691  LEU A CD2   1 
ATOM   5384  N  N     . ASP A 1  692  ? 98.491  84.983  31.445  1.00 117.23 ? 692  ASP A N     1 
ATOM   5385  C  CA    . ASP A 1  692  ? 98.947  86.364  31.453  1.00 118.48 ? 692  ASP A CA    1 
ATOM   5386  C  C     . ASP A 1  692  ? 98.829  86.965  30.051  1.00 120.98 ? 692  ASP A C     1 
ATOM   5387  O  O     . ASP A 1  692  ? 98.155  87.986  29.892  1.00 121.53 ? 692  ASP A O     1 
ATOM   5388  C  CB    . ASP A 1  692  ? 100.379 86.438  32.009  1.00 121.25 ? 692  ASP A CB    1 
ATOM   5389  C  CG    . ASP A 1  692  ? 100.498 86.113  33.500  1.00 138.46 ? 692  ASP A CG    1 
ATOM   5390  O  OD1   . ASP A 1  692  ? 99.463  85.737  34.122  1.00 139.05 ? 692  ASP A OD1   1 
ATOM   5391  O  OD2   . ASP A 1  692  ? 101.619 86.245  34.048  1.00 148.48 ? 692  ASP A OD2   1 
ATOM   5392  N  N     . VAL A 1  693  ? 99.396  86.278  29.030  1.00 115.45 ? 693  VAL A N     1 
ATOM   5393  C  CA    . VAL A 1  693  ? 99.329  86.674  27.614  1.00 114.18 ? 693  VAL A CA    1 
ATOM   5394  C  C     . VAL A 1  693  ? 97.870  86.628  27.127  1.00 118.24 ? 693  VAL A C     1 
ATOM   5395  O  O     . VAL A 1  693  ? 97.507  87.420  26.257  1.00 118.35 ? 693  VAL A O     1 
ATOM   5396  C  CB    . VAL A 1  693  ? 100.325 85.876  26.717  1.00 115.94 ? 693  VAL A CB    1 
ATOM   5397  C  CG1   . VAL A 1  693  ? 100.218 86.266  25.240  1.00 114.65 ? 693  VAL A CG1   1 
ATOM   5398  C  CG2   . VAL A 1  693  ? 101.756 86.068  27.208  1.00 115.94 ? 693  VAL A CG2   1 
ATOM   5399  N  N     . THR A 1  694  ? 97.027  85.758  27.743  1.00 114.54 ? 694  THR A N     1 
ATOM   5400  C  CA    . THR A 1  694  ? 95.602  85.661  27.429  1.00 114.80 ? 694  THR A CA    1 
ATOM   5401  C  C     . THR A 1  694  ? 94.917  86.922  27.915  1.00 121.53 ? 694  THR A C     1 
ATOM   5402  O  O     . THR A 1  694  ? 94.254  87.575  27.115  1.00 122.18 ? 694  THR A O     1 
ATOM   5403  C  CB    . THR A 1  694  ? 94.965  84.380  27.990  1.00 125.56 ? 694  THR A CB    1 
ATOM   5404  O  OG1   . THR A 1  694  ? 95.679  83.243  27.501  1.00 128.85 ? 694  THR A OG1   1 
ATOM   5405  C  CG2   . THR A 1  694  ? 93.486  84.245  27.621  1.00 123.33 ? 694  THR A CG2   1 
ATOM   5406  N  N     . LYS A 1  695  ? 95.107  87.292  29.202  1.00 119.42 ? 695  LYS A N     1 
ATOM   5407  C  CA    . LYS A 1  695  ? 94.506  88.501  29.777  1.00 120.73 ? 695  LYS A CA    1 
ATOM   5408  C  C     . LYS A 1  695  ? 95.025  89.782  29.089  1.00 126.17 ? 695  LYS A C     1 
ATOM   5409  O  O     . LYS A 1  695  ? 94.237  90.702  28.863  1.00 126.81 ? 695  LYS A O     1 
ATOM   5410  C  CB    . LYS A 1  695  ? 94.634  88.540  31.317  1.00 123.50 ? 695  LYS A CB    1 
ATOM   5411  C  CG    . LYS A 1  695  ? 93.733  87.538  32.058  1.00 132.70 ? 695  LYS A CG    1 
ATOM   5412  C  CD    . LYS A 1  695  ? 92.289  88.030  32.258  1.00 146.04 ? 695  LYS A CD    1 
ATOM   5413  C  CE    . LYS A 1  695  ? 91.315  86.935  32.667  1.00 159.06 ? 695  LYS A CE    1 
ATOM   5414  N  NZ    . LYS A 1  695  ? 89.915  87.445  32.835  1.00 165.57 ? 695  LYS A NZ    1 
ATOM   5415  N  N     . GLU A 1  696  ? 96.319  89.796  28.685  1.00 122.52 ? 696  GLU A N     1 
ATOM   5416  C  CA    . GLU A 1  696  ? 96.968  90.897  27.959  1.00 122.99 ? 696  GLU A CA    1 
ATOM   5417  C  C     . GLU A 1  696  ? 96.310  91.093  26.580  1.00 125.75 ? 696  GLU A C     1 
ATOM   5418  O  O     . GLU A 1  696  ? 96.079  92.234  26.171  1.00 126.45 ? 696  GLU A O     1 
ATOM   5419  C  CB    . GLU A 1  696  ? 98.477  90.611  27.791  1.00 124.08 ? 696  GLU A CB    1 
ATOM   5420  C  CG    . GLU A 1  696  ? 99.271  91.715  27.092  1.00 139.70 ? 696  GLU A CG    1 
ATOM   5421  C  CD    . GLU A 1  696  ? 100.659 91.373  26.570  1.00 163.91 ? 696  GLU A CD    1 
ATOM   5422  O  OE1   . GLU A 1  696  ? 101.056 90.186  26.633  1.00 148.71 ? 696  GLU A OE1   1 
ATOM   5423  O  OE2   . GLU A 1  696  ? 101.345 92.300  26.078  1.00 162.88 ? 696  GLU A OE2   1 
ATOM   5424  N  N     . ALA A 1  697  ? 96.028  89.984  25.868  1.00 120.20 ? 697  ALA A N     1 
ATOM   5425  C  CA    . ALA A 1  697  ? 95.399  90.004  24.547  1.00 119.26 ? 697  ALA A CA    1 
ATOM   5426  C  C     . ALA A 1  697  ? 93.914  90.354  24.627  1.00 123.92 ? 697  ALA A C     1 
ATOM   5427  O  O     . ALA A 1  697  ? 93.360  90.917  23.680  1.00 123.13 ? 697  ALA A O     1 
ATOM   5428  C  CB    . ALA A 1  697  ? 95.580  88.661  23.864  1.00 118.35 ? 697  ALA A CB    1 
ATOM   5429  N  N     . GLN A 1  698  ? 93.269  90.002  25.749  1.00 122.02 ? 698  GLN A N     1 
ATOM   5430  C  CA    . GLN A 1  698  ? 91.859  90.293  25.991  1.00 123.48 ? 698  GLN A CA    1 
ATOM   5431  C  C     . GLN A 1  698  ? 91.693  91.774  26.304  1.00 131.26 ? 698  GLN A C     1 
ATOM   5432  O  O     . GLN A 1  698  ? 90.658  92.353  25.979  1.00 131.73 ? 698  GLN A O     1 
ATOM   5433  C  CB    . GLN A 1  698  ? 91.308  89.424  27.137  1.00 125.09 ? 698  GLN A CB    1 
ATOM   5434  C  CG    . GLN A 1  698  ? 90.929  88.009  26.689  1.00 138.56 ? 698  GLN A CG    1 
ATOM   5435  C  CD    . GLN A 1  698  ? 90.560  87.049  27.801  1.00 156.72 ? 698  GLN A CD    1 
ATOM   5436  O  OE1   . GLN A 1  698  ? 90.943  87.200  28.970  1.00 151.89 ? 698  GLN A OE1   1 
ATOM   5437  N  NE2   . GLN A 1  698  ? 89.828  86.005  27.442  1.00 150.33 ? 698  GLN A NE2   1 
ATOM   5438  N  N     . ALA A 1  699  ? 92.733  92.388  26.901  1.00 129.84 ? 699  ALA A N     1 
ATOM   5439  C  CA    . ALA A 1  699  ? 92.766  93.798  27.274  1.00 131.93 ? 699  ALA A CA    1 
ATOM   5440  C  C     . ALA A 1  699  ? 93.270  94.737  26.157  1.00 137.94 ? 699  ALA A C     1 
ATOM   5441  O  O     . ALA A 1  699  ? 93.425  95.936  26.406  1.00 139.15 ? 699  ALA A O     1 
ATOM   5442  C  CB    . ALA A 1  699  ? 93.588  93.975  28.538  1.00 133.48 ? 699  ALA A CB    1 
ATOM   5443  N  N     . ASN A 1  700  ? 93.479  94.201  24.924  1.00 134.49 ? 700  ASN A N     1 
ATOM   5444  C  CA    . ASN A 1  700  ? 93.934  94.923  23.717  1.00 134.68 ? 700  ASN A CA    1 
ATOM   5445  C  C     . ASN A 1  700  ? 95.291  95.638  23.917  1.00 140.91 ? 700  ASN A C     1 
ATOM   5446  O  O     . ASN A 1  700  ? 95.480  96.770  23.462  1.00 141.52 ? 700  ASN A O     1 
ATOM   5447  C  CB    . ASN A 1  700  ? 92.830  95.882  23.202  1.00 134.83 ? 700  ASN A CB    1 
ATOM   5448  C  CG    . ASN A 1  700  ? 92.909  96.275  21.744  1.00 150.16 ? 700  ASN A CG    1 
ATOM   5449  O  OD1   . ASN A 1  700  ? 93.197  95.465  20.851  1.00 141.05 ? 700  ASN A OD1   1 
ATOM   5450  N  ND2   . ASN A 1  700  ? 92.584  97.527  21.469  1.00 142.49 ? 700  ASN A ND2   1 
ATOM   5451  N  N     . LEU A 1  701  ? 96.236  94.966  24.597  1.00 137.90 ? 701  LEU A N     1 
ATOM   5452  C  CA    . LEU A 1  701  ? 97.562  95.528  24.888  1.00 138.28 ? 701  LEU A CA    1 
ATOM   5453  C  C     . LEU A 1  701  ? 98.667  94.784  24.138  1.00 141.63 ? 701  LEU A C     1 
ATOM   5454  O  O     . LEU A 1  701  ? 99.822  95.218  24.120  1.00 140.98 ? 701  LEU A O     1 
ATOM   5455  C  CB    . LEU A 1  701  ? 97.819  95.553  26.409  1.00 139.06 ? 701  LEU A CB    1 
ATOM   5456  C  CG    . LEU A 1  701  ? 96.646  95.998  27.301  1.00 144.51 ? 701  LEU A CG    1 
ATOM   5457  C  CD1   . LEU A 1  701  ? 96.930  95.725  28.749  1.00 145.25 ? 701  LEU A CD1   1 
ATOM   5458  C  CD2   . LEU A 1  701  ? 96.297  97.461  27.096  1.00 148.14 ? 701  LEU A CD2   1 
ATOM   5459  N  N     . LEU A 1  702  ? 98.283  93.680  23.486  1.00 138.07 ? 702  LEU A N     1 
ATOM   5460  C  CA    . LEU A 1  702  ? 99.149  92.840  22.670  1.00 137.13 ? 702  LEU A CA    1 
ATOM   5461  C  C     . LEU A 1  702  ? 99.462  93.598  21.377  1.00 142.67 ? 702  LEU A C     1 
ATOM   5462  O  O     . LEU A 1  702  ? 98.549  94.050  20.684  1.00 142.19 ? 702  LEU A O     1 
ATOM   5463  C  CB    . LEU A 1  702  ? 98.415  91.519  22.359  1.00 135.86 ? 702  LEU A CB    1 
ATOM   5464  C  CG    . LEU A 1  702  ? 99.233  90.231  22.378  1.00 138.76 ? 702  LEU A CG    1 
ATOM   5465  C  CD1   . LEU A 1  702  ? 99.169  89.556  23.743  1.00 139.01 ? 702  LEU A CD1   1 
ATOM   5466  C  CD2   . LEU A 1  702  ? 98.738  89.272  21.317  1.00 139.04 ? 702  LEU A CD2   1 
ATOM   5467  N  N     . THR A 1  703  ? 100.750 93.784  21.089  1.00 141.01 ? 703  THR A N     1 
ATOM   5468  C  CA    . THR A 1  703  ? 101.211 94.494  19.897  1.00 141.75 ? 703  THR A CA    1 
ATOM   5469  C  C     . THR A 1  703  ? 101.684 93.450  18.878  1.00 145.41 ? 703  THR A C     1 
ATOM   5470  O  O     . THR A 1  703  ? 102.758 92.861  19.053  1.00 144.00 ? 703  THR A O     1 
ATOM   5471  C  CB    . THR A 1  703  ? 102.265 95.558  20.292  1.00 154.27 ? 703  THR A CB    1 
ATOM   5472  O  OG1   . THR A 1  703  ? 101.790 96.299  21.421  1.00 157.03 ? 703  THR A OG1   1 
ATOM   5473  C  CG2   . THR A 1  703  ? 102.598 96.516  19.153  1.00 153.53 ? 703  THR A CG2   1 
ATOM   5474  N  N     . ALA A 1  704  ? 100.855 93.192  17.844  1.00 142.95 ? 704  ALA A N     1 
ATOM   5475  C  CA    . ALA A 1  704  ? 101.116 92.193  16.797  1.00 142.22 ? 704  ALA A CA    1 
ATOM   5476  C  C     . ALA A 1  704  ? 102.487 92.317  16.132  1.00 148.44 ? 704  ALA A C     1 
ATOM   5477  O  O     . ALA A 1  704  ? 102.953 93.432  15.890  1.00 149.32 ? 704  ALA A O     1 
ATOM   5478  C  CB    . ALA A 1  704  ? 100.027 92.237  15.742  1.00 142.63 ? 704  ALA A CB    1 
ATOM   5479  N  N     . LYS A 1  705  ? 103.131 91.162  15.852  1.00 145.30 ? 705  LYS A N     1 
ATOM   5480  C  CA    . LYS A 1  705  ? 104.442 91.069  15.180  1.00 145.05 ? 705  LYS A CA    1 
ATOM   5481  C  C     . LYS A 1  705  ? 104.209 91.456  13.713  1.00 150.87 ? 705  LYS A C     1 
ATOM   5482  O  O     . LYS A 1  705  ? 103.168 91.071  13.162  1.00 150.18 ? 705  LYS A O     1 
ATOM   5483  C  CB    . LYS A 1  705  ? 105.030 89.632  15.288  1.00 145.10 ? 705  LYS A CB    1 
ATOM   5484  C  CG    . LYS A 1  705  ? 104.924 89.022  16.693  1.00 145.84 ? 705  LYS A CG    1 
ATOM   5485  C  CD    . LYS A 1  705  ? 105.596 87.670  16.876  1.00 144.53 ? 705  LYS A CD    1 
ATOM   5486  C  CE    . LYS A 1  705  ? 105.304 87.139  18.265  1.00 144.66 ? 705  LYS A CE    1 
ATOM   5487  N  NZ    . LYS A 1  705  ? 106.227 86.044  18.664  1.00 147.44 ? 705  LYS A NZ    1 
ATOM   5488  N  N     . HIS A 1  706  ? 105.125 92.257  13.094  1.00 148.53 ? 706  HIS A N     1 
ATOM   5489  C  CA    . HIS A 1  706  ? 104.970 92.690  11.690  1.00 148.38 ? 706  HIS A CA    1 
ATOM   5490  C  C     . HIS A 1  706  ? 104.675 91.492  10.782  1.00 149.24 ? 706  HIS A C     1 
ATOM   5491  O  O     . HIS A 1  706  ? 105.315 90.441  10.911  1.00 147.90 ? 706  HIS A O     1 
ATOM   5492  C  CB    . HIS A 1  706  ? 106.190 93.487  11.183  1.00 149.98 ? 706  HIS A CB    1 
ATOM   5493  C  CG    . HIS A 1  706  ? 106.028 94.083  9.806   1.00 153.77 ? 706  HIS A CG    1 
ATOM   5494  N  ND1   . HIS A 1  706  ? 105.620 95.400  9.628   1.00 157.02 ? 706  HIS A ND1   1 
ATOM   5495  C  CD2   . HIS A 1  706  ? 106.266 93.535  8.589   1.00 154.53 ? 706  HIS A CD2   1 
ATOM   5496  C  CE1   . HIS A 1  706  ? 105.611 95.600  8.318   1.00 156.08 ? 706  HIS A CE1   1 
ATOM   5497  N  NE2   . HIS A 1  706  ? 105.989 94.507  7.652   1.00 154.98 ? 706  HIS A NE2   1 
ATOM   5498  N  N     . GLY A 1  707  ? 103.658 91.650  9.938   1.00 144.09 ? 707  GLY A N     1 
ATOM   5499  C  CA    . GLY A 1  707  ? 103.205 90.616  9.016   1.00 141.86 ? 707  GLY A CA    1 
ATOM   5500  C  C     . GLY A 1  707  ? 102.558 89.437  9.711   1.00 142.34 ? 707  GLY A C     1 
ATOM   5501  O  O     . GLY A 1  707  ? 102.855 88.284  9.383   1.00 141.35 ? 707  GLY A O     1 
ATOM   5502  N  N     . MET A 1  708  ? 101.678 89.726  10.689  1.00 136.53 ? 708  MET A N     1 
ATOM   5503  C  CA    . MET A 1  708  ? 100.944 88.735  11.478  1.00 134.27 ? 708  MET A CA    1 
ATOM   5504  C  C     . MET A 1  708  ? 99.699  89.346  12.102  1.00 133.33 ? 708  MET A C     1 
ATOM   5505  O  O     . MET A 1  708  ? 99.720  90.514  12.502  1.00 134.60 ? 708  MET A O     1 
ATOM   5506  C  CB    . MET A 1  708  ? 101.829 88.197  12.605  1.00 136.79 ? 708  MET A CB    1 
ATOM   5507  C  CG    . MET A 1  708  ? 102.106 86.730  12.507  1.00 139.71 ? 708  MET A CG    1 
ATOM   5508  S  SD    . MET A 1  708  ? 103.425 86.244  13.642  1.00 144.50 ? 708  MET A SD    1 
ATOM   5509  C  CE    . MET A 1  708  ? 104.874 86.914  12.767  1.00 141.25 ? 708  MET A CE    1 
ATOM   5510  N  N     . THR A 1  709  ? 98.634  88.536  12.247  1.00 123.94 ? 709  THR A N     1 
ATOM   5511  C  CA    . THR A 1  709  ? 97.395  88.939  12.906  1.00 122.29 ? 709  THR A CA    1 
ATOM   5512  C  C     . THR A 1  709  ? 97.758  89.161  14.365  1.00 122.94 ? 709  THR A C     1 
ATOM   5513  O  O     . THR A 1  709  ? 98.786  88.673  14.831  1.00 120.95 ? 709  THR A O     1 
ATOM   5514  C  CB    . THR A 1  709  ? 96.352  87.786  12.840  1.00 127.93 ? 709  THR A CB    1 
ATOM   5515  O  OG1   . THR A 1  709  ? 96.276  87.231  11.530  1.00 126.63 ? 709  THR A OG1   1 
ATOM   5516  C  CG2   . THR A 1  709  ? 94.973  88.196  13.302  1.00 126.17 ? 709  THR A CG2   1 
ATOM   5517  N  N     . LEU A 1  710  ? 96.907  89.875  15.091  1.00 119.84 ? 710  LEU A N     1 
ATOM   5518  C  CA    . LEU A 1  710  ? 97.040  90.075  16.527  1.00 120.02 ? 710  LEU A CA    1 
ATOM   5519  C  C     . LEU A 1  710  ? 96.921  88.670  17.200  1.00 120.63 ? 710  LEU A C     1 
ATOM   5520  O  O     . LEU A 1  710  ? 97.696  88.323  18.101  1.00 119.80 ? 710  LEU A O     1 
ATOM   5521  C  CB    . LEU A 1  710  ? 95.891  91.001  16.967  1.00 121.53 ? 710  LEU A CB    1 
ATOM   5522  C  CG    . LEU A 1  710  ? 96.144  91.912  18.151  1.00 127.79 ? 710  LEU A CG    1 
ATOM   5523  C  CD1   . LEU A 1  710  ? 97.114  93.028  17.795  1.00 128.93 ? 710  LEU A CD1   1 
ATOM   5524  C  CD2   . LEU A 1  710  ? 94.848  92.514  18.640  1.00 131.37 ? 710  LEU A CD2   1 
ATOM   5525  N  N     . ARG A 1  711  ? 95.997  87.849  16.665  1.00 114.45 ? 711  ARG A N     1 
ATOM   5526  C  CA    . ARG A 1  711  ? 95.704  86.487  17.086  1.00 112.59 ? 711  ARG A CA    1 
ATOM   5527  C  C     . ARG A 1  711  ? 96.842  85.552  16.721  1.00 115.16 ? 711  ARG A C     1 
ATOM   5528  O  O     . ARG A 1  711  ? 97.343  84.856  17.604  1.00 114.03 ? 711  ARG A O     1 
ATOM   5529  C  CB    . ARG A 1  711  ? 94.396  86.005  16.460  1.00 110.52 ? 711  ARG A CB    1 
ATOM   5530  C  CG    . ARG A 1  711  ? 93.301  87.045  16.461  1.00 115.48 ? 711  ARG A CG    1 
ATOM   5531  C  CD    . ARG A 1  711  ? 91.964  86.411  16.178  1.00 120.73 ? 711  ARG A CD    1 
ATOM   5532  N  NE    . ARG A 1  711  ? 91.271  86.051  17.413  1.00 121.55 ? 711  ARG A NE    1 
ATOM   5533  C  CZ    . ARG A 1  711  ? 90.035  86.433  17.708  1.00 132.00 ? 711  ARG A CZ    1 
ATOM   5534  N  NH1   . ARG A 1  711  ? 89.343  87.178  16.857  1.00 119.52 ? 711  ARG A NH1   1 
ATOM   5535  N  NH2   . ARG A 1  711  ? 89.477  86.061  18.848  1.00 116.49 ? 711  ARG A NH2   1 
ATOM   5536  N  N     . GLU A 1  712  ? 97.264  85.546  15.427  1.00 111.80 ? 712  GLU A N     1 
ATOM   5537  C  CA    . GLU A 1  712  ? 98.390  84.744  14.919  1.00 111.07 ? 712  GLU A CA    1 
ATOM   5538  C  C     . GLU A 1  712  ? 99.571  84.879  15.899  1.00 116.63 ? 712  GLU A C     1 
ATOM   5539  O  O     . GLU A 1  712  ? 100.146 83.870  16.319  1.00 115.70 ? 712  GLU A O     1 
ATOM   5540  C  CB    . GLU A 1  712  ? 98.830  85.210  13.500  1.00 112.05 ? 712  GLU A CB    1 
ATOM   5541  C  CG    . GLU A 1  712  ? 98.098  84.576  12.315  1.00 121.82 ? 712  GLU A CG    1 
ATOM   5542  C  CD    . GLU A 1  712  ? 98.569  84.936  10.909  1.00 138.73 ? 712  GLU A CD    1 
ATOM   5543  O  OE1   . GLU A 1  712  ? 99.064  86.069  10.708  1.00 140.20 ? 712  GLU A OE1   1 
ATOM   5544  O  OE2   . GLU A 1  712  ? 98.411  84.092  9.996   1.00 121.72 ? 712  GLU A OE2   1 
ATOM   5545  N  N     . SER A 1  713  ? 99.862  86.140  16.313  1.00 114.72 ? 713  SER A N     1 
ATOM   5546  C  CA    . SER A 1  713  ? 100.915 86.523  17.248  1.00 114.92 ? 713  SER A CA    1 
ATOM   5547  C  C     . SER A 1  713  ? 100.702 85.874  18.612  1.00 117.98 ? 713  SER A C     1 
ATOM   5548  O  O     . SER A 1  713  ? 101.614 85.186  19.079  1.00 118.08 ? 713  SER A O     1 
ATOM   5549  C  CB    . SER A 1  713  ? 100.985 88.040  17.381  1.00 120.15 ? 713  SER A CB    1 
ATOM   5550  O  OG    . SER A 1  713  ? 101.128 88.670  16.119  1.00 129.74 ? 713  SER A OG    1 
ATOM   5551  N  N     . PHE A 1  714  ? 99.498  86.052  19.225  1.00 112.71 ? 714  PHE A N     1 
ATOM   5552  C  CA    . PHE A 1  714  ? 99.125  85.473  20.522  1.00 111.97 ? 714  PHE A CA    1 
ATOM   5553  C  C     . PHE A 1  714  ? 99.340  83.959  20.563  1.00 115.58 ? 714  PHE A C     1 
ATOM   5554  O  O     . PHE A 1  714  ? 100.068 83.448  21.419  1.00 114.68 ? 714  PHE A O     1 
ATOM   5555  C  CB    . PHE A 1  714  ? 97.655  85.773  20.821  1.00 113.81 ? 714  PHE A CB    1 
ATOM   5556  C  CG    . PHE A 1  714  ? 97.006  84.894  21.865  1.00 114.70 ? 714  PHE A CG    1 
ATOM   5557  C  CD1   . PHE A 1  714  ? 97.182  85.147  23.218  1.00 118.73 ? 714  PHE A CD1   1 
ATOM   5558  C  CD2   . PHE A 1  714  ? 96.189  83.835  21.494  1.00 115.36 ? 714  PHE A CD2   1 
ATOM   5559  C  CE1   . PHE A 1  714  ? 96.563  84.349  24.181  1.00 119.63 ? 714  PHE A CE1   1 
ATOM   5560  C  CE2   . PHE A 1  714  ? 95.582  83.028  22.459  1.00 118.33 ? 714  PHE A CE2   1 
ATOM   5561  C  CZ    . PHE A 1  714  ? 95.758  83.300  23.796  1.00 117.50 ? 714  PHE A CZ    1 
ATOM   5562  N  N     . GLU A 1  715  ? 98.680  83.251  19.633  1.00 112.25 ? 715  GLU A N     1 
ATOM   5563  C  CA    . GLU A 1  715  ? 98.718  81.802  19.495  1.00 111.03 ? 715  GLU A CA    1 
ATOM   5564  C  C     . GLU A 1  715  ? 100.132 81.267  19.379  1.00 114.80 ? 715  GLU A C     1 
ATOM   5565  O  O     . GLU A 1  715  ? 100.421 80.234  19.982  1.00 113.99 ? 715  GLU A O     1 
ATOM   5566  C  CB    . GLU A 1  715  ? 97.867  81.369  18.308  1.00 111.46 ? 715  GLU A CB    1 
ATOM   5567  C  CG    . GLU A 1  715  ? 96.402  81.217  18.666  1.00 121.19 ? 715  GLU A CG    1 
ATOM   5568  C  CD    . GLU A 1  715  ? 96.064  79.895  19.322  1.00 135.64 ? 715  GLU A CD    1 
ATOM   5569  O  OE1   . GLU A 1  715  ? 96.703  78.875  18.976  1.00 121.22 ? 715  GLU A OE1   1 
ATOM   5570  O  OE2   . GLU A 1  715  ? 95.139  79.875  20.165  1.00 129.75 ? 715  GLU A OE2   1 
ATOM   5571  N  N     . ASP A 1  716  ? 101.022 81.991  18.652  1.00 111.52 ? 716  ASP A N     1 
ATOM   5572  C  CA    . ASP A 1  716  ? 102.427 81.619  18.489  1.00 110.97 ? 716  ASP A CA    1 
ATOM   5573  C  C     . ASP A 1  716  ? 103.102 81.563  19.844  1.00 113.34 ? 716  ASP A C     1 
ATOM   5574  O  O     . ASP A 1  716  ? 103.832 80.604  20.118  1.00 112.30 ? 716  ASP A O     1 
ATOM   5575  C  CB    . ASP A 1  716  ? 103.180 82.611  17.573  1.00 113.97 ? 716  ASP A CB    1 
ATOM   5576  C  CG    . ASP A 1  716  ? 104.703 82.445  17.589  1.00 132.58 ? 716  ASP A CG    1 
ATOM   5577  O  OD1   . ASP A 1  716  ? 105.197 81.419  17.058  1.00 133.20 ? 716  ASP A OD1   1 
ATOM   5578  O  OD2   . ASP A 1  716  ? 105.399 83.332  18.158  1.00 141.21 ? 716  ASP A OD2   1 
ATOM   5579  N  N     . ASN A 1  717  ? 102.862 82.595  20.681  1.00 109.40 ? 717  ASN A N     1 
ATOM   5580  C  CA    . ASN A 1  717  ? 103.463 82.707  22.007  1.00 109.40 ? 717  ASN A CA    1 
ATOM   5581  C  C     . ASN A 1  717  ? 102.956 81.587  22.904  1.00 110.37 ? 717  ASN A C     1 
ATOM   5582  O  O     . ASN A 1  717  ? 103.763 80.929  23.568  1.00 109.15 ? 717  ASN A O     1 
ATOM   5583  C  CB    . ASN A 1  717  ? 103.218 84.096  22.642  1.00 112.73 ? 717  ASN A CB    1 
ATOM   5584  C  CG    . ASN A 1  717  ? 103.499 85.310  21.764  1.00 137.02 ? 717  ASN A CG    1 
ATOM   5585  O  OD1   . ASN A 1  717  ? 104.547 85.441  21.103  1.00 128.85 ? 717  ASN A OD1   1 
ATOM   5586  N  ND2   . ASN A 1  717  ? 102.580 86.268  21.798  1.00 129.83 ? 717  ASN A ND2   1 
ATOM   5587  N  N     . VAL A 1  718  ? 101.631 81.331  22.867  1.00 105.67 ? 718  VAL A N     1 
ATOM   5588  C  CA    . VAL A 1  718  ? 100.971 80.291  23.665  1.00 105.22 ? 718  VAL A CA    1 
ATOM   5589  C  C     . VAL A 1  718  ? 101.630 78.925  23.418  1.00 108.79 ? 718  VAL A C     1 
ATOM   5590  O  O     . VAL A 1  718  ? 102.181 78.318  24.347  1.00 109.29 ? 718  VAL A O     1 
ATOM   5591  C  CB    . VAL A 1  718  ? 99.441  80.272  23.427  1.00 108.50 ? 718  VAL A CB    1 
ATOM   5592  C  CG1   . VAL A 1  718  ? 98.767  79.178  24.246  1.00 107.88 ? 718  VAL A CG1   1 
ATOM   5593  C  CG2   . VAL A 1  718  ? 98.832  81.625  23.748  1.00 109.55 ? 718  VAL A CG2   1 
ATOM   5594  N  N     . VAL A 1  719  ? 101.621 78.493  22.145  1.00 103.12 ? 719  VAL A N     1 
ATOM   5595  C  CA    . VAL A 1  719  ? 102.214 77.264  21.630  1.00 100.74 ? 719  VAL A CA    1 
ATOM   5596  C  C     . VAL A 1  719  ? 103.677 77.156  22.065  1.00 104.90 ? 719  VAL A C     1 
ATOM   5597  O  O     . VAL A 1  719  ? 104.111 76.089  22.497  1.00 102.09 ? 719  VAL A O     1 
ATOM   5598  C  CB    . VAL A 1  719  ? 102.042 77.290  20.102  1.00 103.18 ? 719  VAL A CB    1 
ATOM   5599  C  CG1   . VAL A 1  719  ? 103.100 76.466  19.385  1.00 102.02 ? 719  VAL A CG1   1 
ATOM   5600  C  CG2   . VAL A 1  719  ? 100.639 76.851  19.715  1.00 102.55 ? 719  VAL A CG2   1 
ATOM   5601  N  N     . ARG A 1  720  ? 104.406 78.287  21.999  1.00 105.18 ? 720  ARG A N     1 
ATOM   5602  C  CA    . ARG A 1  720  ? 105.802 78.387  22.396  1.00 106.46 ? 720  ARG A CA    1 
ATOM   5603  C  C     . ARG A 1  720  ? 106.009 78.167  23.902  1.00 112.12 ? 720  ARG A C     1 
ATOM   5604  O  O     . ARG A 1  720  ? 106.918 77.415  24.246  1.00 111.56 ? 720  ARG A O     1 
ATOM   5605  C  CB    . ARG A 1  720  ? 106.442 79.695  21.899  1.00 109.70 ? 720  ARG A CB    1 
ATOM   5606  C  CG    . ARG A 1  720  ? 107.982 79.710  21.952  1.00 126.07 ? 720  ARG A CG    1 
ATOM   5607  C  CD    . ARG A 1  720  ? 108.595 81.056  21.586  1.00 141.20 ? 720  ARG A CD    1 
ATOM   5608  N  NE    . ARG A 1  720  ? 108.116 82.132  22.459  1.00 155.87 ? 720  ARG A NE    1 
ATOM   5609  C  CZ    . ARG A 1  720  ? 107.248 83.068  22.085  1.00 173.35 ? 720  ARG A CZ    1 
ATOM   5610  N  NH1   . ARG A 1  720  ? 106.772 83.087  20.843  1.00 157.30 ? 720  ARG A NH1   1 
ATOM   5611  N  NH2   . ARG A 1  720  ? 106.855 83.998  22.947  1.00 163.48 ? 720  ARG A NH2   1 
ATOM   5612  N  N     . PHE A 1  721  ? 105.174 78.763  24.796  1.00 110.26 ? 721  PHE A N     1 
ATOM   5613  C  CA    . PHE A 1  721  ? 105.356 78.537  26.248  1.00 111.58 ? 721  PHE A CA    1 
ATOM   5614  C  C     . PHE A 1  721  ? 105.043 77.104  26.628  1.00 114.55 ? 721  PHE A C     1 
ATOM   5615  O  O     . PHE A 1  721  ? 105.656 76.555  27.546  1.00 114.93 ? 721  PHE A O     1 
ATOM   5616  C  CB    . PHE A 1  721  ? 104.503 79.474  27.122  1.00 115.25 ? 721  PHE A CB    1 
ATOM   5617  C  CG    . PHE A 1  721  ? 104.621 80.955  26.866  1.00 118.12 ? 721  PHE A CG    1 
ATOM   5618  C  CD1   . PHE A 1  721  ? 105.850 81.531  26.551  1.00 121.71 ? 721  PHE A CD1   1 
ATOM   5619  C  CD2   . PHE A 1  721  ? 103.511 81.784  26.981  1.00 120.75 ? 721  PHE A CD2   1 
ATOM   5620  C  CE1   . PHE A 1  721  ? 105.947 82.892  26.283  1.00 123.49 ? 721  PHE A CE1   1 
ATOM   5621  C  CE2   . PHE A 1  721  ? 103.612 83.145  26.729  1.00 124.43 ? 721  PHE A CE2   1 
ATOM   5622  C  CZ    . PHE A 1  721  ? 104.827 83.691  26.381  1.00 123.06 ? 721  PHE A CZ    1 
ATOM   5623  N  N     . LEU A 1  722  ? 104.074 76.511  25.926  1.00 109.16 ? 722  LEU A N     1 
ATOM   5624  C  CA    . LEU A 1  722  ? 103.649 75.148  26.164  1.00 107.70 ? 722  LEU A CA    1 
ATOM   5625  C  C     . LEU A 1  722  ? 104.706 74.134  25.719  1.00 112.47 ? 722  LEU A C     1 
ATOM   5626  O  O     . LEU A 1  722  ? 104.955 73.165  26.436  1.00 112.85 ? 722  LEU A O     1 
ATOM   5627  C  CB    . LEU A 1  722  ? 102.282 74.896  25.515  1.00 106.49 ? 722  LEU A CB    1 
ATOM   5628  C  CG    . LEU A 1  722  ? 101.089 75.604  26.165  1.00 110.94 ? 722  LEU A CG    1 
ATOM   5629  C  CD1   . LEU A 1  722  ? 99.805  75.310  25.414  1.00 110.35 ? 722  LEU A CD1   1 
ATOM   5630  C  CD2   . LEU A 1  722  ? 100.926 75.206  27.634  1.00 112.91 ? 722  LEU A CD2   1 
ATOM   5631  N  N     . ASN A 1  723  ? 105.362 74.373  24.572  1.00 108.44 ? 723  ASN A N     1 
ATOM   5632  C  CA    . ASN A 1  723  ? 106.412 73.471  24.105  1.00 107.27 ? 723  ASN A CA    1 
ATOM   5633  C  C     . ASN A 1  723  ? 107.689 73.655  24.906  1.00 113.50 ? 723  ASN A C     1 
ATOM   5634  O  O     . ASN A 1  723  ? 108.437 72.692  25.076  1.00 112.99 ? 723  ASN A O     1 
ATOM   5635  C  CB    . ASN A 1  723  ? 106.639 73.586  22.607  1.00 103.58 ? 723  ASN A CB    1 
ATOM   5636  C  CG    . ASN A 1  723  ? 105.440 73.142  21.811  1.00 121.83 ? 723  ASN A CG    1 
ATOM   5637  O  OD1   . ASN A 1  723  ? 104.768 72.140  22.120  1.00 116.48 ? 723  ASN A OD1   1 
ATOM   5638  N  ND2   . ASN A 1  723  ? 105.130 73.901  20.781  1.00 112.49 ? 723  ASN A ND2   1 
ATOM   5639  N  N     . GLU A 1  724  ? 107.907 74.878  25.446  1.00 111.77 ? 724  GLU A N     1 
ATOM   5640  C  CA    . GLU A 1  724  ? 109.039 75.215  26.309  1.00 112.63 ? 724  GLU A CA    1 
ATOM   5641  C  C     . GLU A 1  724  ? 108.904 74.320  27.550  1.00 114.96 ? 724  GLU A C     1 
ATOM   5642  O  O     . GLU A 1  724  ? 109.872 73.690  27.982  1.00 113.99 ? 724  GLU A O     1 
ATOM   5643  C  CB    . GLU A 1  724  ? 108.931 76.687  26.768  1.00 115.93 ? 724  GLU A CB    1 
ATOM   5644  C  CG    . GLU A 1  724  ? 109.581 77.761  25.902  1.00 132.14 ? 724  GLU A CG    1 
ATOM   5645  C  CD    . GLU A 1  724  ? 109.311 79.204  26.328  1.00 167.04 ? 724  GLU A CD    1 
ATOM   5646  O  OE1   . GLU A 1  724  ? 108.654 79.427  27.375  1.00 156.73 ? 724  GLU A OE1   1 
ATOM   5647  O  OE2   . GLU A 1  724  ? 109.759 80.121  25.600  1.00 170.23 ? 724  GLU A OE2   1 
ATOM   5648  N  N     . ALA A 1  725  ? 107.669 74.258  28.084  1.00 111.28 ? 725  ALA A N     1 
ATOM   5649  C  CA    . ALA A 1  725  ? 107.288 73.513  29.270  1.00 111.78 ? 725  ALA A CA    1 
ATOM   5650  C  C     . ALA A 1  725  ? 107.473 72.030  29.092  1.00 115.67 ? 725  ALA A C     1 
ATOM   5651  O  O     . ALA A 1  725  ? 108.115 71.412  29.940  1.00 116.48 ? 725  ALA A O     1 
ATOM   5652  C  CB    . ALA A 1  725  ? 105.844 73.816  29.634  1.00 113.20 ? 725  ALA A CB    1 
ATOM   5653  N  N     . ARG A 1  726  ? 106.927 71.453  27.995  1.00 110.76 ? 726  ARG A N     1 
ATOM   5654  C  CA    . ARG A 1  726  ? 107.015 70.021  27.702  1.00 109.48 ? 726  ARG A CA    1 
ATOM   5655  C  C     . ARG A 1  726  ? 108.474 69.584  27.681  1.00 114.21 ? 726  ARG A C     1 
ATOM   5656  O  O     . ARG A 1  726  ? 108.800 68.523  28.218  1.00 114.84 ? 726  ARG A O     1 
ATOM   5657  C  CB    . ARG A 1  726  ? 106.298 69.676  26.384  1.00 107.96 ? 726  ARG A CB    1 
ATOM   5658  C  CG    . ARG A 1  726  ? 106.492 68.226  25.919  1.00 115.95 ? 726  ARG A CG    1 
ATOM   5659  C  CD    . ARG A 1  726  ? 105.964 67.936  24.517  1.00 123.23 ? 726  ARG A CD    1 
ATOM   5660  N  NE    . ARG A 1  726  ? 106.314 68.941  23.506  1.00 126.14 ? 726  ARG A NE    1 
ATOM   5661  C  CZ    . ARG A 1  726  ? 107.464 68.976  22.842  1.00 142.92 ? 726  ARG A CZ    1 
ATOM   5662  N  NH1   . ARG A 1  726  ? 108.420 68.088  23.103  1.00 131.03 ? 726  ARG A NH1   1 
ATOM   5663  N  NH2   . ARG A 1  726  ? 107.683 69.918  21.935  1.00 133.62 ? 726  ARG A NH2   1 
ATOM   5664  N  N     . ASP A 1  727  ? 109.351 70.433  27.108  1.00 109.88 ? 727  ASP A N     1 
ATOM   5665  C  CA    . ASP A 1  727  ? 110.783 70.179  27.020  1.00 108.84 ? 727  ASP A CA    1 
ATOM   5666  C  C     . ASP A 1  727  ? 111.445 70.277  28.382  1.00 111.36 ? 727  ASP A C     1 
ATOM   5667  O  O     . ASP A 1  727  ? 112.131 69.336  28.773  1.00 110.43 ? 727  ASP A O     1 
ATOM   5668  C  CB    . ASP A 1  727  ? 111.438 71.101  25.980  1.00 110.78 ? 727  ASP A CB    1 
ATOM   5669  C  CG    . ASP A 1  727  ? 110.935 70.892  24.555  1.00 122.15 ? 727  ASP A CG    1 
ATOM   5670  O  OD1   . ASP A 1  727  ? 109.942 70.150  24.373  1.00 121.34 ? 727  ASP A OD1   1 
ATOM   5671  O  OD2   . ASP A 1  727  ? 111.511 71.496  23.629  1.00 131.63 ? 727  ASP A OD2   1 
ATOM   5672  N  N     . LYS A 1  728  ? 111.184 71.371  29.128  1.00 108.38 ? 728  LYS A N     1 
ATOM   5673  C  CA    . LYS A 1  728  ? 111.711 71.608  30.479  1.00 109.09 ? 728  LYS A CA    1 
ATOM   5674  C  C     . LYS A 1  728  ? 111.455 70.400  31.389  1.00 111.68 ? 728  LYS A C     1 
ATOM   5675  O  O     . LYS A 1  728  ? 112.417 69.796  31.875  1.00 111.69 ? 728  LYS A O     1 
ATOM   5676  C  CB    . LYS A 1  728  ? 111.135 72.912  31.068  1.00 112.76 ? 728  LYS A CB    1 
ATOM   5677  C  CG    . LYS A 1  728  ? 111.838 73.406  32.327  1.00 127.74 ? 728  LYS A CG    1 
ATOM   5678  C  CD    . LYS A 1  728  ? 111.845 74.933  32.390  1.00 138.77 ? 728  LYS A CD    1 
ATOM   5679  C  CE    . LYS A 1  728  ? 111.577 75.466  33.776  1.00 144.92 ? 728  LYS A CE    1 
ATOM   5680  N  NZ    . LYS A 1  728  ? 112.361 76.700  34.042  1.00 149.59 ? 728  LYS A NZ    1 
ATOM   5681  N  N     . ALA A 1  729  ? 110.168 70.009  31.531  1.00 106.33 ? 729  ALA A N     1 
ATOM   5682  C  CA    . ALA A 1  729  ? 109.682 68.873  32.310  1.00 105.65 ? 729  ALA A CA    1 
ATOM   5683  C  C     . ALA A 1  729  ? 110.422 67.595  31.922  1.00 108.19 ? 729  ALA A C     1 
ATOM   5684  O  O     . ALA A 1  729  ? 110.947 66.889  32.787  1.00 106.90 ? 729  ALA A O     1 
ATOM   5685  C  CB    . ALA A 1  729  ? 108.194 68.700  32.068  1.00 106.21 ? 729  ALA A CB    1 
ATOM   5686  N  N     . GLY A 1  730  ? 110.485 67.349  30.613  1.00 105.10 ? 730  GLY A N     1 
ATOM   5687  C  CA    . GLY A 1  730  ? 111.178 66.216  30.020  1.00 104.18 ? 730  GLY A CA    1 
ATOM   5688  C  C     . GLY A 1  730  ? 112.608 66.174  30.495  1.00 109.53 ? 730  GLY A C     1 
ATOM   5689  O  O     . GLY A 1  730  ? 113.032 65.174  31.074  1.00 109.27 ? 730  GLY A O     1 
ATOM   5690  N  N     . ARG A 1  731  ? 113.319 67.306  30.347  1.00 107.56 ? 731  ARG A N     1 
ATOM   5691  C  CA    . ARG A 1  731  ? 114.712 67.451  30.760  1.00 108.39 ? 731  ARG A CA    1 
ATOM   5692  C  C     . ARG A 1  731  ? 114.941 67.216  32.245  1.00 114.57 ? 731  ARG A C     1 
ATOM   5693  O  O     . ARG A 1  731  ? 115.990 66.673  32.600  1.00 114.49 ? 731  ARG A O     1 
ATOM   5694  C  CB    . ARG A 1  731  ? 115.307 68.779  30.301  1.00 109.64 ? 731  ARG A CB    1 
ATOM   5695  C  CG    . ARG A 1  731  ? 115.741 68.777  28.834  1.00 121.92 ? 731  ARG A CG    1 
ATOM   5696  C  CD    . ARG A 1  731  ? 116.340 70.104  28.394  1.00 138.35 ? 731  ARG A CD    1 
ATOM   5697  N  NE    . ARG A 1  731  ? 115.347 71.180  28.266  1.00 151.50 ? 731  ARG A NE    1 
ATOM   5698  C  CZ    . ARG A 1  731  ? 115.104 72.115  29.186  1.00 166.26 ? 731  ARG A CZ    1 
ATOM   5699  N  NH1   . ARG A 1  731  ? 115.768 72.115  30.341  1.00 148.60 ? 731  ARG A NH1   1 
ATOM   5700  N  NH2   . ARG A 1  731  ? 114.193 73.054  28.961  1.00 154.43 ? 731  ARG A NH2   1 
ATOM   5701  N  N     . LEU A 1  732  ? 113.956 67.560  33.107  1.00 112.59 ? 732  LEU A N     1 
ATOM   5702  C  CA    . LEU A 1  732  ? 114.087 67.322  34.555  1.00 113.86 ? 732  LEU A CA    1 
ATOM   5703  C  C     . LEU A 1  732  ? 114.110 65.826  34.844  1.00 117.64 ? 732  LEU A C     1 
ATOM   5704  O  O     . LEU A 1  732  ? 114.871 65.391  35.715  1.00 119.21 ? 732  LEU A O     1 
ATOM   5705  C  CB    . LEU A 1  732  ? 112.981 67.995  35.403  1.00 114.79 ? 732  LEU A CB    1 
ATOM   5706  C  CG    . LEU A 1  732  ? 112.619 69.452  35.138  1.00 119.69 ? 732  LEU A CG    1 
ATOM   5707  C  CD1   . LEU A 1  732  ? 111.616 69.943  36.149  1.00 120.64 ? 732  LEU A CD1   1 
ATOM   5708  C  CD2   . LEU A 1  732  ? 113.843 70.351  35.114  1.00 122.98 ? 732  LEU A CD2   1 
ATOM   5709  N  N     . ALA A 1  733  ? 113.290 65.047  34.097  1.00 111.04 ? 733  ALA A N     1 
ATOM   5710  C  CA    . ALA A 1  733  ? 113.181 63.600  34.235  1.00 109.22 ? 733  ALA A CA    1 
ATOM   5711  C  C     . ALA A 1  733  ? 114.434 62.864  33.752  1.00 111.25 ? 733  ALA A C     1 
ATOM   5712  O  O     . ALA A 1  733  ? 115.009 62.102  34.528  1.00 110.16 ? 733  ALA A O     1 
ATOM   5713  C  CB    . ALA A 1  733  ? 111.947 63.097  33.512  1.00 108.80 ? 733  ALA A CB    1 
ATOM   5714  N  N     . GLU A 1  734  ? 114.888 63.122  32.504  1.00 107.80 ? 734  GLU A N     1 
ATOM   5715  C  CA    . GLU A 1  734  ? 116.073 62.471  31.918  1.00 107.60 ? 734  GLU A CA    1 
ATOM   5716  C  C     . GLU A 1  734  ? 117.321 62.614  32.774  1.00 112.49 ? 734  GLU A C     1 
ATOM   5717  O  O     . GLU A 1  734  ? 118.200 61.757  32.715  1.00 111.93 ? 734  GLU A O     1 
ATOM   5718  C  CB    . GLU A 1  734  ? 116.326 62.924  30.461  1.00 108.38 ? 734  GLU A CB    1 
ATOM   5719  C  CG    . GLU A 1  734  ? 117.335 64.056  30.292  1.00 126.17 ? 734  GLU A CG    1 
ATOM   5720  C  CD    . GLU A 1  734  ? 117.495 64.623  28.892  1.00 162.01 ? 734  GLU A CD    1 
ATOM   5721  O  OE1   . GLU A 1  734  ? 117.634 63.827  27.933  1.00 159.50 ? 734  GLU A OE1   1 
ATOM   5722  O  OE2   . GLU A 1  734  ? 117.489 65.870  28.757  1.00 161.10 ? 734  GLU A OE2   1 
ATOM   5723  N  N     . VAL A 1  735  ? 117.387 63.703  33.557  1.00 110.15 ? 735  VAL A N     1 
ATOM   5724  C  CA    . VAL A 1  735  ? 118.497 64.014  34.447  1.00 111.02 ? 735  VAL A CA    1 
ATOM   5725  C  C     . VAL A 1  735  ? 118.335 63.263  35.771  1.00 116.40 ? 735  VAL A C     1 
ATOM   5726  O  O     . VAL A 1  735  ? 119.323 62.775  36.323  1.00 116.05 ? 735  VAL A O     1 
ATOM   5727  C  CB    . VAL A 1  735  ? 118.660 65.540  34.606  1.00 115.42 ? 735  VAL A CB    1 
ATOM   5728  C  CG1   . VAL A 1  735  ? 119.700 65.880  35.663  1.00 116.44 ? 735  VAL A CG1   1 
ATOM   5729  C  CG2   . VAL A 1  735  ? 119.036 66.179  33.270  1.00 114.37 ? 735  VAL A CG2   1 
ATOM   5730  N  N     . ASN A 1  736  ? 117.086 63.125  36.238  1.00 114.43 ? 736  ASN A N     1 
ATOM   5731  C  CA    . ASN A 1  736  ? 116.731 62.399  37.462  1.00 115.57 ? 736  ASN A CA    1 
ATOM   5732  C  C     . ASN A 1  736  ? 116.852 60.854  37.301  1.00 118.22 ? 736  ASN A C     1 
ATOM   5733  O  O     . ASN A 1  736  ? 117.044 60.140  38.301  1.00 118.62 ? 736  ASN A O     1 
ATOM   5734  C  CB    . ASN A 1  736  ? 115.336 62.807  37.939  1.00 117.91 ? 736  ASN A CB    1 
ATOM   5735  C  CG    . ASN A 1  736  ? 114.867 62.049  39.148  1.00 139.11 ? 736  ASN A CG    1 
ATOM   5736  O  OD1   . ASN A 1  736  ? 114.214 61.000  39.036  1.00 132.85 ? 736  ASN A OD1   1 
ATOM   5737  N  ND2   . ASN A 1  736  ? 115.249 62.534  40.319  1.00 129.26 ? 736  ASN A ND2   1 
ATOM   5738  N  N     . LEU A 1  737  ? 116.729 60.345  36.054  1.00 111.95 ? 737  LEU A N     1 
ATOM   5739  C  CA    . LEU A 1  737  ? 116.894 58.915  35.799  1.00 110.16 ? 737  LEU A CA    1 
ATOM   5740  C  C     . LEU A 1  737  ? 118.375 58.595  35.981  1.00 113.70 ? 737  LEU A C     1 
ATOM   5741  O  O     . LEU A 1  737  ? 119.228 59.322  35.451  1.00 113.66 ? 737  LEU A O     1 
ATOM   5742  C  CB    . LEU A 1  737  ? 116.456 58.525  34.372  1.00 108.33 ? 737  LEU A CB    1 
ATOM   5743  C  CG    . LEU A 1  737  ? 115.020 58.804  33.939  1.00 111.76 ? 737  LEU A CG    1 
ATOM   5744  C  CD1   . LEU A 1  737  ? 114.787 58.282  32.549  1.00 110.23 ? 737  LEU A CD1   1 
ATOM   5745  C  CD2   . LEU A 1  737  ? 113.994 58.211  34.908  1.00 113.57 ? 737  LEU A CD2   1 
ATOM   5746  N  N     . LYS A 1  738  ? 118.684 57.543  36.762  1.00 109.44 ? 738  LYS A N     1 
ATOM   5747  C  CA    . LYS A 1  738  ? 120.075 57.129  37.019  1.00 108.96 ? 738  LYS A CA    1 
ATOM   5748  C  C     . LYS A 1  738  ? 120.642 56.409  35.800  1.00 110.28 ? 738  LYS A C     1 
ATOM   5749  O  O     . LYS A 1  738  ? 119.898 56.096  34.866  1.00 109.79 ? 738  LYS A O     1 
ATOM   5750  C  CB    . LYS A 1  738  ? 120.202 56.210  38.258  1.00 111.93 ? 738  LYS A CB    1 
ATOM   5751  C  CG    . LYS A 1  738  ? 119.278 56.520  39.424  1.00 118.80 ? 738  LYS A CG    1 
ATOM   5752  C  CD    . LYS A 1  738  ? 118.003 55.681  39.376  1.00 118.22 ? 738  LYS A CD    1 
ATOM   5753  C  CE    . LYS A 1  738  ? 117.204 55.895  40.616  1.00 118.87 ? 738  LYS A CE    1 
ATOM   5754  N  NZ    . LYS A 1  738  ? 117.991 55.529  41.822  1.00 124.19 ? 738  LYS A NZ    1 
ATOM   5755  N  N     . ASP A 1  739  ? 121.946 56.106  35.818  1.00 104.75 ? 739  ASP A N     1 
ATOM   5756  C  CA    . ASP A 1  739  ? 122.572 55.376  34.722  1.00 102.49 ? 739  ASP A CA    1 
ATOM   5757  C  C     . ASP A 1  739  ? 122.054 53.924  34.638  1.00 100.41 ? 739  ASP A C     1 
ATOM   5758  O  O     . ASP A 1  739  ? 122.172 53.289  33.587  1.00 98.38  ? 739  ASP A O     1 
ATOM   5759  C  CB    . ASP A 1  739  ? 124.101 55.449  34.839  1.00 105.81 ? 739  ASP A CB    1 
ATOM   5760  C  CG    . ASP A 1  739  ? 124.719 56.611  34.078  1.00 122.70 ? 739  ASP A CG    1 
ATOM   5761  O  OD1   . ASP A 1  739  ? 124.082 57.698  34.021  1.00 124.13 ? 739  ASP A OD1   1 
ATOM   5762  O  OD2   . ASP A 1  739  ? 125.828 56.430  33.518  1.00 130.86 ? 739  ASP A OD2   1 
ATOM   5763  N  N     . LEU A 1  740  ? 121.431 53.434  35.742  1.00 94.04  ? 740  LEU A N     1 
ATOM   5764  C  CA    . LEU A 1  740  ? 120.833 52.103  35.876  1.00 91.63  ? 740  LEU A CA    1 
ATOM   5765  C  C     . LEU A 1  740  ? 119.472 52.011  35.219  1.00 91.00  ? 740  LEU A C     1 
ATOM   5766  O  O     . LEU A 1  740  ? 118.904 50.919  35.153  1.00 89.36  ? 740  LEU A O     1 
ATOM   5767  C  CB    . LEU A 1  740  ? 120.771 51.633  37.348  1.00 92.88  ? 740  LEU A CB    1 
ATOM   5768  C  CG    . LEU A 1  740  ? 119.923 52.432  38.334  1.00 98.49  ? 740  LEU A CG    1 
ATOM   5769  C  CD1   . LEU A 1  740  ? 118.724 51.632  38.810  1.00 98.20  ? 740  LEU A CD1   1 
ATOM   5770  C  CD2   . LEU A 1  740  ? 120.752 52.853  39.511  1.00 103.51 ? 740  LEU A CD2   1 
ATOM   5771  N  N     . ASN A 1  741  ? 118.940 53.153  34.748  1.00 86.45  ? 741  ASN A N     1 
ATOM   5772  C  CA    . ASN A 1  741  ? 117.654 53.186  34.072  1.00 85.33  ? 741  ASN A CA    1 
ATOM   5773  C  C     . ASN A 1  741  ? 117.835 52.487  32.748  1.00 89.05  ? 741  ASN A C     1 
ATOM   5774  O  O     . ASN A 1  741  ? 118.671 52.904  31.937  1.00 88.04  ? 741  ASN A O     1 
ATOM   5775  C  CB    . ASN A 1  741  ? 117.141 54.607  33.870  1.00 83.41  ? 741  ASN A CB    1 
ATOM   5776  C  CG    . ASN A 1  741  ? 115.720 54.616  33.388  1.00 102.39 ? 741  ASN A CG    1 
ATOM   5777  O  OD1   . ASN A 1  741  ? 115.412 54.255  32.262  1.00 92.07  ? 741  ASN A OD1   1 
ATOM   5778  N  ND2   . ASN A 1  741  ? 114.806 54.917  34.269  1.00 100.95 ? 741  ASN A ND2   1 
ATOM   5779  N  N     . ASN A 1  742  ? 117.085 51.385  32.560  1.00 85.57  ? 742  ASN A N     1 
ATOM   5780  C  CA    . ASN A 1  742  ? 117.148 50.545  31.366  1.00 84.10  ? 742  ASN A CA    1 
ATOM   5781  C  C     . ASN A 1  742  ? 116.803 51.329  30.103  1.00 86.90  ? 742  ASN A C     1 
ATOM   5782  O  O     . ASN A 1  742  ? 117.489 51.170  29.092  1.00 85.68  ? 742  ASN A O     1 
ATOM   5783  C  CB    . ASN A 1  742  ? 116.310 49.277  31.532  1.00 84.10  ? 742  ASN A CB    1 
ATOM   5784  C  CG    . ASN A 1  742  ? 116.733 48.403  32.703  1.00 103.02 ? 742  ASN A CG    1 
ATOM   5785  O  OD1   . ASN A 1  742  ? 117.487 47.414  32.566  1.00 90.44  ? 742  ASN A OD1   1 
ATOM   5786  N  ND2   . ASN A 1  742  ? 116.223 48.737  33.881  1.00 96.72  ? 742  ASN A ND2   1 
ATOM   5787  N  N     . VAL A 1  743  ? 115.805 52.239  30.193  1.00 83.48  ? 743  VAL A N     1 
ATOM   5788  C  CA    . VAL A 1  743  ? 115.404 53.119  29.090  1.00 82.50  ? 743  VAL A CA    1 
ATOM   5789  C  C     . VAL A 1  743  ? 116.584 54.043  28.760  1.00 88.21  ? 743  VAL A C     1 
ATOM   5790  O  O     . VAL A 1  743  ? 117.057 54.044  27.631  1.00 87.75  ? 743  VAL A O     1 
ATOM   5791  C  CB    . VAL A 1  743  ? 114.081 53.884  29.375  1.00 85.81  ? 743  VAL A CB    1 
ATOM   5792  C  CG1   . VAL A 1  743  ? 113.796 54.941  28.310  1.00 84.78  ? 743  VAL A CG1   1 
ATOM   5793  C  CG2   . VAL A 1  743  ? 112.909 52.916  29.503  1.00 85.23  ? 743  VAL A CG2   1 
ATOM   5794  N  N     . LYS A 1  744  ? 117.117 54.738  29.767  1.00 86.87  ? 744  LYS A N     1 
ATOM   5795  C  CA    . LYS A 1  744  ? 118.272 55.627  29.629  1.00 87.41  ? 744  LYS A CA    1 
ATOM   5796  C  C     . LYS A 1  744  ? 119.445 54.851  29.010  1.00 88.78  ? 744  LYS A C     1 
ATOM   5797  O  O     . LYS A 1  744  ? 120.120 55.387  28.141  1.00 86.86  ? 744  LYS A O     1 
ATOM   5798  C  CB    . LYS A 1  744  ? 118.647 56.239  31.008  1.00 92.34  ? 744  LYS A CB    1 
ATOM   5799  C  CG    . LYS A 1  744  ? 118.934 57.746  30.991  1.00 109.60 ? 744  LYS A CG    1 
ATOM   5800  C  CD    . LYS A 1  744  ? 119.605 58.241  32.278  1.00 119.78 ? 744  LYS A CD    1 
ATOM   5801  C  CE    . LYS A 1  744  ? 120.505 59.444  32.056  1.00 128.82 ? 744  LYS A CE    1 
ATOM   5802  N  NZ    . LYS A 1  744  ? 121.188 59.886  33.307  1.00 136.58 ? 744  LYS A NZ    1 
ATOM   5803  N  N     . GLN A 1  745  ? 119.628 53.573  29.409  1.00 85.70  ? 745  GLN A N     1 
ATOM   5804  C  CA    . GLN A 1  745  ? 120.684 52.690  28.912  1.00 86.12  ? 745  GLN A CA    1 
ATOM   5805  C  C     . GLN A 1  745  ? 120.532 52.407  27.419  1.00 91.80  ? 745  GLN A C     1 
ATOM   5806  O  O     . GLN A 1  745  ? 121.544 52.269  26.717  1.00 92.58  ? 745  GLN A O     1 
ATOM   5807  C  CB    . GLN A 1  745  ? 120.699 51.359  29.674  1.00 87.77  ? 745  GLN A CB    1 
ATOM   5808  C  CG    . GLN A 1  745  ? 121.555 51.332  30.928  1.00 102.75 ? 745  GLN A CG    1 
ATOM   5809  C  CD    . GLN A 1  745  ? 121.356 50.025  31.660  1.00 119.67 ? 745  GLN A CD    1 
ATOM   5810  O  OE1   . GLN A 1  745  ? 121.982 49.015  31.348  1.00 113.61 ? 745  GLN A OE1   1 
ATOM   5811  N  NE2   . GLN A 1  745  ? 120.430 49.994  32.606  1.00 112.72 ? 745  GLN A NE2   1 
ATOM   5812  N  N     . MET A 1  746  ? 119.280 52.272  26.935  1.00 87.32  ? 746  MET A N     1 
ATOM   5813  C  CA    . MET A 1  746  ? 119.039 52.025  25.513  1.00 85.43  ? 746  MET A CA    1 
ATOM   5814  C  C     . MET A 1  746  ? 119.302 53.308  24.733  1.00 90.57  ? 746  MET A C     1 
ATOM   5815  O  O     . MET A 1  746  ? 119.921 53.273  23.671  1.00 89.72  ? 746  MET A O     1 
ATOM   5816  C  CB    . MET A 1  746  ? 117.628 51.471  25.264  1.00 86.60  ? 746  MET A CB    1 
ATOM   5817  C  CG    . MET A 1  746  ? 117.556 49.974  25.427  1.00 89.12  ? 746  MET A CG    1 
ATOM   5818  S  SD    . MET A 1  746  ? 115.895 49.312  25.197  1.00 92.53  ? 746  MET A SD    1 
ATOM   5819  C  CE    . MET A 1  746  ? 115.189 49.623  26.825  1.00 90.48  ? 746  MET A CE    1 
ATOM   5820  N  N     . VAL A 1  747  ? 118.910 54.445  25.312  1.00 89.03  ? 747  VAL A N     1 
ATOM   5821  C  CA    . VAL A 1  747  ? 119.106 55.755  24.715  1.00 89.60  ? 747  VAL A CA    1 
ATOM   5822  C  C     . VAL A 1  747  ? 120.594 56.075  24.641  1.00 97.27  ? 747  VAL A C     1 
ATOM   5823  O  O     . VAL A 1  747  ? 121.053 56.562  23.609  1.00 96.52  ? 747  VAL A O     1 
ATOM   5824  C  CB    . VAL A 1  747  ? 118.280 56.854  25.420  1.00 93.80  ? 747  VAL A CB    1 
ATOM   5825  C  CG1   . VAL A 1  747  ? 118.431 58.183  24.702  1.00 93.73  ? 747  VAL A CG1   1 
ATOM   5826  C  CG2   . VAL A 1  747  ? 116.802 56.472  25.490  1.00 93.21  ? 747  VAL A CG2   1 
ATOM   5827  N  N     . MET A 1  748  ? 121.351 55.739  25.701  1.00 98.31  ? 748  MET A N     1 
ATOM   5828  C  CA    . MET A 1  748  ? 122.798 55.968  25.771  1.00 100.73 ? 748  MET A CA    1 
ATOM   5829  C  C     . MET A 1  748  ? 123.519 55.184  24.691  1.00 104.53 ? 748  MET A C     1 
ATOM   5830  O  O     . MET A 1  748  ? 124.319 55.764  23.952  1.00 104.61 ? 748  MET A O     1 
ATOM   5831  C  CB    . MET A 1  748  ? 123.359 55.598  27.148  1.00 105.20 ? 748  MET A CB    1 
ATOM   5832  C  CG    . MET A 1  748  ? 123.076 56.615  28.226  1.00 111.87 ? 748  MET A CG    1 
ATOM   5833  S  SD    . MET A 1  748  ? 123.735 56.047  29.820  1.00 119.28 ? 748  MET A SD    1 
ATOM   5834  C  CE    . MET A 1  748  ? 122.267 55.992  30.798  1.00 116.12 ? 748  MET A CE    1 
ATOM   5835  N  N     . ALA A 1  749  ? 123.193 53.876  24.563  1.00 100.28 ? 749  ALA A N     1 
ATOM   5836  C  CA    . ALA A 1  749  ? 123.773 52.978  23.559  1.00 98.81  ? 749  ALA A CA    1 
ATOM   5837  C  C     . ALA A 1  749  ? 123.317 53.372  22.147  1.00 100.46 ? 749  ALA A C     1 
ATOM   5838  O  O     . ALA A 1  749  ? 124.052 53.148  21.180  1.00 99.21  ? 749  ALA A O     1 
ATOM   5839  C  CB    . ALA A 1  749  ? 123.385 51.537  23.864  1.00 99.14  ? 749  ALA A CB    1 
ATOM   5840  N  N     . GLY A 1  750  ? 122.131 53.988  22.075  1.00 95.96  ? 750  GLY A N     1 
ATOM   5841  C  CA    . GLY A 1  750  ? 121.480 54.423  20.847  1.00 94.74  ? 750  GLY A CA    1 
ATOM   5842  C  C     . GLY A 1  750  ? 120.809 53.273  20.122  1.00 97.14  ? 750  GLY A C     1 
ATOM   5843  O  O     . GLY A 1  750  ? 120.538 53.369  18.923  1.00 95.33  ? 750  GLY A O     1 
ATOM   5844  N  N     . SER A 1  751  ? 120.550 52.170  20.848  1.00 94.49  ? 751  SER A N     1 
ATOM   5845  C  CA    . SER A 1  751  ? 119.939 50.946  20.327  1.00 94.06  ? 751  SER A CA    1 
ATOM   5846  C  C     . SER A 1  751  ? 118.448 51.078  20.011  1.00 97.46  ? 751  SER A C     1 
ATOM   5847  O  O     . SER A 1  751  ? 117.971 50.378  19.109  1.00 95.94  ? 751  SER A O     1 
ATOM   5848  C  CB    . SER A 1  751  ? 120.224 49.761  21.243  1.00 98.79  ? 751  SER A CB    1 
ATOM   5849  O  OG    . SER A 1  751  ? 119.580 49.907  22.498  1.00 109.71 ? 751  SER A OG    1 
ATOM   5850  N  N     . LYS A 1  752  ? 117.732 51.967  20.762  1.00 94.97  ? 752  LYS A N     1 
ATOM   5851  C  CA    . LYS A 1  752  ? 116.324 52.401  20.634  1.00 95.01  ? 752  LYS A CA    1 
ATOM   5852  C  C     . LYS A 1  752  ? 116.070 53.608  21.534  1.00 102.22 ? 752  LYS A C     1 
ATOM   5853  O  O     . LYS A 1  752  ? 116.804 53.825  22.503  1.00 101.71 ? 752  LYS A O     1 
ATOM   5854  C  CB    . LYS A 1  752  ? 115.290 51.294  20.950  1.00 96.40  ? 752  LYS A CB    1 
ATOM   5855  C  CG    . LYS A 1  752  ? 114.760 50.526  19.731  1.00 107.14 ? 752  LYS A CG    1 
ATOM   5856  C  CD    . LYS A 1  752  ? 113.783 51.284  18.812  1.00 112.95 ? 752  LYS A CD    1 
ATOM   5857  C  CE    . LYS A 1  752  ? 113.425 50.526  17.530  1.00 117.88 ? 752  LYS A CE    1 
ATOM   5858  N  NZ    . LYS A 1  752  ? 112.508 49.351  17.730  1.00 119.30 ? 752  LYS A NZ    1 
ATOM   5859  N  N     . GLY A 1  753  ? 115.032 54.376  21.189  1.00 101.48 ? 753  GLY A N     1 
ATOM   5860  C  CA    . GLY A 1  753  ? 114.555 55.537  21.939  1.00 102.78 ? 753  GLY A CA    1 
ATOM   5861  C  C     . GLY A 1  753  ? 115.418 56.783  21.930  1.00 107.45 ? 753  GLY A C     1 
ATOM   5862  O  O     . GLY A 1  753  ? 116.603 56.734  21.565  1.00 107.58 ? 753  GLY A O     1 
ATOM   5863  N  N     . SER A 1  754  ? 114.804 57.916  22.358  1.00 103.22 ? 754  SER A N     1 
ATOM   5864  C  CA    . SER A 1  754  ? 115.411 59.252  22.444  1.00 102.99 ? 754  SER A CA    1 
ATOM   5865  C  C     . SER A 1  754  ? 114.785 60.048  23.592  1.00 106.72 ? 754  SER A C     1 
ATOM   5866  O  O     . SER A 1  754  ? 113.848 59.559  24.227  1.00 106.31 ? 754  SER A O     1 
ATOM   5867  C  CB    . SER A 1  754  ? 115.185 60.012  21.143  1.00 105.84 ? 754  SER A CB    1 
ATOM   5868  O  OG    . SER A 1  754  ? 113.886 60.580  21.131  1.00 115.33 ? 754  SER A OG    1 
ATOM   5869  N  N     . PHE A 1  755  ? 115.264 61.297  23.811  1.00 103.29 ? 755  PHE A N     1 
ATOM   5870  C  CA    . PHE A 1  755  ? 114.773 62.201  24.853  1.00 104.01 ? 755  PHE A CA    1 
ATOM   5871  C  C     . PHE A 1  755  ? 113.257 62.267  24.900  1.00 104.00 ? 755  PHE A C     1 
ATOM   5872  O  O     . PHE A 1  755  ? 112.657 62.014  25.945  1.00 103.31 ? 755  PHE A O     1 
ATOM   5873  C  CB    . PHE A 1  755  ? 115.361 63.624  24.682  1.00 107.34 ? 755  PHE A CB    1 
ATOM   5874  C  CG    . PHE A 1  755  ? 114.602 64.741  25.388  1.00 111.15 ? 755  PHE A CG    1 
ATOM   5875  C  CD1   . PHE A 1  755  ? 114.726 64.932  26.762  1.00 116.12 ? 755  PHE A CD1   1 
ATOM   5876  C  CD2   . PHE A 1  755  ? 113.767 65.601  24.676  1.00 114.15 ? 755  PHE A CD2   1 
ATOM   5877  C  CE1   . PHE A 1  755  ? 114.012 65.949  27.413  1.00 118.21 ? 755  PHE A CE1   1 
ATOM   5878  C  CE2   . PHE A 1  755  ? 113.058 66.624  25.330  1.00 118.21 ? 755  PHE A CE2   1 
ATOM   5879  C  CZ    . PHE A 1  755  ? 113.187 66.790  26.695  1.00 117.38 ? 755  PHE A CZ    1 
ATOM   5880  N  N     . ILE A 1  756  ? 112.653 62.615  23.762  1.00 98.49  ? 756  ILE A N     1 
ATOM   5881  C  CA    . ILE A 1  756  ? 111.218 62.815  23.610  1.00 98.00  ? 756  ILE A CA    1 
ATOM   5882  C  C     . ILE A 1  756  ? 110.340 61.666  24.159  1.00 99.80  ? 756  ILE A C     1 
ATOM   5883  O  O     . ILE A 1  756  ? 109.324 61.929  24.814  1.00 99.54  ? 756  ILE A O     1 
ATOM   5884  C  CB    . ILE A 1  756  ? 110.913 63.302  22.168  1.00 100.55 ? 756  ILE A CB    1 
ATOM   5885  C  CG1   . ILE A 1  756  ? 109.746 64.333  22.075  1.00 101.72 ? 756  ILE A CG1   1 
ATOM   5886  C  CG2   . ILE A 1  756  ? 110.940 62.204  21.105  1.00 99.65  ? 756  ILE A CG2   1 
ATOM   5887  C  CD1   . ILE A 1  756  ? 108.311 63.814  22.085  1.00 109.94 ? 756  ILE A CD1   1 
ATOM   5888  N  N     . ASN A 1  757  ? 110.793 60.406  23.962  1.00 93.88  ? 757  ASN A N     1 
ATOM   5889  C  CA    . ASN A 1  757  ? 110.139 59.197  24.463  1.00 92.33  ? 757  ASN A CA    1 
ATOM   5890  C  C     . ASN A 1  757  ? 110.160 59.175  26.007  1.00 94.31  ? 757  ASN A C     1 
ATOM   5891  O  O     . ASN A 1  757  ? 109.108 58.984  26.611  1.00 94.17  ? 757  ASN A O     1 
ATOM   5892  C  CB    . ASN A 1  757  ? 110.782 57.947  23.866  1.00 92.51  ? 757  ASN A CB    1 
ATOM   5893  C  CG    . ASN A 1  757  ? 110.660 57.848  22.363  1.00 114.04 ? 757  ASN A CG    1 
ATOM   5894  O  OD1   . ASN A 1  757  ? 111.617 58.087  21.618  1.00 113.24 ? 757  ASN A OD1   1 
ATOM   5895  N  ND2   . ASN A 1  757  ? 109.486 57.473  21.884  1.00 101.75 ? 757  ASN A ND2   1 
ATOM   5896  N  N     . ILE A 1  758  ? 111.330 59.450  26.640  1.00 89.23  ? 758  ILE A N     1 
ATOM   5897  C  CA    . ILE A 1  758  ? 111.471 59.552  28.100  1.00 89.13  ? 758  ILE A CA    1 
ATOM   5898  C  C     . ILE A 1  758  ? 110.488 60.619  28.594  1.00 94.40  ? 758  ILE A C     1 
ATOM   5899  O  O     . ILE A 1  758  ? 109.661 60.341  29.468  1.00 94.07  ? 758  ILE A O     1 
ATOM   5900  C  CB    . ILE A 1  758  ? 112.929 59.905  28.502  1.00 91.84  ? 758  ILE A CB    1 
ATOM   5901  C  CG1   . ILE A 1  758  ? 113.851 58.694  28.350  1.00 91.38  ? 758  ILE A CG1   1 
ATOM   5902  C  CG2   . ILE A 1  758  ? 112.996 60.464  29.927  1.00 93.43  ? 758  ILE A CG2   1 
ATOM   5903  C  CD1   . ILE A 1  758  ? 115.344 59.011  28.259  1.00 97.07  ? 758  ILE A CD1   1 
ATOM   5904  N  N     . ALA A 1  759  ? 110.559 61.818  27.971  1.00 91.91  ? 759  ALA A N     1 
ATOM   5905  C  CA    . ALA A 1  759  ? 109.733 62.989  28.248  1.00 92.99  ? 759  ALA A CA    1 
ATOM   5906  C  C     . ALA A 1  759  ? 108.224 62.665  28.335  1.00 97.36  ? 759  ALA A C     1 
ATOM   5907  O  O     . ALA A 1  759  ? 107.616 62.833  29.406  1.00 97.45  ? 759  ALA A O     1 
ATOM   5908  C  CB    . ALA A 1  759  ? 109.993 64.063  27.193  1.00 93.48  ? 759  ALA A CB    1 
ATOM   5909  N  N     . GLN A 1  760  ? 107.646 62.161  27.218  1.00 92.81  ? 760  GLN A N     1 
ATOM   5910  C  CA    . GLN A 1  760  ? 106.224 61.827  27.098  1.00 92.25  ? 760  GLN A CA    1 
ATOM   5911  C  C     . GLN A 1  760  ? 105.763 60.689  28.019  1.00 97.25  ? 760  GLN A C     1 
ATOM   5912  O  O     . GLN A 1  760  ? 104.594 60.664  28.423  1.00 97.14  ? 760  GLN A O     1 
ATOM   5913  C  CB    . GLN A 1  760  ? 105.862 61.527  25.638  1.00 91.93  ? 760  GLN A CB    1 
ATOM   5914  C  CG    . GLN A 1  760  ? 105.875 62.753  24.737  1.00 95.79  ? 760  GLN A CG    1 
ATOM   5915  C  CD    . GLN A 1  760  ? 105.238 62.503  23.392  1.00 107.74 ? 760  GLN A CD    1 
ATOM   5916  O  OE1   . GLN A 1  760  ? 105.291 61.407  22.830  1.00 99.87  ? 760  GLN A OE1   1 
ATOM   5917  N  NE2   . GLN A 1  760  ? 104.662 63.538  22.816  1.00 103.98 ? 760  GLN A NE2   1 
ATOM   5918  N  N     . MET A 1  761  ? 106.672 59.754  28.343  1.00 93.91  ? 761  MET A N     1 
ATOM   5919  C  CA    . MET A 1  761  ? 106.353 58.624  29.201  1.00 94.34  ? 761  MET A CA    1 
ATOM   5920  C  C     . MET A 1  761  ? 106.385 59.003  30.677  1.00 100.88 ? 761  MET A C     1 
ATOM   5921  O  O     . MET A 1  761  ? 105.407 58.760  31.388  1.00 100.49 ? 761  MET A O     1 
ATOM   5922  C  CB    . MET A 1  761  ? 107.331 57.469  28.959  1.00 95.97  ? 761  MET A CB    1 
ATOM   5923  C  CG    . MET A 1  761  ? 107.036 56.637  27.719  1.00 98.15  ? 761  MET A CG    1 
ATOM   5924  S  SD    . MET A 1  761  ? 107.960 55.069  27.684  1.00 101.23 ? 761  MET A SD    1 
ATOM   5925  C  CE    . MET A 1  761  ? 109.668 55.669  27.525  1.00 97.94  ? 761  MET A CE    1 
ATOM   5926  N  N     . SER A 1  762  ? 107.520 59.588  31.134  1.00 99.36  ? 762  SER A N     1 
ATOM   5927  C  CA    . SER A 1  762  ? 107.802 59.919  32.538  1.00 101.05 ? 762  SER A CA    1 
ATOM   5928  C  C     . SER A 1  762  ? 107.221 61.193  33.101  1.00 106.11 ? 762  SER A C     1 
ATOM   5929  O  O     . SER A 1  762  ? 106.812 61.182  34.268  1.00 106.11 ? 762  SER A O     1 
ATOM   5930  C  CB    . SER A 1  762  ? 109.305 59.909  32.801  1.00 105.27 ? 762  SER A CB    1 
ATOM   5931  O  OG    . SER A 1  762  ? 109.889 58.650  32.507  1.00 115.47 ? 762  SER A OG    1 
ATOM   5932  N  N     . ALA A 1  763  ? 107.255 62.300  32.308  1.00 103.15 ? 763  ALA A N     1 
ATOM   5933  C  CA    . ALA A 1  763  ? 106.856 63.648  32.735  1.00 104.21 ? 763  ALA A CA    1 
ATOM   5934  C  C     . ALA A 1  763  ? 105.589 64.278  32.129  1.00 108.23 ? 763  ALA A C     1 
ATOM   5935  O  O     . ALA A 1  763  ? 104.643 64.566  32.877  1.00 108.96 ? 763  ALA A O     1 
ATOM   5936  C  CB    . ALA A 1  763  ? 108.033 64.607  32.604  1.00 105.11 ? 763  ALA A CB    1 
ATOM   5937  N  N     . CYS A 1  764  ? 105.582 64.548  30.803  1.00 102.72 ? 764  CYS A N     1 
ATOM   5938  C  CA    . CYS A 1  764  ? 104.454 65.231  30.164  1.00 101.52 ? 764  CYS A CA    1 
ATOM   5939  C  C     . CYS A 1  764  ? 104.361 64.968  28.656  1.00 99.44  ? 764  CYS A C     1 
ATOM   5940  O  O     . CYS A 1  764  ? 105.345 65.183  27.942  1.00 98.56  ? 764  CYS A O     1 
ATOM   5941  C  CB    . CYS A 1  764  ? 104.519 66.727  30.477  1.00 103.28 ? 764  CYS A CB    1 
ATOM   5942  S  SG    . CYS A 1  764  ? 103.539 67.772  29.372  1.00 107.15 ? 764  CYS A SG    1 
ATOM   5943  N  N     . VAL A 1  765  ? 103.155 64.560  28.176  1.00 91.49  ? 765  VAL A N     1 
ATOM   5944  C  CA    . VAL A 1  765  ? 102.856 64.285  26.763  1.00 88.22  ? 765  VAL A CA    1 
ATOM   5945  C  C     . VAL A 1  765  ? 103.000 65.544  25.886  1.00 92.07  ? 765  VAL A C     1 
ATOM   5946  O  O     . VAL A 1  765  ? 103.731 65.516  24.904  1.00 91.46  ? 765  VAL A O     1 
ATOM   5947  C  CB    . VAL A 1  765  ? 101.516 63.540  26.572  1.00 90.21  ? 765  VAL A CB    1 
ATOM   5948  C  CG1   . VAL A 1  765  ? 101.080 63.522  25.119  1.00 88.69  ? 765  VAL A CG1   1 
ATOM   5949  C  CG2   . VAL A 1  765  ? 101.612 62.125  27.096  1.00 89.76  ? 765  VAL A CG2   1 
ATOM   5950  N  N     . GLY A 1  766  ? 102.332 66.626  26.250  1.00 89.45  ? 766  GLY A N     1 
ATOM   5951  C  CA    . GLY A 1  766  ? 102.453 67.877  25.519  1.00 89.98  ? 766  GLY A CA    1 
ATOM   5952  C  C     . GLY A 1  766  ? 101.247 68.368  24.752  1.00 96.01  ? 766  GLY A C     1 
ATOM   5953  O  O     . GLY A 1  766  ? 100.154 67.806  24.852  1.00 95.17  ? 766  GLY A O     1 
ATOM   5954  N  N     . GLN A 1  767  ? 101.449 69.477  24.007  1.00 94.42  ? 767  GLN A N     1 
ATOM   5955  C  CA    . GLN A 1  767  ? 100.417 70.106  23.189  1.00 93.92  ? 767  GLN A CA    1 
ATOM   5956  C  C     . GLN A 1  767  ? 100.212 69.267  21.944  1.00 97.87  ? 767  GLN A C     1 
ATOM   5957  O  O     . GLN A 1  767  ? 101.174 68.791  21.337  1.00 96.08  ? 767  GLN A O     1 
ATOM   5958  C  CB    . GLN A 1  767  ? 100.778 71.565  22.846  1.00 94.87  ? 767  GLN A CB    1 
ATOM   5959  C  CG    . GLN A 1  767  ? 99.762  72.312  21.964  1.00 97.53  ? 767  GLN A CG    1 
ATOM   5960  C  CD    . GLN A 1  767  ? 98.351  72.440  22.515  1.00 120.29 ? 767  GLN A CD    1 
ATOM   5961  O  OE1   . GLN A 1  767  ? 98.060  73.161  23.497  1.00 117.74 ? 767  GLN A OE1   1 
ATOM   5962  N  NE2   . GLN A 1  767  ? 97.424  71.816  21.814  1.00 112.10 ? 767  GLN A NE2   1 
ATOM   5963  N  N     . GLN A 1  768  ? 98.947  69.034  21.617  1.00 95.54  ? 768  GLN A N     1 
ATOM   5964  C  CA    . GLN A 1  768  ? 98.549  68.281  20.446  1.00 94.54  ? 768  GLN A CA    1 
ATOM   5965  C  C     . GLN A 1  768  ? 98.346  69.227  19.277  1.00 100.93 ? 768  GLN A C     1 
ATOM   5966  O  O     . GLN A 1  768  ? 98.025  70.408  19.474  1.00 102.14 ? 768  GLN A O     1 
ATOM   5967  C  CB    . GLN A 1  768  ? 97.265  67.501  20.754  1.00 95.28  ? 768  GLN A CB    1 
ATOM   5968  C  CG    . GLN A 1  768  ? 97.466  65.997  20.759  1.00 94.08  ? 768  GLN A CG    1 
ATOM   5969  C  CD    . GLN A 1  768  ? 98.613  65.545  21.623  1.00 103.13 ? 768  GLN A CD    1 
ATOM   5970  O  OE1   . GLN A 1  768  ? 99.424  64.711  21.222  1.00 97.74  ? 768  GLN A OE1   1 
ATOM   5971  N  NE2   . GLN A 1  768  ? 98.736  66.112  22.808  1.00 95.44  ? 768  GLN A NE2   1 
ATOM   5972  N  N     . SER A 1  769  ? 98.554  68.731  18.061  1.00 97.14  ? 769  SER A N     1 
ATOM   5973  C  CA    . SER A 1  769  ? 98.331  69.578  16.912  1.00 97.53  ? 769  SER A CA    1 
ATOM   5974  C  C     . SER A 1  769  ? 97.801  68.850  15.724  1.00 99.86  ? 769  SER A C     1 
ATOM   5975  O  O     . SER A 1  769  ? 98.221  67.731  15.412  1.00 98.77  ? 769  SER A O     1 
ATOM   5976  C  CB    . SER A 1  769  ? 99.585  70.351  16.527  1.00 103.48 ? 769  SER A CB    1 
ATOM   5977  O  OG    . SER A 1  769  ? 99.508  70.735  15.162  1.00 116.99 ? 769  SER A OG    1 
ATOM   5978  N  N     . VAL A 1  770  ? 96.899  69.543  15.032  1.00 95.64  ? 770  VAL A N     1 
ATOM   5979  C  CA    . VAL A 1  770  ? 96.301  69.135  13.781  1.00 94.13  ? 770  VAL A CA    1 
ATOM   5980  C  C     . VAL A 1  770  ? 96.488  70.314  12.840  1.00 100.20 ? 770  VAL A C     1 
ATOM   5981  O  O     . VAL A 1  770  ? 96.041  71.424  13.155  1.00 101.83 ? 770  VAL A O     1 
ATOM   5982  C  CB    . VAL A 1  770  ? 94.824  68.728  13.916  1.00 97.02  ? 770  VAL A CB    1 
ATOM   5983  C  CG1   . VAL A 1  770  ? 94.255  68.328  12.557  1.00 95.97  ? 770  VAL A CG1   1 
ATOM   5984  C  CG2   . VAL A 1  770  ? 94.662  67.591  14.916  1.00 96.60  ? 770  VAL A CG2   1 
ATOM   5985  N  N     . GLU A 1  771  ? 97.182  70.076  11.701  1.00 95.62  ? 771  GLU A N     1 
ATOM   5986  C  CA    . GLU A 1  771  ? 97.482  71.060  10.649  1.00 94.96  ? 771  GLU A CA    1 
ATOM   5987  C  C     . GLU A 1  771  ? 98.295  72.256  11.177  1.00 97.90  ? 771  GLU A C     1 
ATOM   5988  O  O     . GLU A 1  771  ? 98.158  73.372  10.682  1.00 97.72  ? 771  GLU A O     1 
ATOM   5989  C  CB    . GLU A 1  771  ? 96.208  71.484  9.865   1.00 96.79  ? 771  GLU A CB    1 
ATOM   5990  C  CG    . GLU A 1  771  ? 95.461  70.319  9.213   1.00 111.42 ? 771  GLU A CG    1 
ATOM   5991  C  CD    . GLU A 1  771  ? 94.295  70.655  8.296   1.00 141.35 ? 771  GLU A CD    1 
ATOM   5992  O  OE1   . GLU A 1  771  ? 93.406  71.437  8.707   1.00 137.47 ? 771  GLU A OE1   1 
ATOM   5993  O  OE2   . GLU A 1  771  ? 94.242  70.085  7.181   1.00 138.26 ? 771  GLU A OE2   1 
ATOM   5994  N  N     . GLY A 1  772  ? 99.145  71.995  12.167  1.00 94.22  ? 772  GLY A N     1 
ATOM   5995  C  CA    . GLY A 1  772  ? 99.996  73.006  12.787  1.00 94.91  ? 772  GLY A CA    1 
ATOM   5996  C  C     . GLY A 1  772  ? 99.327  73.713  13.948  1.00 100.31 ? 772  GLY A C     1 
ATOM   5997  O  O     . GLY A 1  772  ? 99.930  73.927  15.010  1.00 101.43 ? 772  GLY A O     1 
ATOM   5998  N  N     . LYS A 1  773  ? 98.069  74.071  13.757  1.00 96.02  ? 773  LYS A N     1 
ATOM   5999  C  CA    . LYS A 1  773  ? 97.313  74.754  14.783  1.00 96.48  ? 773  LYS A CA    1 
ATOM   6000  C  C     . LYS A 1  773  ? 96.837  73.771  15.852  1.00 98.09  ? 773  LYS A C     1 
ATOM   6001  O  O     . LYS A 1  773  ? 96.505  72.623  15.549  1.00 95.96  ? 773  LYS A O     1 
ATOM   6002  C  CB    . LYS A 1  773  ? 96.137  75.515  14.149  1.00 99.84  ? 773  LYS A CB    1 
ATOM   6003  C  CG    . LYS A 1  773  ? 96.576  76.626  13.191  1.00 115.00 ? 773  LYS A CG    1 
ATOM   6004  C  CD    . LYS A 1  773  ? 95.719  76.699  11.923  1.00 124.96 ? 773  LYS A CD    1 
ATOM   6005  C  CE    . LYS A 1  773  ? 96.227  75.861  10.765  1.00 133.97 ? 773  LYS A CE    1 
ATOM   6006  N  NZ    . LYS A 1  773  ? 97.525  76.353  10.211  1.00 141.40 ? 773  LYS A NZ    1 
ATOM   6007  N  N     . ARG A 1  774  ? 96.817  74.230  17.109  1.00 94.77  ? 774  ARG A N     1 
ATOM   6008  C  CA    . ARG A 1  774  ? 96.316  73.450  18.238  1.00 94.13  ? 774  ARG A CA    1 
ATOM   6009  C  C     . ARG A 1  774  ? 94.825  73.194  18.021  1.00 96.98  ? 774  ARG A C     1 
ATOM   6010  O  O     . ARG A 1  774  ? 94.180  73.944  17.288  1.00 96.08  ? 774  ARG A O     1 
ATOM   6011  C  CB    . ARG A 1  774  ? 96.609  74.136  19.590  1.00 95.17  ? 774  ARG A CB    1 
ATOM   6012  C  CG    . ARG A 1  774  ? 96.384  75.646  19.643  1.00 104.34 ? 774  ARG A CG    1 
ATOM   6013  C  CD    . ARG A 1  774  ? 97.243  76.303  20.711  1.00 112.11 ? 774  ARG A CD    1 
ATOM   6014  N  NE    . ARG A 1  774  ? 96.690  76.190  22.066  1.00 118.52 ? 774  ARG A NE    1 
ATOM   6015  C  CZ    . ARG A 1  774  ? 96.165  77.198  22.762  1.00 123.33 ? 774  ARG A CZ    1 
ATOM   6016  N  NH1   . ARG A 1  774  ? 96.095  78.414  22.236  1.00 97.57  ? 774  ARG A NH1   1 
ATOM   6017  N  NH2   . ARG A 1  774  ? 95.700  76.994  23.985  1.00 112.55 ? 774  ARG A NH2   1 
ATOM   6018  N  N     . ILE A 1  775  ? 94.305  72.098  18.591  1.00 93.82  ? 775  ILE A N     1 
ATOM   6019  C  CA    . ILE A 1  775  ? 92.926  71.619  18.436  1.00 93.68  ? 775  ILE A CA    1 
ATOM   6020  C  C     . ILE A 1  775  ? 91.912  72.738  18.244  1.00 99.51  ? 775  ILE A C     1 
ATOM   6021  O  O     . ILE A 1  775  ? 91.758  73.586  19.123  1.00 100.60 ? 775  ILE A O     1 
ATOM   6022  C  CB    . ILE A 1  775  ? 92.517  70.595  19.529  1.00 96.61  ? 775  ILE A CB    1 
ATOM   6023  C  CG1   . ILE A 1  775  ? 93.605  69.513  19.783  1.00 95.59  ? 775  ILE A CG1   1 
ATOM   6024  C  CG2   . ILE A 1  775  ? 91.155  69.979  19.220  1.00 97.96  ? 775  ILE A CG2   1 
ATOM   6025  C  CD1   . ILE A 1  775  ? 94.068  68.658  18.555  1.00 97.77  ? 775  ILE A CD1   1 
ATOM   6026  N  N     . ALA A 1  776  ? 91.266  72.759  17.068  1.00 96.03  ? 776  ALA A N     1 
ATOM   6027  C  CA    . ALA A 1  776  ? 90.298  73.781  16.657  1.00 96.91  ? 776  ALA A CA    1 
ATOM   6028  C  C     . ALA A 1  776  ? 88.918  73.640  17.260  1.00 102.72 ? 776  ALA A C     1 
ATOM   6029  O  O     . ALA A 1  776  ? 88.594  72.598  17.830  1.00 102.81 ? 776  ALA A O     1 
ATOM   6030  C  CB    . ALA A 1  776  ? 90.180  73.786  15.149  1.00 97.02  ? 776  ALA A CB    1 
ATOM   6031  N  N     . PHE A 1  777  ? 88.082  74.679  17.087  1.00 100.91 ? 777  PHE A N     1 
ATOM   6032  C  CA    . PHE A 1  777  ? 86.703  74.687  17.561  1.00 102.09 ? 777  PHE A CA    1 
ATOM   6033  C  C     . PHE A 1  777  ? 85.794  74.001  16.533  1.00 102.96 ? 777  PHE A C     1 
ATOM   6034  O  O     . PHE A 1  777  ? 85.266  74.669  15.642  1.00 102.52 ? 777  PHE A O     1 
ATOM   6035  C  CB    . PHE A 1  777  ? 86.227  76.130  17.862  1.00 106.21 ? 777  PHE A CB    1 
ATOM   6036  C  CG    . PHE A 1  777  ? 86.974  76.908  18.930  1.00 109.89 ? 777  PHE A CG    1 
ATOM   6037  C  CD1   . PHE A 1  777  ? 87.637  76.252  19.963  1.00 114.11 ? 777  PHE A CD1   1 
ATOM   6038  C  CD2   . PHE A 1  777  ? 86.964  78.297  18.936  1.00 114.09 ? 777  PHE A CD2   1 
ATOM   6039  C  CE1   . PHE A 1  777  ? 88.290  76.975  20.970  1.00 116.43 ? 777  PHE A CE1   1 
ATOM   6040  C  CE2   . PHE A 1  777  ? 87.619  79.019  19.943  1.00 118.06 ? 777  PHE A CE2   1 
ATOM   6041  C  CZ    . PHE A 1  777  ? 88.281  78.354  20.950  1.00 116.20 ? 777  PHE A CZ    1 
ATOM   6042  N  N     . GLY A 1  778  ? 85.645  72.677  16.649  1.00 97.79  ? 778  GLY A N     1 
ATOM   6043  C  CA    . GLY A 1  778  ? 84.797  71.871  15.764  1.00 96.89  ? 778  GLY A CA    1 
ATOM   6044  C  C     . GLY A 1  778  ? 83.338  72.189  15.994  1.00 101.46 ? 778  GLY A C     1 
ATOM   6045  O  O     . GLY A 1  778  ? 82.520  72.211  15.063  1.00 100.14 ? 778  GLY A O     1 
ATOM   6046  N  N     . PHE A 1  779  ? 83.038  72.475  17.269  1.00 99.47  ? 779  PHE A N     1 
ATOM   6047  C  CA    . PHE A 1  779  ? 81.760  72.944  17.760  1.00 100.63 ? 779  PHE A CA    1 
ATOM   6048  C  C     . PHE A 1  779  ? 81.842  74.469  17.683  1.00 107.29 ? 779  PHE A C     1 
ATOM   6049  O  O     . PHE A 1  779  ? 82.927  75.028  17.466  1.00 107.29 ? 779  PHE A O     1 
ATOM   6050  C  CB    . PHE A 1  779  ? 81.526  72.478  19.217  1.00 102.89 ? 779  PHE A CB    1 
ATOM   6051  C  CG    . PHE A 1  779  ? 81.282  70.991  19.393  1.00 103.45 ? 779  PHE A CG    1 
ATOM   6052  C  CD1   . PHE A 1  779  ? 80.027  70.439  19.148  1.00 105.83 ? 779  PHE A CD1   1 
ATOM   6053  C  CD2   . PHE A 1  779  ? 82.303  70.147  19.820  1.00 104.61 ? 779  PHE A CD2   1 
ATOM   6054  C  CE1   . PHE A 1  779  ? 79.808  69.066  19.293  1.00 105.64 ? 779  PHE A CE1   1 
ATOM   6055  C  CE2   . PHE A 1  779  ? 82.083  68.775  19.961  1.00 106.35 ? 779  PHE A CE2   1 
ATOM   6056  C  CZ    . PHE A 1  779  ? 80.835  68.245  19.697  1.00 104.16 ? 779  PHE A CZ    1 
ATOM   6057  N  N     . VAL A 1  780  ? 80.714  75.148  17.858  1.00 105.42 ? 780  VAL A N     1 
ATOM   6058  C  CA    . VAL A 1  780  ? 80.685  76.602  17.802  1.00 106.12 ? 780  VAL A CA    1 
ATOM   6059  C  C     . VAL A 1  780  ? 81.473  77.192  18.979  1.00 110.75 ? 780  VAL A C     1 
ATOM   6060  O  O     . VAL A 1  780  ? 81.063  77.019  20.127  1.00 111.66 ? 780  VAL A O     1 
ATOM   6061  C  CB    . VAL A 1  780  ? 79.233  77.130  17.727  1.00 111.03 ? 780  VAL A CB    1 
ATOM   6062  C  CG1   . VAL A 1  780  ? 79.203  78.657  17.741  1.00 112.25 ? 780  VAL A CG1   1 
ATOM   6063  C  CG2   . VAL A 1  780  ? 78.519  76.591  16.490  1.00 110.06 ? 780  VAL A CG2   1 
ATOM   6064  N  N     . ASP A 1  781  ? 82.630  77.827  18.687  1.00 106.39 ? 781  ASP A N     1 
ATOM   6065  C  CA    . ASP A 1  781  ? 83.494  78.516  19.658  1.00 106.99 ? 781  ASP A CA    1 
ATOM   6066  C  C     . ASP A 1  781  ? 84.057  77.669  20.830  1.00 107.56 ? 781  ASP A C     1 
ATOM   6067  O  O     . ASP A 1  781  ? 84.496  78.212  21.856  1.00 107.55 ? 781  ASP A O     1 
ATOM   6068  C  CB    . ASP A 1  781  ? 82.821  79.820  20.157  1.00 111.87 ? 781  ASP A CB    1 
ATOM   6069  C  CG    . ASP A 1  781  ? 82.625  80.925  19.117  1.00 131.87 ? 781  ASP A CG    1 
ATOM   6070  O  OD1   . ASP A 1  781  ? 83.547  81.132  18.283  1.00 132.91 ? 781  ASP A OD1   1 
ATOM   6071  O  OD2   . ASP A 1  781  ? 81.590  81.655  19.202  1.00 141.15 ? 781  ASP A OD2   1 
ATOM   6072  N  N     . ARG A 1  782  ? 84.068  76.347  20.663  1.00 101.39 ? 782  ARG A N     1 
ATOM   6073  C  CA    . ARG A 1  782  ? 84.595  75.418  21.667  1.00 100.22 ? 782  ARG A CA    1 
ATOM   6074  C  C     . ARG A 1  782  ? 85.103  74.105  21.018  1.00 102.27 ? 782  ARG A C     1 
ATOM   6075  O  O     . ARG A 1  782  ? 84.620  73.714  19.947  1.00 100.71 ? 782  ARG A O     1 
ATOM   6076  C  CB    . ARG A 1  782  ? 83.589  75.183  22.820  1.00 98.63  ? 782  ARG A CB    1 
ATOM   6077  C  CG    . ARG A 1  782  ? 82.338  74.397  22.435  1.00 99.33  ? 782  ARG A CG    1 
ATOM   6078  C  CD    . ARG A 1  782  ? 81.072  75.156  22.723  1.00 96.14  ? 782  ARG A CD    1 
ATOM   6079  N  NE    . ARG A 1  782  ? 79.879  74.307  22.691  1.00 94.67  ? 782  ARG A NE    1 
ATOM   6080  C  CZ    . ARG A 1  782  ? 79.330  73.750  23.773  1.00 104.17 ? 782  ARG A CZ    1 
ATOM   6081  N  NH1   . ARG A 1  782  ? 79.883  73.920  24.973  1.00 83.54  ? 782  ARG A NH1   1 
ATOM   6082  N  NH2   . ARG A 1  782  ? 78.228  73.019  23.663  1.00 87.79  ? 782  ARG A NH2   1 
ATOM   6083  N  N     . THR A 1  783  ? 86.097  73.454  21.654  1.00 98.08  ? 783  THR A N     1 
ATOM   6084  C  CA    . THR A 1  783  ? 86.694  72.196  21.174  1.00 96.29  ? 783  THR A CA    1 
ATOM   6085  C  C     . THR A 1  783  ? 85.829  70.964  21.517  1.00 99.09  ? 783  THR A C     1 
ATOM   6086  O  O     . THR A 1  783  ? 85.736  70.015  20.734  1.00 96.83  ? 783  THR A O     1 
ATOM   6087  C  CB    . THR A 1  783  ? 88.119  72.051  21.699  1.00 101.44 ? 783  THR A CB    1 
ATOM   6088  O  OG1   . THR A 1  783  ? 88.110  72.244  23.114  1.00 102.40 ? 783  THR A OG1   1 
ATOM   6089  C  CG2   . THR A 1  783  ? 89.073  73.034  21.053  1.00 97.76  ? 783  THR A CG2   1 
ATOM   6090  N  N     . LEU A 1  784  ? 85.205  70.986  22.695  1.00 96.31  ? 784  LEU A N     1 
ATOM   6091  C  CA    . LEU A 1  784  ? 84.341  69.903  23.154  1.00 95.81  ? 784  LEU A CA    1 
ATOM   6092  C  C     . LEU A 1  784  ? 83.096  70.482  23.841  1.00 98.87  ? 784  LEU A C     1 
ATOM   6093  O  O     . LEU A 1  784  ? 83.143  71.646  24.243  1.00 99.09  ? 784  LEU A O     1 
ATOM   6094  C  CB    . LEU A 1  784  ? 85.115  68.971  24.108  1.00 95.60  ? 784  LEU A CB    1 
ATOM   6095  C  CG    . LEU A 1  784  ? 86.131  68.024  23.487  1.00 98.18  ? 784  LEU A CG    1 
ATOM   6096  C  CD1   . LEU A 1  784  ? 86.887  67.295  24.568  1.00 98.29  ? 784  LEU A CD1   1 
ATOM   6097  C  CD2   . LEU A 1  784  ? 85.459  67.032  22.557  1.00 98.65  ? 784  LEU A CD2   1 
ATOM   6098  N  N     . PRO A 1  785  ? 81.983  69.720  24.008  1.00 94.15  ? 785  PRO A N     1 
ATOM   6099  C  CA    . PRO A 1  785  ? 80.798  70.298  24.670  1.00 95.65  ? 785  PRO A CA    1 
ATOM   6100  C  C     . PRO A 1  785  ? 80.867  70.385  26.201  1.00 102.04 ? 785  PRO A C     1 
ATOM   6101  O  O     . PRO A 1  785  ? 79.943  70.893  26.839  1.00 101.59 ? 785  PRO A O     1 
ATOM   6102  C  CB    . PRO A 1  785  ? 79.646  69.423  24.168  1.00 96.96  ? 785  PRO A CB    1 
ATOM   6103  C  CG    . PRO A 1  785  ? 80.267  68.208  23.574  1.00 99.15  ? 785  PRO A CG    1 
ATOM   6104  C  CD    . PRO A 1  785  ? 81.747  68.315  23.625  1.00 93.95  ? 785  PRO A CD    1 
ATOM   6105  N  N     . HIS A 1  786  ? 81.987  69.912  26.776  1.00 100.92 ? 786  HIS A N     1 
ATOM   6106  C  CA    . HIS A 1  786  ? 82.292  69.911  28.204  1.00 102.76 ? 786  HIS A CA    1 
ATOM   6107  C  C     . HIS A 1  786  ? 83.024  71.172  28.558  1.00 109.10 ? 786  HIS A C     1 
ATOM   6108  O  O     . HIS A 1  786  ? 83.443  71.329  29.703  1.00 109.56 ? 786  HIS A O     1 
ATOM   6109  C  CB    . HIS A 1  786  ? 83.159  68.700  28.558  1.00 103.06 ? 786  HIS A CB    1 
ATOM   6110  C  CG    . HIS A 1  786  ? 82.691  67.458  27.887  1.00 105.93 ? 786  HIS A CG    1 
ATOM   6111  N  ND1   . HIS A 1  786  ? 83.207  67.067  26.666  1.00 106.53 ? 786  HIS A ND1   1 
ATOM   6112  C  CD2   . HIS A 1  786  ? 81.701  66.608  28.241  1.00 108.29 ? 786  HIS A CD2   1 
ATOM   6113  C  CE1   . HIS A 1  786  ? 82.541  65.976  26.334  1.00 105.69 ? 786  HIS A CE1   1 
ATOM   6114  N  NE2   . HIS A 1  786  ? 81.622  65.661  27.251  1.00 107.05 ? 786  HIS A NE2   1 
ATOM   6115  N  N     . PHE A 1  787  ? 83.172  72.076  27.573  1.00 107.22 ? 787  PHE A N     1 
ATOM   6116  C  CA    . PHE A 1  787  ? 83.848  73.362  27.701  1.00 108.62 ? 787  PHE A CA    1 
ATOM   6117  C  C     . PHE A 1  787  ? 82.928  74.562  27.448  1.00 113.49 ? 787  PHE A C     1 
ATOM   6118  O  O     . PHE A 1  787  ? 81.969  74.483  26.661  1.00 111.44 ? 787  PHE A O     1 
ATOM   6119  C  CB    . PHE A 1  787  ? 85.021  73.439  26.711  1.00 109.70 ? 787  PHE A CB    1 
ATOM   6120  C  CG    . PHE A 1  787  ? 86.248  72.633  27.050  1.00 110.57 ? 787  PHE A CG    1 
ATOM   6121  C  CD1   . PHE A 1  787  ? 87.149  73.079  28.009  1.00 114.26 ? 787  PHE A CD1   1 
ATOM   6122  C  CD2   . PHE A 1  787  ? 86.549  71.475  26.352  1.00 111.78 ? 787  PHE A CD2   1 
ATOM   6123  C  CE1   . PHE A 1  787  ? 88.300  72.348  28.303  1.00 114.28 ? 787  PHE A CE1   1 
ATOM   6124  C  CE2   . PHE A 1  787  ? 87.706  70.750  26.641  1.00 113.99 ? 787  PHE A CE2   1 
ATOM   6125  C  CZ    . PHE A 1  787  ? 88.572  71.191  27.617  1.00 112.31 ? 787  PHE A CZ    1 
ATOM   6126  N  N     . SER A 1  788  ? 83.274  75.694  28.089  1.00 112.60 ? 788  SER A N     1 
ATOM   6127  C  CA    . SER A 1  788  ? 82.580  76.962  27.898  1.00 114.19 ? 788  SER A CA    1 
ATOM   6128  C  C     . SER A 1  788  ? 83.075  77.569  26.574  1.00 120.61 ? 788  SER A C     1 
ATOM   6129  O  O     . SER A 1  788  ? 84.168  77.217  26.096  1.00 120.21 ? 788  SER A O     1 
ATOM   6130  C  CB    . SER A 1  788  ? 82.852  77.907  29.064  1.00 117.54 ? 788  SER A CB    1 
ATOM   6131  O  OG    . SER A 1  788  ? 81.706  78.006  29.892  1.00 124.28 ? 788  SER A OG    1 
ATOM   6132  N  N     . LYS A 1  789  ? 82.258  78.448  25.960  1.00 117.93 ? 789  LYS A N     1 
ATOM   6133  C  CA    . LYS A 1  789  ? 82.602  79.098  24.692  1.00 116.69 ? 789  LYS A CA    1 
ATOM   6134  C  C     . LYS A 1  789  ? 83.773  80.076  24.868  1.00 121.32 ? 789  LYS A C     1 
ATOM   6135  O  O     . LYS A 1  789  ? 84.051  80.526  25.992  1.00 121.87 ? 789  LYS A O     1 
ATOM   6136  C  CB    . LYS A 1  789  ? 81.372  79.804  24.088  1.00 118.79 ? 789  LYS A CB    1 
ATOM   6137  C  CG    . LYS A 1  789  ? 80.500  78.897  23.228  1.00 117.85 ? 789  LYS A CG    1 
ATOM   6138  C  CD    . LYS A 1  789  ? 79.155  79.540  22.870  1.00 123.17 ? 789  LYS A CD    1 
ATOM   6139  C  CE    . LYS A 1  789  ? 78.396  78.726  21.843  1.00 127.80 ? 789  LYS A CE    1 
ATOM   6140  N  NZ    . LYS A 1  789  ? 76.947  79.063  21.799  1.00 135.09 ? 789  LYS A NZ    1 
ATOM   6141  N  N     . ASP A 1  790  ? 84.474  80.369  23.750  1.00 117.20 ? 790  ASP A N     1 
ATOM   6142  C  CA    . ASP A 1  790  ? 85.597  81.315  23.663  1.00 117.10 ? 790  ASP A CA    1 
ATOM   6143  C  C     . ASP A 1  790  ? 86.694  81.036  24.733  1.00 120.79 ? 790  ASP A C     1 
ATOM   6144  O  O     . ASP A 1  790  ? 87.146  81.936  25.453  1.00 120.08 ? 790  ASP A O     1 
ATOM   6145  C  CB    . ASP A 1  790  ? 85.066  82.777  23.634  1.00 120.19 ? 790  ASP A CB    1 
ATOM   6146  C  CG    . ASP A 1  790  ? 84.085  83.086  22.490  1.00 128.48 ? 790  ASP A CG    1 
ATOM   6147  O  OD1   . ASP A 1  790  ? 84.539  83.153  21.317  1.00 128.63 ? 790  ASP A OD1   1 
ATOM   6148  O  OD2   . ASP A 1  790  ? 82.861  83.304  22.778  1.00 130.67 ? 790  ASP A OD2   1 
ATOM   6149  N  N     . ASP A 1  791  ? 87.063  79.733  24.840  1.00 117.86 ? 791  ASP A N     1 
ATOM   6150  C  CA    . ASP A 1  791  ? 88.067  79.164  25.747  1.00 118.02 ? 791  ASP A CA    1 
ATOM   6151  C  C     . ASP A 1  791  ? 89.318  78.834  24.930  1.00 120.81 ? 791  ASP A C     1 
ATOM   6152  O  O     . ASP A 1  791  ? 89.311  77.905  24.118  1.00 118.83 ? 791  ASP A O     1 
ATOM   6153  C  CB    . ASP A 1  791  ? 87.510  77.900  26.463  1.00 120.06 ? 791  ASP A CB    1 
ATOM   6154  C  CG    . ASP A 1  791  ? 88.318  77.362  27.652  1.00 128.89 ? 791  ASP A CG    1 
ATOM   6155  O  OD1   . ASP A 1  791  ? 89.557  77.490  27.634  1.00 127.46 ? 791  ASP A OD1   1 
ATOM   6156  O  OD2   . ASP A 1  791  ? 87.704  76.744  28.568  1.00 134.45 ? 791  ASP A OD2   1 
ATOM   6157  N  N     . TYR A 1  792  ? 90.380  79.626  25.140  1.00 118.62 ? 792  TYR A N     1 
ATOM   6158  C  CA    . TYR A 1  792  ? 91.664  79.539  24.439  1.00 118.07 ? 792  TYR A CA    1 
ATOM   6159  C  C     . TYR A 1  792  ? 92.780  78.944  25.325  1.00 119.78 ? 792  TYR A C     1 
ATOM   6160  O  O     . TYR A 1  792  ? 93.954  78.954  24.941  1.00 118.21 ? 792  TYR A O     1 
ATOM   6161  C  CB    . TYR A 1  792  ? 92.035  80.939  23.873  1.00 121.27 ? 792  TYR A CB    1 
ATOM   6162  C  CG    . TYR A 1  792  ? 91.237  81.333  22.639  1.00 125.26 ? 792  TYR A CG    1 
ATOM   6163  C  CD1   . TYR A 1  792  ? 89.917  81.776  22.744  1.00 128.55 ? 792  TYR A CD1   1 
ATOM   6164  C  CD2   . TYR A 1  792  ? 91.797  81.247  21.363  1.00 125.67 ? 792  TYR A CD2   1 
ATOM   6165  C  CE1   . TYR A 1  792  ? 89.164  82.095  21.608  1.00 129.91 ? 792  TYR A CE1   1 
ATOM   6166  C  CE2   . TYR A 1  792  ? 91.059  81.578  20.222  1.00 126.86 ? 792  TYR A CE2   1 
ATOM   6167  C  CZ    . TYR A 1  792  ? 89.743  82.004  20.349  1.00 136.41 ? 792  TYR A CZ    1 
ATOM   6168  O  OH    . TYR A 1  792  ? 89.014  82.338  19.226  1.00 136.86 ? 792  TYR A OH    1 
ATOM   6169  N  N     . SER A 1  793  ? 92.387  78.380  26.492  1.00 115.96 ? 793  SER A N     1 
ATOM   6170  C  CA    . SER A 1  793  ? 93.255  77.776  27.518  1.00 114.94 ? 793  SER A CA    1 
ATOM   6171  C  C     . SER A 1  793  ? 94.019  76.575  27.007  1.00 116.32 ? 793  SER A C     1 
ATOM   6172  O  O     . SER A 1  793  ? 93.523  75.929  26.080  1.00 116.11 ? 793  SER A O     1 
ATOM   6173  C  CB    . SER A 1  793  ? 92.432  77.358  28.736  1.00 118.53 ? 793  SER A CB    1 
ATOM   6174  O  OG    . SER A 1  793  ? 91.553  76.277  28.464  1.00 123.75 ? 793  SER A OG    1 
ATOM   6175  N  N     . PRO A 1  794  ? 95.177  76.204  27.623  1.00 111.07 ? 794  PRO A N     1 
ATOM   6176  C  CA    . PRO A 1  794  ? 95.911  75.002  27.158  1.00 109.28 ? 794  PRO A CA    1 
ATOM   6177  C  C     . PRO A 1  794  ? 95.046  73.727  27.112  1.00 108.96 ? 794  PRO A C     1 
ATOM   6178  O  O     . PRO A 1  794  ? 95.037  73.023  26.095  1.00 106.74 ? 794  PRO A O     1 
ATOM   6179  C  CB    . PRO A 1  794  ? 97.071  74.886  28.167  1.00 111.48 ? 794  PRO A CB    1 
ATOM   6180  C  CG    . PRO A 1  794  ? 96.663  75.716  29.341  1.00 117.01 ? 794  PRO A CG    1 
ATOM   6181  C  CD    . PRO A 1  794  ? 95.888  76.847  28.745  1.00 113.06 ? 794  PRO A CD    1 
ATOM   6182  N  N     . GLU A 1  795  ? 94.264  73.505  28.198  1.00 103.61 ? 795  GLU A N     1 
ATOM   6183  C  CA    . GLU A 1  795  ? 93.337  72.407  28.429  1.00 102.26 ? 795  GLU A CA    1 
ATOM   6184  C  C     . GLU A 1  795  ? 92.291  72.363  27.362  1.00 106.31 ? 795  GLU A C     1 
ATOM   6185  O  O     . GLU A 1  795  ? 91.903  71.271  26.972  1.00 106.48 ? 795  GLU A O     1 
ATOM   6186  C  CB    . GLU A 1  795  ? 92.631  72.532  29.790  1.00 104.94 ? 795  GLU A CB    1 
ATOM   6187  C  CG    . GLU A 1  795  ? 93.464  73.159  30.898  1.00 119.84 ? 795  GLU A CG    1 
ATOM   6188  C  CD    . GLU A 1  795  ? 93.204  74.630  31.172  1.00 147.47 ? 795  GLU A CD    1 
ATOM   6189  O  OE1   . GLU A 1  795  ? 92.021  75.044  31.144  1.00 155.24 ? 795  GLU A OE1   1 
ATOM   6190  O  OE2   . GLU A 1  795  ? 94.179  75.356  31.477  1.00 133.71 ? 795  GLU A OE2   1 
ATOM   6191  N  N     . SER A 1  796  ? 91.807  73.521  26.889  1.00 103.47 ? 796  SER A N     1 
ATOM   6192  C  CA    . SER A 1  796  ? 90.783  73.523  25.844  1.00 103.37 ? 796  SER A CA    1 
ATOM   6193  C  C     . SER A 1  796  ? 91.362  73.226  24.482  1.00 106.55 ? 796  SER A C     1 
ATOM   6194  O  O     . SER A 1  796  ? 90.776  72.443  23.735  1.00 105.21 ? 796  SER A O     1 
ATOM   6195  C  CB    . SER A 1  796  ? 90.014  74.836  25.804  1.00 108.31 ? 796  SER A CB    1 
ATOM   6196  O  OG    . SER A 1  796  ? 88.890  74.731  24.942  1.00 117.64 ? 796  SER A OG    1 
ATOM   6197  N  N     . LYS A 1  797  ? 92.521  73.818  24.165  1.00 103.35 ? 797  LYS A N     1 
ATOM   6198  C  CA    . LYS A 1  797  ? 93.124  73.622  22.854  1.00 102.02 ? 797  LYS A CA    1 
ATOM   6199  C  C     . LYS A 1  797  ? 94.042  72.397  22.662  1.00 103.88 ? 797  LYS A C     1 
ATOM   6200  O  O     . LYS A 1  797  ? 94.662  72.251  21.606  1.00 102.44 ? 797  LYS A O     1 
ATOM   6201  C  CB    . LYS A 1  797  ? 93.643  74.935  22.250  1.00 104.77 ? 797  LYS A CB    1 
ATOM   6202  C  CG    . LYS A 1  797  ? 92.531  75.954  21.976  1.00 111.31 ? 797  LYS A CG    1 
ATOM   6203  C  CD    . LYS A 1  797  ? 92.973  77.043  21.020  1.00 117.11 ? 797  LYS A CD    1 
ATOM   6204  C  CE    . LYS A 1  797  ? 91.926  77.335  19.971  1.00 123.64 ? 797  LYS A CE    1 
ATOM   6205  N  NZ    . LYS A 1  797  ? 92.036  76.427  18.796  1.00 128.18 ? 797  LYS A NZ    1 
ATOM   6206  N  N     . GLY A 1  798  ? 94.043  71.491  23.638  1.00 100.02 ? 798  GLY A N     1 
ATOM   6207  C  CA    . GLY A 1  798  ? 94.740  70.214  23.537  1.00 98.66  ? 798  GLY A CA    1 
ATOM   6208  C  C     . GLY A 1  798  ? 96.103  70.028  24.167  1.00 101.71 ? 798  GLY A C     1 
ATOM   6209  O  O     . GLY A 1  798  ? 96.906  69.233  23.658  1.00 100.48 ? 798  GLY A O     1 
ATOM   6210  N  N     . PHE A 1  799  ? 96.387  70.725  25.273  1.00 97.96  ? 799  PHE A N     1 
ATOM   6211  C  CA    . PHE A 1  799  ? 97.677  70.518  25.925  1.00 96.37  ? 799  PHE A CA    1 
ATOM   6212  C  C     . PHE A 1  799  ? 97.507  69.366  26.898  1.00 100.78 ? 799  PHE A C     1 
ATOM   6213  O  O     . PHE A 1  799  ? 96.667  69.443  27.817  1.00 101.94 ? 799  PHE A O     1 
ATOM   6214  C  CB    . PHE A 1  799  ? 98.211  71.785  26.616  1.00 98.03  ? 799  PHE A CB    1 
ATOM   6215  C  CG    . PHE A 1  799  ? 99.498  71.559  27.377  1.00 98.50  ? 799  PHE A CG    1 
ATOM   6216  C  CD1   . PHE A 1  799  ? 100.692 71.314  26.705  1.00 99.85  ? 799  PHE A CD1   1 
ATOM   6217  C  CD2   . PHE A 1  799  ? 99.518  71.589  28.766  1.00 100.97 ? 799  PHE A CD2   1 
ATOM   6218  C  CE1   . PHE A 1  799  ? 101.886 71.104  27.410  1.00 100.41 ? 799  PHE A CE1   1 
ATOM   6219  C  CE2   . PHE A 1  799  ? 100.713 71.384  29.471  1.00 103.53 ? 799  PHE A CE2   1 
ATOM   6220  C  CZ    . PHE A 1  799  ? 101.888 71.142  28.788  1.00 100.41 ? 799  PHE A CZ    1 
ATOM   6221  N  N     . VAL A 1  800  ? 98.252  68.263  26.642  1.00 94.42  ? 800  VAL A N     1 
ATOM   6222  C  CA    . VAL A 1  800  ? 98.209  67.060  27.479  1.00 92.78  ? 800  VAL A CA    1 
ATOM   6223  C  C     . VAL A 1  800  ? 99.218  67.229  28.620  1.00 97.66  ? 800  VAL A C     1 
ATOM   6224  O  O     . VAL A 1  800  ? 100.407 66.962  28.451  1.00 96.72  ? 800  VAL A O     1 
ATOM   6225  C  CB    . VAL A 1  800  ? 98.356  65.737  26.674  1.00 93.27  ? 800  VAL A CB    1 
ATOM   6226  C  CG1   . VAL A 1  800  ? 98.299  64.528  27.595  1.00 92.95  ? 800  VAL A CG1   1 
ATOM   6227  C  CG2   . VAL A 1  800  ? 97.281  65.631  25.604  1.00 91.89  ? 800  VAL A CG2   1 
ATOM   6228  N  N     . GLU A 1  801  ? 98.737  67.738  29.761  1.00 96.15  ? 801  GLU A N     1 
ATOM   6229  C  CA    . GLU A 1  801  ? 99.561  67.997  30.937  1.00 97.84  ? 801  GLU A CA    1 
ATOM   6230  C  C     . GLU A 1  801  ? 100.144 66.706  31.525  1.00 102.67 ? 801  GLU A C     1 
ATOM   6231  O  O     . GLU A 1  801  ? 101.291 66.685  32.001  1.00 103.08 ? 801  GLU A O     1 
ATOM   6232  C  CB    . GLU A 1  801  ? 98.747  68.763  31.985  1.00 100.86 ? 801  GLU A CB    1 
ATOM   6233  C  CG    . GLU A 1  801  ? 99.516  69.048  33.260  1.00 114.95 ? 801  GLU A CG    1 
ATOM   6234  C  CD    . GLU A 1  801  ? 98.797  69.926  34.256  1.00 153.76 ? 801  GLU A CD    1 
ATOM   6235  O  OE1   . GLU A 1  801  ? 97.581  70.168  34.075  1.00 147.48 ? 801  GLU A OE1   1 
ATOM   6236  O  OE2   . GLU A 1  801  ? 99.456  70.377  35.222  1.00 171.98 ? 801  GLU A OE2   1 
ATOM   6237  N  N     . ASN A 1  802  ? 99.349  65.636  31.476  1.00 98.31  ? 802  ASN A N     1 
ATOM   6238  C  CA    . ASN A 1  802  ? 99.732  64.342  32.004  1.00 97.47  ? 802  ASN A CA    1 
ATOM   6239  C  C     . ASN A 1  802  ? 100.701 63.551  31.129  1.00 98.21  ? 802  ASN A C     1 
ATOM   6240  O  O     . ASN A 1  802  ? 100.735 63.730  29.910  1.00 96.53  ? 802  ASN A O     1 
ATOM   6241  C  CB    . ASN A 1  802  ? 98.490  63.524  32.306  1.00 98.96  ? 802  ASN A CB    1 
ATOM   6242  C  CG    . ASN A 1  802  ? 97.823  63.922  33.591  1.00 123.76 ? 802  ASN A CG    1 
ATOM   6243  O  OD1   . ASN A 1  802  ? 98.449  63.966  34.665  1.00 115.45 ? 802  ASN A OD1   1 
ATOM   6244  N  ND2   . ASN A 1  802  ? 96.533  64.209  33.503  1.00 119.34 ? 802  ASN A ND2   1 
ATOM   6245  N  N     . SER A 1  803  ? 101.502 62.686  31.792  1.00 93.43  ? 803  SER A N     1 
ATOM   6246  C  CA    . SER A 1  803  ? 102.440 61.725  31.213  1.00 91.23  ? 803  SER A CA    1 
ATOM   6247  C  C     . SER A 1  803  ? 101.652 60.433  30.894  1.00 94.11  ? 803  SER A C     1 
ATOM   6248  O  O     . SER A 1  803  ? 100.502 60.283  31.351  1.00 94.23  ? 803  SER A O     1 
ATOM   6249  C  CB    . SER A 1  803  ? 103.571 61.418  32.197  1.00 93.39  ? 803  SER A CB    1 
ATOM   6250  O  OG    . SER A 1  803  ? 103.129 61.192  33.527  1.00 98.27  ? 803  SER A OG    1 
ATOM   6251  N  N     . TYR A 1  804  ? 102.253 59.512  30.090  1.00 88.26  ? 804  TYR A N     1 
ATOM   6252  C  CA    . TYR A 1  804  ? 101.613 58.231  29.765  1.00 86.11  ? 804  TYR A CA    1 
ATOM   6253  C  C     . TYR A 1  804  ? 101.552 57.364  31.035  1.00 90.79  ? 804  TYR A C     1 
ATOM   6254  O  O     . TYR A 1  804  ? 100.549 56.678  31.269  1.00 89.96  ? 804  TYR A O     1 
ATOM   6255  C  CB    . TYR A 1  804  ? 102.352 57.509  28.636  1.00 84.40  ? 804  TYR A CB    1 
ATOM   6256  C  CG    . TYR A 1  804  ? 102.129 58.105  27.262  1.00 84.14  ? 804  TYR A CG    1 
ATOM   6257  C  CD1   . TYR A 1  804  ? 100.849 58.188  26.711  1.00 85.23  ? 804  TYR A CD1   1 
ATOM   6258  C  CD2   . TYR A 1  804  ? 103.201 58.491  26.469  1.00 84.32  ? 804  TYR A CD2   1 
ATOM   6259  C  CE1   . TYR A 1  804  ? 100.643 58.707  25.430  1.00 83.34  ? 804  TYR A CE1   1 
ATOM   6260  C  CE2   . TYR A 1  804  ? 103.010 58.985  25.178  1.00 84.25  ? 804  TYR A CE2   1 
ATOM   6261  C  CZ    . TYR A 1  804  ? 101.731 59.095  24.663  1.00 88.81  ? 804  TYR A CZ    1 
ATOM   6262  O  OH    . TYR A 1  804  ? 101.576 59.606  23.393  1.00 87.39  ? 804  TYR A OH    1 
ATOM   6263  N  N     . LEU A 1  805  ? 102.607 57.479  31.889  1.00 87.61  ? 805  LEU A N     1 
ATOM   6264  C  CA    . LEU A 1  805  ? 102.751 56.791  33.172  1.00 87.57  ? 805  LEU A CA    1 
ATOM   6265  C  C     . LEU A 1  805  ? 101.648 57.185  34.102  1.00 91.47  ? 805  LEU A C     1 
ATOM   6266  O  O     . LEU A 1  805  ? 101.243 56.361  34.912  1.00 90.62  ? 805  LEU A O     1 
ATOM   6267  C  CB    . LEU A 1  805  ? 104.128 57.092  33.801  1.00 88.10  ? 805  LEU A CB    1 
ATOM   6268  C  CG    . LEU A 1  805  ? 104.368 56.785  35.301  1.00 93.91  ? 805  LEU A CG    1 
ATOM   6269  C  CD1   . LEU A 1  805  ? 104.441 55.306  35.573  1.00 93.15  ? 805  LEU A CD1   1 
ATOM   6270  C  CD2   . LEU A 1  805  ? 105.640 57.482  35.808  1.00 99.05  ? 805  LEU A CD2   1 
ATOM   6271  N  N     . ARG A 1  806  ? 101.165 58.438  33.999  1.00 90.21  ? 806  ARG A N     1 
ATOM   6272  C  CA    . ARG A 1  806  ? 100.086 58.931  34.855  1.00 92.37  ? 806  ARG A CA    1 
ATOM   6273  C  C     . ARG A 1  806  ? 98.741  58.640  34.269  1.00 97.06  ? 806  ARG A C     1 
ATOM   6274  O  O     . ARG A 1  806  ? 97.808  58.325  35.008  1.00 98.13  ? 806  ARG A O     1 
ATOM   6275  C  CB    . ARG A 1  806  ? 100.233 60.420  35.192  1.00 94.68  ? 806  ARG A CB    1 
ATOM   6276  C  CG    . ARG A 1  806  ? 100.729 60.649  36.612  1.00 108.58 ? 806  ARG A CG    1 
ATOM   6277  C  CD    . ARG A 1  806  ? 101.841 61.673  36.634  1.00 125.25 ? 806  ARG A CD    1 
ATOM   6278  N  NE    . ARG A 1  806  ? 101.352 62.984  37.063  1.00 141.80 ? 806  ARG A NE    1 
ATOM   6279  C  CZ    . ARG A 1  806  ? 101.624 63.540  38.242  1.00 155.87 ? 806  ARG A CZ    1 
ATOM   6280  N  NH1   . ARG A 1  806  ? 102.403 62.913  39.118  1.00 139.50 ? 806  ARG A NH1   1 
ATOM   6281  N  NH2   . ARG A 1  806  ? 101.133 64.734  38.547  1.00 142.22 ? 806  ARG A NH2   1 
ATOM   6282  N  N     . GLY A 1  807  ? 98.656  58.712  32.950  1.00 92.81  ? 807  GLY A N     1 
ATOM   6283  C  CA    . GLY A 1  807  ? 97.407  58.457  32.250  1.00 92.71  ? 807  GLY A CA    1 
ATOM   6284  C  C     . GLY A 1  807  ? 96.735  59.731  31.801  1.00 97.04  ? 807  GLY A C     1 
ATOM   6285  O  O     . GLY A 1  807  ? 96.909  60.788  32.418  1.00 98.28  ? 807  GLY A O     1 
ATOM   6286  N  N     . LEU A 1  808  ? 95.964  59.626  30.711  1.00 91.04  ? 808  LEU A N     1 
ATOM   6287  C  CA    . LEU A 1  808  ? 95.272  60.747  30.092  1.00 89.92  ? 808  LEU A CA    1 
ATOM   6288  C  C     . LEU A 1  808  ? 93.849  60.921  30.590  1.00 96.07  ? 808  LEU A C     1 
ATOM   6289  O  O     . LEU A 1  808  ? 93.210  59.958  31.029  1.00 97.27  ? 808  LEU A O     1 
ATOM   6290  C  CB    . LEU A 1  808  ? 95.306  60.601  28.564  1.00 87.77  ? 808  LEU A CB    1 
ATOM   6291  C  CG    . LEU A 1  808  ? 96.461  61.305  27.862  1.00 90.89  ? 808  LEU A CG    1 
ATOM   6292  C  CD1   . LEU A 1  808  ? 97.817  60.594  28.091  1.00 90.40  ? 808  LEU A CD1   1 
ATOM   6293  C  CD2   . LEU A 1  808  ? 96.182  61.459  26.397  1.00 90.66  ? 808  LEU A CD2   1 
ATOM   6294  N  N     . THR A 1  809  ? 93.363  62.165  30.535  1.00 92.07  ? 809  THR A N     1 
ATOM   6295  C  CA    . THR A 1  809  ? 91.998  62.504  30.908  1.00 92.08  ? 809  THR A CA    1 
ATOM   6296  C  C     . THR A 1  809  ? 91.129  62.295  29.642  1.00 94.22  ? 809  THR A C     1 
ATOM   6297  O  O     . THR A 1  809  ? 91.696  62.228  28.549  1.00 93.03  ? 809  THR A O     1 
ATOM   6298  C  CB    . THR A 1  809  ? 91.968  63.914  31.459  1.00 99.10  ? 809  THR A CB    1 
ATOM   6299  O  OG1   . THR A 1  809  ? 92.146  64.825  30.376  1.00 98.36  ? 809  THR A OG1   1 
ATOM   6300  C  CG2   . THR A 1  809  ? 93.012  64.134  32.562  1.00 96.93  ? 809  THR A CG2   1 
ATOM   6301  N  N     . PRO A 1  810  ? 89.786  62.151  29.729  1.00 89.96  ? 810  PRO A N     1 
ATOM   6302  C  CA    . PRO A 1  810  ? 88.995  61.896  28.504  1.00 88.88  ? 810  PRO A CA    1 
ATOM   6303  C  C     . PRO A 1  810  ? 89.223  62.891  27.370  1.00 93.10  ? 810  PRO A C     1 
ATOM   6304  O  O     . PRO A 1  810  ? 89.399  62.489  26.213  1.00 90.59  ? 810  PRO A O     1 
ATOM   6305  C  CB    . PRO A 1  810  ? 87.551  61.911  29.004  1.00 91.19  ? 810  PRO A CB    1 
ATOM   6306  C  CG    . PRO A 1  810  ? 87.659  61.544  30.431  1.00 96.16  ? 810  PRO A CG    1 
ATOM   6307  C  CD    . PRO A 1  810  ? 88.923  62.155  30.926  1.00 92.09  ? 810  PRO A CD    1 
ATOM   6308  N  N     . GLN A 1  811  ? 89.270  64.192  27.733  1.00 92.26  ? 811  GLN A N     1 
ATOM   6309  C  CA    . GLN A 1  811  ? 89.506  65.334  26.835  1.00 91.78  ? 811  GLN A CA    1 
ATOM   6310  C  C     . GLN A 1  811  ? 90.905  65.176  26.209  1.00 93.14  ? 811  GLN A C     1 
ATOM   6311  O  O     . GLN A 1  811  ? 91.027  65.134  24.974  1.00 91.14  ? 811  GLN A O     1 
ATOM   6312  C  CB    . GLN A 1  811  ? 89.362  66.686  27.590  1.00 94.15  ? 811  GLN A CB    1 
ATOM   6313  C  CG    . GLN A 1  811  ? 88.066  66.841  28.410  1.00 103.94 ? 811  GLN A CG    1 
ATOM   6314  C  CD    . GLN A 1  811  ? 88.237  66.481  29.875  1.00 122.46 ? 811  GLN A CD    1 
ATOM   6315  O  OE1   . GLN A 1  811  ? 88.984  65.566  30.255  1.00 116.14 ? 811  GLN A OE1   1 
ATOM   6316  N  NE2   . GLN A 1  811  ? 87.526  67.185  30.740  1.00 117.67 ? 811  GLN A NE2   1 
ATOM   6317  N  N     . GLU A 1  812  ? 91.936  64.990  27.081  1.00 88.51  ? 812  GLU A N     1 
ATOM   6318  C  CA    . GLU A 1  812  ? 93.329  64.763  26.705  1.00 86.77  ? 812  GLU A CA    1 
ATOM   6319  C  C     . GLU A 1  812  ? 93.427  63.578  25.743  1.00 88.09  ? 812  GLU A C     1 
ATOM   6320  O  O     . GLU A 1  812  ? 94.136  63.670  24.745  1.00 85.72  ? 812  GLU A O     1 
ATOM   6321  C  CB    . GLU A 1  812  ? 94.183  64.498  27.956  1.00 88.62  ? 812  GLU A CB    1 
ATOM   6322  C  CG    . GLU A 1  812  ? 94.716  65.746  28.642  1.00 99.93  ? 812  GLU A CG    1 
ATOM   6323  C  CD    . GLU A 1  812  ? 95.622  65.520  29.841  1.00 122.73 ? 812  GLU A CD    1 
ATOM   6324  O  OE1   . GLU A 1  812  ? 95.646  64.388  30.379  1.00 118.18 ? 812  GLU A OE1   1 
ATOM   6325  O  OE2   . GLU A 1  812  ? 96.308  66.486  30.249  1.00 118.64 ? 812  GLU A OE2   1 
ATOM   6326  N  N     . PHE A 1  813  ? 92.678  62.488  26.036  1.00 85.10  ? 813  PHE A N     1 
ATOM   6327  C  CA    . PHE A 1  813  ? 92.625  61.258  25.253  1.00 84.12  ? 813  PHE A CA    1 
ATOM   6328  C  C     . PHE A 1  813  ? 92.088  61.504  23.867  1.00 84.06  ? 813  PHE A C     1 
ATOM   6329  O  O     . PHE A 1  813  ? 92.626  60.964  22.893  1.00 81.02  ? 813  PHE A O     1 
ATOM   6330  C  CB    . PHE A 1  813  ? 91.767  60.201  25.966  1.00 87.34  ? 813  PHE A CB    1 
ATOM   6331  C  CG    . PHE A 1  813  ? 91.727  58.850  25.280  1.00 89.27  ? 813  PHE A CG    1 
ATOM   6332  C  CD1   . PHE A 1  813  ? 90.775  58.574  24.301  1.00 91.27  ? 813  PHE A CD1   1 
ATOM   6333  C  CD2   . PHE A 1  813  ? 92.623  57.845  25.633  1.00 93.27  ? 813  PHE A CD2   1 
ATOM   6334  C  CE1   . PHE A 1  813  ? 90.728  57.325  23.680  1.00 93.50  ? 813  PHE A CE1   1 
ATOM   6335  C  CE2   . PHE A 1  813  ? 92.566  56.590  25.019  1.00 93.70  ? 813  PHE A CE2   1 
ATOM   6336  C  CZ    . PHE A 1  813  ? 91.618  56.339  24.046  1.00 91.79  ? 813  PHE A CZ    1 
ATOM   6337  N  N     . PHE A 1  814  ? 91.001  62.280  23.784  1.00 80.79  ? 814  PHE A N     1 
ATOM   6338  C  CA    . PHE A 1  814  ? 90.379  62.572  22.510  1.00 80.13  ? 814  PHE A CA    1 
ATOM   6339  C  C     . PHE A 1  814  ? 91.259  63.454  21.651  1.00 85.32  ? 814  PHE A C     1 
ATOM   6340  O  O     . PHE A 1  814  ? 91.445  63.152  20.477  1.00 83.09  ? 814  PHE A O     1 
ATOM   6341  C  CB    . PHE A 1  814  ? 88.995  63.179  22.696  1.00 82.59  ? 814  PHE A CB    1 
ATOM   6342  C  CG    . PHE A 1  814  ? 88.192  63.159  21.422  1.00 83.74  ? 814  PHE A CG    1 
ATOM   6343  C  CD1   . PHE A 1  814  ? 87.501  62.021  21.037  1.00 86.67  ? 814  PHE A CD1   1 
ATOM   6344  C  CD2   . PHE A 1  814  ? 88.144  64.274  20.593  1.00 86.63  ? 814  PHE A CD2   1 
ATOM   6345  C  CE1   . PHE A 1  814  ? 86.764  62.000  19.847  1.00 87.72  ? 814  PHE A CE1   1 
ATOM   6346  C  CE2   . PHE A 1  814  ? 87.416  64.251  19.398  1.00 89.22  ? 814  PHE A CE2   1 
ATOM   6347  C  CZ    . PHE A 1  814  ? 86.728  63.115  19.035  1.00 86.96  ? 814  PHE A CZ    1 
ATOM   6348  N  N     . PHE A 1  815  ? 91.808  64.538  22.233  1.00 85.38  ? 815  PHE A N     1 
ATOM   6349  C  CA    . PHE A 1  815  ? 92.685  65.477  21.524  1.00 85.57  ? 815  PHE A CA    1 
ATOM   6350  C  C     . PHE A 1  815  ? 93.934  64.770  21.020  1.00 88.69  ? 815  PHE A C     1 
ATOM   6351  O  O     . PHE A 1  815  ? 94.324  64.958  19.863  1.00 86.78  ? 815  PHE A O     1 
ATOM   6352  C  CB    . PHE A 1  815  ? 93.026  66.693  22.404  1.00 88.57  ? 815  PHE A CB    1 
ATOM   6353  C  CG    . PHE A 1  815  ? 91.854  67.566  22.808  1.00 91.53  ? 815  PHE A CG    1 
ATOM   6354  C  CD1   . PHE A 1  815  ? 90.737  67.689  21.986  1.00 94.60  ? 815  PHE A CD1   1 
ATOM   6355  C  CD2   . PHE A 1  815  ? 91.885  68.296  23.993  1.00 95.58  ? 815  PHE A CD2   1 
ATOM   6356  C  CE1   . PHE A 1  815  ? 89.662  68.506  22.354  1.00 97.12  ? 815  PHE A CE1   1 
ATOM   6357  C  CE2   . PHE A 1  815  ? 90.819  69.129  24.352  1.00 99.76  ? 815  PHE A CE2   1 
ATOM   6358  C  CZ    . PHE A 1  815  ? 89.715  69.229  23.530  1.00 97.90  ? 815  PHE A CZ    1 
ATOM   6359  N  N     . HIS A 1  816  ? 94.500  63.884  21.862  1.00 86.38  ? 816  HIS A N     1 
ATOM   6360  C  CA    . HIS A 1  816  ? 95.646  63.066  21.498  1.00 85.75  ? 816  HIS A CA    1 
ATOM   6361  C  C     . HIS A 1  816  ? 95.268  62.186  20.327  1.00 88.81  ? 816  HIS A C     1 
ATOM   6362  O  O     . HIS A 1  816  ? 96.056  62.072  19.386  1.00 88.39  ? 816  HIS A O     1 
ATOM   6363  C  CB    . HIS A 1  816  ? 96.131  62.225  22.678  1.00 87.17  ? 816  HIS A CB    1 
ATOM   6364  C  CG    . HIS A 1  816  ? 97.382  61.460  22.392  1.00 90.34  ? 816  HIS A CG    1 
ATOM   6365  N  ND1   . HIS A 1  816  ? 98.412  62.012  21.655  1.00 92.11  ? 816  HIS A ND1   1 
ATOM   6366  C  CD2   . HIS A 1  816  ? 97.737  60.212  22.772  1.00 92.58  ? 816  HIS A CD2   1 
ATOM   6367  C  CE1   . HIS A 1  816  ? 99.349  61.079  21.590  1.00 91.34  ? 816  HIS A CE1   1 
ATOM   6368  N  NE2   . HIS A 1  816  ? 98.990  59.979  22.250  1.00 91.81  ? 816  HIS A NE2   1 
ATOM   6369  N  N     . ALA A 1  817  ? 94.038  61.622  20.353  1.00 84.42  ? 817  ALA A N     1 
ATOM   6370  C  CA    . ALA A 1  817  ? 93.530  60.797  19.266  1.00 83.27  ? 817  ALA A CA    1 
ATOM   6371  C  C     . ALA A 1  817  ? 93.389  61.609  17.969  1.00 88.26  ? 817  ALA A C     1 
ATOM   6372  O  O     . ALA A 1  817  ? 93.784  61.124  16.915  1.00 86.86  ? 817  ALA A O     1 
ATOM   6373  C  CB    . ALA A 1  817  ? 92.212  60.160  19.657  1.00 84.29  ? 817  ALA A CB    1 
ATOM   6374  N  N     . MET A 1  818  ? 92.907  62.864  18.056  1.00 87.40  ? 818  MET A N     1 
ATOM   6375  C  CA    . MET A 1  818  ? 92.760  63.764  16.904  1.00 87.24  ? 818  MET A CA    1 
ATOM   6376  C  C     . MET A 1  818  ? 94.094  63.993  16.196  1.00 91.77  ? 818  MET A C     1 
ATOM   6377  O  O     . MET A 1  818  ? 94.177  63.811  14.974  1.00 90.80  ? 818  MET A O     1 
ATOM   6378  C  CB    . MET A 1  818  ? 92.158  65.099  17.336  1.00 90.28  ? 818  MET A CB    1 
ATOM   6379  C  CG    . MET A 1  818  ? 90.704  65.029  17.598  1.00 94.24  ? 818  MET A CG    1 
ATOM   6380  S  SD    . MET A 1  818  ? 90.133  66.608  18.206  1.00 99.80  ? 818  MET A SD    1 
ATOM   6381  C  CE    . MET A 1  818  ? 89.775  67.433  16.672  1.00 96.49  ? 818  MET A CE    1 
ATOM   6382  N  N     . GLY A 1  819  ? 95.115  64.357  16.981  1.00 89.30  ? 819  GLY A N     1 
ATOM   6383  C  CA    . GLY A 1  819  ? 96.470  64.590  16.499  1.00 89.26  ? 819  GLY A CA    1 
ATOM   6384  C  C     . GLY A 1  819  ? 97.075  63.334  15.908  1.00 92.94  ? 819  GLY A C     1 
ATOM   6385  O  O     . GLY A 1  819  ? 97.690  63.378  14.833  1.00 91.71  ? 819  GLY A O     1 
ATOM   6386  N  N     . GLY A 1  820  ? 96.851  62.219  16.608  1.00 89.69  ? 820  GLY A N     1 
ATOM   6387  C  CA    . GLY A 1  820  ? 97.328  60.894  16.235  1.00 88.69  ? 820  GLY A CA    1 
ATOM   6388  C  C     . GLY A 1  820  ? 96.846  60.456  14.871  1.00 91.23  ? 820  GLY A C     1 
ATOM   6389  O  O     . GLY A 1  820  ? 97.650  60.039  14.033  1.00 90.15  ? 820  GLY A O     1 
ATOM   6390  N  N     . ARG A 1  821  ? 95.533  60.595  14.639  1.00 87.56  ? 821  ARG A N     1 
ATOM   6391  C  CA    . ARG A 1  821  ? 94.881  60.253  13.384  1.00 86.66  ? 821  ARG A CA    1 
ATOM   6392  C  C     . ARG A 1  821  ? 95.508  61.028  12.223  1.00 92.50  ? 821  ARG A C     1 
ATOM   6393  O  O     . ARG A 1  821  ? 95.837  60.403  11.216  1.00 90.98  ? 821  ARG A O     1 
ATOM   6394  C  CB    . ARG A 1  821  ? 93.363  60.458  13.487  1.00 84.92  ? 821  ARG A CB    1 
ATOM   6395  C  CG    . ARG A 1  821  ? 92.625  60.422  12.168  1.00 88.40  ? 821  ARG A CG    1 
ATOM   6396  C  CD    . ARG A 1  821  ? 92.104  59.057  11.802  1.00 91.28  ? 821  ARG A CD    1 
ATOM   6397  N  NE    . ARG A 1  821  ? 90.651  59.054  11.908  1.00 99.54  ? 821  ARG A NE    1 
ATOM   6398  C  CZ    . ARG A 1  821  ? 89.985  58.519  12.922  1.00 112.85 ? 821  ARG A CZ    1 
ATOM   6399  N  NH1   . ARG A 1  821  ? 90.638  57.892  13.898  1.00 98.03  ? 821  ARG A NH1   1 
ATOM   6400  N  NH2   . ARG A 1  821  ? 88.659  58.586  12.962  1.00 94.98  ? 821  ARG A NH2   1 
ATOM   6401  N  N     . GLU A 1  822  ? 95.760  62.354  12.392  1.00 92.10  ? 822  GLU A N     1 
ATOM   6402  C  CA    . GLU A 1  822  ? 96.410  63.217  11.377  1.00 92.58  ? 822  GLU A CA    1 
ATOM   6403  C  C     . GLU A 1  822  ? 97.741  62.564  10.853  1.00 94.75  ? 822  GLU A C     1 
ATOM   6404  O  O     . GLU A 1  822  ? 98.075  62.668  9.658   1.00 93.20  ? 822  GLU A O     1 
ATOM   6405  C  CB    . GLU A 1  822  ? 96.663  64.636  11.958  1.00 95.11  ? 822  GLU A CB    1 
ATOM   6406  C  CG    . GLU A 1  822  ? 96.952  65.744  10.943  1.00 108.92 ? 822  GLU A CG    1 
ATOM   6407  C  CD    . GLU A 1  822  ? 97.936  66.842  11.342  1.00 135.58 ? 822  GLU A CD    1 
ATOM   6408  O  OE1   . GLU A 1  822  ? 98.454  66.821  12.485  1.00 130.00 ? 822  GLU A OE1   1 
ATOM   6409  O  OE2   . GLU A 1  822  ? 98.210  67.720  10.491  1.00 129.10 ? 822  GLU A OE2   1 
ATOM   6410  N  N     . GLY A 1  823  ? 98.426  61.857  11.760  1.00 90.59  ? 823  GLY A N     1 
ATOM   6411  C  CA    . GLY A 1  823  ? 99.680  61.154  11.504  1.00 89.25  ? 823  GLY A CA    1 
ATOM   6412  C  C     . GLY A 1  823  ? 99.547  59.968  10.576  1.00 89.34  ? 823  GLY A C     1 
ATOM   6413  O  O     . GLY A 1  823  ? 100.249 59.889  9.561   1.00 87.42  ? 823  GLY A O     1 
ATOM   6414  N  N     . LEU A 1  824  ? 98.637  59.047  10.919  1.00 84.66  ? 824  LEU A N     1 
ATOM   6415  C  CA    . LEU A 1  824  ? 98.375  57.889  10.077  1.00 83.63  ? 824  LEU A CA    1 
ATOM   6416  C  C     . LEU A 1  824  ? 97.635  58.203  8.786   1.00 86.36  ? 824  LEU A C     1 
ATOM   6417  O  O     . LEU A 1  824  ? 97.562  57.342  7.908   1.00 84.15  ? 824  LEU A O     1 
ATOM   6418  C  CB    . LEU A 1  824  ? 97.827  56.651  10.805  1.00 84.04  ? 824  LEU A CB    1 
ATOM   6419  C  CG    . LEU A 1  824  ? 96.797  56.820  11.901  1.00 89.68  ? 824  LEU A CG    1 
ATOM   6420  C  CD1   . LEU A 1  824  ? 95.655  55.815  11.719  1.00 89.82  ? 824  LEU A CD1   1 
ATOM   6421  C  CD2   . LEU A 1  824  ? 97.453  56.676  13.283  1.00 91.67  ? 824  LEU A CD2   1 
ATOM   6422  N  N     . ILE A 1  825  ? 97.136  59.449  8.639   1.00 84.78  ? 825  ILE A N     1 
ATOM   6423  C  CA    . ILE A 1  825  ? 96.546  59.860  7.371   1.00 85.05  ? 825  ILE A CA    1 
ATOM   6424  C  C     . ILE A 1  825  ? 97.724  60.211  6.492   1.00 93.21  ? 825  ILE A C     1 
ATOM   6425  O  O     . ILE A 1  825  ? 97.906  59.550  5.474   1.00 92.04  ? 825  ILE A O     1 
ATOM   6426  C  CB    . ILE A 1  825  ? 95.458  60.964  7.398   1.00 87.94  ? 825  ILE A CB    1 
ATOM   6427  C  CG1   . ILE A 1  825  ? 94.269  60.549  8.248   1.00 88.75  ? 825  ILE A CG1   1 
ATOM   6428  C  CG2   . ILE A 1  825  ? 94.969  61.254  5.984   1.00 86.98  ? 825  ILE A CG2   1 
ATOM   6429  C  CD1   . ILE A 1  825  ? 93.616  61.704  8.899   1.00 100.55 ? 825  ILE A CD1   1 
ATOM   6430  N  N     . ASP A 1  826  ? 98.588  61.158  6.906   1.00 94.86  ? 826  ASP A N     1 
ATOM   6431  C  CA    . ASP A 1  826  ? 99.727  61.433  6.038   1.00 97.09  ? 826  ASP A CA    1 
ATOM   6432  C  C     . ASP A 1  826  ? 100.703 60.252  5.861   1.00 102.35 ? 826  ASP A C     1 
ATOM   6433  O  O     . ASP A 1  826  ? 101.373 60.185  4.838   1.00 102.12 ? 826  ASP A O     1 
ATOM   6434  C  CB    . ASP A 1  826  ? 100.357 62.828  6.207   1.00 101.12 ? 826  ASP A CB    1 
ATOM   6435  C  CG    . ASP A 1  826  ? 101.366 62.950  7.320   1.00 126.78 ? 826  ASP A CG    1 
ATOM   6436  O  OD1   . ASP A 1  826  ? 102.509 62.443  7.148   1.00 128.00 ? 826  ASP A OD1   1 
ATOM   6437  O  OD2   . ASP A 1  826  ? 101.048 63.618  8.337   1.00 140.16 ? 826  ASP A OD2   1 
ATOM   6438  N  N     . THR A 1  827  ? 100.675 59.258  6.765   1.00 100.16 ? 827  THR A N     1 
ATOM   6439  C  CA    . THR A 1  827  ? 101.461 58.037  6.578   1.00 100.33 ? 827  THR A CA    1 
ATOM   6440  C  C     . THR A 1  827  ? 100.927 57.360  5.309   1.00 107.26 ? 827  THR A C     1 
ATOM   6441  O  O     . THR A 1  827  ? 101.688 57.191  4.362   1.00 106.53 ? 827  THR A O     1 
ATOM   6442  C  CB    . THR A 1  827  ? 101.359 57.139  7.807   1.00 107.75 ? 827  THR A CB    1 
ATOM   6443  O  OG1   . THR A 1  827  ? 102.036 57.775  8.884   1.00 109.46 ? 827  THR A OG1   1 
ATOM   6444  C  CG2   . THR A 1  827  ? 101.939 55.762  7.579   1.00 104.41 ? 827  THR A CG2   1 
ATOM   6445  N  N     . ALA A 1  828  ? 99.600  57.083  5.267   1.00 106.79 ? 828  ALA A N     1 
ATOM   6446  C  CA    . ALA A 1  828  ? 98.857  56.471  4.153   1.00 107.23 ? 828  ALA A CA    1 
ATOM   6447  C  C     . ALA A 1  828  ? 98.824  57.324  2.861   1.00 113.58 ? 828  ALA A C     1 
ATOM   6448  O  O     . ALA A 1  828  ? 98.883  56.766  1.760   1.00 112.89 ? 828  ALA A O     1 
ATOM   6449  C  CB    . ALA A 1  828  ? 97.441  56.153  4.597   1.00 108.20 ? 828  ALA A CB    1 
ATOM   6450  N  N     . VAL A 1  829  ? 98.711  58.659  2.998   1.00 112.02 ? 829  VAL A N     1 
ATOM   6451  C  CA    . VAL A 1  829  ? 98.682  59.612  1.883   1.00 112.67 ? 829  VAL A CA    1 
ATOM   6452  C  C     . VAL A 1  829  ? 100.049 59.622  1.189   1.00 119.08 ? 829  VAL A C     1 
ATOM   6453  O  O     . VAL A 1  829  ? 100.142 59.366  -0.019  1.00 117.99 ? 829  VAL A O     1 
ATOM   6454  C  CB    . VAL A 1  829  ? 98.254  61.026  2.388   1.00 116.80 ? 829  VAL A CB    1 
ATOM   6455  C  CG1   . VAL A 1  829  ? 98.785  62.162  1.506   1.00 116.68 ? 829  VAL A CG1   1 
ATOM   6456  C  CG2   . VAL A 1  829  ? 96.745  61.116  2.545   1.00 116.84 ? 829  VAL A CG2   1 
ATOM   6457  N  N     . LYS A 1  830  ? 101.102 59.897  1.977   1.00 118.26 ? 830  LYS A N     1 
ATOM   6458  C  CA    . LYS A 1  830  ? 102.465 60.002  1.489   1.00 119.11 ? 830  LYS A CA    1 
ATOM   6459  C  C     . LYS A 1  830  ? 103.089 58.689  1.042   1.00 124.70 ? 830  LYS A C     1 
ATOM   6460  O  O     . LYS A 1  830  ? 103.963 58.735  0.178   1.00 125.09 ? 830  LYS A O     1 
ATOM   6461  C  CB    . LYS A 1  830  ? 103.371 60.818  2.438   1.00 122.15 ? 830  LYS A CB    1 
ATOM   6462  C  CG    . LYS A 1  830  ? 103.393 62.331  2.130   1.00 129.93 ? 830  LYS A CG    1 
ATOM   6463  C  CD    . LYS A 1  830  ? 102.536 63.171  3.065   1.00 129.94 ? 830  LYS A CD    1 
ATOM   6464  C  CE    . LYS A 1  830  ? 103.165 64.517  3.283   1.00 131.17 ? 830  LYS A CE    1 
ATOM   6465  N  NZ    . LYS A 1  830  ? 102.480 65.256  4.368   1.00 140.63 ? 830  LYS A NZ    1 
ATOM   6466  N  N     . THR A 1  831  ? 102.603 57.527  1.551   1.00 120.88 ? 831  THR A N     1 
ATOM   6467  C  CA    . THR A 1  831  ? 103.119 56.202  1.159   1.00 119.75 ? 831  THR A CA    1 
ATOM   6468  C  C     . THR A 1  831  ? 103.007 55.903  -0.364  1.00 122.00 ? 831  THR A C     1 
ATOM   6469  O  O     . THR A 1  831  ? 103.873 55.210  -0.912  1.00 120.81 ? 831  THR A O     1 
ATOM   6470  C  CB    . THR A 1  831  ? 102.649 55.091  2.134   1.00 128.00 ? 831  THR A CB    1 
ATOM   6471  O  OG1   . THR A 1  831  ? 103.613 54.046  2.185   1.00 127.13 ? 831  THR A OG1   1 
ATOM   6472  C  CG2   . THR A 1  831  ? 101.266 54.529  1.808   1.00 127.21 ? 831  THR A CG2   1 
ATOM   6473  N  N     . ALA A 1  832  ? 101.970 56.480  -1.038  1.00 117.63 ? 832  ALA A N     1 
ATOM   6474  C  CA    . ALA A 1  832  ? 101.709 56.334  -2.477  1.00 116.50 ? 832  ALA A CA    1 
ATOM   6475  C  C     . ALA A 1  832  ? 102.387 57.425  -3.317  1.00 117.20 ? 832  ALA A C     1 
ATOM   6476  O  O     . ALA A 1  832  ? 103.010 57.114  -4.337  1.00 115.95 ? 832  ALA A O     1 
ATOM   6477  C  CB    . ALA A 1  832  ? 100.217 56.336  -2.733  1.00 117.70 ? 832  ALA A CB    1 
ATOM   6478  N  N     . GLU A 1  833  ? 102.253 58.701  -2.878  1.00 112.13 ? 833  GLU A N     1 
ATOM   6479  C  CA    . GLU A 1  833  ? 102.842 59.906  -3.478  1.00 110.82 ? 833  GLU A CA    1 
ATOM   6480  C  C     . GLU A 1  833  ? 104.342 59.692  -3.695  1.00 108.69 ? 833  GLU A C     1 
ATOM   6481  O  O     . GLU A 1  833  ? 104.845 59.874  -4.809  1.00 107.53 ? 833  GLU A O     1 
ATOM   6482  C  CB    . GLU A 1  833  ? 102.640 61.092  -2.520  1.00 113.25 ? 833  GLU A CB    1 
ATOM   6483  C  CG    . GLU A 1  833  ? 101.738 62.195  -3.048  1.00 130.84 ? 833  GLU A CG    1 
ATOM   6484  C  CD    . GLU A 1  833  ? 101.592 63.415  -2.148  1.00 168.62 ? 833  GLU A CD    1 
ATOM   6485  O  OE1   . GLU A 1  833  ? 101.677 63.268  -0.904  1.00 170.59 ? 833  GLU A OE1   1 
ATOM   6486  O  OE2   . GLU A 1  833  ? 101.354 64.519  -2.692  1.00 166.99 ? 833  GLU A OE2   1 
ATOM   6487  N  N     . THR A 1  834  ? 105.024 59.253  -2.615  1.00 101.30 ? 834  THR A N     1 
ATOM   6488  C  CA    . THR A 1  834  ? 106.449 58.955  -2.532  1.00 99.53  ? 834  THR A CA    1 
ATOM   6489  C  C     . THR A 1  834  ? 106.895 57.818  -3.495  1.00 100.26 ? 834  THR A C     1 
ATOM   6490  O  O     . THR A 1  834  ? 108.041 57.794  -3.970  1.00 99.64  ? 834  THR A O     1 
ATOM   6491  C  CB    . THR A 1  834  ? 106.831 58.739  -1.046  1.00 104.92 ? 834  THR A CB    1 
ATOM   6492  O  OG1   . THR A 1  834  ? 108.156 59.193  -0.810  1.00 105.44 ? 834  THR A OG1   1 
ATOM   6493  C  CG2   . THR A 1  834  ? 106.670 57.288  -0.567  1.00 102.95 ? 834  THR A CG2   1 
ATOM   6494  N  N     . GLY A 1  835  ? 105.988 56.887  -3.753  1.00 93.45  ? 835  GLY A N     1 
ATOM   6495  C  CA    . GLY A 1  835  ? 106.274 55.749  -4.611  1.00 90.96  ? 835  GLY A CA    1 
ATOM   6496  C  C     . GLY A 1  835  ? 106.352 56.121  -6.071  1.00 88.69  ? 835  GLY A C     1 
ATOM   6497  O  O     . GLY A 1  835  ? 107.249 55.644  -6.789  1.00 87.32  ? 835  GLY A O     1 
ATOM   6498  N  N     . TYR A 1  836  ? 105.375 56.952  -6.508  1.00 80.85  ? 836  TYR A N     1 
ATOM   6499  C  CA    . TYR A 1  836  ? 105.276 57.442  -7.870  1.00 79.28  ? 836  TYR A CA    1 
ATOM   6500  C  C     . TYR A 1  836  ? 106.388 58.442  -8.133  1.00 81.28  ? 836  TYR A C     1 
ATOM   6501  O  O     . TYR A 1  836  ? 106.911 58.473  -9.251  1.00 80.56  ? 836  TYR A O     1 
ATOM   6502  C  CB    . TYR A 1  836  ? 103.885 58.014  -8.143  1.00 80.95  ? 836  TYR A CB    1 
ATOM   6503  C  CG    . TYR A 1  836  ? 103.665 58.639  -9.510  1.00 83.57  ? 836  TYR A CG    1 
ATOM   6504  C  CD1   . TYR A 1  836  ? 103.969 57.944  -10.677 1.00 85.61  ? 836  TYR A CD1   1 
ATOM   6505  C  CD2   . TYR A 1  836  ? 103.037 59.873  -9.638  1.00 85.20  ? 836  TYR A CD2   1 
ATOM   6506  C  CE1   . TYR A 1  836  ? 103.727 58.498  -11.938 1.00 87.11  ? 836  TYR A CE1   1 
ATOM   6507  C  CE2   . TYR A 1  836  ? 102.768 60.427  -10.891 1.00 86.49  ? 836  TYR A CE2   1 
ATOM   6508  C  CZ    . TYR A 1  836  ? 103.116 59.738  -12.039 1.00 94.11  ? 836  TYR A CZ    1 
ATOM   6509  O  OH    . TYR A 1  836  ? 102.891 60.320  -13.268 1.00 97.09  ? 836  TYR A OH    1 
ATOM   6510  N  N     . ILE A 1  837  ? 106.814 59.201  -7.088  1.00 76.30  ? 837  ILE A N     1 
ATOM   6511  C  CA    . ILE A 1  837  ? 107.949 60.129  -7.200  1.00 75.00  ? 837  ILE A CA    1 
ATOM   6512  C  C     . ILE A 1  837  ? 109.187 59.301  -7.564  1.00 75.45  ? 837  ILE A C     1 
ATOM   6513  O  O     . ILE A 1  837  ? 109.878 59.638  -8.525  1.00 74.57  ? 837  ILE A O     1 
ATOM   6514  C  CB    . ILE A 1  837  ? 108.130 61.004  -5.922  1.00 78.18  ? 837  ILE A CB    1 
ATOM   6515  C  CG1   . ILE A 1  837  ? 107.114 62.150  -5.911  1.00 78.95  ? 837  ILE A CG1   1 
ATOM   6516  C  CG2   . ILE A 1  837  ? 109.567 61.535  -5.779  1.00 78.40  ? 837  ILE A CG2   1 
ATOM   6517  C  CD1   . ILE A 1  837  ? 107.277 63.093  -4.792  1.00 87.40  ? 837  ILE A CD1   1 
ATOM   6518  N  N     . GLN A 1  838  ? 109.398 58.171  -6.854  1.00 70.32  ? 838  GLN A N     1 
ATOM   6519  C  CA    . GLN A 1  838  ? 110.500 57.243  -7.111  1.00 69.57  ? 838  GLN A CA    1 
ATOM   6520  C  C     . GLN A 1  838  ? 110.423 56.695  -8.547  1.00 70.25  ? 838  GLN A C     1 
ATOM   6521  O  O     . GLN A 1  838  ? 111.409 56.792  -9.269  1.00 69.88  ? 838  GLN A O     1 
ATOM   6522  C  CB    . GLN A 1  838  ? 110.532 56.120  -6.051  1.00 71.29  ? 838  GLN A CB    1 
ATOM   6523  C  CG    . GLN A 1  838  ? 111.894 55.407  -5.879  1.00 91.12  ? 838  GLN A CG    1 
ATOM   6524  C  CD    . GLN A 1  838  ? 111.941 54.022  -6.509  1.00 116.97 ? 838  GLN A CD    1 
ATOM   6525  O  OE1   . GLN A 1  838  ? 111.046 53.602  -7.278  1.00 113.20 ? 838  GLN A OE1   1 
ATOM   6526  N  NE2   . GLN A 1  838  ? 113.013 53.286  -6.214  1.00 106.27 ? 838  GLN A NE2   1 
ATOM   6527  N  N     . ARG A 1  839  ? 109.238 56.223  -8.986  1.00 64.64  ? 839  ARG A N     1 
ATOM   6528  C  CA    . ARG A 1  839  ? 109.023 55.703  -10.346 1.00 63.09  ? 839  ARG A CA    1 
ATOM   6529  C  C     . ARG A 1  839  ? 109.502 56.661  -11.390 1.00 65.27  ? 839  ARG A C     1 
ATOM   6530  O  O     . ARG A 1  839  ? 110.337 56.307  -12.230 1.00 64.58  ? 839  ARG A O     1 
ATOM   6531  C  CB    . ARG A 1  839  ? 107.540 55.428  -10.625 1.00 61.90  ? 839  ARG A CB    1 
ATOM   6532  C  CG    . ARG A 1  839  ? 107.346 54.178  -11.471 1.00 66.78  ? 839  ARG A CG    1 
ATOM   6533  C  CD    . ARG A 1  839  ? 106.310 54.290  -12.558 1.00 65.02  ? 839  ARG A CD    1 
ATOM   6534  N  NE    . ARG A 1  839  ? 106.657 53.315  -13.582 1.00 69.28  ? 839  ARG A NE    1 
ATOM   6535  C  CZ    . ARG A 1  839  ? 106.150 53.282  -14.807 1.00 88.01  ? 839  ARG A CZ    1 
ATOM   6536  N  NH1   . ARG A 1  839  ? 105.214 54.168  -15.177 1.00 70.30  ? 839  ARG A NH1   1 
ATOM   6537  N  NH2   . ARG A 1  839  ? 106.561 52.358  -15.674 1.00 73.06  ? 839  ARG A NH2   1 
ATOM   6538  N  N     . ARG A 1  840  ? 108.945 57.880  -11.338 1.00 60.81  ? 840  ARG A N     1 
ATOM   6539  C  CA    . ARG A 1  840  ? 109.244 58.977  -12.247 1.00 59.70  ? 840  ARG A CA    1 
ATOM   6540  C  C     . ARG A 1  840  ? 110.752 59.179  -12.328 1.00 59.39  ? 840  ARG A C     1 
ATOM   6541  O  O     . ARG A 1  840  ? 111.296 59.120  -13.430 1.00 58.10  ? 840  ARG A O     1 
ATOM   6542  C  CB    . ARG A 1  840  ? 108.536 60.249  -11.772 1.00 59.45  ? 840  ARG A CB    1 
ATOM   6543  C  CG    . ARG A 1  840  ? 107.062 60.317  -12.128 1.00 62.71  ? 840  ARG A CG    1 
ATOM   6544  C  CD    . ARG A 1  840  ? 106.278 61.016  -11.030 1.00 72.07  ? 840  ARG A CD    1 
ATOM   6545  N  NE    . ARG A 1  840  ? 106.704 62.389  -10.763 1.00 81.62  ? 840  ARG A NE    1 
ATOM   6546  C  CZ    . ARG A 1  840  ? 106.254 63.133  -9.755  1.00 101.52 ? 840  ARG A CZ    1 
ATOM   6547  N  NH1   . ARG A 1  840  ? 105.349 62.644  -8.907  1.00 82.57  ? 840  ARG A NH1   1 
ATOM   6548  N  NH2   . ARG A 1  840  ? 106.717 64.363  -9.576  1.00 95.69  ? 840  ARG A NH2   1 
ATOM   6549  N  N     . LEU A 1  841  ? 111.424 59.289  -11.158 1.00 54.01  ? 841  LEU A N     1 
ATOM   6550  C  CA    . LEU A 1  841  ? 112.867 59.450  -11.042 1.00 54.03  ? 841  LEU A CA    1 
ATOM   6551  C  C     . LEU A 1  841  ? 113.637 58.354  -11.767 1.00 59.45  ? 841  LEU A C     1 
ATOM   6552  O  O     . LEU A 1  841  ? 114.617 58.647  -12.448 1.00 59.46  ? 841  LEU A O     1 
ATOM   6553  C  CB    . LEU A 1  841  ? 113.286 59.473  -9.573  1.00 54.24  ? 841  LEU A CB    1 
ATOM   6554  C  CG    . LEU A 1  841  ? 113.104 60.791  -8.845  1.00 60.86  ? 841  LEU A CG    1 
ATOM   6555  C  CD1   . LEU A 1  841  ? 113.174 60.602  -7.333  1.00 60.87  ? 841  LEU A CD1   1 
ATOM   6556  C  CD2   . LEU A 1  841  ? 114.136 61.827  -9.303  1.00 66.08  ? 841  LEU A CD2   1 
ATOM   6557  N  N     . VAL A 1  842  ? 113.204 57.094  -11.618 1.00 56.68  ? 842  VAL A N     1 
ATOM   6558  C  CA    . VAL A 1  842  ? 113.876 55.946  -12.230 1.00 56.35  ? 842  VAL A CA    1 
ATOM   6559  C  C     . VAL A 1  842  ? 113.631 55.901  -13.739 1.00 61.52  ? 842  VAL A C     1 
ATOM   6560  O  O     . VAL A 1  842  ? 114.542 55.695  -14.561 1.00 60.17  ? 842  VAL A O     1 
ATOM   6561  C  CB    . VAL A 1  842  ? 113.509 54.634  -11.513 1.00 58.98  ? 842  VAL A CB    1 
ATOM   6562  C  CG1   . VAL A 1  842  ? 114.176 53.443  -12.186 1.00 58.56  ? 842  VAL A CG1   1 
ATOM   6563  C  CG2   . VAL A 1  842  ? 113.921 54.706  -10.056 1.00 58.59  ? 842  VAL A CG2   1 
ATOM   6564  N  N     . LYS A 1  843  ? 112.397 56.145  -14.093 1.00 59.51  ? 843  LYS A N     1 
ATOM   6565  C  CA    . LYS A 1  843  ? 112.038 56.163  -15.482 1.00 59.45  ? 843  LYS A CA    1 
ATOM   6566  C  C     . LYS A 1  843  ? 112.746 57.295  -16.223 1.00 62.26  ? 843  LYS A C     1 
ATOM   6567  O  O     . LYS A 1  843  ? 113.165 57.083  -17.358 1.00 60.24  ? 843  LYS A O     1 
ATOM   6568  C  CB    . LYS A 1  843  ? 110.510 56.153  -15.629 1.00 61.28  ? 843  LYS A CB    1 
ATOM   6569  C  CG    . LYS A 1  843  ? 109.943 54.739  -15.563 1.00 55.12  ? 843  LYS A CG    1 
ATOM   6570  C  CD    . LYS A 1  843  ? 110.366 53.904  -16.789 1.00 65.70  ? 843  LYS A CD    1 
ATOM   6571  C  CE    . LYS A 1  843  ? 110.003 52.450  -16.657 1.00 87.83  ? 843  LYS A CE    1 
ATOM   6572  N  NZ    . LYS A 1  843  ? 110.433 51.709  -17.857 1.00 102.40 ? 843  LYS A NZ    1 
ATOM   6573  N  N     . ALA A 1  844  ? 112.988 58.434  -15.534 1.00 60.69  ? 844  ALA A N     1 
ATOM   6574  C  CA    . ALA A 1  844  ? 113.681 59.603  -16.100 1.00 62.46  ? 844  ALA A CA    1 
ATOM   6575  C  C     . ALA A 1  844  ? 115.170 59.396  -16.270 1.00 68.71  ? 844  ALA A C     1 
ATOM   6576  O  O     . ALA A 1  844  ? 115.777 59.972  -17.191 1.00 68.75  ? 844  ALA A O     1 
ATOM   6577  C  CB    . ALA A 1  844  ? 113.439 60.844  -15.254 1.00 63.54  ? 844  ALA A CB    1 
ATOM   6578  N  N     . LEU A 1  845  ? 115.766 58.583  -15.373 1.00 65.02  ? 845  LEU A N     1 
ATOM   6579  C  CA    . LEU A 1  845  ? 117.208 58.377  -15.377 1.00 63.35  ? 845  LEU A CA    1 
ATOM   6580  C  C     . LEU A 1  845  ? 117.728 57.038  -15.874 1.00 68.17  ? 845  LEU A C     1 
ATOM   6581  O  O     . LEU A 1  845  ? 118.891 57.000  -16.257 1.00 68.83  ? 845  LEU A O     1 
ATOM   6582  C  CB    . LEU A 1  845  ? 117.855 58.779  -14.029 1.00 61.97  ? 845  LEU A CB    1 
ATOM   6583  C  CG    . LEU A 1  845  ? 117.433 60.101  -13.356 1.00 64.64  ? 845  LEU A CG    1 
ATOM   6584  C  CD1   . LEU A 1  845  ? 118.332 60.408  -12.210 1.00 64.46  ? 845  LEU A CD1   1 
ATOM   6585  C  CD2   . LEU A 1  845  ? 117.428 61.281  -14.309 1.00 64.21  ? 845  LEU A CD2   1 
ATOM   6586  N  N     . GLU A 1  846  ? 116.898 55.968  -15.912 1.00 64.82  ? 846  GLU A N     1 
ATOM   6587  C  CA    . GLU A 1  846  ? 117.320 54.601  -16.278 1.00 65.42  ? 846  GLU A CA    1 
ATOM   6588  C  C     . GLU A 1  846  ? 118.547 54.399  -17.200 1.00 69.36  ? 846  GLU A C     1 
ATOM   6589  O  O     . GLU A 1  846  ? 119.589 53.911  -16.717 1.00 68.27  ? 846  GLU A O     1 
ATOM   6590  C  CB    . GLU A 1  846  ? 116.144 53.674  -16.627 1.00 67.16  ? 846  GLU A CB    1 
ATOM   6591  C  CG    . GLU A 1  846  ? 115.440 53.932  -17.956 1.00 84.25  ? 846  GLU A CG    1 
ATOM   6592  C  CD    . GLU A 1  846  ? 114.033 53.366  -18.070 1.00 111.20 ? 846  GLU A CD    1 
ATOM   6593  O  OE1   . GLU A 1  846  ? 113.535 52.764  -17.089 1.00 106.03 ? 846  GLU A OE1   1 
ATOM   6594  O  OE2   . GLU A 1  846  ? 113.415 53.549  -19.143 1.00 106.11 ? 846  GLU A OE2   1 
ATOM   6595  N  N     . ASP A 1  847  ? 118.439 54.849  -18.482 1.00 66.37  ? 847  ASP A N     1 
ATOM   6596  C  CA    . ASP A 1  847  ? 119.449 54.757  -19.556 1.00 66.99  ? 847  ASP A CA    1 
ATOM   6597  C  C     . ASP A 1  847  ? 120.805 55.475  -19.349 1.00 71.10  ? 847  ASP A C     1 
ATOM   6598  O  O     . ASP A 1  847  ? 121.705 55.343  -20.199 1.00 71.74  ? 847  ASP A O     1 
ATOM   6599  C  CB    . ASP A 1  847  ? 118.847 55.197  -20.898 1.00 69.78  ? 847  ASP A CB    1 
ATOM   6600  C  CG    . ASP A 1  847  ? 118.492 56.678  -20.985 1.00 84.32  ? 847  ASP A CG    1 
ATOM   6601  O  OD1   . ASP A 1  847  ? 118.169 57.281  -19.923 1.00 88.27  ? 847  ASP A OD1   1 
ATOM   6602  O  OD2   . ASP A 1  847  ? 118.470 57.221  -22.120 1.00 84.49  ? 847  ASP A OD2   1 
ATOM   6603  N  N     . ILE A 1  848  ? 120.950 56.245  -18.260 1.00 66.78  ? 848  ILE A N     1 
ATOM   6604  C  CA    . ILE A 1  848  ? 122.199 56.955  -17.981 1.00 66.40  ? 848  ILE A CA    1 
ATOM   6605  C  C     . ILE A 1  848  ? 123.205 56.012  -17.345 1.00 69.60  ? 848  ILE A C     1 
ATOM   6606  O  O     . ILE A 1  848  ? 122.845 55.261  -16.423 1.00 69.84  ? 848  ILE A O     1 
ATOM   6607  C  CB    . ILE A 1  848  ? 121.990 58.245  -17.158 1.00 69.49  ? 848  ILE A CB    1 
ATOM   6608  C  CG1   . ILE A 1  848  ? 121.029 59.195  -17.880 1.00 70.29  ? 848  ILE A CG1   1 
ATOM   6609  C  CG2   . ILE A 1  848  ? 123.314 58.936  -16.926 1.00 70.29  ? 848  ILE A CG2   1 
ATOM   6610  C  CD1   . ILE A 1  848  ? 120.182 59.977  -16.998 1.00 79.20  ? 848  ILE A CD1   1 
ATOM   6611  N  N     . MET A 1  849  ? 124.449 56.021  -17.895 1.00 64.62  ? 849  MET A N     1 
ATOM   6612  C  CA    . MET A 1  849  ? 125.621 55.258  -17.449 1.00 63.24  ? 849  MET A CA    1 
ATOM   6613  C  C     . MET A 1  849  ? 126.935 55.904  -17.883 1.00 67.73  ? 849  MET A C     1 
ATOM   6614  O  O     . MET A 1  849  ? 126.952 56.761  -18.780 1.00 69.16  ? 849  MET A O     1 
ATOM   6615  C  CB    . MET A 1  849  ? 125.567 53.773  -17.842 1.00 64.45  ? 849  MET A CB    1 
ATOM   6616  C  CG    . MET A 1  849  ? 126.174 53.447  -19.182 1.00 67.91  ? 849  MET A CG    1 
ATOM   6617  S  SD    . MET A 1  849  ? 126.647 51.699  -19.277 1.00 71.32  ? 849  MET A SD    1 
ATOM   6618  C  CE    . MET A 1  849  ? 127.767 51.779  -20.578 1.00 68.24  ? 849  MET A CE    1 
ATOM   6619  N  N     . VAL A 1  850  ? 128.029 55.487  -17.238 1.00 61.80  ? 850  VAL A N     1 
ATOM   6620  C  CA    . VAL A 1  850  ? 129.349 55.990  -17.521 1.00 61.86  ? 850  VAL A CA    1 
ATOM   6621  C  C     . VAL A 1  850  ? 129.896 55.181  -18.669 1.00 67.73  ? 850  VAL A C     1 
ATOM   6622  O  O     . VAL A 1  850  ? 129.899 53.959  -18.569 1.00 66.35  ? 850  VAL A O     1 
ATOM   6623  C  CB    . VAL A 1  850  ? 130.242 55.867  -16.268 1.00 65.99  ? 850  VAL A CB    1 
ATOM   6624  C  CG1   . VAL A 1  850  ? 131.674 56.296  -16.572 1.00 67.32  ? 850  VAL A CG1   1 
ATOM   6625  C  CG2   . VAL A 1  850  ? 129.684 56.666  -15.105 1.00 65.35  ? 850  VAL A CG2   1 
ATOM   6626  N  N     . HIS A 1  851  ? 130.339 55.833  -19.764 1.00 68.77  ? 851  HIS A N     1 
ATOM   6627  C  CA    . HIS A 1  851  ? 130.942 55.104  -20.895 1.00 70.79  ? 851  HIS A CA    1 
ATOM   6628  C  C     . HIS A 1  851  ? 132.429 55.055  -20.739 1.00 78.27  ? 851  HIS A C     1 
ATOM   6629  O  O     . HIS A 1  851  ? 132.964 55.686  -19.810 1.00 77.87  ? 851  HIS A O     1 
ATOM   6630  C  CB    . HIS A 1  851  ? 130.531 55.622  -22.271 1.00 72.34  ? 851  HIS A CB    1 
ATOM   6631  C  CG    . HIS A 1  851  ? 129.073 55.461  -22.508 1.00 76.34  ? 851  HIS A CG    1 
ATOM   6632  N  ND1   . HIS A 1  851  ? 128.143 56.293  -21.886 1.00 78.76  ? 851  HIS A ND1   1 
ATOM   6633  C  CD2   . HIS A 1  851  ? 128.416 54.541  -23.244 1.00 78.37  ? 851  HIS A CD2   1 
ATOM   6634  C  CE1   . HIS A 1  851  ? 126.955 55.862  -22.281 1.00 78.13  ? 851  HIS A CE1   1 
ATOM   6635  N  NE2   . HIS A 1  851  ? 127.067 54.819  -23.109 1.00 78.37  ? 851  HIS A NE2   1 
ATOM   6636  N  N     . TYR A 1  852  ? 133.106 54.281  -21.630 1.00 76.34  ? 852  TYR A N     1 
ATOM   6637  C  CA    . TYR A 1  852  ? 134.557 54.059  -21.562 1.00 75.99  ? 852  TYR A CA    1 
ATOM   6638  C  C     . TYR A 1  852  ? 135.463 55.301  -21.719 1.00 79.38  ? 852  TYR A C     1 
ATOM   6639  O  O     . TYR A 1  852  ? 136.685 55.174  -21.610 1.00 80.33  ? 852  TYR A O     1 
ATOM   6640  C  CB    . TYR A 1  852  ? 134.984 52.845  -22.402 1.00 76.27  ? 852  TYR A CB    1 
ATOM   6641  C  CG    . TYR A 1  852  ? 134.699 51.511  -21.741 1.00 76.10  ? 852  TYR A CG    1 
ATOM   6642  C  CD1   . TYR A 1  852  ? 135.580 50.970  -20.814 1.00 77.80  ? 852  TYR A CD1   1 
ATOM   6643  C  CD2   . TYR A 1  852  ? 133.599 50.747  -22.115 1.00 76.39  ? 852  TYR A CD2   1 
ATOM   6644  C  CE1   . TYR A 1  852  ? 135.342 49.732  -20.222 1.00 77.49  ? 852  TYR A CE1   1 
ATOM   6645  C  CE2   . TYR A 1  852  ? 133.379 49.482  -21.570 1.00 76.97  ? 852  TYR A CE2   1 
ATOM   6646  C  CZ    . TYR A 1  852  ? 134.249 48.982  -20.612 1.00 85.28  ? 852  TYR A CZ    1 
ATOM   6647  O  OH    . TYR A 1  852  ? 134.010 47.772  -19.998 1.00 87.26  ? 852  TYR A OH    1 
ATOM   6648  N  N     . ASP A 1  853  ? 134.846 56.497  -21.884 1.00 73.98  ? 853  ASP A N     1 
ATOM   6649  C  CA    . ASP A 1  853  ? 135.487 57.804  -21.994 1.00 74.81  ? 853  ASP A CA    1 
ATOM   6650  C  C     . ASP A 1  853  ? 135.204 58.666  -20.731 1.00 80.55  ? 853  ASP A C     1 
ATOM   6651  O  O     . ASP A 1  853  ? 135.239 59.912  -20.774 1.00 81.11  ? 853  ASP A O     1 
ATOM   6652  C  CB    . ASP A 1  853  ? 135.010 58.513  -23.281 1.00 77.08  ? 853  ASP A CB    1 
ATOM   6653  C  CG    . ASP A 1  853  ? 133.529 58.823  -23.338 1.00 85.09  ? 853  ASP A CG    1 
ATOM   6654  O  OD1   . ASP A 1  853  ? 132.773 58.218  -22.566 1.00 89.01  ? 853  ASP A OD1   1 
ATOM   6655  O  OD2   . ASP A 1  853  ? 133.125 59.668  -24.172 1.00 82.93  ? 853  ASP A OD2   1 
ATOM   6656  N  N     . ASN A 1  854  ? 134.878 57.982  -19.616 1.00 77.31  ? 854  ASN A N     1 
ATOM   6657  C  CA    . ASN A 1  854  ? 134.545 58.570  -18.313 1.00 77.86  ? 854  ASN A CA    1 
ATOM   6658  C  C     . ASN A 1  854  ? 133.379 59.578  -18.322 1.00 82.72  ? 854  ASN A C     1 
ATOM   6659  O  O     . ASN A 1  854  ? 133.039 60.184  -17.293 1.00 83.03  ? 854  ASN A O     1 
ATOM   6660  C  CB    . ASN A 1  854  ? 135.793 59.096  -17.611 1.00 80.93  ? 854  ASN A CB    1 
ATOM   6661  C  CG    . ASN A 1  854  ? 136.446 58.021  -16.789 1.00 112.46 ? 854  ASN A CG    1 
ATOM   6662  O  OD1   . ASN A 1  854  ? 137.412 57.395  -17.238 1.00 113.20 ? 854  ASN A OD1   1 
ATOM   6663  N  ND2   . ASN A 1  854  ? 135.874 57.720  -15.602 1.00 101.11 ? 854  ASN A ND2   1 
ATOM   6664  N  N     . THR A 1  855  ? 132.749 59.699  -19.496 1.00 78.33  ? 855  THR A N     1 
ATOM   6665  C  CA    . THR A 1  855  ? 131.630 60.564  -19.808 1.00 77.19  ? 855  THR A CA    1 
ATOM   6666  C  C     . THR A 1  855  ? 130.336 59.912  -19.361 1.00 78.03  ? 855  THR A C     1 
ATOM   6667  O  O     . THR A 1  855  ? 130.247 58.685  -19.382 1.00 77.47  ? 855  THR A O     1 
ATOM   6668  C  CB    . THR A 1  855  ? 131.693 60.869  -21.302 1.00 84.87  ? 855  THR A CB    1 
ATOM   6669  O  OG1   . THR A 1  855  ? 131.630 62.262  -21.506 1.00 92.21  ? 855  THR A OG1   1 
ATOM   6670  C  CG2   . THR A 1  855  ? 130.631 60.190  -22.094 1.00 78.85  ? 855  THR A CG2   1 
ATOM   6671  N  N     . THR A 1  856  ? 129.339 60.729  -18.972 1.00 72.72  ? 856  THR A N     1 
ATOM   6672  C  CA    . THR A 1  856  ? 128.010 60.281  -18.536 1.00 71.16  ? 856  THR A CA    1 
ATOM   6673  C  C     . THR A 1  856  ? 127.007 60.564  -19.653 1.00 76.14  ? 856  THR A C     1 
ATOM   6674  O  O     . THR A 1  856  ? 126.804 61.725  -20.043 1.00 76.67  ? 856  THR A O     1 
ATOM   6675  C  CB    . THR A 1  856  ? 127.674 60.947  -17.219 1.00 73.77  ? 856  THR A CB    1 
ATOM   6676  O  OG1   . THR A 1  856  ? 128.391 60.294  -16.180 1.00 69.11  ? 856  THR A OG1   1 
ATOM   6677  C  CG2   . THR A 1  856  ? 126.214 60.942  -16.923 1.00 73.51  ? 856  THR A CG2   1 
ATOM   6678  N  N     . ARG A 1  857  ? 126.418 59.506  -20.210 1.00 72.37  ? 857  ARG A N     1 
ATOM   6679  C  CA    . ARG A 1  857  ? 125.514 59.690  -21.347 1.00 72.43  ? 857  ARG A CA    1 
ATOM   6680  C  C     . ARG A 1  857  ? 124.231 58.875  -21.265 1.00 76.31  ? 857  ARG A C     1 
ATOM   6681  O  O     . ARG A 1  857  ? 124.202 57.794  -20.661 1.00 76.80  ? 857  ARG A O     1 
ATOM   6682  C  CB    . ARG A 1  857  ? 126.230 59.338  -22.668 1.00 71.27  ? 857  ARG A CB    1 
ATOM   6683  C  CG    . ARG A 1  857  ? 127.410 60.206  -23.075 1.00 71.87  ? 857  ARG A CG    1 
ATOM   6684  C  CD    . ARG A 1  857  ? 127.938 59.747  -24.417 1.00 68.17  ? 857  ARG A CD    1 
ATOM   6685  N  NE    . ARG A 1  857  ? 129.285 60.226  -24.706 1.00 71.12  ? 857  ARG A NE    1 
ATOM   6686  C  CZ    . ARG A 1  857  ? 129.739 60.537  -25.917 1.00 90.77  ? 857  ARG A CZ    1 
ATOM   6687  N  NH1   . ARG A 1  857  ? 128.951 60.426  -26.980 1.00 77.27  ? 857  ARG A NH1   1 
ATOM   6688  N  NH2   . ARG A 1  857  ? 130.995 60.920  -26.082 1.00 84.84  ? 857  ARG A NH2   1 
ATOM   6689  N  N     . ASN A 1  858  ? 123.200 59.345  -21.960 1.00 71.23  ? 858  ASN A N     1 
ATOM   6690  C  CA    . ASN A 1  858  ? 121.964 58.604  -22.001 1.00 71.17  ? 858  ASN A CA    1 
ATOM   6691  C  C     . ASN A 1  858  ? 121.948 57.600  -23.195 1.00 77.65  ? 858  ASN A C     1 
ATOM   6692  O  O     . ASN A 1  858  ? 123.023 57.298  -23.742 1.00 78.39  ? 858  ASN A O     1 
ATOM   6693  C  CB    . ASN A 1  858  ? 120.781 59.565  -21.968 1.00 72.24  ? 858  ASN A CB    1 
ATOM   6694  C  CG    . ASN A 1  858  ? 120.480 60.334  -23.226 1.00 87.73  ? 858  ASN A CG    1 
ATOM   6695  O  OD1   . ASN A 1  858  ? 121.170 60.258  -24.247 1.00 71.36  ? 858  ASN A OD1   1 
ATOM   6696  N  ND2   . ASN A 1  858  ? 119.395 61.077  -23.172 1.00 85.49  ? 858  ASN A ND2   1 
ATOM   6697  N  N     . SER A 1  859  ? 120.745 57.082  -23.588 1.00 74.04  ? 859  SER A N     1 
ATOM   6698  C  CA    . SER A 1  859  ? 120.558 56.136  -24.699 1.00 74.18  ? 859  SER A CA    1 
ATOM   6699  C  C     . SER A 1  859  ? 120.638 56.782  -26.111 1.00 80.22  ? 859  SER A C     1 
ATOM   6700  O  O     . SER A 1  859  ? 120.488 56.099  -27.141 1.00 80.81  ? 859  SER A O     1 
ATOM   6701  C  CB    . SER A 1  859  ? 119.258 55.361  -24.530 1.00 78.74  ? 859  SER A CB    1 
ATOM   6702  O  OG    . SER A 1  859  ? 118.106 56.147  -24.803 1.00 93.86  ? 859  SER A OG    1 
ATOM   6703  N  N     . LEU A 1  860  ? 120.871 58.096  -26.148 1.00 77.21  ? 860  LEU A N     1 
ATOM   6704  C  CA    . LEU A 1  860  ? 121.033 58.849  -27.386 1.00 77.68  ? 860  LEU A CA    1 
ATOM   6705  C  C     . LEU A 1  860  ? 122.487 59.285  -27.463 1.00 79.85  ? 860  LEU A C     1 
ATOM   6706  O  O     . LEU A 1  860  ? 122.883 59.982  -28.413 1.00 80.71  ? 860  LEU A O     1 
ATOM   6707  C  CB    . LEU A 1  860  ? 120.126 60.084  -27.373 1.00 78.63  ? 860  LEU A CB    1 
ATOM   6708  C  CG    . LEU A 1  860  ? 118.645 59.841  -27.551 1.00 84.22  ? 860  LEU A CG    1 
ATOM   6709  C  CD1   . LEU A 1  860  ? 117.854 60.893  -26.824 1.00 85.26  ? 860  LEU A CD1   1 
ATOM   6710  C  CD2   . LEU A 1  860  ? 118.268 59.825  -29.025 1.00 88.66  ? 860  LEU A CD2   1 
ATOM   6711  N  N     . GLY A 1  861  ? 123.252 58.898  -26.435 1.00 73.18  ? 861  GLY A N     1 
ATOM   6712  C  CA    . GLY A 1  861  ? 124.657 59.245  -26.287 1.00 72.18  ? 861  GLY A CA    1 
ATOM   6713  C  C     . GLY A 1  861  ? 124.872 60.727  -26.067 1.00 74.46  ? 861  GLY A C     1 
ATOM   6714  O  O     . GLY A 1  861  ? 125.984 61.227  -26.238 1.00 74.94  ? 861  GLY A O     1 
ATOM   6715  N  N     . ASN A 1  862  ? 123.808 61.450  -25.713 1.00 69.37  ? 862  ASN A N     1 
ATOM   6716  C  CA    . ASN A 1  862  ? 123.909 62.868  -25.435 1.00 69.16  ? 862  ASN A CA    1 
ATOM   6717  C  C     . ASN A 1  862  ? 124.615 62.986  -24.100 1.00 71.86  ? 862  ASN A C     1 
ATOM   6718  O  O     . ASN A 1  862  ? 124.369 62.189  -23.186 1.00 71.30  ? 862  ASN A O     1 
ATOM   6719  C  CB    . ASN A 1  862  ? 122.529 63.543  -25.409 1.00 70.18  ? 862  ASN A CB    1 
ATOM   6720  C  CG    . ASN A 1  862  ? 121.688 63.334  -26.652 1.00 99.72  ? 862  ASN A CG    1 
ATOM   6721  O  OD1   . ASN A 1  862  ? 122.175 63.175  -27.784 1.00 94.81  ? 862  ASN A OD1   1 
ATOM   6722  N  ND2   . ASN A 1  862  ? 120.387 63.340  -26.459 1.00 95.55  ? 862  ASN A ND2   1 
ATOM   6723  N  N     . VAL A 1  863  ? 125.566 63.901  -24.019 1.00 67.75  ? 863  VAL A N     1 
ATOM   6724  C  CA    . VAL A 1  863  ? 126.322 64.079  -22.788 1.00 66.96  ? 863  VAL A CA    1 
ATOM   6725  C  C     . VAL A 1  863  ? 125.439 64.730  -21.719 1.00 72.39  ? 863  VAL A C     1 
ATOM   6726  O  O     . VAL A 1  863  ? 124.790 65.763  -21.984 1.00 72.64  ? 863  VAL A O     1 
ATOM   6727  C  CB    . VAL A 1  863  ? 127.685 64.808  -23.027 1.00 69.81  ? 863  VAL A CB    1 
ATOM   6728  C  CG1   . VAL A 1  863  ? 128.380 65.178  -21.723 1.00 68.96  ? 863  VAL A CG1   1 
ATOM   6729  C  CG2   . VAL A 1  863  ? 128.605 63.955  -23.885 1.00 69.38  ? 863  VAL A CG2   1 
ATOM   6730  N  N     . ILE A 1  864  ? 125.355 64.069  -20.540 1.00 68.39  ? 864  ILE A N     1 
ATOM   6731  C  CA    . ILE A 1  864  ? 124.678 64.664  -19.396 1.00 68.11  ? 864  ILE A CA    1 
ATOM   6732  C  C     . ILE A 1  864  ? 125.773 65.373  -18.628 1.00 73.43  ? 864  ILE A C     1 
ATOM   6733  O  O     . ILE A 1  864  ? 125.791 66.604  -18.620 1.00 74.80  ? 864  ILE A O     1 
ATOM   6734  C  CB    . ILE A 1  864  ? 123.786 63.734  -18.553 1.00 69.84  ? 864  ILE A CB    1 
ATOM   6735  C  CG1   . ILE A 1  864  ? 122.442 63.549  -19.254 1.00 70.42  ? 864  ILE A CG1   1 
ATOM   6736  C  CG2   . ILE A 1  864  ? 123.523 64.360  -17.184 1.00 69.97  ? 864  ILE A CG2   1 
ATOM   6737  C  CD1   . ILE A 1  864  ? 122.426 62.626  -20.461 1.00 84.59  ? 864  ILE A CD1   1 
ATOM   6738  N  N     . GLN A 1  865  ? 126.733 64.602  -18.087 1.00 68.65  ? 865  GLN A N     1 
ATOM   6739  C  CA    . GLN A 1  865  ? 127.909 65.098  -17.378 1.00 68.75  ? 865  GLN A CA    1 
ATOM   6740  C  C     . GLN A 1  865  ? 129.140 64.707  -18.209 1.00 74.08  ? 865  GLN A C     1 
ATOM   6741  O  O     . GLN A 1  865  ? 129.167 63.612  -18.800 1.00 73.45  ? 865  GLN A O     1 
ATOM   6742  C  CB    . GLN A 1  865  ? 128.017 64.467  -15.976 1.00 69.31  ? 865  GLN A CB    1 
ATOM   6743  C  CG    . GLN A 1  865  ? 126.905 64.830  -14.992 1.00 80.10  ? 865  GLN A CG    1 
ATOM   6744  C  CD    . GLN A 1  865  ? 127.106 64.170  -13.646 1.00 95.42  ? 865  GLN A CD    1 
ATOM   6745  O  OE1   . GLN A 1  865  ? 127.699 63.087  -13.538 1.00 90.45  ? 865  GLN A OE1   1 
ATOM   6746  N  NE2   . GLN A 1  865  ? 126.586 64.791  -12.587 1.00 81.43  ? 865  GLN A NE2   1 
ATOM   6747  N  N     . PHE A 1  866  ? 130.157 65.596  -18.267 1.00 70.80  ? 866  PHE A N     1 
ATOM   6748  C  CA    . PHE A 1  866  ? 131.376 65.297  -19.011 1.00 69.92  ? 866  PHE A CA    1 
ATOM   6749  C  C     . PHE A 1  866  ? 132.194 64.273  -18.295 1.00 77.62  ? 866  PHE A C     1 
ATOM   6750  O  O     . PHE A 1  866  ? 132.826 63.411  -18.924 1.00 78.99  ? 866  PHE A O     1 
ATOM   6751  C  CB    . PHE A 1  866  ? 132.162 66.550  -19.333 1.00 71.09  ? 866  PHE A CB    1 
ATOM   6752  C  CG    . PHE A 1  866  ? 131.547 67.217  -20.536 1.00 72.14  ? 866  PHE A CG    1 
ATOM   6753  C  CD1   . PHE A 1  866  ? 131.865 66.793  -21.823 1.00 73.51  ? 866  PHE A CD1   1 
ATOM   6754  C  CD2   . PHE A 1  866  ? 130.610 68.238  -20.385 1.00 75.47  ? 866  PHE A CD2   1 
ATOM   6755  C  CE1   . PHE A 1  866  ? 131.274 67.390  -22.936 1.00 76.84  ? 866  PHE A CE1   1 
ATOM   6756  C  CE2   . PHE A 1  866  ? 130.022 68.841  -21.502 1.00 76.57  ? 866  PHE A CE2   1 
ATOM   6757  C  CZ    . PHE A 1  866  ? 130.347 68.402  -22.769 1.00 75.55  ? 866  PHE A CZ    1 
ATOM   6758  N  N     . ILE A 1  867  ? 132.152 64.345  -16.967 1.00 74.49  ? 867  ILE A N     1 
ATOM   6759  C  CA    . ILE A 1  867  ? 132.834 63.431  -16.064 1.00 74.13  ? 867  ILE A CA    1 
ATOM   6760  C  C     . ILE A 1  867  ? 131.819 63.204  -14.946 1.00 77.65  ? 867  ILE A C     1 
ATOM   6761  O  O     . ILE A 1  867  ? 131.107 64.147  -14.567 1.00 75.67  ? 867  ILE A O     1 
ATOM   6762  C  CB    . ILE A 1  867  ? 134.230 64.032  -15.663 1.00 77.89  ? 867  ILE A CB    1 
ATOM   6763  C  CG1   . ILE A 1  867  ? 135.305 63.729  -16.764 1.00 80.18  ? 867  ILE A CG1   1 
ATOM   6764  C  CG2   . ILE A 1  867  ? 134.733 63.616  -14.305 1.00 75.48  ? 867  ILE A CG2   1 
ATOM   6765  C  CD1   . ILE A 1  867  ? 135.567 64.980  -18.113 1.00 91.73  ? 867  ILE A CD1   1 
ATOM   6766  N  N     . TYR A 1  868  ? 131.663 61.927  -14.513 1.00 74.89  ? 868  TYR A N     1 
ATOM   6767  C  CA    . TYR A 1  868  ? 130.690 61.562  -13.480 1.00 74.13  ? 868  TYR A CA    1 
ATOM   6768  C  C     . TYR A 1  868  ? 130.917 62.273  -12.162 1.00 77.45  ? 868  TYR A C     1 
ATOM   6769  O  O     . TYR A 1  868  ? 132.028 62.277  -11.617 1.00 76.36  ? 868  TYR A O     1 
ATOM   6770  C  CB    . TYR A 1  868  ? 130.550 60.038  -13.304 1.00 74.75  ? 868  TYR A CB    1 
ATOM   6771  C  CG    . TYR A 1  868  ? 129.752 59.598  -12.085 1.00 75.93  ? 868  TYR A CG    1 
ATOM   6772  C  CD1   . TYR A 1  868  ? 128.406 59.913  -11.952 1.00 77.01  ? 868  TYR A CD1   1 
ATOM   6773  C  CD2   . TYR A 1  868  ? 130.332 58.820  -11.094 1.00 76.91  ? 868  TYR A CD2   1 
ATOM   6774  C  CE1   . TYR A 1  868  ? 127.689 59.548  -10.815 1.00 76.59  ? 868  TYR A CE1   1 
ATOM   6775  C  CE2   . TYR A 1  868  ? 129.600 58.382  -9.991  1.00 77.46  ? 868  TYR A CE2   1 
ATOM   6776  C  CZ    . TYR A 1  868  ? 128.279 58.748  -9.851  1.00 81.80  ? 868  TYR A CZ    1 
ATOM   6777  O  OH    . TYR A 1  868  ? 127.569 58.292  -8.763  1.00 81.38  ? 868  TYR A OH    1 
ATOM   6778  N  N     . GLY A 1  869  ? 129.845 62.891  -11.683 1.00 74.73  ? 869  GLY A N     1 
ATOM   6779  C  CA    . GLY A 1  869  ? 129.850 63.649  -10.443 1.00 75.56  ? 869  GLY A CA    1 
ATOM   6780  C  C     . GLY A 1  869  ? 130.934 64.711  -10.410 1.00 81.05  ? 869  GLY A C     1 
ATOM   6781  O  O     . GLY A 1  869  ? 131.488 64.975  -9.346  1.00 81.70  ? 869  GLY A O     1 
ATOM   6782  N  N     . GLU A 1  870  ? 131.278 65.285  -11.600 1.00 76.78  ? 870  GLU A N     1 
ATOM   6783  C  CA    . GLU A 1  870  ? 132.256 66.353  -11.823 1.00 76.61  ? 870  GLU A CA    1 
ATOM   6784  C  C     . GLU A 1  870  ? 133.728 65.991  -11.470 1.00 83.11  ? 870  GLU A C     1 
ATOM   6785  O  O     . GLU A 1  870  ? 134.635 66.785  -11.789 1.00 84.86  ? 870  GLU A O     1 
ATOM   6786  C  CB    . GLU A 1  870  ? 131.786 67.672  -11.169 1.00 77.61  ? 870  GLU A CB    1 
ATOM   6787  C  CG    . GLU A 1  870  ? 130.505 68.198  -11.778 1.00 84.87  ? 870  GLU A CG    1 
ATOM   6788  C  CD    . GLU A 1  870  ? 129.771 69.340  -11.103 1.00 111.68 ? 870  GLU A CD    1 
ATOM   6789  O  OE1   . GLU A 1  870  ? 130.421 70.276  -10.582 1.00 110.32 ? 870  GLU A OE1   1 
ATOM   6790  O  OE2   . GLU A 1  870  ? 128.522 69.339  -11.189 1.00 110.06 ? 870  GLU A OE2   1 
ATOM   6791  N  N     . ASP A 1  871  ? 133.964 64.783  -10.853 1.00 77.51  ? 871  ASP A N     1 
ATOM   6792  C  CA    . ASP A 1  871  ? 135.286 64.329  -10.413 1.00 76.88  ? 871  ASP A CA    1 
ATOM   6793  C  C     . ASP A 1  871  ? 135.768 62.982  -10.943 1.00 79.34  ? 871  ASP A C     1 
ATOM   6794  O  O     . ASP A 1  871  ? 136.957 62.686  -10.823 1.00 78.91  ? 871  ASP A O     1 
ATOM   6795  C  CB    . ASP A 1  871  ? 135.395 64.373  -8.878  1.00 78.99  ? 871  ASP A CB    1 
ATOM   6796  C  CG    . ASP A 1  871  ? 134.469 63.444  -8.102  1.00 86.56  ? 871  ASP A CG    1 
ATOM   6797  O  OD1   . ASP A 1  871  ? 134.002 62.436  -8.690  1.00 85.65  ? 871  ASP A OD1   1 
ATOM   6798  O  OD2   . ASP A 1  871  ? 134.255 63.695  -6.879  1.00 89.75  ? 871  ASP A OD2   1 
ATOM   6799  N  N     . GLY A 1  872  ? 134.838 62.158  -11.427 1.00 74.95  ? 872  GLY A N     1 
ATOM   6800  C  CA    . GLY A 1  872  ? 135.114 60.840  -12.003 1.00 73.52  ? 872  GLY A CA    1 
ATOM   6801  C  C     . GLY A 1  872  ? 135.233 59.700  -11.021 1.00 75.05  ? 872  GLY A C     1 
ATOM   6802  O  O     . GLY A 1  872  ? 135.503 58.571  -11.428 1.00 73.99  ? 872  GLY A O     1 
ATOM   6803  N  N     . MET A 1  873  ? 134.981 59.985  -9.740  1.00 71.30  ? 873  MET A N     1 
ATOM   6804  C  CA    . MET A 1  873  ? 135.072 59.055  -8.620  1.00 71.16  ? 873  MET A CA    1 
ATOM   6805  C  C     . MET A 1  873  ? 133.783 58.276  -8.288  1.00 75.88  ? 873  MET A C     1 
ATOM   6806  O  O     . MET A 1  873  ? 132.695 58.808  -8.497  1.00 74.47  ? 873  MET A O     1 
ATOM   6807  C  CB    . MET A 1  873  ? 135.492 59.859  -7.386  1.00 73.79  ? 873  MET A CB    1 
ATOM   6808  C  CG    . MET A 1  873  ? 136.759 59.371  -6.746  1.00 77.53  ? 873  MET A CG    1 
ATOM   6809  S  SD    . MET A 1  873  ? 138.160 59.306  -7.879  1.00 82.29  ? 873  MET A SD    1 
ATOM   6810  C  CE    . MET A 1  873  ? 138.346 61.095  -8.369  1.00 80.00  ? 873  MET A CE    1 
ATOM   6811  N  N     . ASP A 1  874  ? 133.915 57.036  -7.718  1.00 74.22  ? 874  ASP A N     1 
ATOM   6812  C  CA    . ASP A 1  874  ? 132.791 56.211  -7.227  1.00 74.83  ? 874  ASP A CA    1 
ATOM   6813  C  C     . ASP A 1  874  ? 132.481 56.621  -5.808  1.00 80.02  ? 874  ASP A C     1 
ATOM   6814  O  O     . ASP A 1  874  ? 133.344 56.521  -4.925  1.00 79.74  ? 874  ASP A O     1 
ATOM   6815  C  CB    . ASP A 1  874  ? 133.066 54.678  -7.285  1.00 77.27  ? 874  ASP A CB    1 
ATOM   6816  C  CG    . ASP A 1  874  ? 131.949 53.750  -6.751  1.00 91.08  ? 874  ASP A CG    1 
ATOM   6817  O  OD1   . ASP A 1  874  ? 130.744 54.152  -6.794  1.00 90.77  ? 874  ASP A OD1   1 
ATOM   6818  O  OD2   . ASP A 1  874  ? 132.268 52.602  -6.363  1.00 100.06 ? 874  ASP A OD2   1 
ATOM   6819  N  N     . ALA A 1  875  ? 131.222 57.054  -5.591  1.00 77.22  ? 875  ALA A N     1 
ATOM   6820  C  CA    . ALA A 1  875  ? 130.672 57.532  -4.318  1.00 76.64  ? 875  ALA A CA    1 
ATOM   6821  C  C     . ALA A 1  875  ? 131.032 56.707  -3.082  1.00 78.23  ? 875  ALA A C     1 
ATOM   6822  O  O     . ALA A 1  875  ? 131.278 57.314  -2.048  1.00 77.61  ? 875  ALA A O     1 
ATOM   6823  C  CB    . ALA A 1  875  ? 129.177 57.701  -4.432  1.00 76.96  ? 875  ALA A CB    1 
ATOM   6824  N  N     . ALA A 1  876  ? 131.137 55.358  -3.205  1.00 73.40  ? 876  ALA A N     1 
ATOM   6825  C  CA    . ALA A 1  876  ? 131.511 54.449  -2.123  1.00 73.72  ? 876  ALA A CA    1 
ATOM   6826  C  C     . ALA A 1  876  ? 132.931 54.694  -1.596  1.00 82.02  ? 876  ALA A C     1 
ATOM   6827  O  O     . ALA A 1  876  ? 133.190 54.586  -0.380  1.00 82.08  ? 876  ALA A O     1 
ATOM   6828  C  CB    . ALA A 1  876  ? 131.401 53.035  -2.601  1.00 73.67  ? 876  ALA A CB    1 
ATOM   6829  N  N     . HIS A 1  877  ? 133.841 55.065  -2.522  1.00 80.89  ? 877  HIS A N     1 
ATOM   6830  C  CA    . HIS A 1  877  ? 135.265 55.327  -2.265  1.00 81.92  ? 877  HIS A CA    1 
ATOM   6831  C  C     . HIS A 1  877  ? 135.620 56.725  -1.767  1.00 87.05  ? 877  HIS A C     1 
ATOM   6832  O  O     . HIS A 1  877  ? 136.809 57.069  -1.698  1.00 88.66  ? 877  HIS A O     1 
ATOM   6833  C  CB    . HIS A 1  877  ? 136.073 55.012  -3.512  1.00 82.70  ? 877  HIS A CB    1 
ATOM   6834  C  CG    . HIS A 1  877  ? 136.154 53.558  -3.799  1.00 85.49  ? 877  HIS A CG    1 
ATOM   6835  N  ND1   . HIS A 1  877  ? 135.071 52.867  -4.299  1.00 86.61  ? 877  HIS A ND1   1 
ATOM   6836  C  CD2   . HIS A 1  877  ? 137.190 52.711  -3.647  1.00 87.33  ? 877  HIS A CD2   1 
ATOM   6837  C  CE1   . HIS A 1  877  ? 135.475 51.620  -4.426  1.00 85.83  ? 877  HIS A CE1   1 
ATOM   6838  N  NE2   . HIS A 1  877  ? 136.748 51.483  -4.060  1.00 86.69  ? 877  HIS A NE2   1 
ATOM   6839  N  N     . ILE A 1  878  ? 134.605 57.503  -1.385  1.00 81.97  ? 878  ILE A N     1 
ATOM   6840  C  CA    . ILE A 1  878  ? 134.744 58.870  -0.902  1.00 81.42  ? 878  ILE A CA    1 
ATOM   6841  C  C     . ILE A 1  878  ? 134.431 58.936  0.608   1.00 85.53  ? 878  ILE A C     1 
ATOM   6842  O  O     . ILE A 1  878  ? 133.572 58.194  1.086   1.00 85.92  ? 878  ILE A O     1 
ATOM   6843  C  CB    . ILE A 1  878  ? 133.837 59.725  -1.804  1.00 83.70  ? 878  ILE A CB    1 
ATOM   6844  C  CG1   . ILE A 1  878  ? 134.524 59.959  -3.140  1.00 83.93  ? 878  ILE A CG1   1 
ATOM   6845  C  CG2   . ILE A 1  878  ? 133.423 61.022  -1.177  1.00 84.94  ? 878  ILE A CG2   1 
ATOM   6846  C  CD1   . ILE A 1  878  ? 133.634 59.797  -4.268  1.00 91.59  ? 878  ILE A CD1   1 
ATOM   6847  N  N     . GLU A 1  879  ? 135.200 59.752  1.362   1.00 81.00  ? 879  GLU A N     1 
ATOM   6848  C  CA    . GLU A 1  879  ? 135.066 59.951  2.815   1.00 80.23  ? 879  GLU A CA    1 
ATOM   6849  C  C     . GLU A 1  879  ? 135.272 61.430  3.141   1.00 82.59  ? 879  GLU A C     1 
ATOM   6850  O  O     . GLU A 1  879  ? 136.130 62.075  2.526   1.00 81.59  ? 879  GLU A O     1 
ATOM   6851  C  CB    . GLU A 1  879  ? 136.126 59.141  3.586   1.00 81.75  ? 879  GLU A CB    1 
ATOM   6852  C  CG    . GLU A 1  879  ? 136.184 57.663  3.253   1.00 90.47  ? 879  GLU A CG    1 
ATOM   6853  C  CD    . GLU A 1  879  ? 137.407 56.972  3.813   1.00 111.81 ? 879  GLU A CD    1 
ATOM   6854  O  OE1   . GLU A 1  879  ? 137.807 57.320  4.950   1.00 99.36  ? 879  GLU A OE1   1 
ATOM   6855  O  OE2   . GLU A 1  879  ? 137.974 56.096  3.115   1.00 107.92 ? 879  GLU A OE2   1 
ATOM   6856  N  N     . LYS A 1  880  ? 134.530 61.960  4.131   1.00 78.39  ? 880  LYS A N     1 
ATOM   6857  C  CA    . LYS A 1  880  ? 134.673 63.364  4.526   1.00 78.63  ? 880  LYS A CA    1 
ATOM   6858  C  C     . LYS A 1  880  ? 136.083 63.592  5.056   1.00 81.44  ? 880  LYS A C     1 
ATOM   6859  O  O     . LYS A 1  880  ? 136.540 62.830  5.894   1.00 81.10  ? 880  LYS A O     1 
ATOM   6860  C  CB    . LYS A 1  880  ? 133.600 63.761  5.559   1.00 81.94  ? 880  LYS A CB    1 
ATOM   6861  C  CG    . LYS A 1  880  ? 133.089 65.198  5.427   1.00 99.86  ? 880  LYS A CG    1 
ATOM   6862  C  CD    . LYS A 1  880  ? 131.709 65.398  6.111   1.00 115.73 ? 880  LYS A CD    1 
ATOM   6863  C  CE    . LYS A 1  880  ? 130.514 64.879  5.311   1.00 128.85 ? 880  LYS A CE    1 
ATOM   6864  N  NZ    . LYS A 1  880  ? 129.264 65.664  5.553   1.00 133.53 ? 880  LYS A NZ    1 
ATOM   6865  N  N     . GLN A 1  881  ? 136.807 64.550  4.475   1.00 78.04  ? 881  GLN A N     1 
ATOM   6866  C  CA    . GLN A 1  881  ? 138.182 64.904  4.851   1.00 78.45  ? 881  GLN A CA    1 
ATOM   6867  C  C     . GLN A 1  881  ? 138.242 66.403  5.108   1.00 86.33  ? 881  GLN A C     1 
ATOM   6868  O  O     . GLN A 1  881  ? 137.433 67.152  4.553   1.00 86.43  ? 881  GLN A O     1 
ATOM   6869  C  CB    . GLN A 1  881  ? 139.180 64.526  3.744   1.00 78.70  ? 881  GLN A CB    1 
ATOM   6870  C  CG    . GLN A 1  881  ? 139.161 63.048  3.428   1.00 78.94  ? 881  GLN A CG    1 
ATOM   6871  C  CD    . GLN A 1  881  ? 140.470 62.494  2.966   1.00 83.50  ? 881  GLN A CD    1 
ATOM   6872  O  OE1   . GLN A 1  881  ? 141.476 62.439  3.709   1.00 75.59  ? 881  GLN A OE1   1 
ATOM   6873  N  NE2   . GLN A 1  881  ? 140.431 61.958  1.763   1.00 69.30  ? 881  GLN A NE2   1 
ATOM   6874  N  N     . SER A 1  882  ? 139.175 66.844  5.961   1.00 84.86  ? 882  SER A N     1 
ATOM   6875  C  CA    . SER A 1  882  ? 139.326 68.258  6.271   1.00 85.78  ? 882  SER A CA    1 
ATOM   6876  C  C     . SER A 1  882  ? 140.418 68.837  5.418   1.00 91.72  ? 882  SER A C     1 
ATOM   6877  O  O     . SER A 1  882  ? 141.530 68.301  5.405   1.00 91.60  ? 882  SER A O     1 
ATOM   6878  C  CB    . SER A 1  882  ? 139.676 68.452  7.740   1.00 90.63  ? 882  SER A CB    1 
ATOM   6879  O  OG    . SER A 1  882  ? 139.986 69.806  8.020   1.00 102.46 ? 882  SER A OG    1 
ATOM   6880  N  N     . LEU A 1  883  ? 140.097 69.929  4.696   1.00 89.86  ? 883  LEU A N     1 
ATOM   6881  C  CA    . LEU A 1  883  ? 141.043 70.680  3.865   1.00 90.82  ? 883  LEU A CA    1 
ATOM   6882  C  C     . LEU A 1  883  ? 141.658 71.727  4.818   1.00 100.41 ? 883  LEU A C     1 
ATOM   6883  O  O     . LEU A 1  883  ? 141.132 72.842  4.950   1.00 101.15 ? 883  LEU A O     1 
ATOM   6884  C  CB    . LEU A 1  883  ? 140.311 71.343  2.683   1.00 89.81  ? 883  LEU A CB    1 
ATOM   6885  C  CG    . LEU A 1  883  ? 139.602 70.418  1.705   1.00 92.19  ? 883  LEU A CG    1 
ATOM   6886  C  CD1   . LEU A 1  883  ? 138.368 71.064  1.168   1.00 91.87  ? 883  LEU A CD1   1 
ATOM   6887  C  CD2   . LEU A 1  883  ? 140.493 70.042  0.550   1.00 93.67  ? 883  LEU A CD2   1 
ATOM   6888  N  N     . ASP A 1  884  ? 142.705 71.306  5.569   1.00 99.46  ? 884  ASP A N     1 
ATOM   6889  C  CA    . ASP A 1  884  ? 143.371 72.089  6.623   1.00 101.30 ? 884  ASP A CA    1 
ATOM   6890  C  C     . ASP A 1  884  ? 143.596 73.546  6.249   1.00 105.27 ? 884  ASP A C     1 
ATOM   6891  O  O     . ASP A 1  884  ? 143.057 74.436  6.919   1.00 105.68 ? 884  ASP A O     1 
ATOM   6892  C  CB    . ASP A 1  884  ? 144.668 71.412  7.090   1.00 104.08 ? 884  ASP A CB    1 
ATOM   6893  C  CG    . ASP A 1  884  ? 144.479 69.940  7.377   1.00 115.61 ? 884  ASP A CG    1 
ATOM   6894  O  OD1   . ASP A 1  884  ? 144.561 69.135  6.417   1.00 122.42 ? 884  ASP A OD1   1 
ATOM   6895  O  OD2   . ASP A 1  884  ? 144.189 69.595  8.549   1.00 116.03 ? 884  ASP A OD2   1 
ATOM   6896  N  N     . THR A 1  885  ? 144.301 73.753  5.115   1.00 99.79  ? 885  THR A N     1 
ATOM   6897  C  CA    . THR A 1  885  ? 144.662 75.004  4.465   1.00 99.49  ? 885  THR A CA    1 
ATOM   6898  C  C     . THR A 1  885  ? 143.597 76.134  4.577   1.00 103.58 ? 885  THR A C     1 
ATOM   6899  O  O     . THR A 1  885  ? 143.921 77.245  4.995   1.00 104.19 ? 885  THR A O     1 
ATOM   6900  C  CB    . THR A 1  885  ? 145.161 74.651  3.043   1.00 104.69 ? 885  THR A CB    1 
ATOM   6901  O  OG1   . THR A 1  885  ? 146.499 75.082  2.889   1.00 105.96 ? 885  THR A OG1   1 
ATOM   6902  C  CG2   . THR A 1  885  ? 144.315 75.215  1.919   1.00 103.12 ? 885  THR A CG2   1 
ATOM   6903  N  N     . ILE A 1  886  ? 142.328 75.805  4.270   1.00 98.95  ? 886  ILE A N     1 
ATOM   6904  C  CA    . ILE A 1  886  ? 141.153 76.677  4.214   1.00 98.51  ? 886  ILE A CA    1 
ATOM   6905  C  C     . ILE A 1  886  ? 140.930 77.673  5.365   1.00 102.95 ? 886  ILE A C     1 
ATOM   6906  O  O     . ILE A 1  886  ? 140.554 78.812  5.112   1.00 102.80 ? 886  ILE A O     1 
ATOM   6907  C  CB    . ILE A 1  886  ? 139.887 75.824  3.870   1.00 100.39 ? 886  ILE A CB    1 
ATOM   6908  C  CG1   . ILE A 1  886  ? 139.057 76.369  2.689   1.00 99.71  ? 886  ILE A CG1   1 
ATOM   6909  C  CG2   . ILE A 1  886  ? 139.043 75.434  5.082   1.00 101.96 ? 886  ILE A CG2   1 
ATOM   6910  C  CD1   . ILE A 1  886  ? 138.100 77.443  2.967   1.00 102.71 ? 886  ILE A CD1   1 
ATOM   6911  N  N     . GLY A 1  887  ? 141.128 77.244  6.602   1.00 100.34 ? 887  GLY A N     1 
ATOM   6912  C  CA    . GLY A 1  887  ? 140.834 78.108  7.736   1.00 101.52 ? 887  GLY A CA    1 
ATOM   6913  C  C     . GLY A 1  887  ? 141.965 78.526  8.646   1.00 107.65 ? 887  GLY A C     1 
ATOM   6914  O  O     . GLY A 1  887  ? 143.149 78.355  8.331   1.00 106.10 ? 887  GLY A O     1 
ATOM   6915  N  N     . GLY A 1  888  ? 141.559 79.095  9.780   1.00 107.32 ? 888  GLY A N     1 
ATOM   6916  C  CA    . GLY A 1  888  ? 142.455 79.596  10.813  1.00 109.28 ? 888  GLY A CA    1 
ATOM   6917  C  C     . GLY A 1  888  ? 143.017 80.951  10.461  1.00 115.73 ? 888  GLY A C     1 
ATOM   6918  O  O     . GLY A 1  888  ? 142.628 81.547  9.451   1.00 115.79 ? 888  GLY A O     1 
ATOM   6919  N  N     . SER A 1  889  ? 143.935 81.454  11.285  1.00 113.74 ? 889  SER A N     1 
ATOM   6920  C  CA    . SER A 1  889  ? 144.521 82.756  10.988  1.00 114.96 ? 889  SER A CA    1 
ATOM   6921  C  C     . SER A 1  889  ? 145.580 82.653  9.906   1.00 116.45 ? 889  SER A C     1 
ATOM   6922  O  O     . SER A 1  889  ? 146.244 81.617  9.782   1.00 114.30 ? 889  SER A O     1 
ATOM   6923  C  CB    . SER A 1  889  ? 145.102 83.398  12.243  1.00 121.68 ? 889  SER A CB    1 
ATOM   6924  O  OG    . SER A 1  889  ? 146.001 82.516  12.891  1.00 134.89 ? 889  SER A OG    1 
ATOM   6925  N  N     . ASP A 1  890  ? 145.751 83.753  9.136   1.00 112.89 ? 890  ASP A N     1 
ATOM   6926  C  CA    . ASP A 1  890  ? 146.775 83.887  8.096   1.00 112.33 ? 890  ASP A CA    1 
ATOM   6927  C  C     . ASP A 1  890  ? 148.129 83.677  8.797   1.00 114.75 ? 890  ASP A C     1 
ATOM   6928  O  O     . ASP A 1  890  ? 149.084 83.157  8.211   1.00 114.09 ? 890  ASP A O     1 
ATOM   6929  C  CB    . ASP A 1  890  ? 146.696 85.291  7.447   1.00 115.15 ? 890  ASP A CB    1 
ATOM   6930  C  CG    . ASP A 1  890  ? 145.854 85.391  6.173   1.00 128.05 ? 890  ASP A CG    1 
ATOM   6931  O  OD1   . ASP A 1  890  ? 146.208 84.722  5.164   1.00 129.03 ? 890  ASP A OD1   1 
ATOM   6932  O  OD2   . ASP A 1  890  ? 144.889 86.201  6.154   1.00 133.71 ? 890  ASP A OD2   1 
ATOM   6933  N  N     . ALA A 1  891  ? 148.142 84.011  10.099  1.00 110.26 ? 891  ALA A N     1 
ATOM   6934  C  CA    . ALA A 1  891  ? 149.249 83.904  11.035  1.00 110.10 ? 891  ALA A CA    1 
ATOM   6935  C  C     . ALA A 1  891  ? 149.632 82.459  11.336  1.00 110.24 ? 891  ALA A C     1 
ATOM   6936  O  O     . ALA A 1  891  ? 150.789 82.088  11.150  1.00 109.19 ? 891  ALA A O     1 
ATOM   6937  C  CB    . ALA A 1  891  ? 148.887 84.627  12.323  1.00 111.85 ? 891  ALA A CB    1 
ATOM   6938  N  N     . ALA A 1  892  ? 148.669 81.659  11.820  1.00 105.33 ? 892  ALA A N     1 
ATOM   6939  C  CA    . ALA A 1  892  ? 148.873 80.260  12.196  1.00 104.57 ? 892  ALA A CA    1 
ATOM   6940  C  C     . ALA A 1  892  ? 149.145 79.348  11.005  1.00 107.05 ? 892  ALA A C     1 
ATOM   6941  O  O     . ALA A 1  892  ? 149.797 78.303  11.171  1.00 106.26 ? 892  ALA A O     1 
ATOM   6942  C  CB    . ALA A 1  892  ? 147.685 79.754  12.983  1.00 104.86 ? 892  ALA A CB    1 
ATOM   6943  N  N     . PHE A 1  893  ? 148.642 79.751  9.807   1.00 102.25 ? 893  PHE A N     1 
ATOM   6944  C  CA    . PHE A 1  893  ? 148.852 79.063  8.530   1.00 100.52 ? 893  PHE A CA    1 
ATOM   6945  C  C     . PHE A 1  893  ? 150.370 79.020  8.272   1.00 104.53 ? 893  PHE A C     1 
ATOM   6946  O  O     . PHE A 1  893  ? 150.950 77.943  8.066   1.00 104.27 ? 893  PHE A O     1 
ATOM   6947  C  CB    . PHE A 1  893  ? 148.138 79.835  7.405   1.00 101.64 ? 893  PHE A CB    1 
ATOM   6948  C  CG    . PHE A 1  893  ? 148.451 79.373  6.001   1.00 102.24 ? 893  PHE A CG    1 
ATOM   6949  C  CD1   . PHE A 1  893  ? 149.551 79.876  5.313   1.00 105.22 ? 893  PHE A CD1   1 
ATOM   6950  C  CD2   . PHE A 1  893  ? 147.632 78.459  5.355   1.00 103.88 ? 893  PHE A CD2   1 
ATOM   6951  C  CE1   . PHE A 1  893  ? 149.846 79.442  4.018   1.00 107.50 ? 893  PHE A CE1   1 
ATOM   6952  C  CE2   . PHE A 1  893  ? 147.918 78.037  4.053   1.00 104.36 ? 893  PHE A CE2   1 
ATOM   6953  C  CZ    . PHE A 1  893  ? 149.027 78.525  3.397   1.00 104.34 ? 893  PHE A CZ    1 
ATOM   6954  N  N     . GLU A 1  894  ? 151.000 80.204  8.327   1.00 100.25 ? 894  GLU A N     1 
ATOM   6955  C  CA    . GLU A 1  894  ? 152.424 80.392  8.143   1.00 100.41 ? 894  GLU A CA    1 
ATOM   6956  C  C     . GLU A 1  894  ? 153.236 79.469  9.057   1.00 103.84 ? 894  GLU A C     1 
ATOM   6957  O  O     . GLU A 1  894  ? 154.128 78.786  8.559   1.00 103.48 ? 894  GLU A O     1 
ATOM   6958  C  CB    . GLU A 1  894  ? 152.770 81.854  8.397   1.00 103.11 ? 894  GLU A CB    1 
ATOM   6959  C  CG    . GLU A 1  894  ? 154.090 82.271  7.790   1.00 113.27 ? 894  GLU A CG    1 
ATOM   6960  C  CD    . GLU A 1  894  ? 154.336 83.761  7.848   1.00 132.55 ? 894  GLU A CD    1 
ATOM   6961  O  OE1   . GLU A 1  894  ? 153.408 84.532  7.514   1.00 119.68 ? 894  GLU A OE1   1 
ATOM   6962  O  OE2   . GLU A 1  894  ? 155.463 84.156  8.225   1.00 140.87 ? 894  GLU A OE2   1 
ATOM   6963  N  N     . LYS A 1  895  ? 152.904 79.417  10.374  1.00 100.36 ? 895  LYS A N     1 
ATOM   6964  C  CA    . LYS A 1  895  ? 153.592 78.561  11.351  1.00 100.65 ? 895  LYS A CA    1 
ATOM   6965  C  C     . LYS A 1  895  ? 153.539 77.094  10.913  1.00 105.00 ? 895  LYS A C     1 
ATOM   6966  O  O     . LYS A 1  895  ? 154.558 76.389  10.977  1.00 105.17 ? 895  LYS A O     1 
ATOM   6967  C  CB    . LYS A 1  895  ? 153.015 78.735  12.773  1.00 102.87 ? 895  LYS A CB    1 
ATOM   6968  C  CG    . LYS A 1  895  ? 153.806 77.994  13.871  1.00 113.70 ? 895  LYS A CG    1 
ATOM   6969  C  CD    . LYS A 1  895  ? 153.224 78.208  15.272  1.00 125.49 ? 895  LYS A CD    1 
ATOM   6970  C  CE    . LYS A 1  895  ? 154.174 77.795  16.379  1.00 139.53 ? 895  LYS A CE    1 
ATOM   6971  N  NZ    . LYS A 1  895  ? 154.060 78.670  17.588  1.00 149.57 ? 895  LYS A NZ    1 
ATOM   6972  N  N     . ARG A 1  896  ? 152.363 76.656  10.426  1.00 100.40 ? 896  ARG A N     1 
ATOM   6973  C  CA    . ARG A 1  896  ? 152.184 75.288  9.960   1.00 98.96  ? 896  ARG A CA    1 
ATOM   6974  C  C     . ARG A 1  896  ? 153.006 74.965  8.712   1.00 101.81 ? 896  ARG A C     1 
ATOM   6975  O  O     . ARG A 1  896  ? 153.782 74.004  8.733   1.00 100.94 ? 896  ARG A O     1 
ATOM   6976  C  CB    . ARG A 1  896  ? 150.695 74.970  9.705   1.00 96.62  ? 896  ARG A CB    1 
ATOM   6977  C  CG    . ARG A 1  896  ? 150.450 73.516  9.286   1.00 99.99  ? 896  ARG A CG    1 
ATOM   6978  C  CD    . ARG A 1  896  ? 148.996 73.166  9.380   1.00 106.26 ? 896  ARG A CD    1 
ATOM   6979  N  NE    . ARG A 1  896  ? 148.759 72.088  10.332  1.00 119.97 ? 896  ARG A NE    1 
ATOM   6980  C  CZ    . ARG A 1  896  ? 147.553 71.614  10.618  1.00 144.31 ? 896  ARG A CZ    1 
ATOM   6981  N  NH1   . ARG A 1  896  ? 146.476 72.117  10.024  1.00 138.41 ? 896  ARG A NH1   1 
ATOM   6982  N  NH2   . ARG A 1  896  ? 147.412 70.629  11.497  1.00 133.24 ? 896  ARG A NH2   1 
ATOM   6983  N  N     . TYR A 1  897  ? 152.810 75.758  7.634   1.00 97.10  ? 897  TYR A N     1 
ATOM   6984  C  CA    . TYR A 1  897  ? 153.364 75.499  6.313   1.00 96.04  ? 897  TYR A CA    1 
ATOM   6985  C  C     . TYR A 1  897  ? 154.745 75.993  5.943   1.00 100.52 ? 897  TYR A C     1 
ATOM   6986  O  O     . TYR A 1  897  ? 155.513 75.229  5.339   1.00 100.88 ? 897  TYR A O     1 
ATOM   6987  C  CB    . TYR A 1  897  ? 152.324 75.796  5.229   1.00 96.09  ? 897  TYR A CB    1 
ATOM   6988  C  CG    . TYR A 1  897  ? 151.079 74.954  5.408   1.00 97.43  ? 897  TYR A CG    1 
ATOM   6989  C  CD1   . TYR A 1  897  ? 151.054 73.612  5.019   1.00 98.43  ? 897  TYR A CD1   1 
ATOM   6990  C  CD2   . TYR A 1  897  ? 149.955 75.467  6.042   1.00 98.54  ? 897  TYR A CD2   1 
ATOM   6991  C  CE1   . TYR A 1  897  ? 149.921 72.820  5.218   1.00 97.93  ? 897  TYR A CE1   1 
ATOM   6992  C  CE2   . TYR A 1  897  ? 148.810 74.691  6.231   1.00 98.86  ? 897  TYR A CE2   1 
ATOM   6993  C  CZ    . TYR A 1  897  ? 148.796 73.367  5.820   1.00 105.48 ? 897  TYR A CZ    1 
ATOM   6994  O  OH    . TYR A 1  897  ? 147.652 72.623  6.023   1.00 104.54 ? 897  TYR A OH    1 
ATOM   6995  N  N     . ARG A 1  898  ? 155.059 77.253  6.282   1.00 96.19  ? 898  ARG A N     1 
ATOM   6996  C  CA    . ARG A 1  898  ? 156.315 77.903  5.923   1.00 95.60  ? 898  ARG A CA    1 
ATOM   6997  C  C     . ARG A 1  898  ? 157.588 77.313  6.447   1.00 98.18  ? 898  ARG A C     1 
ATOM   6998  O  O     . ARG A 1  898  ? 157.730 77.028  7.640   1.00 97.70  ? 898  ARG A O     1 
ATOM   6999  C  CB    . ARG A 1  898  ? 156.272 79.408  6.194   1.00 95.08  ? 898  ARG A CB    1 
ATOM   7000  C  CG    . ARG A 1  898  ? 157.473 80.173  5.664   1.00 104.98 ? 898  ARG A CG    1 
ATOM   7001  C  CD    . ARG A 1  898  ? 157.433 80.435  4.174   1.00 113.57 ? 898  ARG A CD    1 
ATOM   7002  N  NE    . ARG A 1  898  ? 158.100 81.705  3.892   1.00 122.43 ? 898  ARG A NE    1 
ATOM   7003  C  CZ    . ARG A 1  898  ? 159.142 81.849  3.085   1.00 133.76 ? 898  ARG A CZ    1 
ATOM   7004  N  NH1   . ARG A 1  898  ? 159.629 80.803  2.424   1.00 112.69 ? 898  ARG A NH1   1 
ATOM   7005  N  NH2   . ARG A 1  898  ? 159.694 83.046  2.912   1.00 125.12 ? 898  ARG A NH2   1 
ATOM   7006  N  N     . VAL A 1  899  ? 158.531 77.182  5.508   1.00 93.99  ? 899  VAL A N     1 
ATOM   7007  C  CA    . VAL A 1  899  ? 159.921 76.782  5.677   1.00 93.99  ? 899  VAL A CA    1 
ATOM   7008  C  C     . VAL A 1  899  ? 160.720 77.874  4.954   1.00 100.12 ? 899  VAL A C     1 
ATOM   7009  O  O     . VAL A 1  899  ? 160.420 78.180  3.788   1.00 99.96  ? 899  VAL A O     1 
ATOM   7010  C  CB    . VAL A 1  899  ? 160.204 75.368  5.126   1.00 95.64  ? 899  VAL A CB    1 
ATOM   7011  C  CG1   . VAL A 1  899  ? 161.699 75.113  4.978   1.00 95.97  ? 899  VAL A CG1   1 
ATOM   7012  C  CG2   . VAL A 1  899  ? 159.567 74.315  6.016   1.00 94.40  ? 899  VAL A CG2   1 
ATOM   7013  N  N     . ASP A 1  900  ? 161.674 78.508  5.680   1.00 97.52  ? 900  ASP A N     1 
ATOM   7014  C  CA    . ASP A 1  900  ? 162.536 79.587  5.188   1.00 98.45  ? 900  ASP A CA    1 
ATOM   7015  C  C     . ASP A 1  900  ? 163.951 79.254  5.605   1.00 103.18 ? 900  ASP A C     1 
ATOM   7016  O  O     . ASP A 1  900  ? 164.387 79.704  6.660   1.00 104.28 ? 900  ASP A O     1 
ATOM   7017  C  CB    . ASP A 1  900  ? 162.089 80.945  5.794   1.00 101.21 ? 900  ASP A CB    1 
ATOM   7018  C  CG    . ASP A 1  900  ? 162.749 82.227  5.279   1.00 111.66 ? 900  ASP A CG    1 
ATOM   7019  O  OD1   . ASP A 1  900  ? 163.896 82.149  4.771   1.00 113.46 ? 900  ASP A OD1   1 
ATOM   7020  O  OD2   . ASP A 1  900  ? 162.127 83.320  5.420   1.00 114.35 ? 900  ASP A OD2   1 
ATOM   7021  N  N     . LEU A 1  901  ? 164.674 78.464  4.784   1.00 99.38  ? 901  LEU A N     1 
ATOM   7022  C  CA    . LEU A 1  901  ? 166.062 78.054  5.072   1.00 100.02 ? 901  LEU A CA    1 
ATOM   7023  C  C     . LEU A 1  901  ? 167.025 79.241  5.141   1.00 105.28 ? 901  LEU A C     1 
ATOM   7024  O  O     . LEU A 1  901  ? 168.166 79.081  5.594   1.00 106.95 ? 901  LEU A O     1 
ATOM   7025  C  CB    . LEU A 1  901  ? 166.600 77.016  4.066   1.00 99.32  ? 901  LEU A CB    1 
ATOM   7026  C  CG    . LEU A 1  901  ? 165.678 75.897  3.650   1.00 102.14 ? 901  LEU A CG    1 
ATOM   7027  C  CD1   . LEU A 1  901  ? 166.261 75.153  2.476   1.00 101.84 ? 901  LEU A CD1   1 
ATOM   7028  C  CD2   . LEU A 1  901  ? 165.397 74.970  4.812   1.00 104.54 ? 901  LEU A CD2   1 
ATOM   7029  N  N     . LEU A 1  902  ? 166.573 80.423  4.702   1.00 100.03 ? 902  LEU A N     1 
ATOM   7030  C  CA    . LEU A 1  902  ? 167.418 81.599  4.754   1.00 101.09 ? 902  LEU A CA    1 
ATOM   7031  C  C     . LEU A 1  902  ? 167.219 82.430  6.045   1.00 108.26 ? 902  LEU A C     1 
ATOM   7032  O  O     . LEU A 1  902  ? 167.795 83.516  6.169   1.00 110.31 ? 902  LEU A O     1 
ATOM   7033  C  CB    . LEU A 1  902  ? 167.284 82.445  3.480   1.00 100.54 ? 902  LEU A CB    1 
ATOM   7034  C  CG    . LEU A 1  902  ? 167.203 81.710  2.152   1.00 103.14 ? 902  LEU A CG    1 
ATOM   7035  C  CD1   . LEU A 1  902  ? 166.838 82.649  1.061   1.00 104.04 ? 902  LEU A CD1   1 
ATOM   7036  C  CD2   . LEU A 1  902  ? 168.478 80.988  1.805   1.00 103.14 ? 902  LEU A CD2   1 
ATOM   7037  N  N     . ASN A 1  903  ? 166.444 81.897  7.019   1.00 104.03 ? 903  ASN A N     1 
ATOM   7038  C  CA    . ASN A 1  903  ? 166.170 82.538  8.306   1.00 104.70 ? 903  ASN A CA    1 
ATOM   7039  C  C     . ASN A 1  903  ? 166.528 81.566  9.421   1.00 110.12 ? 903  ASN A C     1 
ATOM   7040  O  O     . ASN A 1  903  ? 165.942 80.484  9.492   1.00 108.36 ? 903  ASN A O     1 
ATOM   7041  C  CB    . ASN A 1  903  ? 164.695 82.927  8.390   1.00 104.61 ? 903  ASN A CB    1 
ATOM   7042  C  CG    . ASN A 1  903  ? 164.323 83.739  9.603   1.00 134.77 ? 903  ASN A CG    1 
ATOM   7043  O  OD1   . ASN A 1  903  ? 164.573 83.360  10.758  1.00 129.17 ? 903  ASN A OD1   1 
ATOM   7044  N  ND2   . ASN A 1  903  ? 163.647 84.850  9.365   1.00 130.03 ? 903  ASN A ND2   1 
ATOM   7045  N  N     . THR A 1  904  ? 167.451 81.968  10.318  1.00 109.88 ? 904  THR A N     1 
ATOM   7046  C  CA    . THR A 1  904  ? 167.940 81.156  11.445  1.00 110.96 ? 904  THR A CA    1 
ATOM   7047  C  C     . THR A 1  904  ? 166.882 80.533  12.379  1.00 116.32 ? 904  THR A C     1 
ATOM   7048  O  O     . THR A 1  904  ? 167.181 79.559  13.071  1.00 115.05 ? 904  THR A O     1 
ATOM   7049  C  CB    . THR A 1  904  ? 169.093 81.857  12.177  1.00 121.60 ? 904  THR A CB    1 
ATOM   7050  O  OG1   . THR A 1  904  ? 169.989 80.861  12.654  1.00 125.13 ? 904  THR A OG1   1 
ATOM   7051  C  CG2   . THR A 1  904  ? 168.637 82.722  13.344  1.00 119.53 ? 904  THR A CG2   1 
ATOM   7052  N  N     . ASP A 1  905  ? 165.662 81.094  12.392  1.00 115.06 ? 905  ASP A N     1 
ATOM   7053  C  CA    . ASP A 1  905  ? 164.564 80.637  13.241  1.00 115.14 ? 905  ASP A CA    1 
ATOM   7054  C  C     . ASP A 1  905  ? 163.528 79.819  12.470  1.00 120.09 ? 905  ASP A C     1 
ATOM   7055  O  O     . ASP A 1  905  ? 162.929 78.896  13.043  1.00 120.23 ? 905  ASP A O     1 
ATOM   7056  C  CB    . ASP A 1  905  ? 163.873 81.834  13.918  1.00 117.55 ? 905  ASP A CB    1 
ATOM   7057  C  CG    . ASP A 1  905  ? 164.801 82.966  14.322  1.00 130.62 ? 905  ASP A CG    1 
ATOM   7058  O  OD1   . ASP A 1  905  ? 165.792 82.697  15.042  1.00 132.19 ? 905  ASP A OD1   1 
ATOM   7059  O  OD2   . ASP A 1  905  ? 164.526 84.123  13.938  1.00 136.55 ? 905  ASP A OD2   1 
ATOM   7060  N  N     . HIS A 1  906  ? 163.293 80.171  11.185  1.00 115.93 ? 906  HIS A N     1 
ATOM   7061  C  CA    . HIS A 1  906  ? 162.271 79.526  10.351  1.00 113.97 ? 906  HIS A CA    1 
ATOM   7062  C  C     . HIS A 1  906  ? 162.735 78.348  9.473   1.00 114.52 ? 906  HIS A C     1 
ATOM   7063  O  O     . HIS A 1  906  ? 161.971 77.864  8.632   1.00 111.79 ? 906  HIS A O     1 
ATOM   7064  C  CB    . HIS A 1  906  ? 161.462 80.575  9.572   1.00 114.98 ? 906  HIS A CB    1 
ATOM   7065  C  CG    . HIS A 1  906  ? 160.939 81.712  10.404  1.00 119.70 ? 906  HIS A CG    1 
ATOM   7066  N  ND1   . HIS A 1  906  ? 161.164 81.783  11.771  1.00 122.64 ? 906  HIS A ND1   1 
ATOM   7067  C  CD2   . HIS A 1  906  ? 160.230 82.799  10.023  1.00 122.31 ? 906  HIS A CD2   1 
ATOM   7068  C  CE1   . HIS A 1  906  ? 160.599 82.909  12.172  1.00 123.11 ? 906  HIS A CE1   1 
ATOM   7069  N  NE2   . HIS A 1  906  ? 160.017 83.551  11.157  1.00 123.22 ? 906  HIS A NE2   1 
ATOM   7070  N  N     . THR A 1  907  ? 163.973 77.873  9.699   1.00 111.24 ? 907  THR A N     1 
ATOM   7071  C  CA    . THR A 1  907  ? 164.546 76.706  9.025   1.00 110.37 ? 907  THR A CA    1 
ATOM   7072  C  C     . THR A 1  907  ? 164.034 75.485  9.795   1.00 114.34 ? 907  THR A C     1 
ATOM   7073  O  O     . THR A 1  907  ? 163.600 75.614  10.951  1.00 114.91 ? 907  THR A O     1 
ATOM   7074  C  CB    . THR A 1  907  ? 166.093 76.778  9.082   1.00 116.35 ? 907  THR A CB    1 
ATOM   7075  O  OG1   . THR A 1  907  ? 166.501 78.014  8.518   1.00 119.91 ? 907  THR A OG1   1 
ATOM   7076  C  CG2   . THR A 1  907  ? 166.803 75.627  8.340   1.00 111.32 ? 907  THR A CG2   1 
ATOM   7077  N  N     . LEU A 1  908  ? 164.067 74.306  9.149   1.00 109.02 ? 908  LEU A N     1 
ATOM   7078  C  CA    . LEU A 1  908  ? 163.725 73.038  9.781   1.00 107.26 ? 908  LEU A CA    1 
ATOM   7079  C  C     . LEU A 1  908  ? 164.924 72.732  10.695  1.00 112.87 ? 908  LEU A C     1 
ATOM   7080  O  O     . LEU A 1  908  ? 166.076 72.768  10.236  1.00 113.62 ? 908  LEU A O     1 
ATOM   7081  C  CB    . LEU A 1  908  ? 163.576 71.931  8.722   1.00 105.57 ? 908  LEU A CB    1 
ATOM   7082  C  CG    . LEU A 1  908  ? 162.568 72.164  7.612   1.00 108.28 ? 908  LEU A CG    1 
ATOM   7083  C  CD1   . LEU A 1  908  ? 163.063 71.594  6.309   1.00 107.47 ? 908  LEU A CD1   1 
ATOM   7084  C  CD2   . LEU A 1  908  ? 161.240 71.552  7.963   1.00 110.43 ? 908  LEU A CD2   1 
ATOM   7085  N  N     . ASP A 1  909  ? 164.666 72.524  11.994  1.00 109.67 ? 909  ASP A N     1 
ATOM   7086  C  CA    . ASP A 1  909  ? 165.721 72.237  12.962  1.00 111.03 ? 909  ASP A CA    1 
ATOM   7087  C  C     . ASP A 1  909  ? 166.450 70.958  12.540  1.00 114.69 ? 909  ASP A C     1 
ATOM   7088  O  O     . ASP A 1  909  ? 165.779 70.021  12.102  1.00 114.07 ? 909  ASP A O     1 
ATOM   7089  C  CB    . ASP A 1  909  ? 165.118 72.060  14.361  1.00 113.60 ? 909  ASP A CB    1 
ATOM   7090  C  CG    . ASP A 1  909  ? 166.129 72.130  15.486  1.00 132.37 ? 909  ASP A CG    1 
ATOM   7091  O  OD1   . ASP A 1  909  ? 166.794 71.102  15.753  1.00 139.26 ? 909  ASP A OD1   1 
ATOM   7092  O  OD2   . ASP A 1  909  ? 166.260 73.214  16.100  1.00 135.94 ? 909  ASP A OD2   1 
ATOM   7093  N  N     . PRO A 1  910  ? 167.799 70.873  12.640  1.00 111.26 ? 910  PRO A N     1 
ATOM   7094  C  CA    . PRO A 1  910  ? 168.493 69.631  12.242  1.00 111.01 ? 910  PRO A CA    1 
ATOM   7095  C  C     . PRO A 1  910  ? 168.064 68.370  13.014  1.00 115.09 ? 910  PRO A C     1 
ATOM   7096  O  O     . PRO A 1  910  ? 168.574 67.277  12.747  1.00 114.80 ? 910  PRO A O     1 
ATOM   7097  C  CB    . PRO A 1  910  ? 169.967 69.971  12.447  1.00 114.22 ? 910  PRO A CB    1 
ATOM   7098  C  CG    . PRO A 1  910  ? 169.952 71.064  13.442  1.00 119.46 ? 910  PRO A CG    1 
ATOM   7099  C  CD    . PRO A 1  910  ? 168.761 71.882  13.110  1.00 114.07 ? 910  PRO A CD    1 
ATOM   7100  N  N     . SER A 1  911  ? 167.107 68.532  13.956  1.00 111.22 ? 911  SER A N     1 
ATOM   7101  C  CA    . SER A 1  911  ? 166.474 67.476  14.746  1.00 110.17 ? 911  SER A CA    1 
ATOM   7102  C  C     . SER A 1  911  ? 165.401 66.782  13.891  1.00 112.32 ? 911  SER A C     1 
ATOM   7103  O  O     . SER A 1  911  ? 165.032 65.632  14.177  1.00 111.20 ? 911  SER A O     1 
ATOM   7104  C  CB    . SER A 1  911  ? 165.806 68.076  15.979  1.00 113.22 ? 911  SER A CB    1 
ATOM   7105  O  OG    . SER A 1  911  ? 164.722 68.921  15.622  1.00 117.71 ? 911  SER A OG    1 
ATOM   7106  N  N     . LEU A 1  912  ? 164.881 67.520  12.869  1.00 107.58 ? 912  LEU A N     1 
ATOM   7107  C  CA    . LEU A 1  912  ? 163.829 67.096  11.941  1.00 105.42 ? 912  LEU A CA    1 
ATOM   7108  C  C     . LEU A 1  912  ? 164.334 66.192  10.836  1.00 108.41 ? 912  LEU A C     1 
ATOM   7109  O  O     . LEU A 1  912  ? 163.642 65.224  10.481  1.00 107.63 ? 912  LEU A O     1 
ATOM   7110  C  CB    . LEU A 1  912  ? 163.073 68.300  11.340  1.00 105.02 ? 912  LEU A CB    1 
ATOM   7111  C  CG    . LEU A 1  912  ? 162.297 69.221  12.297  1.00 109.81 ? 912  LEU A CG    1 
ATOM   7112  C  CD1   . LEU A 1  912  ? 161.472 70.219  11.530  1.00 108.94 ? 912  LEU A CD1   1 
ATOM   7113  C  CD2   . LEU A 1  912  ? 161.373 68.442  13.212  1.00 112.46 ? 912  LEU A CD2   1 
ATOM   7114  N  N     . LEU A 1  913  ? 165.523 66.510  10.288  1.00 104.60 ? 913  LEU A N     1 
ATOM   7115  C  CA    . LEU A 1  913  ? 166.168 65.754  9.213   1.00 104.32 ? 913  LEU A CA    1 
ATOM   7116  C  C     . LEU A 1  913  ? 167.671 65.864  9.299   1.00 110.85 ? 913  LEU A C     1 
ATOM   7117  O  O     . LEU A 1  913  ? 168.165 66.861  9.828   1.00 112.71 ? 913  LEU A O     1 
ATOM   7118  C  CB    . LEU A 1  913  ? 165.660 66.183  7.821   1.00 103.64 ? 913  LEU A CB    1 
ATOM   7119  C  CG    . LEU A 1  913  ? 166.046 67.560  7.243   1.00 109.50 ? 913  LEU A CG    1 
ATOM   7120  C  CD1   . LEU A 1  913  ? 165.505 67.702  5.848   1.00 108.80 ? 913  LEU A CD1   1 
ATOM   7121  C  CD2   . LEU A 1  913  ? 165.506 68.729  8.081   1.00 112.30 ? 913  LEU A CD2   1 
ATOM   7122  N  N     . GLU A 1  914  ? 168.395 64.851  8.778   1.00 107.21 ? 914  GLU A N     1 
ATOM   7123  C  CA    . GLU A 1  914  ? 169.864 64.774  8.777   1.00 108.80 ? 914  GLU A CA    1 
ATOM   7124  C  C     . GLU A 1  914  ? 170.519 65.985  8.065   1.00 115.17 ? 914  GLU A C     1 
ATOM   7125  O  O     . GLU A 1  914  ? 171.468 66.604  8.583   1.00 116.36 ? 914  GLU A O     1 
ATOM   7126  C  CB    . GLU A 1  914  ? 170.326 63.438  8.160   1.00 109.84 ? 914  GLU A CB    1 
ATOM   7127  C  CG    . GLU A 1  914  ? 170.221 62.254  9.120   1.00 123.10 ? 914  GLU A CG    1 
ATOM   7128  C  CD    . GLU A 1  914  ? 169.770 60.897  8.595   1.00 140.24 ? 914  GLU A CD    1 
ATOM   7129  O  OE1   . GLU A 1  914  ? 170.176 60.507  7.474   1.00 115.14 ? 914  GLU A OE1   1 
ATOM   7130  O  OE2   . GLU A 1  914  ? 169.057 60.191  9.348   1.00 136.45 ? 914  GLU A OE2   1 
ATOM   7131  N  N     . SER A 1  915  ? 169.940 66.360  6.918   1.00 110.87 ? 915  SER A N     1 
ATOM   7132  C  CA    . SER A 1  915  ? 170.375 67.472  6.080   1.00 111.07 ? 915  SER A CA    1 
ATOM   7133  C  C     . SER A 1  915  ? 170.213 68.877  6.694   1.00 116.14 ? 915  SER A C     1 
ATOM   7134  O  O     . SER A 1  915  ? 170.789 69.823  6.157   1.00 116.66 ? 915  SER A O     1 
ATOM   7135  C  CB    . SER A 1  915  ? 169.676 67.397  4.729   1.00 112.97 ? 915  SER A CB    1 
ATOM   7136  O  OG    . SER A 1  915  ? 168.386 66.818  4.841   1.00 120.31 ? 915  SER A OG    1 
ATOM   7137  N  N     . GLY A 1  916  ? 169.462 68.993  7.800   1.00 112.87 ? 916  GLY A N     1 
ATOM   7138  C  CA    . GLY A 1  916  ? 169.139 70.242  8.508   1.00 113.39 ? 916  GLY A CA    1 
ATOM   7139  C  C     . GLY A 1  916  ? 170.247 71.267  8.723   1.00 117.31 ? 916  GLY A C     1 
ATOM   7140  O  O     . GLY A 1  916  ? 170.023 72.485  8.643   1.00 116.38 ? 916  GLY A O     1 
ATOM   7141  N  N     . SER A 1  917  ? 171.442 70.762  9.020   1.00 114.03 ? 917  SER A N     1 
ATOM   7142  C  CA    . SER A 1  917  ? 172.648 71.538  9.247   1.00 115.23 ? 917  SER A CA    1 
ATOM   7143  C  C     . SER A 1  917  ? 173.115 72.200  7.942   1.00 118.72 ? 917  SER A C     1 
ATOM   7144  O  O     . SER A 1  917  ? 173.224 73.430  7.878   1.00 119.83 ? 917  SER A O     1 
ATOM   7145  C  CB    . SER A 1  917  ? 173.739 70.627  9.807   1.00 119.69 ? 917  SER A CB    1 
ATOM   7146  O  OG    . SER A 1  917  ? 173.733 69.355  9.174   1.00 126.83 ? 917  SER A OG    1 
ATOM   7147  N  N     . GLU A 1  918  ? 173.358 71.367  6.900   1.00 112.83 ? 918  GLU A N     1 
ATOM   7148  C  CA    . GLU A 1  918  ? 173.846 71.726  5.562   1.00 111.60 ? 918  GLU A CA    1 
ATOM   7149  C  C     . GLU A 1  918  ? 172.776 72.355  4.651   1.00 111.51 ? 918  GLU A C     1 
ATOM   7150  O  O     . GLU A 1  918  ? 173.081 72.778  3.535   1.00 111.22 ? 918  GLU A O     1 
ATOM   7151  C  CB    . GLU A 1  918  ? 174.533 70.508  4.894   1.00 112.82 ? 918  GLU A CB    1 
ATOM   7152  C  CG    . GLU A 1  918  ? 173.610 69.332  4.592   1.00 127.39 ? 918  GLU A CG    1 
ATOM   7153  C  CD    . GLU A 1  918  ? 174.190 67.939  4.766   1.00 163.21 ? 918  GLU A CD    1 
ATOM   7154  O  OE1   . GLU A 1  918  ? 174.737 67.397  3.777   1.00 169.63 ? 918  GLU A OE1   1 
ATOM   7155  O  OE2   . GLU A 1  918  ? 174.038 67.362  5.869   1.00 159.87 ? 918  GLU A OE2   1 
ATOM   7156  N  N     . ILE A 1  919  ? 171.542 72.431  5.126   1.00 105.13 ? 919  ILE A N     1 
ATOM   7157  C  CA    . ILE A 1  919  ? 170.465 72.997  4.338   1.00 103.93 ? 919  ILE A CA    1 
ATOM   7158  C  C     . ILE A 1  919  ? 170.322 74.531  4.539   1.00 107.01 ? 919  ILE A C     1 
ATOM   7159  O  O     . ILE A 1  919  ? 169.735 75.225  3.699   1.00 106.20 ? 919  ILE A O     1 
ATOM   7160  C  CB    . ILE A 1  919  ? 169.180 72.168  4.617   1.00 106.10 ? 919  ILE A CB    1 
ATOM   7161  C  CG1   . ILE A 1  919  ? 168.452 71.761  3.351   1.00 105.97 ? 919  ILE A CG1   1 
ATOM   7162  C  CG2   . ILE A 1  919  ? 168.254 72.731  5.700   1.00 107.03 ? 919  ILE A CG2   1 
ATOM   7163  C  CD1   . ILE A 1  919  ? 168.817 70.343  2.877   1.00 120.48 ? 919  ILE A CD1   1 
ATOM   7164  N  N     . LEU A 1  920  ? 170.859 75.046  5.655   1.00 103.02 ? 920  LEU A N     1 
ATOM   7165  C  CA    . LEU A 1  920  ? 170.792 76.455  6.013   1.00 102.97 ? 920  LEU A CA    1 
ATOM   7166  C  C     . LEU A 1  920  ? 171.425 77.349  4.970   1.00 107.13 ? 920  LEU A C     1 
ATOM   7167  O  O     . LEU A 1  920  ? 172.581 77.152  4.597   1.00 106.62 ? 920  LEU A O     1 
ATOM   7168  C  CB    . LEU A 1  920  ? 171.504 76.672  7.337   1.00 104.16 ? 920  LEU A CB    1 
ATOM   7169  C  CG    . LEU A 1  920  ? 170.725 77.373  8.418   1.00 108.61 ? 920  LEU A CG    1 
ATOM   7170  C  CD1   . LEU A 1  920  ? 171.538 77.402  9.673   1.00 110.50 ? 920  LEU A CD1   1 
ATOM   7171  C  CD2   . LEU A 1  920  ? 170.351 78.801  8.026   1.00 109.62 ? 920  LEU A CD2   1 
ATOM   7172  N  N     . GLY A 1  921  ? 170.659 78.332  4.518   1.00 104.36 ? 921  GLY A N     1 
ATOM   7173  C  CA    . GLY A 1  921  ? 171.110 79.299  3.525   1.00 105.34 ? 921  GLY A CA    1 
ATOM   7174  C  C     . GLY A 1  921  ? 171.264 78.768  2.112   1.00 110.15 ? 921  GLY A C     1 
ATOM   7175  O  O     . GLY A 1  921  ? 171.879 79.442  1.281   1.00 110.44 ? 921  GLY A O     1 
ATOM   7176  N  N     . ASP A 1  922  ? 170.707 77.563  1.813   1.00 106.53 ? 922  ASP A N     1 
ATOM   7177  C  CA    . ASP A 1  922  ? 170.780 76.963  0.473   1.00 106.06 ? 922  ASP A CA    1 
ATOM   7178  C  C     . ASP A 1  922  ? 169.736 77.654  -0.380  1.00 108.17 ? 922  ASP A C     1 
ATOM   7179  O  O     . ASP A 1  922  ? 168.535 77.414  -0.223  1.00 106.65 ? 922  ASP A O     1 
ATOM   7180  C  CB    . ASP A 1  922  ? 170.554 75.438  0.525   1.00 107.43 ? 922  ASP A CB    1 
ATOM   7181  C  CG    . ASP A 1  922  ? 170.953 74.659  -0.723  1.00 122.82 ? 922  ASP A CG    1 
ATOM   7182  O  OD1   . ASP A 1  922  ? 170.530 75.056  -1.838  1.00 123.85 ? 922  ASP A OD1   1 
ATOM   7183  O  OD2   . ASP A 1  922  ? 171.563 73.575  -0.574  1.00 130.62 ? 922  ASP A OD2   1 
ATOM   7184  N  N     . LEU A 1  923  ? 170.200 78.554  -1.246  1.00 104.22 ? 923  LEU A N     1 
ATOM   7185  C  CA    . LEU A 1  923  ? 169.335 79.380  -2.083  1.00 102.83 ? 923  LEU A CA    1 
ATOM   7186  C  C     . LEU A 1  923  ? 168.592 78.613  -3.149  1.00 104.27 ? 923  LEU A C     1 
ATOM   7187  O  O     . LEU A 1  923  ? 167.454 78.969  -3.459  1.00 102.92 ? 923  LEU A O     1 
ATOM   7188  C  CB    . LEU A 1  923  ? 170.116 80.533  -2.701  1.00 103.98 ? 923  LEU A CB    1 
ATOM   7189  C  CG    . LEU A 1  923  ? 170.925 81.350  -1.730  1.00 109.62 ? 923  LEU A CG    1 
ATOM   7190  C  CD1   . LEU A 1  923  ? 172.370 80.888  -1.728  1.00 111.84 ? 923  LEU A CD1   1 
ATOM   7191  C  CD2   . LEU A 1  923  ? 170.844 82.806  -2.064  1.00 110.94 ? 923  LEU A CD2   1 
ATOM   7192  N  N     . LYS A 1  924  ? 169.234 77.572  -3.709  1.00 100.00 ? 924  LYS A N     1 
ATOM   7193  C  CA    . LYS A 1  924  ? 168.666 76.709  -4.746  1.00 98.54  ? 924  LYS A CA    1 
ATOM   7194  C  C     . LYS A 1  924  ? 167.438 75.949  -4.200  1.00 100.93 ? 924  LYS A C     1 
ATOM   7195  O  O     . LYS A 1  924  ? 166.402 75.844  -4.887  1.00 99.09  ? 924  LYS A O     1 
ATOM   7196  C  CB    . LYS A 1  924  ? 169.735 75.737  -5.278  1.00 101.12 ? 924  LYS A CB    1 
ATOM   7197  C  CG    . LYS A 1  924  ? 170.819 76.390  -6.141  1.00 111.82 ? 924  LYS A CG    1 
ATOM   7198  C  CD    . LYS A 1  924  ? 171.941 75.407  -6.534  1.00 124.12 ? 924  LYS A CD    1 
ATOM   7199  C  CE    . LYS A 1  924  ? 172.942 75.128  -5.424  1.00 138.86 ? 924  LYS A CE    1 
ATOM   7200  N  NZ    . LYS A 1  924  ? 174.199 74.517  -5.938  1.00 148.86 ? 924  LYS A NZ    1 
ATOM   7201  N  N     . LEU A 1  925  ? 167.556 75.464  -2.942  1.00 97.21  ? 925  LEU A N     1 
ATOM   7202  C  CA    . LEU A 1  925  ? 166.486 74.759  -2.243  1.00 95.52  ? 925  LEU A CA    1 
ATOM   7203  C  C     . LEU A 1  925  ? 165.405 75.707  -1.824  1.00 100.62 ? 925  LEU A C     1 
ATOM   7204  O  O     . LEU A 1  925  ? 164.236 75.348  -1.900  1.00 99.36  ? 925  LEU A O     1 
ATOM   7205  C  CB    . LEU A 1  925  ? 167.004 74.021  -1.027  1.00 95.34  ? 925  LEU A CB    1 
ATOM   7206  C  CG    . LEU A 1  925  ? 167.749 72.771  -1.329  1.00 99.69  ? 925  LEU A CG    1 
ATOM   7207  C  CD1   . LEU A 1  925  ? 168.512 72.357  -0.159  1.00 101.06 ? 925  LEU A CD1   1 
ATOM   7208  C  CD2   . LEU A 1  925  ? 166.813 71.652  -1.726  1.00 101.15 ? 925  LEU A CD2   1 
ATOM   7209  N  N     . GLN A 1  926  ? 165.780 76.932  -1.416  1.00 99.21  ? 926  GLN A N     1 
ATOM   7210  C  CA    . GLN A 1  926  ? 164.809 77.947  -1.030  1.00 99.38  ? 926  GLN A CA    1 
ATOM   7211  C  C     . GLN A 1  926  ? 163.922 78.375  -2.176  1.00 104.33 ? 926  GLN A C     1 
ATOM   7212  O  O     . GLN A 1  926  ? 162.840 78.893  -1.918  1.00 104.09 ? 926  GLN A O     1 
ATOM   7213  C  CB    . GLN A 1  926  ? 165.452 79.143  -0.339  1.00 102.06 ? 926  GLN A CB    1 
ATOM   7214  C  CG    . GLN A 1  926  ? 165.273 79.088  1.173   1.00 108.31 ? 926  GLN A CG    1 
ATOM   7215  C  CD    . GLN A 1  926  ? 163.843 79.166  1.617   1.00 111.00 ? 926  GLN A CD    1 
ATOM   7216  O  OE1   . GLN A 1  926  ? 163.266 78.183  2.064   1.00 106.78 ? 926  GLN A OE1   1 
ATOM   7217  N  NE2   . GLN A 1  926  ? 163.243 80.328  1.495   1.00 98.35  ? 926  GLN A NE2   1 
ATOM   7218  N  N     . VAL A 1  927  ? 164.346 78.108  -3.434  1.00 101.26 ? 927  VAL A N     1 
ATOM   7219  C  CA    . VAL A 1  927  ? 163.535 78.369  -4.619  1.00 100.63 ? 927  VAL A CA    1 
ATOM   7220  C  C     . VAL A 1  927  ? 162.402 77.340  -4.594  1.00 102.81 ? 927  VAL A C     1 
ATOM   7221  O  O     . VAL A 1  927  ? 161.237 77.717  -4.768  1.00 102.31 ? 927  VAL A O     1 
ATOM   7222  C  CB    . VAL A 1  927  ? 164.347 78.320  -5.932  1.00 105.26 ? 927  VAL A CB    1 
ATOM   7223  C  CG1   . VAL A 1  927  ? 163.439 78.481  -7.149  1.00 104.54 ? 927  VAL A CG1   1 
ATOM   7224  C  CG2   . VAL A 1  927  ? 165.416 79.400  -5.938  1.00 106.88 ? 927  VAL A CG2   1 
ATOM   7225  N  N     . LEU A 1  928  ? 162.741 76.064  -4.303  1.00 97.56  ? 928  LEU A N     1 
ATOM   7226  C  CA    . LEU A 1  928  ? 161.768 74.976  -4.201  1.00 95.66  ? 928  LEU A CA    1 
ATOM   7227  C  C     . LEU A 1  928  ? 160.743 75.188  -3.092  1.00 97.86  ? 928  LEU A C     1 
ATOM   7228  O  O     . LEU A 1  928  ? 159.564 74.895  -3.298  1.00 95.93  ? 928  LEU A O     1 
ATOM   7229  C  CB    . LEU A 1  928  ? 162.462 73.623  -4.002  1.00 95.69  ? 928  LEU A CB    1 
ATOM   7230  C  CG    . LEU A 1  928  ? 163.060 72.966  -5.228  1.00 100.91 ? 928  LEU A CG    1 
ATOM   7231  C  CD1   . LEU A 1  928  ? 163.701 71.656  -4.857  1.00 100.47 ? 928  LEU A CD1   1 
ATOM   7232  C  CD2   . LEU A 1  928  ? 162.003 72.727  -6.314  1.00 104.36 ? 928  LEU A CD2   1 
ATOM   7233  N  N     . LEU A 1  929  ? 161.185 75.667  -1.920  1.00 95.11  ? 929  LEU A N     1 
ATOM   7234  C  CA    . LEU A 1  929  ? 160.283 75.892  -0.796  1.00 95.05  ? 929  LEU A CA    1 
ATOM   7235  C  C     . LEU A 1  929  ? 159.397 77.110  -0.979  1.00 102.72 ? 929  LEU A C     1 
ATOM   7236  O  O     . LEU A 1  929  ? 158.283 77.136  -0.437  1.00 101.83 ? 929  LEU A O     1 
ATOM   7237  C  CB    . LEU A 1  929  ? 161.021 75.945  0.545   1.00 95.55  ? 929  LEU A CB    1 
ATOM   7238  C  CG    . LEU A 1  929  ? 161.552 74.640  1.151   1.00 98.33  ? 929  LEU A CG    1 
ATOM   7239  C  CD1   . LEU A 1  929  ? 160.745 73.428  0.740   1.00 96.06  ? 929  LEU A CD1   1 
ATOM   7240  C  CD2   . LEU A 1  929  ? 163.007 74.475  0.877   1.00 101.00 ? 929  LEU A CD2   1 
ATOM   7241  N  N     . ASP A 1  930  ? 159.879 78.111  -1.748  1.00 102.68 ? 930  ASP A N     1 
ATOM   7242  C  CA    . ASP A 1  930  ? 159.079 79.294  -2.062  1.00 103.92 ? 930  ASP A CA    1 
ATOM   7243  C  C     . ASP A 1  930  ? 158.035 78.910  -3.085  1.00 107.22 ? 930  ASP A C     1 
ATOM   7244  O  O     . ASP A 1  930  ? 156.876 79.241  -2.876  1.00 106.62 ? 930  ASP A O     1 
ATOM   7245  C  CB    . ASP A 1  930  ? 159.925 80.509  -2.475  1.00 107.98 ? 930  ASP A CB    1 
ATOM   7246  C  CG    . ASP A 1  930  ? 160.792 81.077  -1.353  1.00 123.84 ? 930  ASP A CG    1 
ATOM   7247  O  OD1   . ASP A 1  930  ? 160.582 80.683  -0.176  1.00 125.14 ? 930  ASP A OD1   1 
ATOM   7248  O  OD2   . ASP A 1  930  ? 161.726 81.868  -1.659  1.00 130.31 ? 930  ASP A OD2   1 
ATOM   7249  N  N     . GLU A 1  931  ? 158.399 78.099  -4.106  1.00 103.92 ? 931  GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  931  ? 157.435 77.544  -5.070  1.00 103.14 ? 931  GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  931  ? 156.299 76.910  -4.251  1.00 101.24 ? 931  GLU A C     1 
ATOM   7252  O  O     . GLU A 1  931  ? 155.144 77.306  -4.412  1.00 98.53  ? 931  GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  931  ? 158.065 76.389  -5.884  1.00 105.45 ? 931  GLU A CB    1 
ATOM   7254  C  CG    . GLU A 1  931  ? 158.990 76.722  -7.049  1.00 128.39 ? 931  GLU A CG    1 
ATOM   7255  C  CD    . GLU A 1  931  ? 159.673 75.499  -7.659  1.00 163.96 ? 931  GLU A CD    1 
ATOM   7256  O  OE1   . GLU A 1  931  ? 159.002 74.452  -7.844  1.00 154.54 ? 931  GLU A OE1   1 
ATOM   7257  O  OE2   . GLU A 1  931  ? 160.894 75.585  -7.932  1.00 167.58 ? 931  GLU A OE2   1 
ATOM   7258  N  N     . GLU A 1  932  ? 156.671 75.951  -3.341  1.00 96.63  ? 932  GLU A N     1 
ATOM   7259  C  CA    . GLU A 1  932  ? 155.799 75.167  -2.455  1.00 95.45  ? 932  GLU A CA    1 
ATOM   7260  C  C     . GLU A 1  932  ? 154.819 76.049  -1.735  1.00 98.50  ? 932  GLU A C     1 
ATOM   7261  O  O     . GLU A 1  932  ? 153.609 75.846  -1.864  1.00 97.35  ? 932  GLU A O     1 
ATOM   7262  C  CB    . GLU A 1  932  ? 156.602 74.308  -1.423  1.00 97.17  ? 932  GLU A CB    1 
ATOM   7263  C  CG    . GLU A 1  932  ? 155.728 73.727  -0.301  1.00 107.42 ? 932  GLU A CG    1 
ATOM   7264  C  CD    . GLU A 1  932  ? 156.313 72.867  0.810   1.00 122.03 ? 932  GLU A CD    1 
ATOM   7265  O  OE1   . GLU A 1  932  ? 156.557 71.664  0.555   1.00 117.54 ? 932  GLU A OE1   1 
ATOM   7266  O  OE2   . GLU A 1  932  ? 156.347 73.342  1.971   1.00 104.55 ? 932  GLU A OE2   1 
ATOM   7267  N  N     . TYR A 1  933  ? 155.350 77.000  -0.952  1.00 95.07  ? 933  TYR A N     1 
ATOM   7268  C  CA    . TYR A 1  933  ? 154.560 77.914  -0.152  1.00 94.74  ? 933  TYR A CA    1 
ATOM   7269  C  C     . TYR A 1  933  ? 153.624 78.775  -1.010  1.00 95.73  ? 933  TYR A C     1 
ATOM   7270  O  O     . TYR A 1  933  ? 152.443 78.881  -0.670  1.00 93.87  ? 933  TYR A O     1 
ATOM   7271  C  CB    . TYR A 1  933  ? 155.471 78.753  0.759   1.00 98.03  ? 933  TYR A CB    1 
ATOM   7272  C  CG    . TYR A 1  933  ? 154.727 79.470  1.861   1.00 100.67 ? 933  TYR A CG    1 
ATOM   7273  C  CD1   . TYR A 1  933  ? 154.333 78.800  3.011   1.00 103.30 ? 933  TYR A CD1   1 
ATOM   7274  C  CD2   . TYR A 1  933  ? 154.396 80.811  1.745   1.00 101.69 ? 933  TYR A CD2   1 
ATOM   7275  C  CE1   . TYR A 1  933  ? 153.607 79.445  4.012   1.00 105.16 ? 933  TYR A CE1   1 
ATOM   7276  C  CE2   . TYR A 1  933  ? 153.693 81.472  2.751   1.00 102.93 ? 933  TYR A CE2   1 
ATOM   7277  C  CZ    . TYR A 1  933  ? 153.304 80.786  3.886   1.00 110.25 ? 933  TYR A CZ    1 
ATOM   7278  O  OH    . TYR A 1  933  ? 152.607 81.422  4.883   1.00 112.70 ? 933  TYR A OH    1 
ATOM   7279  N  N     . LYS A 1  934  ? 154.125 79.319  -2.156  1.00 91.76  ? 934  LYS A N     1 
ATOM   7280  C  CA    . LYS A 1  934  ? 153.336 80.164  -3.073  1.00 90.89  ? 934  LYS A CA    1 
ATOM   7281  C  C     . LYS A 1  934  ? 152.105 79.445  -3.627  1.00 91.80  ? 934  LYS A C     1 
ATOM   7282  O  O     . LYS A 1  934  ? 151.056 80.071  -3.801  1.00 91.29  ? 934  LYS A O     1 
ATOM   7283  C  CB    . LYS A 1  934  ? 154.198 80.820  -4.176  1.00 94.20  ? 934  LYS A CB    1 
ATOM   7284  C  CG    . LYS A 1  934  ? 154.685 82.252  -3.842  1.00 114.08 ? 934  LYS A CG    1 
ATOM   7285  C  CD    . LYS A 1  934  ? 156.071 82.331  -3.101  1.00 127.98 ? 934  LYS A CD    1 
ATOM   7286  C  CE    . LYS A 1  934  ? 156.522 83.742  -2.716  1.00 138.01 ? 934  LYS A CE    1 
ATOM   7287  N  NZ    . LYS A 1  934  ? 157.736 83.755  -1.840  1.00 139.24 ? 934  LYS A NZ    1 
ATOM   7288  N  N     . GLN A 1  935  ? 152.223 78.118  -3.816  1.00 85.90  ? 935  GLN A N     1 
ATOM   7289  C  CA    . GLN A 1  935  ? 151.157 77.218  -4.260  1.00 83.42  ? 935  GLN A CA    1 
ATOM   7290  C  C     . GLN A 1  935  ? 150.160 76.995  -3.119  1.00 85.83  ? 935  GLN A C     1 
ATOM   7291  O  O     . GLN A 1  935  ? 148.956 77.042  -3.362  1.00 84.36  ? 935  GLN A O     1 
ATOM   7292  C  CB    . GLN A 1  935  ? 151.759 75.879  -4.735  1.00 83.74  ? 935  GLN A CB    1 
ATOM   7293  C  CG    . GLN A 1  935  ? 150.765 74.820  -5.185  1.00 84.59  ? 935  GLN A CG    1 
ATOM   7294  C  CD    . GLN A 1  935  ? 149.858 75.251  -6.308  1.00 107.48 ? 935  GLN A CD    1 
ATOM   7295  O  OE1   . GLN A 1  935  ? 150.268 75.868  -7.299  1.00 101.51 ? 935  GLN A OE1   1 
ATOM   7296  N  NE2   . GLN A 1  935  ? 148.591 74.909  -6.186  1.00 106.52 ? 935  GLN A NE2   1 
ATOM   7297  N  N     . LEU A 1  936  ? 150.658 76.759  -1.878  1.00 82.52  ? 936  LEU A N     1 
ATOM   7298  C  CA    . LEU A 1  936  ? 149.814 76.558  -0.693  1.00 81.71  ? 936  LEU A CA    1 
ATOM   7299  C  C     . LEU A 1  936  ? 148.993 77.807  -0.413  1.00 87.23  ? 936  LEU A C     1 
ATOM   7300  O  O     . LEU A 1  936  ? 147.853 77.691  0.048   1.00 87.08  ? 936  LEU A O     1 
ATOM   7301  C  CB    . LEU A 1  936  ? 150.627 76.184  0.555   1.00 82.08  ? 936  LEU A CB    1 
ATOM   7302  C  CG    . LEU A 1  936  ? 151.362 74.846  0.557   1.00 86.52  ? 936  LEU A CG    1 
ATOM   7303  C  CD1   . LEU A 1  936  ? 152.412 74.835  1.622   1.00 87.77  ? 936  LEU A CD1   1 
ATOM   7304  C  CD2   . LEU A 1  936  ? 150.422 73.689  0.802   1.00 88.46  ? 936  LEU A CD2   1 
ATOM   7305  N  N     . VAL A 1  937  ? 149.560 78.999  -0.712  1.00 84.60  ? 937  VAL A N     1 
ATOM   7306  C  CA    . VAL A 1  937  ? 148.863 80.269  -0.540  1.00 85.00  ? 937  VAL A CA    1 
ATOM   7307  C  C     . VAL A 1  937  ? 147.805 80.413  -1.630  1.00 90.77  ? 937  VAL A C     1 
ATOM   7308  O  O     . VAL A 1  937  ? 146.687 80.843  -1.334  1.00 90.35  ? 937  VAL A O     1 
ATOM   7309  C  CB    . VAL A 1  937  ? 149.827 81.460  -0.459  1.00 89.90  ? 937  VAL A CB    1 
ATOM   7310  C  CG1   . VAL A 1  937  ? 149.069 82.773  -0.346  1.00 90.60  ? 937  VAL A CG1   1 
ATOM   7311  C  CG2   . VAL A 1  937  ? 150.757 81.299  0.730   1.00 90.34  ? 937  VAL A CG2   1 
ATOM   7312  N  N     . LYS A 1  938  ? 148.141 79.988  -2.874  1.00 88.80  ? 938  LYS A N     1 
ATOM   7313  C  CA    . LYS A 1  938  ? 147.238 79.982  -4.037  1.00 88.22  ? 938  LYS A CA    1 
ATOM   7314  C  C     . LYS A 1  938  ? 146.045 79.115  -3.687  1.00 90.64  ? 938  LYS A C     1 
ATOM   7315  O  O     . LYS A 1  938  ? 144.917 79.616  -3.696  1.00 90.23  ? 938  LYS A O     1 
ATOM   7316  C  CB    . LYS A 1  938  ? 147.954 79.433  -5.299  1.00 90.78  ? 938  LYS A CB    1 
ATOM   7317  C  CG    . LYS A 1  938  ? 147.199 79.596  -6.632  1.00 103.07 ? 938  LYS A CG    1 
ATOM   7318  C  CD    . LYS A 1  938  ? 147.878 78.796  -7.775  1.00 112.48 ? 938  LYS A CD    1 
ATOM   7319  C  CE    . LYS A 1  938  ? 147.615 79.348  -9.163  1.00 120.88 ? 938  LYS A CE    1 
ATOM   7320  N  NZ    . LYS A 1  938  ? 148.244 78.514  -10.224 1.00 129.09 ? 938  LYS A NZ    1 
ATOM   7321  N  N     . ASP A 1  939  ? 146.318 77.836  -3.313  1.00 86.49  ? 939  ASP A N     1 
ATOM   7322  C  CA    . ASP A 1  939  ? 145.345 76.817  -2.918  1.00 85.62  ? 939  ASP A CA    1 
ATOM   7323  C  C     . ASP A 1  939  ? 144.363 77.408  -1.932  1.00 89.55  ? 939  ASP A C     1 
ATOM   7324  O  O     . ASP A 1  939  ? 143.155 77.400  -2.196  1.00 88.47  ? 939  ASP A O     1 
ATOM   7325  C  CB    . ASP A 1  939  ? 146.052 75.611  -2.256  1.00 87.59  ? 939  ASP A CB    1 
ATOM   7326  C  CG    . ASP A 1  939  ? 146.698 74.599  -3.183  1.00 97.57  ? 939  ASP A CG    1 
ATOM   7327  O  OD1   . ASP A 1  939  ? 146.692 74.832  -4.418  1.00 97.86  ? 939  ASP A OD1   1 
ATOM   7328  O  OD2   . ASP A 1  939  ? 147.185 73.550  -2.675  1.00 101.26 ? 939  ASP A OD2   1 
ATOM   7329  N  N     . ARG A 1  940  ? 144.896 77.978  -0.820  1.00 86.60  ? 940  ARG A N     1 
ATOM   7330  C  CA    . ARG A 1  940  ? 144.109 78.590  0.242   1.00 86.44  ? 940  ARG A CA    1 
ATOM   7331  C  C     . ARG A 1  940  ? 143.146 79.634  -0.305  1.00 90.13  ? 940  ARG A C     1 
ATOM   7332  O  O     . ARG A 1  940  ? 141.988 79.628  0.108   1.00 89.63  ? 940  ARG A O     1 
ATOM   7333  C  CB    . ARG A 1  940  ? 144.995 79.154  1.364   1.00 87.41  ? 940  ARG A CB    1 
ATOM   7334  C  CG    . ARG A 1  940  ? 144.230 79.381  2.671   1.00 95.16  ? 940  ARG A CG    1 
ATOM   7335  C  CD    . ARG A 1  940  ? 144.975 80.276  3.643   1.00 98.12  ? 940  ARG A CD    1 
ATOM   7336  N  NE    . ARG A 1  940  ? 144.479 80.140  5.016   1.00 97.39  ? 940  ARG A NE    1 
ATOM   7337  C  CZ    . ARG A 1  940  ? 144.505 81.119  5.916   1.00 108.54 ? 940  ARG A CZ    1 
ATOM   7338  N  NH1   . ARG A 1  940  ? 144.965 82.317  5.590   1.00 98.49  ? 940  ARG A NH1   1 
ATOM   7339  N  NH2   . ARG A 1  940  ? 144.060 80.908  7.147   1.00 92.12  ? 940  ARG A NH2   1 
ATOM   7340  N  N     . LYS A 1  941  ? 143.587 80.481  -1.267  1.00 86.74  ? 941  LYS A N     1 
ATOM   7341  C  CA    . LYS A 1  941  ? 142.676 81.463  -1.844  1.00 86.52  ? 941  LYS A CA    1 
ATOM   7342  C  C     . LYS A 1  941  ? 141.567 80.778  -2.618  1.00 89.54  ? 941  LYS A C     1 
ATOM   7343  O  O     . LYS A 1  941  ? 140.391 80.960  -2.283  1.00 89.29  ? 941  LYS A O     1 
ATOM   7344  C  CB    . LYS A 1  941  ? 143.372 82.542  -2.688  1.00 89.71  ? 941  LYS A CB    1 
ATOM   7345  C  CG    . LYS A 1  941  ? 142.884 83.965  -2.343  1.00 114.13 ? 941  LYS A CG    1 
ATOM   7346  C  CD    . LYS A 1  941  ? 141.421 84.381  -2.814  1.00 127.05 ? 941  LYS A CD    1 
ATOM   7347  C  CE    . LYS A 1  941  ? 140.163 83.972  -2.006  1.00 126.24 ? 941  LYS A CE    1 
ATOM   7348  N  NZ    . LYS A 1  941  ? 140.279 84.071  -0.517  1.00 123.14 ? 941  LYS A NZ    1 
ATOM   7349  N  N     . PHE A 1  942  ? 141.940 79.938  -3.595  1.00 84.92  ? 942  PHE A N     1 
ATOM   7350  C  CA    . PHE A 1  942  ? 141.006 79.186  -4.427  1.00 83.59  ? 942  PHE A CA    1 
ATOM   7351  C  C     . PHE A 1  942  ? 139.959 78.425  -3.615  1.00 85.89  ? 942  PHE A C     1 
ATOM   7352  O  O     . PHE A 1  942  ? 138.787 78.376  -4.011  1.00 84.40  ? 942  PHE A O     1 
ATOM   7353  C  CB    . PHE A 1  942  ? 141.781 78.218  -5.317  1.00 85.28  ? 942  PHE A CB    1 
ATOM   7354  C  CG    . PHE A 1  942  ? 140.919 77.204  -6.023  1.00 85.92  ? 942  PHE A CG    1 
ATOM   7355  C  CD1   . PHE A 1  942  ? 140.200 77.552  -7.163  1.00 88.95  ? 942  PHE A CD1   1 
ATOM   7356  C  CD2   . PHE A 1  942  ? 140.812 75.903  -5.538  1.00 86.99  ? 942  PHE A CD2   1 
ATOM   7357  C  CE1   . PHE A 1  942  ? 139.397 76.615  -7.811  1.00 88.91  ? 942  PHE A CE1   1 
ATOM   7358  C  CE2   . PHE A 1  942  ? 140.012 74.967  -6.186  1.00 88.73  ? 942  PHE A CE2   1 
ATOM   7359  C  CZ    . PHE A 1  942  ? 139.320 75.326  -7.326  1.00 86.96  ? 942  PHE A CZ    1 
ATOM   7360  N  N     . LEU A 1  943  ? 140.395 77.801  -2.506  1.00 82.37  ? 943  LEU A N     1 
ATOM   7361  C  CA    . LEU A 1  943  ? 139.522 77.027  -1.636  1.00 81.47  ? 943  LEU A CA    1 
ATOM   7362  C  C     . LEU A 1  943  ? 138.453 77.914  -1.023  1.00 87.21  ? 943  LEU A C     1 
ATOM   7363  O  O     . LEU A 1  943  ? 137.269 77.557  -1.056  1.00 86.58  ? 943  LEU A O     1 
ATOM   7364  C  CB    . LEU A 1  943  ? 140.328 76.281  -0.564  1.00 81.24  ? 943  LEU A CB    1 
ATOM   7365  C  CG    . LEU A 1  943  ? 141.092 75.011  -0.980  1.00 84.47  ? 943  LEU A CG    1 
ATOM   7366  C  CD1   . LEU A 1  943  ? 141.174 74.052  0.169   1.00 83.69  ? 943  LEU A CD1   1 
ATOM   7367  C  CD2   . LEU A 1  943  ? 140.445 74.303  -2.169  1.00 85.26  ? 943  LEU A CD2   1 
ATOM   7368  N  N     . ARG A 1  944  ? 138.860 79.112  -0.563  1.00 85.54  ? 944  ARG A N     1 
ATOM   7369  C  CA    . ARG A 1  944  ? 137.967 80.121  0.009   1.00 86.40  ? 944  ARG A CA    1 
ATOM   7370  C  C     . ARG A 1  944  ? 136.979 80.684  -1.024  1.00 93.86  ? 944  ARG A C     1 
ATOM   7371  O  O     . ARG A 1  944  ? 135.931 81.208  -0.635  1.00 94.23  ? 944  ARG A O     1 
ATOM   7372  C  CB    . ARG A 1  944  ? 138.757 81.232  0.700   1.00 85.09  ? 944  ARG A CB    1 
ATOM   7373  C  CG    . ARG A 1  944  ? 139.361 80.765  1.997   1.00 87.21  ? 944  ARG A CG    1 
ATOM   7374  C  CD    . ARG A 1  944  ? 139.830 81.902  2.859   1.00 95.01  ? 944  ARG A CD    1 
ATOM   7375  N  NE    . ARG A 1  944  ? 140.392 81.403  4.111   1.00 99.49  ? 944  ARG A NE    1 
ATOM   7376  C  CZ    . ARG A 1  944  ? 140.716 82.164  5.149   1.00 118.39 ? 944  ARG A CZ    1 
ATOM   7377  N  NH1   . ARG A 1  944  ? 140.534 83.479  5.102   1.00 105.08 ? 944  ARG A NH1   1 
ATOM   7378  N  NH2   . ARG A 1  944  ? 141.222 81.618  6.243   1.00 114.30 ? 944  ARG A NH2   1 
ATOM   7379  N  N     . GLU A 1  945  ? 137.306 80.560  -2.331  1.00 91.92  ? 945  GLU A N     1 
ATOM   7380  C  CA    . GLU A 1  945  ? 136.430 80.970  -3.431  1.00 92.20  ? 945  GLU A CA    1 
ATOM   7381  C  C     . GLU A 1  945  ? 135.386 79.860  -3.660  1.00 94.72  ? 945  GLU A C     1 
ATOM   7382  O  O     . GLU A 1  945  ? 134.206 80.171  -3.864  1.00 94.89  ? 945  GLU A O     1 
ATOM   7383  C  CB    . GLU A 1  945  ? 137.216 81.230  -4.728  1.00 94.15  ? 945  GLU A CB    1 
ATOM   7384  C  CG    . GLU A 1  945  ? 138.156 82.420  -4.681  1.00 109.52 ? 945  GLU A CG    1 
ATOM   7385  C  CD    . GLU A 1  945  ? 139.041 82.611  -5.902  1.00 141.65 ? 945  GLU A CD    1 
ATOM   7386  O  OE1   . GLU A 1  945  ? 138.943 81.799  -6.853  1.00 139.21 ? 945  GLU A OE1   1 
ATOM   7387  O  OE2   . GLU A 1  945  ? 139.839 83.578  -5.903  1.00 139.45 ? 945  GLU A OE2   1 
ATOM   7388  N  N     . VAL A 1  946  ? 135.812 78.572  -3.625  1.00 88.64  ? 946  VAL A N     1 
ATOM   7389  C  CA    . VAL A 1  946  ? 134.885 77.454  -3.797  1.00 86.85  ? 946  VAL A CA    1 
ATOM   7390  C  C     . VAL A 1  946  ? 133.966 77.422  -2.582  1.00 91.42  ? 946  VAL A C     1 
ATOM   7391  O  O     . VAL A 1  946  ? 132.759 77.634  -2.724  1.00 91.14  ? 946  VAL A O     1 
ATOM   7392  C  CB    . VAL A 1  946  ? 135.593 76.099  -4.018  1.00 89.49  ? 946  VAL A CB    1 
ATOM   7393  C  CG1   . VAL A 1  946  ? 134.582 74.970  -4.192  1.00 87.81  ? 946  VAL A CG1   1 
ATOM   7394  C  CG2   . VAL A 1  946  ? 136.518 76.164  -5.215  1.00 89.58  ? 946  VAL A CG2   1 
ATOM   7395  N  N     . PHE A 1  947  ? 134.547 77.242  -1.388  1.00 88.26  ? 947  PHE A N     1 
ATOM   7396  C  CA    . PHE A 1  947  ? 133.791 77.194  -0.146  1.00 88.25  ? 947  PHE A CA    1 
ATOM   7397  C  C     . PHE A 1  947  ? 133.781 78.555  0.534   1.00 95.59  ? 947  PHE A C     1 
ATOM   7398  O  O     . PHE A 1  947  ? 134.651 78.831  1.363   1.00 96.51  ? 947  PHE A O     1 
ATOM   7399  C  CB    . PHE A 1  947  ? 134.340 76.083  0.754   1.00 89.23  ? 947  PHE A CB    1 
ATOM   7400  C  CG    . PHE A 1  947  ? 134.527 74.783  0.016   1.00 89.42  ? 947  PHE A CG    1 
ATOM   7401  C  CD1   . PHE A 1  947  ? 133.459 74.163  -0.618  1.00 91.41  ? 947  PHE A CD1   1 
ATOM   7402  C  CD2   . PHE A 1  947  ? 135.776 74.197  -0.080  1.00 91.69  ? 947  PHE A CD2   1 
ATOM   7403  C  CE1   . PHE A 1  947  ? 133.628 72.957  -1.299  1.00 91.27  ? 947  PHE A CE1   1 
ATOM   7404  C  CE2   . PHE A 1  947  ? 135.942 72.984  -0.754  1.00 93.71  ? 947  PHE A CE2   1 
ATOM   7405  C  CZ    . PHE A 1  947  ? 134.864 72.373  -1.357  1.00 90.65  ? 947  PHE A CZ    1 
ATOM   7406  N  N     . VAL A 1  948  ? 132.793 79.416  0.160   1.00 92.91  ? 948  VAL A N     1 
ATOM   7407  C  CA    . VAL A 1  948  ? 132.620 80.810  0.636   1.00 93.45  ? 948  VAL A CA    1 
ATOM   7408  C  C     . VAL A 1  948  ? 132.520 81.003  2.151   1.00 97.85  ? 948  VAL A C     1 
ATOM   7409  O  O     . VAL A 1  948  ? 133.084 81.966  2.687   1.00 97.76  ? 948  VAL A O     1 
ATOM   7410  C  CB    . VAL A 1  948  ? 131.522 81.584  -0.122  1.00 96.89  ? 948  VAL A CB    1 
ATOM   7411  C  CG1   . VAL A 1  948  ? 132.134 82.477  -1.188  1.00 96.99  ? 948  VAL A CG1   1 
ATOM   7412  C  CG2   . VAL A 1  948  ? 130.486 80.634  -0.728  1.00 95.81  ? 948  VAL A CG2   1 
ATOM   7413  N  N     . ASP A 1  949  ? 131.813 80.072  2.830   1.00 94.14  ? 949  ASP A N     1 
ATOM   7414  C  CA    . ASP A 1  949  ? 131.620 80.042  4.279   1.00 94.28  ? 949  ASP A CA    1 
ATOM   7415  C  C     . ASP A 1  949  ? 132.862 79.499  5.008   1.00 98.15  ? 949  ASP A C     1 
ATOM   7416  O  O     . ASP A 1  949  ? 132.977 79.659  6.223   1.00 98.93  ? 949  ASP A O     1 
ATOM   7417  C  CB    . ASP A 1  949  ? 130.365 79.228  4.638   1.00 95.68  ? 949  ASP A CB    1 
ATOM   7418  C  CG    . ASP A 1  949  ? 130.425 77.762  4.260   1.00 113.65 ? 949  ASP A CG    1 
ATOM   7419  O  OD1   . ASP A 1  949  ? 130.647 77.463  3.057   1.00 115.60 ? 949  ASP A OD1   1 
ATOM   7420  O  OD2   . ASP A 1  949  ? 130.209 76.911  5.152   1.00 122.74 ? 949  ASP A OD2   1 
ATOM   7421  N  N     . GLY A 1  950  ? 133.773 78.873  4.267   1.00 93.41  ? 950  GLY A N     1 
ATOM   7422  C  CA    . GLY A 1  950  ? 135.014 78.343  4.814   1.00 93.57  ? 950  GLY A CA    1 
ATOM   7423  C  C     . GLY A 1  950  ? 134.957 76.921  5.328   1.00 97.65  ? 950  GLY A C     1 
ATOM   7424  O  O     . GLY A 1  950  ? 135.885 76.481  6.023   1.00 97.03  ? 950  GLY A O     1 
ATOM   7425  N  N     . GLU A 1  951  ? 133.868 76.191  4.984   1.00 94.22  ? 951  GLU A N     1 
ATOM   7426  C  CA    . GLU A 1  951  ? 133.654 74.795  5.366   1.00 93.53  ? 951  GLU A CA    1 
ATOM   7427  C  C     . GLU A 1  951  ? 134.842 73.957  4.889   1.00 97.11  ? 951  GLU A C     1 
ATOM   7428  O  O     . GLU A 1  951  ? 135.154 73.971  3.702   1.00 96.74  ? 951  GLU A O     1 
ATOM   7429  C  CB    . GLU A 1  951  ? 132.324 74.271  4.782   1.00 94.18  ? 951  GLU A CB    1 
ATOM   7430  C  CG    . GLU A 1  951  ? 131.931 72.882  5.265   1.00 106.54 ? 951  GLU A CG    1 
ATOM   7431  C  CD    . GLU A 1  951  ? 132.067 72.662  6.758   1.00 132.89 ? 951  GLU A CD    1 
ATOM   7432  O  OE1   . GLU A 1  951  ? 131.262 73.246  7.520   1.00 135.78 ? 951  GLU A OE1   1 
ATOM   7433  O  OE2   . GLU A 1  951  ? 133.013 71.951  7.169   1.00 124.73 ? 951  GLU A OE2   1 
ATOM   7434  N  N     . ALA A 1  952  ? 135.545 73.301  5.822   1.00 93.61  ? 952  ALA A N     1 
ATOM   7435  C  CA    . ALA A 1  952  ? 136.736 72.500  5.523   1.00 93.32  ? 952  ALA A CA    1 
ATOM   7436  C  C     . ALA A 1  952  ? 136.436 71.040  5.256   1.00 96.36  ? 952  ALA A C     1 
ATOM   7437  O  O     . ALA A 1  952  ? 137.240 70.371  4.598   1.00 95.98  ? 952  ALA A O     1 
ATOM   7438  C  CB    . ALA A 1  952  ? 137.724 72.593  6.674   1.00 94.91  ? 952  ALA A CB    1 
ATOM   7439  N  N     . ASN A 1  953  ? 135.325 70.528  5.819   1.00 91.55  ? 953  ASN A N     1 
ATOM   7440  C  CA    . ASN A 1  953  ? 134.972 69.119  5.732   1.00 89.78  ? 953  ASN A CA    1 
ATOM   7441  C  C     . ASN A 1  953  ? 134.191 68.773  4.517   1.00 92.18  ? 953  ASN A C     1 
ATOM   7442  O  O     . ASN A 1  953  ? 133.037 69.171  4.365   1.00 92.62  ? 953  ASN A O     1 
ATOM   7443  C  CB    . ASN A 1  953  ? 134.347 68.632  7.009   1.00 89.67  ? 953  ASN A CB    1 
ATOM   7444  C  CG    . ASN A 1  953  ? 135.269 68.864  8.166   1.00 113.93 ? 953  ASN A CG    1 
ATOM   7445  O  OD1   . ASN A 1  953  ? 136.420 68.399  8.176   1.00 104.51 ? 953  ASN A OD1   1 
ATOM   7446  N  ND2   . ASN A 1  953  ? 134.817 69.676  9.111   1.00 108.62 ? 953  ASN A ND2   1 
ATOM   7447  N  N     . TRP A 1  954  ? 134.871 68.091  3.605   1.00 86.69  ? 954  TRP A N     1 
ATOM   7448  C  CA    . TRP A 1  954  ? 134.346 67.718  2.310   1.00 85.04  ? 954  TRP A CA    1 
ATOM   7449  C  C     . TRP A 1  954  ? 134.715 66.320  2.008   1.00 85.88  ? 954  TRP A C     1 
ATOM   7450  O  O     . TRP A 1  954  ? 135.842 65.915  2.272   1.00 86.55  ? 954  TRP A O     1 
ATOM   7451  C  CB    . TRP A 1  954  ? 134.862 68.677  1.217   1.00 84.49  ? 954  TRP A CB    1 
ATOM   7452  C  CG    . TRP A 1  954  ? 134.299 70.045  1.421   1.00 86.12  ? 954  TRP A CG    1 
ATOM   7453  C  CD1   . TRP A 1  954  ? 134.858 71.059  2.141   1.00 89.98  ? 954  TRP A CD1   1 
ATOM   7454  C  CD2   . TRP A 1  954  ? 132.955 70.442  1.149   1.00 85.57  ? 954  TRP A CD2   1 
ATOM   7455  N  NE1   . TRP A 1  954  ? 133.965 72.095  2.267   1.00 89.79  ? 954  TRP A NE1   1 
ATOM   7456  C  CE2   . TRP A 1  954  ? 132.777 71.728  1.698   1.00 90.40  ? 954  TRP A CE2   1 
ATOM   7457  C  CE3   . TRP A 1  954  ? 131.883 69.836  0.482   1.00 85.81  ? 954  TRP A CE3   1 
ATOM   7458  C  CZ2   . TRP A 1  954  ? 131.583 72.428  1.577   1.00 89.84  ? 954  TRP A CZ2   1 
ATOM   7459  C  CZ3   . TRP A 1  954  ? 130.706 70.535  0.354   1.00 87.31  ? 954  TRP A CZ3   1 
ATOM   7460  C  CH2   . TRP A 1  954  ? 130.563 71.815  0.896   1.00 88.94  ? 954  TRP A CH2   1 
ATOM   7461  N  N     . PRO A 1  955  ? 133.786 65.555  1.436   1.00 79.13  ? 955  PRO A N     1 
ATOM   7462  C  CA    . PRO A 1  955  ? 134.088 64.168  1.111   1.00 76.91  ? 955  PRO A CA    1 
ATOM   7463  C  C     . PRO A 1  955  ? 134.916 64.094  -0.155  1.00 76.97  ? 955  PRO A C     1 
ATOM   7464  O  O     . PRO A 1  955  ? 134.533 64.612  -1.212  1.00 75.92  ? 955  PRO A O     1 
ATOM   7465  C  CB    . PRO A 1  955  ? 132.707 63.520  0.991   1.00 78.16  ? 955  PRO A CB    1 
ATOM   7466  C  CG    . PRO A 1  955  ? 131.729 64.564  1.413   1.00 83.96  ? 955  PRO A CG    1 
ATOM   7467  C  CD    . PRO A 1  955  ? 132.397 65.865  1.091   1.00 80.63  ? 955  PRO A CD    1 
ATOM   7468  N  N     . LEU A 1  956  ? 136.108 63.520  0.007   1.00 71.57  ? 956  LEU A N     1 
ATOM   7469  C  CA    . LEU A 1  956  ? 137.105 63.339  -1.032  1.00 70.80  ? 956  LEU A CA    1 
ATOM   7470  C  C     . LEU A 1  956  ? 137.619 61.897  -1.007  1.00 75.53  ? 956  LEU A C     1 
ATOM   7471  O  O     . LEU A 1  956  ? 137.532 61.268  0.046   1.00 76.59  ? 956  LEU A O     1 
ATOM   7472  C  CB    . LEU A 1  956  ? 138.251 64.346  -0.825  1.00 71.36  ? 956  LEU A CB    1 
ATOM   7473  C  CG    . LEU A 1  956  ? 137.895 65.790  -1.189  1.00 76.45  ? 956  LEU A CG    1 
ATOM   7474  C  CD1   . LEU A 1  956  ? 138.963 66.761  -0.765  1.00 77.06  ? 956  LEU A CD1   1 
ATOM   7475  C  CD2   . LEU A 1  956  ? 137.626 65.928  -2.669  1.00 80.80  ? 956  LEU A CD2   1 
ATOM   7476  N  N     . PRO A 1  957  ? 138.137 61.328  -2.124  1.00 70.71  ? 957  PRO A N     1 
ATOM   7477  C  CA    . PRO A 1  957  ? 138.660 59.954  -2.061  1.00 69.95  ? 957  PRO A CA    1 
ATOM   7478  C  C     . PRO A 1  957  ? 140.011 59.892  -1.345  1.00 74.29  ? 957  PRO A C     1 
ATOM   7479  O  O     . PRO A 1  957  ? 140.601 60.934  -1.063  1.00 73.62  ? 957  PRO A O     1 
ATOM   7480  C  CB    . PRO A 1  957  ? 138.789 59.573  -3.532  1.00 71.37  ? 957  PRO A CB    1 
ATOM   7481  C  CG    . PRO A 1  957  ? 139.080 60.845  -4.216  1.00 76.18  ? 957  PRO A CG    1 
ATOM   7482  C  CD    . PRO A 1  957  ? 138.339 61.913  -3.467  1.00 72.08  ? 957  PRO A CD    1 
ATOM   7483  N  N     . VAL A 1  958  ? 140.507 58.674  -1.065  1.00 72.50  ? 958  VAL A N     1 
ATOM   7484  C  CA    . VAL A 1  958  ? 141.808 58.441  -0.395  1.00 73.82  ? 958  VAL A CA    1 
ATOM   7485  C  C     . VAL A 1  958  ? 141.926 59.134  0.971   1.00 80.28  ? 958  VAL A C     1 
ATOM   7486  O  O     . VAL A 1  958  ? 142.325 60.303  0.998   1.00 80.40  ? 958  VAL A O     1 
ATOM   7487  C  CB    . VAL A 1  958  ? 143.029 58.806  -1.284  1.00 77.41  ? 958  VAL A CB    1 
ATOM   7488  C  CG1   . VAL A 1  958  ? 144.323 58.281  -0.679  1.00 77.44  ? 958  VAL A CG1   1 
ATOM   7489  C  CG2   . VAL A 1  958  ? 142.849 58.304  -2.705  1.00 76.56  ? 958  VAL A CG2   1 
ATOM   7490  N  N     . ASN A 1  959  ? 141.609 58.429  2.098   1.00 77.26  ? 959  ASN A N     1 
ATOM   7491  C  CA    . ASN A 1  959  ? 141.763 59.057  3.408   1.00 77.57  ? 959  ASN A CA    1 
ATOM   7492  C  C     . ASN A 1  959  ? 143.241 59.016  3.709   1.00 83.39  ? 959  ASN A C     1 
ATOM   7493  O  O     . ASN A 1  959  ? 143.791 57.942  3.972   1.00 83.23  ? 959  ASN A O     1 
ATOM   7494  C  CB    . ASN A 1  959  ? 140.929 58.398  4.507   1.00 76.41  ? 959  ASN A CB    1 
ATOM   7495  C  CG    . ASN A 1  959  ? 141.088 59.020  5.890   1.00 99.38  ? 959  ASN A CG    1 
ATOM   7496  O  OD1   . ASN A 1  959  ? 141.893 59.932  6.115   1.00 94.71  ? 959  ASN A OD1   1 
ATOM   7497  N  ND2   . ASN A 1  959  ? 140.338 58.521  6.868   1.00 90.99  ? 959  ASN A ND2   1 
ATOM   7498  N  N     . ILE A 1  960  ? 143.889 60.195  3.565   1.00 80.70  ? 960  ILE A N     1 
ATOM   7499  C  CA    . ILE A 1  960  ? 145.316 60.409  3.759   1.00 80.96  ? 960  ILE A CA    1 
ATOM   7500  C  C     . ILE A 1  960  ? 145.659 60.254  5.221   1.00 86.68  ? 960  ILE A C     1 
ATOM   7501  O  O     . ILE A 1  960  ? 146.659 59.588  5.538   1.00 86.24  ? 960  ILE A O     1 
ATOM   7502  C  CB    . ILE A 1  960  ? 145.727 61.769  3.162   1.00 84.06  ? 960  ILE A CB    1 
ATOM   7503  C  CG1   . ILE A 1  960  ? 145.909 61.642  1.673   1.00 83.69  ? 960  ILE A CG1   1 
ATOM   7504  C  CG2   . ILE A 1  960  ? 146.983 62.345  3.784   1.00 86.54  ? 960  ILE A CG2   1 
ATOM   7505  C  CD1   . ILE A 1  960  ? 144.911 62.386  0.971   1.00 92.96  ? 960  ILE A CD1   1 
ATOM   7506  N  N     . ARG A 1  961  ? 144.801 60.828  6.115   1.00 84.08  ? 961  ARG A N     1 
ATOM   7507  C  CA    . ARG A 1  961  ? 144.992 60.742  7.565   1.00 84.52  ? 961  ARG A CA    1 
ATOM   7508  C  C     . ARG A 1  961  ? 145.315 59.306  7.924   1.00 86.33  ? 961  ARG A C     1 
ATOM   7509  O  O     . ARG A 1  961  ? 146.383 59.068  8.499   1.00 86.87  ? 961  ARG A O     1 
ATOM   7510  C  CB    . ARG A 1  961  ? 143.776 61.274  8.357   1.00 86.39  ? 961  ARG A CB    1 
ATOM   7511  C  CG    . ARG A 1  961  ? 143.977 61.297  9.882   1.00 99.70  ? 961  ARG A CG    1 
ATOM   7512  C  CD    . ARG A 1  961  ? 142.704 61.589  10.668  1.00 115.00 ? 961  ARG A CD    1 
ATOM   7513  N  NE    . ARG A 1  961  ? 142.888 61.383  12.107  1.00 132.23 ? 961  ARG A NE    1 
ATOM   7514  C  CZ    . ARG A 1  961  ? 143.359 62.303  12.948  1.00 157.06 ? 961  ARG A CZ    1 
ATOM   7515  N  NH1   . ARG A 1  961  ? 143.696 63.510  12.506  1.00 145.38 ? 961  ARG A NH1   1 
ATOM   7516  N  NH2   . ARG A 1  961  ? 143.500 62.021  14.238  1.00 150.76 ? 961  ARG A NH2   1 
ATOM   7517  N  N     . ARG A 1  962  ? 144.468 58.348  7.474   1.00 80.29  ? 962  ARG A N     1 
ATOM   7518  C  CA    . ARG A 1  962  ? 144.703 56.927  7.720   1.00 79.71  ? 962  ARG A CA    1 
ATOM   7519  C  C     . ARG A 1  962  ? 146.010 56.389  7.131   1.00 83.88  ? 962  ARG A C     1 
ATOM   7520  O  O     . ARG A 1  962  ? 146.705 55.646  7.830   1.00 84.30  ? 962  ARG A O     1 
ATOM   7521  C  CB    . ARG A 1  962  ? 143.508 56.056  7.335   1.00 78.21  ? 962  ARG A CB    1 
ATOM   7522  C  CG    . ARG A 1  962  ? 142.652 55.692  8.543   1.00 87.71  ? 962  ARG A CG    1 
ATOM   7523  C  CD    . ARG A 1  962  ? 141.654 54.594  8.250   1.00 93.06  ? 962  ARG A CD    1 
ATOM   7524  N  NE    . ARG A 1  962  ? 140.574 55.039  7.369   1.00 91.42  ? 962  ARG A NE    1 
ATOM   7525  C  CZ    . ARG A 1  962  ? 140.495 54.720  6.082   1.00 101.42 ? 962  ARG A CZ    1 
ATOM   7526  N  NH1   . ARG A 1  962  ? 141.426 53.955  5.520   1.00 91.94  ? 962  ARG A NH1   1 
ATOM   7527  N  NH2   . ARG A 1  962  ? 139.488 55.168  5.344   1.00 75.07  ? 962  ARG A NH2   1 
ATOM   7528  N  N     . ILE A 1  963  ? 146.374 56.796  5.886   1.00 78.98  ? 963  ILE A N     1 
ATOM   7529  C  CA    . ILE A 1  963  ? 147.612 56.339  5.245   1.00 78.30  ? 963  ILE A CA    1 
ATOM   7530  C  C     . ILE A 1  963  ? 148.804 56.693  6.122   1.00 84.26  ? 963  ILE A C     1 
ATOM   7531  O  O     . ILE A 1  963  ? 149.607 55.805  6.444   1.00 84.61  ? 963  ILE A O     1 
ATOM   7532  C  CB    . ILE A 1  963  ? 147.778 56.797  3.774   1.00 80.51  ? 963  ILE A CB    1 
ATOM   7533  C  CG1   . ILE A 1  963  ? 146.532 56.425  2.944   1.00 79.66  ? 963  ILE A CG1   1 
ATOM   7534  C  CG2   . ILE A 1  963  ? 149.048 56.180  3.161   1.00 81.24  ? 963  ILE A CG2   1 
ATOM   7535  C  CD1   . ILE A 1  963  ? 146.607 56.689  1.449   1.00 84.42  ? 963  ILE A CD1   1 
ATOM   7536  N  N     . ILE A 1  964  ? 148.879 57.968  6.570   1.00 81.24  ? 964  ILE A N     1 
ATOM   7537  C  CA    . ILE A 1  964  ? 149.955 58.401  7.464   1.00 81.84  ? 964  ILE A CA    1 
ATOM   7538  C  C     . ILE A 1  964  ? 149.914 57.586  8.773   1.00 86.07  ? 964  ILE A C     1 
ATOM   7539  O  O     . ILE A 1  964  ? 150.932 56.987  9.135   1.00 86.59  ? 964  ILE A O     1 
ATOM   7540  C  CB    . ILE A 1  964  ? 150.022 59.946  7.625   1.00 84.89  ? 964  ILE A CB    1 
ATOM   7541  C  CG1   . ILE A 1  964  ? 150.618 60.559  6.359   1.00 85.15  ? 964  ILE A CG1   1 
ATOM   7542  C  CG2   . ILE A 1  964  ? 150.845 60.380  8.846   1.00 85.77  ? 964  ILE A CG2   1 
ATOM   7543  C  CD1   . ILE A 1  964  ? 149.898 61.690  5.874   1.00 93.57  ? 964  ILE A CD1   1 
ATOM   7544  N  N     . GLN A 1  965  ? 148.719 57.462  9.401   1.00 80.90  ? 965  GLN A N     1 
ATOM   7545  C  CA    . GLN A 1  965  ? 148.546 56.675  10.626  1.00 80.13  ? 965  GLN A CA    1 
ATOM   7546  C  C     . GLN A 1  965  ? 149.213 55.311  10.474  1.00 83.56  ? 965  GLN A C     1 
ATOM   7547  O  O     . GLN A 1  965  ? 150.105 54.962  11.257  1.00 81.81  ? 965  GLN A O     1 
ATOM   7548  C  CB    . GLN A 1  965  ? 147.056 56.544  11.015  1.00 80.24  ? 965  GLN A CB    1 
ATOM   7549  C  CG    . GLN A 1  965  ? 146.498 57.821  11.643  1.00 96.61  ? 965  GLN A CG    1 
ATOM   7550  C  CD    . GLN A 1  965  ? 145.042 57.755  12.054  1.00 121.98 ? 965  GLN A CD    1 
ATOM   7551  O  OE1   . GLN A 1  965  ? 144.214 57.057  11.450  1.00 119.52 ? 965  GLN A OE1   1 
ATOM   7552  N  NE2   . GLN A 1  965  ? 144.682 58.538  13.069  1.00 115.00 ? 965  GLN A NE2   1 
ATOM   7553  N  N     . ASN A 1  966  ? 148.857 54.603  9.392   1.00 81.98  ? 966  ASN A N     1 
ATOM   7554  C  CA    . ASN A 1  966  ? 149.396 53.278  9.105   1.00 83.00  ? 966  ASN A CA    1 
ATOM   7555  C  C     . ASN A 1  966  ? 150.880 53.310  8.871   1.00 88.41  ? 966  ASN A C     1 
ATOM   7556  O  O     . ASN A 1  966  ? 151.562 52.476  9.447   1.00 89.05  ? 966  ASN A O     1 
ATOM   7557  C  CB    . ASN A 1  966  ? 148.660 52.555  7.967   1.00 85.86  ? 966  ASN A CB    1 
ATOM   7558  C  CG    . ASN A 1  966  ? 147.144 52.626  7.993   1.00 107.53 ? 966  ASN A CG    1 
ATOM   7559  O  OD1   . ASN A 1  966  ? 146.477 52.494  9.048   1.00 96.85  ? 966  ASN A OD1   1 
ATOM   7560  N  ND2   . ASN A 1  966  ? 146.580 52.845  6.799   1.00 97.98  ? 966  ASN A ND2   1 
ATOM   7561  N  N     . ALA A 1  967  ? 151.402 54.304  8.120   1.00 85.40  ? 967  ALA A N     1 
ATOM   7562  C  CA    . ALA A 1  967  ? 152.849 54.419  7.895   1.00 86.50  ? 967  ALA A CA    1 
ATOM   7563  C  C     . ALA A 1  967  ? 153.587 54.459  9.219   1.00 92.51  ? 967  ALA A C     1 
ATOM   7564  O  O     . ALA A 1  967  ? 154.627 53.820  9.356   1.00 92.53  ? 967  ALA A O     1 
ATOM   7565  C  CB    . ALA A 1  967  ? 153.162 55.665  7.099   1.00 87.60  ? 967  ALA A CB    1 
ATOM   7566  N  N     . GLN A 1  968  ? 152.991 55.147  10.214  1.00 90.25  ? 968  GLN A N     1 
ATOM   7567  C  CA    . GLN A 1  968  ? 153.526 55.276  11.558  1.00 91.38  ? 968  GLN A CA    1 
ATOM   7568  C  C     . GLN A 1  968  ? 153.561 53.930  12.289  1.00 97.80  ? 968  GLN A C     1 
ATOM   7569  O  O     . GLN A 1  968  ? 154.658 53.537  12.693  1.00 98.86  ? 968  GLN A O     1 
ATOM   7570  C  CB    . GLN A 1  968  ? 152.838 56.408  12.323  1.00 92.63  ? 968  GLN A CB    1 
ATOM   7571  C  CG    . GLN A 1  968  ? 152.996 57.726  11.572  1.00 101.92 ? 968  GLN A CG    1 
ATOM   7572  C  CD    . GLN A 1  968  ? 152.397 58.920  12.252  1.00 123.08 ? 968  GLN A CD    1 
ATOM   7573  O  OE1   . GLN A 1  968  ? 151.208 59.224  12.087  1.00 115.62 ? 968  GLN A OE1   1 
ATOM   7574  N  NE2   . GLN A 1  968  ? 153.238 59.683  12.945  1.00 119.53 ? 968  GLN A NE2   1 
ATOM   7575  N  N     . GLN A 1  969  ? 152.428 53.164  12.369  1.00 94.33  ? 969  GLN A N     1 
ATOM   7576  C  CA    . GLN A 1  969  ? 152.517 51.823  12.995  1.00 94.47  ? 969  GLN A CA    1 
ATOM   7577  C  C     . GLN A 1  969  ? 153.349 50.816  12.173  1.00 96.43  ? 969  GLN A C     1 
ATOM   7578  O  O     . GLN A 1  969  ? 154.151 50.094  12.761  1.00 96.87  ? 969  GLN A O     1 
ATOM   7579  C  CB    . GLN A 1  969  ? 151.207 51.244  13.661  1.00 95.54  ? 969  GLN A CB    1 
ATOM   7580  C  CG    . GLN A 1  969  ? 149.969 50.952  12.751  1.00 121.94 ? 969  GLN A CG    1 
ATOM   7581  C  CD    . GLN A 1  969  ? 148.580 51.124  13.423  1.00 137.70 ? 969  GLN A CD    1 
ATOM   7582  O  OE1   . GLN A 1  969  ? 148.440 51.066  14.656  1.00 139.61 ? 969  GLN A OE1   1 
ATOM   7583  N  NE2   . GLN A 1  969  ? 147.504 51.340  12.629  1.00 105.83 ? 969  GLN A NE2   1 
ATOM   7584  N  N     . THR A 1  970  ? 153.250 50.859  10.826  1.00 90.92  ? 970  THR A N     1 
ATOM   7585  C  CA    . THR A 1  970  ? 153.961 49.957  9.912   1.00 90.66  ? 970  THR A CA    1 
ATOM   7586  C  C     . THR A 1  970  ? 155.463 50.079  10.038  1.00 97.41  ? 970  THR A C     1 
ATOM   7587  O  O     . THR A 1  970  ? 156.148 49.059  10.145  1.00 96.65  ? 970  THR A O     1 
ATOM   7588  C  CB    . THR A 1  970  ? 153.511 50.169  8.442   1.00 98.25  ? 970  THR A CB    1 
ATOM   7589  O  OG1   . THR A 1  970  ? 152.090 50.042  8.325   1.00 101.80 ? 970  THR A OG1   1 
ATOM   7590  C  CG2   . THR A 1  970  ? 154.184 49.214  7.463   1.00 94.25  ? 970  THR A CG2   1 
ATOM   7591  N  N     . PHE A 1  971  ? 155.973 51.318  10.015  1.00 97.35  ? 971  PHE A N     1 
ATOM   7592  C  CA    . PHE A 1  971  ? 157.406 51.585  10.016  1.00 99.82  ? 971  PHE A CA    1 
ATOM   7593  C  C     . PHE A 1  971  ? 158.032 51.884  11.366  1.00 111.66 ? 971  PHE A C     1 
ATOM   7594  O  O     . PHE A 1  971  ? 159.257 52.021  11.455  1.00 111.83 ? 971  PHE A O     1 
ATOM   7595  C  CB    . PHE A 1  971  ? 157.758 52.629  8.952   1.00 101.12 ? 971  PHE A CB    1 
ATOM   7596  C  CG    . PHE A 1  971  ? 157.429 52.184  7.544   1.00 101.19 ? 971  PHE A CG    1 
ATOM   7597  C  CD1   . PHE A 1  971  ? 156.155 52.365  7.017   1.00 102.29 ? 971  PHE A CD1   1 
ATOM   7598  C  CD2   . PHE A 1  971  ? 158.395 51.591  6.742   1.00 103.86 ? 971  PHE A CD2   1 
ATOM   7599  C  CE1   . PHE A 1  971  ? 155.850 51.946  5.718   1.00 104.21 ? 971  PHE A CE1   1 
ATOM   7600  C  CE2   . PHE A 1  971  ? 158.095 51.190  5.436   1.00 104.00 ? 971  PHE A CE2   1 
ATOM   7601  C  CZ    . PHE A 1  971  ? 156.824 51.365  4.934   1.00 102.35 ? 971  PHE A CZ    1 
ATOM   7602  N  N     . HIS A 1  972  ? 157.200 51.906  12.426  1.00 114.71 ? 972  HIS A N     1 
ATOM   7603  C  CA    . HIS A 1  972  ? 157.597 52.155  13.819  1.00 119.06 ? 972  HIS A CA    1 
ATOM   7604  C  C     . HIS A 1  972  ? 158.351 53.483  13.892  1.00 124.19 ? 972  HIS A C     1 
ATOM   7605  O  O     . HIS A 1  972  ? 159.531 53.548  14.258  1.00 124.67 ? 972  HIS A O     1 
ATOM   7606  C  CB    . HIS A 1  972  ? 158.371 50.955  14.423  1.00 122.62 ? 972  HIS A CB    1 
ATOM   7607  C  CG    . HIS A 1  972  ? 157.838 49.613  13.994  1.00 127.17 ? 972  HIS A CG    1 
ATOM   7608  N  ND1   . HIS A 1  972  ? 156.561 49.179  14.366  1.00 129.15 ? 972  HIS A ND1   1 
ATOM   7609  C  CD2   . HIS A 1  972  ? 158.413 48.660  13.216  1.00 130.19 ? 972  HIS A CD2   1 
ATOM   7610  C  CE1   . HIS A 1  972  ? 156.407 47.986  13.803  1.00 128.52 ? 972  HIS A CE1   1 
ATOM   7611  N  NE2   . HIS A 1  972  ? 157.495 47.628  13.103  1.00 129.32 ? 972  HIS A NE2   1 
ATOM   7612  N  N     . ILE A 1  973  ? 157.644 54.534  13.452  1.00 120.65 ? 973  ILE A N     1 
ATOM   7613  C  CA    . ILE A 1  973  ? 158.117 55.898  13.345  1.00 121.42 ? 973  ILE A CA    1 
ATOM   7614  C  C     . ILE A 1  973  ? 158.518 56.496  14.695  1.00 129.73 ? 973  ILE A C     1 
ATOM   7615  O  O     . ILE A 1  973  ? 157.706 56.562  15.629  1.00 128.99 ? 973  ILE A O     1 
ATOM   7616  C  CB    . ILE A 1  973  ? 157.166 56.731  12.432  1.00 122.96 ? 973  ILE A CB    1 
ATOM   7617  C  CG1   . ILE A 1  973  ? 157.900 57.321  11.235  1.00 122.75 ? 973  ILE A CG1   1 
ATOM   7618  C  CG2   . ILE A 1  973  ? 156.305 57.760  13.150  1.00 124.19 ? 973  ILE A CG2   1 
ATOM   7619  C  CD1   . ILE A 1  973  ? 157.953 56.433  10.108  1.00 125.00 ? 973  ILE A CD1   1 
ATOM   7620  N  N     . ASP A 1  974  ? 159.820 56.826  14.812  1.00 129.97 ? 974  ASP A N     1 
ATOM   7621  C  CA    . ASP A 1  974  ? 160.424 57.362  16.030  1.00 132.03 ? 974  ASP A CA    1 
ATOM   7622  C  C     . ASP A 1  974  ? 160.319 58.863  16.074  1.00 138.71 ? 974  ASP A C     1 
ATOM   7623  O  O     . ASP A 1  974  ? 161.089 59.562  15.409  1.00 138.43 ? 974  ASP A O     1 
ATOM   7624  C  CB    . ASP A 1  974  ? 161.890 56.904  16.172  1.00 134.82 ? 974  ASP A CB    1 
ATOM   7625  C  CG    . ASP A 1  974  ? 162.507 57.128  17.543  1.00 143.60 ? 974  ASP A CG    1 
ATOM   7626  O  OD1   . ASP A 1  974  ? 161.758 57.475  18.488  1.00 143.29 ? 974  ASP A OD1   1 
ATOM   7627  O  OD2   . ASP A 1  974  ? 163.731 56.909  17.684  1.00 149.90 ? 974  ASP A OD2   1 
ATOM   7628  N  N     . HIS A 1  975  ? 159.388 59.364  16.893  1.00 137.98 ? 975  HIS A N     1 
ATOM   7629  C  CA    . HIS A 1  975  ? 159.172 60.802  17.052  1.00 139.85 ? 975  HIS A CA    1 
ATOM   7630  C  C     . HIS A 1  975  ? 160.314 61.448  17.885  1.00 143.40 ? 975  HIS A C     1 
ATOM   7631  O  O     . HIS A 1  975  ? 160.063 62.283  18.760  1.00 142.98 ? 975  HIS A O     1 
ATOM   7632  C  CB    . HIS A 1  975  ? 157.761 61.084  17.634  1.00 141.45 ? 975  HIS A CB    1 
ATOM   7633  C  CG    . HIS A 1  975  ? 156.600 60.788  16.707  1.00 144.29 ? 975  HIS A CG    1 
ATOM   7634  N  ND1   . HIS A 1  975  ? 155.783 61.807  16.213  1.00 145.98 ? 975  HIS A ND1   1 
ATOM   7635  C  CD2   . HIS A 1  975  ? 156.118 59.598  16.265  1.00 145.33 ? 975  HIS A CD2   1 
ATOM   7636  C  CE1   . HIS A 1  975  ? 154.857 61.205  15.479  1.00 144.12 ? 975  HIS A CE1   1 
ATOM   7637  N  NE2   . HIS A 1  975  ? 155.015 59.879  15.478  1.00 143.98 ? 975  HIS A NE2   1 
ATOM   7638  N  N     . THR A 1  976  ? 161.576 61.019  17.611  1.00 140.01 ? 976  THR A N     1 
ATOM   7639  C  CA    . THR A 1  976  ? 162.820 61.493  18.245  1.00 141.03 ? 976  THR A CA    1 
ATOM   7640  C  C     . THR A 1  976  ? 163.932 61.679  17.197  1.00 143.42 ? 976  THR A C     1 
ATOM   7641  O  O     . THR A 1  976  ? 164.443 62.797  17.035  1.00 145.02 ? 976  THR A O     1 
ATOM   7642  C  CB    . THR A 1  976  ? 163.313 60.590  19.424  1.00 149.31 ? 976  THR A CB    1 
ATOM   7643  O  OG1   . THR A 1  976  ? 164.148 59.518  18.963  1.00 144.41 ? 976  THR A OG1   1 
ATOM   7644  C  CG2   . THR A 1  976  ? 162.192 60.095  20.343  1.00 149.59 ? 976  THR A CG2   1 
ATOM   7645  N  N     . LYS A 1  977  ? 164.308 60.571  16.506  1.00 135.47 ? 977  LYS A N     1 
ATOM   7646  C  CA    . LYS A 1  977  ? 165.374 60.520  15.502  1.00 133.53 ? 977  LYS A CA    1 
ATOM   7647  C  C     . LYS A 1  977  ? 165.106 61.377  14.244  1.00 132.02 ? 977  LYS A C     1 
ATOM   7648  O  O     . LYS A 1  977  ? 163.941 61.499  13.837  1.00 131.43 ? 977  LYS A O     1 
ATOM   7649  C  CB    . LYS A 1  977  ? 165.712 59.067  15.138  1.00 135.19 ? 977  LYS A CB    1 
ATOM   7650  C  CG    . LYS A 1  977  ? 166.463 58.321  16.239  1.00 151.79 ? 977  LYS A CG    1 
ATOM   7651  C  CD    . LYS A 1  977  ? 167.966 58.583  16.216  1.00 163.33 ? 977  LYS A CD    1 
ATOM   7652  C  CE    . LYS A 1  977  ? 168.677 57.809  17.297  1.00 176.33 ? 977  LYS A CE    1 
ATOM   7653  N  NZ    . LYS A 1  977  ? 170.153 57.955  17.204  1.00 186.87 ? 977  LYS A NZ    1 
ATOM   7654  N  N     . PRO A 1  978  ? 166.155 62.010  13.641  1.00 123.37 ? 978  PRO A N     1 
ATOM   7655  C  CA    . PRO A 1  978  ? 165.917 62.842  12.452  1.00 120.17 ? 978  PRO A CA    1 
ATOM   7656  C  C     . PRO A 1  978  ? 165.704 62.029  11.177  1.00 115.96 ? 978  PRO A C     1 
ATOM   7657  O  O     . PRO A 1  978  ? 166.316 60.972  11.005  1.00 114.94 ? 978  PRO A O     1 
ATOM   7658  C  CB    . PRO A 1  978  ? 167.173 63.709  12.377  1.00 123.50 ? 978  PRO A CB    1 
ATOM   7659  C  CG    . PRO A 1  978  ? 168.230 62.870  12.955  1.00 129.58 ? 978  PRO A CG    1 
ATOM   7660  C  CD    . PRO A 1  978  ? 167.590 61.994  13.997  1.00 125.37 ? 978  PRO A CD    1 
ATOM   7661  N  N     . SER A 1  979  ? 164.843 62.543  10.282  1.00 106.97 ? 979  SER A N     1 
ATOM   7662  C  CA    . SER A 1  979  ? 164.511 61.919  9.007   1.00 103.91 ? 979  SER A CA    1 
ATOM   7663  C  C     . SER A 1  979  ? 165.680 61.847  8.026   1.00 107.40 ? 979  SER A C     1 
ATOM   7664  O  O     . SER A 1  979  ? 166.591 62.668  8.058   1.00 108.46 ? 979  SER A O     1 
ATOM   7665  C  CB    . SER A 1  979  ? 163.326 62.625  8.356   1.00 103.70 ? 979  SER A CB    1 
ATOM   7666  O  OG    . SER A 1  979  ? 162.970 62.029  7.117   1.00 103.80 ? 979  SER A OG    1 
ATOM   7667  N  N     . ASP A 1  980  ? 165.612 60.872  7.131   1.00 102.60 ? 980  ASP A N     1 
ATOM   7668  C  CA    . ASP A 1  980  ? 166.565 60.630  6.058   1.00 103.06 ? 980  ASP A CA    1 
ATOM   7669  C  C     . ASP A 1  980  ? 165.995 61.218  4.733   1.00 105.74 ? 980  ASP A C     1 
ATOM   7670  O  O     . ASP A 1  980  ? 166.401 60.828  3.630   1.00 105.41 ? 980  ASP A O     1 
ATOM   7671  C  CB    . ASP A 1  980  ? 166.801 59.113  5.943   1.00 105.21 ? 980  ASP A CB    1 
ATOM   7672  C  CG    . ASP A 1  980  ? 165.533 58.315  5.699   1.00 120.97 ? 980  ASP A CG    1 
ATOM   7673  O  OD1   . ASP A 1  980  ? 164.517 58.595  6.366   1.00 121.33 ? 980  ASP A OD1   1 
ATOM   7674  O  OD2   . ASP A 1  980  ? 165.558 57.410  4.840   1.00 130.96 ? 980  ASP A OD2   1 
ATOM   7675  N  N     . LEU A 1  981  ? 165.035 62.144  4.853   1.00 100.82 ? 981  LEU A N     1 
ATOM   7676  C  CA    . LEU A 1  981  ? 164.424 62.797  3.704   1.00 99.16  ? 981  LEU A CA    1 
ATOM   7677  C  C     . LEU A 1  981  ? 165.194 64.067  3.309   1.00 103.60 ? 981  LEU A C     1 
ATOM   7678  O  O     . LEU A 1  981  ? 165.796 64.746  4.153   1.00 103.65 ? 981  LEU A O     1 
ATOM   7679  C  CB    . LEU A 1  981  ? 162.950 63.138  3.986   1.00 97.83  ? 981  LEU A CB    1 
ATOM   7680  C  CG    . LEU A 1  981  ? 161.923 62.017  3.869   1.00 100.49 ? 981  LEU A CG    1 
ATOM   7681  C  CD1   . LEU A 1  981  ? 160.654 62.381  4.593   1.00 99.70  ? 981  LEU A CD1   1 
ATOM   7682  C  CD2   . LEU A 1  981  ? 161.557 61.766  2.435   1.00 101.97 ? 981  LEU A CD2   1 
ATOM   7683  N  N     . THR A 1  982  ? 165.183 64.349  2.000   1.00 99.85  ? 982  THR A N     1 
ATOM   7684  C  CA    . THR A 1  982  ? 165.759 65.526  1.355   1.00 100.14 ? 982  THR A CA    1 
ATOM   7685  C  C     . THR A 1  982  ? 164.572 66.436  1.138   1.00 102.60 ? 982  THR A C     1 
ATOM   7686  O  O     . THR A 1  982  ? 163.426 65.962  1.144   1.00 99.56  ? 982  THR A O     1 
ATOM   7687  C  CB    . THR A 1  982  ? 166.300 65.165  -0.054  1.00 108.62 ? 982  THR A CB    1 
ATOM   7688  O  OG1   . THR A 1  982  ? 166.921 63.883  -0.047  1.00 108.48 ? 982  THR A OG1   1 
ATOM   7689  C  CG2   . THR A 1  982  ? 167.263 66.206  -0.607  1.00 111.12 ? 982  THR A CG2   1 
ATOM   7690  N  N     . ILE A 1  983  ? 164.829 67.735  0.904   1.00 100.86 ? 983  ILE A N     1 
ATOM   7691  C  CA    . ILE A 1  983  ? 163.750 68.664  0.578   1.00 99.77  ? 983  ILE A CA    1 
ATOM   7692  C  C     . ILE A 1  983  ? 163.192 68.249  -0.793  1.00 103.41 ? 983  ILE A C     1 
ATOM   7693  O  O     . ILE A 1  983  ? 161.971 68.171  -0.959  1.00 102.27 ? 983  ILE A O     1 
ATOM   7694  C  CB    . ILE A 1  983  ? 164.208 70.139  0.691   1.00 102.99 ? 983  ILE A CB    1 
ATOM   7695  C  CG1   . ILE A 1  983  ? 163.987 70.636  2.122   1.00 103.09 ? 983  ILE A CG1   1 
ATOM   7696  C  CG2   . ILE A 1  983  ? 163.471 71.042  -0.292  1.00 102.79 ? 983  ILE A CG2   1 
ATOM   7697  C  CD1   . ILE A 1  983  ? 164.961 70.120  3.118   1.00 110.48 ? 983  ILE A CD1   1 
ATOM   7698  N  N     . LYS A 1  984  ? 164.107 67.868  -1.718  1.00 99.62  ? 984  LYS A N     1 
ATOM   7699  C  CA    . LYS A 1  984  ? 163.806 67.374  -3.057  1.00 98.23  ? 984  LYS A CA    1 
ATOM   7700  C  C     . LYS A 1  984  ? 162.952 66.103  -2.964  1.00 100.34 ? 984  LYS A C     1 
ATOM   7701  O  O     . LYS A 1  984  ? 161.899 66.029  -3.616  1.00 98.07  ? 984  LYS A O     1 
ATOM   7702  C  CB    . LYS A 1  984  ? 165.107 67.146  -3.844  1.00 101.29 ? 984  LYS A CB    1 
ATOM   7703  C  CG    . LYS A 1  984  ? 165.730 68.450  -4.355  1.00 109.77 ? 984  LYS A CG    1 
ATOM   7704  C  CD    . LYS A 1  984  ? 166.973 68.246  -5.219  1.00 114.37 ? 984  LYS A CD    1 
ATOM   7705  C  CE    . LYS A 1  984  ? 166.744 68.678  -6.643  1.00 117.93 ? 984  LYS A CE    1 
ATOM   7706  N  NZ    . LYS A 1  984  ? 168.025 68.987  -7.314  1.00 129.35 ? 984  LYS A NZ    1 
ATOM   7707  N  N     . ASP A 1  985  ? 163.350 65.155  -2.068  1.00 97.14  ? 985  ASP A N     1 
ATOM   7708  C  CA    . ASP A 1  985  ? 162.604 63.912  -1.804  1.00 95.79  ? 985  ASP A CA    1 
ATOM   7709  C  C     . ASP A 1  985  ? 161.099 64.197  -1.599  1.00 96.25  ? 985  ASP A C     1 
ATOM   7710  O  O     . ASP A 1  985  ? 160.271 63.597  -2.289  1.00 94.61  ? 985  ASP A O     1 
ATOM   7711  C  CB    . ASP A 1  985  ? 163.177 63.155  -0.580  1.00 98.56  ? 985  ASP A CB    1 
ATOM   7712  C  CG    . ASP A 1  985  ? 164.344 62.204  -0.840  1.00 115.79 ? 985  ASP A CG    1 
ATOM   7713  O  OD1   . ASP A 1  985  ? 164.661 61.954  -2.030  1.00 117.22 ? 985  ASP A OD1   1 
ATOM   7714  O  OD2   . ASP A 1  985  ? 164.939 61.698  0.156   1.00 123.60 ? 985  ASP A OD2   1 
ATOM   7715  N  N     . ILE A 1  986  ? 160.769 65.162  -0.704  1.00 90.96  ? 986  ILE A N     1 
ATOM   7716  C  CA    . ILE A 1  986  ? 159.399 65.580  -0.396  1.00 88.68  ? 986  ILE A CA    1 
ATOM   7717  C  C     . ILE A 1  986  ? 158.833 66.439  -1.511  1.00 91.67  ? 986  ILE A C     1 
ATOM   7718  O  O     . ILE A 1  986  ? 157.879 66.018  -2.160  1.00 90.76  ? 986  ILE A O     1 
ATOM   7719  C  CB    . ILE A 1  986  ? 159.262 66.273  0.993   1.00 91.78  ? 986  ILE A CB    1 
ATOM   7720  C  CG1   . ILE A 1  986  ? 159.857 65.407  2.119   1.00 92.97  ? 986  ILE A CG1   1 
ATOM   7721  C  CG2   . ILE A 1  986  ? 157.802 66.645  1.291   1.00 90.00  ? 986  ILE A CG2   1 
ATOM   7722  C  CD1   . ILE A 1  986  ? 160.318 66.176  3.351   1.00 102.42 ? 986  ILE A CD1   1 
ATOM   7723  N  N     . VAL A 1  987  ? 159.397 67.651  -1.715  1.00 88.70  ? 987  VAL A N     1 
ATOM   7724  C  CA    . VAL A 1  987  ? 158.930 68.655  -2.693  1.00 88.04  ? 987  VAL A CA    1 
ATOM   7725  C  C     . VAL A 1  987  ? 158.585 68.068  -4.072  1.00 92.42  ? 987  VAL A C     1 
ATOM   7726  O  O     . VAL A 1  987  ? 157.458 68.255  -4.576  1.00 90.69  ? 987  VAL A O     1 
ATOM   7727  C  CB    . VAL A 1  987  ? 159.837 69.929  -2.722  1.00 91.45  ? 987  VAL A CB    1 
ATOM   7728  C  CG1   . VAL A 1  987  ? 159.829 70.633  -4.072  1.00 90.80  ? 987  VAL A CG1   1 
ATOM   7729  C  CG2   . VAL A 1  987  ? 159.440 70.894  -1.619  1.00 91.41  ? 987  VAL A CG2   1 
ATOM   7730  N  N     . LEU A 1  988  ? 159.539 67.289  -4.621  1.00 89.21  ? 988  LEU A N     1 
ATOM   7731  C  CA    . LEU A 1  988  ? 159.395 66.698  -5.935  1.00 88.00  ? 988  LEU A CA    1 
ATOM   7732  C  C     . LEU A 1  988  ? 158.576 65.469  -5.918  1.00 91.12  ? 988  LEU A C     1 
ATOM   7733  O  O     . LEU A 1  988  ? 157.799 65.287  -6.848  1.00 91.19  ? 988  LEU A O     1 
ATOM   7734  C  CB    . LEU A 1  988  ? 160.736 66.479  -6.609  1.00 88.74  ? 988  LEU A CB    1 
ATOM   7735  C  CG    . LEU A 1  988  ? 161.689 67.650  -6.469  1.00 95.12  ? 988  LEU A CG    1 
ATOM   7736  C  CD1   . LEU A 1  988  ? 163.078 67.249  -6.811  1.00 96.80  ? 988  LEU A CD1   1 
ATOM   7737  C  CD2   . LEU A 1  988  ? 161.237 68.839  -7.285  1.00 98.15  ? 988  LEU A CD2   1 
ATOM   7738  N  N     . GLY A 1  989  ? 158.698 64.663  -4.860  1.00 86.87  ? 989  GLY A N     1 
ATOM   7739  C  CA    . GLY A 1  989  ? 157.921 63.432  -4.687  1.00 85.16  ? 989  GLY A CA    1 
ATOM   7740  C  C     . GLY A 1  989  ? 156.420 63.638  -4.800  1.00 85.32  ? 989  GLY A C     1 
ATOM   7741  O  O     . GLY A 1  989  ? 155.733 62.888  -5.510  1.00 82.24  ? 989  GLY A O     1 
ATOM   7742  N  N     . VAL A 1  990  ? 155.929 64.699  -4.125  1.00 82.34  ? 990  VAL A N     1 
ATOM   7743  C  CA    . VAL A 1  990  ? 154.534 65.121  -4.128  1.00 82.11  ? 990  VAL A CA    1 
ATOM   7744  C  C     . VAL A 1  990  ? 154.166 65.626  -5.529  1.00 87.35  ? 990  VAL A C     1 
ATOM   7745  O  O     . VAL A 1  990  ? 153.105 65.258  -6.039  1.00 85.93  ? 990  VAL A O     1 
ATOM   7746  C  CB    . VAL A 1  990  ? 154.209 66.153  -3.016  1.00 86.71  ? 990  VAL A CB    1 
ATOM   7747  C  CG1   . VAL A 1  990  ? 152.708 66.438  -2.960  1.00 85.70  ? 990  VAL A CG1   1 
ATOM   7748  C  CG2   . VAL A 1  990  ? 154.694 65.664  -1.655  1.00 86.92  ? 990  VAL A CG2   1 
ATOM   7749  N  N     . LYS A 1  991  ? 155.069 66.419  -6.166  1.00 86.07  ? 991  LYS A N     1 
ATOM   7750  C  CA    . LYS A 1  991  ? 154.891 66.930  -7.532  1.00 86.28  ? 991  LYS A CA    1 
ATOM   7751  C  C     . LYS A 1  991  ? 154.723 65.772  -8.535  1.00 92.51  ? 991  LYS A C     1 
ATOM   7752  O  O     . LYS A 1  991  ? 153.985 65.926  -9.504  1.00 92.43  ? 991  LYS A O     1 
ATOM   7753  C  CB    . LYS A 1  991  ? 156.044 67.866  -7.948  1.00 89.11  ? 991  LYS A CB    1 
ATOM   7754  C  CG    . LYS A 1  991  ? 155.727 69.357  -7.817  1.00 101.12 ? 991  LYS A CG    1 
ATOM   7755  C  CD    . LYS A 1  991  ? 156.686 70.235  -8.652  1.00 116.61 ? 991  LYS A CD    1 
ATOM   7756  C  CE    . LYS A 1  991  ? 156.445 71.738  -8.536  1.00 130.21 ? 991  LYS A CE    1 
ATOM   7757  N  NZ    . LYS A 1  991  ? 157.501 72.561  -9.214  1.00 132.63 ? 991  LYS A NZ    1 
ATOM   7758  N  N     . ASP A 1  992  ? 155.340 64.600  -8.260  1.00 90.99  ? 992  ASP A N     1 
ATOM   7759  C  CA    . ASP A 1  992  ? 155.247 63.414  -9.115  1.00 91.38  ? 992  ASP A CA    1 
ATOM   7760  C  C     . ASP A 1  992  ? 153.969 62.646  -8.914  1.00 94.60  ? 992  ASP A C     1 
ATOM   7761  O  O     . ASP A 1  992  ? 153.259 62.431  -9.895  1.00 93.67  ? 992  ASP A O     1 
ATOM   7762  C  CB    . ASP A 1  992  ? 156.477 62.513  -8.990  1.00 94.82  ? 992  ASP A CB    1 
ATOM   7763  C  CG    . ASP A 1  992  ? 157.766 63.223  -9.384  1.00 123.01 ? 992  ASP A CG    1 
ATOM   7764  O  OD1   . ASP A 1  992  ? 157.695 64.417  -9.794  1.00 126.25 ? 992  ASP A OD1   1 
ATOM   7765  O  OD2   . ASP A 1  992  ? 158.857 62.605  -9.246  1.00 136.35 ? 992  ASP A OD2   1 
ATOM   7766  N  N     . LEU A 1  993  ? 153.634 62.270  -7.654  1.00 90.76  ? 993  LEU A N     1 
ATOM   7767  C  CA    . LEU A 1  993  ? 152.389 61.545  -7.352  1.00 89.08  ? 993  LEU A CA    1 
ATOM   7768  C  C     . LEU A 1  993  ? 151.204 62.234  -8.033  1.00 92.78  ? 993  LEU A C     1 
ATOM   7769  O  O     . LEU A 1  993  ? 150.308 61.558  -8.550  1.00 92.57  ? 993  LEU A O     1 
ATOM   7770  C  CB    . LEU A 1  993  ? 152.159 61.412  -5.827  1.00 88.78  ? 993  LEU A CB    1 
ATOM   7771  C  CG    . LEU A 1  993  ? 150.699 61.281  -5.299  1.00 92.11  ? 993  LEU A CG    1 
ATOM   7772  C  CD1   . LEU A 1  993  ? 150.072 59.931  -5.637  1.00 91.21  ? 993  LEU A CD1   1 
ATOM   7773  C  CD2   . LEU A 1  993  ? 150.658 61.423  -3.824  1.00 94.66  ? 993  LEU A CD2   1 
ATOM   7774  N  N     . GLN A 1  994  ? 151.241 63.573  -8.077  1.00 88.57  ? 994  GLN A N     1 
ATOM   7775  C  CA    . GLN A 1  994  ? 150.214 64.391  -8.698  1.00 87.54  ? 994  GLN A CA    1 
ATOM   7776  C  C     . GLN A 1  994  ? 150.001 64.046  -10.172 1.00 91.04  ? 994  GLN A C     1 
ATOM   7777  O  O     . GLN A 1  994  ? 148.854 63.892  -10.614 1.00 89.01  ? 994  GLN A O     1 
ATOM   7778  C  CB    . GLN A 1  994  ? 150.525 65.874  -8.490  1.00 89.29  ? 994  GLN A CB    1 
ATOM   7779  C  CG    . GLN A 1  994  ? 150.093 66.336  -7.113  1.00 95.79  ? 994  GLN A CG    1 
ATOM   7780  C  CD    . GLN A 1  994  ? 150.093 67.824  -6.977  1.00 116.81 ? 994  GLN A CD    1 
ATOM   7781  O  OE1   . GLN A 1  994  ? 150.823 68.380  -6.162  1.00 114.27 ? 994  GLN A OE1   1 
ATOM   7782  N  NE2   . GLN A 1  994  ? 149.252 68.503  -7.748  1.00 112.02 ? 994  GLN A NE2   1 
ATOM   7783  N  N     . GLU A 1  995  ? 151.109 63.857  -10.907 1.00 89.01  ? 995  GLU A N     1 
ATOM   7784  C  CA    . GLU A 1  995  ? 151.094 63.521  -12.331 1.00 89.37  ? 995  GLU A CA    1 
ATOM   7785  C  C     . GLU A 1  995  ? 150.445 62.165  -12.637 1.00 89.85  ? 995  GLU A C     1 
ATOM   7786  O  O     . GLU A 1  995  ? 149.965 61.963  -13.754 1.00 88.16  ? 995  GLU A O     1 
ATOM   7787  C  CB    . GLU A 1  995  ? 152.524 63.604  -12.919 1.00 92.53  ? 995  GLU A CB    1 
ATOM   7788  C  CG    . GLU A 1  995  ? 152.844 64.914  -13.634 1.00 111.81 ? 995  GLU A CG    1 
ATOM   7789  C  CD    . GLU A 1  995  ? 152.280 65.067  -15.041 1.00 154.43 ? 995  GLU A CD    1 
ATOM   7790  O  OE1   . GLU A 1  995  ? 151.036 65.149  -15.188 1.00 155.78 ? 995  GLU A OE1   1 
ATOM   7791  O  OE2   . GLU A 1  995  ? 153.087 65.107  -16.000 1.00 159.60 ? 995  GLU A OE2   1 
ATOM   7792  N  N     . ASN A 1  996  ? 150.415 61.261  -11.627 1.00 85.25  ? 996  ASN A N     1 
ATOM   7793  C  CA    . ASN A 1  996  ? 149.891 59.891  -11.676 1.00 83.54  ? 996  ASN A CA    1 
ATOM   7794  C  C     . ASN A 1  996  ? 148.443 59.673  -11.202 1.00 82.22  ? 996  ASN A C     1 
ATOM   7795  O  O     . ASN A 1  996  ? 147.909 58.573  -11.370 1.00 79.48  ? 996  ASN A O     1 
ATOM   7796  C  CB    . ASN A 1  996  ? 150.827 58.953  -10.938 1.00 88.37  ? 996  ASN A CB    1 
ATOM   7797  C  CG    . ASN A 1  996  ? 152.138 58.768  -11.624 1.00 127.12 ? 996  ASN A CG    1 
ATOM   7798  O  OD1   . ASN A 1  996  ? 152.219 58.156  -12.698 1.00 127.62 ? 996  ASN A OD1   1 
ATOM   7799  N  ND2   . ASN A 1  996  ? 153.191 59.271  -10.997 1.00 123.22 ? 996  ASN A ND2   1 
ATOM   7800  N  N     . LEU A 1  997  ? 147.811 60.698  -10.621 1.00 78.01  ? 997  LEU A N     1 
ATOM   7801  C  CA    . LEU A 1  997  ? 146.414 60.598  -10.177 1.00 77.06  ? 997  LEU A CA    1 
ATOM   7802  C  C     . LEU A 1  997  ? 145.480 60.737  -11.399 1.00 78.19  ? 997  LEU A C     1 
ATOM   7803  O  O     . LEU A 1  997  ? 144.808 61.756  -11.614 1.00 76.89  ? 997  LEU A O     1 
ATOM   7804  C  CB    . LEU A 1  997  ? 146.068 61.623  -9.076  1.00 77.71  ? 997  LEU A CB    1 
ATOM   7805  C  CG    . LEU A 1  997  ? 146.997 61.712  -7.884  1.00 83.03  ? 997  LEU A CG    1 
ATOM   7806  C  CD1   . LEU A 1  997  ? 146.912 63.074  -7.262  1.00 83.49  ? 997  LEU A CD1   1 
ATOM   7807  C  CD2   . LEU A 1  997  ? 146.714 60.616  -6.882  1.00 84.97  ? 997  LEU A CD2   1 
ATOM   7808  N  N     . LEU A 1  998  ? 145.438 59.673  -12.184 1.00 73.26  ? 998  LEU A N     1 
ATOM   7809  C  CA    . LEU A 1  998  ? 144.695 59.621  -13.423 1.00 71.82  ? 998  LEU A CA    1 
ATOM   7810  C  C     . LEU A 1  998  ? 143.238 59.205  -13.425 1.00 75.51  ? 998  LEU A C     1 
ATOM   7811  O  O     . LEU A 1  998  ? 142.873 58.107  -12.981 1.00 74.07  ? 998  LEU A O     1 
ATOM   7812  C  CB    . LEU A 1  998  ? 145.483 58.843  -14.439 1.00 71.11  ? 998  LEU A CB    1 
ATOM   7813  C  CG    . LEU A 1  998  ? 146.423 59.692  -15.163 1.00 75.27  ? 998  LEU A CG    1 
ATOM   7814  C  CD1   . LEU A 1  998  ? 147.831 59.406  -14.733 1.00 75.21  ? 998  LEU A CD1   1 
ATOM   7815  C  CD2   . LEU A 1  998  ? 146.186 59.558  -16.638 1.00 79.65  ? 998  LEU A CD2   1 
ATOM   7816  N  N     . VAL A 1  999  ? 142.429 60.083  -14.040 1.00 72.96  ? 999  VAL A N     1 
ATOM   7817  C  CA    . VAL A 1  999  ? 140.995 59.946  -14.239 1.00 72.97  ? 999  VAL A CA    1 
ATOM   7818  C  C     . VAL A 1  999  ? 140.683 59.847  -15.739 1.00 81.60  ? 999  VAL A C     1 
ATOM   7819  O  O     . VAL A 1  999  ? 139.968 58.934  -16.139 1.00 81.51  ? 999  VAL A O     1 
ATOM   7820  C  CB    . VAL A 1  999  ? 140.192 61.058  -13.536 1.00 76.19  ? 999  VAL A CB    1 
ATOM   7821  C  CG1   . VAL A 1  999  ? 138.768 60.601  -13.268 1.00 75.04  ? 999  VAL A CG1   1 
ATOM   7822  C  CG2   . VAL A 1  999  ? 140.853 61.469  -12.231 1.00 76.37  ? 999  VAL A CG2   1 
ATOM   7823  N  N     . LEU A 1  1000 ? 141.247 60.749  -16.568 1.00 81.86  ? 1000 LEU A N     1 
ATOM   7824  C  CA    . LEU A 1  1000 ? 141.077 60.754  -18.037 1.00 83.07  ? 1000 LEU A CA    1 
ATOM   7825  C  C     . LEU A 1  1000 ? 142.420 60.469  -18.730 1.00 91.15  ? 1000 LEU A C     1 
ATOM   7826  O  O     . LEU A 1  1000 ? 143.464 61.001  -18.323 1.00 91.18  ? 1000 LEU A O     1 
ATOM   7827  C  CB    . LEU A 1  1000 ? 140.473 62.070  -18.519 1.00 83.22  ? 1000 LEU A CB    1 
ATOM   7828  C  CG    . LEU A 1  1000 ? 139.151 62.392  -17.893 1.00 86.90  ? 1000 LEU A CG    1 
ATOM   7829  C  CD1   . LEU A 1  1000 ? 139.134 63.782  -17.390 1.00 86.93  ? 1000 LEU A CD1   1 
ATOM   7830  C  CD2   . LEU A 1  1000 ? 138.021 62.103  -18.836 1.00 90.96  ? 1000 LEU A CD2   1 
ATOM   7831  N  N     . ARG A 1  1001 ? 142.407 59.613  -19.756 1.00 90.19  ? 1001 ARG A N     1 
ATOM   7832  C  CA    . ARG A 1  1001 ? 143.681 59.216  -20.330 1.00 91.77  ? 1001 ARG A CA    1 
ATOM   7833  C  C     . ARG A 1  1001 ? 144.182 59.870  -21.608 1.00 97.43  ? 1001 ARG A C     1 
ATOM   7834  O  O     . ARG A 1  1001 ? 145.414 59.970  -21.771 1.00 99.20  ? 1001 ARG A O     1 
ATOM   7835  C  CB    . ARG A 1  1001 ? 143.858 57.691  -20.319 1.00 92.40  ? 1001 ARG A CB    1 
ATOM   7836  C  CG    . ARG A 1  1001 ? 144.509 57.158  -19.044 1.00 96.45  ? 1001 ARG A CG    1 
ATOM   7837  C  CD    . ARG A 1  1001 ? 143.982 55.784  -18.706 1.00 99.91  ? 1001 ARG A CD    1 
ATOM   7838  N  NE    . ARG A 1  1001 ? 143.216 55.790  -17.461 1.00 104.54 ? 1001 ARG A NE    1 
ATOM   7839  C  CZ    . ARG A 1  1001 ? 143.745 55.563  -16.261 1.00 114.56 ? 1001 ARG A CZ    1 
ATOM   7840  N  NH1   . ARG A 1  1001 ? 145.052 55.314  -16.137 1.00 81.58  ? 1001 ARG A NH1   1 
ATOM   7841  N  NH2   . ARG A 1  1001 ? 142.975 55.587  -15.174 1.00 104.16 ? 1001 ARG A NH2   1 
ATOM   7842  N  N     . GLY A 1  1002 ? 143.268 60.326  -22.465 1.00 92.40  ? 1002 GLY A N     1 
ATOM   7843  C  CA    . GLY A 1  1002 ? 143.602 60.968  -23.741 1.00 93.30  ? 1002 GLY A CA    1 
ATOM   7844  C  C     . GLY A 1  1002 ? 144.841 61.862  -23.888 1.00 97.83  ? 1002 GLY A C     1 
ATOM   7845  O  O     . GLY A 1  1002 ? 145.158 62.675  -23.008 1.00 97.10  ? 1002 GLY A O     1 
ATOM   7846  N  N     . LYS A 1  1003 ? 145.531 61.734  -25.046 1.00 95.33  ? 1003 LYS A N     1 
ATOM   7847  C  CA    . LYS A 1  1003 ? 146.715 62.525  -25.408 1.00 96.62  ? 1003 LYS A CA    1 
ATOM   7848  C  C     . LYS A 1  1003 ? 146.293 63.735  -26.268 1.00 101.26 ? 1003 LYS A C     1 
ATOM   7849  O  O     . LYS A 1  1003 ? 146.458 63.720  -27.494 1.00 101.01 ? 1003 LYS A O     1 
ATOM   7850  C  CB    . LYS A 1  1003 ? 147.749 61.675  -26.174 1.00 99.69  ? 1003 LYS A CB    1 
ATOM   7851  C  CG    . LYS A 1  1003 ? 148.419 60.566  -25.378 1.00 116.68 ? 1003 LYS A CG    1 
ATOM   7852  C  CD    . LYS A 1  1003 ? 149.242 59.663  -26.309 1.00 123.30 ? 1003 LYS A CD    1 
ATOM   7853  C  CE    . LYS A 1  1003 ? 150.198 58.758  -25.570 1.00 125.99 ? 1003 LYS A CE    1 
ATOM   7854  N  NZ    . LYS A 1  1003 ? 150.936 57.861  -26.497 1.00 131.38 ? 1003 LYS A NZ    1 
ATOM   7855  N  N     . ASN A 1  1004 ? 145.713 64.761  -25.618 1.00 97.64  ? 1004 ASN A N     1 
ATOM   7856  C  CA    . ASN A 1  1004 ? 145.263 66.014  -26.230 1.00 97.56  ? 1004 ASN A CA    1 
ATOM   7857  C  C     . ASN A 1  1004 ? 144.894 67.034  -25.167 1.00 100.55 ? 1004 ASN A C     1 
ATOM   7858  O  O     . ASN A 1  1004 ? 144.379 66.662  -24.107 1.00 99.66  ? 1004 ASN A O     1 
ATOM   7859  C  CB    . ASN A 1  1004 ? 144.092 65.804  -27.186 1.00 96.29  ? 1004 ASN A CB    1 
ATOM   7860  C  CG    . ASN A 1  1004 ? 142.811 65.510  -26.493 1.00 116.48 ? 1004 ASN A CG    1 
ATOM   7861  O  OD1   . ASN A 1  1004 ? 142.088 66.412  -26.049 1.00 105.96 ? 1004 ASN A OD1   1 
ATOM   7862  N  ND2   . ASN A 1  1004 ? 142.494 64.239  -26.423 1.00 114.18 ? 1004 ASN A ND2   1 
ATOM   7863  N  N     . GLU A 1  1005 ? 145.070 68.319  -25.494 1.00 96.41  ? 1005 GLU A N     1 
ATOM   7864  C  CA    . GLU A 1  1005 ? 144.797 69.420  -24.587 1.00 95.79  ? 1005 GLU A CA    1 
ATOM   7865  C  C     . GLU A 1  1005 ? 143.440 69.411  -23.907 1.00 92.63  ? 1005 GLU A C     1 
ATOM   7866  O  O     . GLU A 1  1005 ? 143.400 69.509  -22.685 1.00 91.09  ? 1005 GLU A O     1 
ATOM   7867  C  CB    . GLU A 1  1005 ? 145.155 70.777  -25.214 1.00 99.34  ? 1005 GLU A CB    1 
ATOM   7868  C  CG    . GLU A 1  1005 ? 145.666 71.827  -24.218 1.00 120.18 ? 1005 GLU A CG    1 
ATOM   7869  C  CD    . GLU A 1  1005 ? 146.913 71.606  -23.356 1.00 146.87 ? 1005 GLU A CD    1 
ATOM   7870  O  OE1   . GLU A 1  1005 ? 147.427 70.461  -23.262 1.00 127.15 ? 1005 GLU A OE1   1 
ATOM   7871  O  OE2   . GLU A 1  1005 ? 147.345 72.601  -22.726 1.00 141.52 ? 1005 GLU A OE2   1 
ATOM   7872  N  N     . ILE A 1  1006 ? 142.353 69.227  -24.669 1.00 85.87  ? 1006 ILE A N     1 
ATOM   7873  C  CA    . ILE A 1  1006 ? 140.989 69.176  -24.126 1.00 83.92  ? 1006 ILE A CA    1 
ATOM   7874  C  C     . ILE A 1  1006 ? 140.885 68.153  -22.978 1.00 86.64  ? 1006 ILE A C     1 
ATOM   7875  O  O     . ILE A 1  1006 ? 140.538 68.512  -21.839 1.00 85.11  ? 1006 ILE A O     1 
ATOM   7876  C  CB    . ILE A 1  1006 ? 139.929 68.904  -25.229 1.00 86.13  ? 1006 ILE A CB    1 
ATOM   7877  C  CG1   . ILE A 1  1006 ? 139.987 69.971  -26.320 1.00 87.94  ? 1006 ILE A CG1   1 
ATOM   7878  C  CG2   . ILE A 1  1006 ? 138.528 68.802  -24.624 1.00 85.41  ? 1006 ILE A CG2   1 
ATOM   7879  C  CD1   . ILE A 1  1006 ? 138.776 70.050  -27.215 1.00 99.29  ? 1006 ILE A CD1   1 
ATOM   7880  N  N     . ILE A 1  1007 ? 141.209 66.882  -23.295 1.00 82.61  ? 1007 ILE A N     1 
ATOM   7881  C  CA    . ILE A 1  1007 ? 141.150 65.768  -22.359 1.00 81.11  ? 1007 ILE A CA    1 
ATOM   7882  C  C     . ILE A 1  1007 ? 142.161 65.979  -21.255 1.00 87.13  ? 1007 ILE A C     1 
ATOM   7883  O  O     . ILE A 1  1007 ? 141.864 65.678  -20.098 1.00 87.29  ? 1007 ILE A O     1 
ATOM   7884  C  CB    . ILE A 1  1007 ? 141.287 64.390  -23.073 1.00 83.14  ? 1007 ILE A CB    1 
ATOM   7885  C  CG1   . ILE A 1  1007 ? 140.234 64.173  -24.200 1.00 82.79  ? 1007 ILE A CG1   1 
ATOM   7886  C  CG2   . ILE A 1  1007 ? 141.271 63.229  -22.083 1.00 83.72  ? 1007 ILE A CG2   1 
ATOM   7887  C  CD1   . ILE A 1  1007 ? 138.703 64.521  -23.887 1.00 90.96  ? 1007 ILE A CD1   1 
ATOM   7888  N  N     . GLN A 1  1008 ? 143.335 66.537  -21.589 1.00 84.71  ? 1008 GLN A N     1 
ATOM   7889  C  CA    . GLN A 1  1008 ? 144.341 66.765  -20.562 1.00 84.93  ? 1008 GLN A CA    1 
ATOM   7890  C  C     . GLN A 1  1008 ? 143.982 67.823  -19.543 1.00 87.13  ? 1008 GLN A C     1 
ATOM   7891  O  O     . GLN A 1  1008 ? 144.089 67.547  -18.347 1.00 85.59  ? 1008 GLN A O     1 
ATOM   7892  C  CB    . GLN A 1  1008 ? 145.768 66.826  -21.106 1.00 87.52  ? 1008 GLN A CB    1 
ATOM   7893  C  CG    . GLN A 1  1008 ? 146.359 65.422  -21.344 1.00 98.17  ? 1008 GLN A CG    1 
ATOM   7894  C  CD    . GLN A 1  1008 ? 146.743 64.737  -20.053 1.00 114.16 ? 1008 GLN A CD    1 
ATOM   7895  O  OE1   . GLN A 1  1008 ? 147.479 65.293  -19.227 1.00 107.72 ? 1008 GLN A OE1   1 
ATOM   7896  N  NE2   . GLN A 1  1008 ? 146.234 63.523  -19.841 1.00 107.49 ? 1008 GLN A NE2   1 
ATOM   7897  N  N     . ASN A 1  1009 ? 143.430 68.967  -19.990 1.00 84.11  ? 1009 ASN A N     1 
ATOM   7898  C  CA    . ASN A 1  1009 ? 142.944 70.003  -19.072 1.00 84.42  ? 1009 ASN A CA    1 
ATOM   7899  C  C     . ASN A 1  1009 ? 141.792 69.455  -18.280 1.00 87.79  ? 1009 ASN A C     1 
ATOM   7900  O  O     . ASN A 1  1009 ? 141.656 69.798  -17.106 1.00 87.76  ? 1009 ASN A O     1 
ATOM   7901  C  CB    . ASN A 1  1009 ? 142.466 71.231  -19.807 1.00 85.89  ? 1009 ASN A CB    1 
ATOM   7902  C  CG    . ASN A 1  1009 ? 143.567 72.013  -20.419 1.00 109.88 ? 1009 ASN A CG    1 
ATOM   7903  O  OD1   . ASN A 1  1009 ? 143.540 72.293  -21.620 1.00 104.44 ? 1009 ASN A OD1   1 
ATOM   7904  N  ND2   . ASN A 1  1009 ? 144.548 72.394  -19.604 1.00 103.82 ? 1009 ASN A ND2   1 
ATOM   7905  N  N     . ALA A 1  1010 ? 140.979 68.576  -18.910 1.00 83.31  ? 1010 ALA A N     1 
ATOM   7906  C  CA    . ALA A 1  1010 ? 139.855 67.914  -18.249 1.00 82.62  ? 1010 ALA A CA    1 
ATOM   7907  C  C     . ALA A 1  1010 ? 140.334 67.135  -17.031 1.00 83.96  ? 1010 ALA A C     1 
ATOM   7908  O  O     . ALA A 1  1010 ? 139.715 67.230  -15.960 1.00 82.73  ? 1010 ALA A O     1 
ATOM   7909  C  CB    . ALA A 1  1010 ? 139.138 66.982  -19.218 1.00 83.21  ? 1010 ALA A CB    1 
ATOM   7910  N  N     . GLN A 1  1011 ? 141.459 66.393  -17.206 1.00 78.99  ? 1011 GLN A N     1 
ATOM   7911  C  CA    . GLN A 1  1011 ? 142.105 65.616  -16.167 1.00 77.54  ? 1011 GLN A CA    1 
ATOM   7912  C  C     . GLN A 1  1011 ? 142.558 66.561  -15.052 1.00 85.53  ? 1011 GLN A C     1 
ATOM   7913  O  O     . GLN A 1  1011 ? 142.159 66.364  -13.897 1.00 85.91  ? 1011 GLN A O     1 
ATOM   7914  C  CB    . GLN A 1  1011 ? 143.260 64.803  -16.752 1.00 77.41  ? 1011 GLN A CB    1 
ATOM   7915  C  CG    . GLN A 1  1011 ? 144.307 64.365  -15.738 1.00 67.40  ? 1011 GLN A CG    1 
ATOM   7916  C  CD    . GLN A 1  1011 ? 143.769 63.452  -14.673 1.00 79.96  ? 1011 GLN A CD    1 
ATOM   7917  O  OE1   . GLN A 1  1011 ? 143.275 62.364  -14.945 1.00 76.69  ? 1011 GLN A OE1   1 
ATOM   7918  N  NE2   . GLN A 1  1011 ? 143.858 63.874  -13.429 1.00 72.32  ? 1011 GLN A NE2   1 
ATOM   7919  N  N     . ARG A 1  1012 ? 143.319 67.622  -15.411 1.00 83.78  ? 1012 ARG A N     1 
ATOM   7920  C  CA    . ARG A 1  1012 ? 143.834 68.622  -14.472 1.00 84.95  ? 1012 ARG A CA    1 
ATOM   7921  C  C     . ARG A 1  1012 ? 142.742 69.128  -13.570 1.00 88.20  ? 1012 ARG A C     1 
ATOM   7922  O  O     . ARG A 1  1012 ? 142.928 69.171  -12.358 1.00 87.09  ? 1012 ARG A O     1 
ATOM   7923  C  CB    . ARG A 1  1012 ? 144.485 69.803  -15.217 1.00 90.42  ? 1012 ARG A CB    1 
ATOM   7924  C  CG    . ARG A 1  1012 ? 145.914 69.543  -15.705 1.00 113.64 ? 1012 ARG A CG    1 
ATOM   7925  C  CD    . ARG A 1  1012 ? 146.369 70.543  -16.770 1.00 134.59 ? 1012 ARG A CD    1 
ATOM   7926  N  NE    . ARG A 1  1012 ? 146.733 69.873  -18.024 1.00 148.98 ? 1012 ARG A NE    1 
ATOM   7927  C  CZ    . ARG A 1  1012 ? 147.251 70.480  -19.088 1.00 163.28 ? 1012 ARG A CZ    1 
ATOM   7928  N  NH1   . ARG A 1  1012 ? 147.494 71.786  -19.065 1.00 152.92 ? 1012 ARG A NH1   1 
ATOM   7929  N  NH2   . ARG A 1  1012 ? 147.543 69.783  -20.180 1.00 146.55 ? 1012 ARG A NH2   1 
ATOM   7930  N  N     . ASP A 1  1013 ? 141.588 69.460  -14.160 1.00 86.27  ? 1013 ASP A N     1 
ATOM   7931  C  CA    . ASP A 1  1013 ? 140.439 70.008  -13.454 1.00 87.40  ? 1013 ASP A CA    1 
ATOM   7932  C  C     . ASP A 1  1013 ? 139.809 69.019  -12.506 1.00 89.49  ? 1013 ASP A C     1 
ATOM   7933  O  O     . ASP A 1  1013 ? 139.623 69.340  -11.335 1.00 88.54  ? 1013 ASP A O     1 
ATOM   7934  C  CB    . ASP A 1  1013 ? 139.413 70.600  -14.438 1.00 91.01  ? 1013 ASP A CB    1 
ATOM   7935  C  CG    . ASP A 1  1013 ? 139.901 71.847  -15.167 1.00 117.24 ? 1013 ASP A CG    1 
ATOM   7936  O  OD1   . ASP A 1  1013 ? 140.477 72.753  -14.493 1.00 121.31 ? 1013 ASP A OD1   1 
ATOM   7937  O  OD2   . ASP A 1  1013 ? 139.682 71.937  -16.407 1.00 127.19 ? 1013 ASP A OD2   1 
ATOM   7938  N  N     . ALA A 1  1014 ? 139.517 67.810  -13.001 1.00 85.32  ? 1014 ALA A N     1 
ATOM   7939  C  CA    . ALA A 1  1014 ? 138.929 66.697  -12.250 1.00 84.09  ? 1014 ALA A CA    1 
ATOM   7940  C  C     . ALA A 1  1014 ? 139.681 66.422  -10.917 1.00 86.27  ? 1014 ALA A C     1 
ATOM   7941  O  O     . ALA A 1  1014 ? 139.084 66.128  -9.856  1.00 84.73  ? 1014 ALA A O     1 
ATOM   7942  C  CB    . ALA A 1  1014 ? 138.970 65.450  -13.123 1.00 84.30  ? 1014 ALA A CB    1 
ATOM   7943  N  N     . VAL A 1  1015 ? 141.007 66.547  -11.004 1.00 81.52  ? 1015 VAL A N     1 
ATOM   7944  C  CA    . VAL A 1  1015 ? 141.913 66.279  -9.915  1.00 80.24  ? 1015 VAL A CA    1 
ATOM   7945  C  C     . VAL A 1  1015 ? 142.253 67.507  -9.012  1.00 82.67  ? 1015 VAL A C     1 
ATOM   7946  O  O     . VAL A 1  1015 ? 142.784 67.317  -7.913  1.00 81.55  ? 1015 VAL A O     1 
ATOM   7947  C  CB    . VAL A 1  1015 ? 143.106 65.497  -10.503 1.00 83.58  ? 1015 VAL A CB    1 
ATOM   7948  C  CG1   . VAL A 1  1015 ? 144.270 66.394  -10.860 1.00 84.55  ? 1015 VAL A CG1   1 
ATOM   7949  C  CG2   . VAL A 1  1015 ? 143.529 64.357  -9.603  1.00 83.08  ? 1015 VAL A CG2   1 
ATOM   7950  N  N     . THR A 1  1016 ? 141.869 68.742  -9.454  1.00 78.81  ? 1016 THR A N     1 
ATOM   7951  C  CA    . THR A 1  1016 ? 142.101 70.044  -8.785  1.00 79.01  ? 1016 THR A CA    1 
ATOM   7952  C  C     . THR A 1  1016 ? 141.996 70.050  -7.248  1.00 82.96  ? 1016 THR A C     1 
ATOM   7953  O  O     . THR A 1  1016 ? 142.987 70.349  -6.574  1.00 82.55  ? 1016 THR A O     1 
ATOM   7954  C  CB    . THR A 1  1016 ? 141.258 71.167  -9.442  1.00 83.17  ? 1016 THR A CB    1 
ATOM   7955  O  OG1   . THR A 1  1016 ? 141.788 71.510  -10.724 1.00 86.75  ? 1016 THR A OG1   1 
ATOM   7956  C  CG2   . THR A 1  1016 ? 141.148 72.415  -8.582  1.00 77.84  ? 1016 THR A CG2   1 
ATOM   7957  N  N     . LEU A 1  1017 ? 140.790 69.738  -6.713  1.00 79.45  ? 1017 LEU A N     1 
ATOM   7958  C  CA    . LEU A 1  1017 ? 140.476 69.755  -5.287  1.00 78.88  ? 1017 LEU A CA    1 
ATOM   7959  C  C     . LEU A 1  1017 ? 141.300 68.764  -4.511  1.00 84.91  ? 1017 LEU A C     1 
ATOM   7960  O  O     . LEU A 1  1017 ? 141.846 69.123  -3.460  1.00 85.38  ? 1017 LEU A O     1 
ATOM   7961  C  CB    . LEU A 1  1017 ? 138.978 69.518  -5.046  1.00 77.49  ? 1017 LEU A CB    1 
ATOM   7962  C  CG    . LEU A 1  1017 ? 138.442 69.791  -3.646  1.00 81.15  ? 1017 LEU A CG    1 
ATOM   7963  C  CD1   . LEU A 1  1017 ? 138.733 71.203  -3.206  1.00 81.66  ? 1017 LEU A CD1   1 
ATOM   7964  C  CD2   . LEU A 1  1017 ? 136.955 69.525  -3.583  1.00 82.39  ? 1017 LEU A CD2   1 
ATOM   7965  N  N     . PHE A 1  1018 ? 141.410 67.518  -5.029  1.00 81.83  ? 1018 PHE A N     1 
ATOM   7966  C  CA    . PHE A 1  1018 ? 142.170 66.455  -4.356  1.00 81.67  ? 1018 PHE A CA    1 
ATOM   7967  C  C     . PHE A 1  1018 ? 143.596 66.869  -4.111  1.00 86.57  ? 1018 PHE A C     1 
ATOM   7968  O  O     . PHE A 1  1018 ? 144.138 66.664  -3.025  1.00 85.48  ? 1018 PHE A O     1 
ATOM   7969  C  CB    . PHE A 1  1018 ? 142.120 65.136  -5.146  1.00 82.35  ? 1018 PHE A CB    1 
ATOM   7970  C  CG    . PHE A 1  1018 ? 142.858 64.011  -4.467  1.00 83.23  ? 1018 PHE A CG    1 
ATOM   7971  C  CD1   . PHE A 1  1018 ? 142.389 63.470  -3.277  1.00 85.66  ? 1018 PHE A CD1   1 
ATOM   7972  C  CD2   . PHE A 1  1018 ? 144.026 63.497  -5.014  1.00 85.76  ? 1018 PHE A CD2   1 
ATOM   7973  C  CE1   . PHE A 1  1018 ? 143.079 62.434  -2.647  1.00 87.00  ? 1018 PHE A CE1   1 
ATOM   7974  C  CE2   . PHE A 1  1018 ? 144.721 62.464  -4.381  1.00 88.57  ? 1018 PHE A CE2   1 
ATOM   7975  C  CZ    . PHE A 1  1018 ? 144.242 61.937  -3.204  1.00 86.41  ? 1018 PHE A CZ    1 
ATOM   7976  N  N     . CYS A 1  1019 ? 144.173 67.501  -5.121  1.00 84.98  ? 1019 CYS A N     1 
ATOM   7977  C  CA    . CYS A 1  1019 ? 145.531 67.962  -5.082  1.00 86.65  ? 1019 CYS A CA    1 
ATOM   7978  C  C     . CYS A 1  1019 ? 145.750 69.008  -4.049  1.00 88.84  ? 1019 CYS A C     1 
ATOM   7979  O  O     . CYS A 1  1019 ? 146.788 68.958  -3.402  1.00 89.21  ? 1019 CYS A O     1 
ATOM   7980  C  CB    . CYS A 1  1019 ? 145.978 68.409  -6.461  1.00 88.60  ? 1019 CYS A CB    1 
ATOM   7981  S  SG    . CYS A 1  1019 ? 146.053 67.057  -7.659  1.00 92.44  ? 1019 CYS A SG    1 
ATOM   7982  N  N     . CYS A 1  1020 ? 144.764 69.903  -3.825  1.00 83.59  ? 1020 CYS A N     1 
ATOM   7983  C  CA    . CYS A 1  1020 ? 144.870 70.917  -2.778  1.00 83.79  ? 1020 CYS A CA    1 
ATOM   7984  C  C     . CYS A 1  1020 ? 145.021 70.218  -1.464  1.00 85.40  ? 1020 CYS A C     1 
ATOM   7985  O  O     . CYS A 1  1020 ? 145.952 70.540  -0.717  1.00 87.03  ? 1020 CYS A O     1 
ATOM   7986  C  CB    . CYS A 1  1020 ? 143.656 71.829  -2.760  1.00 84.49  ? 1020 CYS A CB    1 
ATOM   7987  S  SG    . CYS A 1  1020 ? 143.465 72.819  -4.246  1.00 89.15  ? 1020 CYS A SG    1 
ATOM   7988  N  N     . LEU A 1  1021 ? 144.120 69.236  -1.195  1.00 77.45  ? 1021 LEU A N     1 
ATOM   7989  C  CA    . LEU A 1  1021 ? 144.142 68.435  0.021   1.00 76.02  ? 1021 LEU A CA    1 
ATOM   7990  C  C     . LEU A 1  1021 ? 145.507 67.767  0.131   1.00 79.29  ? 1021 LEU A C     1 
ATOM   7991  O  O     . LEU A 1  1021 ? 146.178 67.916  1.152   1.00 79.55  ? 1021 LEU A O     1 
ATOM   7992  C  CB    . LEU A 1  1021 ? 142.997 67.391  0.011   1.00 74.60  ? 1021 LEU A CB    1 
ATOM   7993  C  CG    . LEU A 1  1021 ? 143.090 66.190  0.986   1.00 77.67  ? 1021 LEU A CG    1 
ATOM   7994  C  CD1   . LEU A 1  1021 ? 142.649 66.570  2.389   1.00 77.43  ? 1021 LEU A CD1   1 
ATOM   7995  C  CD2   . LEU A 1  1021 ? 142.273 65.023  0.478   1.00 77.89  ? 1021 LEU A CD2   1 
ATOM   7996  N  N     . LEU A 1  1022 ? 145.935 67.109  -0.958  1.00 74.93  ? 1022 LEU A N     1 
ATOM   7997  C  CA    . LEU A 1  1022 ? 147.199 66.402  -1.064  1.00 75.22  ? 1022 LEU A CA    1 
ATOM   7998  C  C     . LEU A 1  1022 ? 148.421 67.297  -0.721  1.00 80.46  ? 1022 LEU A C     1 
ATOM   7999  O  O     . LEU A 1  1022 ? 149.213 66.945  0.166   1.00 80.02  ? 1022 LEU A O     1 
ATOM   8000  C  CB    . LEU A 1  1022 ? 147.284 65.743  -2.459  1.00 74.78  ? 1022 LEU A CB    1 
ATOM   8001  C  CG    . LEU A 1  1022 ? 148.583 65.049  -2.880  1.00 80.30  ? 1022 LEU A CG    1 
ATOM   8002  C  CD1   . LEU A 1  1022 ? 149.001 63.977  -1.905  1.00 80.05  ? 1022 LEU A CD1   1 
ATOM   8003  C  CD2   . LEU A 1  1022 ? 148.436 64.453  -4.241  1.00 83.28  ? 1022 LEU A CD2   1 
ATOM   8004  N  N     . ARG A 1  1023 ? 148.520 68.471  -1.380  1.00 77.61  ? 1023 ARG A N     1 
ATOM   8005  C  CA    . ARG A 1  1023 ? 149.587 69.456  -1.185  1.00 78.56  ? 1023 ARG A CA    1 
ATOM   8006  C  C     . ARG A 1  1023 ? 149.610 69.974  0.230   1.00 84.06  ? 1023 ARG A C     1 
ATOM   8007  O  O     . ARG A 1  1023 ? 150.700 70.225  0.757   1.00 85.10  ? 1023 ARG A O     1 
ATOM   8008  C  CB    . ARG A 1  1023 ? 149.444 70.633  -2.158  1.00 78.35  ? 1023 ARG A CB    1 
ATOM   8009  C  CG    . ARG A 1  1023 ? 149.891 70.303  -3.568  1.00 83.65  ? 1023 ARG A CG    1 
ATOM   8010  C  CD    . ARG A 1  1023 ? 149.867 71.520  -4.453  1.00 82.63  ? 1023 ARG A CD    1 
ATOM   8011  N  NE    . ARG A 1  1023 ? 149.216 71.239  -5.729  1.00 79.51  ? 1023 ARG A NE    1 
ATOM   8012  C  CZ    . ARG A 1  1023 ? 147.972 71.596  -6.017  1.00 92.45  ? 1023 ARG A CZ    1 
ATOM   8013  N  NH1   . ARG A 1  1023 ? 147.246 72.262  -5.131  1.00 76.74  ? 1023 ARG A NH1   1 
ATOM   8014  N  NH2   . ARG A 1  1023 ? 147.445 71.300  -7.202  1.00 82.19  ? 1023 ARG A NH2   1 
ATOM   8015  N  N     . SER A 1  1024 ? 148.407 70.153  0.836   1.00 80.26  ? 1024 SER A N     1 
ATOM   8016  C  CA    . SER A 1  1024 ? 148.248 70.633  2.206   1.00 80.63  ? 1024 SER A CA    1 
ATOM   8017  C  C     . SER A 1  1024 ? 148.712 69.566  3.195   1.00 84.56  ? 1024 SER A C     1 
ATOM   8018  O  O     . SER A 1  1024 ? 149.571 69.845  4.031   1.00 86.11  ? 1024 SER A O     1 
ATOM   8019  C  CB    . SER A 1  1024 ? 146.810 71.081  2.479   1.00 83.50  ? 1024 SER A CB    1 
ATOM   8020  O  OG    . SER A 1  1024 ? 146.034 70.167  3.242   1.00 89.98  ? 1024 SER A OG    1 
ATOM   8021  N  N     . ARG A 1  1025 ? 148.195 68.339  3.066   1.00 79.10  ? 1025 ARG A N     1 
ATOM   8022  C  CA    . ARG A 1  1025 ? 148.560 67.265  3.984   1.00 78.65  ? 1025 ARG A CA    1 
ATOM   8023  C  C     . ARG A 1  1025 ? 149.979 66.762  3.774   1.00 83.75  ? 1025 ARG A C     1 
ATOM   8024  O  O     . ARG A 1  1025 ? 150.526 66.176  4.692   1.00 83.82  ? 1025 ARG A O     1 
ATOM   8025  C  CB    . ARG A 1  1025 ? 147.516 66.115  4.015   1.00 76.59  ? 1025 ARG A CB    1 
ATOM   8026  C  CG    . ARG A 1  1025 ? 146.058 66.545  4.323   1.00 78.69  ? 1025 ARG A CG    1 
ATOM   8027  C  CD    . ARG A 1  1025 ? 145.552 65.994  5.635   1.00 75.23  ? 1025 ARG A CD    1 
ATOM   8028  N  NE    . ARG A 1  1025 ? 144.104 66.139  5.788   1.00 87.51  ? 1025 ARG A NE    1 
ATOM   8029  C  CZ    . ARG A 1  1025 ? 143.246 65.115  5.875   1.00 124.00 ? 1025 ARG A CZ    1 
ATOM   8030  N  NH1   . ARG A 1  1025 ? 143.683 63.859  5.792   1.00 117.26 ? 1025 ARG A NH1   1 
ATOM   8031  N  NH2   . ARG A 1  1025 ? 141.947 65.339  6.043   1.00 119.49 ? 1025 ARG A NH2   1 
ATOM   8032  N  N     . LEU A 1  1026 ? 150.600 67.016  2.608   1.00 81.35  ? 1026 LEU A N     1 
ATOM   8033  C  CA    . LEU A 1  1026 ? 151.974 66.548  2.365   1.00 82.27  ? 1026 LEU A CA    1 
ATOM   8034  C  C     . LEU A 1  1026 ? 153.028 67.629  2.110   1.00 91.75  ? 1026 LEU A C     1 
ATOM   8035  O  O     . LEU A 1  1026 ? 153.983 67.387  1.358   1.00 93.07  ? 1026 LEU A O     1 
ATOM   8036  C  CB    . LEU A 1  1026 ? 152.025 65.462  1.287   1.00 80.81  ? 1026 LEU A CB    1 
ATOM   8037  C  CG    . LEU A 1  1026 ? 151.373 64.155  1.641   1.00 83.78  ? 1026 LEU A CG    1 
ATOM   8038  C  CD1   . LEU A 1  1026 ? 151.588 63.167  0.558   1.00 83.45  ? 1026 LEU A CD1   1 
ATOM   8039  C  CD2   . LEU A 1  1026 ? 151.920 63.599  2.938   1.00 85.91  ? 1026 LEU A CD2   1 
ATOM   8040  N  N     . ALA A 1  1027 ? 152.870 68.814  2.744   1.00 89.65  ? 1027 ALA A N     1 
ATOM   8041  C  CA    . ALA A 1  1027 ? 153.827 69.915  2.622   1.00 90.69  ? 1027 ALA A CA    1 
ATOM   8042  C  C     . ALA A 1  1027 ? 155.076 69.564  3.451   1.00 95.03  ? 1027 ALA A C     1 
ATOM   8043  O  O     . ALA A 1  1027 ? 154.986 68.760  4.382   1.00 93.87  ? 1027 ALA A O     1 
ATOM   8044  C  CB    . ALA A 1  1027 ? 153.196 71.206  3.115   1.00 91.99  ? 1027 ALA A CB    1 
ATOM   8045  N  N     . THR A 1  1028 ? 156.234 70.132  3.096   1.00 93.15  ? 1028 THR A N     1 
ATOM   8046  C  CA    . THR A 1  1028 ? 157.512 69.834  3.753   1.00 94.06  ? 1028 THR A CA    1 
ATOM   8047  C  C     . THR A 1  1028 ? 157.528 69.932  5.279   1.00 97.32  ? 1028 THR A C     1 
ATOM   8048  O  O     . THR A 1  1028 ? 157.975 68.979  5.920   1.00 97.01  ? 1028 THR A O     1 
ATOM   8049  C  CB    . THR A 1  1028 ? 158.692 70.514  3.043   1.00 105.47 ? 1028 THR A CB    1 
ATOM   8050  O  OG1   . THR A 1  1028 ? 158.597 70.263  1.640   1.00 105.77 ? 1028 THR A OG1   1 
ATOM   8051  C  CG2   . THR A 1  1028 ? 160.044 70.017  3.544   1.00 104.49 ? 1028 THR A CG2   1 
ATOM   8052  N  N     . ARG A 1  1029 ? 157.042 71.048  5.857   1.00 93.36  ? 1029 ARG A N     1 
ATOM   8053  C  CA    . ARG A 1  1029 ? 157.039 71.207  7.317   1.00 93.74  ? 1029 ARG A CA    1 
ATOM   8054  C  C     . ARG A 1  1029 ? 156.155 70.185  8.024   1.00 95.78  ? 1029 ARG A C     1 
ATOM   8055  O  O     . ARG A 1  1029 ? 156.536 69.645  9.056   1.00 95.72  ? 1029 ARG A O     1 
ATOM   8056  C  CB    . ARG A 1  1029 ? 156.649 72.629  7.723   1.00 96.27  ? 1029 ARG A CB    1 
ATOM   8057  C  CG    . ARG A 1  1029 ? 156.778 72.896  9.224   1.00 105.06 ? 1029 ARG A CG    1 
ATOM   8058  C  CD    . ARG A 1  1029 ? 157.347 74.265  9.491   1.00 106.41 ? 1029 ARG A CD    1 
ATOM   8059  N  NE    . ARG A 1  1029 ? 158.694 74.161  10.033  1.00 106.30 ? 1029 ARG A NE    1 
ATOM   8060  C  CZ    . ARG A 1  1029 ? 159.531 75.183  10.146  1.00 129.92 ? 1029 ARG A CZ    1 
ATOM   8061  N  NH1   . ARG A 1  1029 ? 159.168 76.394  9.740   1.00 121.11 ? 1029 ARG A NH1   1 
ATOM   8062  N  NH2   . ARG A 1  1029 ? 160.739 75.004  10.667  1.00 122.51 ? 1029 ARG A NH2   1 
ATOM   8063  N  N     . ARG A 1  1030 ? 154.986 69.920  7.455   1.00 90.85  ? 1030 ARG A N     1 
ATOM   8064  C  CA    . ARG A 1  1030 ? 154.010 68.961  7.952   1.00 89.17  ? 1030 ARG A CA    1 
ATOM   8065  C  C     . ARG A 1  1030 ? 154.657 67.572  8.031   1.00 91.71  ? 1030 ARG A C     1 
ATOM   8066  O  O     . ARG A 1  1030 ? 154.781 67.026  9.124   1.00 92.03  ? 1030 ARG A O     1 
ATOM   8067  C  CB    . ARG A 1  1030 ? 152.804 68.947  6.999   1.00 87.96  ? 1030 ARG A CB    1 
ATOM   8068  C  CG    . ARG A 1  1030 ? 151.528 68.437  7.611   1.00 96.43  ? 1030 ARG A CG    1 
ATOM   8069  C  CD    . ARG A 1  1030 ? 150.598 69.574  7.935   1.00 104.39 ? 1030 ARG A CD    1 
ATOM   8070  N  NE    . ARG A 1  1030 ? 149.438 69.089  8.674   1.00 107.06 ? 1030 ARG A NE    1 
ATOM   8071  C  CZ    . ARG A 1  1030 ? 148.245 68.886  8.136   1.00 115.78 ? 1030 ARG A CZ    1 
ATOM   8072  N  NH1   . ARG A 1  1030 ? 148.036 69.143  6.851   1.00 88.88  ? 1030 ARG A NH1   1 
ATOM   8073  N  NH2   . ARG A 1  1030 ? 147.242 68.443  8.883   1.00 114.43 ? 1030 ARG A NH2   1 
ATOM   8074  N  N     . VAL A 1  1031 ? 155.145 67.053  6.887   1.00 86.12  ? 1031 VAL A N     1 
ATOM   8075  C  CA    . VAL A 1  1031 ? 155.774 65.742  6.757   1.00 84.97  ? 1031 VAL A CA    1 
ATOM   8076  C  C     . VAL A 1  1031 ? 156.879 65.529  7.776   1.00 89.95  ? 1031 VAL A C     1 
ATOM   8077  O  O     . VAL A 1  1031 ? 156.902 64.495  8.445   1.00 89.68  ? 1031 VAL A O     1 
ATOM   8078  C  CB    . VAL A 1  1031 ? 156.264 65.507  5.305   1.00 88.41  ? 1031 VAL A CB    1 
ATOM   8079  C  CG1   . VAL A 1  1031 ? 157.187 64.291  5.201   1.00 88.18  ? 1031 VAL A CG1   1 
ATOM   8080  C  CG2   . VAL A 1  1031 ? 155.084 65.370  4.350   1.00 87.15  ? 1031 VAL A CG2   1 
ATOM   8081  N  N     . LEU A 1  1032 ? 157.773 66.511  7.906   1.00 87.64  ? 1032 LEU A N     1 
ATOM   8082  C  CA    . LEU A 1  1032 ? 158.939 66.407  8.769   1.00 88.86  ? 1032 LEU A CA    1 
ATOM   8083  C  C     . LEU A 1  1032 ? 158.707 66.581  10.244  1.00 95.83  ? 1032 LEU A C     1 
ATOM   8084  O  O     . LEU A 1  1032 ? 159.202 65.775  11.035  1.00 95.96  ? 1032 LEU A O     1 
ATOM   8085  C  CB    . LEU A 1  1032 ? 160.047 67.359  8.304   1.00 89.65  ? 1032 LEU A CB    1 
ATOM   8086  C  CG    . LEU A 1  1032 ? 160.795 66.989  7.037   1.00 93.50  ? 1032 LEU A CG    1 
ATOM   8087  C  CD1   . LEU A 1  1032 ? 161.765 68.066  6.673   1.00 94.91  ? 1032 LEU A CD1   1 
ATOM   8088  C  CD2   . LEU A 1  1032 ? 161.553 65.692  7.202   1.00 95.25  ? 1032 LEU A CD2   1 
ATOM   8089  N  N     . GLN A 1  1033 ? 158.031 67.672  10.618  1.00 94.30  ? 1033 GLN A N     1 
ATOM   8090  C  CA    . GLN A 1  1033 ? 157.811 68.076  12.003  1.00 95.70  ? 1033 GLN A CA    1 
ATOM   8091  C  C     . GLN A 1  1033 ? 156.650 67.378  12.662  1.00 99.94  ? 1033 GLN A C     1 
ATOM   8092  O  O     . GLN A 1  1033 ? 156.771 67.019  13.840  1.00 100.24 ? 1033 GLN A O     1 
ATOM   8093  C  CB    . GLN A 1  1033 ? 157.623 69.589  12.062  1.00 97.94  ? 1033 GLN A CB    1 
ATOM   8094  C  CG    . GLN A 1  1033 ? 158.041 70.267  13.348  1.00 112.20 ? 1033 GLN A CG    1 
ATOM   8095  C  CD    . GLN A 1  1033 ? 157.795 71.739  13.176  1.00 135.01 ? 1033 GLN A CD    1 
ATOM   8096  O  OE1   . GLN A 1  1033 ? 158.724 72.535  13.001  1.00 135.85 ? 1033 GLN A OE1   1 
ATOM   8097  N  NE2   . GLN A 1  1033 ? 156.528 72.119  13.105  1.00 124.61 ? 1033 GLN A NE2   1 
ATOM   8098  N  N     . GLU A 1  1034 ? 155.523 67.209  11.918  1.00 95.76  ? 1034 GLU A N     1 
ATOM   8099  C  CA    . GLU A 1  1034 ? 154.298 66.549  12.397  1.00 94.75  ? 1034 GLU A CA    1 
ATOM   8100  C  C     . GLU A 1  1034 ? 154.352 64.999  12.247  1.00 98.30  ? 1034 GLU A C     1 
ATOM   8101  O  O     . GLU A 1  1034 ? 154.394 64.282  13.257  1.00 98.17  ? 1034 GLU A O     1 
ATOM   8102  C  CB    . GLU A 1  1034 ? 153.034 67.121  11.708  1.00 94.99  ? 1034 GLU A CB    1 
ATOM   8103  C  CG    . GLU A 1  1034 ? 152.791 68.606  11.923  1.00 105.97 ? 1034 GLU A CG    1 
ATOM   8104  C  CD    . GLU A 1  1034 ? 151.441 69.136  11.466  1.00 126.87 ? 1034 GLU A CD    1 
ATOM   8105  O  OE1   . GLU A 1  1034 ? 150.451 68.366  11.496  1.00 117.03 ? 1034 GLU A OE1   1 
ATOM   8106  O  OE2   . GLU A 1  1034 ? 151.365 70.341  11.121  1.00 117.95 ? 1034 GLU A OE2   1 
ATOM   8107  N  N     . TYR A 1  1035 ? 154.370 64.500  10.993  1.00 93.65  ? 1035 TYR A N     1 
ATOM   8108  C  CA    . TYR A 1  1035 ? 154.349 63.064  10.682  1.00 92.58  ? 1035 TYR A CA    1 
ATOM   8109  C  C     . TYR A 1  1035 ? 155.635 62.328  11.018  1.00 94.29  ? 1035 TYR A C     1 
ATOM   8110  O  O     . TYR A 1  1035 ? 155.607 61.110  11.266  1.00 92.48  ? 1035 TYR A O     1 
ATOM   8111  C  CB    . TYR A 1  1035 ? 153.929 62.804  9.217   1.00 93.44  ? 1035 TYR A CB    1 
ATOM   8112  C  CG    . TYR A 1  1035 ? 152.719 63.586  8.745   1.00 95.37  ? 1035 TYR A CG    1 
ATOM   8113  C  CD1   . TYR A 1  1035 ? 151.698 63.935  9.627   1.00 97.26  ? 1035 TYR A CD1   1 
ATOM   8114  C  CD2   . TYR A 1  1035 ? 152.582 63.954  7.414   1.00 96.21  ? 1035 TYR A CD2   1 
ATOM   8115  C  CE1   . TYR A 1  1035 ? 150.603 64.688  9.208   1.00 97.90  ? 1035 TYR A CE1   1 
ATOM   8116  C  CE2   . TYR A 1  1035 ? 151.483 64.691  6.979   1.00 97.09  ? 1035 TYR A CE2   1 
ATOM   8117  C  CZ    . TYR A 1  1035 ? 150.485 65.043  7.876   1.00 105.88 ? 1035 TYR A CZ    1 
ATOM   8118  O  OH    . TYR A 1  1035 ? 149.389 65.764  7.456   1.00 107.73 ? 1035 TYR A OH    1 
ATOM   8119  N  N     . ARG A 1  1036 ? 156.759 63.074  11.009  1.00 90.15  ? 1036 ARG A N     1 
ATOM   8120  C  CA    . ARG A 1  1036 ? 158.097 62.576  11.295  1.00 89.94  ? 1036 ARG A CA    1 
ATOM   8121  C  C     . ARG A 1  1036 ? 158.496 61.352  10.419  1.00 90.59  ? 1036 ARG A C     1 
ATOM   8122  O  O     . ARG A 1  1036 ? 159.222 60.467  10.890  1.00 90.45  ? 1036 ARG A O     1 
ATOM   8123  C  CB    . ARG A 1  1036 ? 158.240 62.304  12.806  1.00 91.28  ? 1036 ARG A CB    1 
ATOM   8124  C  CG    . ARG A 1  1036 ? 158.722 63.490  13.614  1.00 107.86 ? 1036 ARG A CG    1 
ATOM   8125  C  CD    . ARG A 1  1036 ? 160.200 63.791  13.336  1.00 127.16 ? 1036 ARG A CD    1 
ATOM   8126  N  NE    . ARG A 1  1036 ? 160.947 64.244  14.510  1.00 141.01 ? 1036 ARG A NE    1 
ATOM   8127  C  CZ    . ARG A 1  1036 ? 160.652 65.322  15.234  1.00 156.96 ? 1036 ARG A CZ    1 
ATOM   8128  N  NH1   . ARG A 1  1036 ? 159.579 66.055  14.947  1.00 133.84 ? 1036 ARG A NH1   1 
ATOM   8129  N  NH2   . ARG A 1  1036 ? 161.409 65.659  16.269  1.00 151.75 ? 1036 ARG A NH2   1 
ATOM   8130  N  N     . LEU A 1  1037 ? 158.045 61.329  9.137   1.00 84.03  ? 1037 LEU A N     1 
ATOM   8131  C  CA    . LEU A 1  1037 ? 158.295 60.210  8.223   1.00 82.66  ? 1037 LEU A CA    1 
ATOM   8132  C  C     . LEU A 1  1037 ? 159.728 60.030  7.778   1.00 88.08  ? 1037 LEU A C     1 
ATOM   8133  O  O     . LEU A 1  1037 ? 160.430 61.010  7.545   1.00 88.73  ? 1037 LEU A O     1 
ATOM   8134  C  CB    . LEU A 1  1037 ? 157.407 60.260  6.966   1.00 81.20  ? 1037 LEU A CB    1 
ATOM   8135  C  CG    . LEU A 1  1037 ? 155.912 60.443  7.116   1.00 84.04  ? 1037 LEU A CG    1 
ATOM   8136  C  CD1   . LEU A 1  1037 ? 155.252 60.422  5.762   1.00 83.01  ? 1037 LEU A CD1   1 
ATOM   8137  C  CD2   . LEU A 1  1037 ? 155.309 59.401  8.018   1.00 84.51  ? 1037 LEU A CD2   1 
ATOM   8138  N  N     . THR A 1  1038 ? 160.128 58.758  7.583   1.00 84.98  ? 1038 THR A N     1 
ATOM   8139  C  CA    . THR A 1  1038 ? 161.425 58.347  7.039   1.00 85.83  ? 1038 THR A CA    1 
ATOM   8140  C  C     . THR A 1  1038 ? 161.244 58.340  5.511   1.00 89.30  ? 1038 THR A C     1 
ATOM   8141  O  O     . THR A 1  1038 ? 160.096 58.434  5.058   1.00 87.63  ? 1038 THR A O     1 
ATOM   8142  C  CB    . THR A 1  1038 ? 161.844 56.952  7.577   1.00 97.18  ? 1038 THR A CB    1 
ATOM   8143  O  OG1   . THR A 1  1038 ? 161.224 55.908  6.829   1.00 96.31  ? 1038 THR A OG1   1 
ATOM   8144  C  CG2   . THR A 1  1038 ? 161.554 56.768  9.058   1.00 98.04  ? 1038 THR A CG2   1 
ATOM   8145  N  N     . LYS A 1  1039 ? 162.326 58.223  4.711   1.00 87.06  ? 1039 LYS A N     1 
ATOM   8146  C  CA    . LYS A 1  1039 ? 162.112 58.199  3.261   1.00 87.07  ? 1039 LYS A CA    1 
ATOM   8147  C  C     . LYS A 1  1039 ? 161.220 57.022  2.893   1.00 93.22  ? 1039 LYS A C     1 
ATOM   8148  O  O     . LYS A 1  1039 ? 160.182 57.222  2.242   1.00 92.39  ? 1039 LYS A O     1 
ATOM   8149  C  CB    . LYS A 1  1039 ? 163.418 58.195  2.446   1.00 90.10  ? 1039 LYS A CB    1 
ATOM   8150  C  CG    . LYS A 1  1039 ? 163.196 57.805  0.974   1.00 97.92  ? 1039 LYS A CG    1 
ATOM   8151  C  CD    . LYS A 1  1039 ? 164.192 58.374  -0.029  1.00 102.43 ? 1039 LYS A CD    1 
ATOM   8152  C  CE    . LYS A 1  1039 ? 163.925 57.873  -1.441  1.00 104.59 ? 1039 LYS A CE    1 
ATOM   8153  N  NZ    . LYS A 1  1039 ? 162.644 58.390  -2.027  1.00 106.03 ? 1039 LYS A NZ    1 
ATOM   8154  N  N     . GLN A 1  1040 ? 161.595 55.809  3.372   1.00 90.90  ? 1040 GLN A N     1 
ATOM   8155  C  CA    . GLN A 1  1040 ? 160.853 54.576  3.112   1.00 89.54  ? 1040 GLN A CA    1 
ATOM   8156  C  C     . GLN A 1  1040 ? 159.370 54.652  3.463   1.00 90.15  ? 1040 GLN A C     1 
ATOM   8157  O  O     . GLN A 1  1040 ? 158.543 54.180  2.681   1.00 89.18  ? 1040 GLN A O     1 
ATOM   8158  C  CB    . GLN A 1  1040 ? 161.551 53.336  3.708   1.00 91.81  ? 1040 GLN A CB    1 
ATOM   8159  C  CG    . GLN A 1  1040 ? 161.452 53.155  5.229   1.00 108.82 ? 1040 GLN A CG    1 
ATOM   8160  C  CD    . GLN A 1  1040 ? 161.577 51.716  5.695   1.00 117.51 ? 1040 GLN A CD    1 
ATOM   8161  O  OE1   . GLN A 1  1040 ? 161.260 50.744  4.980   1.00 106.44 ? 1040 GLN A OE1   1 
ATOM   8162  N  NE2   . GLN A 1  1040 ? 161.959 51.561  6.951   1.00 109.72 ? 1040 GLN A NE2   1 
ATOM   8163  N  N     . ALA A 1  1041 ? 159.035 55.285  4.599   1.00 85.71  ? 1041 ALA A N     1 
ATOM   8164  C  CA    . ALA A 1  1041 ? 157.652 55.465  5.031   1.00 84.91  ? 1041 ALA A CA    1 
ATOM   8165  C  C     . ALA A 1  1041 ? 156.915 56.416  4.082   1.00 88.64  ? 1041 ALA A C     1 
ATOM   8166  O  O     . ALA A 1  1041 ? 155.815 56.094  3.622   1.00 87.31  ? 1041 ALA A O     1 
ATOM   8167  C  CB    . ALA A 1  1041 ? 157.609 56.001  6.447   1.00 86.32  ? 1041 ALA A CB    1 
ATOM   8168  N  N     . PHE A 1  1042 ? 157.547 57.563  3.760   1.00 85.41  ? 1042 PHE A N     1 
ATOM   8169  C  CA    . PHE A 1  1042 ? 157.012 58.572  2.850   1.00 84.50  ? 1042 PHE A CA    1 
ATOM   8170  C  C     . PHE A 1  1042 ? 156.768 57.998  1.450   1.00 85.71  ? 1042 PHE A C     1 
ATOM   8171  O  O     . PHE A 1  1042 ? 155.763 58.340  0.824   1.00 83.35  ? 1042 PHE A O     1 
ATOM   8172  C  CB    . PHE A 1  1042 ? 157.955 59.796  2.797   1.00 87.43  ? 1042 PHE A CB    1 
ATOM   8173  C  CG    . PHE A 1  1042 ? 157.580 60.865  1.795   1.00 88.11  ? 1042 PHE A CG    1 
ATOM   8174  C  CD1   . PHE A 1  1042 ? 156.561 61.771  2.068   1.00 89.93  ? 1042 PHE A CD1   1 
ATOM   8175  C  CD2   . PHE A 1  1042 ? 158.253 60.971  0.584   1.00 89.57  ? 1042 PHE A CD2   1 
ATOM   8176  C  CE1   . PHE A 1  1042 ? 156.217 62.753  1.142   1.00 90.47  ? 1042 PHE A CE1   1 
ATOM   8177  C  CE2   . PHE A 1  1042 ? 157.913 61.959  -0.335  1.00 91.92  ? 1042 PHE A CE2   1 
ATOM   8178  C  CZ    . PHE A 1  1042 ? 156.889 62.835  -0.057  1.00 89.66  ? 1042 PHE A CZ    1 
ATOM   8179  N  N     . ASP A 1  1043 ? 157.693 57.139  0.971   1.00 82.85  ? 1043 ASP A N     1 
ATOM   8180  C  CA    . ASP A 1  1043 ? 157.620 56.488  -0.336  1.00 82.87  ? 1043 ASP A CA    1 
ATOM   8181  C  C     . ASP A 1  1043 ? 156.403 55.556  -0.406  1.00 85.93  ? 1043 ASP A C     1 
ATOM   8182  O  O     . ASP A 1  1043 ? 155.709 55.495  -1.434  1.00 84.53  ? 1043 ASP A O     1 
ATOM   8183  C  CB    . ASP A 1  1043 ? 158.909 55.705  -0.601  1.00 85.88  ? 1043 ASP A CB    1 
ATOM   8184  C  CG    . ASP A 1  1043 ? 160.117 56.517  -1.042  1.00 103.29 ? 1043 ASP A CG    1 
ATOM   8185  O  OD1   . ASP A 1  1043 ? 159.935 57.693  -1.461  1.00 105.04 ? 1043 ASP A OD1   1 
ATOM   8186  O  OD2   . ASP A 1  1043 ? 161.239 55.957  -1.038  1.00 111.25 ? 1043 ASP A OD2   1 
ATOM   8187  N  N     . TRP A 1  1044 ? 156.148 54.861  0.720   1.00 82.08  ? 1044 TRP A N     1 
ATOM   8188  C  CA    . TRP A 1  1044 ? 155.030 53.962  0.947   1.00 80.80  ? 1044 TRP A CA    1 
ATOM   8189  C  C     . TRP A 1  1044 ? 153.750 54.788  1.010   1.00 80.88  ? 1044 TRP A C     1 
ATOM   8190  O  O     . TRP A 1  1044 ? 152.791 54.432  0.331   1.00 79.02  ? 1044 TRP A O     1 
ATOM   8191  C  CB    . TRP A 1  1044 ? 155.259 53.204  2.251   1.00 80.85  ? 1044 TRP A CB    1 
ATOM   8192  C  CG    . TRP A 1  1044 ? 154.221 52.183  2.615   1.00 81.78  ? 1044 TRP A CG    1 
ATOM   8193  C  CD1   . TRP A 1  1044 ? 154.216 50.868  2.264   1.00 84.30  ? 1044 TRP A CD1   1 
ATOM   8194  C  CD2   . TRP A 1  1044 ? 153.130 52.355  3.532   1.00 81.67  ? 1044 TRP A CD2   1 
ATOM   8195  N  NE1   . TRP A 1  1044 ? 153.160 50.221  2.860   1.00 83.15  ? 1044 TRP A NE1   1 
ATOM   8196  C  CE2   . TRP A 1  1044 ? 152.494 51.101  3.667   1.00 84.66  ? 1044 TRP A CE2   1 
ATOM   8197  C  CE3   . TRP A 1  1044 ? 152.594 53.461  4.219   1.00 83.52  ? 1044 TRP A CE3   1 
ATOM   8198  C  CZ2   . TRP A 1  1044 ? 151.376 50.910  4.487   1.00 83.63  ? 1044 TRP A CZ2   1 
ATOM   8199  C  CZ3   . TRP A 1  1044 ? 151.463 53.276  5.003   1.00 84.56  ? 1044 TRP A CZ3   1 
ATOM   8200  C  CH2   . TRP A 1  1044 ? 150.892 52.006  5.164   1.00 84.46  ? 1044 TRP A CH2   1 
ATOM   8201  N  N     . VAL A 1  1045 ? 153.746 55.920  1.768   1.00 76.72  ? 1045 VAL A N     1 
ATOM   8202  C  CA    . VAL A 1  1045 ? 152.586 56.835  1.837   1.00 75.58  ? 1045 VAL A CA    1 
ATOM   8203  C  C     . VAL A 1  1045 ? 152.208 57.271  0.407   1.00 78.55  ? 1045 VAL A C     1 
ATOM   8204  O  O     . VAL A 1  1045 ? 151.032 57.227  0.047   1.00 77.27  ? 1045 VAL A O     1 
ATOM   8205  C  CB    . VAL A 1  1045 ? 152.784 58.060  2.787   1.00 79.62  ? 1045 VAL A CB    1 
ATOM   8206  C  CG1   . VAL A 1  1045 ? 151.600 59.016  2.725   1.00 78.68  ? 1045 VAL A CG1   1 
ATOM   8207  C  CG2   . VAL A 1  1045 ? 152.985 57.617  4.220   1.00 79.81  ? 1045 VAL A CG2   1 
ATOM   8208  N  N     . LEU A 1  1046 ? 153.219 57.607  -0.413  1.00 75.07  ? 1046 LEU A N     1 
ATOM   8209  C  CA    . LEU A 1  1046 ? 153.042 58.030  -1.795  1.00 73.91  ? 1046 LEU A CA    1 
ATOM   8210  C  C     . LEU A 1  1046 ? 152.423 56.978  -2.702  1.00 79.95  ? 1046 LEU A C     1 
ATOM   8211  O  O     . LEU A 1  1046 ? 151.434 57.280  -3.367  1.00 77.96  ? 1046 LEU A O     1 
ATOM   8212  C  CB    . LEU A 1  1046 ? 154.344 58.568  -2.376  1.00 73.73  ? 1046 LEU A CB    1 
ATOM   8213  C  CG    . LEU A 1  1046 ? 154.772 59.945  -1.928  1.00 76.86  ? 1046 LEU A CG    1 
ATOM   8214  C  CD1   . LEU A 1  1046 ? 155.886 60.422  -2.771  1.00 77.60  ? 1046 LEU A CD1   1 
ATOM   8215  C  CD2   . LEU A 1  1046 ? 153.660 60.930  -2.050  1.00 76.07  ? 1046 LEU A CD2   1 
ATOM   8216  N  N     . SER A 1  1047 ? 152.965 55.747  -2.711  1.00 80.73  ? 1047 SER A N     1 
ATOM   8217  C  CA    . SER A 1  1047 ? 152.417 54.641  -3.535  1.00 81.88  ? 1047 SER A CA    1 
ATOM   8218  C  C     . SER A 1  1047 ? 150.941 54.289  -3.190  1.00 82.68  ? 1047 SER A C     1 
ATOM   8219  O  O     . SER A 1  1047 ? 150.127 53.976  -4.077  1.00 80.55  ? 1047 SER A O     1 
ATOM   8220  C  CB    . SER A 1  1047 ? 153.285 53.389  -3.407  1.00 88.92  ? 1047 SER A CB    1 
ATOM   8221  O  OG    . SER A 1  1047 ? 153.195 52.821  -2.108  1.00 103.59 ? 1047 SER A OG    1 
ATOM   8222  N  N     . ASN A 1  1048 ? 150.632 54.343  -1.891  1.00 77.77  ? 1048 ASN A N     1 
ATOM   8223  C  CA    . ASN A 1  1048 ? 149.317 54.054  -1.378  1.00 76.41  ? 1048 ASN A CA    1 
ATOM   8224  C  C     . ASN A 1  1048 ? 148.291 55.102  -1.762  1.00 78.67  ? 1048 ASN A C     1 
ATOM   8225  O  O     . ASN A 1  1048 ? 147.175 54.721  -2.101  1.00 78.50  ? 1048 ASN A O     1 
ATOM   8226  C  CB    . ASN A 1  1048 ? 149.360 53.733  0.105   1.00 78.51  ? 1048 ASN A CB    1 
ATOM   8227  C  CG    . ASN A 1  1048 ? 150.014 52.393  0.368   1.00 106.71 ? 1048 ASN A CG    1 
ATOM   8228  O  OD1   . ASN A 1  1048 ? 149.584 51.341  -0.126  1.00 105.78 ? 1048 ASN A OD1   1 
ATOM   8229  N  ND2   . ASN A 1  1048 ? 151.093 52.404  1.121   1.00 97.39  ? 1048 ASN A ND2   1 
ATOM   8230  N  N     . ILE A 1  1049 ? 148.669 56.397  -1.804  1.00 73.74  ? 1049 ILE A N     1 
ATOM   8231  C  CA    . ILE A 1  1049 ? 147.744 57.443  -2.258  1.00 72.36  ? 1049 ILE A CA    1 
ATOM   8232  C  C     . ILE A 1  1049 ? 147.404 57.138  -3.729  1.00 76.69  ? 1049 ILE A C     1 
ATOM   8233  O  O     . ILE A 1  1049 ? 146.227 57.085  -4.082  1.00 74.80  ? 1049 ILE A O     1 
ATOM   8234  C  CB    . ILE A 1  1049 ? 148.277 58.895  -2.050  1.00 75.47  ? 1049 ILE A CB    1 
ATOM   8235  C  CG1   . ILE A 1  1049 ? 148.475 59.209  -0.573  1.00 76.00  ? 1049 ILE A CG1   1 
ATOM   8236  C  CG2   . ILE A 1  1049 ? 147.323 59.926  -2.651  1.00 75.59  ? 1049 ILE A CG2   1 
ATOM   8237  C  CD1   . ILE A 1  1049 ? 149.522 60.216  -0.296  1.00 83.43  ? 1049 ILE A CD1   1 
ATOM   8238  N  N     . GLU A 1  1050 ? 148.434 56.855  -4.554  1.00 75.46  ? 1050 GLU A N     1 
ATOM   8239  C  CA    . GLU A 1  1050 ? 148.271 56.526  -5.971  1.00 75.42  ? 1050 GLU A CA    1 
ATOM   8240  C  C     . GLU A 1  1050 ? 147.324 55.323  -6.126  1.00 78.43  ? 1050 GLU A C     1 
ATOM   8241  O  O     . GLU A 1  1050 ? 146.304 55.426  -6.826  1.00 77.39  ? 1050 GLU A O     1 
ATOM   8242  C  CB    . GLU A 1  1050 ? 149.639 56.240  -6.641  1.00 77.48  ? 1050 GLU A CB    1 
ATOM   8243  C  CG    . GLU A 1  1050 ? 149.629 56.490  -8.145  1.00 89.41  ? 1050 GLU A CG    1 
ATOM   8244  C  CD    . GLU A 1  1050 ? 150.603 55.708  -9.012  1.00 116.94 ? 1050 GLU A CD    1 
ATOM   8245  O  OE1   . GLU A 1  1050 ? 151.768 55.514  -8.591  1.00 125.08 ? 1050 GLU A OE1   1 
ATOM   8246  O  OE2   . GLU A 1  1050 ? 150.219 55.359  -10.154 1.00 106.77 ? 1050 GLU A OE2   1 
ATOM   8247  N  N     . ALA A 1  1051 ? 147.643 54.206  -5.433  1.00 74.01  ? 1051 ALA A N     1 
ATOM   8248  C  CA    . ALA A 1  1051 ? 146.859 52.973  -5.485  1.00 72.53  ? 1051 ALA A CA    1 
ATOM   8249  C  C     . ALA A 1  1051 ? 145.388 53.213  -5.162  1.00 73.35  ? 1051 ALA A C     1 
ATOM   8250  O  O     . ALA A 1  1051 ? 144.501 52.881  -5.962  1.00 71.71  ? 1051 ALA A O     1 
ATOM   8251  C  CB    . ALA A 1  1051 ? 147.442 51.961  -4.526  1.00 73.69  ? 1051 ALA A CB    1 
ATOM   8252  N  N     . GLN A 1  1052 ? 145.150 53.843  -4.011  1.00 69.13  ? 1052 GLN A N     1 
ATOM   8253  C  CA    . GLN A 1  1052 ? 143.824 54.174  -3.547  1.00 68.46  ? 1052 GLN A CA    1 
ATOM   8254  C  C     . GLN A 1  1052 ? 143.093 55.096  -4.504  1.00 73.47  ? 1052 GLN A C     1 
ATOM   8255  O  O     . GLN A 1  1052 ? 141.958 54.784  -4.876  1.00 73.35  ? 1052 GLN A O     1 
ATOM   8256  C  CB    . GLN A 1  1052 ? 143.874 54.741  -2.136  1.00 70.01  ? 1052 GLN A CB    1 
ATOM   8257  C  CG    . GLN A 1  1052 ? 143.664 53.672  -1.099  1.00 82.20  ? 1052 GLN A CG    1 
ATOM   8258  C  CD    . GLN A 1  1052 ? 144.291 54.056  0.194   1.00 101.58 ? 1052 GLN A CD    1 
ATOM   8259  O  OE1   . GLN A 1  1052 ? 143.724 54.824  1.001   1.00 96.69  ? 1052 GLN A OE1   1 
ATOM   8260  N  NE2   . GLN A 1  1052 ? 145.486 53.519  0.402   1.00 93.98  ? 1052 GLN A NE2   1 
ATOM   8261  N  N     . PHE A 1  1053 ? 143.749 56.180  -4.955  1.00 70.52  ? 1053 PHE A N     1 
ATOM   8262  C  CA    . PHE A 1  1053 ? 143.138 57.109  -5.894  1.00 70.71  ? 1053 PHE A CA    1 
ATOM   8263  C  C     . PHE A 1  1053 ? 142.617 56.357  -7.099  1.00 75.25  ? 1053 PHE A C     1 
ATOM   8264  O  O     . PHE A 1  1053 ? 141.438 56.474  -7.432  1.00 74.73  ? 1053 PHE A O     1 
ATOM   8265  C  CB    . PHE A 1  1053 ? 144.122 58.198  -6.332  1.00 73.81  ? 1053 PHE A CB    1 
ATOM   8266  C  CG    . PHE A 1  1053 ? 143.475 59.196  -7.253  1.00 76.13  ? 1053 PHE A CG    1 
ATOM   8267  C  CD1   . PHE A 1  1053 ? 142.824 60.313  -6.744  1.00 80.78  ? 1053 PHE A CD1   1 
ATOM   8268  C  CD2   . PHE A 1  1053 ? 143.456 58.987  -8.628  1.00 78.72  ? 1053 PHE A CD2   1 
ATOM   8269  C  CE1   . PHE A 1  1053 ? 142.170 61.211  -7.594  1.00 82.31  ? 1053 PHE A CE1   1 
ATOM   8270  C  CE2   . PHE A 1  1053 ? 142.782 59.869  -9.475  1.00 82.56  ? 1053 PHE A CE2   1 
ATOM   8271  C  CZ    . PHE A 1  1053 ? 142.150 60.981  -8.953  1.00 81.38  ? 1053 PHE A CZ    1 
ATOM   8272  N  N     . LEU A 1  1054 ? 143.486 55.558  -7.733  1.00 72.36  ? 1054 LEU A N     1 
ATOM   8273  C  CA    . LEU A 1  1054 ? 143.128 54.781  -8.914  1.00 71.37  ? 1054 LEU A CA    1 
ATOM   8274  C  C     . LEU A 1  1054 ? 141.920 53.860  -8.692  1.00 74.12  ? 1054 LEU A C     1 
ATOM   8275  O  O     . LEU A 1  1054 ? 140.948 53.957  -9.454  1.00 72.00  ? 1054 LEU A O     1 
ATOM   8276  C  CB    . LEU A 1  1054 ? 144.359 54.079  -9.474  1.00 71.31  ? 1054 LEU A CB    1 
ATOM   8277  C  CG    . LEU A 1  1054 ? 145.251 55.023  -10.242 1.00 75.95  ? 1054 LEU A CG    1 
ATOM   8278  C  CD1   . LEU A 1  1054 ? 146.639 54.502  -10.323 1.00 76.31  ? 1054 LEU A CD1   1 
ATOM   8279  C  CD2   . LEU A 1  1054 ? 144.642 55.381  -11.615 1.00 78.86  ? 1054 LEU A CD2   1 
ATOM   8280  N  N     . ARG A 1  1055 ? 141.931 53.091  -7.566  1.00 70.96  ? 1055 ARG A N     1 
ATOM   8281  C  CA    . ARG A 1  1055 ? 140.827 52.236  -7.112  1.00 70.58  ? 1055 ARG A CA    1 
ATOM   8282  C  C     . ARG A 1  1055 ? 139.505 53.023  -6.988  1.00 74.27  ? 1055 ARG A C     1 
ATOM   8283  O  O     . ARG A 1  1055 ? 138.422 52.499  -7.304  1.00 73.63  ? 1055 ARG A O     1 
ATOM   8284  C  CB    . ARG A 1  1055 ? 141.164 51.627  -5.742  1.00 72.45  ? 1055 ARG A CB    1 
ATOM   8285  C  CG    . ARG A 1  1055 ? 141.782 50.243  -5.840  1.00 89.49  ? 1055 ARG A CG    1 
ATOM   8286  C  CD    . ARG A 1  1055 ? 142.045 49.610  -4.488  1.00 101.77 ? 1055 ARG A CD    1 
ATOM   8287  N  NE    . ARG A 1  1055 ? 143.443 49.194  -4.373  1.00 115.65 ? 1055 ARG A NE    1 
ATOM   8288  C  CZ    . ARG A 1  1055 ? 144.297 49.660  -3.464  1.00 135.80 ? 1055 ARG A CZ    1 
ATOM   8289  N  NH1   . ARG A 1  1055 ? 143.893 50.539  -2.551  1.00 122.86 ? 1055 ARG A NH1   1 
ATOM   8290  N  NH2   . ARG A 1  1055 ? 145.553 49.230  -3.442  1.00 125.60 ? 1055 ARG A NH2   1 
ATOM   8291  N  N     . SER A 1  1056 ? 139.619 54.294  -6.551  1.00 69.86  ? 1056 SER A N     1 
ATOM   8292  C  CA    . SER A 1  1056 ? 138.503 55.195  -6.316  1.00 68.66  ? 1056 SER A CA    1 
ATOM   8293  C  C     . SER A 1  1056 ? 137.704 55.670  -7.541  1.00 71.71  ? 1056 SER A C     1 
ATOM   8294  O  O     . SER A 1  1056 ? 136.519 55.972  -7.388  1.00 70.75  ? 1056 SER A O     1 
ATOM   8295  C  CB    . SER A 1  1056 ? 138.918 56.345  -5.404  1.00 71.20  ? 1056 SER A CB    1 
ATOM   8296  O  OG    . SER A 1  1056 ? 139.311 55.880  -4.119  1.00 74.71  ? 1056 SER A OG    1 
ATOM   8297  N  N     . VAL A 1  1057 ? 138.313 55.696  -8.748  1.00 68.25  ? 1057 VAL A N     1 
ATOM   8298  C  CA    . VAL A 1  1057 ? 137.627 56.149  -9.990  1.00 67.60  ? 1057 VAL A CA    1 
ATOM   8299  C  C     . VAL A 1  1057 ? 136.440 55.230  -10.402 1.00 71.30  ? 1057 VAL A C     1 
ATOM   8300  O  O     . VAL A 1  1057 ? 136.566 54.012  -10.209 1.00 71.68  ? 1057 VAL A O     1 
ATOM   8301  C  CB    . VAL A 1  1057 ? 138.647 56.370  -11.146 1.00 70.71  ? 1057 VAL A CB    1 
ATOM   8302  C  CG1   . VAL A 1  1057 ? 137.953 56.734  -12.455 1.00 70.11  ? 1057 VAL A CG1   1 
ATOM   8303  C  CG2   . VAL A 1  1057 ? 139.677 57.434  -10.779 1.00 71.12  ? 1057 VAL A CG2   1 
ATOM   8304  N  N     . VAL A 1  1058 ? 135.302 55.799  -10.951 1.00 66.59  ? 1058 VAL A N     1 
ATOM   8305  C  CA    . VAL A 1  1058 ? 134.141 54.985  -11.393 1.00 65.94  ? 1058 VAL A CA    1 
ATOM   8306  C  C     . VAL A 1  1058 ? 134.468 54.050  -12.510 1.00 74.04  ? 1058 VAL A C     1 
ATOM   8307  O  O     . VAL A 1  1058 ? 135.301 54.372  -13.379 1.00 76.25  ? 1058 VAL A O     1 
ATOM   8308  C  CB    . VAL A 1  1058 ? 132.833 55.700  -11.745 1.00 68.24  ? 1058 VAL A CB    1 
ATOM   8309  C  CG1   . VAL A 1  1058 ? 132.253 56.362  -10.553 1.00 67.23  ? 1058 VAL A CG1   1 
ATOM   8310  C  CG2   . VAL A 1  1058 ? 133.003 56.673  -12.894 1.00 69.01  ? 1058 VAL A CG2   1 
ATOM   8311  N  N     . HIS A 1  1059 ? 133.723 52.930  -12.544 1.00 69.30  ? 1059 HIS A N     1 
ATOM   8312  C  CA    . HIS A 1  1059 ? 133.894 51.883  -13.538 1.00 68.43  ? 1059 HIS A CA    1 
ATOM   8313  C  C     . HIS A 1  1059 ? 132.984 52.050  -14.754 1.00 70.02  ? 1059 HIS A C     1 
ATOM   8314  O  O     . HIS A 1  1059 ? 131.771 51.920  -14.599 1.00 70.62  ? 1059 HIS A O     1 
ATOM   8315  C  CB    . HIS A 1  1059 ? 133.630 50.541  -12.873 1.00 69.06  ? 1059 HIS A CB    1 
ATOM   8316  C  CG    . HIS A 1  1059 ? 134.696 50.136  -11.921 1.00 73.41  ? 1059 HIS A CG    1 
ATOM   8317  N  ND1   . HIS A 1  1059 ? 135.346 48.925  -12.051 1.00 75.43  ? 1059 HIS A ND1   1 
ATOM   8318  C  CD2   . HIS A 1  1059 ? 135.191 50.792  -10.844 1.00 76.58  ? 1059 HIS A CD2   1 
ATOM   8319  C  CE1   . HIS A 1  1059 ? 136.220 48.885  -11.063 1.00 75.86  ? 1059 HIS A CE1   1 
ATOM   8320  N  NE2   . HIS A 1  1059 ? 136.173 49.994  -10.316 1.00 76.71  ? 1059 HIS A NE2   1 
ATOM   8321  N  N     . PRO A 1  1060 ? 133.490 52.266  -15.984 1.00 63.97  ? 1060 PRO A N     1 
ATOM   8322  C  CA    . PRO A 1  1060 ? 132.567 52.344  -17.123 1.00 63.61  ? 1060 PRO A CA    1 
ATOM   8323  C  C     . PRO A 1  1060 ? 131.637 51.118  -17.148 1.00 69.10  ? 1060 PRO A C     1 
ATOM   8324  O  O     . PRO A 1  1060 ? 132.063 49.958  -17.018 1.00 69.03  ? 1060 PRO A O     1 
ATOM   8325  C  CB    . PRO A 1  1060 ? 133.487 52.449  -18.332 1.00 65.32  ? 1060 PRO A CB    1 
ATOM   8326  C  CG    . PRO A 1  1060 ? 134.733 52.983  -17.796 1.00 70.35  ? 1060 PRO A CG    1 
ATOM   8327  C  CD    . PRO A 1  1060 ? 134.886 52.421  -16.419 1.00 65.50  ? 1060 PRO A CD    1 
ATOM   8328  N  N     . GLY A 1  1061 ? 130.355 51.418  -17.202 1.00 65.86  ? 1061 GLY A N     1 
ATOM   8329  C  CA    . GLY A 1  1061 ? 129.299 50.432  -17.141 1.00 65.94  ? 1061 GLY A CA    1 
ATOM   8330  C  C     . GLY A 1  1061 ? 128.349 50.790  -16.021 1.00 72.92  ? 1061 GLY A C     1 
ATOM   8331  O  O     . GLY A 1  1061 ? 127.160 50.457  -16.094 1.00 73.28  ? 1061 GLY A O     1 
ATOM   8332  N  N     . GLU A 1  1062 ? 128.866 51.511  -14.988 1.00 70.67  ? 1062 GLU A N     1 
ATOM   8333  C  CA    . GLU A 1  1062 ? 128.109 51.922  -13.801 1.00 71.02  ? 1062 GLU A CA    1 
ATOM   8334  C  C     . GLU A 1  1062 ? 126.840 52.608  -14.175 1.00 76.71  ? 1062 GLU A C     1 
ATOM   8335  O  O     . GLU A 1  1062 ? 126.889 53.647  -14.830 1.00 77.11  ? 1062 GLU A O     1 
ATOM   8336  C  CB    . GLU A 1  1062 ? 128.934 52.801  -12.847 1.00 72.84  ? 1062 GLU A CB    1 
ATOM   8337  C  CG    . GLU A 1  1062 ? 129.607 52.008  -11.732 1.00 86.29  ? 1062 GLU A CG    1 
ATOM   8338  C  CD    . GLU A 1  1062 ? 128.800 51.796  -10.463 1.00 120.19 ? 1062 GLU A CD    1 
ATOM   8339  O  OE1   . GLU A 1  1062 ? 127.560 51.620  -10.541 1.00 118.17 ? 1062 GLU A OE1   1 
ATOM   8340  O  OE2   . GLU A 1  1062 ? 129.427 51.792  -9.379  1.00 126.43 ? 1062 GLU A OE2   1 
ATOM   8341  N  N     . MET A 1  1063 ? 125.692 51.992  -13.813 1.00 73.20  ? 1063 MET A N     1 
ATOM   8342  C  CA    . MET A 1  1063 ? 124.372 52.561  -14.121 1.00 72.26  ? 1063 MET A CA    1 
ATOM   8343  C  C     . MET A 1  1063 ? 124.015 53.677  -13.151 1.00 75.36  ? 1063 MET A C     1 
ATOM   8344  O  O     . MET A 1  1063 ? 123.198 53.528  -12.235 1.00 73.95  ? 1063 MET A O     1 
ATOM   8345  C  CB    . MET A 1  1063 ? 123.289 51.481  -14.232 1.00 73.45  ? 1063 MET A CB    1 
ATOM   8346  C  CG    . MET A 1  1063 ? 123.571 50.458  -15.324 1.00 75.59  ? 1063 MET A CG    1 
ATOM   8347  S  SD    . MET A 1  1063 ? 123.708 51.086  -17.016 1.00 78.03  ? 1063 MET A SD    1 
ATOM   8348  C  CE    . MET A 1  1063 ? 122.195 52.080  -17.092 1.00 74.26  ? 1063 MET A CE    1 
ATOM   8349  N  N     . VAL A 1  1064 ? 124.666 54.802  -13.360 1.00 73.02  ? 1064 VAL A N     1 
ATOM   8350  C  CA    . VAL A 1  1064 ? 124.476 55.940  -12.500 1.00 74.35  ? 1064 VAL A CA    1 
ATOM   8351  C  C     . VAL A 1  1064 ? 123.103 56.633  -12.528 1.00 78.77  ? 1064 VAL A C     1 
ATOM   8352  O  O     . VAL A 1  1064 ? 122.758 57.364  -11.589 1.00 78.36  ? 1064 VAL A O     1 
ATOM   8353  C  CB    . VAL A 1  1064 ? 125.653 56.909  -12.443 1.00 79.74  ? 1064 VAL A CB    1 
ATOM   8354  C  CG1   . VAL A 1  1064 ? 125.889 57.250  -10.989 1.00 80.65  ? 1064 VAL A CG1   1 
ATOM   8355  C  CG2   . VAL A 1  1064 ? 126.907 56.304  -13.050 1.00 79.22  ? 1064 VAL A CG2   1 
ATOM   8356  N  N     . GLY A 1  1065 ? 122.327 56.363  -13.574 1.00 74.73  ? 1065 GLY A N     1 
ATOM   8357  C  CA    . GLY A 1  1065 ? 120.983 56.891  -13.706 1.00 73.35  ? 1065 GLY A CA    1 
ATOM   8358  C  C     . GLY A 1  1065 ? 120.138 56.327  -12.590 1.00 73.30  ? 1065 GLY A C     1 
ATOM   8359  O  O     . GLY A 1  1065 ? 119.758 57.060  -11.669 1.00 72.98  ? 1065 GLY A O     1 
ATOM   8360  N  N     . VAL A 1  1066 ? 119.938 54.992  -12.616 1.00 66.33  ? 1066 VAL A N     1 
ATOM   8361  C  CA    . VAL A 1  1066 ? 119.154 54.279  -11.598 1.00 64.35  ? 1066 VAL A CA    1 
ATOM   8362  C  C     . VAL A 1  1066 ? 119.681 54.589  -10.198 1.00 64.19  ? 1066 VAL A C     1 
ATOM   8363  O  O     . VAL A 1  1066 ? 118.905 54.984  -9.321  1.00 62.60  ? 1066 VAL A O     1 
ATOM   8364  C  CB    . VAL A 1  1066 ? 119.028 52.758  -11.899 1.00 67.47  ? 1066 VAL A CB    1 
ATOM   8365  C  CG1   . VAL A 1  1066 ? 118.308 52.013  -10.777 1.00 66.39  ? 1066 VAL A CG1   1 
ATOM   8366  C  CG2   . VAL A 1  1066 ? 118.304 52.542  -13.218 1.00 67.45  ? 1066 VAL A CG2   1 
ATOM   8367  N  N     . LEU A 1  1067 ? 121.004 54.471  -10.025 1.00 59.25  ? 1067 LEU A N     1 
ATOM   8368  C  CA    . LEU A 1  1067 ? 121.673 54.758  -8.767  1.00 59.01  ? 1067 LEU A CA    1 
ATOM   8369  C  C     . LEU A 1  1067 ? 121.194 56.137  -8.230  1.00 65.23  ? 1067 LEU A C     1 
ATOM   8370  O  O     . LEU A 1  1067 ? 120.636 56.190  -7.134  1.00 65.06  ? 1067 LEU A O     1 
ATOM   8371  C  CB    . LEU A 1  1067 ? 123.204 54.738  -8.986  1.00 58.61  ? 1067 LEU A CB    1 
ATOM   8372  C  CG    . LEU A 1  1067 ? 124.192 54.553  -7.807  1.00 62.22  ? 1067 LEU A CG    1 
ATOM   8373  C  CD1   . LEU A 1  1067 ? 123.616 54.864  -6.467  1.00 61.18  ? 1067 LEU A CD1   1 
ATOM   8374  C  CD2   . LEU A 1  1067 ? 124.744 53.168  -7.788  1.00 67.27  ? 1067 LEU A CD2   1 
ATOM   8375  N  N     . ALA A 1  1068 ? 121.357 57.219  -9.023  1.00 62.19  ? 1068 ALA A N     1 
ATOM   8376  C  CA    . ALA A 1  1068 ? 120.983 58.562  -8.610  1.00 62.03  ? 1068 ALA A CA    1 
ATOM   8377  C  C     . ALA A 1  1068 ? 119.520 58.641  -8.249  1.00 66.12  ? 1068 ALA A C     1 
ATOM   8378  O  O     . ALA A 1  1068 ? 119.190 59.123  -7.165  1.00 66.52  ? 1068 ALA A O     1 
ATOM   8379  C  CB    . ALA A 1  1068 ? 121.320 59.561  -9.700  1.00 63.18  ? 1068 ALA A CB    1 
ATOM   8380  N  N     . ALA A 1  1069 ? 118.645 58.114  -9.127  1.00 62.83  ? 1069 ALA A N     1 
ATOM   8381  C  CA    . ALA A 1  1069 ? 117.178 58.093  -8.957  1.00 62.32  ? 1069 ALA A CA    1 
ATOM   8382  C  C     . ALA A 1  1069 ? 116.758 57.446  -7.604  1.00 63.32  ? 1069 ALA A C     1 
ATOM   8383  O  O     . ALA A 1  1069 ? 116.028 58.059  -6.812  1.00 60.87  ? 1069 ALA A O     1 
ATOM   8384  C  CB    . ALA A 1  1069 ? 116.538 57.360  -10.135 1.00 62.54  ? 1069 ALA A CB    1 
ATOM   8385  N  N     . GLN A 1  1070 ? 117.302 56.234  -7.341  1.00 58.78  ? 1070 GLN A N     1 
ATOM   8386  C  CA    . GLN A 1  1070 ? 117.104 55.454  -6.131  1.00 58.04  ? 1070 GLN A CA    1 
ATOM   8387  C  C     . GLN A 1  1070 ? 117.757 56.158  -4.899  1.00 62.21  ? 1070 GLN A C     1 
ATOM   8388  O  O     . GLN A 1  1070 ? 117.272 56.054  -3.771  1.00 60.36  ? 1070 GLN A O     1 
ATOM   8389  C  CB    . GLN A 1  1070 ? 117.675 54.032  -6.331  1.00 58.82  ? 1070 GLN A CB    1 
ATOM   8390  C  CG    . GLN A 1  1070 ? 116.909 53.165  -7.338  1.00 75.47  ? 1070 GLN A CG    1 
ATOM   8391  C  CD    . GLN A 1  1070 ? 117.239 51.670  -7.310  1.00 97.16  ? 1070 GLN A CD    1 
ATOM   8392  O  OE1   . GLN A 1  1070 ? 118.376 51.242  -7.036  1.00 89.32  ? 1070 GLN A OE1   1 
ATOM   8393  N  NE2   . GLN A 1  1070 ? 116.240 50.837  -7.642  1.00 88.32  ? 1070 GLN A NE2   1 
ATOM   8394  N  N     . SER A 1  1071 ? 118.848 56.875  -5.119  1.00 61.32  ? 1071 SER A N     1 
ATOM   8395  C  CA    . SER A 1  1071 ? 119.529 57.538  -4.015  1.00 62.62  ? 1071 SER A CA    1 
ATOM   8396  C  C     . SER A 1  1071 ? 118.799 58.768  -3.535  1.00 68.17  ? 1071 SER A C     1 
ATOM   8397  O  O     . SER A 1  1071 ? 119.099 59.239  -2.443  1.00 68.54  ? 1071 SER A O     1 
ATOM   8398  C  CB    . SER A 1  1071 ? 120.991 57.809  -4.347  1.00 66.66  ? 1071 SER A CB    1 
ATOM   8399  O  OG    . SER A 1  1071 ? 121.617 56.557  -4.572  1.00 75.11  ? 1071 SER A OG    1 
ATOM   8400  N  N     . ILE A 1  1072 ? 117.826 59.266  -4.331  1.00 65.09  ? 1072 ILE A N     1 
ATOM   8401  C  CA    . ILE A 1  1072 ? 116.968 60.400  -3.974  1.00 65.93  ? 1072 ILE A CA    1 
ATOM   8402  C  C     . ILE A 1  1072 ? 115.585 59.825  -3.596  1.00 74.01  ? 1072 ILE A C     1 
ATOM   8403  O  O     . ILE A 1  1072 ? 114.921 60.353  -2.705  1.00 73.86  ? 1072 ILE A O     1 
ATOM   8404  C  CB    . ILE A 1  1072 ? 116.854 61.439  -5.119  1.00 68.32  ? 1072 ILE A CB    1 
ATOM   8405  C  CG1   . ILE A 1  1072 ? 118.233 61.956  -5.558  1.00 67.90  ? 1072 ILE A CG1   1 
ATOM   8406  C  CG2   . ILE A 1  1072 ? 115.905 62.586  -4.726  1.00 68.90  ? 1072 ILE A CG2   1 
ATOM   8407  C  CD1   . ILE A 1  1072 ? 118.232 62.699  -6.844  1.00 70.09  ? 1072 ILE A CD1   1 
ATOM   8408  N  N     . GLY A 1  1073 ? 115.183 58.754  -4.292  1.00 73.00  ? 1073 GLY A N     1 
ATOM   8409  C  CA    . GLY A 1  1073 ? 113.915 58.053  -4.101  1.00 73.75  ? 1073 GLY A CA    1 
ATOM   8410  C  C     . GLY A 1  1073 ? 113.746 57.480  -2.711  1.00 80.26  ? 1073 GLY A C     1 
ATOM   8411  O  O     . GLY A 1  1073 ? 112.892 57.950  -1.960  1.00 80.74  ? 1073 GLY A O     1 
ATOM   8412  N  N     . GLU A 1  1074 ? 114.591 56.486  -2.353  1.00 77.74  ? 1074 GLU A N     1 
ATOM   8413  C  CA    . GLU A 1  1074 ? 114.646 55.814  -1.043  1.00 77.57  ? 1074 GLU A CA    1 
ATOM   8414  C  C     . GLU A 1  1074 ? 114.550 56.809  0.139   1.00 81.30  ? 1074 GLU A C     1 
ATOM   8415  O  O     . GLU A 1  1074 ? 113.613 56.676  0.924   1.00 79.32  ? 1074 GLU A O     1 
ATOM   8416  C  CB    . GLU A 1  1074 ? 115.880 54.892  -0.947  1.00 78.63  ? 1074 GLU A CB    1 
ATOM   8417  C  CG    . GLU A 1  1074 ? 115.830 53.919  0.211   1.00 89.80  ? 1074 GLU A CG    1 
ATOM   8418  C  CD    . GLU A 1  1074 ? 116.323 54.443  1.547   1.00 125.06 ? 1074 GLU A CD    1 
ATOM   8419  O  OE1   . GLU A 1  1074 ? 117.167 55.374  1.573   1.00 101.20 ? 1074 GLU A OE1   1 
ATOM   8420  O  OE2   . GLU A 1  1074 ? 115.871 53.892  2.578   1.00 139.95 ? 1074 GLU A OE2   1 
ATOM   8421  N  N     . PRO A 1  1075 ? 115.418 57.848  0.259   1.00 80.32  ? 1075 PRO A N     1 
ATOM   8422  C  CA    . PRO A 1  1075 ? 115.245 58.805  1.371   1.00 81.62  ? 1075 PRO A CA    1 
ATOM   8423  C  C     . PRO A 1  1075 ? 113.890 59.541  1.419   1.00 85.77  ? 1075 PRO A C     1 
ATOM   8424  O  O     . PRO A 1  1075 ? 113.422 59.847  2.524   1.00 85.75  ? 1075 PRO A O     1 
ATOM   8425  C  CB    . PRO A 1  1075 ? 116.427 59.779  1.206   1.00 83.82  ? 1075 PRO A CB    1 
ATOM   8426  C  CG    . PRO A 1  1075 ? 116.895 59.603  -0.167  1.00 87.43  ? 1075 PRO A CG    1 
ATOM   8427  C  CD    . PRO A 1  1075 ? 116.615 58.185  -0.543  1.00 82.01  ? 1075 PRO A CD    1 
ATOM   8428  N  N     . ALA A 1  1076 ? 113.255 59.800  0.241   1.00 81.67  ? 1076 ALA A N     1 
ATOM   8429  C  CA    . ALA A 1  1076 ? 111.956 60.471  0.151   1.00 82.07  ? 1076 ALA A CA    1 
ATOM   8430  C  C     . ALA A 1  1076 ? 110.873 59.680  0.876   1.00 91.20  ? 1076 ALA A C     1 
ATOM   8431  O  O     . ALA A 1  1076 ? 109.929 60.270  1.398   1.00 91.66  ? 1076 ALA A O     1 
ATOM   8432  C  CB    . ALA A 1  1076 ? 111.566 60.690  -1.296  1.00 82.09  ? 1076 ALA A CB    1 
ATOM   8433  N  N     . THR A 1  1077 ? 111.039 58.346  0.937   1.00 90.76  ? 1077 THR A N     1 
ATOM   8434  C  CA    . THR A 1  1077 ? 110.154 57.393  1.605   1.00 91.87  ? 1077 THR A CA    1 
ATOM   8435  C  C     . THR A 1  1077 ? 110.264 57.520  3.132   1.00 102.35 ? 1077 THR A C     1 
ATOM   8436  O  O     . THR A 1  1077 ? 109.264 57.363  3.830   1.00 103.21 ? 1077 THR A O     1 
ATOM   8437  C  CB    . THR A 1  1077 ? 110.499 55.998  1.114   1.00 94.19  ? 1077 THR A CB    1 
ATOM   8438  O  OG1   . THR A 1  1077 ? 110.586 56.049  -0.310  1.00 87.64  ? 1077 THR A OG1   1 
ATOM   8439  C  CG2   . THR A 1  1077 ? 109.498 54.939  1.572   1.00 95.11  ? 1077 THR A CG2   1 
ATOM   8440  N  N     . GLN A 1  1078 ? 111.464 57.824  3.647   1.00 102.83 ? 1078 GLN A N     1 
ATOM   8441  C  CA    . GLN A 1  1078 ? 111.698 57.974  5.088   1.00 104.63 ? 1078 GLN A CA    1 
ATOM   8442  C  C     . GLN A 1  1078 ? 111.383 59.411  5.551   1.00 111.44 ? 1078 GLN A C     1 
ATOM   8443  O  O     . GLN A 1  1078 ? 111.779 59.804  6.653   1.00 112.46 ? 1078 GLN A O     1 
ATOM   8444  C  CB    . GLN A 1  1078 ? 113.146 57.552  5.485   1.00 106.33 ? 1078 GLN A CB    1 
ATOM   8445  C  CG    . GLN A 1  1078 ? 113.831 56.470  4.614   1.00 126.93 ? 1078 GLN A CG    1 
ATOM   8446  C  CD    . GLN A 1  1078 ? 113.175 55.098  4.628   1.00 147.19 ? 1078 GLN A CD    1 
ATOM   8447  O  OE1   . GLN A 1  1078 ? 112.241 54.817  3.863   1.00 140.98 ? 1078 GLN A OE1   1 
ATOM   8448  N  NE2   . GLN A 1  1078 ? 113.715 54.183  5.425   1.00 139.65 ? 1078 GLN A NE2   1 
ATOM   8449  N  N     . MET A 1  1079 ? 110.650 60.185  4.724   1.00 108.82 ? 1079 MET A N     1 
ATOM   8450  C  CA    . MET A 1  1079 ? 110.304 61.571  5.043   1.00 109.90 ? 1079 MET A CA    1 
ATOM   8451  C  C     . MET A 1  1079 ? 109.035 61.706  5.865   1.00 117.84 ? 1079 MET A C     1 
ATOM   8452  O  O     . MET A 1  1079 ? 108.020 61.087  5.516   1.00 118.02 ? 1079 MET A O     1 
ATOM   8453  C  CB    . MET A 1  1079 ? 110.254 62.450  3.788   1.00 111.72 ? 1079 MET A CB    1 
ATOM   8454  C  CG    . MET A 1  1079 ? 111.613 62.627  3.149   1.00 114.45 ? 1079 MET A CG    1 
ATOM   8455  S  SD    . MET A 1  1079 ? 111.861 64.238  2.400   1.00 118.23 ? 1079 MET A SD    1 
ATOM   8456  C  CE    . MET A 1  1079 ? 111.104 63.976  0.804   1.00 114.14 ? 1079 MET A CE    1 
ATOM   8457  N  N     . THR A 1  1080 ? 109.110 62.521  6.971   1.00 116.13 ? 1080 THR A N     1 
ATOM   8458  C  CA    . THR A 1  1080 ? 108.025 62.837  7.927   1.00 140.31 ? 1080 THR A CA    1 
ATOM   8459  C  C     . THR A 1  1080 ? 107.121 63.970  7.393   1.00 158.95 ? 1080 THR A C     1 
ATOM   8460  O  O     . THR A 1  1080 ? 107.601 64.954  6.824   1.00 107.11 ? 1080 THR A O     1 
ATOM   8461  C  CB    . THR A 1  1080 ? 108.595 63.168  9.332   1.00 145.12 ? 1080 THR A CB    1 
ATOM   8462  O  OG1   . THR A 1  1080 ? 109.519 62.150  9.732   1.00 142.91 ? 1080 THR A OG1   1 
ATOM   8463  C  CG2   . THR A 1  1080 ? 107.499 63.338  10.397  1.00 141.81 ? 1080 THR A CG2   1 
ATOM   8464  N  N     . LYS A 1  1092 ? 110.911 81.814  8.883   1.00 151.03 ? 1092 LYS A N     1 
ATOM   8465  C  CA    . LYS A 1  1092 ? 109.816 81.710  7.907   1.00 150.88 ? 1092 LYS A CA    1 
ATOM   8466  C  C     . LYS A 1  1092 ? 109.366 80.241  7.610   1.00 153.87 ? 1092 LYS A C     1 
ATOM   8467  O  O     . LYS A 1  1092 ? 110.222 79.347  7.522   1.00 153.10 ? 1092 LYS A O     1 
ATOM   8468  C  CB    . LYS A 1  1092 ? 110.174 82.499  6.613   1.00 153.36 ? 1092 LYS A CB    1 
ATOM   8469  C  CG    . LYS A 1  1092 ? 109.335 82.225  5.340   1.00 157.04 ? 1092 LYS A CG    1 
ATOM   8470  C  CD    . LYS A 1  1092 ? 107.912 82.808  5.362   1.00 156.71 ? 1092 LYS A CD    1 
ATOM   8471  C  CE    . LYS A 1  1092 ? 107.095 82.360  4.172   1.00 149.85 ? 1092 LYS A CE    1 
ATOM   8472  N  NZ    . LYS A 1  1092 ? 107.495 83.059  2.919   1.00 149.64 ? 1092 LYS A NZ    1 
ATOM   8473  N  N     . LYS A 1  1093 ? 108.014 80.009  7.457   1.00 149.01 ? 1093 LYS A N     1 
ATOM   8474  C  CA    . LYS A 1  1093 ? 107.415 78.695  7.129   1.00 146.54 ? 1093 LYS A CA    1 
ATOM   8475  C  C     . LYS A 1  1093 ? 107.161 78.504  5.612   1.00 146.09 ? 1093 LYS A C     1 
ATOM   8476  O  O     . LYS A 1  1093 ? 106.292 79.159  5.023   1.00 145.95 ? 1093 LYS A O     1 
ATOM   8477  C  CB    . LYS A 1  1093 ? 106.194 78.343  8.010   1.00 148.79 ? 1093 LYS A CB    1 
ATOM   8478  C  CG    . LYS A 1  1093 ? 106.603 77.672  9.326   1.00 158.31 ? 1093 LYS A CG    1 
ATOM   8479  C  CD    . LYS A 1  1093 ? 105.435 77.045  10.092  1.00 166.09 ? 1093 LYS A CD    1 
ATOM   8480  C  CE    . LYS A 1  1093 ? 105.901 76.319  11.340  1.00 171.46 ? 1093 LYS A CE    1 
ATOM   8481  N  NZ    . LYS A 1  1093 ? 104.777 75.696  12.096  1.00 175.01 ? 1093 LYS A NZ    1 
ATOM   8482  N  N     . VAL A 1  1094 ? 107.986 77.624  4.993   1.00 138.08 ? 1094 VAL A N     1 
ATOM   8483  C  CA    . VAL A 1  1094 ? 108.025 77.296  3.561   1.00 135.06 ? 1094 VAL A CA    1 
ATOM   8484  C  C     . VAL A 1  1094 ? 107.580 75.847  3.353   1.00 133.12 ? 1094 VAL A C     1 
ATOM   8485  O  O     . VAL A 1  1094 ? 107.850 75.006  4.214   1.00 132.45 ? 1094 VAL A O     1 
ATOM   8486  C  CB    . VAL A 1  1094 ? 109.474 77.490  3.011   1.00 138.55 ? 1094 VAL A CB    1 
ATOM   8487  C  CG1   . VAL A 1  1094 ? 109.500 77.556  1.487   1.00 137.87 ? 1094 VAL A CG1   1 
ATOM   8488  C  CG2   . VAL A 1  1094 ? 110.151 78.723  3.606   1.00 139.36 ? 1094 VAL A CG2   1 
ATOM   8489  N  N     . THR A 1  1095 ? 106.932 75.549  2.200   1.00 125.29 ? 1095 THR A N     1 
ATOM   8490  C  CA    . THR A 1  1095 ? 106.524 74.191  1.820   1.00 122.16 ? 1095 THR A CA    1 
ATOM   8491  C  C     . THR A 1  1095 ? 107.802 73.383  1.688   1.00 123.07 ? 1095 THR A C     1 
ATOM   8492  O  O     . THR A 1  1095 ? 108.740 73.853  1.047   1.00 122.22 ? 1095 THR A O     1 
ATOM   8493  C  CB    . THR A 1  1095 ? 105.717 74.190  0.513   1.00 124.04 ? 1095 THR A CB    1 
ATOM   8494  O  OG1   . THR A 1  1095 ? 106.404 74.936  -0.494  1.00 120.58 ? 1095 THR A OG1   1 
ATOM   8495  C  CG2   . THR A 1  1095 ? 104.324 74.742  0.696   1.00 123.43 ? 1095 THR A CG2   1 
ATOM   8496  N  N     . SER A 1  1096 ? 107.889 72.241  2.391   1.00 118.19 ? 1096 SER A N     1 
ATOM   8497  C  CA    . SER A 1  1096 ? 109.088 71.382  2.408   1.00 116.48 ? 1096 SER A CA    1 
ATOM   8498  C  C     . SER A 1  1096 ? 108.729 69.891  2.324   1.00 115.17 ? 1096 SER A C     1 
ATOM   8499  O  O     . SER A 1  1096 ? 107.548 69.556  2.228   1.00 114.50 ? 1096 SER A O     1 
ATOM   8500  C  CB    . SER A 1  1096 ? 109.943 71.667  3.644   1.00 121.32 ? 1096 SER A CB    1 
ATOM   8501  O  OG    . SER A 1  1096 ? 109.196 71.489  4.837   1.00 133.94 ? 1096 SER A OG    1 
ATOM   8502  N  N     . GLY A 1  1097 ? 109.746 69.026  2.346   1.00 107.15 ? 1097 GLY A N     1 
ATOM   8503  C  CA    . GLY A 1  1097 ? 109.567 67.580  2.285   1.00 104.08 ? 1097 GLY A CA    1 
ATOM   8504  C  C     . GLY A 1  1097 ? 108.959 67.066  0.995   1.00 101.92 ? 1097 GLY A C     1 
ATOM   8505  O  O     . GLY A 1  1097 ? 109.166 67.659  -0.066  1.00 101.65 ? 1097 GLY A O     1 
ATOM   8506  N  N     . VAL A 1  1098 ? 108.204 65.951  1.089   1.00 94.11  ? 1098 VAL A N     1 
ATOM   8507  C  CA    . VAL A 1  1098 ? 107.538 65.263  -0.030  1.00 91.95  ? 1098 VAL A CA    1 
ATOM   8508  C  C     . VAL A 1  1098 ? 106.778 66.246  -0.914  1.00 93.76  ? 1098 VAL A C     1 
ATOM   8509  O  O     . VAL A 1  1098 ? 107.010 66.252  -2.131  1.00 93.14  ? 1098 VAL A O     1 
ATOM   8510  C  CB    . VAL A 1  1098 ? 106.613 64.103  0.417   1.00 95.20  ? 1098 VAL A CB    1 
ATOM   8511  C  CG1   . VAL A 1  1098 ? 106.054 63.348  -0.785  1.00 93.97  ? 1098 VAL A CG1   1 
ATOM   8512  C  CG2   . VAL A 1  1098 ? 107.319 63.157  1.386   1.00 94.99  ? 1098 VAL A CG2   1 
ATOM   8513  N  N     . PRO A 1  1099 ? 105.896 67.105  -0.342  1.00 88.23  ? 1099 PRO A N     1 
ATOM   8514  C  CA    . PRO A 1  1099 ? 105.171 68.058  -1.190  1.00 87.36  ? 1099 PRO A CA    1 
ATOM   8515  C  C     . PRO A 1  1099 ? 106.091 68.986  -1.983  1.00 88.10  ? 1099 PRO A C     1 
ATOM   8516  O  O     . PRO A 1  1099 ? 105.946 69.026  -3.205  1.00 87.64  ? 1099 PRO A O     1 
ATOM   8517  C  CB    . PRO A 1  1099 ? 104.277 68.797  -0.202  1.00 89.92  ? 1099 PRO A CB    1 
ATOM   8518  C  CG    . PRO A 1  1099 ? 104.913 68.592  1.113   1.00 94.48  ? 1099 PRO A CG    1 
ATOM   8519  C  CD    . PRO A 1  1099 ? 105.472 67.233  1.066   1.00 89.34  ? 1099 PRO A CD    1 
ATOM   8520  N  N     . ARG A 1  1100 ? 107.075 69.665  -1.329  1.00 82.09  ? 1100 ARG A N     1 
ATOM   8521  C  CA    . ARG A 1  1100 ? 108.013 70.521  -2.058  1.00 81.04  ? 1100 ARG A CA    1 
ATOM   8522  C  C     . ARG A 1  1100 ? 108.789 69.718  -3.115  1.00 84.56  ? 1100 ARG A C     1 
ATOM   8523  O  O     . ARG A 1  1100 ? 109.062 70.256  -4.193  1.00 85.87  ? 1100 ARG A O     1 
ATOM   8524  C  CB    . ARG A 1  1100 ? 108.969 71.268  -1.123  1.00 79.42  ? 1100 ARG A CB    1 
ATOM   8525  C  CG    . ARG A 1  1100 ? 110.041 72.146  -1.824  1.00 89.38  ? 1100 ARG A CG    1 
ATOM   8526  C  CD    . ARG A 1  1100 ? 109.479 73.262  -2.690  1.00 92.92  ? 1100 ARG A CD    1 
ATOM   8527  N  NE    . ARG A 1  1100 ? 110.510 74.028  -3.392  1.00 93.55  ? 1100 ARG A NE    1 
ATOM   8528  C  CZ    . ARG A 1  1100 ? 110.298 74.632  -4.558  1.00 113.53 ? 1100 ARG A CZ    1 
ATOM   8529  N  NH1   . ARG A 1  1100 ? 109.118 74.537  -5.159  1.00 102.16 ? 1100 ARG A NH1   1 
ATOM   8530  N  NH2   . ARG A 1  1100 ? 111.269 75.315  -5.144  1.00 103.51 ? 1100 ARG A NH2   1 
ATOM   8531  N  N     . LEU A 1  1101 ? 109.113 68.429  -2.828  1.00 77.34  ? 1101 LEU A N     1 
ATOM   8532  C  CA    . LEU A 1  1101 ? 109.817 67.577  -3.788  1.00 74.48  ? 1101 LEU A CA    1 
ATOM   8533  C  C     . LEU A 1  1101 ? 108.958 67.372  -5.036  1.00 77.61  ? 1101 LEU A C     1 
ATOM   8534  O  O     . LEU A 1  1101 ? 109.453 67.567  -6.151  1.00 76.83  ? 1101 LEU A O     1 
ATOM   8535  C  CB    . LEU A 1  1101 ? 110.253 66.248  -3.145  1.00 72.73  ? 1101 LEU A CB    1 
ATOM   8536  C  CG    . LEU A 1  1101 ? 110.934 65.210  -4.042  1.00 74.20  ? 1101 LEU A CG    1 
ATOM   8537  C  CD1   . LEU A 1  1101 ? 112.208 65.747  -4.697  1.00 72.94  ? 1101 LEU A CD1   1 
ATOM   8538  C  CD2   . LEU A 1  1101 ? 111.215 63.976  -3.266  1.00 74.52  ? 1101 LEU A CD2   1 
ATOM   8539  N  N     . LYS A 1  1102 ? 107.656 67.068  -4.832  1.00 74.43  ? 1102 LYS A N     1 
ATOM   8540  C  CA    . LYS A 1  1102 ? 106.655 66.897  -5.894  1.00 74.69  ? 1102 LYS A CA    1 
ATOM   8541  C  C     . LYS A 1  1102 ? 106.560 68.222  -6.681  1.00 79.83  ? 1102 LYS A C     1 
ATOM   8542  O  O     . LYS A 1  1102 ? 106.603 68.214  -7.909  1.00 79.38  ? 1102 LYS A O     1 
ATOM   8543  C  CB    . LYS A 1  1102 ? 105.297 66.482  -5.274  1.00 77.15  ? 1102 LYS A CB    1 
ATOM   8544  C  CG    . LYS A 1  1102 ? 104.197 66.035  -6.250  1.00 86.11  ? 1102 LYS A CG    1 
ATOM   8545  C  CD    . LYS A 1  1102 ? 102.972 65.548  -5.461  1.00 98.58  ? 1102 LYS A CD    1 
ATOM   8546  C  CE    . LYS A 1  1102 ? 101.638 65.865  -6.098  1.00 116.63 ? 1102 LYS A CE    1 
ATOM   8547  N  NZ    . LYS A 1  1102 ? 100.546 65.934  -5.081  1.00 128.85 ? 1102 LYS A NZ    1 
ATOM   8548  N  N     . GLU A 1  1103 ? 106.529 69.355  -5.955  1.00 77.52  ? 1103 GLU A N     1 
ATOM   8549  C  CA    . GLU A 1  1103 ? 106.528 70.709  -6.501  1.00 78.60  ? 1103 GLU A CA    1 
ATOM   8550  C  C     . GLU A 1  1103 ? 107.749 70.857  -7.452  1.00 82.96  ? 1103 GLU A C     1 
ATOM   8551  O  O     . GLU A 1  1103 ? 107.574 71.238  -8.623  1.00 82.86  ? 1103 GLU A O     1 
ATOM   8552  C  CB    . GLU A 1  1103 ? 106.599 71.726  -5.332  1.00 80.72  ? 1103 GLU A CB    1 
ATOM   8553  C  CG    . GLU A 1  1103 ? 106.140 73.138  -5.640  1.00 93.97  ? 1103 GLU A CG    1 
ATOM   8554  C  CD    . GLU A 1  1103 ? 105.328 73.773  -4.523  1.00 123.18 ? 1103 GLU A CD    1 
ATOM   8555  O  OE1   . GLU A 1  1103 ? 104.100 73.524  -4.482  1.00 123.56 ? 1103 GLU A OE1   1 
ATOM   8556  O  OE2   . GLU A 1  1103 ? 105.908 74.514  -3.693  1.00 116.51 ? 1103 GLU A OE2   1 
ATOM   8557  N  N     . ILE A 1  1104 ? 108.965 70.457  -6.963  1.00 78.40  ? 1104 ILE A N     1 
ATOM   8558  C  CA    . ILE A 1  1104 ? 110.209 70.554  -7.726  1.00 77.52  ? 1104 ILE A CA    1 
ATOM   8559  C  C     . ILE A 1  1104 ? 110.170 69.734  -9.000  1.00 83.89  ? 1104 ILE A C     1 
ATOM   8560  O  O     . ILE A 1  1104 ? 110.160 70.312  -10.078 1.00 84.46  ? 1104 ILE A O     1 
ATOM   8561  C  CB    . ILE A 1  1104 ? 111.538 70.346  -6.929  1.00 79.05  ? 1104 ILE A CB    1 
ATOM   8562  C  CG1   . ILE A 1  1104 ? 111.600 71.183  -5.632  1.00 78.32  ? 1104 ILE A CG1   1 
ATOM   8563  C  CG2   . ILE A 1  1104 ? 112.749 70.635  -7.853  1.00 79.75  ? 1104 ILE A CG2   1 
ATOM   8564  C  CD1   . ILE A 1  1104 ? 112.877 71.052  -4.759  1.00 75.20  ? 1104 ILE A CD1   1 
ATOM   8565  N  N     . LEU A 1  1105 ? 110.148 68.405  -8.884  1.00 81.44  ? 1105 LEU A N     1 
ATOM   8566  C  CA    . LEU A 1  1105 ? 110.177 67.505  -10.033 1.00 81.91  ? 1105 LEU A CA    1 
ATOM   8567  C  C     . LEU A 1  1105 ? 109.140 67.843  -11.093 1.00 88.76  ? 1105 LEU A C     1 
ATOM   8568  O  O     . LEU A 1  1105 ? 109.421 67.735  -12.289 1.00 88.89  ? 1105 LEU A O     1 
ATOM   8569  C  CB    . LEU A 1  1105 ? 110.081 66.033  -9.596  1.00 81.23  ? 1105 LEU A CB    1 
ATOM   8570  C  CG    . LEU A 1  1105 ? 111.048 65.572  -8.487  1.00 85.13  ? 1105 LEU A CG    1 
ATOM   8571  C  CD1   . LEU A 1  1105 ? 110.521 64.348  -7.812  1.00 84.88  ? 1105 LEU A CD1   1 
ATOM   8572  C  CD2   . LEU A 1  1105 ? 112.431 65.290  -9.028  1.00 85.70  ? 1105 LEU A CD2   1 
ATOM   8573  N  N     . ASN A 1  1106 ? 107.980 68.336  -10.661 1.00 87.40  ? 1106 ASN A N     1 
ATOM   8574  C  CA    . ASN A 1  1106 ? 106.918 68.704  -11.580 1.00 88.73  ? 1106 ASN A CA    1 
ATOM   8575  C  C     . ASN A 1  1106 ? 107.168 69.992  -12.322 1.00 96.20  ? 1106 ASN A C     1 
ATOM   8576  O  O     . ASN A 1  1106 ? 106.460 70.264  -13.302 1.00 96.38  ? 1106 ASN A O     1 
ATOM   8577  C  CB    . ASN A 1  1106 ? 105.577 68.759  -10.855 1.00 89.04  ? 1106 ASN A CB    1 
ATOM   8578  C  CG    . ASN A 1  1106 ? 105.031 67.395  -10.533 1.00 109.19 ? 1106 ASN A CG    1 
ATOM   8579  O  OD1   . ASN A 1  1106 ? 104.139 67.250  -9.698  1.00 107.11 ? 1106 ASN A OD1   1 
ATOM   8580  N  ND2   . ASN A 1  1106 ? 105.553 66.355  -11.180 1.00 95.70  ? 1106 ASN A ND2   1 
ATOM   8581  N  N     . VAL A 1  1107 ? 108.175 70.785  -11.869 1.00 94.62  ? 1107 VAL A N     1 
ATOM   8582  C  CA    . VAL A 1  1107 ? 108.511 72.126  -12.392 1.00 95.72  ? 1107 VAL A CA    1 
ATOM   8583  C  C     . VAL A 1  1107 ? 107.179 72.863  -12.348 1.00 103.18 ? 1107 VAL A C     1 
ATOM   8584  O  O     . VAL A 1  1107 ? 106.611 73.254  -13.380 1.00 102.88 ? 1107 VAL A O     1 
ATOM   8585  C  CB    . VAL A 1  1107 ? 109.237 72.169  -13.775 1.00 98.68  ? 1107 VAL A CB    1 
ATOM   8586  C  CG1   . VAL A 1  1107 ? 109.726 73.572  -14.095 1.00 98.91  ? 1107 VAL A CG1   1 
ATOM   8587  C  CG2   . VAL A 1  1107 ? 110.408 71.203  -13.811 1.00 97.81  ? 1107 VAL A CG2   1 
ATOM   8588  N  N     . ALA A 1  1108 ? 106.608 72.861  -11.127 1.00 102.30 ? 1108 ALA A N     1 
ATOM   8589  C  CA    . ALA A 1  1108 ? 105.319 73.449  -10.815 1.00 104.00 ? 1108 ALA A CA    1 
ATOM   8590  C  C     . ALA A 1  1108 ? 105.411 74.935  -11.080 1.00 111.46 ? 1108 ALA A C     1 
ATOM   8591  O  O     . ALA A 1  1108 ? 106.362 75.582  -10.600 1.00 112.22 ? 1108 ALA A O     1 
ATOM   8592  C  CB    . ALA A 1  1108 ? 104.972 73.186  -9.358  1.00 104.65 ? 1108 ALA A CB    1 
ATOM   8593  N  N     . LYS A 1  1109 ? 104.495 75.462  -11.923 1.00 108.68 ? 1109 LYS A N     1 
ATOM   8594  C  CA    . LYS A 1  1109 ? 104.553 76.886  -12.215 1.00 109.66 ? 1109 LYS A CA    1 
ATOM   8595  C  C     . LYS A 1  1109 ? 103.991 77.675  -11.043 1.00 114.06 ? 1109 LYS A C     1 
ATOM   8596  O  O     . LYS A 1  1109 ? 104.646 78.600  -10.550 1.00 114.05 ? 1109 LYS A O     1 
ATOM   8597  C  CB    . LYS A 1  1109 ? 103.926 77.256  -13.576 1.00 112.70 ? 1109 LYS A CB    1 
ATOM   8598  C  CG    . LYS A 1  1109 ? 103.971 78.769  -13.911 1.00 134.07 ? 1109 LYS A CG    1 
ATOM   8599  C  CD    . LYS A 1  1109 ? 105.398 79.412  -13.955 1.00 146.23 ? 1109 LYS A CD    1 
ATOM   8600  C  CE    . LYS A 1  1109 ? 105.390 80.930  -13.821 1.00 151.77 ? 1109 LYS A CE    1 
ATOM   8601  N  NZ    . LYS A 1  1109 ? 106.751 81.531  -13.949 1.00 151.08 ? 1109 LYS A NZ    1 
ATOM   8602  N  N     . ASN A 1  1110 ? 102.822 77.261  -10.549 1.00 110.86 ? 1110 ASN A N     1 
ATOM   8603  C  CA    . ASN A 1  1110 ? 102.208 77.958  -9.434  1.00 111.38 ? 1110 ASN A CA    1 
ATOM   8604  C  C     . ASN A 1  1110 ? 102.501 77.345  -8.092  1.00 110.98 ? 1110 ASN A C     1 
ATOM   8605  O  O     . ASN A 1  1110 ? 101.660 76.667  -7.499  1.00 109.59 ? 1110 ASN A O     1 
ATOM   8606  C  CB    . ASN A 1  1110 ? 100.746 78.328  -9.706  1.00 118.97 ? 1110 ASN A CB    1 
ATOM   8607  C  CG    . ASN A 1  1110 ? 100.637 79.495  -10.688 1.00 162.87 ? 1110 ASN A CG    1 
ATOM   8608  O  OD1   . ASN A 1  1110 ? 101.032 80.642  -10.395 1.00 162.76 ? 1110 ASN A OD1   1 
ATOM   8609  N  ND2   . ASN A 1  1110 ? 100.153 79.220  -11.899 1.00 155.73 ? 1110 ASN A ND2   1 
ATOM   8610  N  N     . MET A 1  1111 ? 103.745 77.580  -7.640  1.00 105.69 ? 1111 MET A N     1 
ATOM   8611  C  CA    . MET A 1  1111 ? 104.292 77.085  -6.381  1.00 104.66 ? 1111 MET A CA    1 
ATOM   8612  C  C     . MET A 1  1111 ? 103.646 77.689  -5.143  1.00 106.86 ? 1111 MET A C     1 
ATOM   8613  O  O     . MET A 1  1111 ? 103.169 78.819  -5.202  1.00 107.26 ? 1111 MET A O     1 
ATOM   8614  C  CB    . MET A 1  1111 ? 105.827 77.130  -6.363  1.00 107.07 ? 1111 MET A CB    1 
ATOM   8615  C  CG    . MET A 1  1111 ? 106.451 78.510  -6.449  1.00 111.60 ? 1111 MET A CG    1 
ATOM   8616  S  SD    . MET A 1  1111 ? 108.183 78.458  -5.902  1.00 115.53 ? 1111 MET A SD    1 
ATOM   8617  C  CE    . MET A 1  1111 ? 107.957 77.999  -4.145  1.00 111.92 ? 1111 MET A CE    1 
ATOM   8618  N  N     . LYS A 1  1112 ? 103.599 76.922  -4.039  1.00 101.78 ? 1112 LYS A N     1 
ATOM   8619  C  CA    . LYS A 1  1112 ? 102.893 77.320  -2.821  1.00 101.95 ? 1112 LYS A CA    1 
ATOM   8620  C  C     . LYS A 1  1112 ? 103.440 78.430  -1.975  1.00 105.73 ? 1112 LYS A C     1 
ATOM   8621  O  O     . LYS A 1  1112 ? 102.695 79.356  -1.686  1.00 106.81 ? 1112 LYS A O     1 
ATOM   8622  C  CB    . LYS A 1  1112 ? 102.428 76.131  -1.974  1.00 104.33 ? 1112 LYS A CB    1 
ATOM   8623  C  CG    . LYS A 1  1112 ? 101.203 75.428  -2.561  1.00 123.92 ? 1112 LYS A CG    1 
ATOM   8624  C  CD    . LYS A 1  1112 ? 101.020 74.015  -2.016  1.00 132.30 ? 1112 LYS A CD    1 
ATOM   8625  C  CE    . LYS A 1  1112 ? 100.198 73.167  -2.954  1.00 136.82 ? 1112 LYS A CE    1 
ATOM   8626  N  NZ    . LYS A 1  1112 ? 99.759  71.906  -2.304  1.00 143.66 ? 1112 LYS A NZ    1 
ATOM   8627  N  N     . THR A 1  1113 ? 104.701 78.364  -1.562  1.00 101.15 ? 1113 THR A N     1 
ATOM   8628  C  CA    . THR A 1  1113 ? 105.279 79.395  -0.691  1.00 101.19 ? 1113 THR A CA    1 
ATOM   8629  C  C     . THR A 1  1113 ? 106.313 80.305  -1.403  1.00 104.29 ? 1113 THR A C     1 
ATOM   8630  O  O     . THR A 1  1113 ? 107.421 80.390  -0.865  1.00 104.77 ? 1113 THR A O     1 
ATOM   8631  C  CB    . THR A 1  1113 ? 105.916 78.715  0.556   1.00 109.56 ? 1113 THR A CB    1 
ATOM   8632  O  OG1   . THR A 1  1113 ? 106.597 77.523  0.155   1.00 112.44 ? 1113 THR A OG1   1 
ATOM   8633  C  CG2   . THR A 1  1113 ? 104.913 78.384  1.629   1.00 106.99 ? 1113 THR A CG2   1 
ATOM   8634  N  N     . PRO A 1  1114 ? 106.060 80.999  -2.560  1.00 99.27  ? 1114 PRO A N     1 
ATOM   8635  C  CA    . PRO A 1  1114 ? 107.143 81.796  -3.174  1.00 99.01  ? 1114 PRO A CA    1 
ATOM   8636  C  C     . PRO A 1  1114 ? 107.762 82.796  -2.220  1.00 104.11 ? 1114 PRO A C     1 
ATOM   8637  O  O     . PRO A 1  1114 ? 107.066 83.336  -1.355  1.00 105.09 ? 1114 PRO A O     1 
ATOM   8638  C  CB    . PRO A 1  1114 ? 106.476 82.454  -4.377  1.00 100.94 ? 1114 PRO A CB    1 
ATOM   8639  C  CG    . PRO A 1  1114 ? 105.371 81.556  -4.716  1.00 104.97 ? 1114 PRO A CG    1 
ATOM   8640  C  CD    . PRO A 1  1114 ? 104.848 81.064  -3.394  1.00 100.55 ? 1114 PRO A CD    1 
ATOM   8641  N  N     . SER A 1  1115 ? 109.092 82.923  -2.287  1.00 100.23 ? 1115 SER A N     1 
ATOM   8642  C  CA    . SER A 1  1115 ? 109.870 83.789  -1.407  1.00 101.03 ? 1115 SER A CA    1 
ATOM   8643  C  C     . SER A 1  1115 ? 111.160 84.210  -2.040  1.00 105.72 ? 1115 SER A C     1 
ATOM   8644  O  O     . SER A 1  1115 ? 111.807 83.455  -2.767  1.00 104.51 ? 1115 SER A O     1 
ATOM   8645  C  CB    . SER A 1  1115 ? 110.162 83.118  -0.064  1.00 104.37 ? 1115 SER A CB    1 
ATOM   8646  O  OG    . SER A 1  1115 ? 111.050 83.884  0.741   1.00 112.40 ? 1115 SER A OG    1 
ATOM   8647  N  N     . LEU A 1  1116 ? 111.557 85.410  -1.681  1.00 104.17 ? 1116 LEU A N     1 
ATOM   8648  C  CA    . LEU A 1  1116 ? 112.753 86.073  -2.131  1.00 104.62 ? 1116 LEU A CA    1 
ATOM   8649  C  C     . LEU A 1  1116 ? 113.586 86.363  -0.892  1.00 110.70 ? 1116 LEU A C     1 
ATOM   8650  O  O     . LEU A 1  1116 ? 113.031 86.701  0.160   1.00 111.75 ? 1116 LEU A O     1 
ATOM   8651  C  CB    . LEU A 1  1116 ? 112.290 87.359  -2.772  1.00 105.36 ? 1116 LEU A CB    1 
ATOM   8652  C  CG    . LEU A 1  1116 ? 112.980 87.748  -3.996  1.00 110.48 ? 1116 LEU A CG    1 
ATOM   8653  C  CD1   . LEU A 1  1116 ? 112.092 87.545  -5.192  1.00 110.11 ? 1116 LEU A CD1   1 
ATOM   8654  C  CD2   . LEU A 1  1116 ? 113.312 89.171  -3.895  1.00 117.53 ? 1116 LEU A CD2   1 
ATOM   8655  N  N     . THR A 1  1117 ? 114.900 86.162  -0.982  1.00 106.86 ? 1117 THR A N     1 
ATOM   8656  C  CA    . THR A 1  1117 ? 115.796 86.405  0.143   1.00 106.72 ? 1117 THR A CA    1 
ATOM   8657  C  C     . THR A 1  1117 ? 116.744 87.512  -0.273  1.00 112.09 ? 1117 THR A C     1 
ATOM   8658  O  O     . THR A 1  1117 ? 117.687 87.266  -1.024  1.00 112.31 ? 1117 THR A O     1 
ATOM   8659  C  CB    . THR A 1  1117 ? 116.341 85.077  0.703   1.00 107.58 ? 1117 THR A CB    1 
ATOM   8660  O  OG1   . THR A 1  1117 ? 115.235 84.390  1.297   1.00 107.32 ? 1117 THR A OG1   1 
ATOM   8661  C  CG2   . THR A 1  1117 ? 117.418 85.268  1.757   1.00 102.95 ? 1117 THR A CG2   1 
ATOM   8662  N  N     . VAL A 1  1118 ? 116.414 88.755  0.126   1.00 109.28 ? 1118 VAL A N     1 
ATOM   8663  C  CA    . VAL A 1  1118 ? 117.154 89.967  -0.238  1.00 109.77 ? 1118 VAL A CA    1 
ATOM   8664  C  C     . VAL A 1  1118 ? 118.277 90.303  0.730   1.00 113.77 ? 1118 VAL A C     1 
ATOM   8665  O  O     . VAL A 1  1118 ? 118.021 90.561  1.914   1.00 113.24 ? 1118 VAL A O     1 
ATOM   8666  C  CB    . VAL A 1  1118 ? 116.258 91.198  -0.537  1.00 114.36 ? 1118 VAL A CB    1 
ATOM   8667  C  CG1   . VAL A 1  1118 ? 116.621 91.808  -1.880  1.00 114.45 ? 1118 VAL A CG1   1 
ATOM   8668  C  CG2   . VAL A 1  1118 ? 114.775 90.849  -0.494  1.00 113.76 ? 1118 VAL A CG2   1 
ATOM   8669  N  N     . TYR A 1  1119 ? 119.531 90.288  0.216   1.00 110.21 ? 1119 TYR A N     1 
ATOM   8670  C  CA    . TYR A 1  1119 ? 120.730 90.599  0.989   1.00 110.17 ? 1119 TYR A CA    1 
ATOM   8671  C  C     . TYR A 1  1119 ? 121.088 92.041  0.753   1.00 119.79 ? 1119 TYR A C     1 
ATOM   8672  O  O     . TYR A 1  1119 ? 121.020 92.519  -0.382  1.00 119.05 ? 1119 TYR A O     1 
ATOM   8673  C  CB    . TYR A 1  1119 ? 121.894 89.677  0.612   1.00 108.74 ? 1119 TYR A CB    1 
ATOM   8674  C  CG    . TYR A 1  1119 ? 121.677 88.228  0.987   1.00 106.25 ? 1119 TYR A CG    1 
ATOM   8675  C  CD1   . TYR A 1  1119 ? 121.934 87.775  2.279   1.00 107.44 ? 1119 TYR A CD1   1 
ATOM   8676  C  CD2   . TYR A 1  1119 ? 121.235 87.303  0.047   1.00 105.29 ? 1119 TYR A CD2   1 
ATOM   8677  C  CE1   . TYR A 1  1119 ? 121.734 86.441  2.632   1.00 106.24 ? 1119 TYR A CE1   1 
ATOM   8678  C  CE2   . TYR A 1  1119 ? 121.044 85.963  0.385   1.00 104.99 ? 1119 TYR A CE2   1 
ATOM   8679  C  CZ    . TYR A 1  1119 ? 121.286 85.538  1.682   1.00 111.24 ? 1119 TYR A CZ    1 
ATOM   8680  O  OH    . TYR A 1  1119 ? 121.088 84.223  2.024   1.00 110.24 ? 1119 TYR A OH    1 
ATOM   8681  N  N     . LEU A 1  1120 ? 121.434 92.739  1.837   1.00 121.88 ? 1120 LEU A N     1 
ATOM   8682  C  CA    . LEU A 1  1120 ? 121.763 94.167  1.865   1.00 125.42 ? 1120 LEU A CA    1 
ATOM   8683  C  C     . LEU A 1  1120 ? 123.119 94.502  1.236   1.00 134.24 ? 1120 LEU A C     1 
ATOM   8684  O  O     . LEU A 1  1120 ? 124.037 93.684  1.299   1.00 133.73 ? 1120 LEU A O     1 
ATOM   8685  C  CB    . LEU A 1  1120 ? 121.735 94.646  3.330   1.00 126.55 ? 1120 LEU A CB    1 
ATOM   8686  C  CG    . LEU A 1  1120 ? 120.474 95.373  3.830   1.00 132.07 ? 1120 LEU A CG    1 
ATOM   8687  C  CD1   . LEU A 1  1120 ? 119.207 94.530  3.649   1.00 131.32 ? 1120 LEU A CD1   1 
ATOM   8688  C  CD2   . LEU A 1  1120 ? 120.619 95.758  5.297   1.00 135.40 ? 1120 LEU A CD2   1 
ATOM   8689  N  N     . GLU A 1  1121 ? 123.249 95.732  0.675   1.00 134.83 ? 1121 GLU A N     1 
ATOM   8690  C  CA    . GLU A 1  1121 ? 124.458 96.287  0.040   1.00 136.66 ? 1121 GLU A CA    1 
ATOM   8691  C  C     . GLU A 1  1121 ? 125.712 96.036  0.876   1.00 143.65 ? 1121 GLU A C     1 
ATOM   8692  O  O     . GLU A 1  1121 ? 125.660 96.206  2.102   1.00 143.34 ? 1121 GLU A O     1 
ATOM   8693  C  CB    . GLU A 1  1121 ? 124.305 97.797  -0.184  1.00 139.67 ? 1121 GLU A CB    1 
ATOM   8694  C  CG    . GLU A 1  1121 ? 124.933 98.304  -1.469  1.00 152.34 ? 1121 GLU A CG    1 
ATOM   8695  C  CD    . GLU A 1  1121 ? 124.115 99.388  -2.143  1.00 178.42 ? 1121 GLU A CD    1 
ATOM   8696  O  OE1   . GLU A 1  1121 ? 124.034 100.504 -1.579  1.00 174.03 ? 1121 GLU A OE1   1 
ATOM   8697  O  OE2   . GLU A 1  1121 ? 123.509 99.107  -3.205  1.00 172.46 ? 1121 GLU A OE2   1 
ATOM   8698  N  N     . PRO A 1  1122 ? 126.832 95.617  0.221   1.00 142.47 ? 1122 PRO A N     1 
ATOM   8699  C  CA    . PRO A 1  1122 ? 128.074 95.304  0.951   1.00 143.15 ? 1122 PRO A CA    1 
ATOM   8700  C  C     . PRO A 1  1122 ? 128.304 95.905  2.342   1.00 150.42 ? 1122 PRO A C     1 
ATOM   8701  O  O     . PRO A 1  1122 ? 128.282 95.160  3.329   1.00 149.55 ? 1122 PRO A O     1 
ATOM   8702  C  CB    . PRO A 1  1122 ? 129.162 95.660  -0.064  1.00 145.01 ? 1122 PRO A CB    1 
ATOM   8703  C  CG    . PRO A 1  1122 ? 128.511 95.418  -1.409  1.00 148.47 ? 1122 PRO A CG    1 
ATOM   8704  C  CD    . PRO A 1  1122 ? 127.012 95.352  -1.223  1.00 143.62 ? 1122 PRO A CD    1 
ATOM   8705  N  N     . GLY A 1  1123 ? 128.473 97.229  2.410   1.00 149.95 ? 1123 GLY A N     1 
ATOM   8706  C  CA    . GLY A 1  1123 ? 128.733 97.951  3.651   1.00 151.74 ? 1123 GLY A CA    1 
ATOM   8707  C  C     . GLY A 1  1123 ? 127.672 97.777  4.715   1.00 157.40 ? 1123 GLY A C     1 
ATOM   8708  O  O     . GLY A 1  1123 ? 127.823 96.960  5.634   1.00 156.57 ? 1123 GLY A O     1 
ATOM   8709  N  N     . HIS A 1  1124 ? 126.580 98.533  4.560   1.00 155.63 ? 1124 HIS A N     1 
ATOM   8710  C  CA    . HIS A 1  1124 ? 125.405 98.581  5.432   1.00 156.11 ? 1124 HIS A CA    1 
ATOM   8711  C  C     . HIS A 1  1124 ? 124.679 97.225  5.520   1.00 156.73 ? 1124 HIS A C     1 
ATOM   8712  O  O     . HIS A 1  1124 ? 123.588 97.050  4.982   1.00 155.82 ? 1124 HIS A O     1 
ATOM   8713  C  CB    . HIS A 1  1124 ? 124.460 99.721  4.985   1.00 158.41 ? 1124 HIS A CB    1 
ATOM   8714  C  CG    . HIS A 1  1124 ? 124.928 100.442 3.755   1.00 162.71 ? 1124 HIS A CG    1 
ATOM   8715  N  ND1   . HIS A 1  1124 ? 124.984 99.807  2.520   1.00 163.65 ? 1124 HIS A ND1   1 
ATOM   8716  C  CD2   . HIS A 1  1124 ? 125.384 101.709 3.616   1.00 166.03 ? 1124 HIS A CD2   1 
ATOM   8717  C  CE1   . HIS A 1  1124 ? 125.457 100.707 1.675   1.00 163.97 ? 1124 HIS A CE1   1 
ATOM   8718  N  NE2   . HIS A 1  1124 ? 125.713 101.868 2.288   1.00 165.73 ? 1124 HIS A NE2   1 
ATOM   8719  N  N     . ALA A 1  1125 ? 125.313 96.271  6.201   1.00 151.19 ? 1125 ALA A N     1 
ATOM   8720  C  CA    . ALA A 1  1125 ? 124.797 94.928  6.410   1.00 148.89 ? 1125 ALA A CA    1 
ATOM   8721  C  C     . ALA A 1  1125 ? 124.367 94.766  7.865   1.00 151.44 ? 1125 ALA A C     1 
ATOM   8722  O  O     . ALA A 1  1125 ? 123.525 93.924  8.158   1.00 149.60 ? 1125 ALA A O     1 
ATOM   8723  C  CB    . ALA A 1  1125 ? 125.868 93.917  6.062   1.00 148.77 ? 1125 ALA A CB    1 
ATOM   8724  N  N     . ALA A 1  1126 ? 124.945 95.584  8.770   1.00 148.89 ? 1126 ALA A N     1 
ATOM   8725  C  CA    . ALA A 1  1126 ? 124.655 95.608  10.208  1.00 149.02 ? 1126 ALA A CA    1 
ATOM   8726  C  C     . ALA A 1  1126 ? 123.657 96.704  10.529  1.00 153.84 ? 1126 ALA A C     1 
ATOM   8727  O  O     . ALA A 1  1126 ? 122.955 96.617  11.541  1.00 153.64 ? 1126 ALA A O     1 
ATOM   8728  C  CB    . ALA A 1  1126 ? 125.931 95.843  10.992  1.00 150.51 ? 1126 ALA A CB    1 
ATOM   8729  N  N     . ASP A 1  1127 ? 123.622 97.751  9.672   1.00 151.13 ? 1127 ASP A N     1 
ATOM   8730  C  CA    . ASP A 1  1127 ? 122.733 98.912  9.753   1.00 152.01 ? 1127 ASP A CA    1 
ATOM   8731  C  C     . ASP A 1  1127 ? 121.290 98.398  9.634   1.00 153.56 ? 1127 ASP A C     1 
ATOM   8732  O  O     . ASP A 1  1127 ? 120.811 98.130  8.526   1.00 152.37 ? 1127 ASP A O     1 
ATOM   8733  C  CB    . ASP A 1  1127 ? 123.092 99.925  8.625   1.00 154.92 ? 1127 ASP A CB    1 
ATOM   8734  C  CG    . ASP A 1  1127 ? 122.480 101.332 8.663   1.00 168.18 ? 1127 ASP A CG    1 
ATOM   8735  O  OD1   . ASP A 1  1127 ? 121.736 101.643 9.629   1.00 170.01 ? 1127 ASP A OD1   1 
ATOM   8736  O  OD2   . ASP A 1  1127 ? 122.740 102.118 7.718   1.00 172.58 ? 1127 ASP A OD2   1 
ATOM   8737  N  N     . GLN A 1  1128 ? 120.638 98.175  10.799  1.00 148.95 ? 1128 GLN A N     1 
ATOM   8738  C  CA    . GLN A 1  1128 ? 119.260 97.675  10.893  1.00 147.50 ? 1128 GLN A CA    1 
ATOM   8739  C  C     . GLN A 1  1128 ? 118.280 98.695  10.327  1.00 150.88 ? 1128 GLN A C     1 
ATOM   8740  O  O     . GLN A 1  1128 ? 117.198 98.320  9.858   1.00 149.45 ? 1128 GLN A O     1 
ATOM   8741  C  CB    . GLN A 1  1128 ? 118.893 97.337  12.345  1.00 148.86 ? 1128 GLN A CB    1 
ATOM   8742  C  CG    . GLN A 1  1128 ? 117.642 96.470  12.441  1.00 156.25 ? 1128 GLN A CG    1 
ATOM   8743  C  CD    . GLN A 1  1128 ? 116.630 96.929  13.455  1.00 174.70 ? 1128 GLN A CD    1 
ATOM   8744  O  OE1   . GLN A 1  1128 ? 115.998 96.110  14.132  1.00 168.53 ? 1128 GLN A OE1   1 
ATOM   8745  N  NE2   . GLN A 1  1128 ? 116.403 98.239  13.547  1.00 168.19 ? 1128 GLN A NE2   1 
ATOM   8746  N  N     . GLU A 1  1129 ? 118.663 99.986  10.390  1.00 147.98 ? 1129 GLU A N     1 
ATOM   8747  C  CA    . GLU A 1  1129 ? 117.861 101.082 9.868   1.00 148.36 ? 1129 GLU A CA    1 
ATOM   8748  C  C     . GLU A 1  1129 ? 117.837 101.076 8.346   1.00 149.49 ? 1129 GLU A C     1 
ATOM   8749  O  O     . GLU A 1  1129 ? 116.769 101.305 7.774   1.00 149.52 ? 1129 GLU A O     1 
ATOM   8750  C  CB    . GLU A 1  1129 ? 118.279 102.440 10.454  1.00 151.67 ? 1129 GLU A CB    1 
ATOM   8751  C  CG    . GLU A 1  1129 ? 117.716 102.701 11.847  1.00 164.85 ? 1129 GLU A CG    1 
ATOM   8752  C  CD    . GLU A 1  1129 ? 116.207 102.609 12.013  1.00 185.30 ? 1129 GLU A CD    1 
ATOM   8753  O  OE1   . GLU A 1  1129 ? 115.493 103.493 11.485  1.00 178.82 ? 1129 GLU A OE1   1 
ATOM   8754  O  OE2   . GLU A 1  1129 ? 115.739 101.652 12.672  1.00 177.65 ? 1129 GLU A OE2   1 
ATOM   8755  N  N     . GLN A 1  1130 ? 118.987 100.747 7.694   1.00 142.91 ? 1130 GLN A N     1 
ATOM   8756  C  CA    . GLN A 1  1130 ? 119.116 100.610 6.233   1.00 140.75 ? 1130 GLN A CA    1 
ATOM   8757  C  C     . GLN A 1  1130 ? 118.145 99.511  5.760   1.00 140.37 ? 1130 GLN A C     1 
ATOM   8758  O  O     . GLN A 1  1130 ? 117.449 99.686  4.756   1.00 139.67 ? 1130 GLN A O     1 
ATOM   8759  C  CB    . GLN A 1  1130 ? 120.573 100.268 5.853   1.00 141.54 ? 1130 GLN A CB    1 
ATOM   8760  C  CG    . GLN A 1  1130 ? 120.762 99.610  4.485   1.00 146.00 ? 1130 GLN A CG    1 
ATOM   8761  C  CD    . GLN A 1  1130 ? 121.259 100.547 3.416   1.00 158.36 ? 1130 GLN A CD    1 
ATOM   8762  O  OE1   . GLN A 1  1130 ? 121.391 101.765 3.612   1.00 154.59 ? 1130 GLN A OE1   1 
ATOM   8763  N  NE2   . GLN A 1  1130 ? 121.563 99.979  2.254   1.00 144.55 ? 1130 GLN A NE2   1 
ATOM   8764  N  N     . ALA A 1  1131 ? 118.074 98.406  6.534   1.00 133.50 ? 1131 ALA A N     1 
ATOM   8765  C  CA    . ALA A 1  1131 ? 117.195 97.270  6.300   1.00 130.65 ? 1131 ALA A CA    1 
ATOM   8766  C  C     . ALA A 1  1131 ? 115.734 97.729  6.217   1.00 132.09 ? 1131 ALA A C     1 
ATOM   8767  O  O     . ALA A 1  1131 ? 115.072 97.447  5.213   1.00 131.00 ? 1131 ALA A O     1 
ATOM   8768  C  CB    . ALA A 1  1131 ? 117.374 96.237  7.409   1.00 130.63 ? 1131 ALA A CB    1 
ATOM   8769  N  N     . LYS A 1  1132 ? 115.269 98.506  7.232   1.00 127.41 ? 1132 LYS A N     1 
ATOM   8770  C  CA    . LYS A 1  1132 ? 113.903 99.039  7.339   1.00 126.42 ? 1132 LYS A CA    1 
ATOM   8771  C  C     . LYS A 1  1132 ? 113.471 99.813  6.101   1.00 127.99 ? 1132 LYS A C     1 
ATOM   8772  O  O     . LYS A 1  1132 ? 112.327 99.662  5.663   1.00 126.52 ? 1132 LYS A O     1 
ATOM   8773  C  CB    . LYS A 1  1132 ? 113.737 99.907  8.598   1.00 129.81 ? 1132 LYS A CB    1 
ATOM   8774  C  CG    . LYS A 1  1132 ? 113.681 99.125  9.904   1.00 140.18 ? 1132 LYS A CG    1 
ATOM   8775  C  CD    . LYS A 1  1132 ? 113.267 100.013 11.067  1.00 151.72 ? 1132 LYS A CD    1 
ATOM   8776  C  CE    . LYS A 1  1132 ? 113.268 99.295  12.394  1.00 159.95 ? 1132 LYS A CE    1 
ATOM   8777  N  NZ    . LYS A 1  1132 ? 112.817 100.186 13.496  1.00 168.20 ? 1132 LYS A NZ    1 
ATOM   8778  N  N     . LEU A 1  1133 ? 114.403 100.617 5.530   1.00 124.22 ? 1133 LEU A N     1 
ATOM   8779  C  CA    . LEU A 1  1133 ? 114.193 101.445 4.335   1.00 124.25 ? 1133 LEU A CA    1 
ATOM   8780  C  C     . LEU A 1  1133 ? 113.924 100.585 3.132   1.00 125.55 ? 1133 LEU A C     1 
ATOM   8781  O  O     . LEU A 1  1133 ? 113.085 100.944 2.307   1.00 124.88 ? 1133 LEU A O     1 
ATOM   8782  C  CB    . LEU A 1  1133 ? 115.403 102.352 4.032   1.00 125.38 ? 1133 LEU A CB    1 
ATOM   8783  C  CG    . LEU A 1  1133 ? 116.059 103.092 5.197   1.00 131.79 ? 1133 LEU A CG    1 
ATOM   8784  C  CD1   . LEU A 1  1133 ? 117.410 103.659 4.790   1.00 132.69 ? 1133 LEU A CD1   1 
ATOM   8785  C  CD2   . LEU A 1  1133 ? 115.144 104.169 5.779   1.00 135.69 ? 1133 LEU A CD2   1 
ATOM   8786  N  N     . ILE A 1  1134 ? 114.653 99.459  3.015   1.00 120.70 ? 1134 ILE A N     1 
ATOM   8787  C  CA    . ILE A 1  1134 ? 114.481 98.541  1.895   1.00 119.16 ? 1134 ILE A CA    1 
ATOM   8788  C  C     . ILE A 1  1134 ? 113.159 97.817  2.054   1.00 122.84 ? 1134 ILE A C     1 
ATOM   8789  O  O     . ILE A 1  1134 ? 112.364 97.816  1.117   1.00 122.31 ? 1134 ILE A O     1 
ATOM   8790  C  CB    . ILE A 1  1134 ? 115.691 97.606  1.649   1.00 120.84 ? 1134 ILE A CB    1 
ATOM   8791  C  CG1   . ILE A 1  1134 ? 116.981 98.424  1.490   1.00 121.61 ? 1134 ILE A CG1   1 
ATOM   8792  C  CG2   . ILE A 1  1134 ? 115.456 96.778  0.388   1.00 120.74 ? 1134 ILE A CG2   1 
ATOM   8793  C  CD1   . ILE A 1  1134 ? 118.127 97.891  2.189   1.00 130.16 ? 1134 ILE A CD1   1 
ATOM   8794  N  N     . ARG A 1  1135 ? 112.882 97.300  3.270   1.00 119.26 ? 1135 ARG A N     1 
ATOM   8795  C  CA    . ARG A 1  1135 ? 111.619 96.643  3.594   1.00 118.55 ? 1135 ARG A CA    1 
ATOM   8796  C  C     . ARG A 1  1135 ? 110.488 97.529  3.090   1.00 123.04 ? 1135 ARG A C     1 
ATOM   8797  O  O     . ARG A 1  1135 ? 109.686 97.073  2.280   1.00 121.27 ? 1135 ARG A O     1 
ATOM   8798  C  CB    . ARG A 1  1135 ? 111.499 96.400  5.111   1.00 119.43 ? 1135 ARG A CB    1 
ATOM   8799  C  CG    . ARG A 1  1135 ? 110.438 95.363  5.481   1.00 128.44 ? 1135 ARG A CG    1 
ATOM   8800  C  CD    . ARG A 1  1135 ? 109.225 95.954  6.168   1.00 135.53 ? 1135 ARG A CD    1 
ATOM   8801  N  NE    . ARG A 1  1135 ? 109.364 95.889  7.621   1.00 142.85 ? 1135 ARG A NE    1 
ATOM   8802  C  CZ    . ARG A 1  1135 ? 109.839 96.875  8.375   1.00 162.75 ? 1135 ARG A CZ    1 
ATOM   8803  N  NH1   . ARG A 1  1135 ? 110.209 98.027  7.823   1.00 149.24 ? 1135 ARG A NH1   1 
ATOM   8804  N  NH2   . ARG A 1  1135 ? 109.938 96.723  9.687   1.00 155.37 ? 1135 ARG A NH2   1 
ATOM   8805  N  N     . SER A 1  1136 ? 110.526 98.825  3.461   1.00 122.37 ? 1136 SER A N     1 
ATOM   8806  C  CA    . SER A 1  1136 ? 109.557 99.850  3.065   1.00 123.81 ? 1136 SER A CA    1 
ATOM   8807  C  C     . SER A 1  1136 ? 109.532 100.122 1.557   1.00 128.96 ? 1136 SER A C     1 
ATOM   8808  O  O     . SER A 1  1136 ? 108.457 100.395 1.021   1.00 129.78 ? 1136 SER A O     1 
ATOM   8809  C  CB    . SER A 1  1136 ? 109.807 101.145 3.828   1.00 128.13 ? 1136 SER A CB    1 
ATOM   8810  O  OG    . SER A 1  1136 ? 109.795 100.895 5.224   1.00 136.73 ? 1136 SER A OG    1 
ATOM   8811  N  N     . ALA A 1  1137 ? 110.698 100.023 0.877   1.00 124.44 ? 1137 ALA A N     1 
ATOM   8812  C  CA    . ALA A 1  1137 ? 110.844 100.279 -0.563  1.00 123.69 ? 1137 ALA A CA    1 
ATOM   8813  C  C     . ALA A 1  1137 ? 110.377 99.141  -1.462  1.00 124.94 ? 1137 ALA A C     1 
ATOM   8814  O  O     . ALA A 1  1137 ? 110.165 99.372  -2.660  1.00 123.77 ? 1137 ALA A O     1 
ATOM   8815  C  CB    . ALA A 1  1137 ? 112.292 100.617 -0.885  1.00 124.71 ? 1137 ALA A CB    1 
ATOM   8816  N  N     . ILE A 1  1138 ? 110.253 97.915  -0.899  1.00 120.50 ? 1138 ILE A N     1 
ATOM   8817  C  CA    . ILE A 1  1138 ? 109.895 96.698  -1.641  1.00 119.08 ? 1138 ILE A CA    1 
ATOM   8818  C  C     . ILE A 1  1138 ? 108.527 96.088  -1.318  1.00 123.01 ? 1138 ILE A C     1 
ATOM   8819  O  O     . ILE A 1  1138 ? 107.863 95.601  -2.238  1.00 121.45 ? 1138 ILE A O     1 
ATOM   8820  C  CB    . ILE A 1  1138 ? 111.041 95.638  -1.660  1.00 121.00 ? 1138 ILE A CB    1 
ATOM   8821  C  CG1   . ILE A 1  1138 ? 111.366 95.086  -0.256  1.00 121.33 ? 1138 ILE A CG1   1 
ATOM   8822  C  CG2   . ILE A 1  1138 ? 112.298 96.168  -2.354  1.00 121.48 ? 1138 ILE A CG2   1 
ATOM   8823  C  CD1   . ILE A 1  1138 ? 111.604 93.612  -0.223  1.00 129.11 ? 1138 ILE A CD1   1 
ATOM   8824  N  N     . GLU A 1  1139 ? 108.111 96.107  -0.025  1.00 121.06 ? 1139 GLU A N     1 
ATOM   8825  C  CA    . GLU A 1  1139 ? 106.823 95.566  0.439   1.00 121.02 ? 1139 GLU A CA    1 
ATOM   8826  C  C     . GLU A 1  1139 ? 105.681 96.380  -0.145  1.00 127.32 ? 1139 GLU A C     1 
ATOM   8827  O  O     . GLU A 1  1139 ? 105.580 97.588  0.110   1.00 128.33 ? 1139 GLU A O     1 
ATOM   8828  C  CB    . GLU A 1  1139 ? 106.734 95.544  1.975   1.00 122.55 ? 1139 GLU A CB    1 
ATOM   8829  C  CG    . GLU A 1  1139 ? 105.590 94.704  2.515   1.00 129.42 ? 1139 GLU A CG    1 
ATOM   8830  C  CD    . GLU A 1  1139 ? 105.304 94.880  3.993   1.00 145.40 ? 1139 GLU A CD    1 
ATOM   8831  O  OE1   . GLU A 1  1139 ? 106.264 94.911  4.799   1.00 122.91 ? 1139 GLU A OE1   1 
ATOM   8832  O  OE2   . GLU A 1  1139 ? 104.106 94.959  4.348   1.00 144.23 ? 1139 GLU A OE2   1 
ATOM   8833  N  N     . HIS A 1  1140 ? 104.847 95.706  -0.952  1.00 124.00 ? 1140 HIS A N     1 
ATOM   8834  C  CA    . HIS A 1  1140 ? 103.704 96.276  -1.664  1.00 124.62 ? 1140 HIS A CA    1 
ATOM   8835  C  C     . HIS A 1  1140 ? 102.561 96.712  -0.737  1.00 129.30 ? 1140 HIS A C     1 
ATOM   8836  O  O     . HIS A 1  1140 ? 101.945 95.888  -0.038  1.00 128.11 ? 1140 HIS A O     1 
ATOM   8837  C  CB    . HIS A 1  1140 ? 103.236 95.322  -2.774  1.00 124.26 ? 1140 HIS A CB    1 
ATOM   8838  C  CG    . HIS A 1  1140 ? 102.027 95.775  -3.514  1.00 127.90 ? 1140 HIS A CG    1 
ATOM   8839  N  ND1   . HIS A 1  1140 ? 102.123 96.631  -4.589  1.00 130.18 ? 1140 HIS A ND1   1 
ATOM   8840  C  CD2   . HIS A 1  1140 ? 100.729 95.447  -3.323  1.00 129.50 ? 1140 HIS A CD2   1 
ATOM   8841  C  CE1   . HIS A 1  1140 ? 100.886 96.802  -5.019  1.00 130.04 ? 1140 HIS A CE1   1 
ATOM   8842  N  NE2   . HIS A 1  1140 ? 100.012 96.113  -4.284  1.00 130.00 ? 1140 HIS A NE2   1 
ATOM   8843  N  N     . THR A 1  1141 ? 102.296 98.041  -0.764  1.00 126.79 ? 1141 THR A N     1 
ATOM   8844  C  CA    . THR A 1  1141 ? 101.277 98.767  -0.002  1.00 127.08 ? 1141 THR A CA    1 
ATOM   8845  C  C     . THR A 1  1141 ? 100.262 99.428  -0.967  1.00 131.37 ? 1141 THR A C     1 
ATOM   8846  O  O     . THR A 1  1141 ? 100.664 100.126 -1.910  1.00 131.16 ? 1141 THR A O     1 
ATOM   8847  C  CB    . THR A 1  1141 ? 101.966 99.786  0.923   1.00 132.88 ? 1141 THR A CB    1 
ATOM   8848  O  OG1   . THR A 1  1141 ? 102.882 99.101  1.774   1.00 131.13 ? 1141 THR A OG1   1 
ATOM   8849  C  CG2   . THR A 1  1141 ? 100.986 100.589 1.764   1.00 133.15 ? 1141 THR A CG2   1 
ATOM   8850  N  N     . THR A 1  1142 ? 98.946  99.176  -0.731  1.00 127.68 ? 1142 THR A N     1 
ATOM   8851  C  CA    . THR A 1  1142 ? 97.824  99.733  -1.511  1.00 127.64 ? 1142 THR A CA    1 
ATOM   8852  C  C     . THR A 1  1142 ? 96.985  100.729 -0.707  1.00 129.47 ? 1142 THR A C     1 
ATOM   8853  O  O     . THR A 1  1142 ? 97.023  100.747 0.531   1.00 129.29 ? 1142 THR A O     1 
ATOM   8854  C  CB    . THR A 1  1142 ? 96.906  98.640  -2.088  1.00 136.60 ? 1142 THR A CB    1 
ATOM   8855  O  OG1   . THR A 1  1142 ? 96.746  97.573  -1.144  1.00 135.56 ? 1142 THR A OG1   1 
ATOM   8856  C  CG2   . THR A 1  1142 ? 97.369  98.142  -3.443  1.00 134.38 ? 1142 THR A CG2   1 
ATOM   8857  N  N     . LEU A 1  1143 ? 96.187  101.529 -1.424  1.00 123.40 ? 1143 LEU A N     1 
ATOM   8858  C  CA    . LEU A 1  1143 ? 95.320  102.498 -0.785  1.00 122.96 ? 1143 LEU A CA    1 
ATOM   8859  C  C     . LEU A 1  1143 ? 94.279  101.766 0.042   1.00 125.03 ? 1143 LEU A C     1 
ATOM   8860  O  O     . LEU A 1  1143 ? 93.834  102.308 1.050   1.00 125.83 ? 1143 LEU A O     1 
ATOM   8861  C  CB    . LEU A 1  1143 ? 94.687  103.420 -1.837  1.00 123.37 ? 1143 LEU A CB    1 
ATOM   8862  C  CG    . LEU A 1  1143 ? 93.913  104.647 -1.369  1.00 127.71 ? 1143 LEU A CG    1 
ATOM   8863  C  CD1   . LEU A 1  1143 ? 94.711  105.482 -0.406  1.00 128.10 ? 1143 LEU A CD1   1 
ATOM   8864  C  CD2   . LEU A 1  1143 ? 93.531  105.483 -2.540  1.00 129.87 ? 1143 LEU A CD2   1 
ATOM   8865  N  N     . LYS A 1  1144 ? 93.957  100.506 -0.331  1.00 118.58 ? 1144 LYS A N     1 
ATOM   8866  C  CA    . LYS A 1  1144 ? 93.006  99.690  0.417   1.00 117.83 ? 1144 LYS A CA    1 
ATOM   8867  C  C     . LYS A 1  1144 ? 93.500  99.455  1.849   1.00 121.32 ? 1144 LYS A C     1 
ATOM   8868  O  O     . LYS A 1  1144 ? 92.720  99.606  2.797   1.00 120.44 ? 1144 LYS A O     1 
ATOM   8869  C  CB    . LYS A 1  1144 ? 92.730  98.359  -0.298  1.00 118.99 ? 1144 LYS A CB    1 
ATOM   8870  C  CG    . LYS A 1  1144 ? 91.368  97.759  0.058   1.00 132.50 ? 1144 LYS A CG    1 
ATOM   8871  C  CD    . LYS A 1  1144 ? 91.074  96.467  -0.691  1.00 140.36 ? 1144 LYS A CD    1 
ATOM   8872  C  CE    . LYS A 1  1144 ? 89.642  96.024  -0.506  1.00 149.10 ? 1144 LYS A CE    1 
ATOM   8873  N  NZ    . LYS A 1  1144 ? 89.317  94.853  -1.358  1.00 156.93 ? 1144 LYS A NZ    1 
ATOM   8874  N  N     . SER A 1  1145 ? 94.810  99.150  1.991   1.00 118.21 ? 1145 SER A N     1 
ATOM   8875  C  CA    . SER A 1  1145 ? 95.492  98.889  3.264   1.00 118.34 ? 1145 SER A CA    1 
ATOM   8876  C  C     . SER A 1  1145 ? 95.198  99.977  4.303   1.00 125.58 ? 1145 SER A C     1 
ATOM   8877  O  O     . SER A 1  1145 ? 94.645  99.686  5.363   1.00 125.90 ? 1145 SER A O     1 
ATOM   8878  C  CB    . SER A 1  1145 ? 97.001  98.760  3.056   1.00 120.28 ? 1145 SER A CB    1 
ATOM   8879  O  OG    . SER A 1  1145 ? 97.327  98.322  1.746   1.00 125.84 ? 1145 SER A OG    1 
ATOM   8880  N  N     . VAL A 1  1146 ? 95.507  101.230 3.958   1.00 123.51 ? 1146 VAL A N     1 
ATOM   8881  C  CA    . VAL A 1  1146 ? 95.341  102.407 4.811   1.00 124.85 ? 1146 VAL A CA    1 
ATOM   8882  C  C     . VAL A 1  1146 ? 93.896  102.861 5.093   1.00 128.78 ? 1146 VAL A C     1 
ATOM   8883  O  O     . VAL A 1  1146 ? 93.661  103.445 6.153   1.00 130.13 ? 1146 VAL A O     1 
ATOM   8884  C  CB    . VAL A 1  1146 ? 96.214  103.593 4.316   1.00 130.25 ? 1146 VAL A CB    1 
ATOM   8885  C  CG1   . VAL A 1  1146 ? 97.676  103.410 4.708   1.00 130.08 ? 1146 VAL A CG1   1 
ATOM   8886  C  CG2   . VAL A 1  1146 ? 96.081  103.809 2.807   1.00 129.86 ? 1146 VAL A CG2   1 
ATOM   8887  N  N     . THR A 1  1147 ? 92.947  102.634 4.148   1.00 122.92 ? 1147 THR A N     1 
ATOM   8888  C  CA    . THR A 1  1147 ? 91.556  103.122 4.226   1.00 122.23 ? 1147 THR A CA    1 
ATOM   8889  C  C     . THR A 1  1147 ? 90.619  102.468 5.237   1.00 122.63 ? 1147 THR A C     1 
ATOM   8890  O  O     . THR A 1  1147 ? 90.473  101.245 5.249   1.00 120.78 ? 1147 THR A O     1 
ATOM   8891  C  CB    . THR A 1  1147 ? 90.903  103.176 2.833   1.00 129.65 ? 1147 THR A CB    1 
ATOM   8892  O  OG1   . THR A 1  1147 ? 91.866  103.508 1.836   1.00 129.29 ? 1147 THR A OG1   1 
ATOM   8893  C  CG2   . THR A 1  1147 ? 89.751  104.162 2.766   1.00 129.96 ? 1147 THR A CG2   1 
ATOM   8894  N  N     . ILE A 1  1148 ? 89.919  103.305 6.023   1.00 118.86 ? 1148 ILE A N     1 
ATOM   8895  C  CA    . ILE A 1  1148 ? 88.895  102.864 6.975   1.00 118.50 ? 1148 ILE A CA    1 
ATOM   8896  C  C     . ILE A 1  1148 ? 87.584  102.665 6.215   1.00 122.72 ? 1148 ILE A C     1 
ATOM   8897  O  O     . ILE A 1  1148 ? 86.978  101.603 6.344   1.00 123.37 ? 1148 ILE A O     1 
ATOM   8898  C  CB    . ILE A 1  1148 ? 88.689  103.786 8.214   1.00 122.66 ? 1148 ILE A CB    1 
ATOM   8899  C  CG1   . ILE A 1  1148 ? 90.029  104.214 8.843   1.00 123.32 ? 1148 ILE A CG1   1 
ATOM   8900  C  CG2   . ILE A 1  1148 ? 87.771  103.103 9.249   1.00 122.16 ? 1148 ILE A CG2   1 
ATOM   8901  C  CD1   . ILE A 1  1148 ? 89.959  105.383 9.857   1.00 130.32 ? 1148 ILE A CD1   1 
ATOM   8902  N  N     . ALA A 1  1149 ? 87.144  103.687 5.439   1.00 118.01 ? 1149 ALA A N     1 
ATOM   8903  C  CA    . ALA A 1  1149 ? 85.911  103.680 4.640   1.00 117.26 ? 1149 ALA A CA    1 
ATOM   8904  C  C     . ALA A 1  1149 ? 85.925  104.806 3.623   1.00 121.73 ? 1149 ALA A C     1 
ATOM   8905  O  O     . ALA A 1  1149 ? 86.521  105.856 3.877   1.00 122.37 ? 1149 ALA A O     1 
ATOM   8906  C  CB    . ALA A 1  1149 ? 84.707  103.863 5.547   1.00 118.91 ? 1149 ALA A CB    1 
ATOM   8907  N  N     . SER A 1  1150 ? 85.232  104.613 2.493   1.00 117.82 ? 1150 SER A N     1 
ATOM   8908  C  CA    . SER A 1  1150 ? 85.073  105.661 1.477   1.00 118.55 ? 1150 SER A CA    1 
ATOM   8909  C  C     . SER A 1  1150 ? 83.598  106.088 1.457   1.00 122.05 ? 1150 SER A C     1 
ATOM   8910  O  O     . SER A 1  1150 ? 82.729  105.278 1.774   1.00 122.89 ? 1150 SER A O     1 
ATOM   8911  C  CB    . SER A 1  1150 ? 85.539  105.187 0.103   1.00 121.71 ? 1150 SER A CB    1 
ATOM   8912  O  OG    . SER A 1  1150 ? 84.930  103.964 -0.277  1.00 130.01 ? 1150 SER A OG    1 
ATOM   8913  N  N     . GLU A 1  1151 ? 83.310  107.351 1.152   1.00 116.86 ? 1151 GLU A N     1 
ATOM   8914  C  CA    . GLU A 1  1151 ? 81.928  107.828 1.149   1.00 116.63 ? 1151 GLU A CA    1 
ATOM   8915  C  C     . GLU A 1  1151 ? 81.626  108.729 -0.061  1.00 117.78 ? 1151 GLU A C     1 
ATOM   8916  O  O     . GLU A 1  1151 ? 82.527  109.377 -0.589  1.00 117.52 ? 1151 GLU A O     1 
ATOM   8917  C  CB    . GLU A 1  1151 ? 81.625  108.607 2.442   1.00 119.46 ? 1151 GLU A CB    1 
ATOM   8918  C  CG    . GLU A 1  1151 ? 81.573  107.827 3.748   1.00 127.48 ? 1151 GLU A CG    1 
ATOM   8919  C  CD    . GLU A 1  1151 ? 81.341  108.721 4.958   1.00 141.76 ? 1151 GLU A CD    1 
ATOM   8920  O  OE1   . GLU A 1  1151 ? 82.119  109.688 5.145   1.00 121.26 ? 1151 GLU A OE1   1 
ATOM   8921  O  OE2   . GLU A 1  1151 ? 80.374  108.463 5.714   1.00 129.96 ? 1151 GLU A OE2   1 
ATOM   8922  N  N     . ILE A 1  1152 ? 80.358  108.784 -0.486  1.00 112.16 ? 1152 ILE A N     1 
ATOM   8923  C  CA    . ILE A 1  1152 ? 79.946  109.658 -1.576  1.00 111.94 ? 1152 ILE A CA    1 
ATOM   8924  C  C     . ILE A 1  1152 ? 78.844  110.588 -1.092  1.00 116.94 ? 1152 ILE A C     1 
ATOM   8925  O  O     . ILE A 1  1152 ? 77.738  110.153 -0.779  1.00 116.97 ? 1152 ILE A O     1 
ATOM   8926  C  CB    . ILE A 1  1152 ? 79.609  108.945 -2.909  1.00 113.89 ? 1152 ILE A CB    1 
ATOM   8927  C  CG1   . ILE A 1  1152 ? 80.815  108.160 -3.447  1.00 112.09 ? 1152 ILE A CG1   1 
ATOM   8928  C  CG2   . ILE A 1  1152 ? 79.101  109.964 -3.949  1.00 116.36 ? 1152 ILE A CG2   1 
ATOM   8929  C  CD1   . ILE A 1  1152 ? 80.496  107.224 -4.605  1.00 117.16 ? 1152 ILE A CD1   1 
ATOM   8930  N  N     . TYR A 1  1153 ? 79.173  111.871 -1.025  1.00 113.86 ? 1153 TYR A N     1 
ATOM   8931  C  CA    . TYR A 1  1153 ? 78.286  112.927 -0.592  1.00 114.84 ? 1153 TYR A CA    1 
ATOM   8932  C  C     . TYR A 1  1153 ? 77.985  113.798 -1.774  1.00 118.61 ? 1153 TYR A C     1 
ATOM   8933  O  O     . TYR A 1  1153 ? 78.798  113.891 -2.698  1.00 117.14 ? 1153 TYR A O     1 
ATOM   8934  C  CB    . TYR A 1  1153 ? 79.002  113.809 0.441   1.00 117.19 ? 1153 TYR A CB    1 
ATOM   8935  C  CG    . TYR A 1  1153 ? 79.237  113.178 1.791   1.00 119.10 ? 1153 TYR A CG    1 
ATOM   8936  C  CD1   . TYR A 1  1153 ? 80.315  112.326 2.005   1.00 119.86 ? 1153 TYR A CD1   1 
ATOM   8937  C  CD2   . TYR A 1  1153 ? 78.445  113.512 2.884   1.00 121.12 ? 1153 TYR A CD2   1 
ATOM   8938  C  CE1   . TYR A 1  1153 ? 80.554  111.763 3.255   1.00 120.89 ? 1153 TYR A CE1   1 
ATOM   8939  C  CE2   . TYR A 1  1153 ? 78.687  112.972 4.146   1.00 121.78 ? 1153 TYR A CE2   1 
ATOM   8940  C  CZ    . TYR A 1  1153 ? 79.737  112.087 4.324   1.00 129.58 ? 1153 TYR A CZ    1 
ATOM   8941  O  OH    . TYR A 1  1153 ? 79.971  111.526 5.557   1.00 131.86 ? 1153 TYR A OH    1 
ATOM   8942  N  N     . TYR A 1  1154 ? 76.845  114.485 -1.722  1.00 117.12 ? 1154 TYR A N     1 
ATOM   8943  C  CA    . TYR A 1  1154 ? 76.483  115.486 -2.700  1.00 118.61 ? 1154 TYR A CA    1 
ATOM   8944  C  C     . TYR A 1  1154 ? 76.811  116.795 -1.991  1.00 128.27 ? 1154 TYR A C     1 
ATOM   8945  O  O     . TYR A 1  1154 ? 76.069  117.219 -1.101  1.00 128.91 ? 1154 TYR A O     1 
ATOM   8946  C  CB    . TYR A 1  1154 ? 74.994  115.403 -3.101  1.00 119.54 ? 1154 TYR A CB    1 
ATOM   8947  C  CG    . TYR A 1  1154 ? 74.548  116.548 -3.990  1.00 122.40 ? 1154 TYR A CG    1 
ATOM   8948  C  CD1   . TYR A 1  1154 ? 74.835  116.553 -5.352  1.00 123.89 ? 1154 TYR A CD1   1 
ATOM   8949  C  CD2   . TYR A 1  1154 ? 73.860  117.641 -3.466  1.00 124.95 ? 1154 TYR A CD2   1 
ATOM   8950  C  CE1   . TYR A 1  1154 ? 74.457  117.622 -6.168  1.00 125.54 ? 1154 TYR A CE1   1 
ATOM   8951  C  CE2   . TYR A 1  1154 ? 73.455  118.702 -4.278  1.00 127.03 ? 1154 TYR A CE2   1 
ATOM   8952  C  CZ    . TYR A 1  1154 ? 73.767  118.694 -5.627  1.00 132.29 ? 1154 TYR A CZ    1 
ATOM   8953  O  OH    . TYR A 1  1154 ? 73.377  119.736 -6.436  1.00 133.72 ? 1154 TYR A OH    1 
ATOM   8954  N  N     . ASP A 1  1155 ? 77.979  117.368 -2.307  1.00 128.45 ? 1155 ASP A N     1 
ATOM   8955  C  CA    . ASP A 1  1155 ? 78.444  118.639 -1.755  1.00 131.54 ? 1155 ASP A CA    1 
ATOM   8956  C  C     . ASP A 1  1155 ? 78.591  119.558 -2.975  1.00 138.98 ? 1155 ASP A C     1 
ATOM   8957  O  O     . ASP A 1  1155 ? 79.600  119.495 -3.685  1.00 138.96 ? 1155 ASP A O     1 
ATOM   8958  C  CB    . ASP A 1  1155 ? 79.762  118.447 -0.994  1.00 133.07 ? 1155 ASP A CB    1 
ATOM   8959  C  CG    . ASP A 1  1155 ? 80.000  119.456 0.111   1.00 150.70 ? 1155 ASP A CG    1 
ATOM   8960  O  OD1   . ASP A 1  1155 ? 79.633  120.651 -0.075  1.00 154.00 ? 1155 ASP A OD1   1 
ATOM   8961  O  OD2   . ASP A 1  1155 ? 80.553  119.062 1.157   1.00 156.84 ? 1155 ASP A OD2   1 
ATOM   8962  N  N     . PRO A 1  1156 ? 77.528  120.304 -3.323  1.00 137.76 ? 1156 PRO A N     1 
ATOM   8963  C  CA    . PRO A 1  1156 ? 77.540  121.053 -4.582  1.00 139.39 ? 1156 PRO A CA    1 
ATOM   8964  C  C     . PRO A 1  1156 ? 78.345  122.334 -4.624  1.00 148.44 ? 1156 PRO A C     1 
ATOM   8965  O  O     . PRO A 1  1156 ? 78.592  122.849 -5.715  1.00 148.50 ? 1156 PRO A O     1 
ATOM   8966  C  CB    . PRO A 1  1156 ? 76.067  121.280 -4.862  1.00 142.31 ? 1156 PRO A CB    1 
ATOM   8967  C  CG    . PRO A 1  1156 ? 75.469  121.373 -3.520  1.00 147.24 ? 1156 PRO A CG    1 
ATOM   8968  C  CD    . PRO A 1  1156 ? 76.228  120.427 -2.642  1.00 140.63 ? 1156 PRO A CD    1 
ATOM   8969  N  N     . ASP A 1  1157 ? 78.736  122.866 -3.469  1.00 148.74 ? 1157 ASP A N     1 
ATOM   8970  C  CA    . ASP A 1  1157 ? 79.576  124.051 -3.493  1.00 151.39 ? 1157 ASP A CA    1 
ATOM   8971  C  C     . ASP A 1  1157 ? 81.006  123.597 -3.207  1.00 156.51 ? 1157 ASP A C     1 
ATOM   8972  O  O     . ASP A 1  1157 ? 81.271  123.105 -2.104  1.00 155.88 ? 1157 ASP A O     1 
ATOM   8973  C  CB    . ASP A 1  1157 ? 79.114  125.118 -2.486  1.00 155.79 ? 1157 ASP A CB    1 
ATOM   8974  C  CG    . ASP A 1  1157 ? 79.824  126.466 -2.615  1.00 174.19 ? 1157 ASP A CG    1 
ATOM   8975  O  OD1   . ASP A 1  1157 ? 80.942  126.505 -3.198  1.00 174.55 ? 1157 ASP A OD1   1 
ATOM   8976  O  OD2   . ASP A 1  1157 ? 79.273  127.481 -2.116  1.00 184.76 ? 1157 ASP A OD2   1 
ATOM   8977  N  N     . PRO A 1  1158 ? 81.949  123.710 -4.171  1.00 153.37 ? 1158 PRO A N     1 
ATOM   8978  C  CA    . PRO A 1  1158 ? 83.321  123.282 -3.875  1.00 152.45 ? 1158 PRO A CA    1 
ATOM   8979  C  C     . PRO A 1  1158 ? 83.946  124.175 -2.799  1.00 158.60 ? 1158 PRO A C     1 
ATOM   8980  O  O     . PRO A 1  1158 ? 84.589  123.654 -1.884  1.00 158.11 ? 1158 PRO A O     1 
ATOM   8981  C  CB    . PRO A 1  1158 ? 84.034  123.363 -5.236  1.00 153.73 ? 1158 PRO A CB    1 
ATOM   8982  C  CG    . PRO A 1  1158 ? 82.935  123.473 -6.257  1.00 158.45 ? 1158 PRO A CG    1 
ATOM   8983  C  CD    . PRO A 1  1158 ? 81.846  124.225 -5.548  1.00 155.47 ? 1158 PRO A CD    1 
ATOM   8984  N  N     . ARG A 1  1159 ? 83.656  125.496 -2.851  1.00 156.57 ? 1159 ARG A N     1 
ATOM   8985  C  CA    . ARG A 1  1159 ? 84.163  126.512 -1.921  1.00 157.58 ? 1159 ARG A CA    1 
ATOM   8986  C  C     . ARG A 1  1159 ? 83.640  126.426 -0.467  1.00 161.66 ? 1159 ARG A C     1 
ATOM   8987  O  O     . ARG A 1  1159 ? 84.273  126.982 0.436   1.00 162.04 ? 1159 ARG A O     1 
ATOM   8988  C  CB    . ARG A 1  1159 ? 83.974  127.926 -2.495  1.00 159.67 ? 1159 ARG A CB    1 
ATOM   8989  C  CG    . ARG A 1  1159 ? 84.728  128.175 -3.792  1.00 168.10 ? 1159 ARG A CG    1 
ATOM   8990  C  CD    . ARG A 1  1159 ? 85.200  129.606 -3.863  1.00 179.71 ? 1159 ARG A CD    1 
ATOM   8991  N  NE    . ARG A 1  1159 ? 86.584  129.688 -4.328  1.00 191.38 ? 1159 ARG A NE    1 
ATOM   8992  C  CZ    . ARG A 1  1159 ? 87.310  130.803 -4.342  1.00 205.03 ? 1159 ARG A CZ    1 
ATOM   8993  N  NH1   . ARG A 1  1159 ? 86.794  131.948 -3.907  1.00 199.01 ? 1159 ARG A NH1   1 
ATOM   8994  N  NH2   . ARG A 1  1159 ? 88.560  130.781 -4.788  1.00 195.22 ? 1159 ARG A NH2   1 
ATOM   8995  N  N     . SER A 1  1160 ? 82.488  125.768 -0.240  1.00 157.85 ? 1160 SER A N     1 
ATOM   8996  C  CA    . SER A 1  1160 ? 81.913  125.613 1.102   1.00 158.12 ? 1160 SER A CA    1 
ATOM   8997  C  C     . SER A 1  1160 ? 81.310  124.225 1.255   1.00 159.24 ? 1160 SER A C     1 
ATOM   8998  O  O     . SER A 1  1160 ? 80.461  123.811 0.465   1.00 159.16 ? 1160 SER A O     1 
ATOM   8999  C  CB    . SER A 1  1160 ? 80.925  126.736 1.440   1.00 165.04 ? 1160 SER A CB    1 
ATOM   9000  O  OG    . SER A 1  1160 ? 79.597  126.523 0.987   1.00 175.24 ? 1160 SER A OG    1 
ATOM   9001  N  N     . THR A 1  1161 ? 81.766  123.506 2.268   1.00 152.79 ? 1161 THR A N     1 
ATOM   9002  C  CA    . THR A 1  1161 ? 81.383  122.128 2.498   1.00 150.37 ? 1161 THR A CA    1 
ATOM   9003  C  C     . THR A 1  1161 ? 80.232  121.892 3.483   1.00 152.62 ? 1161 THR A C     1 
ATOM   9004  O  O     . THR A 1  1161 ? 80.126  122.563 4.507   1.00 152.33 ? 1161 THR A O     1 
ATOM   9005  C  CB    . THR A 1  1161 ? 82.675  121.316 2.637   1.00 160.93 ? 1161 THR A CB    1 
ATOM   9006  O  OG1   . THR A 1  1161 ? 83.124  121.011 1.317   1.00 163.75 ? 1161 THR A OG1   1 
ATOM   9007  C  CG2   . THR A 1  1161 ? 82.544  120.050 3.466   1.00 157.10 ? 1161 THR A CG2   1 
ATOM   9008  N  N     . VAL A 1  1162 ? 79.365  120.928 3.132   1.00 147.44 ? 1162 VAL A N     1 
ATOM   9009  C  CA    . VAL A 1  1162 ? 78.220  120.461 3.912   1.00 147.45 ? 1162 VAL A CA    1 
ATOM   9010  C  C     . VAL A 1  1162 ? 78.724  119.780 5.194   1.00 153.27 ? 1162 VAL A C     1 
ATOM   9011  O  O     . VAL A 1  1162 ? 78.093  119.921 6.241   1.00 153.33 ? 1162 VAL A O     1 
ATOM   9012  C  CB    . VAL A 1  1162 ? 77.346  119.511 3.064   1.00 149.79 ? 1162 VAL A CB    1 
ATOM   9013  C  CG1   . VAL A 1  1162 ? 76.120  119.036 3.840   1.00 149.82 ? 1162 VAL A CG1   1 
ATOM   9014  C  CG2   . VAL A 1  1162 ? 76.929  120.173 1.758   1.00 150.41 ? 1162 VAL A CG2   1 
ATOM   9015  N  N     . ILE A 1  1163 ? 79.861  119.049 5.105   1.00 150.60 ? 1163 ILE A N     1 
ATOM   9016  C  CA    . ILE A 1  1163 ? 80.515  118.381 6.239   1.00 150.62 ? 1163 ILE A CA    1 
ATOM   9017  C  C     . ILE A 1  1163 ? 81.169  119.462 7.130   1.00 159.81 ? 1163 ILE A C     1 
ATOM   9018  O  O     . ILE A 1  1163 ? 81.996  120.242 6.633   1.00 160.27 ? 1163 ILE A O     1 
ATOM   9019  C  CB    . ILE A 1  1163 ? 81.552  117.318 5.794   1.00 151.42 ? 1163 ILE A CB    1 
ATOM   9020  C  CG1   . ILE A 1  1163 ? 80.938  116.264 4.854   1.00 150.52 ? 1163 ILE A CG1   1 
ATOM   9021  C  CG2   . ILE A 1  1163 ? 82.212  116.659 7.007   1.00 151.42 ? 1163 ILE A CG2   1 
ATOM   9022  C  CD1   . ILE A 1  1163 ? 81.583  116.201 3.530   1.00 156.32 ? 1163 ILE A CD1   1 
ATOM