data_4A4F
# 
_entry.id   4A4F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4A4F         
PDBE  EBI-49972    
WWPDB D_1290049972 
BMRB  18006        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  4A4E  unspecified 'SOLUTION STRUCTURE OF SMN TUDOR DOMAIN IN COMPLEX WITH SYMMETRICALLY DIMETHYLATED ARGININE'    
PDB  4A4G  unspecified 'SOLUTION STRUCTURE OF SMN TUDOR DOMAIN IN COMPLEX WITH ASYMMETRICALLY DIMETHYLATED ARGININE'   
PDB  4A4H  unspecified 'SOLUTION STRUCTURE OF SPF30 TUDOR DOMAIN IN COMPLEX WITH ASYMMETRICALLY DIMETHYLATED ARGININE' 
BMRB 18006 unspecified .                                                                                               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A4F 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-10-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tripsianes, K.'   1 
'Madl, T.'         2 
'Machyna, M.'      3 
'Fessas, D.'       4 
'Englbrecht, C.'   5 
'Fischer, U.'      6 
'Neugebauer, K.M.' 7 
'Sattler, M.'      8 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            18 
_citation.page_first                1414 
_citation.page_last                 ? 
_citation.year                      2011 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22101937 
_citation.pdbx_database_id_DOI      10.1038/NSMB.2185 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tripsianes, K.'   1 
primary 'Madl, T.'         2 
primary 'Machyna, M.'      3 
primary 'Fessas, D.'       4 
primary 'Englbrecht, C.'   5 
primary 'Fischer, U.'      6 
primary 'Neugebauer, K.M.' 7 
primary 'Sattler, M.'      8 
# 
_cell.entry_id           4A4F 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A4F 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30' 6935.511 1 ? ? 'TUDOR DOMAIN, RESIDUES 65-128' ? 
2 non-polymer syn 'N3, N4-DIMETHYLARGININE'                             202.254  1 ? ? ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'SPF30, KDA SPLICING FACTOR SMNRP, SMN-RELATED PROTEIN, SURVIVAL MOTOR NEURON DOMAIN-CONTAINING PROTEIN 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG 
_entity_poly.pdbx_seq_one_letter_code_can   ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  THR n 
1 4  GLN n 
1 5  PRO n 
1 6  THR n 
1 7  HIS n 
1 8  SER n 
1 9  TRP n 
1 10 LYS n 
1 11 VAL n 
1 12 GLY n 
1 13 ASP n 
1 14 LYS n 
1 15 CYS n 
1 16 MET n 
1 17 ALA n 
1 18 VAL n 
1 19 TRP n 
1 20 SER n 
1 21 GLU n 
1 22 ASP n 
1 23 GLY n 
1 24 GLN n 
1 25 CYS n 
1 26 TYR n 
1 27 GLU n 
1 28 ALA n 
1 29 GLU n 
1 30 ILE n 
1 31 GLU n 
1 32 GLU n 
1 33 ILE n 
1 34 ASP n 
1 35 GLU n 
1 36 GLU n 
1 37 ASN n 
1 38 GLY n 
1 39 THR n 
1 40 ALA n 
1 41 ALA n 
1 42 ILE n 
1 43 THR n 
1 44 PHE n 
1 45 ALA n 
1 46 GLY n 
1 47 TYR n 
1 48 GLY n 
1 49 ASN n 
1 50 ALA n 
1 51 GLU n 
1 52 VAL n 
1 53 THR n 
1 54 PRO n 
1 55 LEU n 
1 56 LEU n 
1 57 ASN n 
1 58 LEU n 
1 59 LYS n 
1 60 PRO n 
1 61 VAL n 
1 62 GLU n 
1 63 GLU n 
1 64 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPF30_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          O75940 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4A4F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O75940 
_struct_ref_seq.db_align_beg                  65 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  128 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       65 
_struct_ref_seq.pdbx_auth_seq_align_end       128 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2MR 'L-peptide linking' n 'N3, N4-DIMETHYLARGININE' ? 'C8 H18 N4 O2'   202.254 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '15N-EDITED 3D NOESY'               1 
2 2 'F1 15N/13C FILTERED'               1 
3 2 '15N- EDITED 3D NOESY'              1 
4 3 '13C- EDITED 3D NOESY (ALIPHATICS)' 1 
5 4 'F1 15N/13C FILTERED'               1 
6 4 '13C-EDITED 3D NOESY (ALIPHATICS)'  1 
7 5 '13C- EDITED 3D NOESY (AROMATICS)'  1 
8 6 'F1 15N/13C FILTERED'               1 
9 6 '13C-EDITED 3D NOESY (AROMATICS)'   1 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 298.0 atm 1.0 6.5 50 mM pH K 
2 298.0 atm 1.0 6.5 50 mM pH K 
3 298.0 atm 1.0 6.5 50 mM pH K 
4 298.0 atm 1.0 6.5 50 mM pH K 
5 298.0 atm 1.0 6.5 50 mM pH K 
6 298.0 atm 1.0 6.5 50 mM pH K 
# 
_pdbx_nmr_sample_details.solution_id   1 
_pdbx_nmr_sample_details.contents      '93% WATER/7% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    750 
# 
_pdbx_nmr_refine.entry_id           4A4F 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;THE SET OF NOE DISTANCE RESTRAINTS DERIVED FROM CYANA, TOGETHER WITH PHI AND PSI BACKBONE DIHEDRAL ANGLE RESTRAINTS DERIVED FROM TALOS BASED ON THE CHEMICAL SHIFTS WERE USED FOR WATER REFINEMENT USING CNS.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   4A4F 
_pdbx_nmr_details.text       NONE 
# 
_pdbx_nmr_ensemble.entry_id                             4A4F 
_pdbx_nmr_ensemble.conformers_calculated_total_number   200 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LOWEST ENERGY' 
# 
_pdbx_nmr_representative.entry_id             4A4F 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS   ? 
'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 
'structure solution' TALOS ? ? 2 
'structure solution' CYANA ? ? 3 
'structure solution' CNS   ? ? 4 
# 
_exptl.entry_id          4A4F 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  4A4F 
_struct.title                     'Solution structure of SPF30 Tudor domain in complex with symmetrically dimethylated arginine' 
_struct.pdbx_descriptor           'SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A4F 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
_struct_keywords.text            'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 49 ? PRO A 54 ? ASN A 113 PRO A 118 
AA1 2 THR A 39 ? PHE A 44 ? THR A 103 PHE A 108 
AA1 3 CYS A 25 ? ASP A 34 ? CYS A 89  ASP A 98  
AA1 4 LYS A 14 ? VAL A 18 ? LYS A 78  VAL A 82  
AA1 5 LEU A 58 ? LYS A 59 ? LEU A 122 LYS A 123 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O THR A 53 ? O THR A 117 N ALA A 40 ? N ALA A 104 
AA1 2 3 O THR A 39 ? O THR A 103 N ASP A 34 ? N ASP A 98  
AA1 3 4 O ALA A 28 ? O ALA A 92  N CYS A 15 ? N CYS A 79  
AA1 4 5 N MET A 16 ? N MET A 80  O LYS A 59 ? O LYS A 123 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    2MR 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue 2MR A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 TRP A 19 ? TRP A 83  . ? 1_555 ? 
2 AC1 5 TYR A 26 ? TYR A 90  . ? 1_555 ? 
3 AC1 5 PHE A 44 ? PHE A 108 . ? 1_555 ? 
4 AC1 5 TYR A 47 ? TYR A 111 . ? 1_555 ? 
5 AC1 5 ASN A 49 ? ASN A 113 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4A4F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4A4F 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . ALA A 1 1  ? 18.891  0.537   3.052   1.00 0.00 ? 65  ALA A N    1  
ATOM   2     C CA   . ALA A 1 1  ? 17.837  -0.462  2.949   1.00 0.00 ? 65  ALA A CA   1  
ATOM   3     C C    . ALA A 1 1  ? 18.444  -1.767  2.500   1.00 0.00 ? 65  ALA A C    1  
ATOM   4     O O    . ALA A 1 1  ? 19.503  -1.765  1.858   1.00 0.00 ? 65  ALA A O    1  
ATOM   5     C CB   . ALA A 1 1  ? 16.777  -0.008  1.964   1.00 0.00 ? 65  ALA A CB   1  
ATOM   6     H H1   . ALA A 1 1  ? 19.432  0.584   2.168   1.00 0.00 ? 65  ALA A H1   1  
ATOM   7     H H2   . ALA A 1 1  ? 18.512  1.475   3.293   1.00 0.00 ? 65  ALA A H2   1  
ATOM   8     H H3   . ALA A 1 1  ? 19.550  0.249   3.803   1.00 0.00 ? 65  ALA A H3   1  
ATOM   9     H HA   . ALA A 1 1  ? 17.377  -0.594  3.918   1.00 0.00 ? 65  ALA A HA   1  
ATOM   10    H HB1  . ALA A 1 1  ? 17.221  0.100   0.986   1.00 0.00 ? 65  ALA A HB1  1  
ATOM   11    H HB2  . ALA A 1 1  ? 15.995  -0.752  1.915   1.00 0.00 ? 65  ALA A HB2  1  
ATOM   12    H HB3  . ALA A 1 1  ? 16.362  0.937   2.281   1.00 0.00 ? 65  ALA A HB3  1  
ATOM   13    N N    . SER A 1 2  ? 17.817  -2.874  2.845   1.00 0.00 ? 66  SER A N    1  
ATOM   14    C CA   . SER A 1 2  ? 18.285  -4.162  2.397   1.00 0.00 ? 66  SER A CA   1  
ATOM   15    C C    . SER A 1 2  ? 18.034  -4.283  0.893   1.00 0.00 ? 66  SER A C    1  
ATOM   16    O O    . SER A 1 2  ? 18.967  -4.440  0.105   1.00 0.00 ? 66  SER A O    1  
ATOM   17    C CB   . SER A 1 2  ? 17.583  -5.257  3.183   1.00 0.00 ? 66  SER A CB   1  
ATOM   18    O OG   . SER A 1 2  ? 17.717  -5.004  4.582   1.00 0.00 ? 66  SER A OG   1  
ATOM   19    H H    . SER A 1 2  ? 17.033  -2.849  3.434   1.00 0.00 ? 66  SER A H    1  
ATOM   20    H HA   . SER A 1 2  ? 19.348  -4.206  2.576   1.00 0.00 ? 66  SER A HA   1  
ATOM   21    H HB2  . SER A 1 2  ? 16.535  -5.277  2.923   1.00 0.00 ? 66  SER A HB2  1  
ATOM   22    H HB3  . SER A 1 2  ? 18.033  -6.213  2.959   1.00 0.00 ? 66  SER A HB3  1  
ATOM   23    H HG   . SER A 1 2  ? 17.979  -5.830  5.009   1.00 0.00 ? 66  SER A HG   1  
ATOM   24    N N    . THR A 1 3  ? 16.801  -4.139  0.499   1.00 0.00 ? 67  THR A N    1  
ATOM   25    C CA   . THR A 1 3  ? 16.479  -4.125  -0.881  1.00 0.00 ? 67  THR A CA   1  
ATOM   26    C C    . THR A 1 3  ? 16.089  -2.693  -1.231  1.00 0.00 ? 67  THR A C    1  
ATOM   27    O O    . THR A 1 3  ? 15.459  -1.999  -0.421  1.00 0.00 ? 67  THR A O    1  
ATOM   28    C CB   . THR A 1 3  ? 15.347  -5.152  -1.240  1.00 0.00 ? 67  THR A CB   1  
ATOM   29    O OG1  . THR A 1 3  ? 15.148  -5.212  -2.662  1.00 0.00 ? 67  THR A OG1  1  
ATOM   30    C CG2  . THR A 1 3  ? 14.025  -4.810  -0.555  1.00 0.00 ? 67  THR A CG2  1  
ATOM   31    H H    . THR A 1 3  ? 16.073  -4.003  1.142   1.00 0.00 ? 67  THR A H    1  
ATOM   32    H HA   . THR A 1 3  ? 17.381  -4.370  -1.423  1.00 0.00 ? 67  THR A HA   1  
ATOM   33    H HB   . THR A 1 3  ? 15.674  -6.126  -0.907  1.00 0.00 ? 67  THR A HB   1  
ATOM   34    H HG1  . THR A 1 3  ? 15.829  -5.802  -3.014  1.00 0.00 ? 67  THR A HG1  1  
ATOM   35    H HG21 . THR A 1 3  ? 13.709  -3.822  -0.858  1.00 0.00 ? 67  THR A HG21 1  
ATOM   36    H HG22 . THR A 1 3  ? 13.272  -5.531  -0.843  1.00 0.00 ? 67  THR A HG22 1  
ATOM   37    H HG23 . THR A 1 3  ? 14.155  -4.835  0.516   1.00 0.00 ? 67  THR A HG23 1  
ATOM   38    N N    . GLN A 1 4  ? 16.527  -2.226  -2.358  1.00 0.00 ? 68  GLN A N    1  
ATOM   39    C CA   . GLN A 1 4  ? 16.234  -0.905  -2.776  1.00 0.00 ? 68  GLN A CA   1  
ATOM   40    C C    . GLN A 1 4  ? 15.049  -0.920  -3.732  1.00 0.00 ? 68  GLN A C    1  
ATOM   41    O O    . GLN A 1 4  ? 15.118  -1.524  -4.814  1.00 0.00 ? 68  GLN A O    1  
ATOM   42    C CB   . GLN A 1 4  ? 17.463  -0.271  -3.413  1.00 0.00 ? 68  GLN A CB   1  
ATOM   43    C CG   . GLN A 1 4  ? 17.228  1.130   -3.902  1.00 0.00 ? 68  GLN A CG   1  
ATOM   44    C CD   . GLN A 1 4  ? 18.490  1.795   -4.381  1.00 0.00 ? 68  GLN A CD   1  
ATOM   45    O OE1  . GLN A 1 4  ? 18.865  1.694   -5.553  1.00 0.00 ? 68  GLN A OE1  1  
ATOM   46    N NE2  . GLN A 1 4  ? 19.148  2.478   -3.496  1.00 0.00 ? 68  GLN A NE2  1  
ATOM   47    H H    . GLN A 1 4  ? 17.064  -2.786  -2.957  1.00 0.00 ? 68  GLN A H    1  
ATOM   48    H HA   . GLN A 1 4  ? 15.968  -0.340  -1.894  1.00 0.00 ? 68  GLN A HA   1  
ATOM   49    H HB2  . GLN A 1 4  ? 18.262  -0.249  -2.687  1.00 0.00 ? 68  GLN A HB2  1  
ATOM   50    H HB3  . GLN A 1 4  ? 17.771  -0.877  -4.252  1.00 0.00 ? 68  GLN A HB3  1  
ATOM   51    H HG2  . GLN A 1 4  ? 16.520  1.077   -4.714  1.00 0.00 ? 68  GLN A HG2  1  
ATOM   52    H HG3  . GLN A 1 4  ? 16.807  1.707   -3.093  1.00 0.00 ? 68  GLN A HG3  1  
ATOM   53    H HE21 . GLN A 1 4  ? 18.789  2.511   -2.584  1.00 0.00 ? 68  GLN A HE21 1  
ATOM   54    H HE22 . GLN A 1 4  ? 19.960  2.964   -3.753  1.00 0.00 ? 68  GLN A HE22 1  
ATOM   55    N N    . PRO A 1 5  ? 13.934  -0.328  -3.322  1.00 0.00 ? 69  PRO A N    1  
ATOM   56    C CA   . PRO A 1 5  ? 12.743  -0.253  -4.141  1.00 0.00 ? 69  PRO A CA   1  
ATOM   57    C C    . PRO A 1 5  ? 12.789  0.926   -5.121  1.00 0.00 ? 69  PRO A C    1  
ATOM   58    O O    . PRO A 1 5  ? 13.394  1.983   -4.833  1.00 0.00 ? 69  PRO A O    1  
ATOM   59    C CB   . PRO A 1 5  ? 11.638  -0.042  -3.106  1.00 0.00 ? 69  PRO A CB   1  
ATOM   60    C CG   . PRO A 1 5  ? 12.296  0.726   -2.007  1.00 0.00 ? 69  PRO A CG   1  
ATOM   61    C CD   . PRO A 1 5  ? 13.736  0.305   -1.998  1.00 0.00 ? 69  PRO A CD   1  
ATOM   62    H HA   . PRO A 1 5  ? 12.567  -1.174  -4.676  1.00 0.00 ? 69  PRO A HA   1  
ATOM   63    H HB2  . PRO A 1 5  ? 10.825  0.512   -3.552  1.00 0.00 ? 69  PRO A HB2  1  
ATOM   64    H HB3  . PRO A 1 5  ? 11.279  -0.998  -2.754  1.00 0.00 ? 69  PRO A HB3  1  
ATOM   65    H HG2  . PRO A 1 5  ? 12.220  1.785   -2.204  1.00 0.00 ? 69  PRO A HG2  1  
ATOM   66    H HG3  . PRO A 1 5  ? 11.836  0.492   -1.059  1.00 0.00 ? 69  PRO A HG3  1  
ATOM   67    H HD2  . PRO A 1 5  ? 14.377  1.168   -1.892  1.00 0.00 ? 69  PRO A HD2  1  
ATOM   68    H HD3  . PRO A 1 5  ? 13.917  -0.403  -1.203  1.00 0.00 ? 69  PRO A HD3  1  
ATOM   69    N N    . THR A 1 6  ? 12.185  0.741   -6.273  1.00 0.00 ? 70  THR A N    1  
ATOM   70    C CA   . THR A 1 6  ? 12.071  1.793   -7.251  1.00 0.00 ? 70  THR A CA   1  
ATOM   71    C C    . THR A 1 6  ? 10.966  2.753   -6.803  1.00 0.00 ? 70  THR A C    1  
ATOM   72    O O    . THR A 1 6  ? 10.981  3.937   -7.119  1.00 0.00 ? 70  THR A O    1  
ATOM   73    C CB   . THR A 1 6  ? 11.798  1.228   -8.699  1.00 0.00 ? 70  THR A CB   1  
ATOM   74    O OG1  . THR A 1 6  ? 11.681  2.291   -9.659  1.00 0.00 ? 70  THR A OG1  1  
ATOM   75    C CG2  . THR A 1 6  ? 10.539  0.366   -8.751  1.00 0.00 ? 70  THR A CG2  1  
ATOM   76    H H    . THR A 1 6  ? 11.830  -0.152  -6.481  1.00 0.00 ? 70  THR A H    1  
ATOM   77    H HA   . THR A 1 6  ? 13.006  2.333   -7.247  1.00 0.00 ? 70  THR A HA   1  
ATOM   78    H HB   . THR A 1 6  ? 12.648  0.620   -8.975  1.00 0.00 ? 70  THR A HB   1  
ATOM   79    H HG1  . THR A 1 6  ? 12.555  2.695   -9.745  1.00 0.00 ? 70  THR A HG1  1  
ATOM   80    H HG21 . THR A 1 6  ? 9.688   0.953   -8.439  1.00 0.00 ? 70  THR A HG21 1  
ATOM   81    H HG22 . THR A 1 6  ? 10.385  0.016   -9.761  1.00 0.00 ? 70  THR A HG22 1  
ATOM   82    H HG23 . THR A 1 6  ? 10.656  -0.481  -8.092  1.00 0.00 ? 70  THR A HG23 1  
ATOM   83    N N    . HIS A 1 7  ? 10.030  2.231   -6.033  1.00 0.00 ? 71  HIS A N    1  
ATOM   84    C CA   . HIS A 1 7  ? 8.959   3.025   -5.495  1.00 0.00 ? 71  HIS A CA   1  
ATOM   85    C C    . HIS A 1 7  ? 9.417   3.693   -4.215  1.00 0.00 ? 71  HIS A C    1  
ATOM   86    O O    . HIS A 1 7  ? 9.827   3.025   -3.266  1.00 0.00 ? 71  HIS A O    1  
ATOM   87    C CB   . HIS A 1 7  ? 7.711   2.169   -5.248  1.00 0.00 ? 71  HIS A CB   1  
ATOM   88    C CG   . HIS A 1 7  ? 7.059   1.660   -6.501  1.00 0.00 ? 71  HIS A CG   1  
ATOM   89    N ND1  . HIS A 1 7  ? 7.289   0.414   -7.047  1.00 0.00 ? 71  HIS A ND1  1  
ATOM   90    C CD2  . HIS A 1 7  ? 6.161   2.261   -7.316  1.00 0.00 ? 71  HIS A CD2  1  
ATOM   91    C CE1  . HIS A 1 7  ? 6.546   0.299   -8.151  1.00 0.00 ? 71  HIS A CE1  1  
ATOM   92    N NE2  . HIS A 1 7  ? 5.837   1.399   -8.362  1.00 0.00 ? 71  HIS A NE2  1  
ATOM   93    H H    . HIS A 1 7  ? 10.075  1.277   -5.811  1.00 0.00 ? 71  HIS A H    1  
ATOM   94    H HA   . HIS A 1 7  ? 8.724   3.791   -6.220  1.00 0.00 ? 71  HIS A HA   1  
ATOM   95    H HB2  . HIS A 1 7  ? 7.987   1.312   -4.651  1.00 0.00 ? 71  HIS A HB2  1  
ATOM   96    H HB3  . HIS A 1 7  ? 6.981   2.754   -4.708  1.00 0.00 ? 71  HIS A HB3  1  
ATOM   97    H HD1  . HIS A 1 7  ? 7.895   -0.273  -6.690  1.00 0.00 ? 71  HIS A HD1  1  
ATOM   98    H HD2  . HIS A 1 7  ? 5.752   3.251   -7.187  1.00 0.00 ? 71  HIS A HD2  1  
ATOM   99    H HE1  . HIS A 1 7  ? 6.531   -0.573  -8.788  1.00 0.00 ? 71  HIS A HE1  1  
ATOM   100   N N    . SER A 1 8  ? 9.366   4.993   -4.205  1.00 0.00 ? 72  SER A N    1  
ATOM   101   C CA   . SER A 1 8  ? 9.796   5.768   -3.078  1.00 0.00 ? 72  SER A CA   1  
ATOM   102   C C    . SER A 1 8  ? 8.586   6.300   -2.320  1.00 0.00 ? 72  SER A C    1  
ATOM   103   O O    . SER A 1 8  ? 7.851   7.161   -2.818  1.00 0.00 ? 72  SER A O    1  
ATOM   104   C CB   . SER A 1 8  ? 10.681  6.911   -3.556  1.00 0.00 ? 72  SER A CB   1  
ATOM   105   O OG   . SER A 1 8  ? 11.800  6.410   -4.287  1.00 0.00 ? 72  SER A OG   1  
ATOM   106   H H    . SER A 1 8  ? 8.996   5.464   -4.981  1.00 0.00 ? 72  SER A H    1  
ATOM   107   H HA   . SER A 1 8  ? 10.372  5.128   -2.427  1.00 0.00 ? 72  SER A HA   1  
ATOM   108   H HB2  . SER A 1 8  ? 10.107  7.565   -4.197  1.00 0.00 ? 72  SER A HB2  1  
ATOM   109   H HB3  . SER A 1 8  ? 11.043  7.467   -2.705  1.00 0.00 ? 72  SER A HB3  1  
ATOM   110   H HG   . SER A 1 8  ? 11.523  6.277   -5.203  1.00 0.00 ? 72  SER A HG   1  
ATOM   111   N N    . TRP A 1 9  ? 8.366   5.771   -1.151  1.00 0.00 ? 73  TRP A N    1  
ATOM   112   C CA   . TRP A 1 9  ? 7.245   6.140   -0.322  1.00 0.00 ? 73  TRP A CA   1  
ATOM   113   C C    . TRP A 1 9  ? 7.718   6.601   1.037   1.00 0.00 ? 73  TRP A C    1  
ATOM   114   O O    . TRP A 1 9  ? 8.816   6.227   1.467   1.00 0.00 ? 73  TRP A O    1  
ATOM   115   C CB   . TRP A 1 9  ? 6.296   4.959   -0.176  1.00 0.00 ? 73  TRP A CB   1  
ATOM   116   C CG   . TRP A 1 9  ? 5.634   4.563   -1.460  1.00 0.00 ? 73  TRP A CG   1  
ATOM   117   C CD1  . TRP A 1 9  ? 5.942   3.493   -2.237  1.00 0.00 ? 73  TRP A CD1  1  
ATOM   118   C CD2  . TRP A 1 9  ? 4.571   5.253   -2.130  1.00 0.00 ? 73  TRP A CD2  1  
ATOM   119   N NE1  . TRP A 1 9  ? 5.125   3.451   -3.337  1.00 0.00 ? 73  TRP A NE1  1  
ATOM   120   C CE2  . TRP A 1 9  ? 4.277   4.519   -3.298  1.00 0.00 ? 73  TRP A CE2  1  
ATOM   121   C CE3  . TRP A 1 9  ? 3.827   6.414   -1.855  1.00 0.00 ? 73  TRP A CE3  1  
ATOM   122   C CZ2  . TRP A 1 9  ? 3.288   4.900   -4.185  1.00 0.00 ? 73  TRP A CZ2  1  
ATOM   123   C CZ3  . TRP A 1 9  ? 2.844   6.786   -2.742  1.00 0.00 ? 73  TRP A CZ3  1  
ATOM   124   C CH2  . TRP A 1 9  ? 2.585   6.026   -3.896  1.00 0.00 ? 73  TRP A CH2  1  
ATOM   125   H H    . TRP A 1 9  ? 8.983   5.092   -0.796  1.00 0.00 ? 73  TRP A H    1  
ATOM   126   H HA   . TRP A 1 9  ? 6.714   6.943   -0.811  1.00 0.00 ? 73  TRP A HA   1  
ATOM   127   H HB2  . TRP A 1 9  ? 6.870   4.113   0.173   1.00 0.00 ? 73  TRP A HB2  1  
ATOM   128   H HB3  . TRP A 1 9  ? 5.540   5.190   0.558   1.00 0.00 ? 73  TRP A HB3  1  
ATOM   129   H HD1  . TRP A 1 9  ? 6.716   2.782   -1.997  1.00 0.00 ? 73  TRP A HD1  1  
ATOM   130   H HE1  . TRP A 1 9  ? 5.144   2.756   -4.032  1.00 0.00 ? 73  TRP A HE1  1  
ATOM   131   H HE3  . TRP A 1 9  ? 4.004   7.017   -0.975  1.00 0.00 ? 73  TRP A HE3  1  
ATOM   132   H HZ2  . TRP A 1 9  ? 3.068   4.334   -5.080  1.00 0.00 ? 73  TRP A HZ2  1  
ATOM   133   H HZ3  . TRP A 1 9  ? 2.265   7.676   -2.542  1.00 0.00 ? 73  TRP A HZ3  1  
ATOM   134   H HH2  . TRP A 1 9  ? 1.807   6.331   -4.577  1.00 0.00 ? 73  TRP A HH2  1  
ATOM   135   N N    . LYS A 1 10 ? 6.949   7.466   1.682   1.00 0.00 ? 74  LYS A N    1  
ATOM   136   C CA   . LYS A 1 10 ? 7.265   7.890   3.019   1.00 0.00 ? 74  LYS A CA   1  
ATOM   137   C C    . LYS A 1 10 ? 6.050   7.827   3.928   1.00 0.00 ? 74  LYS A C    1  
ATOM   138   O O    . LYS A 1 10 ? 4.903   7.772   3.463   1.00 0.00 ? 74  LYS A O    1  
ATOM   139   C CB   . LYS A 1 10 ? 7.908   9.273   3.069   1.00 0.00 ? 74  LYS A CB   1  
ATOM   140   C CG   . LYS A 1 10 ? 7.105   10.395  2.446   1.00 0.00 ? 74  LYS A CG   1  
ATOM   141   C CD   . LYS A 1 10 ? 7.657   11.753  2.871   1.00 0.00 ? 74  LYS A CD   1  
ATOM   142   C CE   . LYS A 1 10 ? 7.149   12.157  4.256   1.00 0.00 ? 74  LYS A CE   1  
ATOM   143   N NZ   . LYS A 1 10 ? 5.714   12.521  4.221   1.00 0.00 ? 74  LYS A NZ   1  
ATOM   144   H H    . LYS A 1 10 ? 6.135   7.833   1.277   1.00 0.00 ? 74  LYS A H    1  
ATOM   145   H HA   . LYS A 1 10 ? 7.978   7.169   3.391   1.00 0.00 ? 74  LYS A HA   1  
ATOM   146   H HB2  . LYS A 1 10 ? 8.137   9.535   4.090   1.00 0.00 ? 74  LYS A HB2  1  
ATOM   147   H HB3  . LYS A 1 10 ? 8.826   9.179   2.510   1.00 0.00 ? 74  LYS A HB3  1  
ATOM   148   H HG2  . LYS A 1 10 ? 7.141   10.312  1.370   1.00 0.00 ? 74  LYS A HG2  1  
ATOM   149   H HG3  . LYS A 1 10 ? 6.083   10.307  2.791   1.00 0.00 ? 74  LYS A HG3  1  
ATOM   150   H HD2  . LYS A 1 10 ? 8.735   11.698  2.901   1.00 0.00 ? 74  LYS A HD2  1  
ATOM   151   H HD3  . LYS A 1 10 ? 7.358   12.503  2.155   1.00 0.00 ? 74  LYS A HD3  1  
ATOM   152   H HE2  . LYS A 1 10 ? 7.266   11.326  4.936   1.00 0.00 ? 74  LYS A HE2  1  
ATOM   153   H HE3  . LYS A 1 10 ? 7.717   13.001  4.615   1.00 0.00 ? 74  LYS A HE3  1  
ATOM   154   H HZ1  . LYS A 1 10 ? 5.129   11.798  3.740   1.00 0.00 ? 74  LYS A HZ1  1  
ATOM   155   H HZ2  . LYS A 1 10 ? 5.324   12.684  5.169   1.00 0.00 ? 74  LYS A HZ2  1  
ATOM   156   H HZ3  . LYS A 1 10 ? 5.571   13.392  3.671   1.00 0.00 ? 74  LYS A HZ3  1  
ATOM   157   N N    . VAL A 1 11 ? 6.317   7.806   5.211   1.00 0.00 ? 75  VAL A N    1  
ATOM   158   C CA   . VAL A 1 11 ? 5.303   7.771   6.241   1.00 0.00 ? 75  VAL A CA   1  
ATOM   159   C C    . VAL A 1 11 ? 4.443   9.032   6.203   1.00 0.00 ? 75  VAL A C    1  
ATOM   160   O O    . VAL A 1 11 ? 4.963   10.150  6.067   1.00 0.00 ? 75  VAL A O    1  
ATOM   161   C CB   . VAL A 1 11 ? 5.963   7.620   7.642   1.00 0.00 ? 75  VAL A CB   1  
ATOM   162   C CG1  . VAL A 1 11 ? 4.948   7.781   8.760   1.00 0.00 ? 75  VAL A CG1  1  
ATOM   163   C CG2  . VAL A 1 11 ? 6.649   6.271   7.757   1.00 0.00 ? 75  VAL A CG2  1  
ATOM   164   H H    . VAL A 1 11 ? 7.260   7.815   5.489   1.00 0.00 ? 75  VAL A H    1  
ATOM   165   H HA   . VAL A 1 11 ? 4.677   6.907   6.067   1.00 0.00 ? 75  VAL A HA   1  
ATOM   166   H HB   . VAL A 1 11 ? 6.714   8.388   7.748   1.00 0.00 ? 75  VAL A HB   1  
ATOM   167   H HG11 . VAL A 1 11 ? 4.178   7.031   8.661   1.00 0.00 ? 75  VAL A HG11 1  
ATOM   168   H HG12 . VAL A 1 11 ? 5.444   7.680   9.714   1.00 0.00 ? 75  VAL A HG12 1  
ATOM   169   H HG13 . VAL A 1 11 ? 4.509   8.765   8.682   1.00 0.00 ? 75  VAL A HG13 1  
ATOM   170   H HG21 . VAL A 1 11 ? 7.413   6.189   7.000   1.00 0.00 ? 75  VAL A HG21 1  
ATOM   171   H HG22 . VAL A 1 11 ? 7.097   6.176   8.735   1.00 0.00 ? 75  VAL A HG22 1  
ATOM   172   H HG23 . VAL A 1 11 ? 5.922   5.487   7.615   1.00 0.00 ? 75  VAL A HG23 1  
ATOM   173   N N    . GLY A 1 12 ? 3.140   8.839   6.276   1.00 0.00 ? 76  GLY A N    1  
ATOM   174   C CA   . GLY A 1 12 ? 2.218   9.950   6.333   1.00 0.00 ? 76  GLY A CA   1  
ATOM   175   C C    . GLY A 1 12 ? 1.561   10.206  5.012   1.00 0.00 ? 76  GLY A C    1  
ATOM   176   O O    . GLY A 1 12 ? 0.618   10.996  4.916   1.00 0.00 ? 76  GLY A O    1  
ATOM   177   H H    . GLY A 1 12 ? 2.791   7.921   6.289   1.00 0.00 ? 76  GLY A H    1  
ATOM   178   H HA2  . GLY A 1 12 ? 1.458   9.734   7.067   1.00 0.00 ? 76  GLY A HA2  1  
ATOM   179   H HA3  . GLY A 1 12 ? 2.756   10.837  6.634   1.00 0.00 ? 76  GLY A HA3  1  
ATOM   180   N N    . ASP A 1 13 ? 2.040   9.529   4.008   1.00 0.00 ? 77  ASP A N    1  
ATOM   181   C CA   . ASP A 1 13 ? 1.562   9.685   2.649   1.00 0.00 ? 77  ASP A CA   1  
ATOM   182   C C    . ASP A 1 13 ? 0.574   8.651   2.342   1.00 0.00 ? 77  ASP A C    1  
ATOM   183   O O    . ASP A 1 13 ? 0.676   7.524   2.823   1.00 0.00 ? 77  ASP A O    1  
ATOM   184   C CB   . ASP A 1 13 ? 2.709   9.556   1.660   1.00 0.00 ? 77  ASP A CB   1  
ATOM   185   C CG   . ASP A 1 13 ? 3.577   10.775  1.615   1.00 0.00 ? 77  ASP A CG   1  
ATOM   186   O OD1  . ASP A 1 13 ? 4.097   11.185  2.664   1.00 0.00 ? 77  ASP A OD1  1  
ATOM   187   O OD2  . ASP A 1 13 ? 3.754   11.361  0.529   1.00 0.00 ? 77  ASP A OD2  1  
ATOM   188   H H    . ASP A 1 13 ? 2.749   8.871   4.166   1.00 0.00 ? 77  ASP A H    1  
ATOM   189   H HA   . ASP A 1 13 ? 1.127   10.666  2.535   1.00 0.00 ? 77  ASP A HA   1  
ATOM   190   H HB2  . ASP A 1 13 ? 3.278   8.713   2.011   1.00 0.00 ? 77  ASP A HB2  1  
ATOM   191   H HB3  . ASP A 1 13 ? 2.373   9.287   0.672   1.00 0.00 ? 77  ASP A HB3  1  
ATOM   192   N N    . LYS A 1 14 ? -0.394  9.006   1.587   1.00 0.00 ? 78  LYS A N    1  
ATOM   193   C CA   . LYS A 1 14 ? -1.316  8.092   1.158   1.00 0.00 ? 78  LYS A CA   1  
ATOM   194   C C    . LYS A 1 14 ? -1.065  7.670   -0.247  1.00 0.00 ? 78  LYS A C    1  
ATOM   195   O O    . LYS A 1 14 ? -0.553  8.426   -1.081  1.00 0.00 ? 78  LYS A O    1  
ATOM   196   C CB   . LYS A 1 14 ? -2.716  8.529   1.481   1.00 0.00 ? 78  LYS A CB   1  
ATOM   197   C CG   . LYS A 1 14 ? -3.071  9.898   1.025   1.00 0.00 ? 78  LYS A CG   1  
ATOM   198   C CD   . LYS A 1 14 ? -3.348  9.928   -0.433  1.00 0.00 ? 78  LYS A CD   1  
ATOM   199   C CE   . LYS A 1 14 ? -3.889  11.275  -0.892  1.00 0.00 ? 78  LYS A CE   1  
ATOM   200   N NZ   . LYS A 1 14 ? -5.246  11.524  -0.370  1.00 0.00 ? 78  LYS A NZ   1  
ATOM   201   H H    . LYS A 1 14 ? -0.538  9.929   1.294   1.00 0.00 ? 78  LYS A H    1  
ATOM   202   H HA   . LYS A 1 14 ? -1.126  7.190   1.701   1.00 0.00 ? 78  LYS A HA   1  
ATOM   203   H HB2  . LYS A 1 14 ? -3.405  7.831   1.032   1.00 0.00 ? 78  LYS A HB2  1  
ATOM   204   H HB3  . LYS A 1 14 ? -2.807  8.498   2.556   1.00 0.00 ? 78  LYS A HB3  1  
ATOM   205   H HG2  . LYS A 1 14 ? -3.877  10.253  1.626   1.00 0.00 ? 78  LYS A HG2  1  
ATOM   206   H HG3  . LYS A 1 14 ? -2.224  10.532  1.234   1.00 0.00 ? 78  LYS A HG3  1  
ATOM   207   H HD2  . LYS A 1 14 ? -2.407  9.676   -0.898  1.00 0.00 ? 78  LYS A HD2  1  
ATOM   208   H HD3  . LYS A 1 14 ? -4.059  9.141   -0.634  1.00 0.00 ? 78  LYS A HD3  1  
ATOM   209   H HE2  . LYS A 1 14 ? -3.233  12.058  -0.545  1.00 0.00 ? 78  LYS A HE2  1  
ATOM   210   H HE3  . LYS A 1 14 ? -3.930  11.295  -1.970  1.00 0.00 ? 78  LYS A HE3  1  
ATOM   211   H HZ1  . LYS A 1 14 ? -5.270  11.553  0.667   1.00 0.00 ? 78  LYS A HZ1  1  
ATOM   212   H HZ2  . LYS A 1 14 ? -5.601  12.424  -0.748  1.00 0.00 ? 78  LYS A HZ2  1  
ATOM   213   H HZ3  . LYS A 1 14 ? -5.884  10.766  -0.706  1.00 0.00 ? 78  LYS A HZ3  1  
ATOM   214   N N    . CYS A 1 15 ? -1.398  6.485   -0.474  1.00 0.00 ? 79  CYS A N    1  
ATOM   215   C CA   . CYS A 1 15 ? -1.153  5.805   -1.682  1.00 0.00 ? 79  CYS A CA   1  
ATOM   216   C C    . CYS A 1 15 ? -2.339  4.960   -1.960  1.00 0.00 ? 79  CYS A C    1  
ATOM   217   O O    . CYS A 1 15 ? -3.305  4.973   -1.195  1.00 0.00 ? 79  CYS A O    1  
ATOM   218   C CB   . CYS A 1 15 ? 0.075   4.931   -1.499  1.00 0.00 ? 79  CYS A CB   1  
ATOM   219   S SG   . CYS A 1 15 ? -0.017  3.839   -0.047  1.00 0.00 ? 79  CYS A SG   1  
ATOM   220   H H    . CYS A 1 15 ? -1.887  6.001   0.229   1.00 0.00 ? 79  CYS A H    1  
ATOM   221   H HA   . CYS A 1 15 ? -0.978  6.506   -2.484  1.00 0.00 ? 79  CYS A HA   1  
ATOM   222   H HB2  . CYS A 1 15 ? 0.178   4.305   -2.376  1.00 0.00 ? 79  CYS A HB2  1  
ATOM   223   H HB3  . CYS A 1 15 ? 0.950   5.556   -1.407  1.00 0.00 ? 79  CYS A HB3  1  
ATOM   224   H HG   . CYS A 1 15 ? -1.045  4.145   0.738   1.00 0.00 ? 79  CYS A HG   1  
ATOM   225   N N    . MET A 1 16 ? -2.326  4.280   -3.030  1.00 0.00 ? 80  MET A N    1  
ATOM   226   C CA   . MET A 1 16 ? -3.376  3.376   -3.289  1.00 0.00 ? 80  MET A CA   1  
ATOM   227   C C    . MET A 1 16 ? -2.797  2.020   -3.130  1.00 0.00 ? 80  MET A C    1  
ATOM   228   O O    . MET A 1 16 ? -1.746  1.725   -3.692  1.00 0.00 ? 80  MET A O    1  
ATOM   229   C CB   . MET A 1 16 ? -3.970  3.554   -4.678  1.00 0.00 ? 80  MET A CB   1  
ATOM   230   C CG   . MET A 1 16 ? -4.259  4.996   -5.041  1.00 0.00 ? 80  MET A CG   1  
ATOM   231   S SD   . MET A 1 16 ? -5.338  5.169   -6.462  1.00 0.00 ? 80  MET A SD   1  
ATOM   232   C CE   . MET A 1 16 ? -6.880  4.611   -5.737  1.00 0.00 ? 80  MET A CE   1  
ATOM   233   H H    . MET A 1 16 ? -1.564  4.362   -3.647  1.00 0.00 ? 80  MET A H    1  
ATOM   234   H HA   . MET A 1 16 ? -4.137  3.524   -2.537  1.00 0.00 ? 80  MET A HA   1  
ATOM   235   H HB2  . MET A 1 16 ? -3.278  3.148   -5.398  1.00 0.00 ? 80  MET A HB2  1  
ATOM   236   H HB3  . MET A 1 16 ? -4.893  2.996   -4.734  1.00 0.00 ? 80  MET A HB3  1  
ATOM   237   H HG2  . MET A 1 16 ? -4.717  5.483   -4.194  1.00 0.00 ? 80  MET A HG2  1  
ATOM   238   H HG3  . MET A 1 16 ? -3.312  5.464   -5.265  1.00 0.00 ? 80  MET A HG3  1  
ATOM   239   H HE1  . MET A 1 16 ? -7.118  5.262   -4.908  1.00 0.00 ? 80  MET A HE1  1  
ATOM   240   H HE2  . MET A 1 16 ? -7.668  4.654   -6.473  1.00 0.00 ? 80  MET A HE2  1  
ATOM   241   H HE3  . MET A 1 16 ? -6.769  3.602   -5.373  1.00 0.00 ? 80  MET A HE3  1  
ATOM   242   N N    . ALA A 1 17 ? -3.439  1.218   -2.375  1.00 0.00 ? 81  ALA A N    1  
ATOM   243   C CA   . ALA A 1 17 ? -2.947  -0.082  -2.088  1.00 0.00 ? 81  ALA A CA   1  
ATOM   244   C C    . ALA A 1 17 ? -3.908  -1.071  -2.610  1.00 0.00 ? 81  ALA A C    1  
ATOM   245   O O    . ALA A 1 17 ? -5.105  -0.784  -2.706  1.00 0.00 ? 81  ALA A O    1  
ATOM   246   C CB   . ALA A 1 17 ? -2.784  -0.264  -0.591  1.00 0.00 ? 81  ALA A CB   1  
ATOM   247   H H    . ALA A 1 17 ? -4.304  1.502   -2.000  1.00 0.00 ? 81  ALA A H    1  
ATOM   248   H HA   . ALA A 1 17 ? -1.983  -0.215  -2.557  1.00 0.00 ? 81  ALA A HA   1  
ATOM   249   H HB1  . ALA A 1 17 ? -3.734  -0.086  -0.108  1.00 0.00 ? 81  ALA A HB1  1  
ATOM   250   H HB2  . ALA A 1 17 ? -2.464  -1.272  -0.368  1.00 0.00 ? 81  ALA A HB2  1  
ATOM   251   H HB3  . ALA A 1 17 ? -2.060  0.440   -0.213  1.00 0.00 ? 81  ALA A HB3  1  
ATOM   252   N N    . VAL A 1 18 ? -3.418  -2.203  -2.962  1.00 0.00 ? 82  VAL A N    1  
ATOM   253   C CA   . VAL A 1 18 ? -4.247  -3.244  -3.455  1.00 0.00 ? 82  VAL A CA   1  
ATOM   254   C C    . VAL A 1 18 ? -4.733  -4.018  -2.268  1.00 0.00 ? 82  VAL A C    1  
ATOM   255   O O    . VAL A 1 18 ? -3.935  -4.607  -1.548  1.00 0.00 ? 82  VAL A O    1  
ATOM   256   C CB   . VAL A 1 18 ? -3.476  -4.179  -4.425  1.00 0.00 ? 82  VAL A CB   1  
ATOM   257   C CG1  . VAL A 1 18 ? -4.384  -5.267  -4.972  1.00 0.00 ? 82  VAL A CG1  1  
ATOM   258   C CG2  . VAL A 1 18 ? -2.851  -3.383  -5.565  1.00 0.00 ? 82  VAL A CG2  1  
ATOM   259   H H    . VAL A 1 18 ? -2.453  -2.361  -2.871  1.00 0.00 ? 82  VAL A H    1  
ATOM   260   H HA   . VAL A 1 18 ? -5.102  -2.820  -3.961  1.00 0.00 ? 82  VAL A HA   1  
ATOM   261   H HB   . VAL A 1 18 ? -2.682  -4.654  -3.866  1.00 0.00 ? 82  VAL A HB   1  
ATOM   262   H HG11 . VAL A 1 18 ? -5.212  -4.815  -5.498  1.00 0.00 ? 82  VAL A HG11 1  
ATOM   263   H HG12 . VAL A 1 18 ? -3.824  -5.887  -5.654  1.00 0.00 ? 82  VAL A HG12 1  
ATOM   264   H HG13 . VAL A 1 18 ? -4.759  -5.869  -4.158  1.00 0.00 ? 82  VAL A HG13 1  
ATOM   265   H HG21 . VAL A 1 18 ? -2.166  -2.653  -5.159  1.00 0.00 ? 82  VAL A HG21 1  
ATOM   266   H HG22 . VAL A 1 18 ? -2.315  -4.054  -6.221  1.00 0.00 ? 82  VAL A HG22 1  
ATOM   267   H HG23 . VAL A 1 18 ? -3.627  -2.879  -6.121  1.00 0.00 ? 82  VAL A HG23 1  
ATOM   268   N N    . TRP A 1 19 ? -6.020  -3.961  -2.031  1.00 0.00 ? 83  TRP A N    1  
ATOM   269   C CA   . TRP A 1 19 ? -6.612  -4.647  -0.924  1.00 0.00 ? 83  TRP A CA   1  
ATOM   270   C C    . TRP A 1 19 ? -6.512  -6.107  -1.191  1.00 0.00 ? 83  TRP A C    1  
ATOM   271   O O    . TRP A 1 19 ? -7.096  -6.591  -2.153  1.00 0.00 ? 83  TRP A O    1  
ATOM   272   C CB   . TRP A 1 19 ? -8.080  -4.256  -0.760  1.00 0.00 ? 83  TRP A CB   1  
ATOM   273   C CG   . TRP A 1 19 ? -8.672  -4.696  0.554   1.00 0.00 ? 83  TRP A CG   1  
ATOM   274   C CD1  . TRP A 1 19 ? -8.008  -4.822  1.724   1.00 0.00 ? 83  TRP A CD1  1  
ATOM   275   C CD2  . TRP A 1 19 ? -10.038 -5.018  0.847   1.00 0.00 ? 83  TRP A CD2  1  
ATOM   276   N NE1  . TRP A 1 19 ? -8.844  -5.219  2.711   1.00 0.00 ? 83  TRP A NE1  1  
ATOM   277   C CE2  . TRP A 1 19 ? -10.095 -5.342  2.215   1.00 0.00 ? 83  TRP A CE2  1  
ATOM   278   C CE3  . TRP A 1 19 ? -11.208 -5.069  0.103   1.00 0.00 ? 83  TRP A CE3  1  
ATOM   279   C CZ2  . TRP A 1 19 ? -11.270 -5.713  2.851   1.00 0.00 ? 83  TRP A CZ2  1  
ATOM   280   C CZ3  . TRP A 1 19 ? -12.385 -5.434  0.738   1.00 0.00 ? 83  TRP A CZ3  1  
ATOM   281   C CH2  . TRP A 1 19 ? -12.400 -5.753  2.103   1.00 0.00 ? 83  TRP A CH2  1  
ATOM   282   H H    . TRP A 1 19 ? -6.581  -3.438  -2.645  1.00 0.00 ? 83  TRP A H    1  
ATOM   283   H HA   . TRP A 1 19 ? -6.068  -4.390  -0.029  1.00 0.00 ? 83  TRP A HA   1  
ATOM   284   H HB2  . TRP A 1 19 ? -8.156  -3.186  -0.850  1.00 0.00 ? 83  TRP A HB2  1  
ATOM   285   H HB3  . TRP A 1 19 ? -8.651  -4.712  -1.555  1.00 0.00 ? 83  TRP A HB3  1  
ATOM   286   H HD1  . TRP A 1 19 ? -6.951  -4.649  1.835   1.00 0.00 ? 83  TRP A HD1  1  
ATOM   287   H HE1  . TRP A 1 19 ? -8.573  -5.377  3.642   1.00 0.00 ? 83  TRP A HE1  1  
ATOM   288   H HE3  . TRP A 1 19 ? -11.199 -4.818  -0.948  1.00 0.00 ? 83  TRP A HE3  1  
ATOM   289   H HZ2  . TRP A 1 19 ? -11.298 -5.959  3.902   1.00 0.00 ? 83  TRP A HZ2  1  
ATOM   290   H HZ3  . TRP A 1 19 ? -13.317 -5.474  0.192   1.00 0.00 ? 83  TRP A HZ3  1  
ATOM   291   H HH2  . TRP A 1 19 ? -13.333 -6.027  2.571   1.00 0.00 ? 83  TRP A HH2  1  
ATOM   292   N N    . SER A 1 20 ? -5.792  -6.799  -0.355  1.00 0.00 ? 84  SER A N    1  
ATOM   293   C CA   . SER A 1 20 ? -5.546  -8.222  -0.521  1.00 0.00 ? 84  SER A CA   1  
ATOM   294   C C    . SER A 1 20 ? -6.856  -9.019  -0.571  1.00 0.00 ? 84  SER A C    1  
ATOM   295   O O    . SER A 1 20 ? -6.919  -10.091 -1.167  1.00 0.00 ? 84  SER A O    1  
ATOM   296   C CB   . SER A 1 20 ? -4.634  -8.736  0.611   1.00 0.00 ? 84  SER A CB   1  
ATOM   297   O OG   . SER A 1 20 ? -4.242  -10.099 0.405   1.00 0.00 ? 84  SER A OG   1  
ATOM   298   H H    . SER A 1 20 ? -5.380  -6.317  0.402   1.00 0.00 ? 84  SER A H    1  
ATOM   299   H HA   . SER A 1 20 ? -5.034  -8.359  -1.461  1.00 0.00 ? 84  SER A HA   1  
ATOM   300   H HB2  . SER A 1 20 ? -3.744  -8.126  0.661   1.00 0.00 ? 84  SER A HB2  1  
ATOM   301   H HB3  . SER A 1 20 ? -5.163  -8.666  1.550   1.00 0.00 ? 84  SER A HB3  1  
ATOM   302   H HG   . SER A 1 20 ? -5.048  -10.638 0.401   1.00 0.00 ? 84  SER A HG   1  
ATOM   303   N N    . GLU A 1 21 ? -7.900  -8.464  -0.008  1.00 0.00 ? 85  GLU A N    1  
ATOM   304   C CA   . GLU A 1 21 ? -9.157  -9.160  0.071   1.00 0.00 ? 85  GLU A CA   1  
ATOM   305   C C    . GLU A 1 21 ? -9.961  -9.035  -1.224  1.00 0.00 ? 85  GLU A C    1  
ATOM   306   O O    . GLU A 1 21 ? -10.643 -9.972  -1.629  1.00 0.00 ? 85  GLU A O    1  
ATOM   307   C CB   . GLU A 1 21 ? -9.966  -8.605  1.205   1.00 0.00 ? 85  GLU A CB   1  
ATOM   308   C CG   . GLU A 1 21 ? -9.257  -8.598  2.549   1.00 0.00 ? 85  GLU A CG   1  
ATOM   309   C CD   . GLU A 1 21 ? -8.905  -9.968  3.079   1.00 0.00 ? 85  GLU A CD   1  
ATOM   310   O OE1  . GLU A 1 21 ? -9.765  -10.622 3.695   1.00 0.00 ? 85  GLU A OE1  1  
ATOM   311   O OE2  . GLU A 1 21 ? -7.743  -10.397 2.936   1.00 0.00 ? 85  GLU A OE2  1  
ATOM   312   H H    . GLU A 1 21 ? -7.813  -7.558  0.363   1.00 0.00 ? 85  GLU A H    1  
ATOM   313   H HA   . GLU A 1 21 ? -8.953  -10.199 0.276   1.00 0.00 ? 85  GLU A HA   1  
ATOM   314   H HB2  . GLU A 1 21 ? -10.220 -7.584  0.956   1.00 0.00 ? 85  GLU A HB2  1  
ATOM   315   H HB3  . GLU A 1 21 ? -10.875 -9.172  1.283   1.00 0.00 ? 85  GLU A HB3  1  
ATOM   316   H HG2  . GLU A 1 21 ? -8.359  -8.015  2.419   1.00 0.00 ? 85  GLU A HG2  1  
ATOM   317   H HG3  . GLU A 1 21 ? -9.874  -8.064  3.255   1.00 0.00 ? 85  GLU A HG3  1  
ATOM   318   N N    . ASP A 1 22 ? -9.881  -7.882  -1.872  1.00 0.00 ? 86  ASP A N    1  
ATOM   319   C CA   . ASP A 1 22 ? -10.710 -7.642  -3.070  1.00 0.00 ? 86  ASP A CA   1  
ATOM   320   C C    . ASP A 1 22 ? -9.879  -7.615  -4.351  1.00 0.00 ? 86  ASP A C    1  
ATOM   321   O O    . ASP A 1 22 ? -10.394 -7.797  -5.460  1.00 0.00 ? 86  ASP A O    1  
ATOM   322   C CB   . ASP A 1 22 ? -11.471 -6.331  -2.908  1.00 0.00 ? 86  ASP A CB   1  
ATOM   323   C CG   . ASP A 1 22 ? -12.522 -6.103  -3.952  1.00 0.00 ? 86  ASP A CG   1  
ATOM   324   O OD1  . ASP A 1 22 ? -13.570 -6.772  -3.912  1.00 0.00 ? 86  ASP A OD1  1  
ATOM   325   O OD2  . ASP A 1 22 ? -12.333 -5.242  -4.811  1.00 0.00 ? 86  ASP A OD2  1  
ATOM   326   H H    . ASP A 1 22 ? -9.272  -7.197  -1.524  1.00 0.00 ? 86  ASP A H    1  
ATOM   327   H HA   . ASP A 1 22 ? -11.426 -8.445  -3.133  1.00 0.00 ? 86  ASP A HA   1  
ATOM   328   H HB2  . ASP A 1 22 ? -11.964 -6.328  -1.948  1.00 0.00 ? 86  ASP A HB2  1  
ATOM   329   H HB3  . ASP A 1 22 ? -10.760 -5.518  -2.964  1.00 0.00 ? 86  ASP A HB3  1  
ATOM   330   N N    . GLY A 1 23 ? -8.599  -7.414  -4.191  1.00 0.00 ? 87  GLY A N    1  
ATOM   331   C CA   . GLY A 1 23 ? -7.681  -7.373  -5.323  1.00 0.00 ? 87  GLY A CA   1  
ATOM   332   C C    . GLY A 1 23 ? -7.714  -6.051  -6.083  1.00 0.00 ? 87  GLY A C    1  
ATOM   333   O O    . GLY A 1 23 ? -7.187  -5.951  -7.187  1.00 0.00 ? 87  GLY A O    1  
ATOM   334   H H    . GLY A 1 23 ? -8.242  -7.310  -3.280  1.00 0.00 ? 87  GLY A H    1  
ATOM   335   H HA2  . GLY A 1 23 ? -6.676  -7.534  -4.963  1.00 0.00 ? 87  GLY A HA2  1  
ATOM   336   H HA3  . GLY A 1 23 ? -7.940  -8.171  -6.002  1.00 0.00 ? 87  GLY A HA3  1  
ATOM   337   N N    . GLN A 1 24 ? -8.335  -5.049  -5.505  1.00 0.00 ? 88  GLN A N    1  
ATOM   338   C CA   . GLN A 1 24 ? -8.439  -3.739  -6.142  1.00 0.00 ? 88  GLN A CA   1  
ATOM   339   C C    . GLN A 1 24 ? -7.679  -2.710  -5.359  1.00 0.00 ? 88  GLN A C    1  
ATOM   340   O O    . GLN A 1 24 ? -7.303  -2.967  -4.218  1.00 0.00 ? 88  GLN A O    1  
ATOM   341   C CB   . GLN A 1 24 ? -9.891  -3.311  -6.314  1.00 0.00 ? 88  GLN A CB   1  
ATOM   342   C CG   . GLN A 1 24 ? -10.649 -4.069  -7.376  1.00 0.00 ? 88  GLN A CG   1  
ATOM   343   C CD   . GLN A 1 24 ? -10.079 -3.857  -8.762  1.00 0.00 ? 88  GLN A CD   1  
ATOM   344   O OE1  . GLN A 1 24 ? -10.463 -2.922  -9.460  1.00 0.00 ? 88  GLN A OE1  1  
ATOM   345   N NE2  . GLN A 1 24 ? -9.191  -4.716  -9.175  1.00 0.00 ? 88  GLN A NE2  1  
ATOM   346   H H    . GLN A 1 24 ? -8.694  -5.178  -4.603  1.00 0.00 ? 88  GLN A H    1  
ATOM   347   H HA   . GLN A 1 24 ? -7.982  -3.822  -7.115  1.00 0.00 ? 88  GLN A HA   1  
ATOM   348   H HB2  . GLN A 1 24 ? -10.411 -3.464  -5.380  1.00 0.00 ? 88  GLN A HB2  1  
ATOM   349   H HB3  . GLN A 1 24 ? -9.922  -2.261  -6.558  1.00 0.00 ? 88  GLN A HB3  1  
ATOM   350   H HG2  . GLN A 1 24 ? -10.603 -5.121  -7.139  1.00 0.00 ? 88  GLN A HG2  1  
ATOM   351   H HG3  . GLN A 1 24 ? -11.671 -3.725  -7.355  1.00 0.00 ? 88  GLN A HG3  1  
ATOM   352   H HE21 . GLN A 1 24 ? -8.947  -5.448  -8.563  1.00 0.00 ? 88  GLN A HE21 1  
ATOM   353   H HE22 . GLN A 1 24 ? -8.799  -4.618  -10.068 1.00 0.00 ? 88  GLN A HE22 1  
ATOM   354   N N    . CYS A 1 25 ? -7.489  -1.547  -5.927  1.00 0.00 ? 89  CYS A N    1  
ATOM   355   C CA   . CYS A 1 25 ? -6.735  -0.519  -5.254  1.00 0.00 ? 89  CYS A CA   1  
ATOM   356   C C    . CYS A 1 25 ? -7.652  0.495   -4.596  1.00 0.00 ? 89  CYS A C    1  
ATOM   357   O O    . CYS A 1 25 ? -8.638  0.952   -5.192  1.00 0.00 ? 89  CYS A O    1  
ATOM   358   C CB   . CYS A 1 25 ? -5.730  0.159   -6.190  1.00 0.00 ? 89  CYS A CB   1  
ATOM   359   S SG   . CYS A 1 25 ? -6.451  0.965   -7.631  1.00 0.00 ? 89  CYS A SG   1  
ATOM   360   H H    . CYS A 1 25 ? -7.890  -1.366  -6.805  1.00 0.00 ? 89  CYS A H    1  
ATOM   361   H HA   . CYS A 1 25 ? -6.188  -1.010  -4.462  1.00 0.00 ? 89  CYS A HA   1  
ATOM   362   H HB2  . CYS A 1 25 ? -5.199  0.912   -5.630  1.00 0.00 ? 89  CYS A HB2  1  
ATOM   363   H HB3  . CYS A 1 25 ? -5.023  -0.580  -6.540  1.00 0.00 ? 89  CYS A HB3  1  
ATOM   364   H HG   . CYS A 1 25 ? -7.766  1.015   -7.455  1.00 0.00 ? 89  CYS A HG   1  
ATOM   365   N N    . TYR A 1 26 ? -7.331  0.819   -3.374  1.00 0.00 ? 90  TYR A N    1  
ATOM   366   C CA   . TYR A 1 26 ? -8.094  1.731   -2.551  1.00 0.00 ? 90  TYR A CA   1  
ATOM   367   C C    . TYR A 1 26 ? -7.120  2.677   -1.897  1.00 0.00 ? 90  TYR A C    1  
ATOM   368   O O    . TYR A 1 26 ? -5.931  2.343   -1.787  1.00 0.00 ? 90  TYR A O    1  
ATOM   369   C CB   . TYR A 1 26 ? -8.865  0.949   -1.474  1.00 0.00 ? 90  TYR A CB   1  
ATOM   370   C CG   . TYR A 1 26 ? -9.915  -0.016  -2.011  1.00 0.00 ? 90  TYR A CG   1  
ATOM   371   C CD1  . TYR A 1 26 ? -9.548  -1.247  -2.549  1.00 0.00 ? 90  TYR A CD1  1  
ATOM   372   C CD2  . TYR A 1 26 ? -11.266 0.299   -1.976  1.00 0.00 ? 90  TYR A CD2  1  
ATOM   373   C CE1  . TYR A 1 26 ? -10.481 -2.123  -3.039  1.00 0.00 ? 90  TYR A CE1  1  
ATOM   374   C CE2  . TYR A 1 26 ? -12.211 -0.576  -2.470  1.00 0.00 ? 90  TYR A CE2  1  
ATOM   375   C CZ   . TYR A 1 26 ? -11.810 -1.788  -3.001  1.00 0.00 ? 90  TYR A CZ   1  
ATOM   376   O OH   . TYR A 1 26 ? -12.754 -2.646  -3.529  1.00 0.00 ? 90  TYR A OH   1  
ATOM   377   H H    . TYR A 1 26 ? -6.518  0.424   -2.985  1.00 0.00 ? 90  TYR A H    1  
ATOM   378   H HA   . TYR A 1 26 ? -8.787  2.279   -3.172  1.00 0.00 ? 90  TYR A HA   1  
ATOM   379   H HB2  . TYR A 1 26 ? -8.150  0.364   -0.914  1.00 0.00 ? 90  TYR A HB2  1  
ATOM   380   H HB3  . TYR A 1 26 ? -9.345  1.639   -0.797  1.00 0.00 ? 90  TYR A HB3  1  
ATOM   381   H HD1  . TYR A 1 26 ? -8.500  -1.513  -2.575  1.00 0.00 ? 90  TYR A HD1  1  
ATOM   382   H HD2  . TYR A 1 26 ? -11.581 1.246   -1.561  1.00 0.00 ? 90  TYR A HD2  1  
ATOM   383   H HE1  . TYR A 1 26 ? -10.155 -3.067  -3.449  1.00 0.00 ? 90  TYR A HE1  1  
ATOM   384   H HE2  . TYR A 1 26 ? -13.262 -0.326  -2.423  1.00 0.00 ? 90  TYR A HE2  1  
ATOM   385   H HH   . TYR A 1 26 ? -12.438 -3.560  -3.523  1.00 0.00 ? 90  TYR A HH   1  
ATOM   386   N N    . GLU A 1 27 ? -7.583  3.835   -1.479  1.00 0.00 ? 91  GLU A N    1  
ATOM   387   C CA   . GLU A 1 27 ? -6.700  4.803   -0.869  1.00 0.00 ? 91  GLU A CA   1  
ATOM   388   C C    . GLU A 1 27 ? -6.323  4.361   0.531   1.00 0.00 ? 91  GLU A C    1  
ATOM   389   O O    . GLU A 1 27 ? -7.188  4.107   1.392   1.00 0.00 ? 91  GLU A O    1  
ATOM   390   C CB   . GLU A 1 27 ? -7.318  6.204   -0.846  1.00 0.00 ? 91  GLU A CB   1  
ATOM   391   C CG   . GLU A 1 27 ? -6.381  7.264   -0.269  1.00 0.00 ? 91  GLU A CG   1  
ATOM   392   C CD   . GLU A 1 27 ? -6.906  8.664   -0.405  1.00 0.00 ? 91  GLU A CD   1  
ATOM   393   O OE1  . GLU A 1 27 ? -7.659  9.127   0.472   1.00 0.00 ? 91  GLU A OE1  1  
ATOM   394   O OE2  . GLU A 1 27 ? -6.553  9.350   -1.399  1.00 0.00 ? 91  GLU A OE2  1  
ATOM   395   H H    . GLU A 1 27 ? -8.539  4.033   -1.564  1.00 0.00 ? 91  GLU A H    1  
ATOM   396   H HA   . GLU A 1 27 ? -5.800  4.827   -1.467  1.00 0.00 ? 91  GLU A HA   1  
ATOM   397   H HB2  . GLU A 1 27 ? -7.596  6.487   -1.850  1.00 0.00 ? 91  GLU A HB2  1  
ATOM   398   H HB3  . GLU A 1 27 ? -8.208  6.175   -0.235  1.00 0.00 ? 91  GLU A HB3  1  
ATOM   399   H HG2  . GLU A 1 27 ? -6.228  7.059   0.780   1.00 0.00 ? 91  GLU A HG2  1  
ATOM   400   H HG3  . GLU A 1 27 ? -5.433  7.196   -0.782  1.00 0.00 ? 91  GLU A HG3  1  
ATOM   401   N N    . ALA A 1 28 ? -5.053  4.265   0.750   1.00 0.00 ? 92  ALA A N    1  
ATOM   402   C CA   . ALA A 1 28 ? -4.518  3.828   1.993   1.00 0.00 ? 92  ALA A CA   1  
ATOM   403   C C    . ALA A 1 28 ? -3.325  4.669   2.366   1.00 0.00 ? 92  ALA A C    1  
ATOM   404   O O    . ALA A 1 28 ? -2.483  4.971   1.526   1.00 0.00 ? 92  ALA A O    1  
ATOM   405   C CB   . ALA A 1 28 ? -4.126  2.383   1.895   1.00 0.00 ? 92  ALA A CB   1  
ATOM   406   H H    . ALA A 1 28 ? -4.433  4.507   0.021   1.00 0.00 ? 92  ALA A H    1  
ATOM   407   H HA   . ALA A 1 28 ? -5.280  3.925   2.752   1.00 0.00 ? 92  ALA A HA   1  
ATOM   408   H HB1  . ALA A 1 28 ? -3.340  2.274   1.163   1.00 0.00 ? 92  ALA A HB1  1  
ATOM   409   H HB2  . ALA A 1 28 ? -3.774  2.051   2.860   1.00 0.00 ? 92  ALA A HB2  1  
ATOM   410   H HB3  . ALA A 1 28 ? -4.982  1.793   1.602   1.00 0.00 ? 92  ALA A HB3  1  
ATOM   411   N N    . GLU A 1 29 ? -3.236  5.019   3.607   1.00 0.00 ? 93  GLU A N    1  
ATOM   412   C CA   . GLU A 1 29 ? -2.195  5.878   4.071   1.00 0.00 ? 93  GLU A CA   1  
ATOM   413   C C    . GLU A 1 29 ? -1.103  5.063   4.734   1.00 0.00 ? 93  GLU A C    1  
ATOM   414   O O    . GLU A 1 29 ? -1.381  4.157   5.520   1.00 0.00 ? 93  GLU A O    1  
ATOM   415   C CB   . GLU A 1 29 ? -2.770  6.931   5.007   1.00 0.00 ? 93  GLU A CB   1  
ATOM   416   C CG   . GLU A 1 29 ? -1.789  7.998   5.446   1.00 0.00 ? 93  GLU A CG   1  
ATOM   417   C CD   . GLU A 1 29 ? -2.462  9.072   6.245   1.00 0.00 ? 93  GLU A CD   1  
ATOM   418   O OE1  . GLU A 1 29 ? -2.968  10.039  5.642   1.00 0.00 ? 93  GLU A OE1  1  
ATOM   419   O OE2  . GLU A 1 29 ? -2.514  8.965   7.484   1.00 0.00 ? 93  GLU A OE2  1  
ATOM   420   H H    . GLU A 1 29 ? -3.890  4.662   4.251   1.00 0.00 ? 93  GLU A H    1  
ATOM   421   H HA   . GLU A 1 29 ? -1.772  6.371   3.212   1.00 0.00 ? 93  GLU A HA   1  
ATOM   422   H HB2  . GLU A 1 29 ? -3.596  7.420   4.513   1.00 0.00 ? 93  GLU A HB2  1  
ATOM   423   H HB3  . GLU A 1 29 ? -3.143  6.431   5.887   1.00 0.00 ? 93  GLU A HB3  1  
ATOM   424   H HG2  . GLU A 1 29 ? -1.020  7.540   6.051   1.00 0.00 ? 93  GLU A HG2  1  
ATOM   425   H HG3  . GLU A 1 29 ? -1.335  8.443   4.572   1.00 0.00 ? 93  GLU A HG3  1  
ATOM   426   N N    . ILE A 1 30 ? 0.116   5.353   4.365   1.00 0.00 ? 94  ILE A N    1  
ATOM   427   C CA   . ILE A 1 30 ? 1.281   4.661   4.864   1.00 0.00 ? 94  ILE A CA   1  
ATOM   428   C C    . ILE A 1 30 ? 1.582   5.041   6.307   1.00 0.00 ? 94  ILE A C    1  
ATOM   429   O O    . ILE A 1 30 ? 1.809   6.226   6.638   1.00 0.00 ? 94  ILE A O    1  
ATOM   430   C CB   . ILE A 1 30 ? 2.505   4.947   3.978   1.00 0.00 ? 94  ILE A CB   1  
ATOM   431   C CG1  . ILE A 1 30 ? 2.178   4.542   2.546   1.00 0.00 ? 94  ILE A CG1  1  
ATOM   432   C CG2  . ILE A 1 30 ? 3.710   4.154   4.493   1.00 0.00 ? 94  ILE A CG2  1  
ATOM   433   C CD1  . ILE A 1 30 ? 3.162   5.029   1.526   1.00 0.00 ? 94  ILE A CD1  1  
ATOM   434   H H    . ILE A 1 30 ? 0.251   6.077   3.709   1.00 0.00 ? 94  ILE A H    1  
ATOM   435   H HA   . ILE A 1 30 ? 1.077   3.601   4.826   1.00 0.00 ? 94  ILE A HA   1  
ATOM   436   H HB   . ILE A 1 30 ? 2.724   6.008   3.997   1.00 0.00 ? 94  ILE A HB   1  
ATOM   437   H HG12 . ILE A 1 30 ? 2.165   3.464   2.485   1.00 0.00 ? 94  ILE A HG12 1  
ATOM   438   H HG13 . ILE A 1 30 ? 1.201   4.925   2.294   1.00 0.00 ? 94  ILE A HG13 1  
ATOM   439   H HG21 . ILE A 1 30 ? 3.469   3.100   4.494   1.00 0.00 ? 94  ILE A HG21 1  
ATOM   440   H HG22 . ILE A 1 30 ? 4.569   4.332   3.863   1.00 0.00 ? 94  ILE A HG22 1  
ATOM   441   H HG23 . ILE A 1 30 ? 3.928   4.454   5.507   1.00 0.00 ? 94  ILE A HG23 1  
ATOM   442   H HD11 . ILE A 1 30 ? 4.132   4.620   1.762   1.00 0.00 ? 94  ILE A HD11 1  
ATOM   443   H HD12 . ILE A 1 30 ? 2.846   4.707   0.544   1.00 0.00 ? 94  ILE A HD12 1  
ATOM   444   H HD13 . ILE A 1 30 ? 3.201   6.109   1.552   1.00 0.00 ? 94  ILE A HD13 1  
ATOM   445   N N    . GLU A 1 31 ? 1.593   4.040   7.140   1.00 0.00 ? 95  GLU A N    1  
ATOM   446   C CA   . GLU A 1 31 ? 1.836   4.186   8.547   1.00 0.00 ? 95  GLU A CA   1  
ATOM   447   C C    . GLU A 1 31 ? 3.305   3.966   8.867   1.00 0.00 ? 95  GLU A C    1  
ATOM   448   O O    . GLU A 1 31 ? 3.892   4.700   9.662   1.00 0.00 ? 95  GLU A O    1  
ATOM   449   C CB   . GLU A 1 31 ? 0.994   3.171   9.306   1.00 0.00 ? 95  GLU A CB   1  
ATOM   450   C CG   . GLU A 1 31 ? -0.499  3.345   9.115   1.00 0.00 ? 95  GLU A CG   1  
ATOM   451   C CD   . GLU A 1 31 ? -1.028  4.606   9.747   1.00 0.00 ? 95  GLU A CD   1  
ATOM   452   O OE1  . GLU A 1 31 ? -1.211  4.630   10.980  1.00 0.00 ? 95  GLU A OE1  1  
ATOM   453   O OE2  . GLU A 1 31 ? -1.272  5.601   9.041   1.00 0.00 ? 95  GLU A OE2  1  
ATOM   454   H H    . GLU A 1 31 ? 1.421   3.139   6.785   1.00 0.00 ? 95  GLU A H    1  
ATOM   455   H HA   . GLU A 1 31 ? 1.540   5.174   8.858   1.00 0.00 ? 95  GLU A HA   1  
ATOM   456   H HB2  . GLU A 1 31 ? 1.264   2.180   8.971   1.00 0.00 ? 95  GLU A HB2  1  
ATOM   457   H HB3  . GLU A 1 31 ? 1.215   3.255   10.359  1.00 0.00 ? 95  GLU A HB3  1  
ATOM   458   H HG2  . GLU A 1 31 ? -0.715  3.386   8.058   1.00 0.00 ? 95  GLU A HG2  1  
ATOM   459   H HG3  . GLU A 1 31 ? -1.012  2.500   9.546   1.00 0.00 ? 95  GLU A HG3  1  
ATOM   460   N N    . GLU A 1 32 ? 3.897   2.977   8.223   1.00 0.00 ? 96  GLU A N    1  
ATOM   461   C CA   . GLU A 1 32 ? 5.266   2.585   8.498   1.00 0.00 ? 96  GLU A CA   1  
ATOM   462   C C    . GLU A 1 32 ? 5.826   1.853   7.284   1.00 0.00 ? 96  GLU A C    1  
ATOM   463   O O    . GLU A 1 32 ? 5.069   1.227   6.540   1.00 0.00 ? 96  GLU A O    1  
ATOM   464   C CB   . GLU A 1 32 ? 5.270   1.675   9.732   1.00 0.00 ? 96  GLU A CB   1  
ATOM   465   C CG   . GLU A 1 32 ? 6.630   1.212   10.192  1.00 0.00 ? 96  GLU A CG   1  
ATOM   466   C CD   . GLU A 1 32 ? 6.537   0.327   11.398  1.00 0.00 ? 96  GLU A CD   1  
ATOM   467   O OE1  . GLU A 1 32 ? 6.265   0.829   12.508  1.00 0.00 ? 96  GLU A OE1  1  
ATOM   468   O OE2  . GLU A 1 32 ? 6.731   -0.890  11.264  1.00 0.00 ? 96  GLU A OE2  1  
ATOM   469   H H    . GLU A 1 32 ? 3.414   2.483   7.526   1.00 0.00 ? 96  GLU A H    1  
ATOM   470   H HA   . GLU A 1 32 ? 5.863   3.463   8.692   1.00 0.00 ? 96  GLU A HA   1  
ATOM   471   H HB2  . GLU A 1 32 ? 4.814   2.212   10.550  1.00 0.00 ? 96  GLU A HB2  1  
ATOM   472   H HB3  . GLU A 1 32 ? 4.669   0.804   9.515   1.00 0.00 ? 96  GLU A HB3  1  
ATOM   473   H HG2  . GLU A 1 32 ? 7.071   0.652   9.380   1.00 0.00 ? 96  GLU A HG2  1  
ATOM   474   H HG3  . GLU A 1 32 ? 7.245   2.069   10.420  1.00 0.00 ? 96  GLU A HG3  1  
ATOM   475   N N    . ILE A 1 33 ? 7.119   1.953   7.072   1.00 0.00 ? 97  ILE A N    1  
ATOM   476   C CA   . ILE A 1 33 ? 7.773   1.329   5.939   1.00 0.00 ? 97  ILE A CA   1  
ATOM   477   C C    . ILE A 1 33 ? 8.890   0.412   6.419   1.00 0.00 ? 97  ILE A C    1  
ATOM   478   O O    . ILE A 1 33 ? 9.682   0.777   7.280   1.00 0.00 ? 97  ILE A O    1  
ATOM   479   C CB   . ILE A 1 33 ? 8.371   2.411   5.009   1.00 0.00 ? 97  ILE A CB   1  
ATOM   480   C CG1  . ILE A 1 33 ? 7.272   3.355   4.550   1.00 0.00 ? 97  ILE A CG1  1  
ATOM   481   C CG2  . ILE A 1 33 ? 9.056   1.778   3.793   1.00 0.00 ? 97  ILE A CG2  1  
ATOM   482   C CD1  . ILE A 1 33 ? 7.778   4.695   4.184   1.00 0.00 ? 97  ILE A CD1  1  
ATOM   483   H H    . ILE A 1 33 ? 7.682   2.462   7.698   1.00 0.00 ? 97  ILE A H    1  
ATOM   484   H HA   . ILE A 1 33 ? 7.043   0.760   5.385   1.00 0.00 ? 97  ILE A HA   1  
ATOM   485   H HB   . ILE A 1 33 ? 9.105   2.977   5.562   1.00 0.00 ? 97  ILE A HB   1  
ATOM   486   H HG12 . ILE A 1 33 ? 6.791   2.960   3.666   1.00 0.00 ? 97  ILE A HG12 1  
ATOM   487   H HG13 . ILE A 1 33 ? 6.549   3.471   5.343   1.00 0.00 ? 97  ILE A HG13 1  
ATOM   488   H HG21 . ILE A 1 33 ? 8.336   1.196   3.238   1.00 0.00 ? 97  ILE A HG21 1  
ATOM   489   H HG22 . ILE A 1 33 ? 9.452   2.559   3.159   1.00 0.00 ? 97  ILE A HG22 1  
ATOM   490   H HG23 . ILE A 1 33 ? 9.859   1.136   4.123   1.00 0.00 ? 97  ILE A HG23 1  
ATOM   491   H HD11 . ILE A 1 33 ? 8.507   4.615   3.393   1.00 0.00 ? 97  ILE A HD11 1  
ATOM   492   H HD12 . ILE A 1 33 ? 6.947   5.307   3.866   1.00 0.00 ? 97  ILE A HD12 1  
ATOM   493   H HD13 . ILE A 1 33 ? 8.224   5.122   5.070   1.00 0.00 ? 97  ILE A HD13 1  
ATOM   494   N N    . ASP A 1 34 ? 8.925   -0.762  5.868   1.00 0.00 ? 98  ASP A N    1  
ATOM   495   C CA   . ASP A 1 34 ? 9.941   -1.747  6.150   1.00 0.00 ? 98  ASP A CA   1  
ATOM   496   C C    . ASP A 1 34 ? 10.844  -1.840  4.939   1.00 0.00 ? 98  ASP A C    1  
ATOM   497   O O    . ASP A 1 34 ? 10.521  -2.509  3.961   1.00 0.00 ? 98  ASP A O    1  
ATOM   498   C CB   . ASP A 1 34 ? 9.303   -3.116  6.422   1.00 0.00 ? 98  ASP A CB   1  
ATOM   499   C CG   . ASP A 1 34 ? 10.322  -4.172  6.772   1.00 0.00 ? 98  ASP A CG   1  
ATOM   500   O OD1  . ASP A 1 34 ? 10.908  -4.748  5.861   1.00 0.00 ? 98  ASP A OD1  1  
ATOM   501   O OD2  . ASP A 1 34 ? 10.532  -4.453  7.977   1.00 0.00 ? 98  ASP A OD2  1  
ATOM   502   H H    . ASP A 1 34 ? 8.239   -0.993  5.202   1.00 0.00 ? 98  ASP A H    1  
ATOM   503   H HA   . ASP A 1 34 ? 10.537  -1.445  6.998   1.00 0.00 ? 98  ASP A HA   1  
ATOM   504   H HB2  . ASP A 1 34 ? 8.565   -3.045  7.206   1.00 0.00 ? 98  ASP A HB2  1  
ATOM   505   H HB3  . ASP A 1 34 ? 8.812   -3.436  5.513   1.00 0.00 ? 98  ASP A HB3  1  
ATOM   506   N N    . GLU A 1 35 ? 11.913  -1.092  4.968   1.00 0.00 ? 99  GLU A N    1  
ATOM   507   C CA   . GLU A 1 35 ? 12.895  -1.055  3.886   1.00 0.00 ? 99  GLU A CA   1  
ATOM   508   C C    . GLU A 1 35 ? 13.641  -2.381  3.731   1.00 0.00 ? 99  GLU A C    1  
ATOM   509   O O    . GLU A 1 35 ? 14.285  -2.629  2.706   1.00 0.00 ? 99  GLU A O    1  
ATOM   510   C CB   . GLU A 1 35 ? 13.872  0.065   4.124   1.00 0.00 ? 99  GLU A CB   1  
ATOM   511   C CG   . GLU A 1 35 ? 13.237  1.437   4.132   1.00 0.00 ? 99  GLU A CG   1  
ATOM   512   C CD   . GLU A 1 35 ? 14.204  2.500   4.558   1.00 0.00 ? 99  GLU A CD   1  
ATOM   513   O OE1  . GLU A 1 35 ? 14.930  3.042   3.700   1.00 0.00 ? 99  GLU A OE1  1  
ATOM   514   O OE2  . GLU A 1 35 ? 14.268  2.796   5.768   1.00 0.00 ? 99  GLU A OE2  1  
ATOM   515   H H    . GLU A 1 35 ? 12.063  -0.526  5.756   1.00 0.00 ? 99  GLU A H    1  
ATOM   516   H HA   . GLU A 1 35 ? 12.360  -0.853  2.972   1.00 0.00 ? 99  GLU A HA   1  
ATOM   517   H HB2  . GLU A 1 35 ? 14.363  -0.099  5.070   1.00 0.00 ? 99  GLU A HB2  1  
ATOM   518   H HB3  . GLU A 1 35 ? 14.607  0.034   3.333   1.00 0.00 ? 99  GLU A HB3  1  
ATOM   519   H HG2  . GLU A 1 35 ? 12.877  1.658   3.140   1.00 0.00 ? 99  GLU A HG2  1  
ATOM   520   H HG3  . GLU A 1 35 ? 12.400  1.430   4.815   1.00 0.00 ? 99  GLU A HG3  1  
ATOM   521   N N    . GLU A 1 36 ? 13.583  -3.202  4.758   1.00 0.00 ? 100 GLU A N    1  
ATOM   522   C CA   . GLU A 1 36 ? 14.248  -4.483  4.758   1.00 0.00 ? 100 GLU A CA   1  
ATOM   523   C C    . GLU A 1 36 ? 13.632  -5.388  3.691   1.00 0.00 ? 100 GLU A C    1  
ATOM   524   O O    . GLU A 1 36 ? 14.339  -6.057  2.934   1.00 0.00 ? 100 GLU A O    1  
ATOM   525   C CB   . GLU A 1 36 ? 14.080  -5.131  6.131   1.00 0.00 ? 100 GLU A CB   1  
ATOM   526   C CG   . GLU A 1 36 ? 14.826  -6.442  6.304   1.00 0.00 ? 100 GLU A CG   1  
ATOM   527   C CD   . GLU A 1 36 ? 14.459  -7.140  7.582   1.00 0.00 ? 100 GLU A CD   1  
ATOM   528   O OE1  . GLU A 1 36 ? 13.439  -7.874  7.599   1.00 0.00 ? 100 GLU A OE1  1  
ATOM   529   O OE2  . GLU A 1 36 ? 15.163  -6.975  8.599   1.00 0.00 ? 100 GLU A OE2  1  
ATOM   530   H H    . GLU A 1 36 ? 13.078  -2.920  5.550   1.00 0.00 ? 100 GLU A H    1  
ATOM   531   H HA   . GLU A 1 36 ? 15.300  -4.339  4.562   1.00 0.00 ? 100 GLU A HA   1  
ATOM   532   H HB2  . GLU A 1 36 ? 14.388  -4.432  6.893   1.00 0.00 ? 100 GLU A HB2  1  
ATOM   533   H HB3  . GLU A 1 36 ? 13.027  -5.327  6.272   1.00 0.00 ? 100 GLU A HB3  1  
ATOM   534   H HG2  . GLU A 1 36 ? 14.592  -7.089  5.472   1.00 0.00 ? 100 GLU A HG2  1  
ATOM   535   H HG3  . GLU A 1 36 ? 15.887  -6.240  6.310   1.00 0.00 ? 100 GLU A HG3  1  
ATOM   536   N N    . ASN A 1 37 ? 12.327  -5.377  3.625   1.00 0.00 ? 101 ASN A N    1  
ATOM   537   C CA   . ASN A 1 37 ? 11.591  -6.191  2.666   1.00 0.00 ? 101 ASN A CA   1  
ATOM   538   C C    . ASN A 1 37 ? 11.039  -5.349  1.549   1.00 0.00 ? 101 ASN A C    1  
ATOM   539   O O    . ASN A 1 37 ? 10.611  -5.869  0.522   1.00 0.00 ? 101 ASN A O    1  
ATOM   540   C CB   . ASN A 1 37 ? 10.431  -6.908  3.360   1.00 0.00 ? 101 ASN A CB   1  
ATOM   541   C CG   . ASN A 1 37 ? 10.875  -7.866  4.443   1.00 0.00 ? 101 ASN A CG   1  
ATOM   542   O OD1  . ASN A 1 37 ? 11.119  -9.049  4.191   1.00 0.00 ? 101 ASN A OD1  1  
ATOM   543   N ND2  . ASN A 1 37 ? 11.005  -7.371  5.641   1.00 0.00 ? 101 ASN A ND2  1  
ATOM   544   H H    . ASN A 1 37 ? 11.830  -4.847  4.294   1.00 0.00 ? 101 ASN A H    1  
ATOM   545   H HA   . ASN A 1 37 ? 12.249  -6.941  2.255   1.00 0.00 ? 101 ASN A HA   1  
ATOM   546   H HB2  . ASN A 1 37 ? 9.788   -6.167  3.813   1.00 0.00 ? 101 ASN A HB2  1  
ATOM   547   H HB3  . ASN A 1 37 ? 9.872   -7.451  2.616   1.00 0.00 ? 101 ASN A HB3  1  
ATOM   548   H HD21 . ASN A 1 37 ? 10.808  -6.400  5.737   1.00 0.00 ? 101 ASN A HD21 1  
ATOM   549   H HD22 . ASN A 1 37 ? 11.282  -7.926  6.398   1.00 0.00 ? 101 ASN A HD22 1  
ATOM   550   N N    . GLY A 1 38 ? 11.050  -4.048  1.745   1.00 0.00 ? 102 GLY A N    1  
ATOM   551   C CA   . GLY A 1 38 ? 10.466  -3.155  0.777   1.00 0.00 ? 102 GLY A CA   1  
ATOM   552   C C    . GLY A 1 38 ? 8.956   -3.157  0.903   1.00 0.00 ? 102 GLY A C    1  
ATOM   553   O O    . GLY A 1 38 ? 8.231   -2.951  -0.072  1.00 0.00 ? 102 GLY A O    1  
ATOM   554   H H    . GLY A 1 38 ? 11.455  -3.682  2.562   1.00 0.00 ? 102 GLY A H    1  
ATOM   555   H HA2  . GLY A 1 38 ? 10.843  -2.156  0.941   1.00 0.00 ? 102 GLY A HA2  1  
ATOM   556   H HA3  . GLY A 1 38 ? 10.733  -3.482  -0.216  1.00 0.00 ? 102 GLY A HA3  1  
ATOM   557   N N    . THR A 1 39 ? 8.471   -3.399  2.098   1.00 0.00 ? 103 THR A N    1  
ATOM   558   C CA   . THR A 1 39 ? 7.052   -3.450  2.322   1.00 0.00 ? 103 THR A CA   1  
ATOM   559   C C    . THR A 1 39 ? 6.609   -2.309  3.211   1.00 0.00 ? 103 THR A C    1  
ATOM   560   O O    . THR A 1 39 ? 7.403   -1.774  3.956   1.00 0.00 ? 103 THR A O    1  
ATOM   561   C CB   . THR A 1 39 ? 6.640   -4.806  2.928   1.00 0.00 ? 103 THR A CB   1  
ATOM   562   O OG1  . THR A 1 39 ? 7.435   -5.082  4.105   1.00 0.00 ? 103 THR A OG1  1  
ATOM   563   C CG2  . THR A 1 39 ? 6.818   -5.932  1.916   1.00 0.00 ? 103 THR A CG2  1  
ATOM   564   H H    . THR A 1 39 ? 9.086   -3.546  2.853   1.00 0.00 ? 103 THR A H    1  
ATOM   565   H HA   . THR A 1 39 ? 6.561   -3.328  1.373   1.00 0.00 ? 103 THR A HA   1  
ATOM   566   H HB   . THR A 1 39 ? 5.597   -4.732  3.197   1.00 0.00 ? 103 THR A HB   1  
ATOM   567   H HG1  . THR A 1 39 ? 7.617   -4.243  4.539   1.00 0.00 ? 103 THR A HG1  1  
ATOM   568   H HG21 . THR A 1 39 ? 7.856   -5.988  1.624   1.00 0.00 ? 103 THR A HG21 1  
ATOM   569   H HG22 . THR A 1 39 ? 6.510   -6.870  2.354   1.00 0.00 ? 103 THR A HG22 1  
ATOM   570   H HG23 . THR A 1 39 ? 6.215   -5.724  1.044   1.00 0.00 ? 103 THR A HG23 1  
ATOM   571   N N    . ALA A 1 40 ? 5.368   -1.929  3.123   1.00 0.00 ? 104 ALA A N    1  
ATOM   572   C CA   . ALA A 1 40 ? 4.861   -0.854  3.925   1.00 0.00 ? 104 ALA A CA   1  
ATOM   573   C C    . ALA A 1 40 ? 3.553   -1.235  4.549   1.00 0.00 ? 104 ALA A C    1  
ATOM   574   O O    . ALA A 1 40 ? 2.760   -1.979  3.964   1.00 0.00 ? 104 ALA A O    1  
ATOM   575   C CB   . ALA A 1 40 ? 4.693   0.404   3.099   1.00 0.00 ? 104 ALA A CB   1  
ATOM   576   H H    . ALA A 1 40 ? 4.738   -2.369  2.506   1.00 0.00 ? 104 ALA A H    1  
ATOM   577   H HA   . ALA A 1 40 ? 5.577   -0.651  4.706   1.00 0.00 ? 104 ALA A HA   1  
ATOM   578   H HB1  . ALA A 1 40 ? 3.973   0.222   2.315   1.00 0.00 ? 104 ALA A HB1  1  
ATOM   579   H HB2  . ALA A 1 40 ? 4.342   1.206   3.732   1.00 0.00 ? 104 ALA A HB2  1  
ATOM   580   H HB3  . ALA A 1 40 ? 5.642   0.675   2.665   1.00 0.00 ? 104 ALA A HB3  1  
ATOM   581   N N    . ALA A 1 41 ? 3.350   -0.753  5.729   1.00 0.00 ? 105 ALA A N    1  
ATOM   582   C CA   . ALA A 1 41 ? 2.137   -0.953  6.444   1.00 0.00 ? 105 ALA A CA   1  
ATOM   583   C C    . ALA A 1 41 ? 1.238   0.214   6.152   1.00 0.00 ? 105 ALA A C    1  
ATOM   584   O O    . ALA A 1 41 ? 1.614   1.379   6.382   1.00 0.00 ? 105 ALA A O    1  
ATOM   585   C CB   . ALA A 1 41 ? 2.431   -1.045  7.904   1.00 0.00 ? 105 ALA A CB   1  
ATOM   586   H H    . ALA A 1 41 ? 4.049   -0.196  6.146   1.00 0.00 ? 105 ALA A H    1  
ATOM   587   H HA   . ALA A 1 41 ? 1.673   -1.868  6.110   1.00 0.00 ? 105 ALA A HA   1  
ATOM   588   H HB1  . ALA A 1 41 ? 2.937   -0.136  8.198   1.00 0.00 ? 105 ALA A HB1  1  
ATOM   589   H HB2  . ALA A 1 41 ? 1.507   -1.163  8.448   1.00 0.00 ? 105 ALA A HB2  1  
ATOM   590   H HB3  . ALA A 1 41 ? 3.068   -1.904  8.053   1.00 0.00 ? 105 ALA A HB3  1  
ATOM   591   N N    . ILE A 1 42 ? 0.091   -0.070  5.635   1.00 0.00 ? 106 ILE A N    1  
ATOM   592   C CA   . ILE A 1 42 ? -0.813  0.951   5.184   1.00 0.00 ? 106 ILE A CA   1  
ATOM   593   C C    . ILE A 1 42 ? -2.176  0.795   5.832   1.00 0.00 ? 106 ILE A C    1  
ATOM   594   O O    . ILE A 1 42 ? -2.587  -0.309  6.147   1.00 0.00 ? 106 ILE A O    1  
ATOM   595   C CB   . ILE A 1 42 ? -0.948  0.892   3.628   1.00 0.00 ? 106 ILE A CB   1  
ATOM   596   C CG1  . ILE A 1 42 ? -1.399  -0.500  3.155   1.00 0.00 ? 106 ILE A CG1  1  
ATOM   597   C CG2  . ILE A 1 42 ? 0.331   1.302   2.935   1.00 0.00 ? 106 ILE A CG2  1  
ATOM   598   C CD1  . ILE A 1 42 ? -2.862  -0.603  2.916   1.00 0.00 ? 106 ILE A CD1  1  
ATOM   599   H H    . ILE A 1 42 ? -0.175  -1.014  5.549   1.00 0.00 ? 106 ILE A H    1  
ATOM   600   H HA   . ILE A 1 42 ? -0.390  1.910   5.444   1.00 0.00 ? 106 ILE A HA   1  
ATOM   601   H HB   . ILE A 1 42 ? -1.708  1.608   3.348   1.00 0.00 ? 106 ILE A HB   1  
ATOM   602   H HG12 . ILE A 1 42 ? -0.898  -0.818  2.256   1.00 0.00 ? 106 ILE A HG12 1  
ATOM   603   H HG13 . ILE A 1 42 ? -1.164  -1.202  3.941   1.00 0.00 ? 106 ILE A HG13 1  
ATOM   604   H HG21 . ILE A 1 42 ? 1.131   0.643   3.238   1.00 0.00 ? 106 ILE A HG21 1  
ATOM   605   H HG22 . ILE A 1 42 ? 0.181   1.227   1.868   1.00 0.00 ? 106 ILE A HG22 1  
ATOM   606   H HG23 . ILE A 1 42 ? 0.572   2.320   3.200   1.00 0.00 ? 106 ILE A HG23 1  
ATOM   607   H HD11 . ILE A 1 42 ? -3.095  0.172   2.197   1.00 0.00 ? 106 ILE A HD11 1  
ATOM   608   H HD12 . ILE A 1 42 ? -3.108  -1.574  2.515   1.00 0.00 ? 106 ILE A HD12 1  
ATOM   609   H HD13 . ILE A 1 42 ? -3.401  -0.410  3.831   1.00 0.00 ? 106 ILE A HD13 1  
ATOM   610   N N    . THR A 1 43 ? -2.846  1.888   6.046   1.00 0.00 ? 107 THR A N    1  
ATOM   611   C CA   . THR A 1 43 ? -4.181  1.888   6.592   1.00 0.00 ? 107 THR A CA   1  
ATOM   612   C C    . THR A 1 43 ? -5.173  2.412   5.549   1.00 0.00 ? 107 THR A C    1  
ATOM   613   O O    . THR A 1 43 ? -4.988  3.489   5.000   1.00 0.00 ? 107 THR A O    1  
ATOM   614   C CB   . THR A 1 43 ? -4.250  2.746   7.874   1.00 0.00 ? 107 THR A CB   1  
ATOM   615   O OG1  . THR A 1 43 ? -3.336  2.211   8.843   1.00 0.00 ? 107 THR A OG1  1  
ATOM   616   C CG2  . THR A 1 43 ? -5.654  2.752   8.468   1.00 0.00 ? 107 THR A CG2  1  
ATOM   617   H H    . THR A 1 43 ? -2.418  2.749   5.829   1.00 0.00 ? 107 THR A H    1  
ATOM   618   H HA   . THR A 1 43 ? -4.441  0.869   6.838   1.00 0.00 ? 107 THR A HA   1  
ATOM   619   H HB   . THR A 1 43 ? -3.957  3.757   7.630   1.00 0.00 ? 107 THR A HB   1  
ATOM   620   H HG1  . THR A 1 43 ? -2.831  1.508   8.417   1.00 0.00 ? 107 THR A HG1  1  
ATOM   621   H HG21 . THR A 1 43 ? -5.926  1.743   8.738   1.00 0.00 ? 107 THR A HG21 1  
ATOM   622   H HG22 . THR A 1 43 ? -5.667  3.380   9.346   1.00 0.00 ? 107 THR A HG22 1  
ATOM   623   H HG23 . THR A 1 43 ? -6.353  3.132   7.738   1.00 0.00 ? 107 THR A HG23 1  
ATOM   624   N N    . PHE A 1 44 ? -6.193  1.631   5.265   1.00 0.00 ? 108 PHE A N    1  
ATOM   625   C CA   . PHE A 1 44 ? -7.211  1.996   4.303   1.00 0.00 ? 108 PHE A CA   1  
ATOM   626   C C    . PHE A 1 44 ? -8.094  3.081   4.843   1.00 0.00 ? 108 PHE A C    1  
ATOM   627   O O    . PHE A 1 44 ? -8.786  2.889   5.857   1.00 0.00 ? 108 PHE A O    1  
ATOM   628   C CB   . PHE A 1 44 ? -8.040  0.791   3.885   1.00 0.00 ? 108 PHE A CB   1  
ATOM   629   C CG   . PHE A 1 44 ? -7.267  -0.186  3.069   1.00 0.00 ? 108 PHE A CG   1  
ATOM   630   C CD1  . PHE A 1 44 ? -7.048  0.069   1.730   1.00 0.00 ? 108 PHE A CD1  1  
ATOM   631   C CD2  . PHE A 1 44 ? -6.752  -1.349  3.630   1.00 0.00 ? 108 PHE A CD2  1  
ATOM   632   C CE1  . PHE A 1 44 ? -6.327  -0.806  0.951   1.00 0.00 ? 108 PHE A CE1  1  
ATOM   633   C CE2  . PHE A 1 44 ? -6.030  -2.237  2.855   1.00 0.00 ? 108 PHE A CE2  1  
ATOM   634   C CZ   . PHE A 1 44 ? -5.813  -1.962  1.511   1.00 0.00 ? 108 PHE A CZ   1  
ATOM   635   H H    . PHE A 1 44 ? -6.267  0.784   5.761   1.00 0.00 ? 108 PHE A H    1  
ATOM   636   H HA   . PHE A 1 44 ? -6.708  2.384   3.429   1.00 0.00 ? 108 PHE A HA   1  
ATOM   637   H HB2  . PHE A 1 44 ? -8.407  0.284   4.766   1.00 0.00 ? 108 PHE A HB2  1  
ATOM   638   H HB3  . PHE A 1 44 ? -8.878  1.130   3.294   1.00 0.00 ? 108 PHE A HB3  1  
ATOM   639   H HD1  . PHE A 1 44 ? -7.466  0.971   1.305   1.00 0.00 ? 108 PHE A HD1  1  
ATOM   640   H HD2  . PHE A 1 44 ? -6.937  -1.565  4.674   1.00 0.00 ? 108 PHE A HD2  1  
ATOM   641   H HE1  . PHE A 1 44 ? -6.174  -0.581  -0.095  1.00 0.00 ? 108 PHE A HE1  1  
ATOM   642   H HE2  . PHE A 1 44 ? -5.632  -3.140  3.296   1.00 0.00 ? 108 PHE A HE2  1  
ATOM   643   H HZ   . PHE A 1 44 ? -5.245  -2.652  0.905   1.00 0.00 ? 108 PHE A HZ   1  
ATOM   644   N N    . ALA A 1 45 ? -8.081  4.198   4.154   1.00 0.00 ? 109 ALA A N    1  
ATOM   645   C CA   . ALA A 1 45 ? -8.803  5.378   4.549   1.00 0.00 ? 109 ALA A CA   1  
ATOM   646   C C    . ALA A 1 45 ? -10.301 5.143   4.485   1.00 0.00 ? 109 ALA A C    1  
ATOM   647   O O    . ALA A 1 45 ? -10.811 4.572   3.513   1.00 0.00 ? 109 ALA A O    1  
ATOM   648   C CB   . ALA A 1 45 ? -8.404  6.552   3.665   1.00 0.00 ? 109 ALA A CB   1  
ATOM   649   H H    . ALA A 1 45 ? -7.570  4.223   3.315   1.00 0.00 ? 109 ALA A H    1  
ATOM   650   H HA   . ALA A 1 45 ? -8.522  5.612   5.563   1.00 0.00 ? 109 ALA A HA   1  
ATOM   651   H HB1  . ALA A 1 45 ? -8.671  6.337   2.641   1.00 0.00 ? 109 ALA A HB1  1  
ATOM   652   H HB2  . ALA A 1 45 ? -8.920  7.442   3.992   1.00 0.00 ? 109 ALA A HB2  1  
ATOM   653   H HB3  . ALA A 1 45 ? -7.338  6.709   3.733   1.00 0.00 ? 109 ALA A HB3  1  
ATOM   654   N N    . GLY A 1 46 ? -10.980 5.502   5.543   1.00 0.00 ? 110 GLY A N    1  
ATOM   655   C CA   . GLY A 1 46 ? -12.418 5.391   5.584   1.00 0.00 ? 110 GLY A CA   1  
ATOM   656   C C    . GLY A 1 46 ? -12.865 4.095   6.208   1.00 0.00 ? 110 GLY A C    1  
ATOM   657   O O    . GLY A 1 46 ? -13.637 4.089   7.174   1.00 0.00 ? 110 GLY A O    1  
ATOM   658   H H    . GLY A 1 46 ? -10.489 5.830   6.327   1.00 0.00 ? 110 GLY A H    1  
ATOM   659   H HA2  . GLY A 1 46 ? -12.819 6.215   6.156   1.00 0.00 ? 110 GLY A HA2  1  
ATOM   660   H HA3  . GLY A 1 46 ? -12.801 5.444   4.575   1.00 0.00 ? 110 GLY A HA3  1  
ATOM   661   N N    . TYR A 1 47 ? -12.384 2.999   5.665   1.00 0.00 ? 111 TYR A N    1  
ATOM   662   C CA   . TYR A 1 47 ? -12.724 1.690   6.162   1.00 0.00 ? 111 TYR A CA   1  
ATOM   663   C C    . TYR A 1 47 ? -12.033 1.436   7.498   1.00 0.00 ? 111 TYR A C    1  
ATOM   664   O O    . TYR A 1 47 ? -12.652 0.966   8.448   1.00 0.00 ? 111 TYR A O    1  
ATOM   665   C CB   . TYR A 1 47 ? -12.298 0.637   5.178   1.00 0.00 ? 111 TYR A CB   1  
ATOM   666   C CG   . TYR A 1 47 ? -12.818 0.815   3.768   1.00 0.00 ? 111 TYR A CG   1  
ATOM   667   C CD1  . TYR A 1 47 ? -14.122 0.465   3.428   1.00 0.00 ? 111 TYR A CD1  1  
ATOM   668   C CD2  . TYR A 1 47 ? -11.982 1.288   2.769   1.00 0.00 ? 111 TYR A CD2  1  
ATOM   669   C CE1  . TYR A 1 47 ? -14.577 0.584   2.123   1.00 0.00 ? 111 TYR A CE1  1  
ATOM   670   C CE2  . TYR A 1 47 ? -12.415 1.407   1.470   1.00 0.00 ? 111 TYR A CE2  1  
ATOM   671   C CZ   . TYR A 1 47 ? -13.718 1.051   1.145   1.00 0.00 ? 111 TYR A CZ   1  
ATOM   672   O OH   . TYR A 1 47 ? -14.157 1.154   -0.161  1.00 0.00 ? 111 TYR A OH   1  
ATOM   673   H H    . TYR A 1 47 ? -11.798 3.078   4.881   1.00 0.00 ? 111 TYR A H    1  
ATOM   674   H HA   . TYR A 1 47 ? -13.794 1.639   6.292   1.00 0.00 ? 111 TYR A HA   1  
ATOM   675   H HB2  . TYR A 1 47 ? -11.219 0.640   5.128   1.00 0.00 ? 111 TYR A HB2  1  
ATOM   676   H HB3  . TYR A 1 47 ? -12.621 -0.329  5.536   1.00 0.00 ? 111 TYR A HB3  1  
ATOM   677   H HD1  . TYR A 1 47 ? -14.784 0.102   4.201   1.00 0.00 ? 111 TYR A HD1  1  
ATOM   678   H HD2  . TYR A 1 47 ? -10.969 1.564   3.019   1.00 0.00 ? 111 TYR A HD2  1  
ATOM   679   H HE1  . TYR A 1 47 ? -15.585 0.285   1.872   1.00 0.00 ? 111 TYR A HE1  1  
ATOM   680   H HE2  . TYR A 1 47 ? -11.714 1.773   0.735   1.00 0.00 ? 111 TYR A HE2  1  
ATOM   681   H HH   . TYR A 1 47 ? -13.432 0.921   -0.748  1.00 0.00 ? 111 TYR A HH   1  
ATOM   682   N N    . GLY A 1 48 ? -10.762 1.761   7.567   1.00 0.00 ? 112 GLY A N    1  
ATOM   683   C CA   . GLY A 1 48 ? -10.033 1.604   8.797   1.00 0.00 ? 112 GLY A CA   1  
ATOM   684   C C    . GLY A 1 48 ? -9.443  0.218   8.992   1.00 0.00 ? 112 GLY A C    1  
ATOM   685   O O    . GLY A 1 48 ? -9.624  -0.388  10.051  1.00 0.00 ? 112 GLY A O    1  
ATOM   686   H H    . GLY A 1 48 ? -10.299 2.135   6.784   1.00 0.00 ? 112 GLY A H    1  
ATOM   687   H HA2  . GLY A 1 48 ? -9.229  2.325   8.815   1.00 0.00 ? 112 GLY A HA2  1  
ATOM   688   H HA3  . GLY A 1 48 ? -10.702 1.817   9.618   1.00 0.00 ? 112 GLY A HA3  1  
ATOM   689   N N    . ASN A 1 49 ? -8.783  -0.306  7.972   1.00 0.00 ? 113 ASN A N    1  
ATOM   690   C CA   . ASN A 1 49 ? -8.032  -1.562  8.112   1.00 0.00 ? 113 ASN A CA   1  
ATOM   691   C C    . ASN A 1 49 ? -6.617  -1.279  7.769   1.00 0.00 ? 113 ASN A C    1  
ATOM   692   O O    . ASN A 1 49 ? -6.323  -0.208  7.257   1.00 0.00 ? 113 ASN A O    1  
ATOM   693   C CB   . ASN A 1 49 ? -8.487  -2.709  7.205   1.00 0.00 ? 113 ASN A CB   1  
ATOM   694   C CG   . ASN A 1 49 ? -9.890  -3.193  7.397   1.00 0.00 ? 113 ASN A CG   1  
ATOM   695   O OD1  . ASN A 1 49 ? -10.507 -3.001  8.445   1.00 0.00 ? 113 ASN A OD1  1  
ATOM   696   N ND2  . ASN A 1 49 ? -10.360 -3.914  6.425   1.00 0.00 ? 113 ASN A ND2  1  
ATOM   697   H H    . ASN A 1 49 ? -8.760  0.154   7.109   1.00 0.00 ? 113 ASN A H    1  
ATOM   698   H HA   . ASN A 1 49 ? -8.089  -1.862  9.148   1.00 0.00 ? 113 ASN A HA   1  
ATOM   699   H HB2  . ASN A 1 49 ? -8.391  -2.391  6.177   1.00 0.00 ? 113 ASN A HB2  1  
ATOM   700   H HB3  . ASN A 1 49 ? -7.811  -3.535  7.363   1.00 0.00 ? 113 ASN A HB3  1  
ATOM   701   H HD21 . ASN A 1 49 ? -9.748  -4.084  5.673   1.00 0.00 ? 113 ASN A HD21 1  
ATOM   702   H HD22 . ASN A 1 49 ? -11.282 -4.240  6.434   1.00 0.00 ? 113 ASN A HD22 1  
ATOM   703   N N    . ALA A 1 50 ? -5.757  -2.230  7.965   1.00 0.00 ? 114 ALA A N    1  
ATOM   704   C CA   . ALA A 1 50 ? -4.359  -2.032  7.720   1.00 0.00 ? 114 ALA A CA   1  
ATOM   705   C C    . ALA A 1 50 ? -3.720  -3.316  7.247   1.00 0.00 ? 114 ALA A C    1  
ATOM   706   O O    . ALA A 1 50 ? -4.034  -4.392  7.764   1.00 0.00 ? 114 ALA A O    1  
ATOM   707   C CB   . ALA A 1 50 ? -3.675  -1.525  8.987   1.00 0.00 ? 114 ALA A CB   1  
ATOM   708   H H    . ALA A 1 50 ? -6.055  -3.118  8.260   1.00 0.00 ? 114 ALA A H    1  
ATOM   709   H HA   . ALA A 1 50 ? -4.250  -1.279  6.955   1.00 0.00 ? 114 ALA A HA   1  
ATOM   710   H HB1  . ALA A 1 50 ? -3.738  -2.278  9.759   1.00 0.00 ? 114 ALA A HB1  1  
ATOM   711   H HB2  . ALA A 1 50 ? -2.640  -1.308  8.774   1.00 0.00 ? 114 ALA A HB2  1  
ATOM   712   H HB3  . ALA A 1 50 ? -4.168  -0.625  9.323   1.00 0.00 ? 114 ALA A HB3  1  
ATOM   713   N N    . GLU A 1 51 ? -2.855  -3.224  6.261   1.00 0.00 ? 115 GLU A N    1  
ATOM   714   C CA   . GLU A 1 51 ? -2.145  -4.383  5.787   1.00 0.00 ? 115 GLU A CA   1  
ATOM   715   C C    . GLU A 1 51 ? -0.731  -4.006  5.412   1.00 0.00 ? 115 GLU A C    1  
ATOM   716   O O    . GLU A 1 51 ? -0.440  -2.830  5.168   1.00 0.00 ? 115 GLU A O    1  
ATOM   717   C CB   . GLU A 1 51 ? -2.845  -5.093  4.604   1.00 0.00 ? 115 GLU A CB   1  
ATOM   718   C CG   . GLU A 1 51 ? -2.721  -4.474  3.219   1.00 0.00 ? 115 GLU A CG   1  
ATOM   719   C CD   . GLU A 1 51 ? -3.125  -5.484  2.144   1.00 0.00 ? 115 GLU A CD   1  
ATOM   720   O OE1  . GLU A 1 51 ? -2.257  -6.306  1.724   1.00 0.00 ? 115 GLU A OE1  1  
ATOM   721   O OE2  . GLU A 1 51 ? -4.305  -5.522  1.739   1.00 0.00 ? 115 GLU A OE2  1  
ATOM   722   H H    . GLU A 1 51 ? -2.660  -2.350  5.858   1.00 0.00 ? 115 GLU A H    1  
ATOM   723   H HA   . GLU A 1 51 ? -2.095  -5.065  6.624   1.00 0.00 ? 115 GLU A HA   1  
ATOM   724   H HB2  . GLU A 1 51 ? -2.468  -6.096  4.509   1.00 0.00 ? 115 GLU A HB2  1  
ATOM   725   H HB3  . GLU A 1 51 ? -3.902  -5.114  4.835   1.00 0.00 ? 115 GLU A HB3  1  
ATOM   726   H HG2  . GLU A 1 51 ? -3.368  -3.612  3.157   1.00 0.00 ? 115 GLU A HG2  1  
ATOM   727   H HG3  . GLU A 1 51 ? -1.695  -4.180  3.052   1.00 0.00 ? 115 GLU A HG3  1  
ATOM   728   N N    . VAL A 1 52 ? 0.146   -4.974  5.403   1.00 0.00 ? 116 VAL A N    1  
ATOM   729   C CA   . VAL A 1 52 ? 1.495   -4.753  4.979   1.00 0.00 ? 116 VAL A CA   1  
ATOM   730   C C    . VAL A 1 52 ? 1.620   -5.228  3.553   1.00 0.00 ? 116 VAL A C    1  
ATOM   731   O O    . VAL A 1 52 ? 1.546   -6.432  3.265   1.00 0.00 ? 116 VAL A O    1  
ATOM   732   C CB   . VAL A 1 52 ? 2.539   -5.470  5.866   1.00 0.00 ? 116 VAL A CB   1  
ATOM   733   C CG1  . VAL A 1 52 ? 3.948   -5.128  5.401   1.00 0.00 ? 116 VAL A CG1  1  
ATOM   734   C CG2  . VAL A 1 52 ? 2.358   -5.095  7.324   1.00 0.00 ? 116 VAL A CG2  1  
ATOM   735   H H    . VAL A 1 52 ? -0.130  -5.875  5.678   1.00 0.00 ? 116 VAL A H    1  
ATOM   736   H HA   . VAL A 1 52 ? 1.673   -3.688  5.001   1.00 0.00 ? 116 VAL A HA   1  
ATOM   737   H HB   . VAL A 1 52 ? 2.396   -6.535  5.759   1.00 0.00 ? 116 VAL A HB   1  
ATOM   738   H HG11 . VAL A 1 52 ? 4.091   -4.058  5.448   1.00 0.00 ? 116 VAL A HG11 1  
ATOM   739   H HG12 . VAL A 1 52 ? 4.672   -5.615  6.034   1.00 0.00 ? 116 VAL A HG12 1  
ATOM   740   H HG13 . VAL A 1 52 ? 4.076   -5.466  4.385   1.00 0.00 ? 116 VAL A HG13 1  
ATOM   741   H HG21 . VAL A 1 52 ? 1.367   -5.377  7.648   1.00 0.00 ? 116 VAL A HG21 1  
ATOM   742   H HG22 . VAL A 1 52 ? 3.094   -5.614  7.921   1.00 0.00 ? 116 VAL A HG22 1  
ATOM   743   H HG23 . VAL A 1 52 ? 2.486   -4.030  7.442   1.00 0.00 ? 116 VAL A HG23 1  
ATOM   744   N N    . THR A 1 53 ? 1.787   -4.305  2.687   1.00 0.00 ? 117 THR A N    1  
ATOM   745   C CA   . THR A 1 53 ? 1.830   -4.568  1.280   1.00 0.00 ? 117 THR A CA   1  
ATOM   746   C C    . THR A 1 53 ? 3.123   -3.959  0.712   1.00 0.00 ? 117 THR A C    1  
ATOM   747   O O    . THR A 1 53 ? 3.599   -2.938  1.228   1.00 0.00 ? 117 THR A O    1  
ATOM   748   C CB   . THR A 1 53 ? 0.538   -4.025  0.563   1.00 0.00 ? 117 THR A CB   1  
ATOM   749   O OG1  . THR A 1 53 ? 0.441   -4.513  -0.784  1.00 0.00 ? 117 THR A OG1  1  
ATOM   750   C CG2  . THR A 1 53 ? 0.503   -2.512  0.553   1.00 0.00 ? 117 THR A CG2  1  
ATOM   751   H H    . THR A 1 53 ? 1.920   -3.386  3.023   1.00 0.00 ? 117 THR A H    1  
ATOM   752   H HA   . THR A 1 53 ? 1.882   -5.642  1.162   1.00 0.00 ? 117 THR A HA   1  
ATOM   753   H HB   . THR A 1 53 ? -0.326  -4.386  1.103   1.00 0.00 ? 117 THR A HB   1  
ATOM   754   H HG1  . THR A 1 53 ? -0.394  -4.993  -0.836  1.00 0.00 ? 117 THR A HG1  1  
ATOM   755   H HG21 . THR A 1 53 ? 1.349   -2.145  -0.010  1.00 0.00 ? 117 THR A HG21 1  
ATOM   756   H HG22 . THR A 1 53 ? -0.410  -2.169  0.088   1.00 0.00 ? 117 THR A HG22 1  
ATOM   757   H HG23 . THR A 1 53 ? 0.560   -2.144  1.565   1.00 0.00 ? 117 THR A HG23 1  
ATOM   758   N N    . PRO A 1 54 ? 3.787   -4.636  -0.240  1.00 0.00 ? 118 PRO A N    1  
ATOM   759   C CA   . PRO A 1 54 ? 5.024   -4.145  -0.824  1.00 0.00 ? 118 PRO A CA   1  
ATOM   760   C C    . PRO A 1 54 ? 4.840   -2.800  -1.508  1.00 0.00 ? 118 PRO A C    1  
ATOM   761   O O    . PRO A 1 54 ? 3.758   -2.494  -2.012  1.00 0.00 ? 118 PRO A O    1  
ATOM   762   C CB   . PRO A 1 54 ? 5.410   -5.214  -1.843  1.00 0.00 ? 118 PRO A CB   1  
ATOM   763   C CG   . PRO A 1 54 ? 4.161   -5.945  -2.121  1.00 0.00 ? 118 PRO A CG   1  
ATOM   764   C CD   . PRO A 1 54 ? 3.361   -5.897  -0.854  1.00 0.00 ? 118 PRO A CD   1  
ATOM   765   H HA   . PRO A 1 54 ? 5.803   -4.055  -0.086  1.00 0.00 ? 118 PRO A HA   1  
ATOM   766   H HB2  . PRO A 1 54 ? 5.796   -4.740  -2.732  1.00 0.00 ? 118 PRO A HB2  1  
ATOM   767   H HB3  . PRO A 1 54 ? 6.160   -5.865  -1.421  1.00 0.00 ? 118 PRO A HB3  1  
ATOM   768   H HG2  . PRO A 1 54 ? 3.627   -5.449  -2.919  1.00 0.00 ? 118 PRO A HG2  1  
ATOM   769   H HG3  . PRO A 1 54 ? 4.383   -6.963  -2.402  1.00 0.00 ? 118 PRO A HG3  1  
ATOM   770   H HD2  . PRO A 1 54 ? 2.306   -5.871  -1.081  1.00 0.00 ? 118 PRO A HD2  1  
ATOM   771   H HD3  . PRO A 1 54 ? 3.587   -6.737  -0.220  1.00 0.00 ? 118 PRO A HD3  1  
ATOM   772   N N    . LEU A 1 55 ? 5.897   -2.022  -1.539  1.00 0.00 ? 119 LEU A N    1  
ATOM   773   C CA   . LEU A 1 55 ? 5.901   -0.688  -2.153  1.00 0.00 ? 119 LEU A CA   1  
ATOM   774   C C    . LEU A 1 55 ? 5.546   -0.765  -3.627  1.00 0.00 ? 119 LEU A C    1  
ATOM   775   O O    . LEU A 1 55 ? 5.020   0.185   -4.205  1.00 0.00 ? 119 LEU A O    1  
ATOM   776   C CB   . LEU A 1 55 ? 7.267   -0.033  -1.974  1.00 0.00 ? 119 LEU A CB   1  
ATOM   777   C CG   . LEU A 1 55 ? 7.735   0.146   -0.528  1.00 0.00 ? 119 LEU A CG   1  
ATOM   778   C CD1  . LEU A 1 55 ? 9.096   0.787   -0.481  1.00 0.00 ? 119 LEU A CD1  1  
ATOM   779   C CD2  . LEU A 1 55 ? 6.745   0.959   0.275   1.00 0.00 ? 119 LEU A CD2  1  
ATOM   780   H H    . LEU A 1 55 ? 6.724   -2.357  -1.123  1.00 0.00 ? 119 LEU A H    1  
ATOM   781   H HA   . LEU A 1 55 ? 5.156   -0.084  -1.660  1.00 0.00 ? 119 LEU A HA   1  
ATOM   782   H HB2  . LEU A 1 55 ? 7.994   -0.647  -2.488  1.00 0.00 ? 119 LEU A HB2  1  
ATOM   783   H HB3  . LEU A 1 55 ? 7.249   0.934   -2.452  1.00 0.00 ? 119 LEU A HB3  1  
ATOM   784   H HG   . LEU A 1 55 ? 7.811   -0.833  -0.080  1.00 0.00 ? 119 LEU A HG   1  
ATOM   785   H HD11 . LEU A 1 55 ? 9.055   1.753   -0.962  1.00 0.00 ? 119 LEU A HD11 1  
ATOM   786   H HD12 . LEU A 1 55 ? 9.409   0.903   0.546   1.00 0.00 ? 119 LEU A HD12 1  
ATOM   787   H HD13 . LEU A 1 55 ? 9.799   0.154   -1.003  1.00 0.00 ? 119 LEU A HD13 1  
ATOM   788   H HD21 . LEU A 1 55 ? 5.802   0.434   0.317   1.00 0.00 ? 119 LEU A HD21 1  
ATOM   789   H HD22 . LEU A 1 55 ? 7.130   1.089   1.276   1.00 0.00 ? 119 LEU A HD22 1  
ATOM   790   H HD23 . LEU A 1 55 ? 6.599   1.925   -0.182  1.00 0.00 ? 119 LEU A HD23 1  
ATOM   791   N N    . LEU A 1 56 ? 5.834   -1.905  -4.216  1.00 0.00 ? 120 LEU A N    1  
ATOM   792   C CA   . LEU A 1 56 ? 5.526   -2.183  -5.606  1.00 0.00 ? 120 LEU A CA   1  
ATOM   793   C C    . LEU A 1 56 ? 4.013   -2.250  -5.819  1.00 0.00 ? 120 LEU A C    1  
ATOM   794   O O    . LEU A 1 56 ? 3.519   -2.001  -6.914  1.00 0.00 ? 120 LEU A O    1  
ATOM   795   C CB   . LEU A 1 56 ? 6.200   -3.497  -6.020  1.00 0.00 ? 120 LEU A CB   1  
ATOM   796   C CG   . LEU A 1 56 ? 5.526   -4.804  -5.601  1.00 0.00 ? 120 LEU A CG   1  
ATOM   797   C CD1  . LEU A 1 56 ? 4.623   -5.296  -6.707  1.00 0.00 ? 120 LEU A CD1  1  
ATOM   798   C CD2  . LEU A 1 56 ? 6.554   -5.844  -5.247  1.00 0.00 ? 120 LEU A CD2  1  
ATOM   799   H H    . LEU A 1 56 ? 6.313   -2.575  -3.680  1.00 0.00 ? 120 LEU A H    1  
ATOM   800   H HA   . LEU A 1 56 ? 5.909   -1.388  -6.222  1.00 0.00 ? 120 LEU A HA   1  
ATOM   801   H HB2  . LEU A 1 56 ? 6.285   -3.503  -7.096  1.00 0.00 ? 120 LEU A HB2  1  
ATOM   802   H HB3  . LEU A 1 56 ? 7.192   -3.491  -5.595  1.00 0.00 ? 120 LEU A HB3  1  
ATOM   803   H HG   . LEU A 1 56 ? 4.888   -4.630  -4.744  1.00 0.00 ? 120 LEU A HG   1  
ATOM   804   H HD11 . LEU A 1 56 ? 3.979   -4.463  -6.959  1.00 0.00 ? 120 LEU A HD11 1  
ATOM   805   H HD12 . LEU A 1 56 ? 5.214   -5.548  -7.573  1.00 0.00 ? 120 LEU A HD12 1  
ATOM   806   H HD13 . LEU A 1 56 ? 4.038   -6.140  -6.375  1.00 0.00 ? 120 LEU A HD13 1  
ATOM   807   H HD21 . LEU A 1 56 ? 7.137   -5.515  -4.401  1.00 0.00 ? 120 LEU A HD21 1  
ATOM   808   H HD22 . LEU A 1 56 ? 6.051   -6.767  -5.000  1.00 0.00 ? 120 LEU A HD22 1  
ATOM   809   H HD23 . LEU A 1 56 ? 7.205   -6.007  -6.093  1.00 0.00 ? 120 LEU A HD23 1  
ATOM   810   N N    . ASN A 1 57 ? 3.293   -2.584  -4.768  1.00 0.00 ? 121 ASN A N    1  
ATOM   811   C CA   . ASN A 1 57 ? 1.839   -2.690  -4.821  1.00 0.00 ? 121 ASN A CA   1  
ATOM   812   C C    . ASN A 1 57 ? 1.191   -1.377  -4.466  1.00 0.00 ? 121 ASN A C    1  
ATOM   813   O O    . ASN A 1 57 ? -0.038  -1.257  -4.467  1.00 0.00 ? 121 ASN A O    1  
ATOM   814   C CB   . ASN A 1 57 ? 1.286   -3.801  -3.904  1.00 0.00 ? 121 ASN A CB   1  
ATOM   815   C CG   . ASN A 1 57 ? 1.451   -5.203  -4.442  1.00 0.00 ? 121 ASN A CG   1  
ATOM   816   O OD1  . ASN A 1 57 ? 1.570   -5.410  -5.634  1.00 0.00 ? 121 ASN A OD1  1  
ATOM   817   N ND2  . ASN A 1 57 ? 1.369   -6.174  -3.583  1.00 0.00 ? 121 ASN A ND2  1  
ATOM   818   H H    . ASN A 1 57 ? 3.753   -2.744  -3.915  1.00 0.00 ? 121 ASN A H    1  
ATOM   819   H HA   . ASN A 1 57 ? 1.577   -2.925  -5.841  1.00 0.00 ? 121 ASN A HA   1  
ATOM   820   H HB2  . ASN A 1 57 ? 1.819   -3.758  -2.966  1.00 0.00 ? 121 ASN A HB2  1  
ATOM   821   H HB3  . ASN A 1 57 ? 0.244   -3.636  -3.700  1.00 0.00 ? 121 ASN A HB3  1  
ATOM   822   H HD21 . ASN A 1 57 ? 1.202   -5.957  -2.639  1.00 0.00 ? 121 ASN A HD21 1  
ATOM   823   H HD22 . ASN A 1 57 ? 1.472   -7.094  -3.905  1.00 0.00 ? 121 ASN A HD22 1  
ATOM   824   N N    . LEU A 1 58 ? 2.000   -0.399  -4.151  1.00 0.00 ? 122 LEU A N    1  
ATOM   825   C CA   . LEU A 1 58 ? 1.495   0.894   -3.833  1.00 0.00 ? 122 LEU A CA   1  
ATOM   826   C C    . LEU A 1 58 ? 1.486   1.749   -5.072  1.00 0.00 ? 122 LEU A C    1  
ATOM   827   O O    . LEU A 1 58 ? 2.476   1.819   -5.811  1.00 0.00 ? 122 LEU A O    1  
ATOM   828   C CB   . LEU A 1 58 ? 2.320   1.533   -2.724  1.00 0.00 ? 122 LEU A CB   1  
ATOM   829   C CG   . LEU A 1 58 ? 2.289   0.815   -1.386  1.00 0.00 ? 122 LEU A CG   1  
ATOM   830   C CD1  . LEU A 1 58 ? 3.103   1.571   -0.356  1.00 0.00 ? 122 LEU A CD1  1  
ATOM   831   C CD2  . LEU A 1 58 ? 0.859   0.638   -0.914  1.00 0.00 ? 122 LEU A CD2  1  
ATOM   832   H H    . LEU A 1 58 ? 2.971   -0.538  -4.139  1.00 0.00 ? 122 LEU A H    1  
ATOM   833   H HA   . LEU A 1 58 ? 0.478   0.783   -3.494  1.00 0.00 ? 122 LEU A HA   1  
ATOM   834   H HB2  . LEU A 1 58 ? 3.353   1.540   -3.046  1.00 0.00 ? 122 LEU A HB2  1  
ATOM   835   H HB3  . LEU A 1 58 ? 1.986   2.549   -2.576  1.00 0.00 ? 122 LEU A HB3  1  
ATOM   836   H HG   . LEU A 1 58 ? 2.725   -0.165  -1.517  1.00 0.00 ? 122 LEU A HG   1  
ATOM   837   H HD11 . LEU A 1 58 ? 2.687   2.557   -0.218  1.00 0.00 ? 122 LEU A HD11 1  
ATOM   838   H HD12 . LEU A 1 58 ? 3.076   1.036   0.582   1.00 0.00 ? 122 LEU A HD12 1  
ATOM   839   H HD13 . LEU A 1 58 ? 4.124   1.666   -0.694  1.00 0.00 ? 122 LEU A HD13 1  
ATOM   840   H HD21 . LEU A 1 58 ? 0.313   0.036   -1.624  1.00 0.00 ? 122 LEU A HD21 1  
ATOM   841   H HD22 . LEU A 1 58 ? 0.854   0.147   0.048   1.00 0.00 ? 122 LEU A HD22 1  
ATOM   842   H HD23 . LEU A 1 58 ? 0.388   1.608   -0.831  1.00 0.00 ? 122 LEU A HD23 1  
ATOM   843   N N    . LYS A 1 59 ? 0.379   2.379   -5.308  1.00 0.00 ? 123 LYS A N    1  
ATOM   844   C CA   . LYS A 1 59 ? 0.199   3.196   -6.479  1.00 0.00 ? 123 LYS A CA   1  
ATOM   845   C C    . LYS A 1 59 ? 0.048   4.644   -6.072  1.00 0.00 ? 123 LYS A C    1  
ATOM   846   O O    . LYS A 1 59 ? -0.383  4.933   -4.944  1.00 0.00 ? 123 LYS A O    1  
ATOM   847   C CB   . LYS A 1 59 ? -1.046  2.760   -7.251  1.00 0.00 ? 123 LYS A CB   1  
ATOM   848   C CG   . LYS A 1 59 ? -1.130  1.289   -7.553  1.00 0.00 ? 123 LYS A CG   1  
ATOM   849   C CD   . LYS A 1 59 ? -2.344  0.992   -8.401  1.00 0.00 ? 123 LYS A CD   1  
ATOM   850   C CE   . LYS A 1 59 ? -2.503  -0.499  -8.681  1.00 0.00 ? 123 LYS A CE   1  
ATOM   851   N NZ   . LYS A 1 59 ? -1.346  -1.069  -9.401  1.00 0.00 ? 123 LYS A NZ   1  
ATOM   852   H H    . LYS A 1 59 ? -0.354  2.274   -4.660  1.00 0.00 ? 123 LYS A H    1  
ATOM   853   H HA   . LYS A 1 59 ? 1.063   3.100   -7.115  1.00 0.00 ? 123 LYS A HA   1  
ATOM   854   H HB2  . LYS A 1 59 ? -1.920  3.038   -6.687  1.00 0.00 ? 123 LYS A HB2  1  
ATOM   855   H HB3  . LYS A 1 59 ? -1.071  3.293   -8.190  1.00 0.00 ? 123 LYS A HB3  1  
ATOM   856   H HG2  . LYS A 1 59 ? -0.238  0.994   -8.084  1.00 0.00 ? 123 LYS A HG2  1  
ATOM   857   H HG3  . LYS A 1 59 ? -1.208  0.760   -6.615  1.00 0.00 ? 123 LYS A HG3  1  
ATOM   858   H HD2  . LYS A 1 59 ? -3.222  1.363   -7.892  1.00 0.00 ? 123 LYS A HD2  1  
ATOM   859   H HD3  . LYS A 1 59 ? -2.216  1.523   -9.333  1.00 0.00 ? 123 LYS A HD3  1  
ATOM   860   H HE2  . LYS A 1 59 ? -2.614  -1.017  -7.740  1.00 0.00 ? 123 LYS A HE2  1  
ATOM   861   H HE3  . LYS A 1 59 ? -3.395  -0.645  -9.273  1.00 0.00 ? 123 LYS A HE3  1  
ATOM   862   H HZ1  . LYS A 1 59 ? -0.469  -0.996  -8.848  1.00 0.00 ? 123 LYS A HZ1  1  
ATOM   863   H HZ2  . LYS A 1 59 ? -1.507  -2.080  -9.591  1.00 0.00 ? 123 LYS A HZ2  1  
ATOM   864   H HZ3  . LYS A 1 59 ? -1.196  -0.608  -10.320 1.00 0.00 ? 123 LYS A HZ3  1  
ATOM   865   N N    . PRO A 1 60 ? 0.385   5.576   -6.970  1.00 0.00 ? 124 PRO A N    1  
ATOM   866   C CA   . PRO A 1 60 ? 0.262   6.994   -6.704  1.00 0.00 ? 124 PRO A CA   1  
ATOM   867   C C    . PRO A 1 60 ? -1.193  7.421   -6.705  1.00 0.00 ? 124 PRO A C    1  
ATOM   868   O O    . PRO A 1 60 ? -2.027  6.879   -7.458  1.00 0.00 ? 124 PRO A O    1  
ATOM   869   C CB   . PRO A 1 60 ? 1.026   7.655   -7.850  1.00 0.00 ? 124 PRO A CB   1  
ATOM   870   C CG   . PRO A 1 60 ? 0.973   6.670   -8.967  1.00 0.00 ? 124 PRO A CG   1  
ATOM   871   C CD   . PRO A 1 60 ? 0.903   5.310   -8.331  1.00 0.00 ? 124 PRO A CD   1  
ATOM   872   H HA   . PRO A 1 60 ? 0.692   7.273   -5.755  1.00 0.00 ? 124 PRO A HA   1  
ATOM   873   H HB2  . PRO A 1 60 ? 0.544   8.583   -8.116  1.00 0.00 ? 124 PRO A HB2  1  
ATOM   874   H HB3  . PRO A 1 60 ? 2.044   7.847   -7.544  1.00 0.00 ? 124 PRO A HB3  1  
ATOM   875   H HG2  . PRO A 1 60 ? 0.096   6.846   -9.572  1.00 0.00 ? 124 PRO A HG2  1  
ATOM   876   H HG3  . PRO A 1 60 ? 1.865   6.754   -9.567  1.00 0.00 ? 124 PRO A HG3  1  
ATOM   877   H HD2  . PRO A 1 60 ? 0.209   4.683   -8.871  1.00 0.00 ? 124 PRO A HD2  1  
ATOM   878   H HD3  . PRO A 1 60 ? 1.865   4.824   -8.285  1.00 0.00 ? 124 PRO A HD3  1  
ATOM   879   N N    . VAL A 1 61 ? -1.500  8.355   -5.872  1.00 0.00 ? 125 VAL A N    1  
ATOM   880   C CA   . VAL A 1 61 ? -2.847  8.843   -5.737  1.00 0.00 ? 125 VAL A CA   1  
ATOM   881   C C    . VAL A 1 61 ? -3.072  10.055  -6.606  1.00 0.00 ? 125 VAL A C    1  
ATOM   882   O O    . VAL A 1 61 ? -2.151  10.541  -7.293  1.00 0.00 ? 125 VAL A O    1  
ATOM   883   C CB   . VAL A 1 61 ? -3.150  9.238   -4.281  1.00 0.00 ? 125 VAL A CB   1  
ATOM   884   C CG1  . VAL A 1 61 ? -3.151  8.026   -3.399  1.00 0.00 ? 125 VAL A CG1  1  
ATOM   885   C CG2  . VAL A 1 61 ? -2.123  10.233  -3.793  1.00 0.00 ? 125 VAL A CG2  1  
ATOM   886   H H    . VAL A 1 61 ? -0.788  8.759   -5.330  1.00 0.00 ? 125 VAL A H    1  
ATOM   887   H HA   . VAL A 1 61 ? -3.516  8.041   -6.012  1.00 0.00 ? 125 VAL A HA   1  
ATOM   888   H HB   . VAL A 1 61 ? -4.122  9.706   -4.236  1.00 0.00 ? 125 VAL A HB   1  
ATOM   889   H HG11 . VAL A 1 61 ? -2.222  7.497   -3.545  1.00 0.00 ? 125 VAL A HG11 1  
ATOM   890   H HG12 . VAL A 1 61 ? -3.243  8.321   -2.363  1.00 0.00 ? 125 VAL A HG12 1  
ATOM   891   H HG13 . VAL A 1 61 ? -3.974  7.382   -3.668  1.00 0.00 ? 125 VAL A HG13 1  
ATOM   892   H HG21 . VAL A 1 61 ? -2.145  11.114  -4.416  1.00 0.00 ? 125 VAL A HG21 1  
ATOM   893   H HG22 . VAL A 1 61 ? -2.327  10.509  -2.771  1.00 0.00 ? 125 VAL A HG22 1  
ATOM   894   H HG23 . VAL A 1 61 ? -1.146  9.777   -3.847  1.00 0.00 ? 125 VAL A HG23 1  
ATOM   895   N N    . GLU A 1 62 ? -4.267  10.530  -6.581  1.00 0.00 ? 126 GLU A N    1  
ATOM   896   C CA   . GLU A 1 62 ? -4.639  11.733  -7.240  1.00 0.00 ? 126 GLU A CA   1  
ATOM   897   C C    . GLU A 1 62 ? -4.871  12.784  -6.169  1.00 0.00 ? 126 GLU A C    1  
ATOM   898   O O    . GLU A 1 62 ? -5.277  12.437  -5.046  1.00 0.00 ? 126 GLU A O    1  
ATOM   899   C CB   . GLU A 1 62 ? -5.917  11.536  -8.098  1.00 0.00 ? 126 GLU A CB   1  
ATOM   900   C CG   . GLU A 1 62 ? -7.190  11.131  -7.334  1.00 0.00 ? 126 GLU A CG   1  
ATOM   901   C CD   . GLU A 1 62 ? -7.142  9.743   -6.739  1.00 0.00 ? 126 GLU A CD   1  
ATOM   902   O OE1  . GLU A 1 62 ? -6.611  9.580   -5.623  1.00 0.00 ? 126 GLU A OE1  1  
ATOM   903   O OE2  . GLU A 1 62 ? -7.643  8.782   -7.376  1.00 0.00 ? 126 GLU A OE2  1  
ATOM   904   H H    . GLU A 1 62 ? -4.976  10.062  -6.074  1.00 0.00 ? 126 GLU A H    1  
ATOM   905   H HA   . GLU A 1 62 ? -3.821  12.040  -7.874  1.00 0.00 ? 126 GLU A HA   1  
ATOM   906   H HB2  . GLU A 1 62 ? -6.132  12.462  -8.609  1.00 0.00 ? 126 GLU A HB2  1  
ATOM   907   H HB3  . GLU A 1 62 ? -5.712  10.777  -8.839  1.00 0.00 ? 126 GLU A HB3  1  
ATOM   908   H HG2  . GLU A 1 62 ? -7.340  11.832  -6.527  1.00 0.00 ? 126 GLU A HG2  1  
ATOM   909   H HG3  . GLU A 1 62 ? -8.029  11.193  -8.010  1.00 0.00 ? 126 GLU A HG3  1  
ATOM   910   N N    . GLU A 1 63 ? -4.552  14.032  -6.479  1.00 0.00 ? 127 GLU A N    1  
ATOM   911   C CA   . GLU A 1 63 ? -4.779  15.174  -5.574  1.00 0.00 ? 127 GLU A CA   1  
ATOM   912   C C    . GLU A 1 63 ? -3.961  15.050  -4.264  1.00 0.00 ? 127 GLU A C    1  
ATOM   913   O O    . GLU A 1 63 ? -4.336  15.617  -3.230  1.00 0.00 ? 127 GLU A O    1  
ATOM   914   C CB   . GLU A 1 63 ? -6.286  15.312  -5.256  1.00 0.00 ? 127 GLU A CB   1  
ATOM   915   C CG   . GLU A 1 63 ? -7.176  15.470  -6.482  1.00 0.00 ? 127 GLU A CG   1  
ATOM   916   C CD   . GLU A 1 63 ? -6.938  16.753  -7.229  1.00 0.00 ? 127 GLU A CD   1  
ATOM   917   O OE1  . GLU A 1 63 ? -5.951  16.852  -7.986  1.00 0.00 ? 127 GLU A OE1  1  
ATOM   918   O OE2  . GLU A 1 63 ? -7.738  17.691  -7.076  1.00 0.00 ? 127 GLU A OE2  1  
ATOM   919   H H    . GLU A 1 63 ? -4.146  14.208  -7.357  1.00 0.00 ? 127 GLU A H    1  
ATOM   920   H HA   . GLU A 1 63 ? -4.455  16.062  -6.095  1.00 0.00 ? 127 GLU A HA   1  
ATOM   921   H HB2  . GLU A 1 63 ? -6.608  14.428  -4.727  1.00 0.00 ? 127 GLU A HB2  1  
ATOM   922   H HB3  . GLU A 1 63 ? -6.429  16.172  -4.620  1.00 0.00 ? 127 GLU A HB3  1  
ATOM   923   H HG2  . GLU A 1 63 ? -6.986  14.647  -7.157  1.00 0.00 ? 127 GLU A HG2  1  
ATOM   924   H HG3  . GLU A 1 63 ? -8.209  15.437  -6.166  1.00 0.00 ? 127 GLU A HG3  1  
ATOM   925   N N    . GLY A 1 64 ? -2.852  14.348  -4.310  1.00 0.00 ? 128 GLY A N    1  
ATOM   926   C CA   . GLY A 1 64 ? -2.031  14.205  -3.136  1.00 0.00 ? 128 GLY A CA   1  
ATOM   927   C C    . GLY A 1 64 ? -0.814  13.381  -3.420  1.00 0.00 ? 128 GLY A C    1  
ATOM   928   O O    . GLY A 1 64 ? -0.283  12.731  -2.494  1.00 0.00 ? 128 GLY A O    1  
ATOM   929   O OXT  . GLY A 1 64 ? -0.385  13.343  -4.590  1.00 0.00 ? 128 GLY A OXT  1  
ATOM   930   H H    . GLY A 1 64 ? -2.564  13.917  -5.143  1.00 0.00 ? 128 GLY A H    1  
ATOM   931   H HA2  . GLY A 1 64 ? -1.726  15.184  -2.798  1.00 0.00 ? 128 GLY A HA2  1  
ATOM   932   H HA3  . GLY A 1 64 ? -2.605  13.722  -2.361  1.00 0.00 ? 128 GLY A HA3  1  
HETATM 933   N N    . 2MR B 2 .  ? -17.123 -5.387  -0.244  1.00 0.00 ? 201 2MR A N    1  
HETATM 934   C CA   . 2MR B 2 .  ? -17.134 -4.333  0.755   1.00 0.00 ? 201 2MR A CA   1  
HETATM 935   C CB   . 2MR B 2 .  ? -15.736 -4.148  1.342   1.00 0.00 ? 201 2MR A CB   1  
HETATM 936   C CG   . 2MR B 2 .  ? -15.657 -3.091  2.403   1.00 0.00 ? 201 2MR A CG   1  
HETATM 937   C CD   . 2MR B 2 .  ? -14.272 -2.965  2.960   1.00 0.00 ? 201 2MR A CD   1  
HETATM 938   N NE   . 2MR B 2 .  ? -13.335 -2.527  1.939   1.00 0.00 ? 201 2MR A NE   1  
HETATM 939   C CZ   . 2MR B 2 .  ? -12.090 -2.202  2.159   1.00 0.00 ? 201 2MR A CZ   1  
HETATM 940   N NH1  . 2MR B 2 .  ? -11.615 -2.276  3.444   1.00 0.00 ? 201 2MR A NH1  1  
HETATM 941   C CQ1  . 2MR B 2 .  ? -10.291 -1.982  4.009   1.00 0.00 ? 201 2MR A CQ1  1  
HETATM 942   N NH2  . 2MR B 2 .  ? -11.346 -1.838  1.088   1.00 0.00 ? 201 2MR A NH2  1  
HETATM 943   C CQ2  . 2MR B 2 .  ? -9.953  -1.423  0.984   1.00 0.00 ? 201 2MR A CQ2  1  
HETATM 944   C C    . 2MR B 2 .  ? -17.595 -3.065  0.098   1.00 0.00 ? 201 2MR A C    1  
HETATM 945   O O    . 2MR B 2 .  ? -18.622 -2.500  0.520   1.00 0.00 ? 201 2MR A O    1  
HETATM 946   O OXT  . 2MR B 2 .  ? -16.946 -2.634  -0.869  1.00 0.00 ? 201 2MR A OXT  1  
HETATM 947   H H2   . 2MR B 2 .  ? -16.763 -6.286  0.131   1.00 0.00 ? 201 2MR A H2   1  
HETATM 948   H H    . 2MR B 2 .  ? -18.086 -5.527  -0.611  1.00 0.00 ? 201 2MR A H    1  
HETATM 949   H H3   . 2MR B 2 .  ? -16.529 -5.087  -1.042  1.00 0.00 ? 201 2MR A H3   1  
HETATM 950   H HA   . 2MR B 2 .  ? -17.829 -4.583  1.541   1.00 0.00 ? 201 2MR A HA   1  
HETATM 951   H HB2  . 2MR B 2 .  ? -15.070 -3.844  0.550   1.00 0.00 ? 201 2MR A HB2  1  
HETATM 952   H HB3  . 2MR B 2 .  ? -15.382 -5.074  1.765   1.00 0.00 ? 201 2MR A HB3  1  
HETATM 953   H HG2  . 2MR B 2 .  ? -16.352 -3.325  3.191   1.00 0.00 ? 201 2MR A HG2  1  
HETATM 954   H HG3  . 2MR B 2 .  ? -15.869 -2.156  1.904   1.00 0.00 ? 201 2MR A HG3  1  
HETATM 955   H HD2  . 2MR B 2 .  ? -13.953 -3.923  3.341   1.00 0.00 ? 201 2MR A HD2  1  
HETATM 956   H HD3  . 2MR B 2 .  ? -14.274 -2.233  3.755   1.00 0.00 ? 201 2MR A HD3  1  
HETATM 957   H HE   . 2MR B 2 .  ? -13.696 -2.480  1.025   1.00 0.00 ? 201 2MR A HE   1  
HETATM 958   H HQ11 . 2MR B 2 .  ? -10.096 -0.923  3.924   1.00 0.00 ? 201 2MR A HQ11 1  
HETATM 959   H HQ12 . 2MR B 2 .  ? -10.279 -2.265  5.051   1.00 0.00 ? 201 2MR A HQ12 1  
HETATM 960   H HQ13 . 2MR B 2 .  ? -9.531  -2.535  3.474   1.00 0.00 ? 201 2MR A HQ13 1  
HETATM 961   H HH2  . 2MR B 2 .  ? -11.761 -1.851  0.178   1.00 0.00 ? 201 2MR A HH2  1  
HETATM 962   H HQ21 . 2MR B 2 .  ? -9.312  -2.272  1.174   1.00 0.00 ? 201 2MR A HQ21 1  
HETATM 963   H HQ22 . 2MR B 2 .  ? -9.763  -1.052  -0.011  1.00 0.00 ? 201 2MR A HQ22 1  
HETATM 964   H HQ23 . 2MR B 2 .  ? -9.748  -0.647  1.706   1.00 0.00 ? 201 2MR A HQ23 1  
HETATM 965   H HH1  . 2MR B 2 .  ? -12.232 -2.595  4.167   1.00 0.00 ? 201 2MR A HH1  1  
ATOM   966   N N    . ALA A 1 1  ? 16.331  -2.872  1.185   1.00 0.00 ? 65  ALA A N    2  
ATOM   967   C CA   . ALA A 1 1  ? 15.793  -4.155  0.734   1.00 0.00 ? 65  ALA A CA   2  
ATOM   968   C C    . ALA A 1 1  ? 16.705  -4.731  -0.305  1.00 0.00 ? 65  ALA A C    2  
ATOM   969   O O    . ALA A 1 1  ? 17.407  -3.985  -0.992  1.00 0.00 ? 65  ALA A O    2  
ATOM   970   C CB   . ALA A 1 1  ? 14.402  -3.974  0.134   1.00 0.00 ? 65  ALA A CB   2  
ATOM   971   H H1   . ALA A 1 1  ? 16.397  -2.221  0.378   1.00 0.00 ? 65  ALA A H1   2  
ATOM   972   H H2   . ALA A 1 1  ? 15.737  -2.450  1.927   1.00 0.00 ? 65  ALA A H2   2  
ATOM   973   H H3   . ALA A 1 1  ? 17.295  -3.002  1.550   1.00 0.00 ? 65  ALA A H3   2  
ATOM   974   H HA   . ALA A 1 1  ? 15.720  -4.830  1.573   1.00 0.00 ? 65  ALA A HA   2  
ATOM   975   H HB1  . ALA A 1 1  ? 14.459  -3.325  -0.726  1.00 0.00 ? 65  ALA A HB1  2  
ATOM   976   H HB2  . ALA A 1 1  ? 14.015  -4.937  -0.168  1.00 0.00 ? 65  ALA A HB2  2  
ATOM   977   H HB3  . ALA A 1 1  ? 13.746  -3.540  0.873   1.00 0.00 ? 65  ALA A HB3  2  
ATOM   978   N N    . SER A 1 2  ? 16.711  -6.042  -0.429  1.00 0.00 ? 66  SER A N    2  
ATOM   979   C CA   . SER A 1 2  ? 17.500  -6.683  -1.446  1.00 0.00 ? 66  SER A CA   2  
ATOM   980   C C    . SER A 1 2  ? 16.885  -6.351  -2.796  1.00 0.00 ? 66  SER A C    2  
ATOM   981   O O    . SER A 1 2  ? 17.559  -5.869  -3.711  1.00 0.00 ? 66  SER A O    2  
ATOM   982   C CB   . SER A 1 2  ? 17.492  -8.181  -1.217  1.00 0.00 ? 66  SER A CB   2  
ATOM   983   O OG   . SER A 1 2  ? 17.885  -8.483  0.118   1.00 0.00 ? 66  SER A OG   2  
ATOM   984   H H    . SER A 1 2  ? 16.162  -6.599  0.165   1.00 0.00 ? 66  SER A H    2  
ATOM   985   H HA   . SER A 1 2  ? 18.511  -6.309  -1.398  1.00 0.00 ? 66  SER A HA   2  
ATOM   986   H HB2  . SER A 1 2  ? 16.499  -8.561  -1.412  1.00 0.00 ? 66  SER A HB2  2  
ATOM   987   H HB3  . SER A 1 2  ? 18.184  -8.645  -1.903  1.00 0.00 ? 66  SER A HB3  2  
ATOM   988   H HG   . SER A 1 2  ? 17.952  -7.655  0.615   1.00 0.00 ? 66  SER A HG   2  
ATOM   989   N N    . THR A 1 3  ? 15.601  -6.561  -2.884  1.00 0.00 ? 67  THR A N    2  
ATOM   990   C CA   . THR A 1 3  ? 14.859  -6.259  -4.053  1.00 0.00 ? 67  THR A CA   2  
ATOM   991   C C    . THR A 1 3  ? 14.412  -4.797  -3.959  1.00 0.00 ? 67  THR A C    2  
ATOM   992   O O    . THR A 1 3  ? 13.434  -4.484  -3.266  1.00 0.00 ? 67  THR A O    2  
ATOM   993   C CB   . THR A 1 3  ? 13.626  -7.172  -4.125  1.00 0.00 ? 67  THR A CB   2  
ATOM   994   O OG1  . THR A 1 3  ? 14.014  -8.508  -3.752  1.00 0.00 ? 67  THR A OG1  2  
ATOM   995   C CG2  . THR A 1 3  ? 13.079  -7.204  -5.535  1.00 0.00 ? 67  THR A CG2  2  
ATOM   996   H H    . THR A 1 3  ? 15.114  -6.953  -2.126  1.00 0.00 ? 67  THR A H    2  
ATOM   997   H HA   . THR A 1 3  ? 15.476  -6.414  -4.925  1.00 0.00 ? 67  THR A HA   2  
ATOM   998   H HB   . THR A 1 3  ? 12.867  -6.805  -3.450  1.00 0.00 ? 67  THR A HB   2  
ATOM   999   H HG1  . THR A 1 3  ? 14.509  -8.888  -4.489  1.00 0.00 ? 67  THR A HG1  2  
ATOM   1000  H HG21 . THR A 1 3  ? 13.846  -7.593  -6.188  1.00 0.00 ? 67  THR A HG21 2  
ATOM   1001  H HG22 . THR A 1 3  ? 12.213  -7.845  -5.567  1.00 0.00 ? 67  THR A HG22 2  
ATOM   1002  H HG23 . THR A 1 3  ? 12.812  -6.203  -5.840  1.00 0.00 ? 67  THR A HG23 2  
ATOM   1003  N N    . GLN A 1 4  ? 15.162  -3.906  -4.588  1.00 0.00 ? 68  GLN A N    2  
ATOM   1004  C CA   . GLN A 1 4  ? 14.854  -2.481  -4.527  1.00 0.00 ? 68  GLN A CA   2  
ATOM   1005  C C    . GLN A 1 4  ? 13.653  -2.160  -5.393  1.00 0.00 ? 68  GLN A C    2  
ATOM   1006  O O    . GLN A 1 4  ? 13.665  -2.426  -6.607  1.00 0.00 ? 68  GLN A O    2  
ATOM   1007  C CB   . GLN A 1 4  ? 16.037  -1.623  -4.972  1.00 0.00 ? 68  GLN A CB   2  
ATOM   1008  C CG   . GLN A 1 4  ? 17.280  -1.767  -4.126  1.00 0.00 ? 68  GLN A CG   2  
ATOM   1009  C CD   . GLN A 1 4  ? 18.418  -0.892  -4.622  1.00 0.00 ? 68  GLN A CD   2  
ATOM   1010  O OE1  . GLN A 1 4  ? 18.576  0.257   -4.201  1.00 0.00 ? 68  GLN A OE1  2  
ATOM   1011  N NE2  . GLN A 1 4  ? 19.195  -1.407  -5.525  1.00 0.00 ? 68  GLN A NE2  2  
ATOM   1012  H H    . GLN A 1 4  ? 15.933  -4.220  -5.110  1.00 0.00 ? 68  GLN A H    2  
ATOM   1013  H HA   . GLN A 1 4  ? 14.619  -2.247  -3.499  1.00 0.00 ? 68  GLN A HA   2  
ATOM   1014  H HB2  . GLN A 1 4  ? 16.288  -1.887  -5.988  1.00 0.00 ? 68  GLN A HB2  2  
ATOM   1015  H HB3  . GLN A 1 4  ? 15.733  -0.586  -4.954  1.00 0.00 ? 68  GLN A HB3  2  
ATOM   1016  H HG2  . GLN A 1 4  ? 17.045  -1.489  -3.110  1.00 0.00 ? 68  GLN A HG2  2  
ATOM   1017  H HG3  . GLN A 1 4  ? 17.599  -2.798  -4.150  1.00 0.00 ? 68  GLN A HG3  2  
ATOM   1018  H HE21 . GLN A 1 4  ? 19.001  -2.320  -5.829  1.00 0.00 ? 68  GLN A HE21 2  
ATOM   1019  H HE22 . GLN A 1 4  ? 19.953  -0.887  -5.863  1.00 0.00 ? 68  GLN A HE22 2  
ATOM   1020  N N    . PRO A 1 5  ? 12.594  -1.621  -4.801  1.00 0.00 ? 69  PRO A N    2  
ATOM   1021  C CA   . PRO A 1 5  ? 11.419  -1.228  -5.538  1.00 0.00 ? 69  PRO A CA   2  
ATOM   1022  C C    . PRO A 1 5  ? 11.603  0.139   -6.199  1.00 0.00 ? 69  PRO A C    2  
ATOM   1023  O O    . PRO A 1 5  ? 12.382  0.982   -5.724  1.00 0.00 ? 69  PRO A O    2  
ATOM   1024  C CB   . PRO A 1 5  ? 10.323  -1.176  -4.477  1.00 0.00 ? 69  PRO A CB   2  
ATOM   1025  C CG   . PRO A 1 5  ? 11.032  -0.884  -3.195  1.00 0.00 ? 69  PRO A CG   2  
ATOM   1026  C CD   . PRO A 1 5  ? 12.454  -1.361  -3.352  1.00 0.00 ? 69  PRO A CD   2  
ATOM   1027  H HA   . PRO A 1 5  ? 11.171  -1.961  -6.291  1.00 0.00 ? 69  PRO A HA   2  
ATOM   1028  H HB2  . PRO A 1 5  ? 9.618   -0.397  -4.730  1.00 0.00 ? 69  PRO A HB2  2  
ATOM   1029  H HB3  . PRO A 1 5  ? 9.817   -2.129  -4.440  1.00 0.00 ? 69  PRO A HB3  2  
ATOM   1030  H HG2  . PRO A 1 5  ? 11.016  0.179   -3.005  1.00 0.00 ? 69  PRO A HG2  2  
ATOM   1031  H HG3  . PRO A 1 5  ? 10.548  -1.413  -2.387  1.00 0.00 ? 69  PRO A HG3  2  
ATOM   1032  H HD2  . PRO A 1 5  ? 13.146  -0.596  -3.035  1.00 0.00 ? 69  PRO A HD2  2  
ATOM   1033  H HD3  . PRO A 1 5  ? 12.607  -2.267  -2.784  1.00 0.00 ? 69  PRO A HD3  2  
ATOM   1034  N N    . THR A 1 6  ? 10.906  0.347   -7.278  1.00 0.00 ? 70  THR A N    2  
ATOM   1035  C CA   . THR A 1 6  ? 10.958  1.563   -8.019  1.00 0.00 ? 70  THR A CA   2  
ATOM   1036  C C    . THR A 1 6  ? 10.205  2.678   -7.270  1.00 0.00 ? 70  THR A C    2  
ATOM   1037  O O    . THR A 1 6  ? 10.558  3.861   -7.350  1.00 0.00 ? 70  THR A O    2  
ATOM   1038  C CB   . THR A 1 6  ? 10.317  1.314   -9.392  1.00 0.00 ? 70  THR A CB   2  
ATOM   1039  O OG1  . THR A 1 6  ? 10.980  0.197   -10.015 1.00 0.00 ? 70  THR A OG1  2  
ATOM   1040  C CG2  . THR A 1 6  ? 10.435  2.530   -10.277 1.00 0.00 ? 70  THR A CG2  2  
ATOM   1041  H H    . THR A 1 6  ? 10.315  -0.346  -7.641  1.00 0.00 ? 70  THR A H    2  
ATOM   1042  H HA   . THR A 1 6  ? 11.988  1.845   -8.168  1.00 0.00 ? 70  THR A HA   2  
ATOM   1043  H HB   . THR A 1 6  ? 9.275   1.068   -9.244  1.00 0.00 ? 70  THR A HB   2  
ATOM   1044  H HG1  . THR A 1 6  ? 11.845  0.515   -10.302 1.00 0.00 ? 70  THR A HG1  2  
ATOM   1045  H HG21 . THR A 1 6  ? 11.480  2.762   -10.423 1.00 0.00 ? 70  THR A HG21 2  
ATOM   1046  H HG22 . THR A 1 6  ? 9.959   2.330   -11.225 1.00 0.00 ? 70  THR A HG22 2  
ATOM   1047  H HG23 . THR A 1 6  ? 9.939   3.351   -9.780  1.00 0.00 ? 70  THR A HG23 2  
ATOM   1048  N N    . HIS A 1 7  ? 9.201   2.291   -6.527  1.00 0.00 ? 71  HIS A N    2  
ATOM   1049  C CA   . HIS A 1 7  ? 8.407   3.241   -5.797  1.00 0.00 ? 71  HIS A CA   2  
ATOM   1050  C C    . HIS A 1 7  ? 9.096   3.659   -4.510  1.00 0.00 ? 71  HIS A C    2  
ATOM   1051  O O    . HIS A 1 7  ? 9.590   2.819   -3.745  1.00 0.00 ? 71  HIS A O    2  
ATOM   1052  C CB   . HIS A 1 7  ? 7.017   2.693   -5.494  1.00 0.00 ? 71  HIS A CB   2  
ATOM   1053  C CG   . HIS A 1 7  ? 6.185   2.376   -6.696  1.00 0.00 ? 71  HIS A CG   2  
ATOM   1054  N ND1  . HIS A 1 7  ? 5.308   1.324   -6.757  1.00 0.00 ? 71  HIS A ND1  2  
ATOM   1055  C CD2  . HIS A 1 7  ? 6.098   3.000   -7.885  1.00 0.00 ? 71  HIS A CD2  2  
ATOM   1056  C CE1  . HIS A 1 7  ? 4.733   1.326   -7.952  1.00 0.00 ? 71  HIS A CE1  2  
ATOM   1057  N NE2  . HIS A 1 7  ? 5.177   2.329   -8.686  1.00 0.00 ? 71  HIS A NE2  2  
ATOM   1058  H H    . HIS A 1 7  ? 8.989   1.335   -6.470  1.00 0.00 ? 71  HIS A H    2  
ATOM   1059  H HA   . HIS A 1 7  ? 8.301   4.113   -6.426  1.00 0.00 ? 71  HIS A HA   2  
ATOM   1060  H HB2  . HIS A 1 7  ? 7.119   1.783   -4.923  1.00 0.00 ? 71  HIS A HB2  2  
ATOM   1061  H HB3  . HIS A 1 7  ? 6.484   3.424   -4.903  1.00 0.00 ? 71  HIS A HB3  2  
ATOM   1062  H HD1  . HIS A 1 7  ? 5.101   0.714   -6.015  1.00 0.00 ? 71  HIS A HD1  2  
ATOM   1063  H HD2  . HIS A 1 7  ? 6.644   3.887   -8.164  1.00 0.00 ? 71  HIS A HD2  2  
ATOM   1064  H HE1  . HIS A 1 7  ? 3.999   0.605   -8.275  1.00 0.00 ? 71  HIS A HE1  2  
ATOM   1065  N N    . SER A 1 8  ? 9.139   4.937   -4.294  1.00 0.00 ? 72  SER A N    2  
ATOM   1066  C CA   . SER A 1 8  ? 9.721   5.514   -3.120  1.00 0.00 ? 72  SER A CA   2  
ATOM   1067  C C    . SER A 1 8  ? 8.620   6.151   -2.276  1.00 0.00 ? 72  SER A C    2  
ATOM   1068  O O    . SER A 1 8  ? 7.968   7.104   -2.707  1.00 0.00 ? 72  SER A O    2  
ATOM   1069  C CB   . SER A 1 8  ? 10.804  6.514   -3.536  1.00 0.00 ? 72  SER A CB   2  
ATOM   1070  O OG   . SER A 1 8  ? 10.354  7.328   -4.628  1.00 0.00 ? 72  SER A OG   2  
ATOM   1071  H H    . SER A 1 8  ? 8.739   5.549   -4.949  1.00 0.00 ? 72  SER A H    2  
ATOM   1072  H HA   . SER A 1 8  ? 10.171  4.714   -2.552  1.00 0.00 ? 72  SER A HA   2  
ATOM   1073  H HB2  . SER A 1 8  ? 11.043  7.154   -2.699  1.00 0.00 ? 72  SER A HB2  2  
ATOM   1074  H HB3  . SER A 1 8  ? 11.689  5.978   -3.844  1.00 0.00 ? 72  SER A HB3  2  
ATOM   1075  H HG   . SER A 1 8  ? 9.550   7.786   -4.342  1.00 0.00 ? 72  SER A HG   2  
ATOM   1076  N N    . TRP A 1 9  ? 8.392   5.600   -1.111  1.00 0.00 ? 73  TRP A N    2  
ATOM   1077  C CA   . TRP A 1 9  ? 7.308   6.018   -0.247  1.00 0.00 ? 73  TRP A CA   2  
ATOM   1078  C C    . TRP A 1 9  ? 7.797   6.419   1.116   1.00 0.00 ? 73  TRP A C    2  
ATOM   1079  O O    . TRP A 1 9  ? 8.845   5.951   1.559   1.00 0.00 ? 73  TRP A O    2  
ATOM   1080  C CB   . TRP A 1 9  ? 6.303   4.896   -0.113  1.00 0.00 ? 73  TRP A CB   2  
ATOM   1081  C CG   . TRP A 1 9  ? 5.584   4.603   -1.382  1.00 0.00 ? 73  TRP A CG   2  
ATOM   1082  C CD1  . TRP A 1 9  ? 5.793   3.554   -2.209  1.00 0.00 ? 73  TRP A CD1  2  
ATOM   1083  C CD2  . TRP A 1 9  ? 4.558   5.392   -1.984  1.00 0.00 ? 73  TRP A CD2  2  
ATOM   1084  N NE1  . TRP A 1 9  ? 4.947   3.623   -3.278  1.00 0.00 ? 73  TRP A NE1  2  
ATOM   1085  C CE2  . TRP A 1 9  ? 4.183   4.741   -3.165  1.00 0.00 ? 73  TRP A CE2  2  
ATOM   1086  C CE3  . TRP A 1 9  ? 3.912   6.583   -1.636  1.00 0.00 ? 73  TRP A CE3  2  
ATOM   1087  C CZ2  . TRP A 1 9  ? 3.203   5.226   -3.998  1.00 0.00 ? 73  TRP A CZ2  2  
ATOM   1088  C CZ3  . TRP A 1 9  ? 2.933   7.066   -2.472  1.00 0.00 ? 73  TRP A CZ3  2  
ATOM   1089  C CH2  . TRP A 1 9  ? 2.590   6.384   -3.640  1.00 0.00 ? 73  TRP A CH2  2  
ATOM   1090  H H    . TRP A 1 9  ? 8.972   4.881   -0.782  1.00 0.00 ? 73  TRP A H    2  
ATOM   1091  H HA   . TRP A 1 9  ? 6.809   6.856   -0.710  1.00 0.00 ? 73  TRP A HA   2  
ATOM   1092  H HB2  . TRP A 1 9  ? 6.848   4.006   0.168   1.00 0.00 ? 73  TRP A HB2  2  
ATOM   1093  H HB3  . TRP A 1 9  ? 5.591   5.124   0.664   1.00 0.00 ? 73  TRP A HB3  2  
ATOM   1094  H HD1  . TRP A 1 9  ? 6.522   2.780   -2.027  1.00 0.00 ? 73  TRP A HD1  2  
ATOM   1095  H HE1  . TRP A 1 9  ? 4.891   2.976   -4.016  1.00 0.00 ? 73  TRP A HE1  2  
ATOM   1096  H HE3  . TRP A 1 9  ? 4.171   7.118   -0.735  1.00 0.00 ? 73  TRP A HE3  2  
ATOM   1097  H HZ2  . TRP A 1 9  ? 2.921   4.711   -4.904  1.00 0.00 ? 73  TRP A HZ2  2  
ATOM   1098  H HZ3  . TRP A 1 9  ? 2.419   7.984   -2.227  1.00 0.00 ? 73  TRP A HZ3  2  
ATOM   1099  H HH2  . TRP A 1 9  ? 1.817   6.776   -4.280  1.00 0.00 ? 73  TRP A HH2  2  
ATOM   1100  N N    . LYS A 1 10 ? 7.066   7.308   1.764   1.00 0.00 ? 74  LYS A N    2  
ATOM   1101  C CA   . LYS A 1 10 ? 7.383   7.710   3.110   1.00 0.00 ? 74  LYS A CA   2  
ATOM   1102  C C    . LYS A 1 10 ? 6.142   7.672   3.995   1.00 0.00 ? 74  LYS A C    2  
ATOM   1103  O O    . LYS A 1 10 ? 5.009   7.647   3.502   1.00 0.00 ? 74  LYS A O    2  
ATOM   1104  C CB   . LYS A 1 10 ? 8.017   9.090   3.161   1.00 0.00 ? 74  LYS A CB   2  
ATOM   1105  C CG   . LYS A 1 10 ? 7.159   10.207  2.588   1.00 0.00 ? 74  LYS A CG   2  
ATOM   1106  C CD   . LYS A 1 10 ? 7.722   11.572  2.959   1.00 0.00 ? 74  LYS A CD   2  
ATOM   1107  C CE   . LYS A 1 10 ? 7.461   11.881  4.431   1.00 0.00 ? 74  LYS A CE   2  
ATOM   1108  N NZ   . LYS A 1 10 ? 6.040   12.170  4.677   1.00 0.00 ? 74  LYS A NZ   2  
ATOM   1109  H H    . LYS A 1 10 ? 6.274   7.709   1.346   1.00 0.00 ? 74  LYS A H    2  
ATOM   1110  H HA   . LYS A 1 10 ? 8.089   6.988   3.492   1.00 0.00 ? 74  LYS A HA   2  
ATOM   1111  H HB2  . LYS A 1 10 ? 8.270   9.325   4.184   1.00 0.00 ? 74  LYS A HB2  2  
ATOM   1112  H HB3  . LYS A 1 10 ? 8.926   9.040   2.581   1.00 0.00 ? 74  LYS A HB3  2  
ATOM   1113  H HG2  . LYS A 1 10 ? 7.090   10.108  1.516   1.00 0.00 ? 74  LYS A HG2  2  
ATOM   1114  H HG3  . LYS A 1 10 ? 6.171   10.111  3.016   1.00 0.00 ? 74  LYS A HG3  2  
ATOM   1115  H HD2  . LYS A 1 10 ? 8.786   11.579  2.775   1.00 0.00 ? 74  LYS A HD2  2  
ATOM   1116  H HD3  . LYS A 1 10 ? 7.244   12.327  2.352   1.00 0.00 ? 74  LYS A HD3  2  
ATOM   1117  H HE2  . LYS A 1 10 ? 7.720   11.027  5.038   1.00 0.00 ? 74  LYS A HE2  2  
ATOM   1118  H HE3  . LYS A 1 10 ? 8.049   12.735  4.732   1.00 0.00 ? 74  LYS A HE3  2  
ATOM   1119  H HZ1  . LYS A 1 10 ? 5.408   11.579  4.087   1.00 0.00 ? 74  LYS A HZ1  2  
ATOM   1120  H HZ2  . LYS A 1 10 ? 5.795   11.962  5.667   1.00 0.00 ? 74  LYS A HZ2  2  
ATOM   1121  H HZ3  . LYS A 1 10 ? 5.804   13.165  4.506   1.00 0.00 ? 74  LYS A HZ3  2  
ATOM   1122  N N    . VAL A 1 11 ? 6.375   7.645   5.284   1.00 0.00 ? 75  VAL A N    2  
ATOM   1123  C CA   . VAL A 1 11 ? 5.328   7.633   6.296   1.00 0.00 ? 75  VAL A CA   2  
ATOM   1124  C C    . VAL A 1 11 ? 4.485   8.919   6.260   1.00 0.00 ? 75  VAL A C    2  
ATOM   1125  O O    . VAL A 1 11 ? 5.016   10.013  6.055   1.00 0.00 ? 75  VAL A O    2  
ATOM   1126  C CB   . VAL A 1 11 ? 5.961   7.444   7.702   1.00 0.00 ? 75  VAL A CB   2  
ATOM   1127  C CG1  . VAL A 1 11 ? 4.963   7.673   8.822   1.00 0.00 ? 75  VAL A CG1  2  
ATOM   1128  C CG2  . VAL A 1 11 ? 6.564   6.059   7.812   1.00 0.00 ? 75  VAL A CG2  2  
ATOM   1129  H H    . VAL A 1 11 ? 7.309   7.642   5.586   1.00 0.00 ? 75  VAL A H    2  
ATOM   1130  H HA   . VAL A 1 11 ? 4.690   6.783   6.099   1.00 0.00 ? 75  VAL A HA   2  
ATOM   1131  H HB   . VAL A 1 11 ? 6.760   8.160   7.810   1.00 0.00 ? 75  VAL A HB   2  
ATOM   1132  H HG11 . VAL A 1 11 ? 4.132   6.992   8.722   1.00 0.00 ? 75  VAL A HG11 2  
ATOM   1133  H HG12 . VAL A 1 11 ? 5.451   7.531   9.775   1.00 0.00 ? 75  VAL A HG12 2  
ATOM   1134  H HG13 . VAL A 1 11 ? 4.610   8.691   8.741   1.00 0.00 ? 75  VAL A HG13 2  
ATOM   1135  H HG21 . VAL A 1 11 ? 7.341   5.942   7.071   1.00 0.00 ? 75  VAL A HG21 2  
ATOM   1136  H HG22 . VAL A 1 11 ? 6.982   5.929   8.798   1.00 0.00 ? 75  VAL A HG22 2  
ATOM   1137  H HG23 . VAL A 1 11 ? 5.795   5.318   7.648   1.00 0.00 ? 75  VAL A HG23 2  
ATOM   1138  N N    . GLY A 1 12 ? 3.173   8.768   6.423   1.00 0.00 ? 76  GLY A N    2  
ATOM   1139  C CA   . GLY A 1 12 ? 2.278   9.910   6.485   1.00 0.00 ? 76  GLY A CA   2  
ATOM   1140  C C    . GLY A 1 12 ? 1.772   10.309  5.127   1.00 0.00 ? 76  GLY A C    2  
ATOM   1141  O O    . GLY A 1 12 ? 1.095   11.338  4.968   1.00 0.00 ? 76  GLY A O    2  
ATOM   1142  H H    . GLY A 1 12 ? 2.794   7.863   6.515   1.00 0.00 ? 76  GLY A H    2  
ATOM   1143  H HA2  . GLY A 1 12 ? 1.436   9.664   7.114   1.00 0.00 ? 76  GLY A HA2  2  
ATOM   1144  H HA3  . GLY A 1 12 ? 2.810   10.744  6.920   1.00 0.00 ? 76  GLY A HA3  2  
ATOM   1145  N N    . ASP A 1 13 ? 2.105   9.522   4.148   1.00 0.00 ? 77  ASP A N    2  
ATOM   1146  C CA   . ASP A 1 13 ? 1.714   9.793   2.789   1.00 0.00 ? 77  ASP A CA   2  
ATOM   1147  C C    . ASP A 1 13 ? 0.585   8.919   2.332   1.00 0.00 ? 77  ASP A C    2  
ATOM   1148  O O    . ASP A 1 13 ? 0.405   7.796   2.823   1.00 0.00 ? 77  ASP A O    2  
ATOM   1149  C CB   . ASP A 1 13 ? 2.914   9.688   1.861   1.00 0.00 ? 77  ASP A CB   2  
ATOM   1150  C CG   . ASP A 1 13 ? 3.732   10.962  1.855   1.00 0.00 ? 77  ASP A CG   2  
ATOM   1151  O OD1  . ASP A 1 13 ? 4.259   11.355  2.910   1.00 0.00 ? 77  ASP A OD1  2  
ATOM   1152  O OD2  . ASP A 1 13 ? 3.811   11.631  0.814   1.00 0.00 ? 77  ASP A OD2  2  
ATOM   1153  H H    . ASP A 1 13 ? 2.657   8.733   4.330   1.00 0.00 ? 77  ASP A H    2  
ATOM   1154  H HA   . ASP A 1 13 ? 1.368   10.815  2.763   1.00 0.00 ? 77  ASP A HA   2  
ATOM   1155  H HB2  . ASP A 1 13 ? 3.522   8.889   2.256   1.00 0.00 ? 77  ASP A HB2  2  
ATOM   1156  H HB3  . ASP A 1 13 ? 2.617   9.421   0.860   1.00 0.00 ? 77  ASP A HB3  2  
ATOM   1157  N N    . LYS A 1 14 ? -0.177  9.438   1.402   1.00 0.00 ? 78  LYS A N    2  
ATOM   1158  C CA   . LYS A 1 14 ? -1.305  8.748   0.837   1.00 0.00 ? 78  LYS A CA   2  
ATOM   1159  C C    . LYS A 1 14 ? -0.869  7.982   -0.378  1.00 0.00 ? 78  LYS A C    2  
ATOM   1160  O O    . LYS A 1 14 ? -0.121  8.494   -1.213  1.00 0.00 ? 78  LYS A O    2  
ATOM   1161  C CB   . LYS A 1 14 ? -2.389  9.743   0.424   1.00 0.00 ? 78  LYS A CB   2  
ATOM   1162  C CG   . LYS A 1 14 ? -3.197  10.351  1.549   1.00 0.00 ? 78  LYS A CG   2  
ATOM   1163  C CD   . LYS A 1 14 ? -4.230  9.364   2.061   1.00 0.00 ? 78  LYS A CD   2  
ATOM   1164  C CE   . LYS A 1 14 ? -5.152  10.009  3.071   1.00 0.00 ? 78  LYS A CE   2  
ATOM   1165  N NZ   . LYS A 1 14 ? -6.281  9.130   3.420   1.00 0.00 ? 78  LYS A NZ   2  
ATOM   1166  H H    . LYS A 1 14 ? 0.036   10.327  1.046   1.00 0.00 ? 78  LYS A H    2  
ATOM   1167  H HA   . LYS A 1 14 ? -1.714  8.072   1.572   1.00 0.00 ? 78  LYS A HA   2  
ATOM   1168  H HB2  . LYS A 1 14 ? -1.944  10.541  -0.149  1.00 0.00 ? 78  LYS A HB2  2  
ATOM   1169  H HB3  . LYS A 1 14 ? -3.072  9.216   -0.222  1.00 0.00 ? 78  LYS A HB3  2  
ATOM   1170  H HG2  . LYS A 1 14 ? -2.530  10.618  2.356   1.00 0.00 ? 78  LYS A HG2  2  
ATOM   1171  H HG3  . LYS A 1 14 ? -3.701  11.234  1.185   1.00 0.00 ? 78  LYS A HG3  2  
ATOM   1172  H HD2  . LYS A 1 14 ? -4.820  9.009   1.229   1.00 0.00 ? 78  LYS A HD2  2  
ATOM   1173  H HD3  . LYS A 1 14 ? -3.723  8.533   2.525   1.00 0.00 ? 78  LYS A HD3  2  
ATOM   1174  H HE2  . LYS A 1 14 ? -4.587  10.224  3.964   1.00 0.00 ? 78  LYS A HE2  2  
ATOM   1175  H HE3  . LYS A 1 14 ? -5.532  10.932  2.658   1.00 0.00 ? 78  LYS A HE3  2  
ATOM   1176  H HZ1  . LYS A 1 14 ? -5.949  8.245   3.851   1.00 0.00 ? 78  LYS A HZ1  2  
ATOM   1177  H HZ2  . LYS A 1 14 ? -6.890  9.619   4.107   1.00 0.00 ? 78  LYS A HZ2  2  
ATOM   1178  H HZ3  . LYS A 1 14 ? -6.837  8.915   2.561   1.00 0.00 ? 78  LYS A HZ3  2  
ATOM   1179  N N    . CYS A 1 15 ? -1.326  6.791   -0.476  1.00 0.00 ? 79  CYS A N    2  
ATOM   1180  C CA   . CYS A 1 15 ? -1.041  5.946   -1.582  1.00 0.00 ? 79  CYS A CA   2  
ATOM   1181  C C    . CYS A 1 15 ? -2.276  5.135   -1.892  1.00 0.00 ? 79  CYS A C    2  
ATOM   1182  O O    . CYS A 1 15 ? -3.304  5.276   -1.225  1.00 0.00 ? 79  CYS A O    2  
ATOM   1183  C CB   . CYS A 1 15 ? 0.116   5.019   -1.238  1.00 0.00 ? 79  CYS A CB   2  
ATOM   1184  S SG   . CYS A 1 15 ? -0.164  4.005   0.244   1.00 0.00 ? 79  CYS A SG   2  
ATOM   1185  H H    . CYS A 1 15 ? -1.902  6.422   0.231   1.00 0.00 ? 79  CYS A H    2  
ATOM   1186  H HA   . CYS A 1 15 ? -0.773  6.554   -2.432  1.00 0.00 ? 79  CYS A HA   2  
ATOM   1187  H HB2  . CYS A 1 15 ? 0.282   4.373   -2.089  1.00 0.00 ? 79  CYS A HB2  2  
ATOM   1188  H HB3  . CYS A 1 15 ? 1.009   5.607   -1.089  1.00 0.00 ? 79  CYS A HB3  2  
ATOM   1189  H HG   . CYS A 1 15 ? -1.224  4.441   0.914   1.00 0.00 ? 79  CYS A HG   2  
ATOM   1190  N N    . MET A 1 16 ? -2.214  4.345   -2.897  1.00 0.00 ? 80  MET A N    2  
ATOM   1191  C CA   . MET A 1 16 ? -3.281  3.453   -3.195  1.00 0.00 ? 80  MET A CA   2  
ATOM   1192  C C    . MET A 1 16 ? -2.715  2.082   -3.131  1.00 0.00 ? 80  MET A C    2  
ATOM   1193  O O    . MET A 1 16 ? -1.684  1.816   -3.735  1.00 0.00 ? 80  MET A O    2  
ATOM   1194  C CB   . MET A 1 16 ? -3.883  3.713   -4.569  1.00 0.00 ? 80  MET A CB   2  
ATOM   1195  C CG   . MET A 1 16 ? -4.237  5.166   -4.818  1.00 0.00 ? 80  MET A CG   2  
ATOM   1196  S SD   . MET A 1 16 ? -5.200  5.409   -6.312  1.00 0.00 ? 80  MET A SD   2  
ATOM   1197  C CE   . MET A 1 16 ? -6.706  4.567   -5.838  1.00 0.00 ? 80  MET A CE   2  
ATOM   1198  H H    . MET A 1 16 ? -1.412  4.364   -3.468  1.00 0.00 ? 80  MET A H    2  
ATOM   1199  H HA   . MET A 1 16 ? -4.038  3.561   -2.432  1.00 0.00 ? 80  MET A HA   2  
ATOM   1200  H HB2  . MET A 1 16 ? -3.187  3.383   -5.322  1.00 0.00 ? 80  MET A HB2  2  
ATOM   1201  H HB3  . MET A 1 16 ? -4.782  3.122   -4.652  1.00 0.00 ? 80  MET A HB3  2  
ATOM   1202  H HG2  . MET A 1 16 ? -4.796  5.544   -3.974  1.00 0.00 ? 80  MET A HG2  2  
ATOM   1203  H HG3  . MET A 1 16 ? -3.307  5.709   -4.911  1.00 0.00 ? 80  MET A HG3  2  
ATOM   1204  H HE1  . MET A 1 16 ? -7.069  5.000   -4.916  1.00 0.00 ? 80  MET A HE1  2  
ATOM   1205  H HE2  . MET A 1 16 ? -7.446  4.680   -6.614  1.00 0.00 ? 80  MET A HE2  2  
ATOM   1206  H HE3  . MET A 1 16 ? -6.504  3.518   -5.677  1.00 0.00 ? 80  MET A HE3  2  
ATOM   1207  N N    . ALA A 1 17 ? -3.358  1.238   -2.413  1.00 0.00 ? 81  ALA A N    2  
ATOM   1208  C CA   . ALA A 1 17 ? -2.883  -0.085  -2.184  1.00 0.00 ? 81  ALA A CA   2  
ATOM   1209  C C    . ALA A 1 17 ? -3.865  -1.062  -2.716  1.00 0.00 ? 81  ALA A C    2  
ATOM   1210  O O    . ALA A 1 17 ? -5.056  -0.761  -2.815  1.00 0.00 ? 81  ALA A O    2  
ATOM   1211  C CB   . ALA A 1 17 ? -2.688  -0.311  -0.705  1.00 0.00 ? 81  ALA A CB   2  
ATOM   1212  H H    . ALA A 1 17 ? -4.229  1.498   -2.033  1.00 0.00 ? 81  ALA A H    2  
ATOM   1213  H HA   . ALA A 1 17 ? -1.930  -0.215  -2.674  1.00 0.00 ? 81  ALA A HA   2  
ATOM   1214  H HB1  . ALA A 1 17 ? -3.632  -0.170  -0.198  1.00 0.00 ? 81  ALA A HB1  2  
ATOM   1215  H HB2  . ALA A 1 17 ? -2.336  -1.318  -0.537  1.00 0.00 ? 81  ALA A HB2  2  
ATOM   1216  H HB3  . ALA A 1 17 ? -1.966  0.395   -0.322  1.00 0.00 ? 81  ALA A HB3  2  
ATOM   1217  N N    . VAL A 1 18 ? -3.390  -2.205  -3.075  1.00 0.00 ? 82  VAL A N    2  
ATOM   1218  C CA   . VAL A 1 18 ? -4.239  -3.254  -3.535  1.00 0.00 ? 82  VAL A CA   2  
ATOM   1219  C C    . VAL A 1 18 ? -4.698  -4.020  -2.328  1.00 0.00 ? 82  VAL A C    2  
ATOM   1220  O O    . VAL A 1 18 ? -3.887  -4.620  -1.641  1.00 0.00 ? 82  VAL A O    2  
ATOM   1221  C CB   . VAL A 1 18 ? -3.495  -4.213  -4.499  1.00 0.00 ? 82  VAL A CB   2  
ATOM   1222  C CG1  . VAL A 1 18 ? -4.423  -5.312  -4.999  1.00 0.00 ? 82  VAL A CG1  2  
ATOM   1223  C CG2  . VAL A 1 18 ? -2.892  -3.446  -5.667  1.00 0.00 ? 82  VAL A CG2  2  
ATOM   1224  H H    . VAL A 1 18 ? -2.423  -2.355  -3.011  1.00 0.00 ? 82  VAL A H    2  
ATOM   1225  H HA   . VAL A 1 18 ? -5.102  -2.838  -4.032  1.00 0.00 ? 82  VAL A HA   2  
ATOM   1226  H HB   . VAL A 1 18 ? -2.691  -4.675  -3.943  1.00 0.00 ? 82  VAL A HB   2  
ATOM   1227  H HG11 . VAL A 1 18 ? -5.260  -4.870  -5.518  1.00 0.00 ? 82  VAL A HG11 2  
ATOM   1228  H HG12 . VAL A 1 18 ? -3.888  -5.964  -5.673  1.00 0.00 ? 82  VAL A HG12 2  
ATOM   1229  H HG13 . VAL A 1 18 ? -4.785  -5.885  -4.159  1.00 0.00 ? 82  VAL A HG13 2  
ATOM   1230  H HG21 . VAL A 1 18 ? -2.191  -2.714  -5.297  1.00 0.00 ? 82  VAL A HG21 2  
ATOM   1231  H HG22 . VAL A 1 18 ? -2.382  -4.133  -6.327  1.00 0.00 ? 82  VAL A HG22 2  
ATOM   1232  H HG23 . VAL A 1 18 ? -3.681  -2.946  -6.210  1.00 0.00 ? 82  VAL A HG23 2  
ATOM   1233  N N    . TRP A 1 19 ? -5.978  -3.959  -2.059  1.00 0.00 ? 83  TRP A N    2  
ATOM   1234  C CA   . TRP A 1 19 ? -6.553  -4.628  -0.933  1.00 0.00 ? 83  TRP A CA   2  
ATOM   1235  C C    . TRP A 1 19 ? -6.468  -6.094  -1.181  1.00 0.00 ? 83  TRP A C    2  
ATOM   1236  O O    . TRP A 1 19 ? -7.107  -6.604  -2.105  1.00 0.00 ? 83  TRP A O    2  
ATOM   1237  C CB   . TRP A 1 19 ? -8.014  -4.218  -0.747  1.00 0.00 ? 83  TRP A CB   2  
ATOM   1238  C CG   . TRP A 1 19 ? -8.596  -4.635  0.579   1.00 0.00 ? 83  TRP A CG   2  
ATOM   1239  C CD1  . TRP A 1 19 ? -7.926  -4.738  1.747   1.00 0.00 ? 83  TRP A CD1  2  
ATOM   1240  C CD2  . TRP A 1 19 ? -9.958  -4.958  0.879   1.00 0.00 ? 83  TRP A CD2  2  
ATOM   1241  N NE1  . TRP A 1 19 ? -8.755  -5.123  2.752   1.00 0.00 ? 83  TRP A NE1  2  
ATOM   1242  C CE2  . TRP A 1 19 ? -10.015 -5.261  2.251   1.00 0.00 ? 83  TRP A CE2  2  
ATOM   1243  C CE3  . TRP A 1 19 ? -11.128 -5.028  0.133   1.00 0.00 ? 83  TRP A CE3  2  
ATOM   1244  C CZ2  . TRP A 1 19 ? -11.193 -5.630  2.881   1.00 0.00 ? 83  TRP A CZ2  2  
ATOM   1245  C CZ3  . TRP A 1 19 ? -12.296 -5.395  0.769   1.00 0.00 ? 83  TRP A CZ3  2  
ATOM   1246  C CH2  . TRP A 1 19 ? -12.311 -5.690  2.132   1.00 0.00 ? 83  TRP A CH2  2  
ATOM   1247  H H    . TRP A 1 19 ? -6.559  -3.450  -2.666  1.00 0.00 ? 83  TRP A H    2  
ATOM   1248  H HA   . TRP A 1 19 ? -5.990  -4.369  -0.050  1.00 0.00 ? 83  TRP A HA   2  
ATOM   1249  H HB2  . TRP A 1 19 ? -8.085  -3.149  -0.853  1.00 0.00 ? 83  TRP A HB2  2  
ATOM   1250  H HB3  . TRP A 1 19 ? -8.599  -4.678  -1.530  1.00 0.00 ? 83  TRP A HB3  2  
ATOM   1251  H HD1  . TRP A 1 19 ? -6.870  -4.558  1.839   1.00 0.00 ? 83  TRP A HD1  2  
ATOM   1252  H HE1  . TRP A 1 19 ? -8.465  -5.260  3.682   1.00 0.00 ? 83  TRP A HE1  2  
ATOM   1253  H HE3  . TRP A 1 19 ? -11.132 -4.795  -0.920  1.00 0.00 ? 83  TRP A HE3  2  
ATOM   1254  H HZ2  . TRP A 1 19 ? -11.252 -5.864  3.931   1.00 0.00 ? 83  TRP A HZ2  2  
ATOM   1255  H HZ3  . TRP A 1 19 ? -13.226 -5.453  0.220   1.00 0.00 ? 83  TRP A HZ3  2  
ATOM   1256  H HH2  . TRP A 1 19 ? -13.235 -5.978  2.605   1.00 0.00 ? 83  TRP A HH2  2  
ATOM   1257  N N    . SER A 1 20 ? -5.714  -6.763  -0.365  1.00 0.00 ? 84  SER A N    2  
ATOM   1258  C CA   . SER A 1 20 ? -5.446  -8.185  -0.511  1.00 0.00 ? 84  SER A CA   2  
ATOM   1259  C C    . SER A 1 20 ? -6.749  -9.021  -0.435  1.00 0.00 ? 84  SER A C    2  
ATOM   1260  O O    . SER A 1 20 ? -6.813  -10.162 -0.920  1.00 0.00 ? 84  SER A O    2  
ATOM   1261  C CB   . SER A 1 20 ? -4.431  -8.624  0.561   1.00 0.00 ? 84  SER A CB   2  
ATOM   1262  O OG   . SER A 1 20 ? -3.985  -9.956  0.361   1.00 0.00 ? 84  SER A OG   2  
ATOM   1263  H H    . SER A 1 20 ? -5.297  -6.256  0.375   1.00 0.00 ? 84  SER A H    2  
ATOM   1264  H HA   . SER A 1 20 ? -5.004  -8.335  -1.484  1.00 0.00 ? 84  SER A HA   2  
ATOM   1265  H HB2  . SER A 1 20 ? -3.575  -7.967  0.534   1.00 0.00 ? 84  SER A HB2  2  
ATOM   1266  H HB3  . SER A 1 20 ? -4.898  -8.558  1.533   1.00 0.00 ? 84  SER A HB3  2  
ATOM   1267  H HG   . SER A 1 20 ? -3.019  -9.933  0.351   1.00 0.00 ? 84  SER A HG   2  
ATOM   1268  N N    . GLU A 1 21 ? -7.794  -8.434  0.114   1.00 0.00 ? 85  GLU A N    2  
ATOM   1269  C CA   . GLU A 1 21 ? -9.052  -9.133  0.270   1.00 0.00 ? 85  GLU A CA   2  
ATOM   1270  C C    . GLU A 1 21 ? -9.902  -9.072  -0.975  1.00 0.00 ? 85  GLU A C    2  
ATOM   1271  O O    . GLU A 1 21 ? -10.697 -9.966  -1.232  1.00 0.00 ? 85  GLU A O    2  
ATOM   1272  C CB   . GLU A 1 21 ? -9.834  -8.535  1.389   1.00 0.00 ? 85  GLU A CB   2  
ATOM   1273  C CG   . GLU A 1 21 ? -9.120  -8.528  2.709   1.00 0.00 ? 85  GLU A CG   2  
ATOM   1274  C CD   . GLU A 1 21 ? -8.816  -9.912  3.223   1.00 0.00 ? 85  GLU A CD   2  
ATOM   1275  O OE1  . GLU A 1 21 ? -9.694  -10.524 3.868   1.00 0.00 ? 85  GLU A OE1  2  
ATOM   1276  O OE2  . GLU A 1 21 ? -7.713  -10.425 2.982   1.00 0.00 ? 85  GLU A OE2  2  
ATOM   1277  H H    . GLU A 1 21 ? -7.696  -7.505  0.418   1.00 0.00 ? 85  GLU A H    2  
ATOM   1278  H HA   . GLU A 1 21 ? -8.855  -10.163 0.515   1.00 0.00 ? 85  GLU A HA   2  
ATOM   1279  H HB2  . GLU A 1 21 ? -10.066 -7.513  1.125   1.00 0.00 ? 85  GLU A HB2  2  
ATOM   1280  H HB3  . GLU A 1 21 ? -10.755 -9.088  1.480   1.00 0.00 ? 85  GLU A HB3  2  
ATOM   1281  H HG2  . GLU A 1 21 ? -8.226  -7.942  2.575   1.00 0.00 ? 85  GLU A HG2  2  
ATOM   1282  H HG3  . GLU A 1 21 ? -9.735  -7.979  3.402   1.00 0.00 ? 85  GLU A HG3  2  
ATOM   1283  N N    . ASP A 1 22 ? -9.776  -8.011  -1.720  1.00 0.00 ? 86  ASP A N    2  
ATOM   1284  C CA   . ASP A 1 22 ? -10.646 -7.842  -2.894  1.00 0.00 ? 86  ASP A CA   2  
ATOM   1285  C C    . ASP A 1 22 ? -9.857  -7.881  -4.189  1.00 0.00 ? 86  ASP A C    2  
ATOM   1286  O O    . ASP A 1 22 ? -10.399 -8.134  -5.259  1.00 0.00 ? 86  ASP A O    2  
ATOM   1287  C CB   . ASP A 1 22 ? -11.400 -6.525  -2.780  1.00 0.00 ? 86  ASP A CB   2  
ATOM   1288  C CG   . ASP A 1 22 ? -12.506 -6.376  -3.776  1.00 0.00 ? 86  ASP A CG   2  
ATOM   1289  O OD1  . ASP A 1 22 ? -13.559 -6.996  -3.593  1.00 0.00 ? 86  ASP A OD1  2  
ATOM   1290  O OD2  . ASP A 1 22 ? -12.369 -5.603  -4.716  1.00 0.00 ? 86  ASP A OD2  2  
ATOM   1291  H H    . ASP A 1 22 ? -9.106  -7.348  -1.452  1.00 0.00 ? 86  ASP A H    2  
ATOM   1292  H HA   . ASP A 1 22 ? -11.363 -8.649  -2.896  1.00 0.00 ? 86  ASP A HA   2  
ATOM   1293  H HB2  . ASP A 1 22 ? -11.839 -6.458  -1.796  1.00 0.00 ? 86  ASP A HB2  2  
ATOM   1294  H HB3  . ASP A 1 22 ? -10.703 -5.713  -2.926  1.00 0.00 ? 86  ASP A HB3  2  
ATOM   1295  N N    . GLY A 1 23 ? -8.573  -7.663  -4.086  1.00 0.00 ? 87  GLY A N    2  
ATOM   1296  C CA   . GLY A 1 23 ? -7.713  -7.667  -5.258  1.00 0.00 ? 87  GLY A CA   2  
ATOM   1297  C C    . GLY A 1 23 ? -7.767  -6.359  -6.038  1.00 0.00 ? 87  GLY A C    2  
ATOM   1298  O O    . GLY A 1 23 ? -7.240  -6.263  -7.143  1.00 0.00 ? 87  GLY A O    2  
ATOM   1299  H H    . GLY A 1 23 ? -8.180  -7.503  -3.197  1.00 0.00 ? 87  GLY A H    2  
ATOM   1300  H HA2  . GLY A 1 23 ? -6.694  -7.840  -4.941  1.00 0.00 ? 87  GLY A HA2  2  
ATOM   1301  H HA3  . GLY A 1 23 ? -8.017  -8.474  -5.909  1.00 0.00 ? 87  GLY A HA3  2  
ATOM   1302  N N    . GLN A 1 24 ? -8.399  -5.360  -5.470  1.00 0.00 ? 88  GLN A N    2  
ATOM   1303  C CA   . GLN A 1 24 ? -8.526  -4.061  -6.118  1.00 0.00 ? 88  GLN A CA   2  
ATOM   1304  C C    . GLN A 1 24 ? -7.776  -3.006  -5.354  1.00 0.00 ? 88  GLN A C    2  
ATOM   1305  O O    . GLN A 1 24 ? -7.411  -3.224  -4.207  1.00 0.00 ? 88  GLN A O    2  
ATOM   1306  C CB   . GLN A 1 24 ? -9.986  -3.674  -6.315  1.00 0.00 ? 88  GLN A CB   2  
ATOM   1307  C CG   . GLN A 1 24 ? -10.699 -4.487  -7.378  1.00 0.00 ? 88  GLN A CG   2  
ATOM   1308  C CD   . GLN A 1 24 ? -10.107 -4.286  -8.761  1.00 0.00 ? 88  GLN A CD   2  
ATOM   1309  O OE1  . GLN A 1 24 ? -10.523 -3.401  -9.502  1.00 0.00 ? 88  GLN A OE1  2  
ATOM   1310  N NE2  . GLN A 1 24 ? -9.146  -5.100  -9.121  1.00 0.00 ? 88  GLN A NE2  2  
ATOM   1311  H H    . GLN A 1 24 ? -8.764  -5.487  -4.570  1.00 0.00 ? 88  GLN A H    2  
ATOM   1312  H HA   . GLN A 1 24 ? -8.056  -4.153  -7.086  1.00 0.00 ? 88  GLN A HA   2  
ATOM   1313  H HB2  . GLN A 1 24 ? -10.510 -3.821  -5.382  1.00 0.00 ? 88  GLN A HB2  2  
ATOM   1314  H HB3  . GLN A 1 24 ? -10.044 -2.631  -6.586  1.00 0.00 ? 88  GLN A HB3  2  
ATOM   1315  H HG2  . GLN A 1 24 ? -10.638 -5.532  -7.118  1.00 0.00 ? 88  GLN A HG2  2  
ATOM   1316  H HG3  . GLN A 1 24 ? -11.728 -4.166  -7.393  1.00 0.00 ? 88  GLN A HG3  2  
ATOM   1317  H HE21 . GLN A 1 24 ? -8.853  -5.798  -8.494  1.00 0.00 ? 88  GLN A HE21 2  
ATOM   1318  H HE22 . GLN A 1 24 ? -8.737  -4.976  -10.004 1.00 0.00 ? 88  GLN A HE22 2  
ATOM   1319  N N    . CYS A 1 25 ? -7.572  -1.867  -5.959  1.00 0.00 ? 89  CYS A N    2  
ATOM   1320  C CA   . CYS A 1 25 ? -6.801  -0.818  -5.332  1.00 0.00 ? 89  CYS A CA   2  
ATOM   1321  C C    . CYS A 1 25 ? -7.690  0.244   -4.708  1.00 0.00 ? 89  CYS A C    2  
ATOM   1322  O O    . CYS A 1 25 ? -8.672  0.699   -5.315  1.00 0.00 ? 89  CYS A O    2  
ATOM   1323  C CB   . CYS A 1 25 ? -5.761  -0.219  -6.291  1.00 0.00 ? 89  CYS A CB   2  
ATOM   1324  S SG   . CYS A 1 25 ? -6.419  0.409   -7.850  1.00 0.00 ? 89  CYS A SG   2  
ATOM   1325  H H    . CYS A 1 25 ? -7.998  -1.711  -6.831  1.00 0.00 ? 89  CYS A H    2  
ATOM   1326  H HA   . CYS A 1 25 ? -6.275  -1.285  -4.513  1.00 0.00 ? 89  CYS A HA   2  
ATOM   1327  H HB2  . CYS A 1 25 ? -5.277  0.606   -5.792  1.00 0.00 ? 89  CYS A HB2  2  
ATOM   1328  H HB3  . CYS A 1 25 ? -5.020  -0.971  -6.520  1.00 0.00 ? 89  CYS A HB3  2  
ATOM   1329  H HG   . CYS A 1 25 ? -6.302  -0.557  -8.753  1.00 0.00 ? 89  CYS A HG   2  
ATOM   1330  N N    . TYR A 1 26 ? -7.343  0.613   -3.499  1.00 0.00 ? 90  TYR A N    2  
ATOM   1331  C CA   . TYR A 1 26 ? -8.085  1.545   -2.674  1.00 0.00 ? 90  TYR A CA   2  
ATOM   1332  C C    . TYR A 1 26 ? -7.097  2.496   -2.027  1.00 0.00 ? 90  TYR A C    2  
ATOM   1333  O O    . TYR A 1 26 ? -5.906  2.176   -1.936  1.00 0.00 ? 90  TYR A O    2  
ATOM   1334  C CB   . TYR A 1 26 ? -8.853  0.789   -1.583  1.00 0.00 ? 90  TYR A CB   2  
ATOM   1335  C CG   . TYR A 1 26 ? -9.921  -0.183  -2.081  1.00 0.00 ? 90  TYR A CG   2  
ATOM   1336  C CD1  . TYR A 1 26 ? -9.572  -1.432  -2.572  1.00 0.00 ? 90  TYR A CD1  2  
ATOM   1337  C CD2  . TYR A 1 26 ? -11.270 0.141   -2.034  1.00 0.00 ? 90  TYR A CD2  2  
ATOM   1338  C CE1  . TYR A 1 26 ? -10.516 -2.326  -3.007  1.00 0.00 ? 90  TYR A CE1  2  
ATOM   1339  C CE2  . TYR A 1 26 ? -12.231 -0.755  -2.467  1.00 0.00 ? 90  TYR A CE2  2  
ATOM   1340  C CZ   . TYR A 1 26 ? -11.843 -1.989  -2.957  1.00 0.00 ? 90  TYR A CZ   2  
ATOM   1341  O OH   . TYR A 1 26 ? -12.795 -2.885  -3.405  1.00 0.00 ? 90  TYR A OH   2  
ATOM   1342  H H    . TYR A 1 26 ? -6.516  0.243   -3.111  1.00 0.00 ? 90  TYR A H    2  
ATOM   1343  H HA   . TYR A 1 26 ? -8.779  2.092   -3.295  1.00 0.00 ? 90  TYR A HA   2  
ATOM   1344  H HB2  . TYR A 1 26 ? -8.134  0.206   -1.026  1.00 0.00 ? 90  TYR A HB2  2  
ATOM   1345  H HB3  . TYR A 1 26 ? -9.312  1.490   -0.902  1.00 0.00 ? 90  TYR A HB3  2  
ATOM   1346  H HD1  . TYR A 1 26 ? -8.526  -1.697  -2.616  1.00 0.00 ? 90  TYR A HD1  2  
ATOM   1347  H HD2  . TYR A 1 26 ? -11.567 1.107   -1.651  1.00 0.00 ? 90  TYR A HD2  2  
ATOM   1348  H HE1  . TYR A 1 26 ? -10.200 -3.287  -3.385  1.00 0.00 ? 90  TYR A HE1  2  
ATOM   1349  H HE2  . TYR A 1 26 ? -13.276 -0.489  -2.423  1.00 0.00 ? 90  TYR A HE2  2  
ATOM   1350  H HH   . TYR A 1 26 ? -12.507 -3.786  -3.212  1.00 0.00 ? 90  TYR A HH   2  
ATOM   1351  N N    . GLU A 1 27 ? -7.561  3.647   -1.604  1.00 0.00 ? 91  GLU A N    2  
ATOM   1352  C CA   . GLU A 1 27 ? -6.697  4.641   -1.005  1.00 0.00 ? 91  GLU A CA   2  
ATOM   1353  C C    . GLU A 1 27 ? -6.293  4.218   0.403   1.00 0.00 ? 91  GLU A C    2  
ATOM   1354  O O    . GLU A 1 27 ? -7.127  3.808   1.218   1.00 0.00 ? 91  GLU A O    2  
ATOM   1355  C CB   . GLU A 1 27 ? -7.382  6.003   -0.945  1.00 0.00 ? 91  GLU A CB   2  
ATOM   1356  C CG   . GLU A 1 27 ? -6.487  7.108   -0.398  1.00 0.00 ? 91  GLU A CG   2  
ATOM   1357  C CD   . GLU A 1 27 ? -7.208  8.403   -0.232  1.00 0.00 ? 91  GLU A CD   2  
ATOM   1358  O OE1  . GLU A 1 27 ? -7.554  9.033   -1.250  1.00 0.00 ? 91  GLU A OE1  2  
ATOM   1359  O OE2  . GLU A 1 27 ? -7.442  8.836   0.937   1.00 0.00 ? 91  GLU A OE2  2  
ATOM   1360  H H    . GLU A 1 27 ? -8.523  3.832   -1.664  1.00 0.00 ? 91  GLU A H    2  
ATOM   1361  H HA   . GLU A 1 27 ? -5.809  4.724   -1.614  1.00 0.00 ? 91  GLU A HA   2  
ATOM   1362  H HB2  . GLU A 1 27 ? -7.697  6.279   -1.942  1.00 0.00 ? 91  GLU A HB2  2  
ATOM   1363  H HB3  . GLU A 1 27 ? -8.253  5.928   -0.311  1.00 0.00 ? 91  GLU A HB3  2  
ATOM   1364  H HG2  . GLU A 1 27 ? -6.106  6.802   0.565   1.00 0.00 ? 91  GLU A HG2  2  
ATOM   1365  H HG3  . GLU A 1 27 ? -5.660  7.252   -1.078  1.00 0.00 ? 91  GLU A HG3  2  
ATOM   1366  N N    . ALA A 1 28 ? -5.032  4.317   0.674   1.00 0.00 ? 92  ALA A N    2  
ATOM   1367  C CA   . ALA A 1 28 ? -4.493  3.956   1.947   1.00 0.00 ? 92  ALA A CA   2  
ATOM   1368  C C    . ALA A 1 28 ? -3.373  4.897   2.325   1.00 0.00 ? 92  ALA A C    2  
ATOM   1369  O O    . ALA A 1 28 ? -2.689  5.430   1.464   1.00 0.00 ? 92  ALA A O    2  
ATOM   1370  C CB   . ALA A 1 28 ? -3.987  2.543   1.900   1.00 0.00 ? 92  ALA A CB   2  
ATOM   1371  H H    . ALA A 1 28 ? -4.428  4.663   -0.024  1.00 0.00 ? 92  ALA A H    2  
ATOM   1372  H HA   . ALA A 1 28 ? -5.276  4.013   2.687   1.00 0.00 ? 92  ALA A HA   2  
ATOM   1373  H HB1  . ALA A 1 28 ? -3.177  2.470   1.189   1.00 0.00 ? 92  ALA A HB1  2  
ATOM   1374  H HB2  . ALA A 1 28 ? -3.637  2.260   2.881   1.00 0.00 ? 92  ALA A HB2  2  
ATOM   1375  H HB3  . ALA A 1 28 ? -4.791  1.887   1.600   1.00 0.00 ? 92  ALA A HB3  2  
ATOM   1376  N N    . GLU A 1 29 ? -3.186  5.107   3.581   1.00 0.00 ? 93  GLU A N    2  
ATOM   1377  C CA   . GLU A 1 29 ? -2.149  5.979   4.040   1.00 0.00 ? 93  GLU A CA   2  
ATOM   1378  C C    . GLU A 1 29 ? -1.070  5.152   4.710   1.00 0.00 ? 93  GLU A C    2  
ATOM   1379  O O    . GLU A 1 29 ? -1.371  4.199   5.439   1.00 0.00 ? 93  GLU A O    2  
ATOM   1380  C CB   . GLU A 1 29 ? -2.719  7.028   4.981   1.00 0.00 ? 93  GLU A CB   2  
ATOM   1381  C CG   . GLU A 1 29 ? -1.731  8.113   5.367   1.00 0.00 ? 93  GLU A CG   2  
ATOM   1382  C CD   . GLU A 1 29 ? -2.345  9.159   6.238   1.00 0.00 ? 93  GLU A CD   2  
ATOM   1383  O OE1  . GLU A 1 29 ? -3.150  9.956   5.750   1.00 0.00 ? 93  GLU A OE1  2  
ATOM   1384  O OE2  . GLU A 1 29 ? -2.022  9.216   7.440   1.00 0.00 ? 93  GLU A OE2  2  
ATOM   1385  H H    . GLU A 1 29 ? -3.754  4.648   4.241   1.00 0.00 ? 93  GLU A H    2  
ATOM   1386  H HA   . GLU A 1 29 ? -1.724  6.467   3.176   1.00 0.00 ? 93  GLU A HA   2  
ATOM   1387  H HB2  . GLU A 1 29 ? -3.571  7.483   4.497   1.00 0.00 ? 93  GLU A HB2  2  
ATOM   1388  H HB3  . GLU A 1 29 ? -3.062  6.533   5.877   1.00 0.00 ? 93  GLU A HB3  2  
ATOM   1389  H HG2  . GLU A 1 29 ? -0.915  7.653   5.905   1.00 0.00 ? 93  GLU A HG2  2  
ATOM   1390  H HG3  . GLU A 1 29 ? -1.344  8.580   4.472   1.00 0.00 ? 93  GLU A HG3  2  
ATOM   1391  N N    . ILE A 1 30 ? 0.158   5.479   4.422   1.00 0.00 ? 94  ILE A N    2  
ATOM   1392  C CA   . ILE A 1 30 ? 1.305   4.758   4.940   1.00 0.00 ? 94  ILE A CA   2  
ATOM   1393  C C    . ILE A 1 30 ? 1.600   5.125   6.383   1.00 0.00 ? 94  ILE A C    2  
ATOM   1394  O O    . ILE A 1 30 ? 1.837   6.296   6.711   1.00 0.00 ? 94  ILE A O    2  
ATOM   1395  C CB   . ILE A 1 30 ? 2.549   5.019   4.084   1.00 0.00 ? 94  ILE A CB   2  
ATOM   1396  C CG1  . ILE A 1 30 ? 2.239   4.656   2.644   1.00 0.00 ? 94  ILE A CG1  2  
ATOM   1397  C CG2  . ILE A 1 30 ? 3.724   4.175   4.599   1.00 0.00 ? 94  ILE A CG2  2  
ATOM   1398  C CD1  . ILE A 1 30 ? 3.271   5.116   1.667   1.00 0.00 ? 94  ILE A CD1  2  
ATOM   1399  H H    . ILE A 1 30 ? 0.302   6.246   3.822   1.00 0.00 ? 94  ILE A H    2  
ATOM   1400  H HA   . ILE A 1 30 ? 1.083   3.702   4.897   1.00 0.00 ? 94  ILE A HA   2  
ATOM   1401  H HB   . ILE A 1 30 ? 2.802   6.071   4.129   1.00 0.00 ? 94  ILE A HB   2  
ATOM   1402  H HG12 . ILE A 1 30 ? 2.178   3.581   2.565   1.00 0.00 ? 94  ILE A HG12 2  
ATOM   1403  H HG13 . ILE A 1 30 ? 1.286   5.088   2.380   1.00 0.00 ? 94  ILE A HG13 2  
ATOM   1404  H HG21 . ILE A 1 30 ? 3.434   3.134   4.622   1.00 0.00 ? 94  ILE A HG21 2  
ATOM   1405  H HG22 . ILE A 1 30 ? 4.585   4.311   3.964   1.00 0.00 ? 94  ILE A HG22 2  
ATOM   1406  H HG23 . ILE A 1 30 ? 3.967   4.476   5.608   1.00 0.00 ? 94  ILE A HG23 2  
ATOM   1407  H HD11 . ILE A 1 30 ? 4.215   4.672   1.942   1.00 0.00 ? 94  ILE A HD11 2  
ATOM   1408  H HD12 . ILE A 1 30 ? 2.990   4.808   0.670   1.00 0.00 ? 94  ILE A HD12 2  
ATOM   1409  H HD13 . ILE A 1 30 ? 3.345   6.193   1.708   1.00 0.00 ? 94  ILE A HD13 2  
ATOM   1410  N N    . GLU A 1 31 ? 1.610   4.119   7.213   1.00 0.00 ? 95  GLU A N    2  
ATOM   1411  C CA   . GLU A 1 31 ? 1.883   4.262   8.622   1.00 0.00 ? 95  GLU A CA   2  
ATOM   1412  C C    . GLU A 1 31 ? 3.337   3.957   8.932   1.00 0.00 ? 95  GLU A C    2  
ATOM   1413  O O    . GLU A 1 31 ? 3.974   4.658   9.708   1.00 0.00 ? 95  GLU A O    2  
ATOM   1414  C CB   . GLU A 1 31 ? 0.998   3.306   9.397   1.00 0.00 ? 95  GLU A CB   2  
ATOM   1415  C CG   . GLU A 1 31 ? -0.463  3.623   9.275   1.00 0.00 ? 95  GLU A CG   2  
ATOM   1416  C CD   . GLU A 1 31 ? -0.827  4.898   9.984   1.00 0.00 ? 95  GLU A CD   2  
ATOM   1417  O OE1  . GLU A 1 31 ? -1.087  4.870   11.211  1.00 0.00 ? 95  GLU A OE1  2  
ATOM   1418  O OE2  . GLU A 1 31 ? -0.859  5.948   9.342   1.00 0.00 ? 95  GLU A OE2  2  
ATOM   1419  H H    . GLU A 1 31 ? 1.410   3.224   6.856   1.00 0.00 ? 95  GLU A H    2  
ATOM   1420  H HA   . GLU A 1 31 ? 1.642   5.269   8.925   1.00 0.00 ? 95  GLU A HA   2  
ATOM   1421  H HB2  . GLU A 1 31 ? 1.161   2.304   9.027   1.00 0.00 ? 95  GLU A HB2  2  
ATOM   1422  H HB3  . GLU A 1 31 ? 1.270   3.342   10.440  1.00 0.00 ? 95  GLU A HB3  2  
ATOM   1423  H HG2  . GLU A 1 31 ? -0.668  3.755   8.223   1.00 0.00 ? 95  GLU A HG2  2  
ATOM   1424  H HG3  . GLU A 1 31 ? -1.053  2.801   9.643   1.00 0.00 ? 95  GLU A HG3  2  
ATOM   1425  N N    . GLU A 1 32 ? 3.858   2.923   8.316   1.00 0.00 ? 96  GLU A N    2  
ATOM   1426  C CA   . GLU A 1 32 ? 5.203   2.468   8.603   1.00 0.00 ? 96  GLU A CA   2  
ATOM   1427  C C    . GLU A 1 32 ? 5.742   1.737   7.394   1.00 0.00 ? 96  GLU A C    2  
ATOM   1428  O O    . GLU A 1 32 ? 4.969   1.168   6.628   1.00 0.00 ? 96  GLU A O    2  
ATOM   1429  C CB   . GLU A 1 32 ? 5.164   1.547   9.834   1.00 0.00 ? 96  GLU A CB   2  
ATOM   1430  C CG   . GLU A 1 32 ? 6.509   1.035   10.301  1.00 0.00 ? 96  GLU A CG   2  
ATOM   1431  C CD   . GLU A 1 32 ? 6.401   0.242   11.573  1.00 0.00 ? 96  GLU A CD   2  
ATOM   1432  O OE1  . GLU A 1 32 ? 6.232   0.854   12.647  1.00 0.00 ? 96  GLU A OE1  2  
ATOM   1433  O OE2  . GLU A 1 32 ? 6.501   -1.001  11.534  1.00 0.00 ? 96  GLU A OE2  2  
ATOM   1434  H H    . GLU A 1 32 ? 3.347   2.439   7.633   1.00 0.00 ? 96  GLU A H    2  
ATOM   1435  H HA   . GLU A 1 32 ? 5.833   3.320   8.810   1.00 0.00 ? 96  GLU A HA   2  
ATOM   1436  H HB2  . GLU A 1 32 ? 4.713   2.087   10.654  1.00 0.00 ? 96  GLU A HB2  2  
ATOM   1437  H HB3  . GLU A 1 32 ? 4.540   0.697   9.599   1.00 0.00 ? 96  GLU A HB3  2  
ATOM   1438  H HG2  . GLU A 1 32 ? 6.907   0.398   9.524   1.00 0.00 ? 96  GLU A HG2  2  
ATOM   1439  H HG3  . GLU A 1 32 ? 7.173   1.872   10.458  1.00 0.00 ? 96  GLU A HG3  2  
ATOM   1440  N N    . ILE A 1 33 ? 7.033   1.793   7.197   1.00 0.00 ? 97  ILE A N    2  
ATOM   1441  C CA   . ILE A 1 33 ? 7.671   1.144   6.073   1.00 0.00 ? 97  ILE A CA   2  
ATOM   1442  C C    . ILE A 1 33 ? 8.736   0.175   6.571   1.00 0.00 ? 97  ILE A C    2  
ATOM   1443  O O    . ILE A 1 33 ? 9.528   0.508   7.445   1.00 0.00 ? 97  ILE A O    2  
ATOM   1444  C CB   . ILE A 1 33 ? 8.322   2.210   5.151   1.00 0.00 ? 97  ILE A CB   2  
ATOM   1445  C CG1  . ILE A 1 33 ? 7.257   3.173   4.645   1.00 0.00 ? 97  ILE A CG1  2  
ATOM   1446  C CG2  . ILE A 1 33 ? 9.048   1.563   3.966   1.00 0.00 ? 97  ILE A CG2  2  
ATOM   1447  C CD1  . ILE A 1 33 ? 7.798   4.504   4.294   1.00 0.00 ? 97  ILE A CD1  2  
ATOM   1448  H H    . ILE A 1 33 ? 7.608   2.289   7.822   1.00 0.00 ? 97  ILE A H    2  
ATOM   1449  H HA   . ILE A 1 33 ? 6.921   0.611   5.509   1.00 0.00 ? 97  ILE A HA   2  
ATOM   1450  H HB   . ILE A 1 33 ? 9.043   2.769   5.730   1.00 0.00 ? 97  ILE A HB   2  
ATOM   1451  H HG12 . ILE A 1 33 ? 6.811   2.794   3.733   1.00 0.00 ? 97  ILE A HG12 2  
ATOM   1452  H HG13 . ILE A 1 33 ? 6.498   3.305   5.401   1.00 0.00 ? 97  ILE A HG13 2  
ATOM   1453  H HG21 . ILE A 1 33 ? 8.344   0.983   3.388   1.00 0.00 ? 97  ILE A HG21 2  
ATOM   1454  H HG22 . ILE A 1 33 ? 9.477   2.337   3.346   1.00 0.00 ? 97  ILE A HG22 2  
ATOM   1455  H HG23 . ILE A 1 33 ? 9.832   0.918   4.333   1.00 0.00 ? 97  ILE A HG23 2  
ATOM   1456  H HD11 . ILE A 1 33 ? 8.581   4.406   3.558   1.00 0.00 ? 97  ILE A HD11 2  
ATOM   1457  H HD12 . ILE A 1 33 ? 6.998   5.126   3.922   1.00 0.00 ? 97  ILE A HD12 2  
ATOM   1458  H HD13 . ILE A 1 33 ? 8.187   4.939   5.204   1.00 0.00 ? 97  ILE A HD13 2  
ATOM   1459  N N    . ASP A 1 34 ? 8.719   -1.009  6.026   1.00 0.00 ? 98  ASP A N    2  
ATOM   1460  C CA   . ASP A 1 34 ? 9.707   -2.029  6.300   1.00 0.00 ? 98  ASP A CA   2  
ATOM   1461  C C    . ASP A 1 34 ? 10.643  -2.034  5.127   1.00 0.00 ? 98  ASP A C    2  
ATOM   1462  O O    . ASP A 1 34 ? 10.382  -2.652  4.089   1.00 0.00 ? 98  ASP A O    2  
ATOM   1463  C CB   . ASP A 1 34 ? 9.063   -3.412  6.461   1.00 0.00 ? 98  ASP A CB   2  
ATOM   1464  C CG   . ASP A 1 34 ? 10.072  -4.499  6.792   1.00 0.00 ? 98  ASP A CG   2  
ATOM   1465  O OD1  . ASP A 1 34 ? 10.835  -4.912  5.911   1.00 0.00 ? 98  ASP A OD1  2  
ATOM   1466  O OD2  . ASP A 1 34 ? 10.108  -4.972  7.962   1.00 0.00 ? 98  ASP A OD2  2  
ATOM   1467  H H    . ASP A 1 34 ? 8.029   -1.212  5.354   1.00 0.00 ? 98  ASP A H    2  
ATOM   1468  H HA   . ASP A 1 34 ? 10.290  -1.782  7.176   1.00 0.00 ? 98  ASP A HA   2  
ATOM   1469  H HB2  . ASP A 1 34 ? 8.327   -3.374  7.251   1.00 0.00 ? 98  ASP A HB2  2  
ATOM   1470  H HB3  . ASP A 1 34 ? 8.570   -3.676  5.536   1.00 0.00 ? 98  ASP A HB3  2  
ATOM   1471  N N    . GLU A 1 35 ? 11.679  -1.267  5.250   1.00 0.00 ? 99  GLU A N    2  
ATOM   1472  C CA   . GLU A 1 35 ? 12.658  -1.080  4.202   1.00 0.00 ? 99  GLU A CA   2  
ATOM   1473  C C    . GLU A 1 35 ? 13.438  -2.355  3.893   1.00 0.00 ? 99  GLU A C    2  
ATOM   1474  O O    . GLU A 1 35 ? 14.070  -2.456  2.847   1.00 0.00 ? 99  GLU A O    2  
ATOM   1475  C CB   . GLU A 1 35 ? 13.590  0.052   4.560   1.00 0.00 ? 99  GLU A CB   2  
ATOM   1476  C CG   . GLU A 1 35 ? 12.859  1.349   4.862   1.00 0.00 ? 99  GLU A CG   2  
ATOM   1477  C CD   . GLU A 1 35 ? 13.778  2.476   5.227   1.00 0.00 ? 99  GLU A CD   2  
ATOM   1478  O OE1  . GLU A 1 35 ? 14.248  2.538   6.391   1.00 0.00 ? 99  GLU A OE1  2  
ATOM   1479  O OE2  . GLU A 1 35 ? 14.059  3.328   4.368   1.00 0.00 ? 99  GLU A OE2  2  
ATOM   1480  H H    . GLU A 1 35 ? 11.791  -0.787  6.100   1.00 0.00 ? 99  GLU A H    2  
ATOM   1481  H HA   . GLU A 1 35 ? 12.117  -0.798  3.311   1.00 0.00 ? 99  GLU A HA   2  
ATOM   1482  H HB2  . GLU A 1 35 ? 14.165  -0.243  5.424   1.00 0.00 ? 99  GLU A HB2  2  
ATOM   1483  H HB3  . GLU A 1 35 ? 14.250  0.212   3.721   1.00 0.00 ? 99  GLU A HB3  2  
ATOM   1484  H HG2  . GLU A 1 35 ? 12.295  1.634   3.986   1.00 0.00 ? 99  GLU A HG2  2  
ATOM   1485  H HG3  . GLU A 1 35 ? 12.173  1.176   5.678   1.00 0.00 ? 99  GLU A HG3  2  
ATOM   1486  N N    . GLU A 1 36 ? 13.394  -3.308  4.803   1.00 0.00 ? 100 GLU A N    2  
ATOM   1487  C CA   . GLU A 1 36 ? 14.104  -4.560  4.664   1.00 0.00 ? 100 GLU A CA   2  
ATOM   1488  C C    . GLU A 1 36 ? 13.468  -5.386  3.545   1.00 0.00 ? 100 GLU A C    2  
ATOM   1489  O O    . GLU A 1 36 ? 14.164  -5.982  2.721   1.00 0.00 ? 100 GLU A O    2  
ATOM   1490  C CB   . GLU A 1 36 ? 14.018  -5.334  5.978   1.00 0.00 ? 100 GLU A CB   2  
ATOM   1491  C CG   . GLU A 1 36 ? 14.899  -6.575  6.043   1.00 0.00 ? 100 GLU A CG   2  
ATOM   1492  C CD   . GLU A 1 36 ? 16.374  -6.259  6.046   1.00 0.00 ? 100 GLU A CD   2  
ATOM   1493  O OE1  . GLU A 1 36 ? 16.960  -6.014  4.980   1.00 0.00 ? 100 GLU A OE1  2  
ATOM   1494  O OE2  . GLU A 1 36 ? 16.984  -6.254  7.131   1.00 0.00 ? 100 GLU A OE2  2  
ATOM   1495  H H    . GLU A 1 36 ? 12.850  -3.164  5.608   1.00 0.00 ? 100 GLU A H    2  
ATOM   1496  H HA   . GLU A 1 36 ? 15.140  -4.360  4.437   1.00 0.00 ? 100 GLU A HA   2  
ATOM   1497  H HB2  . GLU A 1 36 ? 14.244  -4.667  6.798   1.00 0.00 ? 100 GLU A HB2  2  
ATOM   1498  H HB3  . GLU A 1 36 ? 12.991  -5.649  6.091   1.00 0.00 ? 100 GLU A HB3  2  
ATOM   1499  H HG2  . GLU A 1 36 ? 14.669  -7.119  6.948   1.00 0.00 ? 100 GLU A HG2  2  
ATOM   1500  H HG3  . GLU A 1 36 ? 14.678  -7.194  5.186   1.00 0.00 ? 100 GLU A HG3  2  
ATOM   1501  N N    . ASN A 1 37 ? 12.152  -5.403  3.514   1.00 0.00 ? 101 ASN A N    2  
ATOM   1502  C CA   . ASN A 1 37 ? 11.408  -6.148  2.492   1.00 0.00 ? 101 ASN A CA   2  
ATOM   1503  C C    . ASN A 1 37 ? 10.918  -5.232  1.410   1.00 0.00 ? 101 ASN A C    2  
ATOM   1504  O O    . ASN A 1 37 ? 10.499  -5.685  0.336   1.00 0.00 ? 101 ASN A O    2  
ATOM   1505  C CB   . ASN A 1 37 ? 10.186  -6.840  3.098   1.00 0.00 ? 101 ASN A CB   2  
ATOM   1506  C CG   . ASN A 1 37 ? 10.514  -7.891  4.120   1.00 0.00 ? 101 ASN A CG   2  
ATOM   1507  O OD1  . ASN A 1 37 ? 10.637  -9.073  3.798   1.00 0.00 ? 101 ASN A OD1  2  
ATOM   1508  N ND2  . ASN A 1 37 ? 10.671  -7.483  5.338   1.00 0.00 ? 101 ASN A ND2  2  
ATOM   1509  H H    . ASN A 1 37 ? 11.660  -4.933  4.232   1.00 0.00 ? 101 ASN A H    2  
ATOM   1510  H HA   . ASN A 1 37 ? 12.046  -6.904  2.062   1.00 0.00 ? 101 ASN A HA   2  
ATOM   1511  H HB2  . ASN A 1 37 ? 9.554   -6.100  3.566   1.00 0.00 ? 101 ASN A HB2  2  
ATOM   1512  H HB3  . ASN A 1 37 ? 9.642   -7.307  2.290   1.00 0.00 ? 101 ASN A HB3  2  
ATOM   1513  H HD21 . ASN A 1 37 ? 10.569  -6.508  5.501   1.00 0.00 ? 101 ASN A HD21 2  
ATOM   1514  H HD22 . ASN A 1 37 ? 10.887  -8.126  6.042   1.00 0.00 ? 101 ASN A HD22 2  
ATOM   1515  N N    . GLY A 1 38 ? 10.965  -3.941  1.676   1.00 0.00 ? 102 GLY A N    2  
ATOM   1516  C CA   . GLY A 1 38 ? 10.413  -2.991  0.750   1.00 0.00 ? 102 GLY A CA   2  
ATOM   1517  C C    . GLY A 1 38 ? 8.901   -3.018  0.824   1.00 0.00 ? 102 GLY A C    2  
ATOM   1518  O O    . GLY A 1 38 ? 8.201   -2.858  -0.192  1.00 0.00 ? 102 GLY A O    2  
ATOM   1519  H H    . GLY A 1 38 ? 11.365  -3.623  2.517   1.00 0.00 ? 102 GLY A H    2  
ATOM   1520  H HA2  . GLY A 1 38 ? 10.774  -2.004  0.993   1.00 0.00 ? 102 GLY A HA2  2  
ATOM   1521  H HA3  . GLY A 1 38 ? 10.717  -3.252  -0.253  1.00 0.00 ? 102 GLY A HA3  2  
ATOM   1522  N N    . THR A 1 39 ? 8.393   -3.256  2.012   1.00 0.00 ? 103 THR A N    2  
ATOM   1523  C CA   . THR A 1 39 ? 6.980   -3.316  2.238   1.00 0.00 ? 103 THR A CA   2  
ATOM   1524  C C    . THR A 1 39 ? 6.537   -2.166  3.128   1.00 0.00 ? 103 THR A C    2  
ATOM   1525  O O    . THR A 1 39 ? 7.358   -1.537  3.782   1.00 0.00 ? 103 THR A O    2  
ATOM   1526  C CB   . THR A 1 39 ? 6.588   -4.677  2.856   1.00 0.00 ? 103 THR A CB   2  
ATOM   1527  O OG1  . THR A 1 39 ? 7.483   -4.994  3.937   1.00 0.00 ? 103 THR A OG1  2  
ATOM   1528  C CG2  . THR A 1 39 ? 6.635   -5.794  1.821   1.00 0.00 ? 103 THR A CG2  2  
ATOM   1529  H H    . THR A 1 39 ? 8.968   -3.411  2.798   1.00 0.00 ? 103 THR A H    2  
ATOM   1530  H HA   . THR A 1 39 ? 6.483   -3.208  1.290   1.00 0.00 ? 103 THR A HA   2  
ATOM   1531  H HB   . THR A 1 39 ? 5.580   -4.580  3.231   1.00 0.00 ? 103 THR A HB   2  
ATOM   1532  H HG1  . THR A 1 39 ? 7.348   -5.911  4.203   1.00 0.00 ? 103 THR A HG1  2  
ATOM   1533  H HG21 . THR A 1 39 ? 7.625   -5.841  1.391   1.00 0.00 ? 103 THR A HG21 2  
ATOM   1534  H HG22 . THR A 1 39 ? 6.411   -6.735  2.300   1.00 0.00 ? 103 THR A HG22 2  
ATOM   1535  H HG23 . THR A 1 39 ? 5.908   -5.608  1.046   1.00 0.00 ? 103 THR A HG23 2  
ATOM   1536  N N    . ALA A 1 40 ? 5.272   -1.856  3.114   1.00 0.00 ? 104 ALA A N    2  
ATOM   1537  C CA   . ALA A 1 40 ? 4.756   -0.799  3.930   1.00 0.00 ? 104 ALA A CA   2  
ATOM   1538  C C    . ALA A 1 40 ? 3.454   -1.200  4.560   1.00 0.00 ? 104 ALA A C    2  
ATOM   1539  O O    . ALA A 1 40 ? 2.662   -1.943  3.971   1.00 0.00 ? 104 ALA A O    2  
ATOM   1540  C CB   . ALA A 1 40 ? 4.576   0.469   3.115   1.00 0.00 ? 104 ALA A CB   2  
ATOM   1541  H H    . ALA A 1 40 ? 4.638   -2.331  2.529   1.00 0.00 ? 104 ALA A H    2  
ATOM   1542  H HA   . ALA A 1 40 ? 5.474   -0.596  4.711   1.00 0.00 ? 104 ALA A HA   2  
ATOM   1543  H HB1  . ALA A 1 40 ? 3.850   0.288   2.336   1.00 0.00 ? 104 ALA A HB1  2  
ATOM   1544  H HB2  . ALA A 1 40 ? 4.231   1.265   3.758   1.00 0.00 ? 104 ALA A HB2  2  
ATOM   1545  H HB3  . ALA A 1 40 ? 5.520   0.746   2.670   1.00 0.00 ? 104 ALA A HB3  2  
ATOM   1546  N N    . ALA A 1 41 ? 3.253   -0.736  5.751   1.00 0.00 ? 105 ALA A N    2  
ATOM   1547  C CA   . ALA A 1 41 ? 2.043   -0.944  6.471   1.00 0.00 ? 105 ALA A CA   2  
ATOM   1548  C C    . ALA A 1 41 ? 1.158   0.237   6.204   1.00 0.00 ? 105 ALA A C    2  
ATOM   1549  O O    . ALA A 1 41 ? 1.532   1.395   6.484   1.00 0.00 ? 105 ALA A O    2  
ATOM   1550  C CB   . ALA A 1 41 ? 2.336   -1.070  7.932   1.00 0.00 ? 105 ALA A CB   2  
ATOM   1551  H H    . ALA A 1 41 ? 3.954   -0.186  6.171   1.00 0.00 ? 105 ALA A H    2  
ATOM   1552  H HA   . ALA A 1 41 ? 1.569   -1.848  6.114   1.00 0.00 ? 105 ALA A HA   2  
ATOM   1553  H HB1  . ALA A 1 41 ? 2.849   -0.173  8.248   1.00 0.00 ? 105 ALA A HB1  2  
ATOM   1554  H HB2  . ALA A 1 41 ? 1.410   -1.201  8.470   1.00 0.00 ? 105 ALA A HB2  2  
ATOM   1555  H HB3  . ALA A 1 41 ? 2.975   -1.929  8.065   1.00 0.00 ? 105 ALA A HB3  2  
ATOM   1556  N N    . ILE A 1 42 ? 0.026   -0.025  5.653   1.00 0.00 ? 106 ILE A N    2  
ATOM   1557  C CA   . ILE A 1 42 ? -0.848  1.014   5.197   1.00 0.00 ? 106 ILE A CA   2  
ATOM   1558  C C    . ILE A 1 42 ? -2.230  0.873   5.801   1.00 0.00 ? 106 ILE A C    2  
ATOM   1559  O O    . ILE A 1 42 ? -2.688  -0.230  6.053   1.00 0.00 ? 106 ILE A O    2  
ATOM   1560  C CB   . ILE A 1 42 ? -0.925  0.989   3.640   1.00 0.00 ? 106 ILE A CB   2  
ATOM   1561  C CG1  . ILE A 1 42 ? -1.363  -0.394  3.125   1.00 0.00 ? 106 ILE A CG1  2  
ATOM   1562  C CG2  . ILE A 1 42 ? 0.386   1.399   3.005   1.00 0.00 ? 106 ILE A CG2  2  
ATOM   1563  C CD1  . ILE A 1 42 ? -2.815  -0.487  2.830   1.00 0.00 ? 106 ILE A CD1  2  
ATOM   1564  H H    . ILE A 1 42 ? -0.244  -0.965  5.540   1.00 0.00 ? 106 ILE A H    2  
ATOM   1565  H HA   . ILE A 1 42 ? -0.429  1.962   5.497   1.00 0.00 ? 106 ILE A HA   2  
ATOM   1566  H HB   . ILE A 1 42 ? -1.668  1.712   3.340   1.00 0.00 ? 106 ILE A HB   2  
ATOM   1567  H HG12 . ILE A 1 42 ? -0.832  -0.698  2.240   1.00 0.00 ? 106 ILE A HG12 2  
ATOM   1568  H HG13 . ILE A 1 42 ? -1.161  -1.115  3.904   1.00 0.00 ? 106 ILE A HG13 2  
ATOM   1569  H HG21 . ILE A 1 42 ? 1.166   0.718   3.314   1.00 0.00 ? 106 ILE A HG21 2  
ATOM   1570  H HG22 . ILE A 1 42 ? 0.270   1.359   1.932   1.00 0.00 ? 106 ILE A HG22 2  
ATOM   1571  H HG23 . ILE A 1 42 ? 0.630   2.405   3.312   1.00 0.00 ? 106 ILE A HG23 2  
ATOM   1572  H HD11 . ILE A 1 42 ? -3.026  0.285   2.103   1.00 0.00 ? 106 ILE A HD11 2  
ATOM   1573  H HD12 . ILE A 1 42 ? -3.050  -1.452  2.406   1.00 0.00 ? 106 ILE A HD12 2  
ATOM   1574  H HD13 . ILE A 1 42 ? -3.385  -0.314  3.732   1.00 0.00 ? 106 ILE A HD13 2  
ATOM   1575  N N    . THR A 1 43 ? -2.869  1.983   6.038   1.00 0.00 ? 107 THR A N    2  
ATOM   1576  C CA   . THR A 1 43 ? -4.199  2.002   6.585   1.00 0.00 ? 107 THR A CA   2  
ATOM   1577  C C    . THR A 1 43 ? -5.190  2.551   5.556   1.00 0.00 ? 107 THR A C    2  
ATOM   1578  O O    . THR A 1 43 ? -5.034  3.677   5.055   1.00 0.00 ? 107 THR A O    2  
ATOM   1579  C CB   . THR A 1 43 ? -4.236  2.829   7.878   1.00 0.00 ? 107 THR A CB   2  
ATOM   1580  O OG1  . THR A 1 43 ? -3.263  2.289   8.770   1.00 0.00 ? 107 THR A OG1  2  
ATOM   1581  C CG2  . THR A 1 43 ? -5.611  2.766   8.538   1.00 0.00 ? 107 THR A CG2  2  
ATOM   1582  H H    . THR A 1 43 ? -2.419  2.831   5.821   1.00 0.00 ? 107 THR A H    2  
ATOM   1583  H HA   . THR A 1 43 ? -4.474  0.983   6.818   1.00 0.00 ? 107 THR A HA   2  
ATOM   1584  H HB   . THR A 1 43 ? -3.987  3.855   7.649   1.00 0.00 ? 107 THR A HB   2  
ATOM   1585  H HG1  . THR A 1 43 ? -2.559  1.929   8.219   1.00 0.00 ? 107 THR A HG1  2  
ATOM   1586  H HG21 . THR A 1 43 ? -5.853  1.740   8.773   1.00 0.00 ? 107 THR A HG21 2  
ATOM   1587  H HG22 . THR A 1 43 ? -5.606  3.353   9.445   1.00 0.00 ? 107 THR A HG22 2  
ATOM   1588  H HG23 . THR A 1 43 ? -6.351  3.160   7.857   1.00 0.00 ? 107 THR A HG23 2  
ATOM   1589  N N    . PHE A 1 44 ? -6.189  1.752   5.257   1.00 0.00 ? 108 PHE A N    2  
ATOM   1590  C CA   . PHE A 1 44 ? -7.188  2.073   4.267   1.00 0.00 ? 108 PHE A CA   2  
ATOM   1591  C C    . PHE A 1 44 ? -8.100  3.177   4.708   1.00 0.00 ? 108 PHE A C    2  
ATOM   1592  O O    . PHE A 1 44 ? -8.700  3.113   5.796   1.00 0.00 ? 108 PHE A O    2  
ATOM   1593  C CB   . PHE A 1 44 ? -7.982  0.850   3.874   1.00 0.00 ? 108 PHE A CB   2  
ATOM   1594  C CG   . PHE A 1 44 ? -7.186  -0.130  3.083   1.00 0.00 ? 108 PHE A CG   2  
ATOM   1595  C CD1  . PHE A 1 44 ? -6.930  0.124   1.749   1.00 0.00 ? 108 PHE A CD1  2  
ATOM   1596  C CD2  . PHE A 1 44 ? -6.696  -1.298  3.656   1.00 0.00 ? 108 PHE A CD2  2  
ATOM   1597  C CE1  . PHE A 1 44 ? -6.203  -0.758  0.986   1.00 0.00 ? 108 PHE A CE1  2  
ATOM   1598  C CE2  . PHE A 1 44 ? -5.965  -2.190  2.897   1.00 0.00 ? 108 PHE A CE2  2  
ATOM   1599  C CZ   . PHE A 1 44 ? -5.715  -1.918  1.558   1.00 0.00 ? 108 PHE A CZ   2  
ATOM   1600  H H    . PHE A 1 44 ? -6.256  0.907   5.757   1.00 0.00 ? 108 PHE A H    2  
ATOM   1601  H HA   . PHE A 1 44 ? -6.655  2.413   3.394   1.00 0.00 ? 108 PHE A HA   2  
ATOM   1602  H HB2  . PHE A 1 44 ? -8.347  0.367   4.767   1.00 0.00 ? 108 PHE A HB2  2  
ATOM   1603  H HB3  . PHE A 1 44 ? -8.820  1.163   3.269   1.00 0.00 ? 108 PHE A HB3  2  
ATOM   1604  H HD1  . PHE A 1 44 ? -7.325  1.031   1.313   1.00 0.00 ? 108 PHE A HD1  2  
ATOM   1605  H HD2  . PHE A 1 44 ? -6.900  -1.518  4.695   1.00 0.00 ? 108 PHE A HD2  2  
ATOM   1606  H HE1  . PHE A 1 44 ? -6.027  -0.531  -0.055  1.00 0.00 ? 108 PHE A HE1  2  
ATOM   1607  H HE2  . PHE A 1 44 ? -5.589  -3.097  3.348   1.00 0.00 ? 108 PHE A HE2  2  
ATOM   1608  H HZ   . PHE A 1 44 ? -5.142  -2.614  0.964   1.00 0.00 ? 108 PHE A HZ   2  
ATOM   1609  N N    . ALA A 1 45 ? -8.206  4.169   3.853   1.00 0.00 ? 109 ALA A N    2  
ATOM   1610  C CA   . ALA A 1 45 ? -8.980  5.357   4.095   1.00 0.00 ? 109 ALA A CA   2  
ATOM   1611  C C    . ALA A 1 45 ? -10.454 5.058   4.300   1.00 0.00 ? 109 ALA A C    2  
ATOM   1612  O O    . ALA A 1 45 ? -11.105 4.438   3.453   1.00 0.00 ? 109 ALA A O    2  
ATOM   1613  C CB   . ALA A 1 45 ? -8.791  6.334   2.951   1.00 0.00 ? 109 ALA A CB   2  
ATOM   1614  H H    . ALA A 1 45 ? -7.735  4.098   2.991   1.00 0.00 ? 109 ALA A H    2  
ATOM   1615  H HA   . ALA A 1 45 ? -8.591  5.820   4.987   1.00 0.00 ? 109 ALA A HA   2  
ATOM   1616  H HB1  . ALA A 1 45 ? -7.739  6.506   2.784   1.00 0.00 ? 109 ALA A HB1  2  
ATOM   1617  H HB2  . ALA A 1 45 ? -9.233  5.926   2.053   1.00 0.00 ? 109 ALA A HB2  2  
ATOM   1618  H HB3  . ALA A 1 45 ? -9.275  7.268   3.192   1.00 0.00 ? 109 ALA A HB3  2  
ATOM   1619  N N    . GLY A 1 46 ? -10.960 5.450   5.444   1.00 0.00 ? 110 GLY A N    2  
ATOM   1620  C CA   . GLY A 1 46 ? -12.359 5.305   5.737   1.00 0.00 ? 110 GLY A CA   2  
ATOM   1621  C C    . GLY A 1 46 ? -12.689 3.986   6.386   1.00 0.00 ? 110 GLY A C    2  
ATOM   1622  O O    . GLY A 1 46 ? -13.372 3.942   7.413   1.00 0.00 ? 110 GLY A O    2  
ATOM   1623  H H    . GLY A 1 46 ? -10.371 5.834   6.129   1.00 0.00 ? 110 GLY A H    2  
ATOM   1624  H HA2  . GLY A 1 46 ? -12.674 6.109   6.384   1.00 0.00 ? 110 GLY A HA2  2  
ATOM   1625  H HA3  . GLY A 1 46 ? -12.900 5.369   4.806   1.00 0.00 ? 110 GLY A HA3  2  
ATOM   1626  N N    . TYR A 1 47 ? -12.204 2.916   5.801   1.00 0.00 ? 111 TYR A N    2  
ATOM   1627  C CA   . TYR A 1 47 ? -12.500 1.584   6.269   1.00 0.00 ? 111 TYR A CA   2  
ATOM   1628  C C    . TYR A 1 47 ? -11.743 1.285   7.556   1.00 0.00 ? 111 TYR A C    2  
ATOM   1629  O O    . TYR A 1 47 ? -12.257 0.621   8.455   1.00 0.00 ? 111 TYR A O    2  
ATOM   1630  C CB   . TYR A 1 47 ? -12.123 0.581   5.221   1.00 0.00 ? 111 TYR A CB   2  
ATOM   1631  C CG   . TYR A 1 47 ? -12.651 0.862   3.829   1.00 0.00 ? 111 TYR A CG   2  
ATOM   1632  C CD1  . TYR A 1 47 ? -13.964 0.577   3.475   1.00 0.00 ? 111 TYR A CD1  2  
ATOM   1633  C CD2  . TYR A 1 47 ? -11.805 1.363   2.854   1.00 0.00 ? 111 TYR A CD2  2  
ATOM   1634  C CE1  . TYR A 1 47 ? -14.414 0.795   2.179   1.00 0.00 ? 111 TYR A CE1  2  
ATOM   1635  C CE2  . TYR A 1 47 ? -12.233 1.578   1.568   1.00 0.00 ? 111 TYR A CE2  2  
ATOM   1636  C CZ   . TYR A 1 47 ? -13.540 1.292   1.229   1.00 0.00 ? 111 TYR A CZ   2  
ATOM   1637  O OH   . TYR A 1 47 ? -13.972 1.490   -0.064  1.00 0.00 ? 111 TYR A OH   2  
ATOM   1638  H H    . TYR A 1 47 ? -11.636 3.038   5.010   1.00 0.00 ? 111 TYR A H    2  
ATOM   1639  H HA   . TYR A 1 47 ? -13.561 1.513   6.457   1.00 0.00 ? 111 TYR A HA   2  
ATOM   1640  H HB2  . TYR A 1 47 ? -11.046 0.540   5.155   1.00 0.00 ? 111 TYR A HB2  2  
ATOM   1641  H HB3  . TYR A 1 47 ? -12.486 -0.392  5.523   1.00 0.00 ? 111 TYR A HB3  2  
ATOM   1642  H HD1  . TYR A 1 47 ? -14.639 0.192   4.226   1.00 0.00 ? 111 TYR A HD1  2  
ATOM   1643  H HD2  . TYR A 1 47 ? -10.785 1.592   3.121   1.00 0.00 ? 111 TYR A HD2  2  
ATOM   1644  H HE1  . TYR A 1 47 ? -15.433 0.556   1.912   1.00 0.00 ? 111 TYR A HE1  2  
ATOM   1645  H HE2  . TYR A 1 47 ? -11.530 1.965   0.844   1.00 0.00 ? 111 TYR A HE2  2  
ATOM   1646  H HH   . TYR A 1 47 ? -14.891 1.793   -0.028  1.00 0.00 ? 111 TYR A HH   2  
ATOM   1647  N N    . GLY A 1 48 ? -10.509 1.741   7.613   1.00 0.00 ? 112 GLY A N    2  
ATOM   1648  C CA   . GLY A 1 48 ? -9.727  1.627   8.825   1.00 0.00 ? 112 GLY A CA   2  
ATOM   1649  C C    . GLY A 1 48 ? -8.955  0.327   8.966   1.00 0.00 ? 112 GLY A C    2  
ATOM   1650  O O    . GLY A 1 48 ? -8.585  -0.050  10.078  1.00 0.00 ? 112 GLY A O    2  
ATOM   1651  H H    . GLY A 1 48 ? -10.126 2.176   6.820   1.00 0.00 ? 112 GLY A H    2  
ATOM   1652  H HA2  . GLY A 1 48 ? -9.019  2.442   8.852   1.00 0.00 ? 112 GLY A HA2  2  
ATOM   1653  H HA3  . GLY A 1 48 ? -10.396 1.727   9.667   1.00 0.00 ? 112 GLY A HA3  2  
ATOM   1654  N N    . ASN A 1 49 ? -8.696  -0.367  7.871   1.00 0.00 ? 113 ASN A N    2  
ATOM   1655  C CA   . ASN A 1 49 ? -7.900  -1.598  7.978   1.00 0.00 ? 113 ASN A CA   2  
ATOM   1656  C C    . ASN A 1 49 ? -6.484  -1.297  7.674   1.00 0.00 ? 113 ASN A C    2  
ATOM   1657  O O    . ASN A 1 49 ? -6.178  -0.242  7.129   1.00 0.00 ? 113 ASN A O    2  
ATOM   1658  C CB   . ASN A 1 49 ? -8.344  -2.735  7.057   1.00 0.00 ? 113 ASN A CB   2  
ATOM   1659  C CG   . ASN A 1 49 ? -9.700  -3.294  7.351   1.00 0.00 ? 113 ASN A CG   2  
ATOM   1660  O OD1  . ASN A 1 49 ? -10.212 -3.206  8.459   1.00 0.00 ? 113 ASN A OD1  2  
ATOM   1661  N ND2  . ASN A 1 49 ? -10.248 -3.940  6.383   1.00 0.00 ? 113 ASN A ND2  2  
ATOM   1662  H H    . ASN A 1 49 ? -9.000  -0.045  6.999   1.00 0.00 ? 113 ASN A H    2  
ATOM   1663  H HA   . ASN A 1 49 ? -7.964  -1.925  9.005   1.00 0.00 ? 113 ASN A HA   2  
ATOM   1664  H HB2  . ASN A 1 49 ? -8.354  -2.375  6.041   1.00 0.00 ? 113 ASN A HB2  2  
ATOM   1665  H HB3  . ASN A 1 49 ? -7.620  -3.533  7.128   1.00 0.00 ? 113 ASN A HB3  2  
ATOM   1666  H HD21 . ASN A 1 49 ? -9.740  -4.027  5.549   1.00 0.00 ? 113 ASN A HD21 2  
ATOM   1667  H HD22 . ASN A 1 49 ? -11.158 -4.284  6.481   1.00 0.00 ? 113 ASN A HD22 2  
ATOM   1668  N N    . ALA A 1 50 ? -5.628  -2.218  7.966   1.00 0.00 ? 114 ALA A N    2  
ATOM   1669  C CA   . ALA A 1 50 ? -4.231  -2.041  7.745   1.00 0.00 ? 114 ALA A CA   2  
ATOM   1670  C C    . ALA A 1 50 ? -3.628  -3.323  7.244   1.00 0.00 ? 114 ALA A C    2  
ATOM   1671  O O    . ALA A 1 50 ? -3.921  -4.397  7.782   1.00 0.00 ? 114 ALA A O    2  
ATOM   1672  C CB   . ALA A 1 50 ? -3.548  -1.592  9.026   1.00 0.00 ? 114 ALA A CB   2  
ATOM   1673  H H    . ALA A 1 50 ? -5.939  -3.079  8.324   1.00 0.00 ? 114 ALA A H    2  
ATOM   1674  H HA   . ALA A 1 50 ? -4.097  -1.271  7.000   1.00 0.00 ? 114 ALA A HA   2  
ATOM   1675  H HB1  . ALA A 1 50 ? -3.649  -2.363  9.776   1.00 0.00 ? 114 ALA A HB1  2  
ATOM   1676  H HB2  . ALA A 1 50 ? -2.501  -1.415  8.828   1.00 0.00 ? 114 ALA A HB2  2  
ATOM   1677  H HB3  . ALA A 1 50 ? -4.007  -0.681  9.379   1.00 0.00 ? 114 ALA A HB3  2  
ATOM   1678  N N    . GLU A 1 51 ? -2.829  -3.234  6.217   1.00 0.00 ? 115 GLU A N    2  
ATOM   1679  C CA   . GLU A 1 51 ? -2.156  -4.392  5.705   1.00 0.00 ? 115 GLU A CA   2  
ATOM   1680  C C    . GLU A 1 51 ? -0.733  -4.031  5.364   1.00 0.00 ? 115 GLU A C    2  
ATOM   1681  O O    . GLU A 1 51 ? -0.414  -2.844  5.178   1.00 0.00 ? 115 GLU A O    2  
ATOM   1682  C CB   . GLU A 1 51 ? -2.864  -5.008  4.475   1.00 0.00 ? 115 GLU A CB   2  
ATOM   1683  C CG   . GLU A 1 51 ? -2.817  -4.210  3.183   1.00 0.00 ? 115 GLU A CG   2  
ATOM   1684  C CD   . GLU A 1 51 ? -3.167  -5.086  1.990   1.00 0.00 ? 115 GLU A CD   2  
ATOM   1685  O OE1  . GLU A 1 51 ? -4.361  -5.234  1.651   1.00 0.00 ? 115 GLU A OE1  2  
ATOM   1686  O OE2  . GLU A 1 51 ? -2.239  -5.682  1.404   1.00 0.00 ? 115 GLU A OE2  2  
ATOM   1687  H H    . GLU A 1 51 ? -2.665  -2.360  5.803   1.00 0.00 ? 115 GLU A H    2  
ATOM   1688  H HA   . GLU A 1 51 ? -2.135  -5.122  6.500   1.00 0.00 ? 115 GLU A HA   2  
ATOM   1689  H HB2  . GLU A 1 51 ? -2.422  -5.963  4.249   1.00 0.00 ? 115 GLU A HB2  2  
ATOM   1690  H HB3  . GLU A 1 51 ? -3.908  -5.131  4.730   1.00 0.00 ? 115 GLU A HB3  2  
ATOM   1691  H HG2  . GLU A 1 51 ? -3.523  -3.396  3.245   1.00 0.00 ? 115 GLU A HG2  2  
ATOM   1692  H HG3  . GLU A 1 51 ? -1.818  -3.821  3.048   1.00 0.00 ? 115 GLU A HG3  2  
ATOM   1693  N N    . VAL A 1 52 ? 0.120   -5.017  5.325   1.00 0.00 ? 116 VAL A N    2  
ATOM   1694  C CA   . VAL A 1 52 ? 1.482   -4.815  4.929   1.00 0.00 ? 116 VAL A CA   2  
ATOM   1695  C C    . VAL A 1 52 ? 1.589   -5.201  3.476   1.00 0.00 ? 116 VAL A C    2  
ATOM   1696  O O    . VAL A 1 52 ? 1.477   -6.378  3.122   1.00 0.00 ? 116 VAL A O    2  
ATOM   1697  C CB   . VAL A 1 52 ? 2.472   -5.656  5.774   1.00 0.00 ? 116 VAL A CB   2  
ATOM   1698  C CG1  . VAL A 1 52 ? 3.908   -5.405  5.331   1.00 0.00 ? 116 VAL A CG1  2  
ATOM   1699  C CG2  . VAL A 1 52 ? 2.316   -5.336  7.249   1.00 0.00 ? 116 VAL A CG2  2  
ATOM   1700  H H    . VAL A 1 52 ? -0.183  -5.924  5.548   1.00 0.00 ? 116 VAL A H    2  
ATOM   1701  H HA   . VAL A 1 52 ? 1.714   -3.766  5.032   1.00 0.00 ? 116 VAL A HA   2  
ATOM   1702  H HB   . VAL A 1 52 ? 2.246   -6.702  5.624   1.00 0.00 ? 116 VAL A HB   2  
ATOM   1703  H HG11 . VAL A 1 52 ? 4.147   -4.359  5.455   1.00 0.00 ? 116 VAL A HG11 2  
ATOM   1704  H HG12 . VAL A 1 52 ? 4.578   -6.003  5.930   1.00 0.00 ? 116 VAL A HG12 2  
ATOM   1705  H HG13 . VAL A 1 52 ? 4.011   -5.677  4.292   1.00 0.00 ? 116 VAL A HG13 2  
ATOM   1706  H HG21 . VAL A 1 52 ? 1.306   -5.561  7.560   1.00 0.00 ? 116 VAL A HG21 2  
ATOM   1707  H HG22 . VAL A 1 52 ? 3.012   -5.932  7.821   1.00 0.00 ? 116 VAL A HG22 2  
ATOM   1708  H HG23 . VAL A 1 52 ? 2.517   -4.287  7.412   1.00 0.00 ? 116 VAL A HG23 2  
ATOM   1709  N N    . THR A 1 53 ? 1.782   -4.240  2.658   1.00 0.00 ? 117 THR A N    2  
ATOM   1710  C CA   . THR A 1 53 ? 1.809   -4.450  1.240   1.00 0.00 ? 117 THR A CA   2  
ATOM   1711  C C    . THR A 1 53 ? 3.112   -3.878  0.670   1.00 0.00 ? 117 THR A C    2  
ATOM   1712  O O    . THR A 1 53 ? 3.623   -2.878  1.180   1.00 0.00 ? 117 THR A O    2  
ATOM   1713  C CB   . THR A 1 53 ? 0.540   -3.827  0.553   1.00 0.00 ? 117 THR A CB   2  
ATOM   1714  O OG1  . THR A 1 53 ? 0.452   -4.218  -0.826  1.00 0.00 ? 117 THR A OG1  2  
ATOM   1715  C CG2  . THR A 1 53 ? 0.548   -2.315  0.647   1.00 0.00 ? 117 THR A CG2  2  
ATOM   1716  H H    . THR A 1 53 ? 1.937   -3.339  3.033   1.00 0.00 ? 117 THR A H    2  
ATOM   1717  H HA   . THR A 1 53 ? 1.808   -5.518  1.080   1.00 0.00 ? 117 THR A HA   2  
ATOM   1718  H HB   . THR A 1 53 ? -0.338  -4.202  1.059   1.00 0.00 ? 117 THR A HB   2  
ATOM   1719  H HG1  . THR A 1 53 ? -0.411  -4.639  -0.920  1.00 0.00 ? 117 THR A HG1  2  
ATOM   1720  H HG21 . THR A 1 53 ? 1.400   -1.928  0.108   1.00 0.00 ? 117 THR A HG21 2  
ATOM   1721  H HG22 . THR A 1 53 ? -0.364  -1.914  0.230   1.00 0.00 ? 117 THR A HG22 2  
ATOM   1722  H HG23 . THR A 1 53 ? 0.632   -2.033  1.686   1.00 0.00 ? 117 THR A HG23 2  
ATOM   1723  N N    . PRO A 1 54 ? 3.732   -4.560  -0.301  1.00 0.00 ? 118 PRO A N    2  
ATOM   1724  C CA   . PRO A 1 54 ? 4.967   -4.096  -0.914  1.00 0.00 ? 118 PRO A CA   2  
ATOM   1725  C C    . PRO A 1 54 ? 4.781   -2.750  -1.601  1.00 0.00 ? 118 PRO A C    2  
ATOM   1726  O O    . PRO A 1 54 ? 3.707   -2.460  -2.136  1.00 0.00 ? 118 PRO A O    2  
ATOM   1727  C CB   . PRO A 1 54 ? 5.291   -5.180  -1.945  1.00 0.00 ? 118 PRO A CB   2  
ATOM   1728  C CG   . PRO A 1 54 ? 4.001   -5.852  -2.199  1.00 0.00 ? 118 PRO A CG   2  
ATOM   1729  C CD   . PRO A 1 54 ? 3.258   -5.805  -0.906  1.00 0.00 ? 118 PRO A CD   2  
ATOM   1730  H HA   . PRO A 1 54 ? 5.772   -4.020  -0.202  1.00 0.00 ? 118 PRO A HA   2  
ATOM   1731  H HB2  . PRO A 1 54 ? 5.686   -4.726  -2.841  1.00 0.00 ? 118 PRO A HB2  2  
ATOM   1732  H HB3  . PRO A 1 54 ? 6.012   -5.872  -1.540  1.00 0.00 ? 118 PRO A HB3  2  
ATOM   1733  H HG2  . PRO A 1 54 ? 3.456   -5.313  -2.960  1.00 0.00 ? 118 PRO A HG2  2  
ATOM   1734  H HG3  . PRO A 1 54 ? 4.158   -6.873  -2.511  1.00 0.00 ? 118 PRO A HG3  2  
ATOM   1735  H HD2  . PRO A 1 54 ? 2.195   -5.753  -1.093  1.00 0.00 ? 118 PRO A HD2  2  
ATOM   1736  H HD3  . PRO A 1 54 ? 3.489   -6.655  -0.286  1.00 0.00 ? 118 PRO A HD3  2  
ATOM   1737  N N    . LEU A 1 55 ? 5.828   -1.945  -1.597  1.00 0.00 ? 119 LEU A N    2  
ATOM   1738  C CA   . LEU A 1 55 ? 5.835   -0.616  -2.221  1.00 0.00 ? 119 LEU A CA   2  
ATOM   1739  C C    . LEU A 1 55 ? 5.457   -0.697  -3.693  1.00 0.00 ? 119 LEU A C    2  
ATOM   1740  O O    . LEU A 1 55 ? 4.914   0.241   -4.256  1.00 0.00 ? 119 LEU A O    2  
ATOM   1741  C CB   . LEU A 1 55 ? 7.213   0.043   -2.069  1.00 0.00 ? 119 LEU A CB   2  
ATOM   1742  C CG   . LEU A 1 55 ? 7.731   0.212   -0.633  1.00 0.00 ? 119 LEU A CG   2  
ATOM   1743  C CD1  . LEU A 1 55 ? 9.076   0.916   -0.614  1.00 0.00 ? 119 LEU A CD1  2  
ATOM   1744  C CD2  . LEU A 1 55 ? 6.733   0.947   0.241   1.00 0.00 ? 119 LEU A CD2  2  
ATOM   1745  H H    . LEU A 1 55 ? 6.639   -2.248  -1.132  1.00 0.00 ? 119 LEU A H    2  
ATOM   1746  H HA   . LEU A 1 55 ? 5.099   -0.001  -1.730  1.00 0.00 ? 119 LEU A HA   2  
ATOM   1747  H HB2  . LEU A 1 55 ? 7.922   -0.571  -2.604  1.00 0.00 ? 119 LEU A HB2  2  
ATOM   1748  H HB3  . LEU A 1 55 ? 7.188   1.011   -2.542  1.00 0.00 ? 119 LEU A HB3  2  
ATOM   1749  H HG   . LEU A 1 55 ? 7.872   -0.780  -0.227  1.00 0.00 ? 119 LEU A HG   2  
ATOM   1750  H HD11 . LEU A 1 55 ? 8.984   1.890   -1.072  1.00 0.00 ? 119 LEU A HD11 2  
ATOM   1751  H HD12 . LEU A 1 55 ? 9.406   1.028   0.408   1.00 0.00 ? 119 LEU A HD12 2  
ATOM   1752  H HD13 . LEU A 1 55 ? 9.798   0.327   -1.160  1.00 0.00 ? 119 LEU A HD13 2  
ATOM   1753  H HD21 . LEU A 1 55 ? 5.817   0.376   0.299   1.00 0.00 ? 119 LEU A HD21 2  
ATOM   1754  H HD22 . LEU A 1 55 ? 7.148   1.065   1.230   1.00 0.00 ? 119 LEU A HD22 2  
ATOM   1755  H HD23 . LEU A 1 55 ? 6.525   1.919   -0.178  1.00 0.00 ? 119 LEU A HD23 2  
ATOM   1756  N N    . LEU A 1 56 ? 5.728   -1.842  -4.293  1.00 0.00 ? 120 LEU A N    2  
ATOM   1757  C CA   . LEU A 1 56 ? 5.393   -2.102  -5.691  1.00 0.00 ? 120 LEU A CA   2  
ATOM   1758  C C    . LEU A 1 56 ? 3.869   -2.051  -5.905  1.00 0.00 ? 120 LEU A C    2  
ATOM   1759  O O    . LEU A 1 56 ? 3.384   -1.703  -6.989  1.00 0.00 ? 120 LEU A O    2  
ATOM   1760  C CB   . LEU A 1 56 ? 5.981   -3.465  -6.116  1.00 0.00 ? 120 LEU A CB   2  
ATOM   1761  C CG   . LEU A 1 56 ? 5.238   -4.737  -5.664  1.00 0.00 ? 120 LEU A CG   2  
ATOM   1762  C CD1  . LEU A 1 56 ? 4.195   -5.124  -6.693  1.00 0.00 ? 120 LEU A CD1  2  
ATOM   1763  C CD2  . LEU A 1 56 ? 6.206   -5.878  -5.411  1.00 0.00 ? 120 LEU A CD2  2  
ATOM   1764  H H    . LEU A 1 56 ? 6.202   -2.522  -3.764  1.00 0.00 ? 120 LEU A H    2  
ATOM   1765  H HA   . LEU A 1 56 ? 5.831   -1.329  -6.295  1.00 0.00 ? 120 LEU A HA   2  
ATOM   1766  H HB2  . LEU A 1 56 ? 6.030   -3.481  -7.194  1.00 0.00 ? 120 LEU A HB2  2  
ATOM   1767  H HB3  . LEU A 1 56 ? 6.987   -3.511  -5.726  1.00 0.00 ? 120 LEU A HB3  2  
ATOM   1768  H HG   . LEU A 1 56 ? 4.693   -4.525  -4.753  1.00 0.00 ? 120 LEU A HG   2  
ATOM   1769  H HD11 . LEU A 1 56 ? 3.569   -4.257  -6.844  1.00 0.00 ? 120 LEU A HD11 2  
ATOM   1770  H HD12 . LEU A 1 56 ? 4.701   -5.365  -7.616  1.00 0.00 ? 120 LEU A HD12 2  
ATOM   1771  H HD13 . LEU A 1 56 ? 3.610   -5.965  -6.353  1.00 0.00 ? 120 LEU A HD13 2  
ATOM   1772  H HD21 . LEU A 1 56 ? 6.901   -5.600  -4.633  1.00 0.00 ? 120 LEU A HD21 2  
ATOM   1773  H HD22 . LEU A 1 56 ? 5.655   -6.755  -5.105  1.00 0.00 ? 120 LEU A HD22 2  
ATOM   1774  H HD23 . LEU A 1 56 ? 6.750   -6.094  -6.318  1.00 0.00 ? 120 LEU A HD23 2  
ATOM   1775  N N    . ASN A 1 57 ? 3.142   -2.376  -4.861  1.00 0.00 ? 121 ASN A N    2  
ATOM   1776  C CA   . ASN A 1 57 ? 1.683   -2.423  -4.878  1.00 0.00 ? 121 ASN A CA   2  
ATOM   1777  C C    . ASN A 1 57 ? 1.080   -1.088  -4.532  1.00 0.00 ? 121 ASN A C    2  
ATOM   1778  O O    . ASN A 1 57 ? -0.137  -0.922  -4.575  1.00 0.00 ? 121 ASN A O    2  
ATOM   1779  C CB   . ASN A 1 57 ? 1.148   -3.499  -3.912  1.00 0.00 ? 121 ASN A CB   2  
ATOM   1780  C CG   . ASN A 1 57 ? 1.116   -4.887  -4.493  1.00 0.00 ? 121 ASN A CG   2  
ATOM   1781  O OD1  . ASN A 1 57 ? 0.977   -5.065  -5.692  1.00 0.00 ? 121 ASN A OD1  2  
ATOM   1782  N ND2  . ASN A 1 57 ? 1.178   -5.879  -3.647  1.00 0.00 ? 121 ASN A ND2  2  
ATOM   1783  H H    . ASN A 1 57 ? 3.601   -2.575  -4.015  1.00 0.00 ? 121 ASN A H    2  
ATOM   1784  H HA   . ASN A 1 57 ? 1.378   -2.688  -5.878  1.00 0.00 ? 121 ASN A HA   2  
ATOM   1785  H HB2  . ASN A 1 57 ? 1.819   -3.534  -3.067  1.00 0.00 ? 121 ASN A HB2  2  
ATOM   1786  H HB3  . ASN A 1 57 ? 0.170   -3.257  -3.536  1.00 0.00 ? 121 ASN A HB3  2  
ATOM   1787  H HD21 . ASN A 1 57 ? 1.225   -5.663  -2.690  1.00 0.00 ? 121 ASN A HD21 2  
ATOM   1788  H HD22 . ASN A 1 57 ? 1.213   -6.794  -4.000  1.00 0.00 ? 121 ASN A HD22 2  
ATOM   1789  N N    . LEU A 1 58 ? 1.919   -0.142  -4.184  1.00 0.00 ? 122 LEU A N    2  
ATOM   1790  C CA   . LEU A 1 58 ? 1.452   1.166   -3.837  1.00 0.00 ? 122 LEU A CA   2  
ATOM   1791  C C    . LEU A 1 58 ? 1.510   2.083   -5.029  1.00 0.00 ? 122 LEU A C    2  
ATOM   1792  O O    . LEU A 1 58 ? 2.514   2.146   -5.732  1.00 0.00 ? 122 LEU A O    2  
ATOM   1793  C CB   . LEU A 1 58 ? 2.270   1.732   -2.687  1.00 0.00 ? 122 LEU A CB   2  
ATOM   1794  C CG   . LEU A 1 58 ? 2.181   0.975   -1.377  1.00 0.00 ? 122 LEU A CG   2  
ATOM   1795  C CD1  . LEU A 1 58 ? 3.014   1.665   -0.317  1.00 0.00 ? 122 LEU A CD1  2  
ATOM   1796  C CD2  . LEU A 1 58 ? 0.738   0.859   -0.929  1.00 0.00 ? 122 LEU A CD2  2  
ATOM   1797  H H    . LEU A 1 58 ? 2.884   -0.307  -4.164  1.00 0.00 ? 122 LEU A H    2  
ATOM   1798  H HA   . LEU A 1 58 ? 0.424   1.084   -3.521  1.00 0.00 ? 122 LEU A HA   2  
ATOM   1799  H HB2  . LEU A 1 58 ? 3.308   1.708   -2.987  1.00 0.00 ? 122 LEU A HB2  2  
ATOM   1800  H HB3  . LEU A 1 58 ? 1.976   2.758   -2.518  1.00 0.00 ? 122 LEU A HB3  2  
ATOM   1801  H HG   . LEU A 1 58 ? 2.569   -0.021  -1.533  1.00 0.00 ? 122 LEU A HG   2  
ATOM   1802  H HD11 . LEU A 1 58 ? 2.637   2.666   -0.168  1.00 0.00 ? 122 LEU A HD11 2  
ATOM   1803  H HD12 . LEU A 1 58 ? 2.950   1.114   0.609   1.00 0.00 ? 122 LEU A HD12 2  
ATOM   1804  H HD13 . LEU A 1 58 ? 4.042   1.718   -0.642  1.00 0.00 ? 122 LEU A HD13 2  
ATOM   1805  H HD21 . LEU A 1 58 ? 0.177   0.308   -1.669  1.00 0.00 ? 122 LEU A HD21 2  
ATOM   1806  H HD22 . LEU A 1 58 ? 0.691   0.340   0.016   1.00 0.00 ? 122 LEU A HD22 2  
ATOM   1807  H HD23 . LEU A 1 58 ? 0.313   1.847   -0.827  1.00 0.00 ? 122 LEU A HD23 2  
ATOM   1808  N N    . LYS A 1 59 ? 0.428   2.759   -5.259  1.00 0.00 ? 123 LYS A N    2  
ATOM   1809  C CA   . LYS A 1 59 ? 0.304   3.690   -6.333  1.00 0.00 ? 123 LYS A CA   2  
ATOM   1810  C C    . LYS A 1 59 ? 0.115   5.075   -5.760  1.00 0.00 ? 123 LYS A C    2  
ATOM   1811  O O    . LYS A 1 59 ? -0.350  5.213   -4.633  1.00 0.00 ? 123 LYS A O    2  
ATOM   1812  C CB   . LYS A 1 59 ? -0.920  3.373   -7.190  1.00 0.00 ? 123 LYS A CB   2  
ATOM   1813  C CG   . LYS A 1 59 ? -1.016  1.957   -7.689  1.00 0.00 ? 123 LYS A CG   2  
ATOM   1814  C CD   . LYS A 1 59 ? -2.265  1.794   -8.523  1.00 0.00 ? 123 LYS A CD   2  
ATOM   1815  C CE   . LYS A 1 59 ? -2.445  0.368   -9.005  1.00 0.00 ? 123 LYS A CE   2  
ATOM   1816  N NZ   . LYS A 1 59 ? -1.331  -0.082  -9.861  1.00 0.00 ? 123 LYS A NZ   2  
ATOM   1817  H H    . LYS A 1 59 ? -0.337  2.636   -4.658  1.00 0.00 ? 123 LYS A H    2  
ATOM   1818  H HA   . LYS A 1 59 ? 1.189   3.644   -6.947  1.00 0.00 ? 123 LYS A HA   2  
ATOM   1819  H HB2  . LYS A 1 59 ? -1.809  3.589   -6.619  1.00 0.00 ? 123 LYS A HB2  2  
ATOM   1820  H HB3  . LYS A 1 59 ? -0.909  4.032   -8.045  1.00 0.00 ? 123 LYS A HB3  2  
ATOM   1821  H HG2  . LYS A 1 59 ? -0.149  1.731   -8.291  1.00 0.00 ? 123 LYS A HG2  2  
ATOM   1822  H HG3  . LYS A 1 59 ? -1.069  1.293   -6.839  1.00 0.00 ? 123 LYS A HG3  2  
ATOM   1823  H HD2  . LYS A 1 59 ? -3.119  2.085   -7.931  1.00 0.00 ? 123 LYS A HD2  2  
ATOM   1824  H HD3  . LYS A 1 59 ? -2.170  2.454   -9.373  1.00 0.00 ? 123 LYS A HD3  2  
ATOM   1825  H HE2  . LYS A 1 59 ? -2.505  -0.283  -8.145  1.00 0.00 ? 123 LYS A HE2  2  
ATOM   1826  H HE3  . LYS A 1 59 ? -3.368  0.310   -9.565  1.00 0.00 ? 123 LYS A HE3  2  
ATOM   1827  H HZ1  . LYS A 1 59 ? -0.436  -0.087  -9.334  1.00 0.00 ? 123 LYS A HZ1  2  
ATOM   1828  H HZ2  . LYS A 1 59 ? -1.509  -1.055  -10.186 1.00 0.00 ? 123 LYS A HZ2  2  
ATOM   1829  H HZ3  . LYS A 1 59 ? -1.236  0.531   -10.695 1.00 0.00 ? 123 LYS A HZ3  2  
ATOM   1830  N N    . PRO A 1 60 ? 0.481   6.100   -6.505  1.00 0.00 ? 124 PRO A N    2  
ATOM   1831  C CA   . PRO A 1 60 ? 0.176   7.485   -6.150  1.00 0.00 ? 124 PRO A CA   2  
ATOM   1832  C C    . PRO A 1 60 ? -1.336  7.698   -6.190  1.00 0.00 ? 124 PRO A C    2  
ATOM   1833  O O    . PRO A 1 60 ? -2.035  7.064   -6.996  1.00 0.00 ? 124 PRO A O    2  
ATOM   1834  C CB   . PRO A 1 60 ? 0.850   8.308   -7.260  1.00 0.00 ? 124 PRO A CB   2  
ATOM   1835  C CG   . PRO A 1 60 ? 1.786   7.371   -7.943  1.00 0.00 ? 124 PRO A CG   2  
ATOM   1836  C CD   . PRO A 1 60 ? 1.241   5.992   -7.735  1.00 0.00 ? 124 PRO A CD   2  
ATOM   1837  H HA   . PRO A 1 60 ? 0.542   7.763   -5.175  1.00 0.00 ? 124 PRO A HA   2  
ATOM   1838  H HB2  . PRO A 1 60 ? 0.092   8.670   -7.938  1.00 0.00 ? 124 PRO A HB2  2  
ATOM   1839  H HB3  . PRO A 1 60 ? 1.376   9.145   -6.826  1.00 0.00 ? 124 PRO A HB3  2  
ATOM   1840  H HG2  . PRO A 1 60 ? 1.838   7.597   -8.997  1.00 0.00 ? 124 PRO A HG2  2  
ATOM   1841  H HG3  . PRO A 1 60 ? 2.767   7.452   -7.498  1.00 0.00 ? 124 PRO A HG3  2  
ATOM   1842  H HD2  . PRO A 1 60 ? 0.570   5.655   -8.509  1.00 0.00 ? 124 PRO A HD2  2  
ATOM   1843  H HD3  . PRO A 1 60 ? 2.037   5.276   -7.610  1.00 0.00 ? 124 PRO A HD3  2  
ATOM   1844  N N    . VAL A 1 61 ? -1.838  8.562   -5.348  1.00 0.00 ? 125 VAL A N    2  
ATOM   1845  C CA   . VAL A 1 61 ? -3.272  8.781   -5.268  1.00 0.00 ? 125 VAL A CA   2  
ATOM   1846  C C    . VAL A 1 61 ? -3.812  9.639   -6.394  1.00 0.00 ? 125 VAL A C    2  
ATOM   1847  O O    . VAL A 1 61 ? -3.120  10.527  -6.927  1.00 0.00 ? 125 VAL A O    2  
ATOM   1848  C CB   . VAL A 1 61 ? -3.735  9.375   -3.911  1.00 0.00 ? 125 VAL A CB   2  
ATOM   1849  C CG1  . VAL A 1 61 ? -3.572  8.370   -2.803  1.00 0.00 ? 125 VAL A CG1  2  
ATOM   1850  C CG2  . VAL A 1 61 ? -2.979  10.657  -3.575  1.00 0.00 ? 125 VAL A CG2  2  
ATOM   1851  H H    . VAL A 1 61 ? -1.224  9.079   -4.782  1.00 0.00 ? 125 VAL A H    2  
ATOM   1852  H HA   . VAL A 1 61 ? -3.729  7.808   -5.367  1.00 0.00 ? 125 VAL A HA   2  
ATOM   1853  H HB   . VAL A 1 61 ? -4.784  9.615   -3.998  1.00 0.00 ? 125 VAL A HB   2  
ATOM   1854  H HG11 . VAL A 1 61 ? -4.104  7.464   -3.051  1.00 0.00 ? 125 VAL A HG11 2  
ATOM   1855  H HG12 . VAL A 1 61 ? -2.523  8.153   -2.655  1.00 0.00 ? 125 VAL A HG12 2  
ATOM   1856  H HG13 . VAL A 1 61 ? -3.991  8.785   -1.898  1.00 0.00 ? 125 VAL A HG13 2  
ATOM   1857  H HG21 . VAL A 1 61 ? -3.129  11.382  -4.361  1.00 0.00 ? 125 VAL A HG21 2  
ATOM   1858  H HG22 . VAL A 1 61 ? -3.351  11.057  -2.642  1.00 0.00 ? 125 VAL A HG22 2  
ATOM   1859  H HG23 . VAL A 1 61 ? -1.927  10.440  -3.475  1.00 0.00 ? 125 VAL A HG23 2  
ATOM   1860  N N    . GLU A 1 62 ? -5.028  9.351   -6.759  1.00 0.00 ? 126 GLU A N    2  
ATOM   1861  C CA   . GLU A 1 62 ? -5.783  10.120  -7.705  1.00 0.00 ? 126 GLU A CA   2  
ATOM   1862  C C    . GLU A 1 62 ? -6.952  10.712  -6.940  1.00 0.00 ? 126 GLU A C    2  
ATOM   1863  O O    . GLU A 1 62 ? -7.230  10.268  -5.818  1.00 0.00 ? 126 GLU A O    2  
ATOM   1864  C CB   . GLU A 1 62 ? -6.267  9.236   -8.872  1.00 0.00 ? 126 GLU A CB   2  
ATOM   1865  C CG   . GLU A 1 62 ? -7.137  8.046   -8.462  1.00 0.00 ? 126 GLU A CG   2  
ATOM   1866  C CD   . GLU A 1 62 ? -7.585  7.226   -9.648  1.00 0.00 ? 126 GLU A CD   2  
ATOM   1867  O OE1  . GLU A 1 62 ? -6.818  6.362   -10.111 1.00 0.00 ? 126 GLU A OE1  2  
ATOM   1868  O OE2  . GLU A 1 62 ? -8.705  7.446   -10.154 1.00 0.00 ? 126 GLU A OE2  2  
ATOM   1869  H H    . GLU A 1 62 ? -5.481  8.577   -6.359  1.00 0.00 ? 126 GLU A H    2  
ATOM   1870  H HA   . GLU A 1 62 ? -5.152  10.916  -8.072  1.00 0.00 ? 126 GLU A HA   2  
ATOM   1871  H HB2  . GLU A 1 62 ? -6.838  9.845   -9.555  1.00 0.00 ? 126 GLU A HB2  2  
ATOM   1872  H HB3  . GLU A 1 62 ? -5.401  8.854   -9.390  1.00 0.00 ? 126 GLU A HB3  2  
ATOM   1873  H HG2  . GLU A 1 62 ? -6.568  7.409   -7.800  1.00 0.00 ? 126 GLU A HG2  2  
ATOM   1874  H HG3  . GLU A 1 62 ? -8.008  8.415   -7.941  1.00 0.00 ? 126 GLU A HG3  2  
ATOM   1875  N N    . GLU A 1 63 ? -7.610  11.694  -7.488  1.00 0.00 ? 127 GLU A N    2  
ATOM   1876  C CA   . GLU A 1 63 ? -8.722  12.299  -6.794  1.00 0.00 ? 127 GLU A CA   2  
ATOM   1877  C C    . GLU A 1 63 ? -9.874  12.643  -7.740  1.00 0.00 ? 127 GLU A C    2  
ATOM   1878  O O    . GLU A 1 63 ? -9.723  13.443  -8.684  1.00 0.00 ? 127 GLU A O    2  
ATOM   1879  C CB   . GLU A 1 63 ? -8.264  13.506  -5.942  1.00 0.00 ? 127 GLU A CB   2  
ATOM   1880  C CG   . GLU A 1 63 ? -7.537  14.611  -6.701  1.00 0.00 ? 127 GLU A CG   2  
ATOM   1881  C CD   . GLU A 1 63 ? -7.088  15.720  -5.787  1.00 0.00 ? 127 GLU A CD   2  
ATOM   1882  O OE1  . GLU A 1 63 ? -7.946  16.462  -5.274  1.00 0.00 ? 127 GLU A OE1  2  
ATOM   1883  O OE2  . GLU A 1 63 ? -5.865  15.864  -5.545  1.00 0.00 ? 127 GLU A OE2  2  
ATOM   1884  H H    . GLU A 1 63 ? -7.368  12.028  -8.377  1.00 0.00 ? 127 GLU A H    2  
ATOM   1885  H HA   . GLU A 1 63 ? -9.091  11.536  -6.123  1.00 0.00 ? 127 GLU A HA   2  
ATOM   1886  H HB2  . GLU A 1 63 ? -9.129  13.949  -5.473  1.00 0.00 ? 127 GLU A HB2  2  
ATOM   1887  H HB3  . GLU A 1 63 ? -7.605  13.142  -5.168  1.00 0.00 ? 127 GLU A HB3  2  
ATOM   1888  H HG2  . GLU A 1 63 ? -6.668  14.191  -7.187  1.00 0.00 ? 127 GLU A HG2  2  
ATOM   1889  H HG3  . GLU A 1 63 ? -8.204  15.021  -7.444  1.00 0.00 ? 127 GLU A HG3  2  
ATOM   1890  N N    . GLY A 1 64 ? -10.993 12.004  -7.517  1.00 0.00 ? 128 GLY A N    2  
ATOM   1891  C CA   . GLY A 1 64 ? -12.171 12.241  -8.288  1.00 0.00 ? 128 GLY A CA   2  
ATOM   1892  C C    . GLY A 1 64 ? -13.365 11.766  -7.525  1.00 0.00 ? 128 GLY A C    2  
ATOM   1893  O O    . GLY A 1 64 ? -13.223 10.813  -6.736  1.00 0.00 ? 128 GLY A O    2  
ATOM   1894  O OXT  . GLY A 1 64 ? -14.446 12.347  -7.647  1.00 0.00 ? 128 GLY A OXT  2  
ATOM   1895  H H    . GLY A 1 64 ? -11.051 11.326  -6.808  1.00 0.00 ? 128 GLY A H    2  
ATOM   1896  H HA2  . GLY A 1 64 ? -12.260 13.300  -8.480  1.00 0.00 ? 128 GLY A HA2  2  
ATOM   1897  H HA3  . GLY A 1 64 ? -12.113 11.703  -9.222  1.00 0.00 ? 128 GLY A HA3  2  
HETATM 1898  N N    . 2MR B 2 .  ? -16.758 -4.830  -0.882  1.00 0.00 ? 201 2MR A N    2  
HETATM 1899  C CA   . 2MR B 2 .  ? -16.861 -3.916  0.236   1.00 0.00 ? 201 2MR A CA   2  
HETATM 1900  C CB   . 2MR B 2 .  ? -15.533 -3.837  0.991   1.00 0.00 ? 201 2MR A CB   2  
HETATM 1901  C CG   . 2MR B 2 .  ? -15.579 -2.956  2.211   1.00 0.00 ? 201 2MR A CG   2  
HETATM 1902  C CD   . 2MR B 2 .  ? -14.221 -2.834  2.828   1.00 0.00 ? 201 2MR A CD   2  
HETATM 1903  N NE   . 2MR B 2 .  ? -13.254 -2.367  1.848   1.00 0.00 ? 201 2MR A NE   2  
HETATM 1904  C CZ   . 2MR B 2 .  ? -12.013 -2.090  2.106   1.00 0.00 ? 201 2MR A CZ   2  
HETATM 1905  N NH1  . 2MR B 2 .  ? -11.563 -2.243  3.393   1.00 0.00 ? 201 2MR A NH1  2  
HETATM 1906  C CQ1  . 2MR B 2 .  ? -10.236 -2.014  3.994   1.00 0.00 ? 201 2MR A CQ1  2  
HETATM 1907  N NH2  . 2MR B 2 .  ? -11.236 -1.699  1.071   1.00 0.00 ? 201 2MR A NH2  2  
HETATM 1908  C CQ2  . 2MR B 2 .  ? -9.829  -1.324  1.019   1.00 0.00 ? 201 2MR A CQ2  2  
HETATM 1909  C C    . 2MR B 2 .  ? -17.206 -2.561  -0.309  1.00 0.00 ? 201 2MR A C    2  
HETATM 1910  O O    . 2MR B 2 .  ? -18.262 -2.008  0.048   1.00 0.00 ? 201 2MR A O    2  
HETATM 1911  O OXT  . 2MR B 2 .  ? -16.435 -2.046  -1.123  1.00 0.00 ? 201 2MR A OXT  2  
HETATM 1912  H H2   . 2MR B 2 .  ? -17.647 -4.817  -1.417  1.00 0.00 ? 201 2MR A H2   2  
HETATM 1913  H H    . 2MR B 2 .  ? -16.020 -4.474  -1.521  1.00 0.00 ? 201 2MR A H    2  
HETATM 1914  H H3   . 2MR B 2 .  ? -16.522 -5.801  -0.595  1.00 0.00 ? 201 2MR A H3   2  
HETATM 1915  H HA   . 2MR B 2 .  ? -17.647 -4.237  0.905   1.00 0.00 ? 201 2MR A HA   2  
HETATM 1916  H HB2  . 2MR B 2 .  ? -14.792 -3.412  0.330   1.00 0.00 ? 201 2MR A HB2  2  
HETATM 1917  H HB3  . 2MR B 2 .  ? -15.194 -4.815  1.307   1.00 0.00 ? 201 2MR A HB3  2  
HETATM 1918  H HG2  . 2MR B 2 .  ? -16.248 -3.412  2.922   1.00 0.00 ? 201 2MR A HG2  2  
HETATM 1919  H HG3  . 2MR B 2 .  ? -15.925 -1.975  1.921   1.00 0.00 ? 201 2MR A HG3  2  
HETATM 1920  H HD2  . 2MR B 2 .  ? -13.901 -3.798  3.195   1.00 0.00 ? 201 2MR A HD2  2  
HETATM 1921  H HD3  . 2MR B 2 .  ? -14.250 -2.122  3.641   1.00 0.00 ? 201 2MR A HD3  2  
HETATM 1922  H HE   . 2MR B 2 .  ? -13.605 -2.239  0.942   1.00 0.00 ? 201 2MR A HE   2  
HETATM 1923  H HQ11 . 2MR B 2 .  ? -10.305 -2.157  5.062   1.00 0.00 ? 201 2MR A HQ11 2  
HETATM 1924  H HQ12 . 2MR B 2 .  ? -9.517  -2.702  3.578   1.00 0.00 ? 201 2MR A HQ12 2  
HETATM 1925  H HQ13 . 2MR B 2 .  ? -9.935  -0.994  3.800   1.00 0.00 ? 201 2MR A HQ13 2  
HETATM 1926  H HH2  . 2MR B 2 .  ? -11.610 -1.637  0.147   1.00 0.00 ? 201 2MR A HH2  2  
HETATM 1927  H HQ21 . 2MR B 2 .  ? -9.685  -0.394  1.552   1.00 0.00 ? 201 2MR A HQ21 2  
HETATM 1928  H HQ22 . 2MR B 2 .  ? -9.233  -2.096  1.482   1.00 0.00 ? 201 2MR A HQ22 2  
HETATM 1929  H HQ23 . 2MR B 2 .  ? -9.528  -1.197  -0.009  1.00 0.00 ? 201 2MR A HQ23 2  
HETATM 1930  H HH1  . 2MR B 2 .  ? -12.196 -2.580  4.098   1.00 0.00 ? 201 2MR A HH1  2  
ATOM   1931  N N    . ALA A 1 1  ? 19.604  -1.278  4.347   1.00 0.00 ? 65  ALA A N    3  
ATOM   1932  C CA   . ALA A 1 1  ? 20.352  -2.356  4.980   1.00 0.00 ? 65  ALA A CA   3  
ATOM   1933  C C    . ALA A 1 1  ? 20.697  -3.448  3.973   1.00 0.00 ? 65  ALA A C    3  
ATOM   1934  O O    . ALA A 1 1  ? 21.767  -3.418  3.364   1.00 0.00 ? 65  ALA A O    3  
ATOM   1935  C CB   . ALA A 1 1  ? 19.615  -2.923  6.186   1.00 0.00 ? 65  ALA A CB   3  
ATOM   1936  H H1   . ALA A 1 1  ? 18.747  -1.646  3.890   1.00 0.00 ? 65  ALA A H1   3  
ATOM   1937  H H2   . ALA A 1 1  ? 19.346  -0.524  5.015   1.00 0.00 ? 65  ALA A H2   3  
ATOM   1938  H H3   . ALA A 1 1  ? 20.185  -0.862  3.592   1.00 0.00 ? 65  ALA A H3   3  
ATOM   1939  H HA   . ALA A 1 1  ? 21.286  -1.942  5.322   1.00 0.00 ? 65  ALA A HA   3  
ATOM   1940  H HB1  . ALA A 1 1  ? 18.690  -3.377  5.863   1.00 0.00 ? 65  ALA A HB1  3  
ATOM   1941  H HB2  . ALA A 1 1  ? 20.231  -3.667  6.667   1.00 0.00 ? 65  ALA A HB2  3  
ATOM   1942  H HB3  . ALA A 1 1  ? 19.402  -2.127  6.884   1.00 0.00 ? 65  ALA A HB3  3  
ATOM   1943  N N    . SER A 1 2  ? 19.799  -4.389  3.763   1.00 0.00 ? 66  SER A N    3  
ATOM   1944  C CA   . SER A 1 2  ? 20.064  -5.467  2.843   1.00 0.00 ? 66  SER A CA   3  
ATOM   1945  C C    . SER A 1 2  ? 19.357  -5.201  1.518   1.00 0.00 ? 66  SER A C    3  
ATOM   1946  O O    . SER A 1 2  ? 19.988  -5.178  0.455   1.00 0.00 ? 66  SER A O    3  
ATOM   1947  C CB   . SER A 1 2  ? 19.574  -6.781  3.445   1.00 0.00 ? 66  SER A CB   3  
ATOM   1948  O OG   . SER A 1 2  ? 19.975  -6.888  4.816   1.00 0.00 ? 66  SER A OG   3  
ATOM   1949  H H    . SER A 1 2  ? 18.933  -4.400  4.231   1.00 0.00 ? 66  SER A H    3  
ATOM   1950  H HA   . SER A 1 2  ? 21.130  -5.529  2.683   1.00 0.00 ? 66  SER A HA   3  
ATOM   1951  H HB2  . SER A 1 2  ? 18.495  -6.816  3.394   1.00 0.00 ? 66  SER A HB2  3  
ATOM   1952  H HB3  . SER A 1 2  ? 19.990  -7.612  2.896   1.00 0.00 ? 66  SER A HB3  3  
ATOM   1953  H HG   . SER A 1 2  ? 19.223  -6.535  5.327   1.00 0.00 ? 66  SER A HG   3  
ATOM   1954  N N    . THR A 1 3  ? 18.068  -4.972  1.593   1.00 0.00 ? 67  THR A N    3  
ATOM   1955  C CA   . THR A 1 3  ? 17.267  -4.757  0.417   1.00 0.00 ? 67  THR A CA   3  
ATOM   1956  C C    . THR A 1 3  ? 16.914  -3.267  0.309   1.00 0.00 ? 67  THR A C    3  
ATOM   1957  O O    . THR A 1 3  ? 16.828  -2.569  1.327   1.00 0.00 ? 67  THR A O    3  
ATOM   1958  C CB   . THR A 1 3  ? 15.987  -5.594  0.534   1.00 0.00 ? 67  THR A CB   3  
ATOM   1959  O OG1  . THR A 1 3  ? 16.337  -6.916  1.003   1.00 0.00 ? 67  THR A OG1  3  
ATOM   1960  C CG2  . THR A 1 3  ? 15.270  -5.721  -0.806  1.00 0.00 ? 67  THR A CG2  3  
ATOM   1961  H H    . THR A 1 3  ? 17.625  -4.950  2.474   1.00 0.00 ? 67  THR A H    3  
ATOM   1962  H HA   . THR A 1 3  ? 17.823  -5.076  -0.453  1.00 0.00 ? 67  THR A HA   3  
ATOM   1963  H HB   . THR A 1 3  ? 15.331  -5.126  1.253   1.00 0.00 ? 67  THR A HB   3  
ATOM   1964  H HG1  . THR A 1 3  ? 16.003  -6.965  1.909   1.00 0.00 ? 67  THR A HG1  3  
ATOM   1965  H HG21 . THR A 1 3  ? 15.918  -6.211  -1.517  1.00 0.00 ? 67  THR A HG21 3  
ATOM   1966  H HG22 . THR A 1 3  ? 14.372  -6.309  -0.678  1.00 0.00 ? 67  THR A HG22 3  
ATOM   1967  H HG23 . THR A 1 3  ? 15.008  -4.738  -1.171  1.00 0.00 ? 67  THR A HG23 3  
ATOM   1968  N N    . GLN A 1 4  ? 16.789  -2.767  -0.896  1.00 0.00 ? 68  GLN A N    3  
ATOM   1969  C CA   . GLN A 1 4  ? 16.444  -1.382  -1.115  1.00 0.00 ? 68  GLN A CA   3  
ATOM   1970  C C    . GLN A 1 4  ? 15.146  -1.258  -1.908  1.00 0.00 ? 68  GLN A C    3  
ATOM   1971  O O    . GLN A 1 4  ? 14.930  -2.006  -2.872  1.00 0.00 ? 68  GLN A O    3  
ATOM   1972  C CB   . GLN A 1 4  ? 17.578  -0.644  -1.824  1.00 0.00 ? 68  GLN A CB   3  
ATOM   1973  C CG   . GLN A 1 4  ? 17.988  -1.248  -3.153  1.00 0.00 ? 68  GLN A CG   3  
ATOM   1974  C CD   . GLN A 1 4  ? 19.134  -0.516  -3.788  1.00 0.00 ? 68  GLN A CD   3  
ATOM   1975  O OE1  . GLN A 1 4  ? 19.978  0.064   -3.089  1.00 0.00 ? 68  GLN A OE1  3  
ATOM   1976  N NE2  . GLN A 1 4  ? 19.202  -0.557  -5.085  1.00 0.00 ? 68  GLN A NE2  3  
ATOM   1977  H H    . GLN A 1 4  ? 16.907  -3.349  -1.679  1.00 0.00 ? 68  GLN A H    3  
ATOM   1978  H HA   . GLN A 1 4  ? 16.307  -0.942  -0.140  1.00 0.00 ? 68  GLN A HA   3  
ATOM   1979  H HB2  . GLN A 1 4  ? 17.259  0.372   -2.009  1.00 0.00 ? 68  GLN A HB2  3  
ATOM   1980  H HB3  . GLN A 1 4  ? 18.441  -0.622  -1.176  1.00 0.00 ? 68  GLN A HB3  3  
ATOM   1981  H HG2  . GLN A 1 4  ? 18.290  -2.271  -2.985  1.00 0.00 ? 68  GLN A HG2  3  
ATOM   1982  H HG3  . GLN A 1 4  ? 17.143  -1.226  -3.824  1.00 0.00 ? 68  GLN A HG3  3  
ATOM   1983  H HE21 . GLN A 1 4  ? 18.512  -1.070  -5.562  1.00 0.00 ? 68  GLN A HE21 3  
ATOM   1984  H HE22 . GLN A 1 4  ? 19.924  -0.083  -5.548  1.00 0.00 ? 68  GLN A HE22 3  
ATOM   1985  N N    . PRO A 1 5  ? 14.256  -0.342  -1.497  1.00 0.00 ? 69  PRO A N    3  
ATOM   1986  C CA   . PRO A 1 5  ? 12.989  -0.072  -2.196  1.00 0.00 ? 69  PRO A CA   3  
ATOM   1987  C C    . PRO A 1 5  ? 13.183  0.353   -3.662  1.00 0.00 ? 69  PRO A C    3  
ATOM   1988  O O    . PRO A 1 5  ? 14.222  0.931   -4.035  1.00 0.00 ? 69  PRO A O    3  
ATOM   1989  C CB   . PRO A 1 5  ? 12.410  1.111   -1.417  1.00 0.00 ? 69  PRO A CB   3  
ATOM   1990  C CG   . PRO A 1 5  ? 13.001  1.003   -0.067  1.00 0.00 ? 69  PRO A CG   3  
ATOM   1991  C CD   . PRO A 1 5  ? 14.384  0.484   -0.278  1.00 0.00 ? 69  PRO A CD   3  
ATOM   1992  H HA   . PRO A 1 5  ? 12.307  -0.906  -2.138  1.00 0.00 ? 69  PRO A HA   3  
ATOM   1993  H HB2  . PRO A 1 5  ? 12.702  2.031   -1.901  1.00 0.00 ? 69  PRO A HB2  3  
ATOM   1994  H HB3  . PRO A 1 5  ? 11.332  1.049   -1.385  1.00 0.00 ? 69  PRO A HB3  3  
ATOM   1995  H HG2  . PRO A 1 5  ? 13.029  1.974   0.405   1.00 0.00 ? 69  PRO A HG2  3  
ATOM   1996  H HG3  . PRO A 1 5  ? 12.429  0.310   0.534   1.00 0.00 ? 69  PRO A HG3  3  
ATOM   1997  H HD2  . PRO A 1 5  ? 15.072  1.300   -0.434  1.00 0.00 ? 69  PRO A HD2  3  
ATOM   1998  H HD3  . PRO A 1 5  ? 14.678  -0.119  0.568   1.00 0.00 ? 69  PRO A HD3  3  
ATOM   1999  N N    . THR A 1 6  ? 12.215  0.026   -4.478  1.00 0.00 ? 70  THR A N    3  
ATOM   2000  C CA   . THR A 1 6  ? 12.166  0.430   -5.836  1.00 0.00 ? 70  THR A CA   3  
ATOM   2001  C C    . THR A 1 6  ? 11.273  1.680   -5.946  1.00 0.00 ? 70  THR A C    3  
ATOM   2002  O O    . THR A 1 6  ? 11.447  2.522   -6.832  1.00 0.00 ? 70  THR A O    3  
ATOM   2003  C CB   . THR A 1 6  ? 11.595  -0.729  -6.662  1.00 0.00 ? 70  THR A CB   3  
ATOM   2004  O OG1  . THR A 1 6  ? 12.369  -1.906  -6.383  1.00 0.00 ? 70  THR A OG1  3  
ATOM   2005  C CG2  . THR A 1 6  ? 11.662  -0.432  -8.137  1.00 0.00 ? 70  THR A CG2  3  
ATOM   2006  H H    . THR A 1 6  ? 11.488  -0.561  -4.187  1.00 0.00 ? 70  THR A H    3  
ATOM   2007  H HA   . THR A 1 6  ? 13.162  0.660   -6.183  1.00 0.00 ? 70  THR A HA   3  
ATOM   2008  H HB   . THR A 1 6  ? 10.568  -0.897  -6.369  1.00 0.00 ? 70  THR A HB   3  
ATOM   2009  H HG1  . THR A 1 6  ? 13.188  -1.612  -5.962  1.00 0.00 ? 70  THR A HG1  3  
ATOM   2010  H HG21 . THR A 1 6  ? 12.694  -0.285  -8.411  1.00 0.00 ? 70  THR A HG21 3  
ATOM   2011  H HG22 . THR A 1 6  ? 11.242  -1.260  -8.688  1.00 0.00 ? 70  THR A HG22 3  
ATOM   2012  H HG23 . THR A 1 6  ? 11.095  0.467   -8.320  1.00 0.00 ? 70  THR A HG23 3  
ATOM   2013  N N    . HIS A 1 7  ? 10.342  1.797   -5.023  1.00 0.00 ? 71  HIS A N    3  
ATOM   2014  C CA   . HIS A 1 7  ? 9.473   2.951   -4.956  1.00 0.00 ? 71  HIS A CA   3  
ATOM   2015  C C    . HIS A 1 7  ? 9.771   3.684   -3.687  1.00 0.00 ? 71  HIS A C    3  
ATOM   2016  O O    . HIS A 1 7  ? 9.953   3.064   -2.642  1.00 0.00 ? 71  HIS A O    3  
ATOM   2017  C CB   . HIS A 1 7  ? 7.985   2.565   -4.969  1.00 0.00 ? 71  HIS A CB   3  
ATOM   2018  C CG   . HIS A 1 7  ? 7.520   1.874   -6.205  1.00 0.00 ? 71  HIS A CG   3  
ATOM   2019  N ND1  . HIS A 1 7  ? 6.955   2.515   -7.281  1.00 0.00 ? 71  HIS A ND1  3  
ATOM   2020  C CD2  . HIS A 1 7  ? 7.535   0.566   -6.516  1.00 0.00 ? 71  HIS A CD2  3  
ATOM   2021  C CE1  . HIS A 1 7  ? 6.652   1.596   -8.196  1.00 0.00 ? 71  HIS A CE1  3  
ATOM   2022  N NE2  . HIS A 1 7  ? 6.989   0.389   -7.778  1.00 0.00 ? 71  HIS A NE2  3  
ATOM   2023  H H    . HIS A 1 7  ? 10.247  1.097   -4.343  1.00 0.00 ? 71  HIS A H    3  
ATOM   2024  H HA   . HIS A 1 7  ? 9.691   3.583   -5.804  1.00 0.00 ? 71  HIS A HA   3  
ATOM   2025  H HB2  . HIS A 1 7  ? 7.793   1.903   -4.140  1.00 0.00 ? 71  HIS A HB2  3  
ATOM   2026  H HB3  . HIS A 1 7  ? 7.392   3.460   -4.843  1.00 0.00 ? 71  HIS A HB3  3  
ATOM   2027  H HD1  . HIS A 1 7  ? 6.783   3.481   -7.364  1.00 0.00 ? 71  HIS A HD1  3  
ATOM   2028  H HD2  . HIS A 1 7  ? 7.897   -0.223  -5.876  1.00 0.00 ? 71  HIS A HD2  3  
ATOM   2029  H HE1  . HIS A 1 7  ? 6.194   1.810   -9.150  1.00 0.00 ? 71  HIS A HE1  3  
ATOM   2030  N N    . SER A 1 8  ? 9.839   4.971   -3.757  1.00 0.00 ? 72  SER A N    3  
ATOM   2031  C CA   . SER A 1 8  ? 10.114  5.742   -2.591  1.00 0.00 ? 72  SER A CA   3  
ATOM   2032  C C    . SER A 1 8  ? 8.826   6.297   -1.996  1.00 0.00 ? 72  SER A C    3  
ATOM   2033  O O    . SER A 1 8  ? 8.184   7.195   -2.557  1.00 0.00 ? 72  SER A O    3  
ATOM   2034  C CB   . SER A 1 8  ? 11.129  6.837   -2.899  1.00 0.00 ? 72  SER A CB   3  
ATOM   2035  O OG   . SER A 1 8  ? 12.363  6.263   -3.361  1.00 0.00 ? 72  SER A OG   3  
ATOM   2036  H H    . SER A 1 8  ? 9.684   5.424   -4.613  1.00 0.00 ? 72  SER A H    3  
ATOM   2037  H HA   . SER A 1 8  ? 10.542  5.065   -1.867  1.00 0.00 ? 72  SER A HA   3  
ATOM   2038  H HB2  . SER A 1 8  ? 10.733  7.485   -3.665  1.00 0.00 ? 72  SER A HB2  3  
ATOM   2039  H HB3  . SER A 1 8  ? 11.326  7.407   -2.004  1.00 0.00 ? 72  SER A HB3  3  
ATOM   2040  H HG   . SER A 1 8  ? 12.748  5.808   -2.598  1.00 0.00 ? 72  SER A HG   3  
ATOM   2041  N N    . TRP A 1 9  ? 8.445   5.713   -0.899  1.00 0.00 ? 73  TRP A N    3  
ATOM   2042  C CA   . TRP A 1 9  ? 7.276   6.090   -0.161  1.00 0.00 ? 73  TRP A CA   3  
ATOM   2043  C C    . TRP A 1 9  ? 7.665   6.561   1.215   1.00 0.00 ? 73  TRP A C    3  
ATOM   2044  O O    . TRP A 1 9  ? 8.707   6.145   1.745   1.00 0.00 ? 73  TRP A O    3  
ATOM   2045  C CB   . TRP A 1 9  ? 6.316   4.917   -0.058  1.00 0.00 ? 73  TRP A CB   3  
ATOM   2046  C CG   . TRP A 1 9  ? 5.651   4.580   -1.343  1.00 0.00 ? 73  TRP A CG   3  
ATOM   2047  C CD1  . TRP A 1 9  ? 5.933   3.538   -2.163  1.00 0.00 ? 73  TRP A CD1  3  
ATOM   2048  C CD2  . TRP A 1 9  ? 4.589   5.308   -1.955  1.00 0.00 ? 73  TRP A CD2  3  
ATOM   2049  N NE1  . TRP A 1 9  ? 5.103   3.562   -3.257  1.00 0.00 ? 73  TRP A NE1  3  
ATOM   2050  C CE2  . TRP A 1 9  ? 4.263   4.648   -3.147  1.00 0.00 ? 73  TRP A CE2  3  
ATOM   2051  C CE3  . TRP A 1 9  ? 3.878   6.457   -1.597  1.00 0.00 ? 73  TRP A CE3  3  
ATOM   2052  C CZ2  . TRP A 1 9  ? 3.254   5.100   -3.989  1.00 0.00 ? 73  TRP A CZ2  3  
ATOM   2053  C CZ3  . TRP A 1 9  ? 2.881   6.908   -2.425  1.00 0.00 ? 73  TRP A CZ3  3  
ATOM   2054  C CH2  . TRP A 1 9  ? 2.572   6.230   -3.612  1.00 0.00 ? 73  TRP A CH2  3  
ATOM   2055  H H    . TRP A 1 9  ? 8.981   4.973   -0.547  1.00 0.00 ? 73  TRP A H    3  
ATOM   2056  H HA   . TRP A 1 9  ? 6.784   6.893   -0.687  1.00 0.00 ? 73  TRP A HA   3  
ATOM   2057  H HB2  . TRP A 1 9  ? 6.865   4.046   0.267   1.00 0.00 ? 73  TRP A HB2  3  
ATOM   2058  H HB3  . TRP A 1 9  ? 5.550   5.135   0.668   1.00 0.00 ? 73  TRP A HB3  3  
ATOM   2059  H HD1  . TRP A 1 9  ? 6.701   2.811   -1.952  1.00 0.00 ? 73  TRP A HD1  3  
ATOM   2060  H HE1  . TRP A 1 9  ? 5.115   2.905   -3.988  1.00 0.00 ? 73  TRP A HE1  3  
ATOM   2061  H HE3  . TRP A 1 9  ? 4.106   6.990   -0.685  1.00 0.00 ? 73  TRP A HE3  3  
ATOM   2062  H HZ2  . TRP A 1 9  ? 3.002   4.585   -4.904  1.00 0.00 ? 73  TRP A HZ2  3  
ATOM   2063  H HZ3  . TRP A 1 9  ? 2.331   7.797   -2.147  1.00 0.00 ? 73  TRP A HZ3  3  
ATOM   2064  H HH2  . TRP A 1 9  ? 1.777   6.613   -4.236  1.00 0.00 ? 73  TRP A HH2  3  
ATOM   2065  N N    . LYS A 1 10 ? 6.872   7.440   1.783   1.00 0.00 ? 74  LYS A N    3  
ATOM   2066  C CA   . LYS A 1 10 ? 7.135   7.919   3.112   1.00 0.00 ? 74  LYS A CA   3  
ATOM   2067  C C    . LYS A 1 10 ? 5.937   7.713   4.022   1.00 0.00 ? 74  LYS A C    3  
ATOM   2068  O O    . LYS A 1 10 ? 4.795   7.584   3.564   1.00 0.00 ? 74  LYS A O    3  
ATOM   2069  C CB   . LYS A 1 10 ? 7.527   9.390   3.138   1.00 0.00 ? 74  LYS A CB   3  
ATOM   2070  C CG   . LYS A 1 10 ? 6.445   10.350  2.657   1.00 0.00 ? 74  LYS A CG   3  
ATOM   2071  C CD   . LYS A 1 10 ? 6.735   11.777  3.083   1.00 0.00 ? 74  LYS A CD   3  
ATOM   2072  C CE   . LYS A 1 10 ? 6.674   11.917  4.602   1.00 0.00 ? 74  LYS A CE   3  
ATOM   2073  N NZ   . LYS A 1 10 ? 6.904   13.293  5.056   1.00 0.00 ? 74  LYS A NZ   3  
ATOM   2074  H H    . LYS A 1 10 ? 6.087   7.770   1.298   1.00 0.00 ? 74  LYS A H    3  
ATOM   2075  H HA   . LYS A 1 10 ? 7.958   7.334   3.496   1.00 0.00 ? 74  LYS A HA   3  
ATOM   2076  H HB2  . LYS A 1 10 ? 7.807   9.644   4.148   1.00 0.00 ? 74  LYS A HB2  3  
ATOM   2077  H HB3  . LYS A 1 10 ? 8.391   9.515   2.502   1.00 0.00 ? 74  LYS A HB3  3  
ATOM   2078  H HG2  . LYS A 1 10 ? 6.409   10.321  1.579   1.00 0.00 ? 74  LYS A HG2  3  
ATOM   2079  H HG3  . LYS A 1 10 ? 5.494   10.041  3.064   1.00 0.00 ? 74  LYS A HG3  3  
ATOM   2080  H HD2  . LYS A 1 10 ? 7.727   12.040  2.744   1.00 0.00 ? 74  LYS A HD2  3  
ATOM   2081  H HD3  . LYS A 1 10 ? 6.007   12.435  2.634   1.00 0.00 ? 74  LYS A HD3  3  
ATOM   2082  H HE2  . LYS A 1 10 ? 5.698   11.605  4.944   1.00 0.00 ? 74  LYS A HE2  3  
ATOM   2083  H HE3  . LYS A 1 10 ? 7.419   11.279  5.052   1.00 0.00 ? 74  LYS A HE3  3  
ATOM   2084  H HZ1  . LYS A 1 10 ? 6.227   13.953  4.629   1.00 0.00 ? 74  LYS A HZ1  3  
ATOM   2085  H HZ2  . LYS A 1 10 ? 6.804   13.343  6.091   1.00 0.00 ? 74  LYS A HZ2  3  
ATOM   2086  H HZ3  . LYS A 1 10 ? 7.865   13.605  4.817   1.00 0.00 ? 74  LYS A HZ3  3  
ATOM   2087  N N    . VAL A 1 11 ? 6.220   7.646   5.299   1.00 0.00 ? 75  VAL A N    3  
ATOM   2088  C CA   . VAL A 1 11 ? 5.214   7.538   6.328   1.00 0.00 ? 75  VAL A CA   3  
ATOM   2089  C C    . VAL A 1 11 ? 4.349   8.797   6.330   1.00 0.00 ? 75  VAL A C    3  
ATOM   2090  O O    . VAL A 1 11 ? 4.867   9.905   6.222   1.00 0.00 ? 75  VAL A O    3  
ATOM   2091  C CB   . VAL A 1 11 ? 5.876   7.349   7.717   1.00 0.00 ? 75  VAL A CB   3  
ATOM   2092  C CG1  . VAL A 1 11 ? 4.841   7.247   8.819   1.00 0.00 ? 75  VAL A CG1  3  
ATOM   2093  C CG2  . VAL A 1 11 ? 6.753   6.119   7.716   1.00 0.00 ? 75  VAL A CG2  3  
ATOM   2094  H H    . VAL A 1 11 ? 7.166   7.685   5.565   1.00 0.00 ? 75  VAL A H    3  
ATOM   2095  H HA   . VAL A 1 11 ? 4.595   6.679   6.114   1.00 0.00 ? 75  VAL A HA   3  
ATOM   2096  H HB   . VAL A 1 11 ? 6.503   8.206   7.916   1.00 0.00 ? 75  VAL A HB   3  
ATOM   2097  H HG11 . VAL A 1 11 ? 4.202   6.396   8.636   1.00 0.00 ? 75  VAL A HG11 3  
ATOM   2098  H HG12 . VAL A 1 11 ? 5.337   7.126   9.771   1.00 0.00 ? 75  VAL A HG12 3  
ATOM   2099  H HG13 . VAL A 1 11 ? 4.247   8.148   8.833   1.00 0.00 ? 75  VAL A HG13 3  
ATOM   2100  H HG21 . VAL A 1 11 ? 7.516   6.218   6.959   1.00 0.00 ? 75  VAL A HG21 3  
ATOM   2101  H HG22 . VAL A 1 11 ? 7.215   6.024   8.686   1.00 0.00 ? 75  VAL A HG22 3  
ATOM   2102  H HG23 . VAL A 1 11 ? 6.152   5.244   7.516   1.00 0.00 ? 75  VAL A HG23 3  
ATOM   2103  N N    . GLY A 1 12 ? 3.055   8.618   6.421   1.00 0.00 ? 76  GLY A N    3  
ATOM   2104  C CA   . GLY A 1 12 ? 2.161   9.746   6.459   1.00 0.00 ? 76  GLY A CA   3  
ATOM   2105  C C    . GLY A 1 12 ? 1.778   10.222  5.084   1.00 0.00 ? 76  GLY A C    3  
ATOM   2106  O O    . GLY A 1 12 ? 1.430   11.394  4.897   1.00 0.00 ? 76  GLY A O    3  
ATOM   2107  H H    . GLY A 1 12 ? 2.693   7.706   6.479   1.00 0.00 ? 76  GLY A H    3  
ATOM   2108  H HA2  . GLY A 1 12 ? 1.265   9.468   6.994   1.00 0.00 ? 76  GLY A HA2  3  
ATOM   2109  H HA3  . GLY A 1 12 ? 2.647   10.555  6.982   1.00 0.00 ? 76  GLY A HA3  3  
ATOM   2110  N N    . ASP A 1 13 ? 1.866   9.348   4.111   1.00 0.00 ? 77  ASP A N    3  
ATOM   2111  C CA   . ASP A 1 13 ? 1.473   9.702   2.756   1.00 0.00 ? 77  ASP A CA   3  
ATOM   2112  C C    . ASP A 1 13 ? 0.285   8.901   2.389   1.00 0.00 ? 77  ASP A C    3  
ATOM   2113  O O    . ASP A 1 13 ? 0.050   7.821   2.954   1.00 0.00 ? 77  ASP A O    3  
ATOM   2114  C CB   . ASP A 1 13 ? 2.537   9.332   1.755   1.00 0.00 ? 77  ASP A CB   3  
ATOM   2115  C CG   . ASP A 1 13 ? 2.592   10.262  0.536   1.00 0.00 ? 77  ASP A CG   3  
ATOM   2116  O OD1  . ASP A 1 13 ? 1.548   10.859  0.135   1.00 0.00 ? 77  ASP A OD1  3  
ATOM   2117  O OD2  . ASP A 1 13 ? 3.693   10.451  -0.015  1.00 0.00 ? 77  ASP A OD2  3  
ATOM   2118  H H    . ASP A 1 13 ? 2.209   8.450   4.289   1.00 0.00 ? 77  ASP A H    3  
ATOM   2119  H HA   . ASP A 1 13 ? 1.269   10.760  2.692   1.00 0.00 ? 77  ASP A HA   3  
ATOM   2120  H HB2  . ASP A 1 13 ? 3.476   9.254   2.264   1.00 0.00 ? 77  ASP A HB2  3  
ATOM   2121  H HB3  . ASP A 1 13 ? 2.295   8.340   1.402   1.00 0.00 ? 77  ASP A HB3  3  
ATOM   2122  N N    . LYS A 1 14 ? -0.427  9.378   1.446   1.00 0.00 ? 78  LYS A N    3  
ATOM   2123  C CA   . LYS A 1 14 ? -1.515  8.677   0.917   1.00 0.00 ? 78  LYS A CA   3  
ATOM   2124  C C    . LYS A 1 14 ? -1.056  7.948   -0.312  1.00 0.00 ? 78  LYS A C    3  
ATOM   2125  O O    . LYS A 1 14 ? -0.380  8.509   -1.168  1.00 0.00 ? 78  LYS A O    3  
ATOM   2126  C CB   . LYS A 1 14 ? -2.686  9.597   0.585   1.00 0.00 ? 78  LYS A CB   3  
ATOM   2127  C CG   . LYS A 1 14 ? -3.522  10.045  1.770   1.00 0.00 ? 78  LYS A CG   3  
ATOM   2128  C CD   . LYS A 1 14 ? -4.294  8.876   2.369   1.00 0.00 ? 78  LYS A CD   3  
ATOM   2129  C CE   . LYS A 1 14 ? -5.246  9.318   3.476   1.00 0.00 ? 78  LYS A CE   3  
ATOM   2130  N NZ   . LYS A 1 14 ? -6.321  10.215  2.978   1.00 0.00 ? 78  LYS A NZ   3  
ATOM   2131  H H    . LYS A 1 14 ? -0.156  10.231  1.044   1.00 0.00 ? 78  LYS A H    3  
ATOM   2132  H HA   . LYS A 1 14 ? -1.815  7.966   1.671   1.00 0.00 ? 78  LYS A HA   3  
ATOM   2133  H HB2  . LYS A 1 14 ? -2.307  10.481  0.096   1.00 0.00 ? 78  LYS A HB2  3  
ATOM   2134  H HB3  . LYS A 1 14 ? -3.334  9.074   -0.100  1.00 0.00 ? 78  LYS A HB3  3  
ATOM   2135  H HG2  . LYS A 1 14 ? -2.878  10.473  2.522   1.00 0.00 ? 78  LYS A HG2  3  
ATOM   2136  H HG3  . LYS A 1 14 ? -4.223  10.785  1.419   1.00 0.00 ? 78  LYS A HG3  3  
ATOM   2137  H HD2  . LYS A 1 14 ? -4.871  8.409   1.585   1.00 0.00 ? 78  LYS A HD2  3  
ATOM   2138  H HD3  . LYS A 1 14 ? -3.590  8.159   2.767   1.00 0.00 ? 78  LYS A HD3  3  
ATOM   2139  H HE2  . LYS A 1 14 ? -5.702  8.441   3.912   1.00 0.00 ? 78  LYS A HE2  3  
ATOM   2140  H HE3  . LYS A 1 14 ? -4.673  9.831   4.232   1.00 0.00 ? 78  LYS A HE3  3  
ATOM   2141  H HZ1  . LYS A 1 14 ? -6.880  9.741   2.228   1.00 0.00 ? 78  LYS A HZ1  3  
ATOM   2142  H HZ2  . LYS A 1 14 ? -6.979  10.458  3.746   1.00 0.00 ? 78  LYS A HZ2  3  
ATOM   2143  H HZ3  . LYS A 1 14 ? -5.944  11.100  2.583   1.00 0.00 ? 78  LYS A HZ3  3  
ATOM   2144  N N    . CYS A 1 15 ? -1.377  6.728   -0.366  1.00 0.00 ? 79  CYS A N    3  
ATOM   2145  C CA   . CYS A 1 15 ? -1.083  5.895   -1.481  1.00 0.00 ? 79  CYS A CA   3  
ATOM   2146  C C    . CYS A 1 15 ? -2.310  5.091   -1.797  1.00 0.00 ? 79  CYS A C    3  
ATOM   2147  O O    . CYS A 1 15 ? -3.324  5.201   -1.110  1.00 0.00 ? 79  CYS A O    3  
ATOM   2148  C CB   . CYS A 1 15 ? 0.074   4.959   -1.129  1.00 0.00 ? 79  CYS A CB   3  
ATOM   2149  S SG   . CYS A 1 15 ? -0.198  3.975   0.371   1.00 0.00 ? 79  CYS A SG   3  
ATOM   2150  H H    . CYS A 1 15 ? -1.840  6.328   0.402   1.00 0.00 ? 79  CYS A H    3  
ATOM   2151  H HA   . CYS A 1 15 ? -0.802  6.507   -2.325  1.00 0.00 ? 79  CYS A HA   3  
ATOM   2152  H HB2  . CYS A 1 15 ? 0.216   4.273   -1.953  1.00 0.00 ? 79  CYS A HB2  3  
ATOM   2153  H HB3  . CYS A 1 15 ? 0.978   5.536   -1.006  1.00 0.00 ? 79  CYS A HB3  3  
ATOM   2154  H HG   . CYS A 1 15 ? -1.297  4.384   0.995   1.00 0.00 ? 79  CYS A HG   3  
ATOM   2155  N N    . MET A 1 16 ? -2.257  4.338   -2.824  1.00 0.00 ? 80  MET A N    3  
ATOM   2156  C CA   . MET A 1 16 ? -3.306  3.428   -3.106  1.00 0.00 ? 80  MET A CA   3  
ATOM   2157  C C    . MET A 1 16 ? -2.714  2.082   -2.991  1.00 0.00 ? 80  MET A C    3  
ATOM   2158  O O    . MET A 1 16 ? -1.674  1.824   -3.565  1.00 0.00 ? 80  MET A O    3  
ATOM   2159  C CB   . MET A 1 16 ? -3.918  3.623   -4.492  1.00 0.00 ? 80  MET A CB   3  
ATOM   2160  C CG   . MET A 1 16 ? -4.318  5.049   -4.787  1.00 0.00 ? 80  MET A CG   3  
ATOM   2161  S SD   . MET A 1 16 ? -5.368  5.224   -6.237  1.00 0.00 ? 80  MET A SD   3  
ATOM   2162  C CE   . MET A 1 16 ? -6.830  4.342   -5.682  1.00 0.00 ? 80  MET A CE   3  
ATOM   2163  H H    . MET A 1 16 ? -1.466  4.387   -3.407  1.00 0.00 ? 80  MET A H    3  
ATOM   2164  H HA   . MET A 1 16 ? -4.063  3.544   -2.345  1.00 0.00 ? 80  MET A HA   3  
ATOM   2165  H HB2  . MET A 1 16 ? -3.209  3.295   -5.234  1.00 0.00 ? 80  MET A HB2  3  
ATOM   2166  H HB3  . MET A 1 16 ? -4.797  3.002   -4.560  1.00 0.00 ? 80  MET A HB3  3  
ATOM   2167  H HG2  . MET A 1 16 ? -4.824  5.467   -3.930  1.00 0.00 ? 80  MET A HG2  3  
ATOM   2168  H HG3  . MET A 1 16 ? -3.391  5.576   -4.967  1.00 0.00 ? 80  MET A HG3  3  
ATOM   2169  H HE1  . MET A 1 16 ? -7.172  4.783   -4.757  1.00 0.00 ? 80  MET A HE1  3  
ATOM   2170  H HE2  . MET A 1 16 ? -7.606  4.422   -6.427  1.00 0.00 ? 80  MET A HE2  3  
ATOM   2171  H HE3  . MET A 1 16 ? -6.592  3.301   -5.515  1.00 0.00 ? 80  MET A HE3  3  
ATOM   2172  N N    . ALA A 1 17 ? -3.339  1.249   -2.265  1.00 0.00 ? 81  ALA A N    3  
ATOM   2173  C CA   . ALA A 1 17 ? -2.816  -0.043  -2.009  1.00 0.00 ? 81  ALA A CA   3  
ATOM   2174  C C    . ALA A 1 17 ? -3.744  -1.049  -2.558  1.00 0.00 ? 81  ALA A C    3  
ATOM   2175  O O    . ALA A 1 17 ? -4.944  -0.786  -2.688  1.00 0.00 ? 81  ALA A O    3  
ATOM   2176  C CB   . ALA A 1 17 ? -2.664  -0.249  -0.522  1.00 0.00 ? 81  ALA A CB   3  
ATOM   2177  H H    . ALA A 1 17 ? -4.217  1.498   -1.894  1.00 0.00 ? 81  ALA A H    3  
ATOM   2178  H HA   . ALA A 1 17 ? -1.845  -0.139  -2.469  1.00 0.00 ? 81  ALA A HA   3  
ATOM   2179  H HB1  . ALA A 1 17 ? -3.627  -0.104  -0.052  1.00 0.00 ? 81  ALA A HB1  3  
ATOM   2180  H HB2  . ALA A 1 17 ? -2.326  -1.256  -0.324  1.00 0.00 ? 81  ALA A HB2  3  
ATOM   2181  H HB3  . ALA A 1 17 ? -1.958  0.462   -0.123  1.00 0.00 ? 81  ALA A HB3  3  
ATOM   2182  N N    . VAL A 1 18 ? -3.218  -2.171  -2.901  1.00 0.00 ? 82  VAL A N    3  
ATOM   2183  C CA   . VAL A 1 18 ? -4.020  -3.230  -3.396  1.00 0.00 ? 82  VAL A CA   3  
ATOM   2184  C C    . VAL A 1 18 ? -4.497  -4.008  -2.205  1.00 0.00 ? 82  VAL A C    3  
ATOM   2185  O O    . VAL A 1 18 ? -3.695  -4.603  -1.495  1.00 0.00 ? 82  VAL A O    3  
ATOM   2186  C CB   . VAL A 1 18 ? -3.214  -4.150  -4.353  1.00 0.00 ? 82  VAL A CB   3  
ATOM   2187  C CG1  . VAL A 1 18 ? -4.069  -5.300  -4.852  1.00 0.00 ? 82  VAL A CG1  3  
ATOM   2188  C CG2  . VAL A 1 18 ? -2.669  -3.350  -5.528  1.00 0.00 ? 82  VAL A CG2  3  
ATOM   2189  H H    . VAL A 1 18 ? -2.251  -2.291  -2.801  1.00 0.00 ? 82  VAL A H    3  
ATOM   2190  H HA   . VAL A 1 18 ? -4.871  -2.821  -3.918  1.00 0.00 ? 82  VAL A HA   3  
ATOM   2191  H HB   . VAL A 1 18 ? -2.378  -4.561  -3.806  1.00 0.00 ? 82  VAL A HB   3  
ATOM   2192  H HG11 . VAL A 1 18 ? -4.927  -4.906  -5.378  1.00 0.00 ? 82  VAL A HG11 3  
ATOM   2193  H HG12 . VAL A 1 18 ? -3.489  -5.917  -5.523  1.00 0.00 ? 82  VAL A HG12 3  
ATOM   2194  H HG13 . VAL A 1 18 ? -4.402  -5.892  -4.013  1.00 0.00 ? 82  VAL A HG13 3  
ATOM   2195  H HG21 . VAL A 1 18 ? -2.018  -2.570  -5.162  1.00 0.00 ? 82  VAL A HG21 3  
ATOM   2196  H HG22 . VAL A 1 18 ? -2.113  -4.005  -6.182  1.00 0.00 ? 82  VAL A HG22 3  
ATOM   2197  H HG23 . VAL A 1 18 ? -3.490  -2.908  -6.073  1.00 0.00 ? 82  VAL A HG23 3  
ATOM   2198  N N    . TRP A 1 19 ? -5.789  -3.961  -1.975  1.00 0.00 ? 83  TRP A N    3  
ATOM   2199  C CA   . TRP A 1 19 ? -6.396  -4.621  -0.863  1.00 0.00 ? 83  TRP A CA   3  
ATOM   2200  C C    . TRP A 1 19 ? -6.271  -6.093  -1.066  1.00 0.00 ? 83  TRP A C    3  
ATOM   2201  O O    . TRP A 1 19 ? -6.814  -6.630  -2.025  1.00 0.00 ? 83  TRP A O    3  
ATOM   2202  C CB   . TRP A 1 19 ? -7.873  -4.230  -0.750  1.00 0.00 ? 83  TRP A CB   3  
ATOM   2203  C CG   . TRP A 1 19 ? -8.518  -4.627  0.554   1.00 0.00 ? 83  TRP A CG   3  
ATOM   2204  C CD1  . TRP A 1 19 ? -7.909  -4.728  1.758   1.00 0.00 ? 83  TRP A CD1  3  
ATOM   2205  C CD2  . TRP A 1 19 ? -9.896  -4.915  0.792   1.00 0.00 ? 83  TRP A CD2  3  
ATOM   2206  N NE1  . TRP A 1 19 ? -8.797  -5.082  2.721   1.00 0.00 ? 83  TRP A NE1  3  
ATOM   2207  C CE2  . TRP A 1 19 ? -10.028 -5.199  2.164   1.00 0.00 ? 83  TRP A CE2  3  
ATOM   2208  C CE3  . TRP A 1 19 ? -11.024 -4.969  -0.010  1.00 0.00 ? 83  TRP A CE3  3  
ATOM   2209  C CZ2  . TRP A 1 19 ? -11.241 -5.530  2.746   1.00 0.00 ? 83  TRP A CZ2  3  
ATOM   2210  C CZ3  . TRP A 1 19 ? -12.231 -5.296  0.568   1.00 0.00 ? 83  TRP A CZ3  3  
ATOM   2211  C CH2  . TRP A 1 19 ? -12.326 -5.573  1.936   1.00 0.00 ? 83  TRP A CH2  3  
ATOM   2212  H H    . TRP A 1 19 ? -6.353  -3.455  -2.600  1.00 0.00 ? 83  TRP A H    3  
ATOM   2213  H HA   . TRP A 1 19 ? -5.882  -4.324  0.038   1.00 0.00 ? 83  TRP A HA   3  
ATOM   2214  H HB2  . TRP A 1 19 ? -7.957  -3.162  -0.868  1.00 0.00 ? 83  TRP A HB2  3  
ATOM   2215  H HB3  . TRP A 1 19 ? -8.415  -4.710  -1.552  1.00 0.00 ? 83  TRP A HB3  3  
ATOM   2216  H HD1  . TRP A 1 19 ? -6.857  -4.564  1.907   1.00 0.00 ? 83  TRP A HD1  3  
ATOM   2217  H HE1  . TRP A 1 19 ? -8.575  -5.220  3.668   1.00 0.00 ? 83  TRP A HE1  3  
ATOM   2218  H HE3  . TRP A 1 19 ? -10.959 -4.750  -1.065  1.00 0.00 ? 83  TRP A HE3  3  
ATOM   2219  H HZ2  . TRP A 1 19 ? -11.332 -5.747  3.800   1.00 0.00 ? 83  TRP A HZ2  3  
ATOM   2220  H HZ3  . TRP A 1 19 ? -13.131 -5.339  -0.029  1.00 0.00 ? 83  TRP A HZ3  3  
ATOM   2221  H HH2  . TRP A 1 19 ? -13.290 -5.817  2.350   1.00 0.00 ? 83  TRP A HH2  3  
ATOM   2222  N N    . SER A 1 20 ? -5.580  -6.729  -0.168  1.00 0.00 ? 84  SER A N    3  
ATOM   2223  C CA   . SER A 1 20 ? -5.301  -8.155  -0.208  1.00 0.00 ? 84  SER A CA   3  
ATOM   2224  C C    . SER A 1 20 ? -6.602  -8.986  -0.272  1.00 0.00 ? 84  SER A C    3  
ATOM   2225  O O    . SER A 1 20 ? -6.610  -10.121 -0.743  1.00 0.00 ? 84  SER A O    3  
ATOM   2226  C CB   . SER A 1 20 ? -4.471  -8.521  1.042   1.00 0.00 ? 84  SER A CB   3  
ATOM   2227  O OG   . SER A 1 20 ? -4.064  -9.885  1.061   1.00 0.00 ? 84  SER A OG   3  
ATOM   2228  H H    . SER A 1 20 ? -5.209  -6.192  0.574   1.00 0.00 ? 84  SER A H    3  
ATOM   2229  H HA   . SER A 1 20 ? -4.703  -8.359  -1.084  1.00 0.00 ? 84  SER A HA   3  
ATOM   2230  H HB2  . SER A 1 20 ? -3.587  -7.901  1.083   1.00 0.00 ? 84  SER A HB2  3  
ATOM   2231  H HB3  . SER A 1 20 ? -5.074  -8.327  1.917   1.00 0.00 ? 84  SER A HB3  3  
ATOM   2232  H HG   . SER A 1 20 ? -3.442  -9.965  1.798   1.00 0.00 ? 84  SER A HG   3  
ATOM   2233  N N    . GLU A 1 21 ? -7.688  -8.400  0.168   1.00 0.00 ? 85  GLU A N    3  
ATOM   2234  C CA   . GLU A 1 21 ? -8.944  -9.094  0.215   1.00 0.00 ? 85  GLU A CA   3  
ATOM   2235  C C    . GLU A 1 21 ? -9.689  -9.042  -1.113  1.00 0.00 ? 85  GLU A C    3  
ATOM   2236  O O    . GLU A 1 21 ? -10.318 -10.016 -1.506  1.00 0.00 ? 85  GLU A O    3  
ATOM   2237  C CB   . GLU A 1 21 ? -9.803  -8.512  1.295   1.00 0.00 ? 85  GLU A CB   3  
ATOM   2238  C CG   . GLU A 1 21 ? -9.130  -8.455  2.650   1.00 0.00 ? 85  GLU A CG   3  
ATOM   2239  C CD   . GLU A 1 21 ? -8.692  -9.809  3.165   1.00 0.00 ? 85  GLU A CD   3  
ATOM   2240  O OE1  . GLU A 1 21 ? -9.538  -10.557 3.688   1.00 0.00 ? 85  GLU A OE1  3  
ATOM   2241  O OE2  . GLU A 1 21 ? -7.500  -10.156 3.044   1.00 0.00 ? 85  GLU A OE2  3  
ATOM   2242  H H    . GLU A 1 21 ? -7.623  -7.471  0.473   1.00 0.00 ? 85  GLU A H    3  
ATOM   2243  H HA   . GLU A 1 21 ? -8.746  -10.124 0.468   1.00 0.00 ? 85  GLU A HA   3  
ATOM   2244  H HB2  . GLU A 1 21 ? -10.075 -7.507  1.004   1.00 0.00 ? 85  GLU A HB2  3  
ATOM   2245  H HB3  . GLU A 1 21 ? -10.697 -9.106  1.367   1.00 0.00 ? 85  GLU A HB3  3  
ATOM   2246  H HG2  . GLU A 1 21 ? -8.286  -7.791  2.541   1.00 0.00 ? 85  GLU A HG2  3  
ATOM   2247  H HG3  . GLU A 1 21 ? -9.803  -7.977  3.342   1.00 0.00 ? 85  GLU A HG3  3  
ATOM   2248  N N    . ASP A 1 22 ? -9.632  -7.908  -1.794  1.00 0.00 ? 86  ASP A N    3  
ATOM   2249  C CA   . ASP A 1 22 ? -10.419 -7.753  -3.032  1.00 0.00 ? 86  ASP A CA   3  
ATOM   2250  C C    . ASP A 1 22 ? -9.534  -7.819  -4.268  1.00 0.00 ? 86  ASP A C    3  
ATOM   2251  O O    . ASP A 1 22 ? -10.001 -8.099  -5.367  1.00 0.00 ? 86  ASP A O    3  
ATOM   2252  C CB   . ASP A 1 22 ? -11.139 -6.407  -3.001  1.00 0.00 ? 86  ASP A CB   3  
ATOM   2253  C CG   . ASP A 1 22 ? -12.248 -6.276  -4.011  1.00 0.00 ? 86  ASP A CG   3  
ATOM   2254  O OD1  . ASP A 1 22 ? -12.005 -5.874  -5.146  1.00 0.00 ? 86  ASP A OD1  3  
ATOM   2255  O OD2  . ASP A 1 22 ? -13.414 -6.539  -3.644  1.00 0.00 ? 86  ASP A OD2  3  
ATOM   2256  H H    . ASP A 1 22 ? -9.078  -7.177  -1.450  1.00 0.00 ? 86  ASP A H    3  
ATOM   2257  H HA   . ASP A 1 22 ? -11.157 -8.538  -3.074  1.00 0.00 ? 86  ASP A HA   3  
ATOM   2258  H HB2  . ASP A 1 22 ? -11.589 -6.299  -2.027  1.00 0.00 ? 86  ASP A HB2  3  
ATOM   2259  H HB3  . ASP A 1 22 ? -10.422 -5.615  -3.161  1.00 0.00 ? 86  ASP A HB3  3  
ATOM   2260  N N    . GLY A 1 23 ? -8.253  -7.596  -4.069  1.00 0.00 ? 87  GLY A N    3  
ATOM   2261  C CA   . GLY A 1 23 ? -7.291  -7.615  -5.165  1.00 0.00 ? 87  GLY A CA   3  
ATOM   2262  C C    . GLY A 1 23 ? -7.256  -6.307  -5.956  1.00 0.00 ? 87  GLY A C    3  
ATOM   2263  O O    . GLY A 1 23 ? -6.622  -6.222  -7.008  1.00 0.00 ? 87  GLY A O    3  
ATOM   2264  H H    . GLY A 1 23 ? -7.924  -7.429  -3.157  1.00 0.00 ? 87  GLY A H    3  
ATOM   2265  H HA2  . GLY A 1 23 ? -6.308  -7.803  -4.760  1.00 0.00 ? 87  GLY A HA2  3  
ATOM   2266  H HA3  . GLY A 1 23 ? -7.554  -8.422  -5.832  1.00 0.00 ? 87  GLY A HA3  3  
ATOM   2267  N N    . GLN A 1 24 ? -7.940  -5.297  -5.467  1.00 0.00 ? 88  GLN A N    3  
ATOM   2268  C CA   . GLN A 1 24 ? -8.010  -4.006  -6.159  1.00 0.00 ? 88  GLN A CA   3  
ATOM   2269  C C    . GLN A 1 24 ? -7.353  -2.907  -5.362  1.00 0.00 ? 88  GLN A C    3  
ATOM   2270  O O    . GLN A 1 24 ? -7.066  -3.091  -4.187  1.00 0.00 ? 88  GLN A O    3  
ATOM   2271  C CB   . GLN A 1 24 ? -9.438  -3.654  -6.507  1.00 0.00 ? 88  GLN A CB   3  
ATOM   2272  C CG   . GLN A 1 24 ? -10.046 -4.550  -7.559  1.00 0.00 ? 88  GLN A CG   3  
ATOM   2273  C CD   . GLN A 1 24 ? -9.380  -4.434  -8.915  1.00 0.00 ? 88  GLN A CD   3  
ATOM   2274  O OE1  . GLN A 1 24 ? -9.778  -3.630  -9.738  1.00 0.00 ? 88  GLN A OE1  3  
ATOM   2275  N NE2  . GLN A 1 24 ? -8.365  -5.223  -9.157  1.00 0.00 ? 88  GLN A NE2  3  
ATOM   2276  H H    . GLN A 1 24 ? -8.375  -5.401  -4.596  1.00 0.00 ? 88  GLN A H    3  
ATOM   2277  H HA   . GLN A 1 24 ? -7.450  -4.118  -7.076  1.00 0.00 ? 88  GLN A HA   3  
ATOM   2278  H HB2  . GLN A 1 24 ? -10.038 -3.736  -5.613  1.00 0.00 ? 88  GLN A HB2  3  
ATOM   2279  H HB3  . GLN A 1 24 ? -9.471  -2.635  -6.857  1.00 0.00 ? 88  GLN A HB3  3  
ATOM   2280  H HG2  . GLN A 1 24 ? -9.967  -5.572  -7.224  1.00 0.00 ? 88  GLN A HG2  3  
ATOM   2281  H HG3  . GLN A 1 24 ? -11.082 -4.269  -7.660  1.00 0.00 ? 88  GLN A HG3  3  
ATOM   2282  H HE21 . GLN A 1 24 ? -8.070  -5.854  -8.464  1.00 0.00 ? 88  GLN A HE21 3  
ATOM   2283  H HE22 . GLN A 1 24 ? -7.936  -5.168  -10.036 1.00 0.00 ? 88  GLN A HE22 3  
ATOM   2284  N N    . CYS A 1 25 ? -7.167  -1.756  -5.970  1.00 0.00 ? 89  CYS A N    3  
ATOM   2285  C CA   . CYS A 1 25 ? -6.476  -0.666  -5.305  1.00 0.00 ? 89  CYS A CA   3  
ATOM   2286  C C    . CYS A 1 25 ? -7.432  0.351   -4.695  1.00 0.00 ? 89  CYS A C    3  
ATOM   2287  O O    . CYS A 1 25 ? -8.426  0.749   -5.309  1.00 0.00 ? 89  CYS A O    3  
ATOM   2288  C CB   . CYS A 1 25 ? -5.429  -0.012  -6.215  1.00 0.00 ? 89  CYS A CB   3  
ATOM   2289  S SG   . CYS A 1 25 ? -6.030  0.488   -7.838  1.00 0.00 ? 89  CYS A SG   3  
ATOM   2290  H H    . CYS A 1 25 ? -7.535  -1.618  -6.871  1.00 0.00 ? 89  CYS A H    3  
ATOM   2291  H HA   . CYS A 1 25 ? -5.958  -1.119  -4.472  1.00 0.00 ? 89  CYS A HA   3  
ATOM   2292  H HB2  . CYS A 1 25 ? -5.066  0.875   -5.719  1.00 0.00 ? 89  CYS A HB2  3  
ATOM   2293  H HB3  . CYS A 1 25 ? -4.606  -0.697  -6.357  1.00 0.00 ? 89  CYS A HB3  3  
ATOM   2294  H HG   . CYS A 1 25 ? -6.100  1.814   -7.869  1.00 0.00 ? 89  CYS A HG   3  
ATOM   2295  N N    . TYR A 1 26 ? -7.135  0.728   -3.470  1.00 0.00 ? 90  TYR A N    3  
ATOM   2296  C CA   . TYR A 1 26 ? -7.940  1.636   -2.664  1.00 0.00 ? 90  TYR A CA   3  
ATOM   2297  C C    . TYR A 1 26 ? -7.013  2.604   -1.945  1.00 0.00 ? 90  TYR A C    3  
ATOM   2298  O O    . TYR A 1 26 ? -5.829  2.302   -1.781  1.00 0.00 ? 90  TYR A O    3  
ATOM   2299  C CB   . TYR A 1 26 ? -8.761  0.840   -1.645  1.00 0.00 ? 90  TYR A CB   3  
ATOM   2300  C CG   . TYR A 1 26 ? -9.797  -0.093  -2.256  1.00 0.00 ? 90  TYR A CG   3  
ATOM   2301  C CD1  . TYR A 1 26 ? -9.445  -1.358  -2.721  1.00 0.00 ? 90  TYR A CD1  3  
ATOM   2302  C CD2  . TYR A 1 26 ? -11.119 0.293   -2.368  1.00 0.00 ? 90  TYR A CD2  3  
ATOM   2303  C CE1  . TYR A 1 26 ? -10.375 -2.195  -3.291  1.00 0.00 ? 90  TYR A CE1  3  
ATOM   2304  C CE2  . TYR A 1 26 ? -12.061 -0.543  -2.926  1.00 0.00 ? 90  TYR A CE2  3  
ATOM   2305  C CZ   . TYR A 1 26 ? -11.684 -1.784  -3.388  1.00 0.00 ? 90  TYR A CZ   3  
ATOM   2306  O OH   . TYR A 1 26 ? -12.622 -2.602  -3.989  1.00 0.00 ? 90  TYR A OH   3  
ATOM   2307  H H    . TYR A 1 26 ? -6.315  0.369   -3.059  1.00 0.00 ? 90  TYR A H    3  
ATOM   2308  H HA   . TYR A 1 26 ? -8.604  2.182   -3.319  1.00 0.00 ? 90  TYR A HA   3  
ATOM   2309  H HB2  . TYR A 1 26 ? -8.077  0.231   -1.073  1.00 0.00 ? 90  TYR A HB2  3  
ATOM   2310  H HB3  . TYR A 1 26 ? -9.260  1.519   -0.972  1.00 0.00 ? 90  TYR A HB3  3  
ATOM   2311  H HD1  . TYR A 1 26 ? -8.416  -1.678  -2.640  1.00 0.00 ? 90  TYR A HD1  3  
ATOM   2312  H HD2  . TYR A 1 26 ? -11.412 1.265   -2.002  1.00 0.00 ? 90  TYR A HD2  3  
ATOM   2313  H HE1  . TYR A 1 26 ? -10.064 -3.171  -3.637  1.00 0.00 ? 90  TYR A HE1  3  
ATOM   2314  H HE2  . TYR A 1 26 ? -13.094 -0.234  -2.987  1.00 0.00 ? 90  TYR A HE2  3  
ATOM   2315  H HH   . TYR A 1 26 ? -12.577 -3.483  -3.600  1.00 0.00 ? 90  TYR A HH   3  
ATOM   2316  N N    . GLU A 1 27 ? -7.528  3.747   -1.528  1.00 0.00 ? 91  GLU A N    3  
ATOM   2317  C CA   . GLU A 1 27 ? -6.708  4.771   -0.886  1.00 0.00 ? 91  GLU A CA   3  
ATOM   2318  C C    . GLU A 1 27 ? -6.327  4.349   0.532   1.00 0.00 ? 91  GLU A C    3  
ATOM   2319  O O    . GLU A 1 27 ? -7.183  4.026   1.362   1.00 0.00 ? 91  GLU A O    3  
ATOM   2320  C CB   . GLU A 1 27 ? -7.439  6.120   -0.841  1.00 0.00 ? 91  GLU A CB   3  
ATOM   2321  C CG   . GLU A 1 27 ? -6.587  7.255   -0.282  1.00 0.00 ? 91  GLU A CG   3  
ATOM   2322  C CD   . GLU A 1 27 ? -7.344  8.545   -0.116  1.00 0.00 ? 91  GLU A CD   3  
ATOM   2323  O OE1  . GLU A 1 27 ? -7.642  9.214   -1.123  1.00 0.00 ? 91  GLU A OE1  3  
ATOM   2324  O OE2  . GLU A 1 27 ? -7.628  8.936   1.036   1.00 0.00 ? 91  GLU A OE2  3  
ATOM   2325  H H    . GLU A 1 27 ? -8.491  3.910   -1.630  1.00 0.00 ? 91  GLU A H    3  
ATOM   2326  H HA   . GLU A 1 27 ? -5.807  4.881   -1.471  1.00 0.00 ? 91  GLU A HA   3  
ATOM   2327  H HB2  . GLU A 1 27 ? -7.746  6.383   -1.841  1.00 0.00 ? 91  GLU A HB2  3  
ATOM   2328  H HB3  . GLU A 1 27 ? -8.317  6.018   -0.220  1.00 0.00 ? 91  GLU A HB3  3  
ATOM   2329  H HG2  . GLU A 1 27 ? -6.210  6.955   0.684   1.00 0.00 ? 91  GLU A HG2  3  
ATOM   2330  H HG3  . GLU A 1 27 ? -5.755  7.423   -0.949  1.00 0.00 ? 91  GLU A HG3  3  
ATOM   2331  N N    . ALA A 1 28 ? -5.054  4.357   0.795   1.00 0.00 ? 92  ALA A N    3  
ATOM   2332  C CA   . ALA A 1 28 ? -4.524  3.971   2.073   1.00 0.00 ? 92  ALA A CA   3  
ATOM   2333  C C    . ALA A 1 28 ? -3.384  4.882   2.465   1.00 0.00 ? 92  ALA A C    3  
ATOM   2334  O O    . ALA A 1 28 ? -2.661  5.373   1.614   1.00 0.00 ? 92  ALA A O    3  
ATOM   2335  C CB   . ALA A 1 28 ? -4.042  2.545   2.012   1.00 0.00 ? 92  ALA A CB   3  
ATOM   2336  H H    . ALA A 1 28 ? -4.433  4.645   0.084   1.00 0.00 ? 92  ALA A H    3  
ATOM   2337  H HA   . ALA A 1 28 ? -5.304  4.037   2.817   1.00 0.00 ? 92  ALA A HA   3  
ATOM   2338  H HB1  . ALA A 1 28 ? -3.236  2.466   1.296   1.00 0.00 ? 92  ALA A HB1  3  
ATOM   2339  H HB2  . ALA A 1 28 ? -3.688  2.252   2.990   1.00 0.00 ? 92  ALA A HB2  3  
ATOM   2340  H HB3  . ALA A 1 28 ? -4.854  1.897   1.717   1.00 0.00 ? 92  ALA A HB3  3  
ATOM   2341  N N    . GLU A 1 29 ? -3.222  5.109   3.726   1.00 0.00 ? 93  GLU A N    3  
ATOM   2342  C CA   . GLU A 1 29 ? -2.159  5.946   4.199   1.00 0.00 ? 93  GLU A CA   3  
ATOM   2343  C C    . GLU A 1 29 ? -1.090  5.089   4.836   1.00 0.00 ? 93  GLU A C    3  
ATOM   2344  O O    . GLU A 1 29 ? -1.396  4.138   5.560   1.00 0.00 ? 93  GLU A O    3  
ATOM   2345  C CB   . GLU A 1 29 ? -2.681  7.002   5.165   1.00 0.00 ? 93  GLU A CB   3  
ATOM   2346  C CG   . GLU A 1 29 ? -1.623  7.975   5.665   1.00 0.00 ? 93  GLU A CG   3  
ATOM   2347  C CD   . GLU A 1 29 ? -2.223  9.110   6.433   1.00 0.00 ? 93  GLU A CD   3  
ATOM   2348  O OE1  . GLU A 1 29 ? -2.743  8.888   7.543   1.00 0.00 ? 93  GLU A OE1  3  
ATOM   2349  O OE2  . GLU A 1 29 ? -2.186  10.255  5.938   1.00 0.00 ? 93  GLU A OE2  3  
ATOM   2350  H H    . GLU A 1 29 ? -3.825  4.673   4.370   1.00 0.00 ? 93  GLU A H    3  
ATOM   2351  H HA   . GLU A 1 29 ? -1.729  6.435   3.338   1.00 0.00 ? 93  GLU A HA   3  
ATOM   2352  H HB2  . GLU A 1 29 ? -3.471  7.565   4.693   1.00 0.00 ? 93  GLU A HB2  3  
ATOM   2353  H HB3  . GLU A 1 29 ? -3.093  6.488   6.021   1.00 0.00 ? 93  GLU A HB3  3  
ATOM   2354  H HG2  . GLU A 1 29 ? -0.934  7.446   6.308   1.00 0.00 ? 93  GLU A HG2  3  
ATOM   2355  H HG3  . GLU A 1 29 ? -1.067  8.372   4.825   1.00 0.00 ? 93  GLU A HG3  3  
ATOM   2356  N N    . ILE A 1 30 ? 0.132   5.394   4.524   1.00 0.00 ? 94  ILE A N    3  
ATOM   2357  C CA   . ILE A 1 30 ? 1.279   4.666   5.028   1.00 0.00 ? 94  ILE A CA   3  
ATOM   2358  C C    . ILE A 1 30 ? 1.558   5.027   6.482   1.00 0.00 ? 94  ILE A C    3  
ATOM   2359  O O    . ILE A 1 30 ? 1.774   6.197   6.818   1.00 0.00 ? 94  ILE A O    3  
ATOM   2360  C CB   . ILE A 1 30 ? 2.523   4.963   4.174   1.00 0.00 ? 94  ILE A CB   3  
ATOM   2361  C CG1  . ILE A 1 30 ? 2.221   4.624   2.721   1.00 0.00 ? 94  ILE A CG1  3  
ATOM   2362  C CG2  . ILE A 1 30 ? 3.707   4.144   4.674   1.00 0.00 ? 94  ILE A CG2  3  
ATOM   2363  C CD1  . ILE A 1 30 ? 3.243   5.115   1.733   1.00 0.00 ? 94  ILE A CD1  3  
ATOM   2364  H H    . ILE A 1 30 ? 0.263   6.150   3.909   1.00 0.00 ? 94  ILE A H    3  
ATOM   2365  H HA   . ILE A 1 30 ? 1.067   3.609   4.968   1.00 0.00 ? 94  ILE A HA   3  
ATOM   2366  H HB   . ILE A 1 30 ? 2.762   6.013   4.247   1.00 0.00 ? 94  ILE A HB   3  
ATOM   2367  H HG12 . ILE A 1 30 ? 2.176   3.550   2.624   1.00 0.00 ? 94  ILE A HG12 3  
ATOM   2368  H HG13 . ILE A 1 30 ? 1.258   5.043   2.474   1.00 0.00 ? 94  ILE A HG13 3  
ATOM   2369  H HG21 . ILE A 1 30 ? 3.472   3.091   4.617   1.00 0.00 ? 94  ILE A HG21 3  
ATOM   2370  H HG22 . ILE A 1 30 ? 4.576   4.355   4.070   1.00 0.00 ? 94  ILE A HG22 3  
ATOM   2371  H HG23 . ILE A 1 30 ? 3.914   4.402   5.703   1.00 0.00 ? 94  ILE A HG23 3  
ATOM   2372  H HD11 . ILE A 1 30 ? 4.202   4.687   1.980   1.00 0.00 ? 94  ILE A HD11 3  
ATOM   2373  H HD12 . ILE A 1 30 ? 2.960   4.815   0.733   1.00 0.00 ? 94  ILE A HD12 3  
ATOM   2374  H HD13 . ILE A 1 30 ? 3.305   6.193   1.780   1.00 0.00 ? 94  ILE A HD13 3  
ATOM   2375  N N    . GLU A 1 31 ? 1.555   4.024   7.314   1.00 0.00 ? 95  GLU A N    3  
ATOM   2376  C CA   . GLU A 1 31 ? 1.797   4.165   8.741   1.00 0.00 ? 95  GLU A CA   3  
ATOM   2377  C C    . GLU A 1 31 ? 3.248   3.850   9.075   1.00 0.00 ? 95  GLU A C    3  
ATOM   2378  O O    . GLU A 1 31 ? 3.833   4.451   9.967   1.00 0.00 ? 95  GLU A O    3  
ATOM   2379  C CB   . GLU A 1 31 ? 0.901   3.203   9.497   1.00 0.00 ? 95  GLU A CB   3  
ATOM   2380  C CG   . GLU A 1 31 ? -0.576  3.475   9.338   1.00 0.00 ? 95  GLU A CG   3  
ATOM   2381  C CD   . GLU A 1 31 ? -1.047  4.682   10.108  1.00 0.00 ? 95  GLU A CD   3  
ATOM   2382  O OE1  . GLU A 1 31 ? -1.396  4.541   11.302  1.00 0.00 ? 95  GLU A OE1  3  
ATOM   2383  O OE2  . GLU A 1 31 ? -1.088  5.788   9.547   1.00 0.00 ? 95  GLU A OE2  3  
ATOM   2384  H H    . GLU A 1 31 ? 1.376   3.129   6.944   1.00 0.00 ? 95  GLU A H    3  
ATOM   2385  H HA   . GLU A 1 31 ? 1.555   5.173   9.041   1.00 0.00 ? 95  GLU A HA   3  
ATOM   2386  H HB2  . GLU A 1 31 ? 1.099   2.201   9.146   1.00 0.00 ? 95  GLU A HB2  3  
ATOM   2387  H HB3  . GLU A 1 31 ? 1.145   3.258   10.548  1.00 0.00 ? 95  GLU A HB3  3  
ATOM   2388  H HG2  . GLU A 1 31 ? -0.775  3.642   8.289   1.00 0.00 ? 95  GLU A HG2  3  
ATOM   2389  H HG3  . GLU A 1 31 ? -1.119  2.602   9.662   1.00 0.00 ? 95  GLU A HG3  3  
ATOM   2390  N N    . GLU A 1 32 ? 3.822   2.907   8.353   1.00 0.00 ? 96  GLU A N    3  
ATOM   2391  C CA   . GLU A 1 32 ? 5.186   2.462   8.607   1.00 0.00 ? 96  GLU A CA   3  
ATOM   2392  C C    . GLU A 1 32 ? 5.732   1.794   7.345   1.00 0.00 ? 96  GLU A C    3  
ATOM   2393  O O    . GLU A 1 32 ? 4.958   1.279   6.551   1.00 0.00 ? 96  GLU A O    3  
ATOM   2394  C CB   . GLU A 1 32 ? 5.168   1.476   9.785   1.00 0.00 ? 96  GLU A CB   3  
ATOM   2395  C CG   . GLU A 1 32 ? 6.522   0.998   10.248  1.00 0.00 ? 96  GLU A CG   3  
ATOM   2396  C CD   . GLU A 1 32 ? 6.412   0.009   11.371  1.00 0.00 ? 96  GLU A CD   3  
ATOM   2397  O OE1  . GLU A 1 32 ? 6.243   -1.203  11.099  1.00 0.00 ? 96  GLU A OE1  3  
ATOM   2398  O OE2  . GLU A 1 32 ? 6.497   0.409   12.541  1.00 0.00 ? 96  GLU A OE2  3  
ATOM   2399  H H    . GLU A 1 32 ? 3.321   2.477   7.626   1.00 0.00 ? 96  GLU A H    3  
ATOM   2400  H HA   . GLU A 1 32 ? 5.801   3.316   8.853   1.00 0.00 ? 96  GLU A HA   3  
ATOM   2401  H HB2  . GLU A 1 32 ? 4.682   1.952   10.623  1.00 0.00 ? 96  GLU A HB2  3  
ATOM   2402  H HB3  . GLU A 1 32 ? 4.588   0.612   9.498   1.00 0.00 ? 96  GLU A HB3  3  
ATOM   2403  H HG2  . GLU A 1 32 ? 7.026   0.533   9.414   1.00 0.00 ? 96  GLU A HG2  3  
ATOM   2404  H HG3  . GLU A 1 32 ? 7.093   1.850   10.585  1.00 0.00 ? 96  GLU A HG3  3  
ATOM   2405  N N    . ILE A 1 33 ? 7.042   1.835   7.148   1.00 0.00 ? 97  ILE A N    3  
ATOM   2406  C CA   . ILE A 1 33 ? 7.680   1.258   5.965   1.00 0.00 ? 97  ILE A CA   3  
ATOM   2407  C C    . ILE A 1 33 ? 8.832   0.343   6.369   1.00 0.00 ? 97  ILE A C    3  
ATOM   2408  O O    . ILE A 1 33 ? 9.670   0.715   7.179   1.00 0.00 ? 97  ILE A O    3  
ATOM   2409  C CB   . ILE A 1 33 ? 8.237   2.392   5.076   1.00 0.00 ? 97  ILE A CB   3  
ATOM   2410  C CG1  . ILE A 1 33 ? 7.114   3.317   4.688   1.00 0.00 ? 97  ILE A CG1  3  
ATOM   2411  C CG2  . ILE A 1 33 ? 8.915   1.842   3.817   1.00 0.00 ? 97  ILE A CG2  3  
ATOM   2412  C CD1  . ILE A 1 33 ? 7.580   4.667   4.343   1.00 0.00 ? 97  ILE A CD1  3  
ATOM   2413  H H    . ILE A 1 33 ? 7.622   2.278   7.803   1.00 0.00 ? 97  ILE A H    3  
ATOM   2414  H HA   . ILE A 1 33 ? 6.946   0.707   5.399   1.00 0.00 ? 97  ILE A HA   3  
ATOM   2415  H HB   . ILE A 1 33 ? 8.966   2.956   5.638   1.00 0.00 ? 97  ILE A HB   3  
ATOM   2416  H HG12 . ILE A 1 33 ? 6.611   2.928   3.815   1.00 0.00 ? 97  ILE A HG12 3  
ATOM   2417  H HG13 . ILE A 1 33 ? 6.418   3.393   5.509   1.00 0.00 ? 97  ILE A HG13 3  
ATOM   2418  H HG21 . ILE A 1 33 ? 8.201   1.272   3.241   1.00 0.00 ? 97  ILE A HG21 3  
ATOM   2419  H HG22 . ILE A 1 33 ? 9.277   2.670   3.225   1.00 0.00 ? 97  ILE A HG22 3  
ATOM   2420  H HG23 . ILE A 1 33 ? 9.743   1.209   4.098   1.00 0.00 ? 97  ILE A HG23 3  
ATOM   2421  H HD11 . ILE A 1 33 ? 8.271   4.623   3.516   1.00 0.00 ? 97  ILE A HD11 3  
ATOM   2422  H HD12 . ILE A 1 33 ? 6.729   5.286   4.096   1.00 0.00 ? 97  ILE A HD12 3  
ATOM   2423  H HD13 . ILE A 1 33 ? 8.078   5.057   5.218   1.00 0.00 ? 97  ILE A HD13 3  
ATOM   2424  N N    . ASP A 1 34 ? 8.853   -0.828  5.810   1.00 0.00 ? 98  ASP A N    3  
ATOM   2425  C CA   . ASP A 1 34 ? 9.917   -1.796  6.006   1.00 0.00 ? 98  ASP A CA   3  
ATOM   2426  C C    . ASP A 1 34 ? 10.711  -1.869  4.725   1.00 0.00 ? 98  ASP A C    3  
ATOM   2427  O O    . ASP A 1 34 ? 10.317  -2.546  3.769   1.00 0.00 ? 98  ASP A O    3  
ATOM   2428  C CB   . ASP A 1 34 ? 9.351   -3.180  6.323   1.00 0.00 ? 98  ASP A CB   3  
ATOM   2429  C CG   . ASP A 1 34 ? 10.430  -4.200  6.627   1.00 0.00 ? 98  ASP A CG   3  
ATOM   2430  O OD1  . ASP A 1 34 ? 11.025  -4.725  5.696   1.00 0.00 ? 98  ASP A OD1  3  
ATOM   2431  O OD2  . ASP A 1 34 ? 10.679  -4.506  7.818   1.00 0.00 ? 98  ASP A OD2  3  
ATOM   2432  H H    . ASP A 1 34 ? 8.123   -1.067  5.193   1.00 0.00 ? 98  ASP A H    3  
ATOM   2433  H HA   . ASP A 1 34 ? 10.589  -1.485  6.795   1.00 0.00 ? 98  ASP A HA   3  
ATOM   2434  H HB2  . ASP A 1 34 ? 8.645   -3.125  7.136   1.00 0.00 ? 98  ASP A HB2  3  
ATOM   2435  H HB3  . ASP A 1 34 ? 8.820   -3.518  5.447   1.00 0.00 ? 98  ASP A HB3  3  
ATOM   2436  N N    . GLU A 1 35 ? 11.778  -1.124  4.680   1.00 0.00 ? 99  GLU A N    3  
ATOM   2437  C CA   . GLU A 1 35 ? 12.651  -1.041  3.512   1.00 0.00 ? 99  GLU A CA   3  
ATOM   2438  C C    . GLU A 1 35 ? 13.362  -2.365  3.221   1.00 0.00 ? 99  GLU A C    3  
ATOM   2439  O O    . GLU A 1 35 ? 13.780  -2.618  2.093   1.00 0.00 ? 99  GLU A O    3  
ATOM   2440  C CB   . GLU A 1 35 ? 13.669  0.065   3.719   1.00 0.00 ? 99  GLU A CB   3  
ATOM   2441  C CG   . GLU A 1 35 ? 13.047  1.441   3.863   1.00 0.00 ? 99  GLU A CG   3  
ATOM   2442  C CD   . GLU A 1 35 ? 14.057  2.486   4.227   1.00 0.00 ? 99  GLU A CD   3  
ATOM   2443  O OE1  . GLU A 1 35 ? 14.857  2.886   3.374   1.00 0.00 ? 99  GLU A OE1  3  
ATOM   2444  O OE2  . GLU A 1 35 ? 14.086  2.914   5.399   1.00 0.00 ? 99  GLU A OE2  3  
ATOM   2445  H H    . GLU A 1 35 ? 12.007  -0.600  5.478   1.00 0.00 ? 99  GLU A H    3  
ATOM   2446  H HA   . GLU A 1 35 ? 12.038  -0.782  2.662   1.00 0.00 ? 99  GLU A HA   3  
ATOM   2447  H HB2  . GLU A 1 35 ? 14.238  -0.147  4.612   1.00 0.00 ? 99  GLU A HB2  3  
ATOM   2448  H HB3  . GLU A 1 35 ? 14.334  0.079   2.869   1.00 0.00 ? 99  GLU A HB3  3  
ATOM   2449  H HG2  . GLU A 1 35 ? 12.586  1.719   2.927   1.00 0.00 ? 99  GLU A HG2  3  
ATOM   2450  H HG3  . GLU A 1 35 ? 12.292  1.403   4.634   1.00 0.00 ? 99  GLU A HG3  3  
ATOM   2451  N N    . GLU A 1 36 ? 13.474  -3.197  4.236   1.00 0.00 ? 100 GLU A N    3  
ATOM   2452  C CA   . GLU A 1 36 ? 14.182  -4.454  4.147   1.00 0.00 ? 100 GLU A CA   3  
ATOM   2453  C C    . GLU A 1 36 ? 13.441  -5.449  3.259   1.00 0.00 ? 100 GLU A C    3  
ATOM   2454  O O    . GLU A 1 36 ? 14.047  -6.279  2.584   1.00 0.00 ? 100 GLU A O    3  
ATOM   2455  C CB   . GLU A 1 36 ? 14.373  -5.032  5.539   1.00 0.00 ? 100 GLU A CB   3  
ATOM   2456  C CG   . GLU A 1 36 ? 15.401  -6.154  5.604   1.00 0.00 ? 100 GLU A CG   3  
ATOM   2457  C CD   . GLU A 1 36 ? 16.823  -5.708  5.275   1.00 0.00 ? 100 GLU A CD   3  
ATOM   2458  O OE1  . GLU A 1 36 ? 17.051  -5.013  4.247   1.00 0.00 ? 100 GLU A OE1  3  
ATOM   2459  O OE2  . GLU A 1 36 ? 17.751  -6.052  6.039   1.00 0.00 ? 100 GLU A OE2  3  
ATOM   2460  H H    . GLU A 1 36 ? 13.069  -2.946  5.095   1.00 0.00 ? 100 GLU A H    3  
ATOM   2461  H HA   . GLU A 1 36 ? 15.156  -4.271  3.717   1.00 0.00 ? 100 GLU A HA   3  
ATOM   2462  H HB2  . GLU A 1 36 ? 14.612  -4.231  6.222   1.00 0.00 ? 100 GLU A HB2  3  
ATOM   2463  H HB3  . GLU A 1 36 ? 13.419  -5.438  5.843   1.00 0.00 ? 100 GLU A HB3  3  
ATOM   2464  H HG2  . GLU A 1 36 ? 15.399  -6.568  6.601   1.00 0.00 ? 100 GLU A HG2  3  
ATOM   2465  H HG3  . GLU A 1 36 ? 15.109  -6.919  4.899   1.00 0.00 ? 100 GLU A HG3  3  
ATOM   2466  N N    . ASN A 1 37 ? 12.148  -5.405  3.301   1.00 0.00 ? 101 ASN A N    3  
ATOM   2467  C CA   . ASN A 1 37 ? 11.340  -6.242  2.420   1.00 0.00 ? 101 ASN A CA   3  
ATOM   2468  C C    . ASN A 1 37 ? 10.764  -5.425  1.310   1.00 0.00 ? 101 ASN A C    3  
ATOM   2469  O O    . ASN A 1 37 ? 10.252  -5.960  0.329   1.00 0.00 ? 101 ASN A O    3  
ATOM   2470  C CB   . ASN A 1 37 ? 10.203  -6.917  3.174   1.00 0.00 ? 101 ASN A CB   3  
ATOM   2471  C CG   . ASN A 1 37 ? 10.677  -7.867  4.235   1.00 0.00 ? 101 ASN A CG   3  
ATOM   2472  O OD1  . ASN A 1 37 ? 10.864  -9.056  3.990   1.00 0.00 ? 101 ASN A OD1  3  
ATOM   2473  N ND2  . ASN A 1 37 ? 10.917  -7.358  5.392   1.00 0.00 ? 101 ASN A ND2  3  
ATOM   2474  H H    . ASN A 1 37 ? 11.731  -4.841  3.998   1.00 0.00 ? 101 ASN A H    3  
ATOM   2475  H HA   . ASN A 1 37 ? 11.974  -7.005  1.997   1.00 0.00 ? 101 ASN A HA   3  
ATOM   2476  H HB2  . ASN A 1 37 ? 9.584   -6.166  3.639   1.00 0.00 ? 101 ASN A HB2  3  
ATOM   2477  H HB3  . ASN A 1 37 ? 9.616   -7.470  2.456   1.00 0.00 ? 101 ASN A HB3  3  
ATOM   2478  H HD21 . ASN A 1 37 ? 10.786  -6.377  5.485   1.00 0.00 ? 101 ASN A HD21 3  
ATOM   2479  H HD22 . ASN A 1 37 ? 11.193  -7.941  6.131   1.00 0.00 ? 101 ASN A HD22 3  
ATOM   2480  N N    . GLY A 1 38 ? 10.846  -4.120  1.462   1.00 0.00 ? 102 GLY A N    3  
ATOM   2481  C CA   . GLY A 1 38 ? 10.247  -3.224  0.508   1.00 0.00 ? 102 GLY A CA   3  
ATOM   2482  C C    . GLY A 1 38 ? 8.747   -3.210  0.689   1.00 0.00 ? 102 GLY A C    3  
ATOM   2483  O O    . GLY A 1 38 ? 7.983   -3.039  -0.262  1.00 0.00 ? 102 GLY A O    3  
ATOM   2484  H H    . GLY A 1 38 ? 11.323  -3.761  2.239   1.00 0.00 ? 102 GLY A H    3  
ATOM   2485  H HA2  . GLY A 1 38 ? 10.639  -2.229  0.658   1.00 0.00 ? 102 GLY A HA2  3  
ATOM   2486  H HA3  . GLY A 1 38 ? 10.477  -3.555  -0.493  1.00 0.00 ? 102 GLY A HA3  3  
ATOM   2487  N N    . THR A 1 39 ? 8.320   -3.417  1.916   1.00 0.00 ? 103 THR A N    3  
ATOM   2488  C CA   . THR A 1 39 ? 6.920   -3.456  2.228   1.00 0.00 ? 103 THR A CA   3  
ATOM   2489  C C    . THR A 1 39 ? 6.543   -2.302  3.127   1.00 0.00 ? 103 THR A C    3  
ATOM   2490  O O    . THR A 1 39 ? 7.387   -1.752  3.802   1.00 0.00 ? 103 THR A O    3  
ATOM   2491  C CB   . THR A 1 39 ? 6.536   -4.800  2.877   1.00 0.00 ? 103 THR A CB   3  
ATOM   2492  O OG1  . THR A 1 39 ? 7.388   -5.056  4.014   1.00 0.00 ? 103 THR A OG1  3  
ATOM   2493  C CG2  . THR A 1 39 ? 6.671   -5.940  1.875   1.00 0.00 ? 103 THR A CG2  3  
ATOM   2494  H H    . THR A 1 39 ? 8.977   -3.533  2.641   1.00 0.00 ? 103 THR A H    3  
ATOM   2495  H HA   . THR A 1 39 ? 6.365   -3.343  1.313   1.00 0.00 ? 103 THR A HA   3  
ATOM   2496  H HB   . THR A 1 39 ? 5.508   -4.728  3.196   1.00 0.00 ? 103 THR A HB   3  
ATOM   2497  H HG1  . THR A 1 39 ? 7.661   -4.205  4.376   1.00 0.00 ? 103 THR A HG1  3  
ATOM   2498  H HG21 . THR A 1 39 ? 7.683   -5.963  1.498   1.00 0.00 ? 103 THR A HG21 3  
ATOM   2499  H HG22 . THR A 1 39 ? 6.446   -6.880  2.355   1.00 0.00 ? 103 THR A HG22 3  
ATOM   2500  H HG23 . THR A 1 39 ? 5.990   -5.777  1.053   1.00 0.00 ? 103 THR A HG23 3  
ATOM   2501  N N    . ALA A 1 40 ? 5.307   -1.937  3.122   1.00 0.00 ? 104 ALA A N    3  
ATOM   2502  C CA   . ALA A 1 40 ? 4.836   -0.866  3.937   1.00 0.00 ? 104 ALA A CA   3  
ATOM   2503  C C    . ALA A 1 40 ? 3.542   -1.247  4.599   1.00 0.00 ? 104 ALA A C    3  
ATOM   2504  O O    . ALA A 1 40 ? 2.749   -2.016  4.049   1.00 0.00 ? 104 ALA A O    3  
ATOM   2505  C CB   . ALA A 1 40 ? 4.653   0.393   3.112   1.00 0.00 ? 104 ALA A CB   3  
ATOM   2506  H H    . ALA A 1 40 ? 4.653   -2.395  2.548   1.00 0.00 ? 104 ALA A H    3  
ATOM   2507  H HA   . ALA A 1 40 ? 5.578   -0.669  4.696   1.00 0.00 ? 104 ALA A HA   3  
ATOM   2508  H HB1  . ALA A 1 40 ? 3.904   0.208   2.357   1.00 0.00 ? 104 ALA A HB1  3  
ATOM   2509  H HB2  . ALA A 1 40 ? 4.336   1.205   3.749   1.00 0.00 ? 104 ALA A HB2  3  
ATOM   2510  H HB3  . ALA A 1 40 ? 5.589   0.644   2.636   1.00 0.00 ? 104 ALA A HB3  3  
ATOM   2511  N N    . ALA A 1 41 ? 3.354   -0.741  5.769   1.00 0.00 ? 105 ALA A N    3  
ATOM   2512  C CA   . ALA A 1 41 ? 2.161   -0.941  6.517   1.00 0.00 ? 105 ALA A CA   3  
ATOM   2513  C C    . ALA A 1 41 ? 1.258   0.221   6.238   1.00 0.00 ? 105 ALA A C    3  
ATOM   2514  O O    . ALA A 1 41 ? 1.616   1.386   6.504   1.00 0.00 ? 105 ALA A O    3  
ATOM   2515  C CB   . ALA A 1 41 ? 2.484   -1.026  7.976   1.00 0.00 ? 105 ALA A CB   3  
ATOM   2516  H H    . ALA A 1 41 ? 4.052   -0.155  6.142   1.00 0.00 ? 105 ALA A H    3  
ATOM   2517  H HA   . ALA A 1 41 ? 1.690   -1.858  6.196   1.00 0.00 ? 105 ALA A HA   3  
ATOM   2518  H HB1  . ALA A 1 41 ? 2.992   -0.123  8.278   1.00 0.00 ? 105 ALA A HB1  3  
ATOM   2519  H HB2  . ALA A 1 41 ? 1.569   -1.142  8.537   1.00 0.00 ? 105 ALA A HB2  3  
ATOM   2520  H HB3  . ALA A 1 41 ? 3.119   -1.885  8.124   1.00 0.00 ? 105 ALA A HB3  3  
ATOM   2521  N N    . ILE A 1 42 ? 0.127   -0.063  5.701   1.00 0.00 ? 106 ILE A N    3  
ATOM   2522  C CA   . ILE A 1 42 ? -0.770  0.952   5.256   1.00 0.00 ? 106 ILE A CA   3  
ATOM   2523  C C    . ILE A 1 42 ? -2.129  0.770   5.885   1.00 0.00 ? 106 ILE A C    3  
ATOM   2524  O O    . ILE A 1 42 ? -2.524  -0.343  6.204   1.00 0.00 ? 106 ILE A O    3  
ATOM   2525  C CB   . ILE A 1 42 ? -0.883  0.920   3.699   1.00 0.00 ? 106 ILE A CB   3  
ATOM   2526  C CG1  . ILE A 1 42 ? -1.347  -0.457  3.196   1.00 0.00 ? 106 ILE A CG1  3  
ATOM   2527  C CG2  . ILE A 1 42 ? 0.412   1.317   3.031   1.00 0.00 ? 106 ILE A CG2  3  
ATOM   2528  C CD1  . ILE A 1 42 ? -2.818  -0.538  2.970   1.00 0.00 ? 106 ILE A CD1  3  
ATOM   2529  H H    . ILE A 1 42 ? -0.131  -1.009  5.600   1.00 0.00 ? 106 ILE A H    3  
ATOM   2530  H HA   . ILE A 1 42 ? -0.368  1.911   5.543   1.00 0.00 ? 106 ILE A HA   3  
ATOM   2531  H HB   . ILE A 1 42 ? -1.627  1.650   3.418   1.00 0.00 ? 106 ILE A HB   3  
ATOM   2532  H HG12 . ILE A 1 42 ? -0.850  -0.774  2.294   1.00 0.00 ? 106 ILE A HG12 3  
ATOM   2533  H HG13 . ILE A 1 42 ? -1.117  -1.171  3.974   1.00 0.00 ? 106 ILE A HG13 3  
ATOM   2534  H HG21 . ILE A 1 42 ? 1.197   0.641   3.332   1.00 0.00 ? 106 ILE A HG21 3  
ATOM   2535  H HG22 . ILE A 1 42 ? 0.270   1.257   1.963   1.00 0.00 ? 106 ILE A HG22 3  
ATOM   2536  H HG23 . ILE A 1 42 ? 0.663   2.328   3.314   1.00 0.00 ? 106 ILE A HG23 3  
ATOM   2537  H HD11 . ILE A 1 42 ? -3.058  0.235   2.253   1.00 0.00 ? 106 ILE A HD11 3  
ATOM   2538  H HD12 . ILE A 1 42 ? -3.082  -1.510  2.581   1.00 0.00 ? 106 ILE A HD12 3  
ATOM   2539  H HD13 . ILE A 1 42 ? -3.335  -0.341  3.897   1.00 0.00 ? 106 ILE A HD13 3  
ATOM   2540  N N    . THR A 1 43 ? -2.816  1.850   6.088   1.00 0.00 ? 107 THR A N    3  
ATOM   2541  C CA   . THR A 1 43 ? -4.142  1.819   6.622   1.00 0.00 ? 107 THR A CA   3  
ATOM   2542  C C    . THR A 1 43 ? -5.106  2.460   5.625   1.00 0.00 ? 107 THR A C    3  
ATOM   2543  O O    . THR A 1 43 ? -4.921  3.611   5.227   1.00 0.00 ? 107 THR A O    3  
ATOM   2544  C CB   . THR A 1 43 ? -4.183  2.543   7.978   1.00 0.00 ? 107 THR A CB   3  
ATOM   2545  O OG1  . THR A 1 43 ? -3.242  1.909   8.849   1.00 0.00 ? 107 THR A OG1  3  
ATOM   2546  C CG2  . THR A 1 43 ? -5.572  2.482   8.603   1.00 0.00 ? 107 THR A CG2  3  
ATOM   2547  H H    . THR A 1 43 ? -2.412  2.723   5.872   1.00 0.00 ? 107 THR A H    3  
ATOM   2548  H HA   . THR A 1 43 ? -4.424  0.787   6.766   1.00 0.00 ? 107 THR A HA   3  
ATOM   2549  H HB   . THR A 1 43 ? -3.893  3.574   7.834   1.00 0.00 ? 107 THR A HB   3  
ATOM   2550  H HG1  . THR A 1 43 ? -2.593  1.471   8.283   1.00 0.00 ? 107 THR A HG1  3  
ATOM   2551  H HG21 . THR A 1 43 ? -5.857  1.450   8.746   1.00 0.00 ? 107 THR A HG21 3  
ATOM   2552  H HG22 . THR A 1 43 ? -5.564  2.993   9.554   1.00 0.00 ? 107 THR A HG22 3  
ATOM   2553  H HG23 . THR A 1 43 ? -6.281  2.960   7.943   1.00 0.00 ? 107 THR A HG23 3  
ATOM   2554  N N    . PHE A 1 44 ? -6.109  1.705   5.228   1.00 0.00 ? 108 PHE A N    3  
ATOM   2555  C CA   . PHE A 1 44 ? -7.096  2.129   4.258   1.00 0.00 ? 108 PHE A CA   3  
ATOM   2556  C C    . PHE A 1 44 ? -7.961  3.225   4.802   1.00 0.00 ? 108 PHE A C    3  
ATOM   2557  O O    . PHE A 1 44 ? -8.568  3.078   5.867   1.00 0.00 ? 108 PHE A O    3  
ATOM   2558  C CB   . PHE A 1 44 ? -7.942  0.952   3.785   1.00 0.00 ? 108 PHE A CB   3  
ATOM   2559  C CG   . PHE A 1 44 ? -7.167  -0.029  2.965   1.00 0.00 ? 108 PHE A CG   3  
ATOM   2560  C CD1  . PHE A 1 44 ? -6.841  0.282   1.655   1.00 0.00 ? 108 PHE A CD1  3  
ATOM   2561  C CD2  . PHE A 1 44 ? -6.742  -1.246  3.494   1.00 0.00 ? 108 PHE A CD2  3  
ATOM   2562  C CE1  . PHE A 1 44 ? -6.114  -0.590  0.877   1.00 0.00 ? 108 PHE A CE1  3  
ATOM   2563  C CE2  . PHE A 1 44 ? -6.007  -2.121  2.720   1.00 0.00 ? 108 PHE A CE2  3  
ATOM   2564  C CZ   . PHE A 1 44 ? -5.693  -1.794  1.408   1.00 0.00 ? 108 PHE A CZ   3  
ATOM   2565  H H    . PHE A 1 44 ? -6.199  0.819   5.647   1.00 0.00 ? 108 PHE A H    3  
ATOM   2566  H HA   . PHE A 1 44 ? -6.556  2.517   3.410   1.00 0.00 ? 108 PHE A HA   3  
ATOM   2567  H HB2  . PHE A 1 44 ? -8.340  0.433   4.644   1.00 0.00 ? 108 PHE A HB2  3  
ATOM   2568  H HB3  . PHE A 1 44 ? -8.756  1.323   3.181   1.00 0.00 ? 108 PHE A HB3  3  
ATOM   2569  H HD1  . PHE A 1 44 ? -7.184  1.223   1.246   1.00 0.00 ? 108 PHE A HD1  3  
ATOM   2570  H HD2  . PHE A 1 44 ? -6.996  -1.520  4.511   1.00 0.00 ? 108 PHE A HD2  3  
ATOM   2571  H HE1  . PHE A 1 44 ? -5.879  -0.323  -0.142  1.00 0.00 ? 108 PHE A HE1  3  
ATOM   2572  H HE2  . PHE A 1 44 ? -5.681  -3.063  3.136   1.00 0.00 ? 108 PHE A HE2  3  
ATOM   2573  H HZ   . PHE A 1 44 ? -5.116  -2.478  0.803   1.00 0.00 ? 108 PHE A HZ   3  
ATOM   2574  N N    . ALA A 1 45 ? -8.037  4.296   4.064   1.00 0.00 ? 109 ALA A N    3  
ATOM   2575  C CA   . ALA A 1 45 ? -8.743  5.472   4.481   1.00 0.00 ? 109 ALA A CA   3  
ATOM   2576  C C    . ALA A 1 45 ? -10.229 5.278   4.295   1.00 0.00 ? 109 ALA A C    3  
ATOM   2577  O O    . ALA A 1 45 ? -10.674 4.705   3.303   1.00 0.00 ? 109 ALA A O    3  
ATOM   2578  C CB   . ALA A 1 45 ? -8.249  6.675   3.708   1.00 0.00 ? 109 ALA A CB   3  
ATOM   2579  H H    . ALA A 1 45 ? -7.640  4.277   3.164   1.00 0.00 ? 109 ALA A H    3  
ATOM   2580  H HA   . ALA A 1 45 ? -8.539  5.631   5.530   1.00 0.00 ? 109 ALA A HA   3  
ATOM   2581  H HB1  . ALA A 1 45 ? -8.400  6.505   2.652   1.00 0.00 ? 109 ALA A HB1  3  
ATOM   2582  H HB2  . ALA A 1 45 ? -8.796  7.555   4.013   1.00 0.00 ? 109 ALA A HB2  3  
ATOM   2583  H HB3  . ALA A 1 45 ? -7.195  6.815   3.896   1.00 0.00 ? 109 ALA A HB3  3  
ATOM   2584  N N    . GLY A 1 46 ? -10.982 5.685   5.277   1.00 0.00 ? 110 GLY A N    3  
ATOM   2585  C CA   . GLY A 1 46 ? -12.405 5.556   5.230   1.00 0.00 ? 110 GLY A CA   3  
ATOM   2586  C C    . GLY A 1 46 ? -12.846 4.252   5.832   1.00 0.00 ? 110 GLY A C    3  
ATOM   2587  O O    . GLY A 1 46 ? -13.691 4.221   6.723   1.00 0.00 ? 110 GLY A O    3  
ATOM   2588  H H    . GLY A 1 46 ? -10.568 6.070   6.079   1.00 0.00 ? 110 GLY A H    3  
ATOM   2589  H HA2  . GLY A 1 46 ? -12.853 6.373   5.776   1.00 0.00 ? 110 GLY A HA2  3  
ATOM   2590  H HA3  . GLY A 1 46 ? -12.731 5.592   4.202   1.00 0.00 ? 110 GLY A HA3  3  
ATOM   2591  N N    . TYR A 1 47 ? -12.255 3.181   5.363   1.00 0.00 ? 111 TYR A N    3  
ATOM   2592  C CA   . TYR A 1 47 ? -12.589 1.867   5.826   1.00 0.00 ? 111 TYR A CA   3  
ATOM   2593  C C    . TYR A 1 47 ? -11.943 1.594   7.185   1.00 0.00 ? 111 TYR A C    3  
ATOM   2594  O O    . TYR A 1 47 ? -12.609 1.146   8.118   1.00 0.00 ? 111 TYR A O    3  
ATOM   2595  C CB   . TYR A 1 47 ? -12.122 0.844   4.832   1.00 0.00 ? 111 TYR A CB   3  
ATOM   2596  C CG   . TYR A 1 47 ? -12.564 1.075   3.399   1.00 0.00 ? 111 TYR A CG   3  
ATOM   2597  C CD1  . TYR A 1 47 ? -13.821 0.689   2.962   1.00 0.00 ? 111 TYR A CD1  3  
ATOM   2598  C CD2  . TYR A 1 47 ? -11.685 1.615   2.473   1.00 0.00 ? 111 TYR A CD2  3  
ATOM   2599  C CE1  . TYR A 1 47 ? -14.193 0.842   1.638   1.00 0.00 ? 111 TYR A CE1  3  
ATOM   2600  C CE2  . TYR A 1 47 ? -12.045 1.782   1.157   1.00 0.00 ? 111 TYR A CE2  3  
ATOM   2601  C CZ   . TYR A 1 47 ? -13.302 1.392   0.739   1.00 0.00 ? 111 TYR A CZ   3  
ATOM   2602  O OH   . TYR A 1 47 ? -13.673 1.558   -0.580  1.00 0.00 ? 111 TYR A OH   3  
ATOM   2603  H H    . TYR A 1 47 ? -11.586 3.289   4.652   1.00 0.00 ? 111 TYR A H    3  
ATOM   2604  H HA   . TYR A 1 47 ? -13.662 1.800   5.920   1.00 0.00 ? 111 TYR A HA   3  
ATOM   2605  H HB2  . TYR A 1 47 ? -11.043 0.818   4.835   1.00 0.00 ? 111 TYR A HB2  3  
ATOM   2606  H HB3  . TYR A 1 47 ? -12.493 -0.124  5.137   1.00 0.00 ? 111 TYR A HB3  3  
ATOM   2607  H HD1  . TYR A 1 47 ? -14.516 0.267   3.670   1.00 0.00 ? 111 TYR A HD1  3  
ATOM   2608  H HD2  . TYR A 1 47 ? -10.703 1.922   2.800   1.00 0.00 ? 111 TYR A HD2  3  
ATOM   2609  H HE1  . TYR A 1 47 ? -15.170 0.508   1.314   1.00 0.00 ? 111 TYR A HE1  3  
ATOM   2610  H HE2  . TYR A 1 47 ? -11.329 2.208   0.468   1.00 0.00 ? 111 TYR A HE2  3  
ATOM   2611  H HH   . TYR A 1 47 ? -14.592 1.855   -0.574  1.00 0.00 ? 111 TYR A HH   3  
ATOM   2612  N N    . GLY A 1 48 ? -10.651 1.855   7.293   1.00 0.00 ? 112 GLY A N    3  
ATOM   2613  C CA   . GLY A 1 48 ? -9.977  1.694   8.566   1.00 0.00 ? 112 GLY A CA   3  
ATOM   2614  C C    . GLY A 1 48 ? -9.211  0.379   8.753   1.00 0.00 ? 112 GLY A C    3  
ATOM   2615  O O    . GLY A 1 48 ? -8.905  0.009   9.892   1.00 0.00 ? 112 GLY A O    3  
ATOM   2616  H H    . GLY A 1 48 ? -10.143 2.204   6.528   1.00 0.00 ? 112 GLY A H    3  
ATOM   2617  H HA2  . GLY A 1 48 ? -9.277  2.508   8.679   1.00 0.00 ? 112 GLY A HA2  3  
ATOM   2618  H HA3  . GLY A 1 48 ? -10.720 1.775   9.346   1.00 0.00 ? 112 GLY A HA3  3  
ATOM   2619  N N    . ASN A 1 49 ? -8.886  -0.328  7.678   1.00 0.00 ? 113 ASN A N    3  
ATOM   2620  C CA   . ASN A 1 49 ? -8.086  -1.574  7.831   1.00 0.00 ? 113 ASN A CA   3  
ATOM   2621  C C    . ASN A 1 49 ? -6.652  -1.288  7.593   1.00 0.00 ? 113 ASN A C    3  
ATOM   2622  O O    . ASN A 1 49 ? -6.321  -0.260  7.037   1.00 0.00 ? 113 ASN A O    3  
ATOM   2623  C CB   . ASN A 1 49 ? -8.475  -2.707  6.881   1.00 0.00 ? 113 ASN A CB   3  
ATOM   2624  C CG   . ASN A 1 49 ? -9.795  -3.342  7.162   1.00 0.00 ? 113 ASN A CG   3  
ATOM   2625  O OD1  . ASN A 1 49 ? -10.291 -3.338  8.286   1.00 0.00 ? 113 ASN A OD1  3  
ATOM   2626  N ND2  . ASN A 1 49 ? -10.330 -3.964  6.172   1.00 0.00 ? 113 ASN A ND2  3  
ATOM   2627  H H    . ASN A 1 49 ? -9.144  -0.009  6.789   1.00 0.00 ? 113 ASN A H    3  
ATOM   2628  H HA   . ASN A 1 49 ? -8.204  -1.909  8.851   1.00 0.00 ? 113 ASN A HA   3  
ATOM   2629  H HB2  . ASN A 1 49 ? -8.507  -2.317  5.875   1.00 0.00 ? 113 ASN A HB2  3  
ATOM   2630  H HB3  . ASN A 1 49 ? -7.709  -3.468  6.926   1.00 0.00 ? 113 ASN A HB3  3  
ATOM   2631  H HD21 . ASN A 1 49 ? -9.837  -3.984  5.322   1.00 0.00 ? 113 ASN A HD21 3  
ATOM   2632  H HD22 . ASN A 1 49 ? -11.210 -4.370  6.284   1.00 0.00 ? 113 ASN A HD22 3  
ATOM   2633  N N    . ALA A 1 50 ? -5.808  -2.203  7.949   1.00 0.00 ? 114 ALA A N    3  
ATOM   2634  C CA   . ALA A 1 50 ? -4.402  -2.032  7.768   1.00 0.00 ? 114 ALA A CA   3  
ATOM   2635  C C    . ALA A 1 50 ? -3.798  -3.310  7.288   1.00 0.00 ? 114 ALA A C    3  
ATOM   2636  O O    . ALA A 1 50 ? -4.223  -4.390  7.708   1.00 0.00 ? 114 ALA A O    3  
ATOM   2637  C CB   . ALA A 1 50 ? -3.744  -1.591  9.058   1.00 0.00 ? 114 ALA A CB   3  
ATOM   2638  H H    . ALA A 1 50 ? -6.120  -3.055  8.328   1.00 0.00 ? 114 ALA A H    3  
ATOM   2639  H HA   . ALA A 1 50 ? -4.239  -1.269  7.022   1.00 0.00 ? 114 ALA A HA   3  
ATOM   2640  H HB1  . ALA A 1 50 ? -3.847  -2.365  9.805   1.00 0.00 ? 114 ALA A HB1  3  
ATOM   2641  H HB2  . ALA A 1 50 ? -2.697  -1.412  8.869   1.00 0.00 ? 114 ALA A HB2  3  
ATOM   2642  H HB3  . ALA A 1 50 ? -4.210  -0.681  9.404   1.00 0.00 ? 114 ALA A HB3  3  
ATOM   2643  N N    . GLU A 1 51 ? -2.857  -3.210  6.395   1.00 0.00 ? 115 GLU A N    3  
ATOM   2644  C CA   . GLU A 1 51 ? -2.177  -4.364  5.898   1.00 0.00 ? 115 GLU A CA   3  
ATOM   2645  C C    . GLU A 1 51 ? -0.750  -4.002  5.552   1.00 0.00 ? 115 GLU A C    3  
ATOM   2646  O O    . GLU A 1 51 ? -0.432  -2.823  5.340   1.00 0.00 ? 115 GLU A O    3  
ATOM   2647  C CB   . GLU A 1 51 ? -2.886  -4.987  4.672   1.00 0.00 ? 115 GLU A CB   3  
ATOM   2648  C CG   . GLU A 1 51 ? -2.834  -4.199  3.378   1.00 0.00 ? 115 GLU A CG   3  
ATOM   2649  C CD   . GLU A 1 51 ? -3.188  -5.081  2.201   1.00 0.00 ? 115 GLU A CD   3  
ATOM   2650  O OE1  . GLU A 1 51 ? -4.392  -5.324  1.948   1.00 0.00 ? 115 GLU A OE1  3  
ATOM   2651  O OE2  . GLU A 1 51 ? -2.256  -5.593  1.542   1.00 0.00 ? 115 GLU A OE2  3  
ATOM   2652  H H    . GLU A 1 51 ? -2.579  -2.322  6.075   1.00 0.00 ? 115 GLU A H    3  
ATOM   2653  H HA   . GLU A 1 51 ? -2.159  -5.092  6.695   1.00 0.00 ? 115 GLU A HA   3  
ATOM   2654  H HB2  . GLU A 1 51 ? -2.477  -5.959  4.452   1.00 0.00 ? 115 GLU A HB2  3  
ATOM   2655  H HB3  . GLU A 1 51 ? -3.934  -5.077  4.925   1.00 0.00 ? 115 GLU A HB3  3  
ATOM   2656  H HG2  . GLU A 1 51 ? -3.540  -3.385  3.438   1.00 0.00 ? 115 GLU A HG2  3  
ATOM   2657  H HG3  . GLU A 1 51 ? -1.836  -3.812  3.239   1.00 0.00 ? 115 GLU A HG3  3  
ATOM   2658  N N    . VAL A 1 52 ? 0.102   -4.986  5.535   1.00 0.00 ? 116 VAL A N    3  
ATOM   2659  C CA   . VAL A 1 52 ? 1.469   -4.809  5.139   1.00 0.00 ? 116 VAL A CA   3  
ATOM   2660  C C    . VAL A 1 52 ? 1.557   -5.243  3.697   1.00 0.00 ? 116 VAL A C    3  
ATOM   2661  O O    . VAL A 1 52 ? 1.398   -6.425  3.381   1.00 0.00 ? 116 VAL A O    3  
ATOM   2662  C CB   . VAL A 1 52 ? 2.443   -5.647  6.012   1.00 0.00 ? 116 VAL A CB   3  
ATOM   2663  C CG1  . VAL A 1 52 ? 3.892   -5.417  5.598   1.00 0.00 ? 116 VAL A CG1  3  
ATOM   2664  C CG2  . VAL A 1 52 ? 2.257   -5.326  7.486   1.00 0.00 ? 116 VAL A CG2  3  
ATOM   2665  H H    . VAL A 1 52 ? -0.200  -5.887  5.780   1.00 0.00 ? 116 VAL A H    3  
ATOM   2666  H HA   . VAL A 1 52 ? 1.713   -3.760  5.211   1.00 0.00 ? 116 VAL A HA   3  
ATOM   2667  H HB   . VAL A 1 52 ? 2.214   -6.692  5.861   1.00 0.00 ? 116 VAL A HB   3  
ATOM   2668  H HG11 . VAL A 1 52 ? 4.134   -4.369  5.702   1.00 0.00 ? 116 VAL A HG11 3  
ATOM   2669  H HG12 . VAL A 1 52 ? 4.543   -5.999  6.232   1.00 0.00 ? 116 VAL A HG12 3  
ATOM   2670  H HG13 . VAL A 1 52 ? 4.025   -5.718  4.569   1.00 0.00 ? 116 VAL A HG13 3  
ATOM   2671  H HG21 . VAL A 1 52 ? 1.243   -5.555  7.780   1.00 0.00 ? 116 VAL A HG21 3  
ATOM   2672  H HG22 . VAL A 1 52 ? 2.944   -5.919  8.071   1.00 0.00 ? 116 VAL A HG22 3  
ATOM   2673  H HG23 . VAL A 1 52 ? 2.450   -4.276  7.653   1.00 0.00 ? 116 VAL A HG23 3  
ATOM   2674  N N    . THR A 1 53 ? 1.767   -4.313  2.839   1.00 0.00 ? 117 THR A N    3  
ATOM   2675  C CA   . THR A 1 53 ? 1.760   -4.568  1.427   1.00 0.00 ? 117 THR A CA   3  
ATOM   2676  C C    . THR A 1 53 ? 3.052   -4.004  0.806   1.00 0.00 ? 117 THR A C    3  
ATOM   2677  O O    . THR A 1 53 ? 3.579   -2.995  1.289   1.00 0.00 ? 117 THR A O    3  
ATOM   2678  C CB   . THR A 1 53 ? 0.470   -3.974  0.749   1.00 0.00 ? 117 THR A CB   3  
ATOM   2679  O OG1  . THR A 1 53 ? 0.274   -4.522  -0.563  1.00 0.00 ? 117 THR A OG1  3  
ATOM   2680  C CG2  . THR A 1 53 ? 0.538   -2.460  0.648   1.00 0.00 ? 117 THR A CG2  3  
ATOM   2681  H H    . THR A 1 53 ? 1.960   -3.405  3.173   1.00 0.00 ? 117 THR A H    3  
ATOM   2682  H HA   . THR A 1 53 ? 1.763   -5.641  1.301   1.00 0.00 ? 117 THR A HA   3  
ATOM   2683  H HB   . THR A 1 53 ? -0.390  -4.240  1.344   1.00 0.00 ? 117 THR A HB   3  
ATOM   2684  H HG1  . THR A 1 53 ? -0.645  -4.815  -0.567  1.00 0.00 ? 117 THR A HG1  3  
ATOM   2685  H HG21 . THR A 1 53 ? 1.382   -2.185  0.031   1.00 0.00 ? 117 THR A HG21 3  
ATOM   2686  H HG22 . THR A 1 53 ? -0.370  -2.081  0.205   1.00 0.00 ? 117 THR A HG22 3  
ATOM   2687  H HG23 . THR A 1 53 ? 0.667   -2.044  1.636   1.00 0.00 ? 117 THR A HG23 3  
ATOM   2688  N N    . PRO A 1 54 ? 3.651   -4.705  -0.172  1.00 0.00 ? 118 PRO A N    3  
ATOM   2689  C CA   . PRO A 1 54 ? 4.864   -4.242  -0.840  1.00 0.00 ? 118 PRO A CA   3  
ATOM   2690  C C    . PRO A 1 54 ? 4.648   -2.895  -1.517  1.00 0.00 ? 118 PRO A C    3  
ATOM   2691  O O    . PRO A 1 54 ? 3.544   -2.589  -1.965  1.00 0.00 ? 118 PRO A O    3  
ATOM   2692  C CB   . PRO A 1 54 ? 5.142   -5.324  -1.890  1.00 0.00 ? 118 PRO A CB   3  
ATOM   2693  C CG   . PRO A 1 54 ? 3.843   -6.004  -2.078  1.00 0.00 ? 118 PRO A CG   3  
ATOM   2694  C CD   . PRO A 1 54 ? 3.165   -5.963  -0.742  1.00 0.00 ? 118 PRO A CD   3  
ATOM   2695  H HA   . PRO A 1 54 ? 5.699   -4.168  -0.164  1.00 0.00 ? 118 PRO A HA   3  
ATOM   2696  H HB2  . PRO A 1 54 ? 5.485   -4.862  -2.804  1.00 0.00 ? 118 PRO A HB2  3  
ATOM   2697  H HB3  . PRO A 1 54 ? 5.892   -6.007  -1.521  1.00 0.00 ? 118 PRO A HB3  3  
ATOM   2698  H HG2  . PRO A 1 54 ? 3.258   -5.457  -2.804  1.00 0.00 ? 118 PRO A HG2  3  
ATOM   2699  H HG3  . PRO A 1 54 ? 3.978   -7.019  -2.411  1.00 0.00 ? 118 PRO A HG3  3  
ATOM   2700  H HD2  . PRO A 1 54 ? 2.096   -5.930  -0.879  1.00 0.00 ? 118 PRO A HD2  3  
ATOM   2701  H HD3  . PRO A 1 54 ? 3.436   -6.808  -0.132  1.00 0.00 ? 118 PRO A HD3  3  
ATOM   2702  N N    . LEU A 1 55 ? 5.697   -2.109  -1.587  1.00 0.00 ? 119 LEU A N    3  
ATOM   2703  C CA   . LEU A 1 55 ? 5.677   -0.781  -2.208  1.00 0.00 ? 119 LEU A CA   3  
ATOM   2704  C C    . LEU A 1 55 ? 5.242   -0.856  -3.666  1.00 0.00 ? 119 LEU A C    3  
ATOM   2705  O O    . LEU A 1 55 ? 4.708   0.103   -4.206  1.00 0.00 ? 119 LEU A O    3  
ATOM   2706  C CB   . LEU A 1 55 ? 7.049   -0.130  -2.098  1.00 0.00 ? 119 LEU A CB   3  
ATOM   2707  C CG   . LEU A 1 55 ? 7.606   0.006   -0.680  1.00 0.00 ? 119 LEU A CG   3  
ATOM   2708  C CD1  . LEU A 1 55 ? 8.995   0.579   -0.704  1.00 0.00 ? 119 LEU A CD1  3  
ATOM   2709  C CD2  . LEU A 1 55 ? 6.703   0.845   0.202   1.00 0.00 ? 119 LEU A CD2  3  
ATOM   2710  H H    . LEU A 1 55 ? 6.536   -2.421  -1.181  1.00 0.00 ? 119 LEU A H    3  
ATOM   2711  H HA   . LEU A 1 55 ? 4.960   -0.166  -1.685  1.00 0.00 ? 119 LEU A HA   3  
ATOM   2712  H HB2  . LEU A 1 55 ? 7.740   -0.722  -2.680  1.00 0.00 ? 119 LEU A HB2  3  
ATOM   2713  H HB3  . LEU A 1 55 ? 6.989   0.854   -2.535  1.00 0.00 ? 119 LEU A HB3  3  
ATOM   2714  H HG   . LEU A 1 55 ? 7.658   -0.986  -0.262  1.00 0.00 ? 119 LEU A HG   3  
ATOM   2715  H HD11 . LEU A 1 55 ? 8.980   1.558   -1.160  1.00 0.00 ? 119 LEU A HD11 3  
ATOM   2716  H HD12 . LEU A 1 55 ? 9.370   0.654   0.307   1.00 0.00 ? 119 LEU A HD12 3  
ATOM   2717  H HD13 . LEU A 1 55 ? 9.632   -0.077  -1.279  1.00 0.00 ? 119 LEU A HD13 3  
ATOM   2718  H HD21 . LEU A 1 55 ? 5.739   0.366   0.289   1.00 0.00 ? 119 LEU A HD21 3  
ATOM   2719  H HD22 . LEU A 1 55 ? 7.149   0.929   1.181   1.00 0.00 ? 119 LEU A HD22 3  
ATOM   2720  H HD23 . LEU A 1 55 ? 6.579   1.830   -0.220  1.00 0.00 ? 119 LEU A HD23 3  
ATOM   2721  N N    . LEU A 1 56 ? 5.479   -2.009  -4.293  1.00 0.00 ? 120 LEU A N    3  
ATOM   2722  C CA   . LEU A 1 56 ? 5.061   -2.249  -5.676  1.00 0.00 ? 120 LEU A CA   3  
ATOM   2723  C C    . LEU A 1 56 ? 3.531   -2.216  -5.771  1.00 0.00 ? 120 LEU A C    3  
ATOM   2724  O O    . LEU A 1 56 ? 2.959   -1.890  -6.811  1.00 0.00 ? 120 LEU A O    3  
ATOM   2725  C CB   . LEU A 1 56 ? 5.618   -3.605  -6.178  1.00 0.00 ? 120 LEU A CB   3  
ATOM   2726  C CG   . LEU A 1 56 ? 4.852   -4.888  -5.802  1.00 0.00 ? 120 LEU A CG   3  
ATOM   2727  C CD1  . LEU A 1 56 ? 3.818   -5.211  -6.870  1.00 0.00 ? 120 LEU A CD1  3  
ATOM   2728  C CD2  . LEU A 1 56 ? 5.804   -6.053  -5.601  1.00 0.00 ? 120 LEU A CD2  3  
ATOM   2729  H H    . LEU A 1 56 ? 5.981   -2.699  -3.807  1.00 0.00 ? 120 LEU A H    3  
ATOM   2730  H HA   . LEU A 1 56 ? 5.450   -1.456  -6.289  1.00 0.00 ? 120 LEU A HA   3  
ATOM   2731  H HB2  . LEU A 1 56 ? 5.664   -3.564  -7.256  1.00 0.00 ? 120 LEU A HB2  3  
ATOM   2732  H HB3  . LEU A 1 56 ? 6.624   -3.698  -5.802  1.00 0.00 ? 120 LEU A HB3  3  
ATOM   2733  H HG   . LEU A 1 56 ? 4.303   -4.714  -4.886  1.00 0.00 ? 120 LEU A HG   3  
ATOM   2734  H HD11 . LEU A 1 56 ? 3.209   -4.327  -6.991  1.00 0.00 ? 120 LEU A HD11 3  
ATOM   2735  H HD12 . LEU A 1 56 ? 4.317   -5.419  -7.805  1.00 0.00 ? 120 LEU A HD12 3  
ATOM   2736  H HD13 . LEU A 1 56 ? 3.213   -6.050  -6.562  1.00 0.00 ? 120 LEU A HD13 3  
ATOM   2737  H HD21 . LEU A 1 56 ? 6.487   -5.828  -4.795  1.00 0.00 ? 120 LEU A HD21 3  
ATOM   2738  H HD22 . LEU A 1 56 ? 5.236   -6.938  -5.353  1.00 0.00 ? 120 LEU A HD22 3  
ATOM   2739  H HD23 . LEU A 1 56 ? 6.360   -6.227  -6.510  1.00 0.00 ? 120 LEU A HD23 3  
ATOM   2740  N N    . ASN A 1 57 ? 2.884   -2.541  -4.674  1.00 0.00 ? 121 ASN A N    3  
ATOM   2741  C CA   . ASN A 1 57 ? 1.439   -2.568  -4.597  1.00 0.00 ? 121 ASN A CA   3  
ATOM   2742  C C    . ASN A 1 57 ? 0.893   -1.207  -4.249  1.00 0.00 ? 121 ASN A C    3  
ATOM   2743  O O    . ASN A 1 57 ? -0.326  -1.016  -4.187  1.00 0.00 ? 121 ASN A O    3  
ATOM   2744  C CB   . ASN A 1 57 ? 0.929   -3.603  -3.576  1.00 0.00 ? 121 ASN A CB   3  
ATOM   2745  C CG   . ASN A 1 57 ? 0.938   -5.032  -4.052  1.00 0.00 ? 121 ASN A CG   3  
ATOM   2746  O OD1  . ASN A 1 57 ? 0.921   -5.316  -5.249  1.00 0.00 ? 121 ASN A OD1  3  
ATOM   2747  N ND2  . ASN A 1 57 ? 0.862   -5.938  -3.125  1.00 0.00 ? 121 ASN A ND2  3  
ATOM   2748  H H    . ASN A 1 57 ? 3.406   -2.740  -3.866  1.00 0.00 ? 121 ASN A H    3  
ATOM   2749  H HA   . ASN A 1 57 ? 1.070   -2.844  -5.574  1.00 0.00 ? 121 ASN A HA   3  
ATOM   2750  H HB2  . ASN A 1 57 ? 1.602   -3.569  -2.733  1.00 0.00 ? 121 ASN A HB2  3  
ATOM   2751  H HB3  . ASN A 1 57 ? -0.050  -3.373  -3.204  1.00 0.00 ? 121 ASN A HB3  3  
ATOM   2752  H HD21 . ASN A 1 57 ? 0.803   -5.618  -2.195  1.00 0.00 ? 121 ASN A HD21 3  
ATOM   2753  H HD22 . ASN A 1 57 ? 0.851   -6.885  -3.385  1.00 0.00 ? 121 ASN A HD22 3  
ATOM   2754  N N    . LEU A 1 58 ? 1.782   -0.261  -4.009  1.00 0.00 ? 122 LEU A N    3  
ATOM   2755  C CA   . LEU A 1 58 ? 1.368   1.065   -3.690  1.00 0.00 ? 122 LEU A CA   3  
ATOM   2756  C C    . LEU A 1 58 ? 1.443   1.930   -4.911  1.00 0.00 ? 122 LEU A C    3  
ATOM   2757  O O    . LEU A 1 58 ? 2.451   1.961   -5.617  1.00 0.00 ? 122 LEU A O    3  
ATOM   2758  C CB   . LEU A 1 58 ? 2.237   1.646   -2.585  1.00 0.00 ? 122 LEU A CB   3  
ATOM   2759  C CG   . LEU A 1 58 ? 2.202   0.913   -1.263  1.00 0.00 ? 122 LEU A CG   3  
ATOM   2760  C CD1  . LEU A 1 58 ? 3.062   1.631   -0.245  1.00 0.00 ? 122 LEU A CD1  3  
ATOM   2761  C CD2  . LEU A 1 58 ? 0.778   0.788   -0.767  1.00 0.00 ? 122 LEU A CD2  3  
ATOM   2762  H H    . LEU A 1 58 ? 2.745   -0.442  -4.062  1.00 0.00 ? 122 LEU A H    3  
ATOM   2763  H HA   . LEU A 1 58 ? 0.345   1.036   -3.349  1.00 0.00 ? 122 LEU A HA   3  
ATOM   2764  H HB2  . LEU A 1 58 ? 3.262   1.619   -2.929  1.00 0.00 ? 122 LEU A HB2  3  
ATOM   2765  H HB3  . LEU A 1 58 ? 1.952   2.673   -2.415  1.00 0.00 ? 122 LEU A HB3  3  
ATOM   2766  H HG   . LEU A 1 58 ? 2.597   -0.080  -1.420  1.00 0.00 ? 122 LEU A HG   3  
ATOM   2767  H HD11 . LEU A 1 58 ? 2.693   2.639   -0.116  1.00 0.00 ? 122 LEU A HD11 3  
ATOM   2768  H HD12 . LEU A 1 58 ? 3.024   1.108   0.697   1.00 0.00 ? 122 LEU A HD12 3  
ATOM   2769  H HD13 . LEU A 1 58 ? 4.083   1.672   -0.598  1.00 0.00 ? 122 LEU A HD13 3  
ATOM   2770  H HD21 . LEU A 1 58 ? 0.192   0.252   -1.499  1.00 0.00 ? 122 LEU A HD21 3  
ATOM   2771  H HD22 . LEU A 1 58 ? 0.761   0.245   0.166   1.00 0.00 ? 122 LEU A HD22 3  
ATOM   2772  H HD23 . LEU A 1 58 ? 0.358   1.775   -0.633  1.00 0.00 ? 122 LEU A HD23 3  
ATOM   2773  N N    . LYS A 1 59 ? 0.376   2.603   -5.158  1.00 0.00 ? 123 LYS A N    3  
ATOM   2774  C CA   . LYS A 1 59 ? 0.239   3.498   -6.270  1.00 0.00 ? 123 LYS A CA   3  
ATOM   2775  C C    . LYS A 1 59 ? 0.033   4.901   -5.738  1.00 0.00 ? 123 LYS A C    3  
ATOM   2776  O O    . LYS A 1 59 ? -0.321  5.059   -4.567  1.00 0.00 ? 123 LYS A O    3  
ATOM   2777  C CB   . LYS A 1 59 ? -0.964  3.088   -7.113  1.00 0.00 ? 123 LYS A CB   3  
ATOM   2778  C CG   . LYS A 1 59 ? -0.992  1.629   -7.488  1.00 0.00 ? 123 LYS A CG   3  
ATOM   2779  C CD   . LYS A 1 59 ? -2.216  1.329   -8.303  1.00 0.00 ? 123 LYS A CD   3  
ATOM   2780  C CE   . LYS A 1 59 ? -2.335  -0.148  -8.647  1.00 0.00 ? 123 LYS A CE   3  
ATOM   2781  N NZ   . LYS A 1 59 ? -1.264  -0.621  -9.548  1.00 0.00 ? 123 LYS A NZ   3  
ATOM   2782  H H    . LYS A 1 59 ? -0.371  2.496   -4.528  1.00 0.00 ? 123 LYS A H    3  
ATOM   2783  H HA   . LYS A 1 59 ? 1.131   3.466   -6.874  1.00 0.00 ? 123 LYS A HA   3  
ATOM   2784  H HB2  . LYS A 1 59 ? -1.869  3.317   -6.573  1.00 0.00 ? 123 LYS A HB2  3  
ATOM   2785  H HB3  . LYS A 1 59 ? -0.963  3.665   -8.024  1.00 0.00 ? 123 LYS A HB3  3  
ATOM   2786  H HG2  . LYS A 1 59 ? -0.104  1.381   -8.049  1.00 0.00 ? 123 LYS A HG2  3  
ATOM   2787  H HG3  . LYS A 1 59 ? -1.030  1.061   -6.571  1.00 0.00 ? 123 LYS A HG3  3  
ATOM   2788  H HD2  . LYS A 1 59 ? -3.087  1.645   -7.749  1.00 0.00 ? 123 LYS A HD2  3  
ATOM   2789  H HD3  . LYS A 1 59 ? -2.138  1.907   -9.213  1.00 0.00 ? 123 LYS A HD3  3  
ATOM   2790  H HE2  . LYS A 1 59 ? -2.282  -0.713  -7.728  1.00 0.00 ? 123 LYS A HE2  3  
ATOM   2791  H HE3  . LYS A 1 59 ? -3.295  -0.320  -9.110  1.00 0.00 ? 123 LYS A HE3  3  
ATOM   2792  H HZ1  . LYS A 1 59 ? -0.327  -0.543  -9.101  1.00 0.00 ? 123 LYS A HZ1  3  
ATOM   2793  H HZ2  . LYS A 1 59 ? -1.406  -1.629  -9.767  1.00 0.00 ? 123 LYS A HZ2  3  
ATOM   2794  H HZ3  . LYS A 1 59 ? -1.247  -0.087  -10.439 1.00 0.00 ? 123 LYS A HZ3  3  
ATOM   2795  N N    . PRO A 1 60 ? 0.237   5.930   -6.551  1.00 0.00 ? 124 PRO A N    3  
ATOM   2796  C CA   . PRO A 1 60 ? -0.063  7.285   -6.150  1.00 0.00 ? 124 PRO A CA   3  
ATOM   2797  C C    . PRO A 1 60 ? -1.571  7.522   -6.210  1.00 0.00 ? 124 PRO A C    3  
ATOM   2798  O O    . PRO A 1 60 ? -2.259  6.988   -7.102  1.00 0.00 ? 124 PRO A O    3  
ATOM   2799  C CB   . PRO A 1 60 ? 0.675   8.148   -7.168  1.00 0.00 ? 124 PRO A CB   3  
ATOM   2800  C CG   . PRO A 1 60 ? 0.828   7.291   -8.380  1.00 0.00 ? 124 PRO A CG   3  
ATOM   2801  C CD   . PRO A 1 60 ? 0.766   5.855   -7.924  1.00 0.00 ? 124 PRO A CD   3  
ATOM   2802  H HA   . PRO A 1 60 ? 0.282   7.487   -5.147  1.00 0.00 ? 124 PRO A HA   3  
ATOM   2803  H HB2  . PRO A 1 60 ? 0.088   9.031   -7.375  1.00 0.00 ? 124 PRO A HB2  3  
ATOM   2804  H HB3  . PRO A 1 60 ? 1.633   8.437   -6.764  1.00 0.00 ? 124 PRO A HB3  3  
ATOM   2805  H HG2  . PRO A 1 60 ? 0.028   7.492   -9.077  1.00 0.00 ? 124 PRO A HG2  3  
ATOM   2806  H HG3  . PRO A 1 60 ? 1.782   7.493   -8.843  1.00 0.00 ? 124 PRO A HG3  3  
ATOM   2807  H HD2  . PRO A 1 60 ? 0.082   5.289   -8.537  1.00 0.00 ? 124 PRO A HD2  3  
ATOM   2808  H HD3  . PRO A 1 60 ? 1.734   5.379   -7.933  1.00 0.00 ? 124 PRO A HD3  3  
ATOM   2809  N N    . VAL A 1 61 ? -2.086  8.271   -5.262  1.00 0.00 ? 125 VAL A N    3  
ATOM   2810  C CA   . VAL A 1 61 ? -3.515  8.526   -5.190  1.00 0.00 ? 125 VAL A CA   3  
ATOM   2811  C C    . VAL A 1 61 ? -4.014  9.360   -6.336  1.00 0.00 ? 125 VAL A C    3  
ATOM   2812  O O    . VAL A 1 61 ? -3.347  10.292  -6.797  1.00 0.00 ? 125 VAL A O    3  
ATOM   2813  C CB   . VAL A 1 61 ? -3.975  9.163   -3.859  1.00 0.00 ? 125 VAL A CB   3  
ATOM   2814  C CG1  . VAL A 1 61 ? -3.765  8.221   -2.708  1.00 0.00 ? 125 VAL A CG1  3  
ATOM   2815  C CG2  . VAL A 1 61 ? -3.281  10.493  -3.598  1.00 0.00 ? 125 VAL A CG2  3  
ATOM   2816  H H    . VAL A 1 61 ? -1.477  8.669   -4.602  1.00 0.00 ? 125 VAL A H    3  
ATOM   2817  H HA   . VAL A 1 61 ? -3.998  7.563   -5.277  1.00 0.00 ? 125 VAL A HA   3  
ATOM   2818  H HB   . VAL A 1 61 ? -5.033  9.350   -3.945  1.00 0.00 ? 125 VAL A HB   3  
ATOM   2819  H HG11 . VAL A 1 61 ? -2.710  8.023   -2.578  1.00 0.00 ? 125 VAL A HG11 3  
ATOM   2820  H HG12 . VAL A 1 61 ? -4.167  8.668   -1.813  1.00 0.00 ? 125 VAL A HG12 3  
ATOM   2821  H HG13 . VAL A 1 61 ? -4.280  7.294   -2.910  1.00 0.00 ? 125 VAL A HG13 3  
ATOM   2822  H HG21 . VAL A 1 61 ? -3.519  11.185  -4.391  1.00 0.00 ? 125 VAL A HG21 3  
ATOM   2823  H HG22 . VAL A 1 61 ? -3.625  10.893  -2.657  1.00 0.00 ? 125 VAL A HG22 3  
ATOM   2824  H HG23 . VAL A 1 61 ? -2.212  10.344  -3.560  1.00 0.00 ? 125 VAL A HG23 3  
ATOM   2825  N N    . GLU A 1 62 ? -5.170  9.019   -6.802  1.00 0.00 ? 126 GLU A N    3  
ATOM   2826  C CA   . GLU A 1 62 ? -5.790  9.740   -7.849  1.00 0.00 ? 126 GLU A CA   3  
ATOM   2827  C C    . GLU A 1 62 ? -6.843  10.631  -7.265  1.00 0.00 ? 126 GLU A C    3  
ATOM   2828  O O    . GLU A 1 62 ? -7.984  10.239  -7.052  1.00 0.00 ? 126 GLU A O    3  
ATOM   2829  C CB   . GLU A 1 62 ? -6.305  8.798   -8.917  1.00 0.00 ? 126 GLU A CB   3  
ATOM   2830  C CG   . GLU A 1 62 ? -5.164  8.028   -9.531  1.00 0.00 ? 126 GLU A CG   3  
ATOM   2831  C CD   . GLU A 1 62 ? -5.578  7.062   -10.605 1.00 0.00 ? 126 GLU A CD   3  
ATOM   2832  O OE1  . GLU A 1 62 ? -5.613  7.458   -11.789 1.00 0.00 ? 126 GLU A OE1  3  
ATOM   2833  O OE2  . GLU A 1 62 ? -5.853  5.879   -10.295 1.00 0.00 ? 126 GLU A OE2  3  
ATOM   2834  H H    . GLU A 1 62 ? -5.641  8.250   -6.416  1.00 0.00 ? 126 GLU A H    3  
ATOM   2835  H HA   . GLU A 1 62 ? -5.022  10.370  -8.273  1.00 0.00 ? 126 GLU A HA   3  
ATOM   2836  H HB2  . GLU A 1 62 ? -7.000  8.104   -8.470  1.00 0.00 ? 126 GLU A HB2  3  
ATOM   2837  H HB3  . GLU A 1 62 ? -6.795  9.361   -9.697  1.00 0.00 ? 126 GLU A HB3  3  
ATOM   2838  H HG2  . GLU A 1 62 ? -4.496  8.773   -9.939  1.00 0.00 ? 126 GLU A HG2  3  
ATOM   2839  H HG3  . GLU A 1 62 ? -4.655  7.509   -8.734  1.00 0.00 ? 126 GLU A HG3  3  
ATOM   2840  N N    . GLU A 1 63 ? -6.403  11.803  -6.929  1.00 0.00 ? 127 GLU A N    3  
ATOM   2841  C CA   . GLU A 1 63 ? -7.221  12.803  -6.257  1.00 0.00 ? 127 GLU A CA   3  
ATOM   2842  C C    . GLU A 1 63 ? -7.868  13.740  -7.257  1.00 0.00 ? 127 GLU A C    3  
ATOM   2843  O O    . GLU A 1 63 ? -8.714  14.572  -6.913  1.00 0.00 ? 127 GLU A O    3  
ATOM   2844  C CB   . GLU A 1 63 ? -6.393  13.573  -5.219  1.00 0.00 ? 127 GLU A CB   3  
ATOM   2845  C CG   . GLU A 1 63 ? -5.122  14.207  -5.772  1.00 0.00 ? 127 GLU A CG   3  
ATOM   2846  C CD   . GLU A 1 63 ? -4.369  14.988  -4.733  1.00 0.00 ? 127 GLU A CD   3  
ATOM   2847  O OE1  . GLU A 1 63 ? -3.522  14.411  -4.023  1.00 0.00 ? 127 GLU A OE1  3  
ATOM   2848  O OE2  . GLU A 1 63 ? -4.618  16.210  -4.589  1.00 0.00 ? 127 GLU A OE2  3  
ATOM   2849  H H    . GLU A 1 63 ? -5.472  11.986  -7.187  1.00 0.00 ? 127 GLU A H    3  
ATOM   2850  H HA   . GLU A 1 63 ? -8.014  12.277  -5.748  1.00 0.00 ? 127 GLU A HA   3  
ATOM   2851  H HB2  . GLU A 1 63 ? -7.003  14.358  -4.801  1.00 0.00 ? 127 GLU A HB2  3  
ATOM   2852  H HB3  . GLU A 1 63 ? -6.112  12.894  -4.428  1.00 0.00 ? 127 GLU A HB3  3  
ATOM   2853  H HG2  . GLU A 1 63 ? -4.477  13.425  -6.144  1.00 0.00 ? 127 GLU A HG2  3  
ATOM   2854  H HG3  . GLU A 1 63 ? -5.387  14.869  -6.583  1.00 0.00 ? 127 GLU A HG3  3  
ATOM   2855  N N    . GLY A 1 64 ? -7.465  13.614  -8.470  1.00 0.00 ? 128 GLY A N    3  
ATOM   2856  C CA   . GLY A 1 64 ? -8.030  14.380  -9.517  1.00 0.00 ? 128 GLY A CA   3  
ATOM   2857  C C    . GLY A 1 64 ? -7.985  13.589  -10.770 1.00 0.00 ? 128 GLY A C    3  
ATOM   2858  O O    . GLY A 1 64 ? -8.942  12.861  -11.066 1.00 0.00 ? 128 GLY A O    3  
ATOM   2859  O OXT  . GLY A 1 64 ? -6.947  13.614  -11.442 1.00 0.00 ? 128 GLY A OXT  3  
ATOM   2860  H H    . GLY A 1 64 ? -6.749  12.978  -8.681  1.00 0.00 ? 128 GLY A H    3  
ATOM   2861  H HA2  . GLY A 1 64 ? -9.054  14.612  -9.261  1.00 0.00 ? 128 GLY A HA2  3  
ATOM   2862  H HA3  . GLY A 1 64 ? -7.468  15.291  -9.648  1.00 0.00 ? 128 GLY A HA3  3  
HETATM 2863  N N    . 2MR B 2 .  ? -17.959 -4.323  1.123   1.00 0.00 ? 201 2MR A N    3  
HETATM 2864  C CA   . 2MR B 2 .  ? -16.814 -4.270  0.225   1.00 0.00 ? 201 2MR A CA   3  
HETATM 2865  C CB   . 2MR B 2 .  ? -15.515 -4.006  0.983   1.00 0.00 ? 201 2MR A CB   3  
HETATM 2866  C CG   . 2MR B 2 .  ? -15.556 -2.840  1.914   1.00 0.00 ? 201 2MR A CG   3  
HETATM 2867  C CD   . 2MR B 2 .  ? -14.226 -2.641  2.573   1.00 0.00 ? 201 2MR A CD   3  
HETATM 2868  N NE   . 2MR B 2 .  ? -13.208 -2.278  1.599   1.00 0.00 ? 201 2MR A NE   3  
HETATM 2869  C CZ   . 2MR B 2 .  ? -11.964 -2.008  1.888   1.00 0.00 ? 201 2MR A CZ   3  
HETATM 2870  N NH1  . 2MR B 2 .  ? -11.569 -2.065  3.205   1.00 0.00 ? 201 2MR A NH1  3  
HETATM 2871  C CQ1  . 2MR B 2 .  ? -10.267 -1.821  3.849   1.00 0.00 ? 201 2MR A CQ1  3  
HETATM 2872  N NH2  . 2MR B 2 .  ? -11.143 -1.687  0.861   1.00 0.00 ? 201 2MR A NH2  3  
HETATM 2873  C CQ2  . 2MR B 2 .  ? -9.727  -1.339  0.841   1.00 0.00 ? 201 2MR A CQ2  3  
HETATM 2874  C C    . 2MR B 2 .  ? -16.727 -5.598  -0.461  1.00 0.00 ? 201 2MR A C    3  
HETATM 2875  O O    . 2MR B 2 .  ? -16.803 -5.652  -1.697  1.00 0.00 ? 201 2MR A O    3  
HETATM 2876  O OXT  . 2MR B 2 .  ? -16.662 -6.616  0.244   1.00 0.00 ? 201 2MR A OXT  3  
HETATM 2877  H H2   . 2MR B 2 .  ? -18.801 -4.580  0.568   1.00 0.00 ? 201 2MR A H2   3  
HETATM 2878  H H    . 2MR B 2 .  ? -17.812 -5.087  1.813   1.00 0.00 ? 201 2MR A H    3  
HETATM 2879  H H3   . 2MR B 2 .  ? -18.126 -3.428  1.621   1.00 0.00 ? 201 2MR A H3   3  
HETATM 2880  H HA   . 2MR B 2 .  ? -16.985 -3.498  -0.511  1.00 0.00 ? 201 2MR A HA   3  
HETATM 2881  H HB2  . 2MR B 2 .  ? -14.748 -3.769  0.259   1.00 0.00 ? 201 2MR A HB2  3  
HETATM 2882  H HB3  . 2MR B 2 .  ? -15.207 -4.870  1.549   1.00 0.00 ? 201 2MR A HB3  3  
HETATM 2883  H HG2  . 2MR B 2 .  ? -16.305 -3.030  2.664   1.00 0.00 ? 201 2MR A HG2  3  
HETATM 2884  H HG3  . 2MR B 2 .  ? -15.768 -1.960  1.325   1.00 0.00 ? 201 2MR A HG3  3  
HETATM 2885  H HD2  . 2MR B 2 .  ? -13.932 -3.558  3.059   1.00 0.00 ? 201 2MR A HD2  3  
HETATM 2886  H HD3  . 2MR B 2 .  ? -14.304 -1.848  3.303   1.00 0.00 ? 201 2MR A HD3  3  
HETATM 2887  H HE   . 2MR B 2 .  ? -13.514 -2.233  0.664   1.00 0.00 ? 201 2MR A HE   3  
HETATM 2888  H HQ11 . 2MR B 2 .  ? -9.535  -2.518  3.469   1.00 0.00 ? 201 2MR A HQ11 3  
HETATM 2889  H HQ12 . 2MR B 2 .  ? -9.954  -0.811  3.628   1.00 0.00 ? 201 2MR A HQ12 3  
HETATM 2890  H HQ13 . 2MR B 2 .  ? -10.364 -1.944  4.917   1.00 0.00 ? 201 2MR A HQ13 3  
HETATM 2891  H HH2  . 2MR B 2 .  ? -11.505 -1.679  -0.072  1.00 0.00 ? 201 2MR A HH2  3  
HETATM 2892  H HQ21 . 2MR B 2 .  ? -9.397  -1.253  -0.185  1.00 0.00 ? 201 2MR A HQ21 3  
HETATM 2893  H HQ22 . 2MR B 2 .  ? -9.578  -0.395  1.346   1.00 0.00 ? 201 2MR A HQ22 3  
HETATM 2894  H HQ23 . 2MR B 2 .  ? -9.156  -2.111  1.334   1.00 0.00 ? 201 2MR A HQ23 3  
HETATM 2895  H HH1  . 2MR B 2 .  ? -12.244 -2.312  3.907   1.00 0.00 ? 201 2MR A HH1  3  
ATOM   2896  N N    . ALA A 1 1  ? 15.544  -6.883  0.355   1.00 0.00 ? 65  ALA A N    4  
ATOM   2897  C CA   . ALA A 1 1  ? 14.738  -7.640  -0.601  1.00 0.00 ? 65  ALA A CA   4  
ATOM   2898  C C    . ALA A 1 1  ? 15.473  -7.742  -1.922  1.00 0.00 ? 65  ALA A C    4  
ATOM   2899  O O    . ALA A 1 1  ? 16.318  -6.900  -2.229  1.00 0.00 ? 65  ALA A O    4  
ATOM   2900  C CB   . ALA A 1 1  ? 13.388  -6.966  -0.806  1.00 0.00 ? 65  ALA A CB   4  
ATOM   2901  H H1   . ALA A 1 1  ? 15.779  -5.954  -0.052  1.00 0.00 ? 65  ALA A H1   4  
ATOM   2902  H H2   . ALA A 1 1  ? 15.007  -6.727  1.233   1.00 0.00 ? 65  ALA A H2   4  
ATOM   2903  H H3   . ALA A 1 1  ? 16.426  -7.387  0.581   1.00 0.00 ? 65  ALA A H3   4  
ATOM   2904  H HA   . ALA A 1 1  ? 14.569  -8.633  -0.211  1.00 0.00 ? 65  ALA A HA   4  
ATOM   2905  H HB1  . ALA A 1 1  ? 13.536  -5.976  -1.209  1.00 0.00 ? 65  ALA A HB1  4  
ATOM   2906  H HB2  . ALA A 1 1  ? 12.791  -7.544  -1.495  1.00 0.00 ? 65  ALA A HB2  4  
ATOM   2907  H HB3  . ALA A 1 1  ? 12.876  -6.892  0.142   1.00 0.00 ? 65  ALA A HB3  4  
ATOM   2908  N N    . SER A 1 2  ? 15.175  -8.766  -2.688  1.00 0.00 ? 66  SER A N    4  
ATOM   2909  C CA   . SER A 1 2  ? 15.749  -8.934  -3.999  1.00 0.00 ? 66  SER A CA   4  
ATOM   2910  C C    . SER A 1 2  ? 14.975  -8.064  -4.982  1.00 0.00 ? 66  SER A C    4  
ATOM   2911  O O    . SER A 1 2  ? 15.555  -7.431  -5.872  1.00 0.00 ? 66  SER A O    4  
ATOM   2912  C CB   . SER A 1 2  ? 15.700  -10.416 -4.415  1.00 0.00 ? 66  SER A CB   4  
ATOM   2913  O OG   . SER A 1 2  ? 16.247  -10.629 -5.709  1.00 0.00 ? 66  SER A OG   4  
ATOM   2914  H H    . SER A 1 2  ? 14.549  -9.451  -2.365  1.00 0.00 ? 66  SER A H    4  
ATOM   2915  H HA   . SER A 1 2  ? 16.776  -8.601  -3.966  1.00 0.00 ? 66  SER A HA   4  
ATOM   2916  H HB2  . SER A 1 2  ? 16.259  -11.008 -3.706  1.00 0.00 ? 66  SER A HB2  4  
ATOM   2917  H HB3  . SER A 1 2  ? 14.671  -10.742 -4.418  1.00 0.00 ? 66  SER A HB3  4  
ATOM   2918  H HG   . SER A 1 2  ? 17.150  -10.955 -5.606  1.00 0.00 ? 66  SER A HG   4  
ATOM   2919  N N    . THR A 1 3  ? 13.669  -8.012  -4.798  1.00 0.00 ? 67  THR A N    4  
ATOM   2920  C CA   . THR A 1 3  ? 12.821  -7.203  -5.627  1.00 0.00 ? 67  THR A CA   4  
ATOM   2921  C C    . THR A 1 3  ? 12.957  -5.741  -5.212  1.00 0.00 ? 67  THR A C    4  
ATOM   2922  O O    . THR A 1 3  ? 12.483  -5.347  -4.140  1.00 0.00 ? 67  THR A O    4  
ATOM   2923  C CB   . THR A 1 3  ? 11.356  -7.668  -5.502  1.00 0.00 ? 67  THR A CB   4  
ATOM   2924  O OG1  . THR A 1 3  ? 11.009  -7.765  -4.108  1.00 0.00 ? 67  THR A OG1  4  
ATOM   2925  C CG2  . THR A 1 3  ? 11.159  -9.024  -6.161  1.00 0.00 ? 67  THR A CG2  4  
ATOM   2926  H H    . THR A 1 3  ? 13.248  -8.522  -4.073  1.00 0.00 ? 67  THR A H    4  
ATOM   2927  H HA   . THR A 1 3  ? 13.141  -7.315  -6.652  1.00 0.00 ? 67  THR A HA   4  
ATOM   2928  H HB   . THR A 1 3  ? 10.716  -6.939  -5.979  1.00 0.00 ? 67  THR A HB   4  
ATOM   2929  H HG1  . THR A 1 3  ? 11.233  -6.907  -3.721  1.00 0.00 ? 67  THR A HG1  4  
ATOM   2930  H HG21 . THR A 1 3  ? 11.786  -9.754  -5.671  1.00 0.00 ? 67  THR A HG21 4  
ATOM   2931  H HG22 . THR A 1 3  ? 10.124  -9.322  -6.070  1.00 0.00 ? 67  THR A HG22 4  
ATOM   2932  H HG23 . THR A 1 3  ? 11.425  -8.966  -7.206  1.00 0.00 ? 67  THR A HG23 4  
ATOM   2933  N N    . GLN A 1 4  ? 13.650  -4.971  -6.017  1.00 0.00 ? 68  GLN A N    4  
ATOM   2934  C CA   . GLN A 1 4  ? 13.884  -3.576  -5.727  1.00 0.00 ? 68  GLN A CA   4  
ATOM   2935  C C    . GLN A 1 4  ? 12.633  -2.767  -6.029  1.00 0.00 ? 68  GLN A C    4  
ATOM   2936  O O    . GLN A 1 4  ? 12.081  -2.861  -7.132  1.00 0.00 ? 68  GLN A O    4  
ATOM   2937  C CB   . GLN A 1 4  ? 15.081  -3.050  -6.518  1.00 0.00 ? 68  GLN A CB   4  
ATOM   2938  C CG   . GLN A 1 4  ? 16.383  -3.763  -6.193  1.00 0.00 ? 68  GLN A CG   4  
ATOM   2939  C CD   . GLN A 1 4  ? 17.551  -3.234  -6.991  1.00 0.00 ? 68  GLN A CD   4  
ATOM   2940  O OE1  . GLN A 1 4  ? 18.237  -2.303  -6.564  1.00 0.00 ? 68  GLN A OE1  4  
ATOM   2941  N NE2  . GLN A 1 4  ? 17.796  -3.813  -8.137  1.00 0.00 ? 68  GLN A NE2  4  
ATOM   2942  H H    . GLN A 1 4  ? 14.004  -5.351  -6.850  1.00 0.00 ? 68  GLN A H    4  
ATOM   2943  H HA   . GLN A 1 4  ? 14.100  -3.506  -4.671  1.00 0.00 ? 68  GLN A HA   4  
ATOM   2944  H HB2  . GLN A 1 4  ? 14.881  -3.171  -7.572  1.00 0.00 ? 68  GLN A HB2  4  
ATOM   2945  H HB3  . GLN A 1 4  ? 15.205  -1.999  -6.301  1.00 0.00 ? 68  GLN A HB3  4  
ATOM   2946  H HG2  . GLN A 1 4  ? 16.600  -3.635  -5.143  1.00 0.00 ? 68  GLN A HG2  4  
ATOM   2947  H HG3  . GLN A 1 4  ? 16.264  -4.816  -6.406  1.00 0.00 ? 68  GLN A HG3  4  
ATOM   2948  H HE21 . GLN A 1 4  ? 17.213  -4.558  -8.407  1.00 0.00 ? 68  GLN A HE21 4  
ATOM   2949  H HE22 . GLN A 1 4  ? 18.536  -3.497  -8.696  1.00 0.00 ? 68  GLN A HE22 4  
ATOM   2950  N N    . PRO A 1 5  ? 12.155  -1.987  -5.056  1.00 0.00 ? 69  PRO A N    4  
ATOM   2951  C CA   . PRO A 1 5  ? 10.933  -1.209  -5.199  1.00 0.00 ? 69  PRO A CA   4  
ATOM   2952  C C    . PRO A 1 5  ? 11.053  -0.078  -6.223  1.00 0.00 ? 69  PRO A C    4  
ATOM   2953  O O    . PRO A 1 5  ? 12.041  0.675   -6.245  1.00 0.00 ? 69  PRO A O    4  
ATOM   2954  C CB   . PRO A 1 5  ? 10.694  -0.642  -3.801  1.00 0.00 ? 69  PRO A CB   4  
ATOM   2955  C CG   . PRO A 1 5  ? 12.037  -0.620  -3.172  1.00 0.00 ? 69  PRO A CG   4  
ATOM   2956  C CD   . PRO A 1 5  ? 12.771  -1.802  -3.725  1.00 0.00 ? 69  PRO A CD   4  
ATOM   2957  H HA   . PRO A 1 5  ? 10.104  -1.847  -5.469  1.00 0.00 ? 69  PRO A HA   4  
ATOM   2958  H HB2  . PRO A 1 5  ? 10.272  0.349   -3.879  1.00 0.00 ? 69  PRO A HB2  4  
ATOM   2959  H HB3  . PRO A 1 5  ? 10.018  -1.286  -3.259  1.00 0.00 ? 69  PRO A HB3  4  
ATOM   2960  H HG2  . PRO A 1 5  ? 12.545  0.293   -3.445  1.00 0.00 ? 69  PRO A HG2  4  
ATOM   2961  H HG3  . PRO A 1 5  ? 11.945  -0.700  -2.099  1.00 0.00 ? 69  PRO A HG3  4  
ATOM   2962  H HD2  . PRO A 1 5  ? 13.824  -1.578  -3.811  1.00 0.00 ? 69  PRO A HD2  4  
ATOM   2963  H HD3  . PRO A 1 5  ? 12.615  -2.672  -3.104  1.00 0.00 ? 69  PRO A HD3  4  
ATOM   2964  N N    . THR A 1 6  ? 10.047  0.033   -7.049  1.00 0.00 ? 70  THR A N    4  
ATOM   2965  C CA   . THR A 1 6  ? 9.968   1.026   -8.075  1.00 0.00 ? 70  THR A CA   4  
ATOM   2966  C C    . THR A 1 6  ? 9.662   2.402   -7.461  1.00 0.00 ? 70  THR A C    4  
ATOM   2967  O O    . THR A 1 6  ? 10.129  3.440   -7.933  1.00 0.00 ? 70  THR A O    4  
ATOM   2968  C CB   . THR A 1 6  ? 8.815   0.641   -9.022  1.00 0.00 ? 70  THR A CB   4  
ATOM   2969  O OG1  . THR A 1 6  ? 8.929   -0.748  -9.381  1.00 0.00 ? 70  THR A OG1  4  
ATOM   2970  C CG2  . THR A 1 6  ? 8.844   1.478   -10.272 1.00 0.00 ? 70  THR A CG2  4  
ATOM   2971  H H    . THR A 1 6  ? 9.316   -0.620  -7.024  1.00 0.00 ? 70  THR A H    4  
ATOM   2972  H HA   . THR A 1 6  ? 10.885  1.038   -8.641  1.00 0.00 ? 70  THR A HA   4  
ATOM   2973  H HB   . THR A 1 6  ? 7.877   0.797   -8.507  1.00 0.00 ? 70  THR A HB   4  
ATOM   2974  H HG1  . THR A 1 6  ? 9.532   -0.807  -10.135 1.00 0.00 ? 70  THR A HG1  4  
ATOM   2975  H HG21 . THR A 1 6  ? 9.792   1.337   -10.767 1.00 0.00 ? 70  THR A HG21 4  
ATOM   2976  H HG22 . THR A 1 6  ? 8.036   1.172   -10.918 1.00 0.00 ? 70  THR A HG22 4  
ATOM   2977  H HG23 . THR A 1 6  ? 8.720   2.514   -9.998  1.00 0.00 ? 70  THR A HG23 4  
ATOM   2978  N N    . HIS A 1 7  ? 8.926   2.386   -6.385  1.00 0.00 ? 71  HIS A N    4  
ATOM   2979  C CA   . HIS A 1 7  ? 8.449   3.600   -5.771  1.00 0.00 ? 71  HIS A CA   4  
ATOM   2980  C C    . HIS A 1 7  ? 9.195   3.884   -4.488  1.00 0.00 ? 71  HIS A C    4  
ATOM   2981  O O    . HIS A 1 7  ? 9.717   2.964   -3.846  1.00 0.00 ? 71  HIS A O    4  
ATOM   2982  C CB   . HIS A 1 7  ? 6.965   3.473   -5.438  1.00 0.00 ? 71  HIS A CB   4  
ATOM   2983  C CG   . HIS A 1 7  ? 6.066   3.165   -6.591  1.00 0.00 ? 71  HIS A CG   4  
ATOM   2984  N ND1  . HIS A 1 7  ? 5.390   1.971   -6.744  1.00 0.00 ? 71  HIS A ND1  4  
ATOM   2985  C CD2  . HIS A 1 7  ? 5.721   3.927   -7.643  1.00 0.00 ? 71  HIS A CD2  4  
ATOM   2986  C CE1  . HIS A 1 7  ? 4.679   2.044   -7.871  1.00 0.00 ? 71  HIS A CE1  4  
ATOM   2987  N NE2  . HIS A 1 7  ? 4.843   3.217   -8.459  1.00 0.00 ? 71  HIS A NE2  4  
ATOM   2988  H H    . HIS A 1 7  ? 8.723   1.528   -5.963  1.00 0.00 ? 71  HIS A H    4  
ATOM   2989  H HA   . HIS A 1 7  ? 8.573   4.417   -6.463  1.00 0.00 ? 71  HIS A HA   4  
ATOM   2990  H HB2  . HIS A 1 7  ? 6.842   2.675   -4.721  1.00 0.00 ? 71  HIS A HB2  4  
ATOM   2991  H HB3  . HIS A 1 7  ? 6.628   4.394   -4.986  1.00 0.00 ? 71  HIS A HB3  4  
ATOM   2992  H HD1  . HIS A 1 7  ? 5.363   1.216   -6.114  1.00 0.00 ? 71  HIS A HD1  4  
ATOM   2993  H HD2  . HIS A 1 7  ? 6.060   4.937   -7.813  1.00 0.00 ? 71  HIS A HD2  4  
ATOM   2994  H HE1  . HIS A 1 7  ? 4.051   1.252   -8.250  1.00 0.00 ? 71  HIS A HE1  4  
ATOM   2995  N N    . SER A 1 8  ? 9.241   5.137   -4.126  1.00 0.00 ? 72  SER A N    4  
ATOM   2996  C CA   . SER A 1 8  ? 9.824   5.565   -2.885  1.00 0.00 ? 72  SER A CA   4  
ATOM   2997  C C    . SER A 1 8  ? 8.740   6.247   -2.053  1.00 0.00 ? 72  SER A C    4  
ATOM   2998  O O    . SER A 1 8  ? 8.213   7.299   -2.427  1.00 0.00 ? 72  SER A O    4  
ATOM   2999  C CB   . SER A 1 8  ? 11.019  6.479   -3.140  1.00 0.00 ? 72  SER A CB   4  
ATOM   3000  O OG   . SER A 1 8  ? 12.047  5.777   -3.837  1.00 0.00 ? 72  SER A OG   4  
ATOM   3001  H H    . SER A 1 8  ? 8.844   5.822   -4.706  1.00 0.00 ? 72  SER A H    4  
ATOM   3002  H HA   . SER A 1 8  ? 10.147  4.675   -2.366  1.00 0.00 ? 72  SER A HA   4  
ATOM   3003  H HB2  . SER A 1 8  ? 10.699  7.317   -3.741  1.00 0.00 ? 72  SER A HB2  4  
ATOM   3004  H HB3  . SER A 1 8  ? 11.416  6.839   -2.202  1.00 0.00 ? 72  SER A HB3  4  
ATOM   3005  H HG   . SER A 1 8  ? 11.645  5.117   -4.416  1.00 0.00 ? 72  SER A HG   4  
ATOM   3006  N N    . TRP A 1 9  ? 8.391   5.625   -0.961  1.00 0.00 ? 73  TRP A N    4  
ATOM   3007  C CA   . TRP A 1 9  ? 7.281   6.051   -0.138  1.00 0.00 ? 73  TRP A CA   4  
ATOM   3008  C C    . TRP A 1 9  ? 7.721   6.570   1.207   1.00 0.00 ? 73  TRP A C    4  
ATOM   3009  O O    . TRP A 1 9  ? 8.807   6.217   1.689   1.00 0.00 ? 73  TRP A O    4  
ATOM   3010  C CB   . TRP A 1 9  ? 6.290   4.909   0.039   1.00 0.00 ? 73  TRP A CB   4  
ATOM   3011  C CG   . TRP A 1 9  ? 5.589   4.555   -1.225  1.00 0.00 ? 73  TRP A CG   4  
ATOM   3012  C CD1  . TRP A 1 9  ? 5.828   3.492   -2.035  1.00 0.00 ? 73  TRP A CD1  4  
ATOM   3013  C CD2  . TRP A 1 9  ? 4.543   5.296   -1.833  1.00 0.00 ? 73  TRP A CD2  4  
ATOM   3014  N NE1  . TRP A 1 9  ? 4.983   3.532   -3.112  1.00 0.00 ? 73  TRP A NE1  4  
ATOM   3015  C CE2  . TRP A 1 9  ? 4.191   4.631   -3.009  1.00 0.00 ? 73  TRP A CE2  4  
ATOM   3016  C CE3  . TRP A 1 9  ? 3.868   6.466   -1.490  1.00 0.00 ? 73  TRP A CE3  4  
ATOM   3017  C CZ2  . TRP A 1 9  ? 3.203   5.092   -3.846  1.00 0.00 ? 73  TRP A CZ2  4  
ATOM   3018  C CZ3  . TRP A 1 9  ? 2.885   6.923   -2.323  1.00 0.00 ? 73  TRP A CZ3  4  
ATOM   3019  C CH2  . TRP A 1 9  ? 2.565   6.235   -3.486  1.00 0.00 ? 73  TRP A CH2  4  
ATOM   3020  H H    . TRP A 1 9  ? 8.914   4.848   -0.664  1.00 0.00 ? 73  TRP A H    4  
ATOM   3021  H HA   . TRP A 1 9  ? 6.775   6.845   -0.667  1.00 0.00 ? 73  TRP A HA   4  
ATOM   3022  H HB2  . TRP A 1 9  ? 6.807   4.032   0.396   1.00 0.00 ? 73  TRP A HB2  4  
ATOM   3023  H HB3  . TRP A 1 9  ? 5.546   5.205   0.760   1.00 0.00 ? 73  TRP A HB3  4  
ATOM   3024  H HD1  . TRP A 1 9  ? 6.573   2.735   -1.844  1.00 0.00 ? 73  TRP A HD1  4  
ATOM   3025  H HE1  . TRP A 1 9  ? 4.943   2.884   -3.851  1.00 0.00 ? 73  TRP A HE1  4  
ATOM   3026  H HE3  . TRP A 1 9  ? 4.109   7.003   -0.585  1.00 0.00 ? 73  TRP A HE3  4  
ATOM   3027  H HZ2  . TRP A 1 9  ? 2.935   4.575   -4.755  1.00 0.00 ? 73  TRP A HZ2  4  
ATOM   3028  H HZ3  . TRP A 1 9  ? 2.349   7.829   -2.079  1.00 0.00 ? 73  TRP A HZ3  4  
ATOM   3029  H HH2  . TRP A 1 9  ? 1.784   6.620   -4.119  1.00 0.00 ? 73  TRP A HH2  4  
ATOM   3030  N N    . LYS A 1 10 ? 6.927   7.457   1.778   1.00 0.00 ? 74  LYS A N    4  
ATOM   3031  C CA   . LYS A 1 10 ? 7.169   7.953   3.118   1.00 0.00 ? 74  LYS A CA   4  
ATOM   3032  C C    . LYS A 1 10 ? 5.930   7.743   3.985   1.00 0.00 ? 74  LYS A C    4  
ATOM   3033  O O    . LYS A 1 10 ? 4.810   7.626   3.479   1.00 0.00 ? 74  LYS A O    4  
ATOM   3034  C CB   . LYS A 1 10 ? 7.538   9.439   3.139   1.00 0.00 ? 74  LYS A CB   4  
ATOM   3035  C CG   . LYS A 1 10 ? 6.449   10.362  2.599   1.00 0.00 ? 74  LYS A CG   4  
ATOM   3036  C CD   . LYS A 1 10 ? 6.688   11.818  2.984   1.00 0.00 ? 74  LYS A CD   4  
ATOM   3037  C CE   . LYS A 1 10 ? 6.522   12.045  4.494   1.00 0.00 ? 74  LYS A CE   4  
ATOM   3038  N NZ   . LYS A 1 10 ? 6.661   13.473  4.865   1.00 0.00 ? 74  LYS A NZ   4  
ATOM   3039  H H    . LYS A 1 10 ? 6.139   7.787   1.295   1.00 0.00 ? 74  LYS A H    4  
ATOM   3040  H HA   . LYS A 1 10 ? 7.980   7.376   3.540   1.00 0.00 ? 74  LYS A HA   4  
ATOM   3041  H HB2  . LYS A 1 10 ? 7.753   9.721   4.159   1.00 0.00 ? 74  LYS A HB2  4  
ATOM   3042  H HB3  . LYS A 1 10 ? 8.428   9.578   2.544   1.00 0.00 ? 74  LYS A HB3  4  
ATOM   3043  H HG2  . LYS A 1 10 ? 6.431   10.290  1.522   1.00 0.00 ? 74  LYS A HG2  4  
ATOM   3044  H HG3  . LYS A 1 10 ? 5.497   10.043  2.999   1.00 0.00 ? 74  LYS A HG3  4  
ATOM   3045  H HD2  . LYS A 1 10 ? 7.700   12.069  2.706   1.00 0.00 ? 74  LYS A HD2  4  
ATOM   3046  H HD3  . LYS A 1 10 ? 5.991   12.445  2.448   1.00 0.00 ? 74  LYS A HD3  4  
ATOM   3047  H HE2  . LYS A 1 10 ? 5.541   11.702  4.790   1.00 0.00 ? 74  LYS A HE2  4  
ATOM   3048  H HE3  . LYS A 1 10 ? 7.258   11.464  5.031   1.00 0.00 ? 74  LYS A HE3  4  
ATOM   3049  H HZ1  . LYS A 1 10 ? 5.956   14.050  4.362   1.00 0.00 ? 74  LYS A HZ1  4  
ATOM   3050  H HZ2  . LYS A 1 10 ? 6.492   13.603  5.885   1.00 0.00 ? 74  LYS A HZ2  4  
ATOM   3051  H HZ3  . LYS A 1 10 ? 7.603   13.849  4.649   1.00 0.00 ? 74  LYS A HZ3  4  
ATOM   3052  N N    . VAL A 1 11 ? 6.150   7.667   5.273   1.00 0.00 ? 75  VAL A N    4  
ATOM   3053  C CA   . VAL A 1 11 ? 5.095   7.554   6.257   1.00 0.00 ? 75  VAL A CA   4  
ATOM   3054  C C    . VAL A 1 11 ? 4.225   8.819   6.239   1.00 0.00 ? 75  VAL A C    4  
ATOM   3055  O O    . VAL A 1 11 ? 4.751   9.931   6.152   1.00 0.00 ? 75  VAL A O    4  
ATOM   3056  C CB   . VAL A 1 11 ? 5.698   7.363   7.681   1.00 0.00 ? 75  VAL A CB   4  
ATOM   3057  C CG1  . VAL A 1 11 ? 4.614   7.362   8.747   1.00 0.00 ? 75  VAL A CG1  4  
ATOM   3058  C CG2  . VAL A 1 11 ? 6.507   6.071   7.759   1.00 0.00 ? 75  VAL A CG2  4  
ATOM   3059  H H    . VAL A 1 11 ? 7.079   7.710   5.587   1.00 0.00 ? 75  VAL A H    4  
ATOM   3060  H HA   . VAL A 1 11 ? 4.488   6.694   6.017   1.00 0.00 ? 75  VAL A HA   4  
ATOM   3061  H HB   . VAL A 1 11 ? 6.366   8.193   7.857   1.00 0.00 ? 75  VAL A HB   4  
ATOM   3062  H HG11 . VAL A 1 11 ? 3.925   6.552   8.559   1.00 0.00 ? 75  VAL A HG11 4  
ATOM   3063  H HG12 . VAL A 1 11 ? 5.063   7.230   9.719   1.00 0.00 ? 75  VAL A HG12 4  
ATOM   3064  H HG13 . VAL A 1 11 ? 4.082   8.302   8.720   1.00 0.00 ? 75  VAL A HG13 4  
ATOM   3065  H HG21 . VAL A 1 11 ? 7.319   6.103   7.048   1.00 0.00 ? 75  VAL A HG21 4  
ATOM   3066  H HG22 . VAL A 1 11 ? 6.907   5.951   8.756   1.00 0.00 ? 75  VAL A HG22 4  
ATOM   3067  H HG23 . VAL A 1 11 ? 5.869   5.230   7.529   1.00 0.00 ? 75  VAL A HG23 4  
ATOM   3068  N N    . GLY A 1 12 ? 2.924   8.647   6.317   1.00 0.00 ? 76  GLY A N    4  
ATOM   3069  C CA   . GLY A 1 12 ? 2.021   9.776   6.380   1.00 0.00 ? 76  GLY A CA   4  
ATOM   3070  C C    . GLY A 1 12 ? 1.566   10.240  5.023   1.00 0.00 ? 76  GLY A C    4  
ATOM   3071  O O    . GLY A 1 12 ? 1.034   11.339  4.881   1.00 0.00 ? 76  GLY A O    4  
ATOM   3072  H H    . GLY A 1 12 ? 2.553   7.736   6.354   1.00 0.00 ? 76  GLY A H    4  
ATOM   3073  H HA2  . GLY A 1 12 ? 1.153   9.500   6.960   1.00 0.00 ? 76  GLY A HA2  4  
ATOM   3074  H HA3  . GLY A 1 12 ? 2.527   10.591  6.875   1.00 0.00 ? 76  GLY A HA3  4  
ATOM   3075  N N    . ASP A 1 13 ? 1.772   9.427   4.021   1.00 0.00 ? 77  ASP A N    4  
ATOM   3076  C CA   . ASP A 1 13 ? 1.363   9.803   2.682   1.00 0.00 ? 77  ASP A CA   4  
ATOM   3077  C C    . ASP A 1 13 ? 0.188   8.990   2.283   1.00 0.00 ? 77  ASP A C    4  
ATOM   3078  O O    . ASP A 1 13 ? -0.078  7.928   2.875   1.00 0.00 ? 77  ASP A O    4  
ATOM   3079  C CB   . ASP A 1 13 ? 2.446   9.522   1.680   1.00 0.00 ? 77  ASP A CB   4  
ATOM   3080  C CG   . ASP A 1 13 ? 2.488   10.558  0.559   1.00 0.00 ? 77  ASP A CG   4  
ATOM   3081  O OD1  . ASP A 1 13 ? 1.432   11.128  0.209   1.00 0.00 ? 77  ASP A OD1  4  
ATOM   3082  O OD2  . ASP A 1 13 ? 3.580   10.818  0.001   1.00 0.00 ? 77  ASP A OD2  4  
ATOM   3083  H H    . ASP A 1 13 ? 2.205   8.562   4.170   1.00 0.00 ? 77  ASP A H    4  
ATOM   3084  H HA   . ASP A 1 13 ? 1.124   10.855  2.659   1.00 0.00 ? 77  ASP A HA   4  
ATOM   3085  H HB2  . ASP A 1 13 ? 3.369   9.410   2.213   1.00 0.00 ? 77  ASP A HB2  4  
ATOM   3086  H HB3  . ASP A 1 13 ? 2.220   8.559   1.242   1.00 0.00 ? 77  ASP A HB3  4  
ATOM   3087  N N    . LYS A 1 14 ? -0.479  9.427   1.272   1.00 0.00 ? 78  LYS A N    4  
ATOM   3088  C CA   . LYS A 1 14 ? -1.578  8.711   0.763   1.00 0.00 ? 78  LYS A CA   4  
ATOM   3089  C C    . LYS A 1 14 ? -1.114  7.952   -0.428  1.00 0.00 ? 78  LYS A C    4  
ATOM   3090  O O    . LYS A 1 14 ? -0.454  8.495   -1.314  1.00 0.00 ? 78  LYS A O    4  
ATOM   3091  C CB   . LYS A 1 14 ? -2.743  9.616   0.364   1.00 0.00 ? 78  LYS A CB   4  
ATOM   3092  C CG   . LYS A 1 14 ? -3.347  10.428  1.486   1.00 0.00 ? 78  LYS A CG   4  
ATOM   3093  C CD   . LYS A 1 14 ? -3.982  9.563   2.562   1.00 0.00 ? 78  LYS A CD   4  
ATOM   3094  C CE   . LYS A 1 14 ? -4.701  10.426  3.593   1.00 0.00 ? 78  LYS A CE   4  
ATOM   3095  N NZ   . LYS A 1 14 ? -3.807  11.431  4.199   1.00 0.00 ? 78  LYS A NZ   4  
ATOM   3096  H H    . LYS A 1 14 ? -0.150  10.232  0.815   1.00 0.00 ? 78  LYS A H    4  
ATOM   3097  H HA   . LYS A 1 14 ? -1.890  8.032   1.540   1.00 0.00 ? 78  LYS A HA   4  
ATOM   3098  H HB2  . LYS A 1 14 ? -2.398  10.303  -0.393  1.00 0.00 ? 78  LYS A HB2  4  
ATOM   3099  H HB3  . LYS A 1 14 ? -3.520  9.000   -0.063  1.00 0.00 ? 78  LYS A HB3  4  
ATOM   3100  H HG2  . LYS A 1 14 ? -2.535  10.972  1.942   1.00 0.00 ? 78  LYS A HG2  4  
ATOM   3101  H HG3  . LYS A 1 14 ? -4.081  11.112  1.086   1.00 0.00 ? 78  LYS A HG3  4  
ATOM   3102  H HD2  . LYS A 1 14 ? -4.692  8.890   2.105   1.00 0.00 ? 78  LYS A HD2  4  
ATOM   3103  H HD3  . LYS A 1 14 ? -3.207  8.995   3.057   1.00 0.00 ? 78  LYS A HD3  4  
ATOM   3104  H HE2  . LYS A 1 14 ? -5.526  10.935  3.118   1.00 0.00 ? 78  LYS A HE2  4  
ATOM   3105  H HE3  . LYS A 1 14 ? -5.085  9.783   4.372   1.00 0.00 ? 78  LYS A HE3  4  
ATOM   3106  H HZ1  . LYS A 1 14 ? -3.336  12.016  3.478   1.00 0.00 ? 78  LYS A HZ1  4  
ATOM   3107  H HZ2  . LYS A 1 14 ? -4.352  12.066  4.813   1.00 0.00 ? 78  LYS A HZ2  4  
ATOM   3108  H HZ3  . LYS A 1 14 ? -3.083  10.978  4.805   1.00 0.00 ? 78  LYS A HZ3  4  
ATOM   3109  N N    . CYS A 1 15 ? -1.432  6.744   -0.441  1.00 0.00 ? 79  CYS A N    4  
ATOM   3110  C CA   . CYS A 1 15 ? -1.106  5.889   -1.523  1.00 0.00 ? 79  CYS A CA   4  
ATOM   3111  C C    . CYS A 1 15 ? -2.293  5.044   -1.850  1.00 0.00 ? 79  CYS A C    4  
ATOM   3112  O O    . CYS A 1 15 ? -3.307  5.079   -1.152  1.00 0.00 ? 79  CYS A O    4  
ATOM   3113  C CB   . CYS A 1 15 ? 0.076   5.001   -1.142  1.00 0.00 ? 79  CYS A CB   4  
ATOM   3114  S SG   . CYS A 1 15 ? -0.178  4.039   0.378   1.00 0.00 ? 79  CYS A SG   4  
ATOM   3115  H H    . CYS A 1 15 ? -1.908  6.391   0.343   1.00 0.00 ? 79  CYS A H    4  
ATOM   3116  H HA   . CYS A 1 15 ? -0.836  6.481   -2.385  1.00 0.00 ? 79  CYS A HA   4  
ATOM   3117  H HB2  . CYS A 1 15 ? 0.248   4.308   -1.953  1.00 0.00 ? 79  CYS A HB2  4  
ATOM   3118  H HB3  . CYS A 1 15 ? 0.959   5.608   -1.016  1.00 0.00 ? 79  CYS A HB3  4  
ATOM   3119  H HG   . CYS A 1 15 ? -1.300  4.437   0.965   1.00 0.00 ? 79  CYS A HG   4  
ATOM   3120  N N    . MET A 1 16 ? -2.193  4.328   -2.903  1.00 0.00 ? 80  MET A N    4  
ATOM   3121  C CA   . MET A 1 16 ? -3.188  3.381   -3.257  1.00 0.00 ? 80  MET A CA   4  
ATOM   3122  C C    . MET A 1 16 ? -2.593  2.058   -2.983  1.00 0.00 ? 80  MET A C    4  
ATOM   3123  O O    . MET A 1 16 ? -1.494  1.775   -3.432  1.00 0.00 ? 80  MET A O    4  
ATOM   3124  C CB   . MET A 1 16 ? -3.534  3.470   -4.729  1.00 0.00 ? 80  MET A CB   4  
ATOM   3125  C CG   . MET A 1 16 ? -3.943  4.851   -5.168  1.00 0.00 ? 80  MET A CG   4  
ATOM   3126  S SD   . MET A 1 16 ? -5.486  5.401   -4.428  1.00 0.00 ? 80  MET A SD   4  
ATOM   3127  C CE   . MET A 1 16 ? -6.640  4.251   -5.158  1.00 0.00 ? 80  MET A CE   4  
ATOM   3128  H H    . MET A 1 16 ? -1.390  4.445   -3.460  1.00 0.00 ? 80  MET A H    4  
ATOM   3129  H HA   . MET A 1 16 ? -4.072  3.534   -2.654  1.00 0.00 ? 80  MET A HA   4  
ATOM   3130  H HB2  . MET A 1 16 ? -2.666  3.152   -5.279  1.00 0.00 ? 80  MET A HB2  4  
ATOM   3131  H HB3  . MET A 1 16 ? -4.341  2.784   -4.939  1.00 0.00 ? 80  MET A HB3  4  
ATOM   3132  H HG2  . MET A 1 16 ? -3.163  5.497   -4.800  1.00 0.00 ? 80  MET A HG2  4  
ATOM   3133  H HG3  . MET A 1 16 ? -4.010  4.900   -6.245  1.00 0.00 ? 80  MET A HG3  4  
ATOM   3134  H HE1  . MET A 1 16 ? -6.384  3.243   -4.869  1.00 0.00 ? 80  MET A HE1  4  
ATOM   3135  H HE2  . MET A 1 16 ? -7.632  4.487   -4.805  1.00 0.00 ? 80  MET A HE2  4  
ATOM   3136  H HE3  . MET A 1 16 ? -6.603  4.344   -6.234  1.00 0.00 ? 80  MET A HE3  4  
ATOM   3137  N N    . ALA A 1 17 ? -3.280  1.272   -2.278  1.00 0.00 ? 81  ALA A N    4  
ATOM   3138  C CA   . ALA A 1 17 ? -2.799  -0.019  -1.902  1.00 0.00 ? 81  ALA A CA   4  
ATOM   3139  C C    . ALA A 1 17 ? -3.700  -1.063  -2.450  1.00 0.00 ? 81  ALA A C    4  
ATOM   3140  O O    . ALA A 1 17 ? -4.887  -0.821  -2.631  1.00 0.00 ? 81  ALA A O    4  
ATOM   3141  C CB   . ALA A 1 17 ? -2.729  -0.133  -0.399  1.00 0.00 ? 81  ALA A CB   4  
ATOM   3142  H H    . ALA A 1 17 ? -4.173  1.587   -2.007  1.00 0.00 ? 81  ALA A H    4  
ATOM   3143  H HA   . ALA A 1 17 ? -1.805  -0.152  -2.301  1.00 0.00 ? 81  ALA A HA   4  
ATOM   3144  H HB1  . ALA A 1 17 ? -3.712  0.027   0.018   1.00 0.00 ? 81  ALA A HB1  4  
ATOM   3145  H HB2  . ALA A 1 17 ? -2.385  -1.119  -0.125  1.00 0.00 ? 81  ALA A HB2  4  
ATOM   3146  H HB3  . ALA A 1 17 ? -2.051  0.613   -0.012  1.00 0.00 ? 81  ALA A HB3  4  
ATOM   3147  N N    . VAL A 1 18 ? -3.158  -2.201  -2.727  1.00 0.00 ? 82  VAL A N    4  
ATOM   3148  C CA   . VAL A 1 18 ? -3.934  -3.292  -3.228  1.00 0.00 ? 82  VAL A CA   4  
ATOM   3149  C C    . VAL A 1 18 ? -4.475  -4.040  -2.048  1.00 0.00 ? 82  VAL A C    4  
ATOM   3150  O O    . VAL A 1 18 ? -3.713  -4.582  -1.270  1.00 0.00 ? 82  VAL A O    4  
ATOM   3151  C CB   . VAL A 1 18 ? -3.083  -4.242  -4.111  1.00 0.00 ? 82  VAL A CB   4  
ATOM   3152  C CG1  . VAL A 1 18 ? -3.914  -5.414  -4.620  1.00 0.00 ? 82  VAL A CG1  4  
ATOM   3153  C CG2  . VAL A 1 18 ? -2.476  -3.480  -5.275  1.00 0.00 ? 82  VAL A CG2  4  
ATOM   3154  H H    . VAL A 1 18 ? -2.200  -2.331  -2.565  1.00 0.00 ? 82  VAL A H    4  
ATOM   3155  H HA   . VAL A 1 18 ? -4.763  -2.906  -3.804  1.00 0.00 ? 82  VAL A HA   4  
ATOM   3156  H HB   . VAL A 1 18 ? -2.278  -4.633  -3.505  1.00 0.00 ? 82  VAL A HB   4  
ATOM   3157  H HG11 . VAL A 1 18 ? -4.740  -5.041  -5.208  1.00 0.00 ? 82  VAL A HG11 4  
ATOM   3158  H HG12 . VAL A 1 18 ? -3.294  -6.054  -5.229  1.00 0.00 ? 82  VAL A HG12 4  
ATOM   3159  H HG13 . VAL A 1 18 ? -4.296  -5.976  -3.781  1.00 0.00 ? 82  VAL A HG13 4  
ATOM   3160  H HG21 . VAL A 1 18 ? -1.856  -2.680  -4.899  1.00 0.00 ? 82  VAL A HG21 4  
ATOM   3161  H HG22 . VAL A 1 18 ? -1.875  -4.151  -5.868  1.00 0.00 ? 82  VAL A HG22 4  
ATOM   3162  H HG23 . VAL A 1 18 ? -3.266  -3.066  -5.883  1.00 0.00 ? 82  VAL A HG23 4  
ATOM   3163  N N    . TRP A 1 19 ? -5.772  -4.014  -1.892  1.00 0.00 ? 83  TRP A N    4  
ATOM   3164  C CA   . TRP A 1 19 ? -6.416  -4.671  -0.802  1.00 0.00 ? 83  TRP A CA   4  
ATOM   3165  C C    . TRP A 1 19 ? -6.281  -6.152  -0.998  1.00 0.00 ? 83  TRP A C    4  
ATOM   3166  O O    . TRP A 1 19 ? -6.798  -6.701  -1.972  1.00 0.00 ? 83  TRP A O    4  
ATOM   3167  C CB   . TRP A 1 19 ? -7.891  -4.270  -0.730  1.00 0.00 ? 83  TRP A CB   4  
ATOM   3168  C CG   . TRP A 1 19 ? -8.562  -4.656  0.562   1.00 0.00 ? 83  TRP A CG   4  
ATOM   3169  C CD1  . TRP A 1 19 ? -7.970  -4.752  1.777   1.00 0.00 ? 83  TRP A CD1  4  
ATOM   3170  C CD2  . TRP A 1 19 ? -9.947  -4.936  0.780   1.00 0.00 ? 83  TRP A CD2  4  
ATOM   3171  N NE1  . TRP A 1 19 ? -8.872  -5.099  2.725   1.00 0.00 ? 83  TRP A NE1  4  
ATOM   3172  C CE2  . TRP A 1 19 ? -10.098 -5.212  2.151   1.00 0.00 ? 83  TRP A CE2  4  
ATOM   3173  C CE3  . TRP A 1 19 ? -11.070 -4.987  -0.036  1.00 0.00 ? 83  TRP A CE3  4  
ATOM   3174  C CZ2  . TRP A 1 19 ? -11.323 -5.534  2.716   1.00 0.00 ? 83  TRP A CZ2  4  
ATOM   3175  C CZ3  . TRP A 1 19 ? -12.289 -5.306  0.531   1.00 0.00 ? 83  TRP A CZ3  4  
ATOM   3176  C CH2  . TRP A 1 19 ? -12.398 -5.574  1.898   1.00 0.00 ? 83  TRP A CH2  4  
ATOM   3177  H H    . TRP A 1 19 ? -6.312  -3.532  -2.558  1.00 0.00 ? 83  TRP A H    4  
ATOM   3178  H HA   . TRP A 1 19 ? -5.922  -4.383  0.113   1.00 0.00 ? 83  TRP A HA   4  
ATOM   3179  H HB2  . TRP A 1 19 ? -7.957  -3.201  -0.850  1.00 0.00 ? 83  TRP A HB2  4  
ATOM   3180  H HB3  . TRP A 1 19 ? -8.420  -4.746  -1.541  1.00 0.00 ? 83  TRP A HB3  4  
ATOM   3181  H HD1  . TRP A 1 19 ? -6.919  -4.593  1.942   1.00 0.00 ? 83  TRP A HD1  4  
ATOM   3182  H HE1  . TRP A 1 19 ? -8.663  -5.230  3.677   1.00 0.00 ? 83  TRP A HE1  4  
ATOM   3183  H HE3  . TRP A 1 19 ? -10.998 -4.779  -1.093  1.00 0.00 ? 83  TRP A HE3  4  
ATOM   3184  H HZ2  . TRP A 1 19 ? -11.443 -5.743  3.768   1.00 0.00 ? 83  TRP A HZ2  4  
ATOM   3185  H HZ3  . TRP A 1 19 ? -13.185 -5.348  -0.072  1.00 0.00 ? 83  TRP A HZ3  4  
ATOM   3186  H HH2  . TRP A 1 19 ? -13.363 -5.815  2.309   1.00 0.00 ? 83  TRP A HH2  4  
ATOM   3187  N N    . SER A 1 20 ? -5.605  -6.778  -0.079  1.00 0.00 ? 84  SER A N    4  
ATOM   3188  C CA   . SER A 1 20 ? -5.302  -8.199  -0.104  1.00 0.00 ? 84  SER A CA   4  
ATOM   3189  C C    . SER A 1 20 ? -6.596  -9.053  -0.123  1.00 0.00 ? 84  SER A C    4  
ATOM   3190  O O    . SER A 1 20 ? -6.572  -10.231 -0.463  1.00 0.00 ? 84  SER A O    4  
ATOM   3191  C CB   . SER A 1 20 ? -4.413  -8.526  1.120   1.00 0.00 ? 84  SER A CB   4  
ATOM   3192  O OG   . SER A 1 20 ? -3.902  -9.852  1.103   1.00 0.00 ? 84  SER A OG   4  
ATOM   3193  H H    . SER A 1 20 ? -5.254  -6.233  0.665   1.00 0.00 ? 84  SER A H    4  
ATOM   3194  H HA   . SER A 1 20 ? -4.737  -8.402  -1.002  1.00 0.00 ? 84  SER A HA   4  
ATOM   3195  H HB2  . SER A 1 20 ? -3.575  -7.846  1.144   1.00 0.00 ? 84  SER A HB2  4  
ATOM   3196  H HB3  . SER A 1 20 ? -4.998  -8.393  2.018   1.00 0.00 ? 84  SER A HB3  4  
ATOM   3197  H HG   . SER A 1 20 ? -3.965  -10.171 2.014   1.00 0.00 ? 84  SER A HG   4  
ATOM   3198  N N    . GLU A 1 21 ? -7.713  -8.443  0.239   1.00 0.00 ? 85  GLU A N    4  
ATOM   3199  C CA   . GLU A 1 21 ? -8.989  -9.125  0.243   1.00 0.00 ? 85  GLU A CA   4  
ATOM   3200  C C    . GLU A 1 21 ? -9.666  -9.101  -1.131  1.00 0.00 ? 85  GLU A C    4  
ATOM   3201  O O    . GLU A 1 21 ? -10.223 -10.100 -1.573  1.00 0.00 ? 85  GLU A O    4  
ATOM   3202  C CB   . GLU A 1 21 ? -9.911  -8.481  1.245   1.00 0.00 ? 85  GLU A CB   4  
ATOM   3203  C CG   . GLU A 1 21 ? -9.386  -8.452  2.662   1.00 0.00 ? 85  GLU A CG   4  
ATOM   3204  C CD   . GLU A 1 21 ? -9.209  -9.813  3.252   1.00 0.00 ? 85  GLU A CD   4  
ATOM   3205  O OE1  . GLU A 1 21 ? -10.190 -10.387 3.753   1.00 0.00 ? 85  GLU A OE1  4  
ATOM   3206  O OE2  . GLU A 1 21 ? -8.080  -10.347 3.224   1.00 0.00 ? 85  GLU A OE2  4  
ATOM   3207  H H    . GLU A 1 21 ? -7.653  -7.504  0.513   1.00 0.00 ? 85  GLU A H    4  
ATOM   3208  H HA   . GLU A 1 21 ? -8.827  -10.148 0.545   1.00 0.00 ? 85  GLU A HA   4  
ATOM   3209  H HB2  . GLU A 1 21 ? -10.089 -7.462  0.935   1.00 0.00 ? 85  GLU A HB2  4  
ATOM   3210  H HB3  . GLU A 1 21 ? -10.849 -9.013  1.235   1.00 0.00 ? 85  GLU A HB3  4  
ATOM   3211  H HG2  . GLU A 1 21 ? -8.442  -7.930  2.639   1.00 0.00 ? 85  GLU A HG2  4  
ATOM   3212  H HG3  . GLU A 1 21 ? -10.053 -7.861  3.268   1.00 0.00 ? 85  GLU A HG3  4  
ATOM   3213  N N    . ASP A 1 22 ? -9.618  -7.959  -1.803  1.00 0.00 ? 86  ASP A N    4  
ATOM   3214  C CA   . ASP A 1 22 ? -10.385 -7.794  -3.049  1.00 0.00 ? 86  ASP A CA   4  
ATOM   3215  C C    . ASP A 1 22 ? -9.493  -7.816  -4.281  1.00 0.00 ? 86  ASP A C    4  
ATOM   3216  O O    . ASP A 1 22 ? -9.951  -8.048  -5.389  1.00 0.00 ? 86  ASP A O    4  
ATOM   3217  C CB   . ASP A 1 22 ? -11.174 -6.482  -2.969  1.00 0.00 ? 86  ASP A CB   4  
ATOM   3218  C CG   . ASP A 1 22 ? -12.130 -6.230  -4.106  1.00 0.00 ? 86  ASP A CG   4  
ATOM   3219  O OD1  . ASP A 1 22 ? -12.868 -7.150  -4.504  1.00 0.00 ? 86  ASP A OD1  4  
ATOM   3220  O OD2  . ASP A 1 22 ? -12.227 -5.075  -4.555  1.00 0.00 ? 86  ASP A OD2  4  
ATOM   3221  H H    . ASP A 1 22 ? -9.077  -7.214  -1.465  1.00 0.00 ? 86  ASP A H    4  
ATOM   3222  H HA   . ASP A 1 22 ? -11.091 -8.608  -3.114  1.00 0.00 ? 86  ASP A HA   4  
ATOM   3223  H HB2  . ASP A 1 22 ? -11.751 -6.475  -2.057  1.00 0.00 ? 86  ASP A HB2  4  
ATOM   3224  H HB3  . ASP A 1 22 ? -10.465 -5.667  -2.946  1.00 0.00 ? 86  ASP A HB3  4  
ATOM   3225  N N    . GLY A 1 23 ? -8.215  -7.586  -4.075  1.00 0.00 ? 87  GLY A N    4  
ATOM   3226  C CA   . GLY A 1 23 ? -7.262  -7.588  -5.169  1.00 0.00 ? 87  GLY A CA   4  
ATOM   3227  C C    . GLY A 1 23 ? -7.282  -6.299  -5.970  1.00 0.00 ? 87  GLY A C    4  
ATOM   3228  O O    . GLY A 1 23 ? -6.720  -6.229  -7.066  1.00 0.00 ? 87  GLY A O    4  
ATOM   3229  H H    . GLY A 1 23 ? -7.885  -7.428  -3.162  1.00 0.00 ? 87  GLY A H    4  
ATOM   3230  H HA2  . GLY A 1 23 ? -6.269  -7.734  -4.770  1.00 0.00 ? 87  GLY A HA2  4  
ATOM   3231  H HA3  . GLY A 1 23 ? -7.501  -8.410  -5.827  1.00 0.00 ? 87  GLY A HA3  4  
ATOM   3232  N N    . GLN A 1 24 ? -7.935  -5.288  -5.442  1.00 0.00 ? 88  GLN A N    4  
ATOM   3233  C CA   . GLN A 1 24 ? -8.036  -4.002  -6.113  1.00 0.00 ? 88  GLN A CA   4  
ATOM   3234  C C    . GLN A 1 24 ? -7.316  -2.940  -5.329  1.00 0.00 ? 88  GLN A C    4  
ATOM   3235  O O    . GLN A 1 24 ? -6.995  -3.150  -4.163  1.00 0.00 ? 88  GLN A O    4  
ATOM   3236  C CB   . GLN A 1 24 ? -9.487  -3.611  -6.363  1.00 0.00 ? 88  GLN A CB   4  
ATOM   3237  C CG   . GLN A 1 24 ? -10.190 -4.452  -7.406  1.00 0.00 ? 88  GLN A CG   4  
ATOM   3238  C CD   . GLN A 1 24 ? -9.547  -4.366  -8.787  1.00 0.00 ? 88  GLN A CD   4  
ATOM   3239  O OE1  . GLN A 1 24 ? -9.888  -3.503  -9.600  1.00 0.00 ? 88  GLN A OE1  4  
ATOM   3240  N NE2  . GLN A 1 24 ? -8.635  -5.254  -9.069  1.00 0.00 ? 88  GLN A NE2  4  
ATOM   3241  H H    . GLN A 1 24 ? -8.324  -5.399  -4.548  1.00 0.00 ? 88  GLN A H    4  
ATOM   3242  H HA   . GLN A 1 24 ? -7.535  -4.108  -7.064  1.00 0.00 ? 88  GLN A HA   4  
ATOM   3243  H HB2  . GLN A 1 24 ? -10.035 -3.724  -5.438  1.00 0.00 ? 88  GLN A HB2  4  
ATOM   3244  H HB3  . GLN A 1 24 ? -9.532  -2.577  -6.667  1.00 0.00 ? 88  GLN A HB3  4  
ATOM   3245  H HG2  . GLN A 1 24 ? -10.163 -5.479  -7.075  1.00 0.00 ? 88  GLN A HG2  4  
ATOM   3246  H HG3  . GLN A 1 24 ? -11.210 -4.106  -7.465  1.00 0.00 ? 88  GLN A HG3  4  
ATOM   3247  H HE21 . GLN A 1 24 ? -8.401  -5.926  -8.393  1.00 0.00 ? 88  GLN A HE21 4  
ATOM   3248  H HE22 . GLN A 1 24 ? -8.215  -5.229  -9.953  1.00 0.00 ? 88  GLN A HE22 4  
ATOM   3249  N N    . CYS A 1 25 ? -7.103  -1.805  -5.933  1.00 0.00 ? 89  CYS A N    4  
ATOM   3250  C CA   . CYS A 1 25 ? -6.343  -0.753  -5.290  1.00 0.00 ? 89  CYS A CA   4  
ATOM   3251  C C    . CYS A 1 25 ? -7.267  0.326   -4.691  1.00 0.00 ? 89  CYS A C    4  
ATOM   3252  O O    . CYS A 1 25 ? -8.228  0.769   -5.332  1.00 0.00 ? 89  CYS A O    4  
ATOM   3253  C CB   . CYS A 1 25 ? -5.313  -0.184  -6.275  1.00 0.00 ? 89  CYS A CB   4  
ATOM   3254  S SG   . CYS A 1 25 ? -6.022  0.465   -7.795  1.00 0.00 ? 89  CYS A SG   4  
ATOM   3255  H H    . CYS A 1 25 ? -7.494  -1.654  -6.822  1.00 0.00 ? 89  CYS A H    4  
ATOM   3256  H HA   . CYS A 1 25 ? -5.817  -1.212  -4.466  1.00 0.00 ? 89  CYS A HA   4  
ATOM   3257  H HB2  . CYS A 1 25 ? -4.698  0.581   -5.828  1.00 0.00 ? 89  CYS A HB2  4  
ATOM   3258  H HB3  . CYS A 1 25 ? -4.659  -0.998  -6.560  1.00 0.00 ? 89  CYS A HB3  4  
ATOM   3259  H HG   . CYS A 1 25 ? -7.301  0.733   -7.550  1.00 0.00 ? 89  CYS A HG   4  
ATOM   3260  N N    . TYR A 1 26 ? -6.973  0.715   -3.456  1.00 0.00 ? 90  TYR A N    4  
ATOM   3261  C CA   . TYR A 1 26 ? -7.780  1.650   -2.659  1.00 0.00 ? 90  TYR A CA   4  
ATOM   3262  C C    . TYR A 1 26 ? -6.876  2.636   -1.947  1.00 0.00 ? 90  TYR A C    4  
ATOM   3263  O O    . TYR A 1 26 ? -5.697  2.351   -1.756  1.00 0.00 ? 90  TYR A O    4  
ATOM   3264  C CB   . TYR A 1 26 ? -8.597  0.883   -1.619  1.00 0.00 ? 90  TYR A CB   4  
ATOM   3265  C CG   . TYR A 1 26 ? -9.638  -0.038  -2.211  1.00 0.00 ? 90  TYR A CG   4  
ATOM   3266  C CD1  . TYR A 1 26 ? -9.298  -1.304  -2.662  1.00 0.00 ? 90  TYR A CD1  4  
ATOM   3267  C CD2  . TYR A 1 26 ? -10.949 0.362   -2.324  1.00 0.00 ? 90  TYR A CD2  4  
ATOM   3268  C CE1  . TYR A 1 26 ? -10.229 -2.137  -3.220  1.00 0.00 ? 90  TYR A CE1  4  
ATOM   3269  C CE2  . TYR A 1 26 ? -11.896 -0.465  -2.871  1.00 0.00 ? 90  TYR A CE2  4  
ATOM   3270  C CZ   . TYR A 1 26 ? -11.534 -1.712  -3.325  1.00 0.00 ? 90  TYR A CZ   4  
ATOM   3271  O OH   . TYR A 1 26 ? -12.483 -2.527  -3.898  1.00 0.00 ? 90  TYR A OH   4  
ATOM   3272  H H    . TYR A 1 26 ? -6.166  0.342   -3.031  1.00 0.00 ? 90  TYR A H    4  
ATOM   3273  H HA   . TYR A 1 26 ? -8.451  2.180   -3.318  1.00 0.00 ? 90  TYR A HA   4  
ATOM   3274  H HB2  . TYR A 1 26 ? -7.917  0.273   -1.043  1.00 0.00 ? 90  TYR A HB2  4  
ATOM   3275  H HB3  . TYR A 1 26 ? -9.088  1.575   -0.952  1.00 0.00 ? 90  TYR A HB3  4  
ATOM   3276  H HD1  . TYR A 1 26 ? -8.272  -1.630  -2.581  1.00 0.00 ? 90  TYR A HD1  4  
ATOM   3277  H HD2  . TYR A 1 26 ? -11.230 1.343   -1.967  1.00 0.00 ? 90  TYR A HD2  4  
ATOM   3278  H HE1  . TYR A 1 26 ? -9.916  -3.117  -3.551  1.00 0.00 ? 90  TYR A HE1  4  
ATOM   3279  H HE2  . TYR A 1 26 ? -12.923 -0.133  -2.940  1.00 0.00 ? 90  TYR A HE2  4  
ATOM   3280  H HH   . TYR A 1 26 ? -12.200 -3.457  -3.877  1.00 0.00 ? 90  TYR A HH   4  
ATOM   3281  N N    . GLU A 1 27 ? -7.418  3.777   -1.557  1.00 0.00 ? 91  GLU A N    4  
ATOM   3282  C CA   . GLU A 1 27 ? -6.634  4.817   -0.901  1.00 0.00 ? 91  GLU A CA   4  
ATOM   3283  C C    . GLU A 1 27 ? -6.299  4.415   0.537   1.00 0.00 ? 91  GLU A C    4  
ATOM   3284  O O    . GLU A 1 27 ? -7.180  4.070   1.338   1.00 0.00 ? 91  GLU A O    4  
ATOM   3285  C CB   . GLU A 1 27 ? -7.381  6.162   -0.926  1.00 0.00 ? 91  GLU A CB   4  
ATOM   3286  C CG   . GLU A 1 27 ? -6.620  7.309   -0.258  1.00 0.00 ? 91  GLU A CG   4  
ATOM   3287  C CD   . GLU A 1 27 ? -7.371  8.615   -0.309  1.00 0.00 ? 91  GLU A CD   4  
ATOM   3288  O OE1  . GLU A 1 27 ? -8.276  8.836   0.522   1.00 0.00 ? 91  GLU A OE1  4  
ATOM   3289  O OE2  . GLU A 1 27 ? -7.066  9.451   -1.174  1.00 0.00 ? 91  GLU A OE2  4  
ATOM   3290  H H    . GLU A 1 27 ? -8.379  3.921   -1.688  1.00 0.00 ? 91  GLU A H    4  
ATOM   3291  H HA   . GLU A 1 27 ? -5.709  4.920   -1.447  1.00 0.00 ? 91  GLU A HA   4  
ATOM   3292  H HB2  . GLU A 1 27 ? -7.569  6.436   -1.953  1.00 0.00 ? 91  GLU A HB2  4  
ATOM   3293  H HB3  . GLU A 1 27 ? -8.326  6.042   -0.417  1.00 0.00 ? 91  GLU A HB3  4  
ATOM   3294  H HG2  . GLU A 1 27 ? -6.446  7.055   0.777   1.00 0.00 ? 91  GLU A HG2  4  
ATOM   3295  H HG3  . GLU A 1 27 ? -5.671  7.433   -0.758  1.00 0.00 ? 91  GLU A HG3  4  
ATOM   3296  N N    . ALA A 1 28 ? -5.035  4.447   0.846   1.00 0.00 ? 92  ALA A N    4  
ATOM   3297  C CA   . ALA A 1 28 ? -4.534  4.068   2.131   1.00 0.00 ? 92  ALA A CA   4  
ATOM   3298  C C    . ALA A 1 28 ? -3.377  4.960   2.513   1.00 0.00 ? 92  ALA A C    4  
ATOM   3299  O O    . ALA A 1 28 ? -2.636  5.422   1.649   1.00 0.00 ? 92  ALA A O    4  
ATOM   3300  C CB   . ALA A 1 28 ? -4.075  2.633   2.083   1.00 0.00 ? 92  ALA A CB   4  
ATOM   3301  H H    . ALA A 1 28 ? -4.391  4.746   0.163   1.00 0.00 ? 92  ALA A H    4  
ATOM   3302  H HA   . ALA A 1 28 ? -5.312  4.153   2.875   1.00 0.00 ? 92  ALA A HA   4  
ATOM   3303  H HB1  . ALA A 1 28 ? -3.271  2.536   1.368   1.00 0.00 ? 92  ALA A HB1  4  
ATOM   3304  H HB2  . ALA A 1 28 ? -3.726  2.341   3.062   1.00 0.00 ? 92  ALA A HB2  4  
ATOM   3305  H HB3  . ALA A 1 28 ? -4.896  1.996   1.787   1.00 0.00 ? 92  ALA A HB3  4  
ATOM   3306  N N    . GLU A 1 29 ? -3.219  5.200   3.777   1.00 0.00 ? 93  GLU A N    4  
ATOM   3307  C CA   . GLU A 1 29 ? -2.145  6.023   4.252   1.00 0.00 ? 93  GLU A CA   4  
ATOM   3308  C C    . GLU A 1 29 ? -1.082  5.154   4.893   1.00 0.00 ? 93  GLU A C    4  
ATOM   3309  O O    . GLU A 1 29 ? -1.396  4.221   5.636   1.00 0.00 ? 93  GLU A O    4  
ATOM   3310  C CB   . GLU A 1 29 ? -2.654  7.080   5.229   1.00 0.00 ? 93  GLU A CB   4  
ATOM   3311  C CG   . GLU A 1 29 ? -1.576  8.028   5.734   1.00 0.00 ? 93  GLU A CG   4  
ATOM   3312  C CD   . GLU A 1 29 ? -2.133  9.097   6.612   1.00 0.00 ? 93  GLU A CD   4  
ATOM   3313  O OE1  . GLU A 1 29 ? -2.290  8.868   7.830   1.00 0.00 ? 93  GLU A OE1  4  
ATOM   3314  O OE2  . GLU A 1 29 ? -2.460  10.179  6.110   1.00 0.00 ? 93  GLU A OE2  4  
ATOM   3315  H H    . GLU A 1 29 ? -3.832  4.786   4.428   1.00 0.00 ? 93  GLU A H    4  
ATOM   3316  H HA   . GLU A 1 29 ? -1.713  6.515   3.393   1.00 0.00 ? 93  GLU A HA   4  
ATOM   3317  H HB2  . GLU A 1 29 ? -3.424  7.663   4.744   1.00 0.00 ? 93  GLU A HB2  4  
ATOM   3318  H HB3  . GLU A 1 29 ? -3.087  6.576   6.081   1.00 0.00 ? 93  GLU A HB3  4  
ATOM   3319  H HG2  . GLU A 1 29 ? -0.846  7.463   6.295   1.00 0.00 ? 93  GLU A HG2  4  
ATOM   3320  H HG3  . GLU A 1 29 ? -1.082  8.489   4.888   1.00 0.00 ? 93  GLU A HG3  4  
ATOM   3321  N N    . ILE A 1 30 ? 0.147   5.428   4.563   1.00 0.00 ? 94  ILE A N    4  
ATOM   3322  C CA   . ILE A 1 30 ? 1.285   4.683   5.080   1.00 0.00 ? 94  ILE A CA   4  
ATOM   3323  C C    . ILE A 1 30 ? 1.577   5.051   6.533   1.00 0.00 ? 94  ILE A C    4  
ATOM   3324  O O    . ILE A 1 30 ? 1.778   6.222   6.861   1.00 0.00 ? 94  ILE A O    4  
ATOM   3325  C CB   . ILE A 1 30 ? 2.530   4.954   4.226   1.00 0.00 ? 94  ILE A CB   4  
ATOM   3326  C CG1  . ILE A 1 30 ? 2.206   4.634   2.777   1.00 0.00 ? 94  ILE A CG1  4  
ATOM   3327  C CG2  . ILE A 1 30 ? 3.702   4.099   4.713   1.00 0.00 ? 94  ILE A CG2  4  
ATOM   3328  C CD1  . ILE A 1 30 ? 3.212   5.136   1.794   1.00 0.00 ? 94  ILE A CD1  4  
ATOM   3329  H H    . ILE A 1 30 ? 0.286   6.158   3.917   1.00 0.00 ? 94  ILE A H    4  
ATOM   3330  H HA   . ILE A 1 30 ? 1.057   3.629   5.032   1.00 0.00 ? 94  ILE A HA   4  
ATOM   3331  H HB   . ILE A 1 30 ? 2.793   5.999   4.304   1.00 0.00 ? 94  ILE A HB   4  
ATOM   3332  H HG12 . ILE A 1 30 ? 2.162   3.561   2.667   1.00 0.00 ? 94  ILE A HG12 4  
ATOM   3333  H HG13 . ILE A 1 30 ? 1.241   5.054   2.545   1.00 0.00 ? 94  ILE A HG13 4  
ATOM   3334  H HG21 . ILE A 1 30 ? 3.436   3.054   4.653   1.00 0.00 ? 94  ILE A HG21 4  
ATOM   3335  H HG22 . ILE A 1 30 ? 4.571   4.286   4.101   1.00 0.00 ? 94  ILE A HG22 4  
ATOM   3336  H HG23 . ILE A 1 30 ? 3.919   4.341   5.743   1.00 0.00 ? 94  ILE A HG23 4  
ATOM   3337  H HD11 . ILE A 1 30 ? 4.171   4.699   2.027   1.00 0.00 ? 94  ILE A HD11 4  
ATOM   3338  H HD12 . ILE A 1 30 ? 2.913   4.853   0.795   1.00 0.00 ? 94  ILE A HD12 4  
ATOM   3339  H HD13 . ILE A 1 30 ? 3.266   6.214   1.860   1.00 0.00 ? 94  ILE A HD13 4  
ATOM   3340  N N    . GLU A 1 31 ? 1.603   4.048   7.370   1.00 0.00 ? 95  GLU A N    4  
ATOM   3341  C CA   . GLU A 1 31 ? 1.881   4.193   8.797   1.00 0.00 ? 95  GLU A CA   4  
ATOM   3342  C C    . GLU A 1 31 ? 3.340   3.873   9.098   1.00 0.00 ? 95  GLU A C    4  
ATOM   3343  O O    . GLU A 1 31 ? 3.956   4.465   9.988   1.00 0.00 ? 95  GLU A O    4  
ATOM   3344  C CB   . GLU A 1 31 ? 0.995   3.239   9.571   1.00 0.00 ? 95  GLU A CB   4  
ATOM   3345  C CG   . GLU A 1 31 ? -0.482  3.536   9.453   1.00 0.00 ? 95  GLU A CG   4  
ATOM   3346  C CD   . GLU A 1 31 ? -0.905  4.748   10.244  1.00 0.00 ? 95  GLU A CD   4  
ATOM   3347  O OE1  . GLU A 1 31 ? -1.191  4.610   11.459  1.00 0.00 ? 95  GLU A OE1  4  
ATOM   3348  O OE2  . GLU A 1 31 ? -0.979  5.854   9.684   1.00 0.00 ? 95  GLU A OE2  4  
ATOM   3349  H H    . GLU A 1 31 ? 1.417   3.150   7.012   1.00 0.00 ? 95  GLU A H    4  
ATOM   3350  H HA   . GLU A 1 31 ? 1.653   5.202   9.100   1.00 0.00 ? 95  GLU A HA   4  
ATOM   3351  H HB2  . GLU A 1 31 ? 1.168   2.238   9.204   1.00 0.00 ? 95  GLU A HB2  4  
ATOM   3352  H HB3  . GLU A 1 31 ? 1.268   3.283   10.614  1.00 0.00 ? 95  GLU A HB3  4  
ATOM   3353  H HG2  . GLU A 1 31 ? -0.707  3.719   8.412   1.00 0.00 ? 95  GLU A HG2  4  
ATOM   3354  H HG3  . GLU A 1 31 ? -1.032  2.672   9.785   1.00 0.00 ? 95  GLU A HG3  4  
ATOM   3355  N N    . GLU A 1 32 ? 3.887   2.944   8.353   1.00 0.00 ? 96  GLU A N    4  
ATOM   3356  C CA   . GLU A 1 32 ? 5.254   2.511   8.537   1.00 0.00 ? 96  GLU A CA   4  
ATOM   3357  C C    . GLU A 1 32 ? 5.740   1.858   7.263   1.00 0.00 ? 96  GLU A C    4  
ATOM   3358  O O    . GLU A 1 32 ? 4.939   1.349   6.486   1.00 0.00 ? 96  GLU A O    4  
ATOM   3359  C CB   . GLU A 1 32 ? 5.371   1.535   9.728   1.00 0.00 ? 96  GLU A CB   4  
ATOM   3360  C CG   . GLU A 1 32 ? 6.791   1.044   9.998   1.00 0.00 ? 96  GLU A CG   4  
ATOM   3361  C CD   . GLU A 1 32 ? 7.760   2.167   10.293  1.00 0.00 ? 96  GLU A CD   4  
ATOM   3362  O OE1  . GLU A 1 32 ? 8.277   2.801   9.343   1.00 0.00 ? 96  GLU A OE1  4  
ATOM   3363  O OE2  . GLU A 1 32 ? 8.030   2.430   11.476  1.00 0.00 ? 96  GLU A OE2  4  
ATOM   3364  H H    . GLU A 1 32 ? 3.365   2.527   7.634   1.00 0.00 ? 96  GLU A H    4  
ATOM   3365  H HA   . GLU A 1 32 ? 5.859   3.385   8.733   1.00 0.00 ? 96  GLU A HA   4  
ATOM   3366  H HB2  . GLU A 1 32 ? 5.012   2.032   10.617  1.00 0.00 ? 96  GLU A HB2  4  
ATOM   3367  H HB3  . GLU A 1 32 ? 4.748   0.675   9.532   1.00 0.00 ? 96  GLU A HB3  4  
ATOM   3368  H HG2  . GLU A 1 32 ? 6.783   0.363   10.833  1.00 0.00 ? 96  GLU A HG2  4  
ATOM   3369  H HG3  . GLU A 1 32 ? 7.133   0.528   9.111   1.00 0.00 ? 96  GLU A HG3  4  
ATOM   3370  N N    . ILE A 1 33 ? 7.019   1.911   7.039   1.00 0.00 ? 97  ILE A N    4  
ATOM   3371  C CA   . ILE A 1 33 ? 7.638   1.343   5.874   1.00 0.00 ? 97  ILE A CA   4  
ATOM   3372  C C    . ILE A 1 33 ? 8.662   0.319   6.320   1.00 0.00 ? 97  ILE A C    4  
ATOM   3373  O O    . ILE A 1 33 ? 9.417   0.563   7.254   1.00 0.00 ? 97  ILE A O    4  
ATOM   3374  C CB   . ILE A 1 33 ? 8.318   2.461   5.060   1.00 0.00 ? 97  ILE A CB   4  
ATOM   3375  C CG1  . ILE A 1 33 ? 7.271   3.479   4.692   1.00 0.00 ? 97  ILE A CG1  4  
ATOM   3376  C CG2  . ILE A 1 33 ? 8.982   1.915   3.794   1.00 0.00 ? 97  ILE A CG2  4  
ATOM   3377  C CD1  . ILE A 1 33 ? 7.834   4.807   4.385   1.00 0.00 ? 97  ILE A CD1  4  
ATOM   3378  H H    . ILE A 1 33 ? 7.602   2.340   7.710   1.00 0.00 ? 97  ILE A H    4  
ATOM   3379  H HA   . ILE A 1 33 ? 6.879   0.873   5.266   1.00 0.00 ? 97  ILE A HA   4  
ATOM   3380  H HB   . ILE A 1 33 ? 9.068   2.958   5.659   1.00 0.00 ? 97  ILE A HB   4  
ATOM   3381  H HG12 . ILE A 1 33 ? 6.737   3.134   3.819   1.00 0.00 ? 97  ILE A HG12 4  
ATOM   3382  H HG13 . ILE A 1 33 ? 6.583   3.577   5.518   1.00 0.00 ? 97  ILE A HG13 4  
ATOM   3383  H HG21 . ILE A 1 33 ? 8.235   1.437   3.178   1.00 0.00 ? 97  ILE A HG21 4  
ATOM   3384  H HG22 . ILE A 1 33 ? 9.427   2.734   3.247   1.00 0.00 ? 97  ILE A HG22 4  
ATOM   3385  H HG23 . ILE A 1 33 ? 9.743   1.198   4.064   1.00 0.00 ? 97  ILE A HG23 4  
ATOM   3386  H HD11 . ILE A 1 33 ? 8.519   4.736   3.553   1.00 0.00 ? 97  ILE A HD11 4  
ATOM   3387  H HD12 . ILE A 1 33 ? 7.020   5.477   4.151   1.00 0.00 ? 97  ILE A HD12 4  
ATOM   3388  H HD13 . ILE A 1 33 ? 8.341   5.159   5.270   1.00 0.00 ? 97  ILE A HD13 4  
ATOM   3389  N N    . ASP A 1 34 ? 8.657   -0.807  5.686   1.00 0.00 ? 98  ASP A N    4  
ATOM   3390  C CA   . ASP A 1 34 ? 9.590   -1.867  5.964   1.00 0.00 ? 98  ASP A CA   4  
ATOM   3391  C C    . ASP A 1 34 ? 10.483  -1.984  4.765   1.00 0.00 ? 98  ASP A C    4  
ATOM   3392  O O    . ASP A 1 34 ? 10.168  -2.661  3.781   1.00 0.00 ? 98  ASP A O    4  
ATOM   3393  C CB   . ASP A 1 34 ? 8.857   -3.181  6.203   1.00 0.00 ? 98  ASP A CB   4  
ATOM   3394  C CG   . ASP A 1 34 ? 9.770   -4.273  6.675   1.00 0.00 ? 98  ASP A CG   4  
ATOM   3395  O OD1  . ASP A 1 34 ? 10.527  -4.840  5.868   1.00 0.00 ? 98  ASP A OD1  4  
ATOM   3396  O OD2  . ASP A 1 34 ? 9.745   -4.586  7.900   1.00 0.00 ? 98  ASP A OD2  4  
ATOM   3397  H H    . ASP A 1 34 ? 8.026   -0.947  4.943   1.00 0.00 ? 98  ASP A H    4  
ATOM   3398  H HA   . ASP A 1 34 ? 10.209  -1.628  6.817   1.00 0.00 ? 98  ASP A HA   4  
ATOM   3399  H HB2  . ASP A 1 34 ? 8.094   -3.032  6.953   1.00 0.00 ? 98  ASP A HB2  4  
ATOM   3400  H HB3  . ASP A 1 34 ? 8.391   -3.496  5.281   1.00 0.00 ? 98  ASP A HB3  4  
ATOM   3401  N N    . GLU A 1 35 ? 11.561  -1.262  4.817   1.00 0.00 ? 99  GLU A N    4  
ATOM   3402  C CA   . GLU A 1 35 ? 12.492  -1.165  3.721   1.00 0.00 ? 99  GLU A CA   4  
ATOM   3403  C C    . GLU A 1 35 ? 13.208  -2.479  3.425   1.00 0.00 ? 99  GLU A C    4  
ATOM   3404  O O    . GLU A 1 35 ? 13.758  -2.658  2.329   1.00 0.00 ? 99  GLU A O    4  
ATOM   3405  C CB   . GLU A 1 35 ? 13.492  -0.063  3.978   1.00 0.00 ? 99  GLU A CB   4  
ATOM   3406  C CG   . GLU A 1 35 ? 12.859  1.312   4.187   1.00 0.00 ? 99  GLU A CG   4  
ATOM   3407  C CD   . GLU A 1 35 ? 13.877  2.398   4.424   1.00 0.00 ? 99  GLU A CD   4  
ATOM   3408  O OE1  . GLU A 1 35 ? 14.468  2.888   3.446   1.00 0.00 ? 99  GLU A OE1  4  
ATOM   3409  O OE2  . GLU A 1 35 ? 14.118  2.782   5.592   1.00 0.00 ? 99  GLU A OE2  4  
ATOM   3410  H H    . GLU A 1 35 ? 11.753  -0.776  5.651   1.00 0.00 ? 99  GLU A H    4  
ATOM   3411  H HA   . GLU A 1 35 ? 11.919  -0.892  2.846   1.00 0.00 ? 99  GLU A HA   4  
ATOM   3412  H HB2  . GLU A 1 35 ? 14.065  -0.337  4.851   1.00 0.00 ? 99  GLU A HB2  4  
ATOM   3413  H HB3  . GLU A 1 35 ? 14.138  -0.026  3.115   1.00 0.00 ? 99  GLU A HB3  4  
ATOM   3414  H HG2  . GLU A 1 35 ? 12.287  1.567   3.308   1.00 0.00 ? 99  GLU A HG2  4  
ATOM   3415  H HG3  . GLU A 1 35 ? 12.195  1.263   5.038   1.00 0.00 ? 99  GLU A HG3  4  
ATOM   3416  N N    . GLU A 1 36 ? 13.197  -3.387  4.378   1.00 0.00 ? 100 GLU A N    4  
ATOM   3417  C CA   . GLU A 1 36 ? 13.905  -4.641  4.242   1.00 0.00 ? 100 GLU A CA   4  
ATOM   3418  C C    . GLU A 1 36 ? 13.157  -5.545  3.264   1.00 0.00 ? 100 GLU A C    4  
ATOM   3419  O O    . GLU A 1 36 ? 13.763  -6.129  2.359   1.00 0.00 ? 100 GLU A O    4  
ATOM   3420  C CB   . GLU A 1 36 ? 13.985  -5.287  5.630   1.00 0.00 ? 100 GLU A CB   4  
ATOM   3421  C CG   . GLU A 1 36 ? 15.024  -6.393  5.822   1.00 0.00 ? 100 GLU A CG   4  
ATOM   3422  C CD   . GLU A 1 36 ? 14.775  -7.626  5.010   1.00 0.00 ? 100 GLU A CD   4  
ATOM   3423  O OE1  . GLU A 1 36 ? 13.780  -8.326  5.265   1.00 0.00 ? 100 GLU A OE1  4  
ATOM   3424  O OE2  . GLU A 1 36 ? 15.569  -7.909  4.088   1.00 0.00 ? 100 GLU A OE2  4  
ATOM   3425  H H    . GLU A 1 36 ? 12.709  -3.202  5.210   1.00 0.00 ? 100 GLU A H    4  
ATOM   3426  H HA   . GLU A 1 36 ? 14.905  -4.453  3.882   1.00 0.00 ? 100 GLU A HA   4  
ATOM   3427  H HB2  . GLU A 1 36 ? 14.152  -4.509  6.359   1.00 0.00 ? 100 GLU A HB2  4  
ATOM   3428  H HB3  . GLU A 1 36 ? 13.009  -5.709  5.824   1.00 0.00 ? 100 GLU A HB3  4  
ATOM   3429  H HG2  . GLU A 1 36 ? 15.995  -6.011  5.543   1.00 0.00 ? 100 GLU A HG2  4  
ATOM   3430  H HG3  . GLU A 1 36 ? 15.039  -6.662  6.868   1.00 0.00 ? 100 GLU A HG3  4  
ATOM   3431  N N    . ASN A 1 37 ? 11.847  -5.596  3.406   1.00 0.00 ? 101 ASN A N    4  
ATOM   3432  C CA   . ASN A 1 37 ? 11.009  -6.408  2.520   1.00 0.00 ? 101 ASN A CA   4  
ATOM   3433  C C    . ASN A 1 37 ? 10.535  -5.590  1.363   1.00 0.00 ? 101 ASN A C    4  
ATOM   3434  O O    . ASN A 1 37 ? 10.027  -6.132  0.368   1.00 0.00 ? 101 ASN A O    4  
ATOM   3435  C CB   . ASN A 1 37 ? 9.775   -6.953  3.247   1.00 0.00 ? 101 ASN A CB   4  
ATOM   3436  C CG   . ASN A 1 37 ? 10.075  -7.949  4.341   1.00 0.00 ? 101 ASN A CG   4  
ATOM   3437  O OD1  . ASN A 1 37 ? 10.087  -9.169  4.115   1.00 0.00 ? 101 ASN A OD1  4  
ATOM   3438  N ND2  . ASN A 1 37 ? 10.319  -7.461  5.518   1.00 0.00 ? 101 ASN A ND2  4  
ATOM   3439  H H    . ASN A 1 37 ? 11.425  -5.101  4.149   1.00 0.00 ? 101 ASN A H    4  
ATOM   3440  H HA   . ASN A 1 37 ? 11.583  -7.241  2.148   1.00 0.00 ? 101 ASN A HA   4  
ATOM   3441  H HB2  . ASN A 1 37 ? 9.224   -6.132  3.682   1.00 0.00 ? 101 ASN A HB2  4  
ATOM   3442  H HB3  . ASN A 1 37 ? 9.160   -7.437  2.504   1.00 0.00 ? 101 ASN A HB3  4  
ATOM   3443  H HD21 . ASN A 1 37 ? 10.294  -6.471  5.603   1.00 0.00 ? 101 ASN A HD21 4  
ATOM   3444  H HD22 . ASN A 1 37 ? 10.528  -8.061  6.262   1.00 0.00 ? 101 ASN A HD22 4  
ATOM   3445  N N    . GLY A 1 38 ? 10.695  -4.282  1.481   1.00 0.00 ? 102 GLY A N    4  
ATOM   3446  C CA   . GLY A 1 38 ? 10.174  -3.399  0.487   1.00 0.00 ? 102 GLY A CA   4  
ATOM   3447  C C    . GLY A 1 38 ? 8.677   -3.298  0.638   1.00 0.00 ? 102 GLY A C    4  
ATOM   3448  O O    . GLY A 1 38 ? 7.942   -3.129  -0.347  1.00 0.00 ? 102 GLY A O    4  
ATOM   3449  H H    . GLY A 1 38 ? 11.169  -3.909  2.259   1.00 0.00 ? 102 GLY A H    4  
ATOM   3450  H HA2  . GLY A 1 38 ? 10.623  -2.424  0.606   1.00 0.00 ? 102 GLY A HA2  4  
ATOM   3451  H HA3  . GLY A 1 38 ? 10.400  -3.787  -0.495  1.00 0.00 ? 102 GLY A HA3  4  
ATOM   3452  N N    . THR A 1 39 ? 8.213   -3.424  1.860   1.00 0.00 ? 103 THR A N    4  
ATOM   3453  C CA   . THR A 1 39 ? 6.819   -3.367  2.144   1.00 0.00 ? 103 THR A CA   4  
ATOM   3454  C C    . THR A 1 39 ? 6.484   -2.150  2.974   1.00 0.00 ? 103 THR A C    4  
ATOM   3455  O O    . THR A 1 39 ? 7.365   -1.457  3.459   1.00 0.00 ? 103 THR A O    4  
ATOM   3456  C CB   . THR A 1 39 ? 6.344   -4.660  2.843   1.00 0.00 ? 103 THR A CB   4  
ATOM   3457  O OG1  . THR A 1 39 ? 7.216   -4.966  3.941   1.00 0.00 ? 103 THR A OG1  4  
ATOM   3458  C CG2  . THR A 1 39 ? 6.319   -5.833  1.874   1.00 0.00 ? 103 THR A CG2  4  
ATOM   3459  H H    . THR A 1 39 ? 8.818   -3.562  2.628   1.00 0.00 ? 103 THR A H    4  
ATOM   3460  H HA   . THR A 1 39 ? 6.285   -3.264  1.218   1.00 0.00 ? 103 THR A HA   4  
ATOM   3461  H HB   . THR A 1 39 ? 5.347   -4.486  3.218   1.00 0.00 ? 103 THR A HB   4  
ATOM   3462  H HG1  . THR A 1 39 ? 7.014   -5.844  4.284   1.00 0.00 ? 103 THR A HG1  4  
ATOM   3463  H HG21 . THR A 1 39 ? 7.312   -5.995  1.481   1.00 0.00 ? 103 THR A HG21 4  
ATOM   3464  H HG22 . THR A 1 39 ? 5.984   -6.719  2.393   1.00 0.00 ? 103 THR A HG22 4  
ATOM   3465  H HG23 . THR A 1 39 ? 5.642   -5.617  1.061   1.00 0.00 ? 103 THR A HG23 4  
ATOM   3466  N N    . ALA A 1 40 ? 5.234   -1.849  3.058   1.00 0.00 ? 104 ALA A N    4  
ATOM   3467  C CA   . ALA A 1 40 ? 4.772   -0.777  3.870   1.00 0.00 ? 104 ALA A CA   4  
ATOM   3468  C C    . ALA A 1 40 ? 3.510   -1.190  4.571   1.00 0.00 ? 104 ALA A C    4  
ATOM   3469  O O    . ALA A 1 40 ? 2.712   -1.962  4.031   1.00 0.00 ? 104 ALA A O    4  
ATOM   3470  C CB   . ALA A 1 40 ? 4.531   0.461   3.032   1.00 0.00 ? 104 ALA A CB   4  
ATOM   3471  H H    . ALA A 1 40 ? 4.570   -2.343  2.523   1.00 0.00 ? 104 ALA A H    4  
ATOM   3472  H HA   . ALA A 1 40 ? 5.530   -0.554  4.605   1.00 0.00 ? 104 ALA A HA   4  
ATOM   3473  H HB1  . ALA A 1 40 ? 3.766   0.239   2.305   1.00 0.00 ? 104 ALA A HB1  4  
ATOM   3474  H HB2  . ALA A 1 40 ? 4.209   1.276   3.661   1.00 0.00 ? 104 ALA A HB2  4  
ATOM   3475  H HB3  . ALA A 1 40 ? 5.444   0.730   2.521   1.00 0.00 ? 104 ALA A HB3  4  
ATOM   3476  N N    . ALA A 1 41 ? 3.355   -0.719  5.762   1.00 0.00 ? 105 ALA A N    4  
ATOM   3477  C CA   . ALA A 1 41 ? 2.181   -0.953  6.535   1.00 0.00 ? 105 ALA A CA   4  
ATOM   3478  C C    . ALA A 1 41 ? 1.276   0.225   6.319   1.00 0.00 ? 105 ALA A C    4  
ATOM   3479  O O    . ALA A 1 41 ? 1.651   1.381   6.601   1.00 0.00 ? 105 ALA A O    4  
ATOM   3480  C CB   . ALA A 1 41 ? 2.537   -1.115  7.990   1.00 0.00 ? 105 ALA A CB   4  
ATOM   3481  H H    . ALA A 1 41 ? 4.052   -0.136  6.137   1.00 0.00 ? 105 ALA A H    4  
ATOM   3482  H HA   . ALA A 1 41 ? 1.700   -1.851  6.173   1.00 0.00 ? 105 ALA A HA   4  
ATOM   3483  H HB1  . ALA A 1 41 ? 3.029   -0.216  8.330   1.00 0.00 ? 105 ALA A HB1  4  
ATOM   3484  H HB2  . ALA A 1 41 ? 1.643   -1.297  8.564   1.00 0.00 ? 105 ALA A HB2  4  
ATOM   3485  H HB3  . ALA A 1 41 ? 3.206   -1.959  8.072   1.00 0.00 ? 105 ALA A HB3  4  
ATOM   3486  N N    . ILE A 1 42 ? 0.134   -0.036  5.787   1.00 0.00 ? 106 ILE A N    4  
ATOM   3487  C CA   . ILE A 1 42 ? -0.762  1.002   5.370   1.00 0.00 ? 106 ILE A CA   4  
ATOM   3488  C C    . ILE A 1 42 ? -2.123  0.829   6.003   1.00 0.00 ? 106 ILE A C    4  
ATOM   3489  O O    . ILE A 1 42 ? -2.522  -0.285  6.328   1.00 0.00 ? 106 ILE A O    4  
ATOM   3490  C CB   . ILE A 1 42 ? -0.894  0.994   3.812   1.00 0.00 ? 106 ILE A CB   4  
ATOM   3491  C CG1  . ILE A 1 42 ? -1.376  -0.372  3.296   1.00 0.00 ? 106 ILE A CG1  4  
ATOM   3492  C CG2  . ILE A 1 42 ? 0.398   1.384   3.134   1.00 0.00 ? 106 ILE A CG2  4  
ATOM   3493  C CD1  . ILE A 1 42 ? -2.847  -0.438  3.078   1.00 0.00 ? 106 ILE A CD1  4  
ATOM   3494  H H    . ILE A 1 42 ? -0.135  -0.977  5.675   1.00 0.00 ? 106 ILE A H    4  
ATOM   3495  H HA   . ILE A 1 42 ? -0.345  1.953   5.662   1.00 0.00 ? 106 ILE A HA   4  
ATOM   3496  H HB   . ILE A 1 42 ? -1.637  1.734   3.551   1.00 0.00 ? 106 ILE A HB   4  
ATOM   3497  H HG12 . ILE A 1 42 ? -0.885  -0.680  2.387   1.00 0.00 ? 106 ILE A HG12 4  
ATOM   3498  H HG13 . ILE A 1 42 ? -1.144  -1.100  4.060   1.00 0.00 ? 106 ILE A HG13 4  
ATOM   3499  H HG21 . ILE A 1 42 ? 1.176   0.686   3.407   1.00 0.00 ? 106 ILE A HG21 4  
ATOM   3500  H HG22 . ILE A 1 42 ? 0.236   1.358   2.067   1.00 0.00 ? 106 ILE A HG22 4  
ATOM   3501  H HG23 . ILE A 1 42 ? 0.671   2.384   3.434   1.00 0.00 ? 106 ILE A HG23 4  
ATOM   3502  H HD11 . ILE A 1 42 ? -3.084  0.347   2.371   1.00 0.00 ? 106 ILE A HD11 4  
ATOM   3503  H HD12 . ILE A 1 42 ? -3.122  -1.401  2.677   1.00 0.00 ? 106 ILE A HD12 4  
ATOM   3504  H HD13 . ILE A 1 42 ? -3.360  -0.254  4.011   1.00 0.00 ? 106 ILE A HD13 4  
ATOM   3505  N N    . THR A 1 43 ? -2.818  1.914   6.177   1.00 0.00 ? 107 THR A N    4  
ATOM   3506  C CA   . THR A 1 43 ? -4.146  1.892   6.703   1.00 0.00 ? 107 THR A CA   4  
ATOM   3507  C C    . THR A 1 43 ? -5.108  2.477   5.671   1.00 0.00 ? 107 THR A C    4  
ATOM   3508  O O    . THR A 1 43 ? -4.921  3.600   5.209   1.00 0.00 ? 107 THR A O    4  
ATOM   3509  C CB   . THR A 1 43 ? -4.216  2.677   8.021   1.00 0.00 ? 107 THR A CB   4  
ATOM   3510  O OG1  . THR A 1 43 ? -3.278  2.105   8.946   1.00 0.00 ? 107 THR A OG1  4  
ATOM   3511  C CG2  . THR A 1 43 ? -5.614  2.613   8.626   1.00 0.00 ? 107 THR A CG2  4  
ATOM   3512  H H    . THR A 1 43 ? -2.426  2.787   5.940   1.00 0.00 ? 107 THR A H    4  
ATOM   3513  H HA   . THR A 1 43 ? -4.415  0.863   6.889   1.00 0.00 ? 107 THR A HA   4  
ATOM   3514  H HB   . THR A 1 43 ? -3.950  3.707   7.833   1.00 0.00 ? 107 THR A HB   4  
ATOM   3515  H HG1  . THR A 1 43 ? -2.628  1.589   8.450   1.00 0.00 ? 107 THR A HG1  4  
ATOM   3516  H HG21 . THR A 1 43 ? -5.867  1.584   8.839   1.00 0.00 ? 107 THR A HG21 4  
ATOM   3517  H HG22 . THR A 1 43 ? -5.636  3.185   9.541   1.00 0.00 ? 107 THR A HG22 4  
ATOM   3518  H HG23 . THR A 1 43 ? -6.326  3.024   7.926   1.00 0.00 ? 107 THR A HG23 4  
ATOM   3519  N N    . PHE A 1 44 ? -6.105  1.700   5.304   1.00 0.00 ? 108 PHE A N    4  
ATOM   3520  C CA   . PHE A 1 44 ? -7.087  2.089   4.308   1.00 0.00 ? 108 PHE A CA   4  
ATOM   3521  C C    . PHE A 1 44 ? -7.966  3.208   4.807   1.00 0.00 ? 108 PHE A C    4  
ATOM   3522  O O    . PHE A 1 44 ? -8.699  3.043   5.799   1.00 0.00 ? 108 PHE A O    4  
ATOM   3523  C CB   . PHE A 1 44 ? -7.925  0.890   3.869   1.00 0.00 ? 108 PHE A CB   4  
ATOM   3524  C CG   . PHE A 1 44 ? -7.141  -0.113  3.084   1.00 0.00 ? 108 PHE A CG   4  
ATOM   3525  C CD1  . PHE A 1 44 ? -6.846  0.143   1.757   1.00 0.00 ? 108 PHE A CD1  4  
ATOM   3526  C CD2  . PHE A 1 44 ? -6.694  -1.301  3.659   1.00 0.00 ? 108 PHE A CD2  4  
ATOM   3527  C CE1  . PHE A 1 44 ? -6.119  -0.755  1.007   1.00 0.00 ? 108 PHE A CE1  4  
ATOM   3528  C CE2  . PHE A 1 44 ? -5.967  -2.207  2.912   1.00 0.00 ? 108 PHE A CE2  4  
ATOM   3529  C CZ   . PHE A 1 44 ? -5.676  -1.932  1.583   1.00 0.00 ? 108 PHE A CZ   4  
ATOM   3530  H H    . PHE A 1 44 ? -6.189  0.831   5.759   1.00 0.00 ? 108 PHE A H    4  
ATOM   3531  H HA   . PHE A 1 44 ? -6.539  2.451   3.452   1.00 0.00 ? 108 PHE A HA   4  
ATOM   3532  H HB2  . PHE A 1 44 ? -8.325  0.396   4.741   1.00 0.00 ? 108 PHE A HB2  4  
ATOM   3533  H HB3  . PHE A 1 44 ? -8.735  1.240   3.248   1.00 0.00 ? 108 PHE A HB3  4  
ATOM   3534  H HD1  . PHE A 1 44 ? -7.204  1.063   1.315   1.00 0.00 ? 108 PHE A HD1  4  
ATOM   3535  H HD2  . PHE A 1 44 ? -6.931  -1.529  4.691   1.00 0.00 ? 108 PHE A HD2  4  
ATOM   3536  H HE1  . PHE A 1 44 ? -5.905  -0.535  -0.029  1.00 0.00 ? 108 PHE A HE1  4  
ATOM   3537  H HE2  . PHE A 1 44 ? -5.623  -3.125  3.364   1.00 0.00 ? 108 PHE A HE2  4  
ATOM   3538  H HZ   . PHE A 1 44 ? -5.104  -2.637  0.998   1.00 0.00 ? 108 PHE A HZ   4  
ATOM   3539  N N    . ALA A 1 45 ? -7.917  4.315   4.100   1.00 0.00 ? 109 ALA A N    4  
ATOM   3540  C CA   . ALA A 1 45 ? -8.617  5.517   4.474   1.00 0.00 ? 109 ALA A CA   4  
ATOM   3541  C C    . ALA A 1 45 ? -10.105 5.339   4.274   1.00 0.00 ? 109 ALA A C    4  
ATOM   3542  O O    . ALA A 1 45 ? -10.552 4.895   3.209   1.00 0.00 ? 109 ALA A O    4  
ATOM   3543  C CB   . ALA A 1 45 ? -8.101  6.696   3.664   1.00 0.00 ? 109 ALA A CB   4  
ATOM   3544  H H    . ALA A 1 45 ? -7.417  4.313   3.253   1.00 0.00 ? 109 ALA A H    4  
ATOM   3545  H HA   . ALA A 1 45 ? -8.426  5.710   5.519   1.00 0.00 ? 109 ALA A HA   4  
ATOM   3546  H HB1  . ALA A 1 45 ? -8.305  6.531   2.616   1.00 0.00 ? 109 ALA A HB1  4  
ATOM   3547  H HB2  . ALA A 1 45 ? -8.597  7.598   3.991   1.00 0.00 ? 109 ALA A HB2  4  
ATOM   3548  H HB3  . ALA A 1 45 ? -7.036  6.798   3.811   1.00 0.00 ? 109 ALA A HB3  4  
ATOM   3549  N N    . GLY A 1 46 ? -10.855 5.620   5.302   1.00 0.00 ? 110 GLY A N    4  
ATOM   3550  C CA   . GLY A 1 46 ? -12.282 5.498   5.235   1.00 0.00 ? 110 GLY A CA   4  
ATOM   3551  C C    . GLY A 1 46 ? -12.759 4.200   5.836   1.00 0.00 ? 110 GLY A C    4  
ATOM   3552  O O    . GLY A 1 46 ? -13.661 4.189   6.675   1.00 0.00 ? 110 GLY A O    4  
ATOM   3553  H H    . GLY A 1 46 ? -10.435 5.915   6.141   1.00 0.00 ? 110 GLY A H    4  
ATOM   3554  H HA2  . GLY A 1 46 ? -12.731 6.322   5.769   1.00 0.00 ? 110 GLY A HA2  4  
ATOM   3555  H HA3  . GLY A 1 46 ? -12.590 5.533   4.200   1.00 0.00 ? 110 GLY A HA3  4  
ATOM   3556  N N    . TYR A 1 47 ? -12.151 3.109   5.428   1.00 0.00 ? 111 TYR A N    4  
ATOM   3557  C CA   . TYR A 1 47 ? -12.534 1.802   5.898   1.00 0.00 ? 111 TYR A CA   4  
ATOM   3558  C C    . TYR A 1 47 ? -11.944 1.498   7.277   1.00 0.00 ? 111 TYR A C    4  
ATOM   3559  O O    . TYR A 1 47 ? -12.661 1.071   8.186   1.00 0.00 ? 111 TYR A O    4  
ATOM   3560  C CB   . TYR A 1 47 ? -12.083 0.767   4.910   1.00 0.00 ? 111 TYR A CB   4  
ATOM   3561  C CG   . TYR A 1 47 ? -12.539 1.019   3.492   1.00 0.00 ? 111 TYR A CG   4  
ATOM   3562  C CD1  . TYR A 1 47 ? -13.820 0.690   3.086   1.00 0.00 ? 111 TYR A CD1  4  
ATOM   3563  C CD2  . TYR A 1 47 ? -11.665 1.546   2.548   1.00 0.00 ? 111 TYR A CD2  4  
ATOM   3564  C CE1  . TYR A 1 47 ? -14.227 0.882   1.781   1.00 0.00 ? 111 TYR A CE1  4  
ATOM   3565  C CE2  . TYR A 1 47 ? -12.057 1.748   1.245   1.00 0.00 ? 111 TYR A CE2  4  
ATOM   3566  C CZ   . TYR A 1 47 ? -13.346 1.412   0.864   1.00 0.00 ? 111 TYR A CZ   4  
ATOM   3567  O OH   . TYR A 1 47 ? -13.764 1.607   -0.441  1.00 0.00 ? 111 TYR A OH   4  
ATOM   3568  H H    . TYR A 1 47 ? -11.443 3.177   4.754   1.00 0.00 ? 111 TYR A H    4  
ATOM   3569  H HA   . TYR A 1 47 ? -13.610 1.769   5.958   1.00 0.00 ? 111 TYR A HA   4  
ATOM   3570  H HB2  . TYR A 1 47 ? -11.004 0.730   4.904   1.00 0.00 ? 111 TYR A HB2  4  
ATOM   3571  H HB3  . TYR A 1 47 ? -12.466 -0.196  5.213   1.00 0.00 ? 111 TYR A HB3  4  
ATOM   3572  H HD1  . TYR A 1 47 ? -14.508 0.278   3.809   1.00 0.00 ? 111 TYR A HD1  4  
ATOM   3573  H HD2  . TYR A 1 47 ? -10.662 1.807   2.850   1.00 0.00 ? 111 TYR A HD2  4  
ATOM   3574  H HE1  . TYR A 1 47 ? -15.227 0.601   1.482   1.00 0.00 ? 111 TYR A HE1  4  
ATOM   3575  H HE2  . TYR A 1 47 ? -11.341 2.157   0.546   1.00 0.00 ? 111 TYR A HE2  4  
ATOM   3576  H HH   . TYR A 1 47 ? -14.614 2.066   -0.384  1.00 0.00 ? 111 TYR A HH   4  
ATOM   3577  N N    . GLY A 1 48 ? -10.649 1.710   7.435   1.00 0.00 ? 112 GLY A N    4  
ATOM   3578  C CA   . GLY A 1 48 ? -10.028 1.485   8.727   1.00 0.00 ? 112 GLY A CA   4  
ATOM   3579  C C    . GLY A 1 48 ? -9.320  0.142   8.882   1.00 0.00 ? 112 GLY A C    4  
ATOM   3580  O O    . GLY A 1 48 ? -9.237  -0.383  9.987   1.00 0.00 ? 112 GLY A O    4  
ATOM   3581  H H    . GLY A 1 48 ? -10.105 2.064   6.696   1.00 0.00 ? 112 GLY A H    4  
ATOM   3582  H HA2  . GLY A 1 48 ? -9.299  2.262   8.894   1.00 0.00 ? 112 GLY A HA2  4  
ATOM   3583  H HA3  . GLY A 1 48 ? -10.793 1.562   9.486   1.00 0.00 ? 112 GLY A HA3  4  
ATOM   3584  N N    . ASN A 1 49 ? -8.830  -0.438  7.800   1.00 0.00 ? 113 ASN A N    4  
ATOM   3585  C CA   . ASN A 1 49 ? -8.028  -1.672  7.926   1.00 0.00 ? 113 ASN A CA   4  
ATOM   3586  C C    . ASN A 1 49 ? -6.593  -1.359  7.679   1.00 0.00 ? 113 ASN A C    4  
ATOM   3587  O O    . ASN A 1 49 ? -6.276  -0.305  7.140   1.00 0.00 ? 113 ASN A O    4  
ATOM   3588  C CB   . ASN A 1 49 ? -8.425  -2.800  6.974   1.00 0.00 ? 113 ASN A CB   4  
ATOM   3589  C CG   . ASN A 1 49 ? -9.767  -3.437  7.229   1.00 0.00 ? 113 ASN A CG   4  
ATOM   3590  O OD1  . ASN A 1 49 ? -10.291 -3.439  8.351   1.00 0.00 ? 113 ASN A OD1  4  
ATOM   3591  N ND2  . ASN A 1 49 ? -10.288 -4.049  6.214   1.00 0.00 ? 113 ASN A ND2  4  
ATOM   3592  H H    . ASN A 1 49 ? -8.978  -0.038  6.920   1.00 0.00 ? 113 ASN A H    4  
ATOM   3593  H HA   . ASN A 1 49 ? -8.129  -2.012  8.947   1.00 0.00 ? 113 ASN A HA   4  
ATOM   3594  H HB2  . ASN A 1 49 ? -8.435  -2.419  5.964   1.00 0.00 ? 113 ASN A HB2  4  
ATOM   3595  H HB3  . ASN A 1 49 ? -7.665  -3.565  7.040   1.00 0.00 ? 113 ASN A HB3  4  
ATOM   3596  H HD21 . ASN A 1 49 ? -9.757  -4.050  5.387   1.00 0.00 ? 113 ASN A HD21 4  
ATOM   3597  H HD22 . ASN A 1 49 ? -11.172 -4.462  6.261   1.00 0.00 ? 113 ASN A HD22 4  
ATOM   3598  N N    . ALA A 1 50 ? -5.736  -2.281  7.998   1.00 0.00 ? 114 ALA A N    4  
ATOM   3599  C CA   . ALA A 1 50 ? -4.323  -2.084  7.848   1.00 0.00 ? 114 ALA A CA   4  
ATOM   3600  C C    . ALA A 1 50 ? -3.688  -3.345  7.337   1.00 0.00 ? 114 ALA A C    4  
ATOM   3601  O O    . ALA A 1 50 ? -4.030  -4.450  7.791   1.00 0.00 ? 114 ALA A O    4  
ATOM   3602  C CB   . ALA A 1 50 ? -3.695  -1.676  9.175   1.00 0.00 ? 114 ALA A CB   4  
ATOM   3603  H H    . ALA A 1 50 ? -6.045  -3.153  8.326   1.00 0.00 ? 114 ALA A H    4  
ATOM   3604  H HA   . ALA A 1 50 ? -4.161  -1.291  7.134   1.00 0.00 ? 114 ALA A HA   4  
ATOM   3605  H HB1  . ALA A 1 50 ? -3.885  -2.442  9.911   1.00 0.00 ? 114 ALA A HB1  4  
ATOM   3606  H HB2  . ALA A 1 50 ? -2.630  -1.563  9.047   1.00 0.00 ? 114 ALA A HB2  4  
ATOM   3607  H HB3  . ALA A 1 50 ? -4.125  -0.743  9.509   1.00 0.00 ? 114 ALA A HB3  4  
ATOM   3608  N N    . GLU A 1 51 ? -2.795  -3.210  6.393   1.00 0.00 ? 115 GLU A N    4  
ATOM   3609  C CA   . GLU A 1 51 ? -2.102  -4.348  5.872   1.00 0.00 ? 115 GLU A CA   4  
ATOM   3610  C C    . GLU A 1 51 ? -0.688  -3.983  5.512   1.00 0.00 ? 115 GLU A C    4  
ATOM   3611  O O    . GLU A 1 51 ? -0.364  -2.801  5.339   1.00 0.00 ? 115 GLU A O    4  
ATOM   3612  C CB   . GLU A 1 51 ? -2.813  -4.982  4.661   1.00 0.00 ? 115 GLU A CB   4  
ATOM   3613  C CG   . GLU A 1 51 ? -2.770  -4.221  3.352   1.00 0.00 ? 115 GLU A CG   4  
ATOM   3614  C CD   . GLU A 1 51 ? -3.162  -5.131  2.205   1.00 0.00 ? 115 GLU A CD   4  
ATOM   3615  O OE1  . GLU A 1 51 ? -4.376  -5.308  1.944   1.00 0.00 ? 115 GLU A OE1  4  
ATOM   3616  O OE2  . GLU A 1 51 ? -2.255  -5.741  1.596   1.00 0.00 ? 115 GLU A OE2  4  
ATOM   3617  H H    . GLU A 1 51 ? -2.567  -2.315  6.056   1.00 0.00 ? 115 GLU A H    4  
ATOM   3618  H HA   . GLU A 1 51 ? -2.063  -5.079  6.666   1.00 0.00 ? 115 GLU A HA   4  
ATOM   3619  H HB2  . GLU A 1 51 ? -2.403  -5.957  4.461   1.00 0.00 ? 115 GLU A HB2  4  
ATOM   3620  H HB3  . GLU A 1 51 ? -3.857  -5.071  4.929   1.00 0.00 ? 115 GLU A HB3  4  
ATOM   3621  H HG2  . GLU A 1 51 ? -3.458  -3.391  3.404   1.00 0.00 ? 115 GLU A HG2  4  
ATOM   3622  H HG3  . GLU A 1 51 ? -1.767  -3.858  3.182   1.00 0.00 ? 115 GLU A HG3  4  
ATOM   3623  N N    . VAL A 1 52 ? 0.143   -4.980  5.432   1.00 0.00 ? 116 VAL A N    4  
ATOM   3624  C CA   . VAL A 1 52 ? 1.503   -4.820  5.015   1.00 0.00 ? 116 VAL A CA   4  
ATOM   3625  C C    . VAL A 1 52 ? 1.566   -5.212  3.553   1.00 0.00 ? 116 VAL A C    4  
ATOM   3626  O O    . VAL A 1 52 ? 1.375   -6.383  3.194   1.00 0.00 ? 116 VAL A O    4  
ATOM   3627  C CB   . VAL A 1 52 ? 2.474   -5.698  5.856   1.00 0.00 ? 116 VAL A CB   4  
ATOM   3628  C CG1  . VAL A 1 52 ? 3.916   -5.496  5.415   1.00 0.00 ? 116 VAL A CG1  4  
ATOM   3629  C CG2  . VAL A 1 52 ? 2.330   -5.386  7.337   1.00 0.00 ? 116 VAL A CG2  4  
ATOM   3630  H H    . VAL A 1 52 ? -0.177  -5.882  5.644   1.00 0.00 ? 116 VAL A H    4  
ATOM   3631  H HA   . VAL A 1 52 ? 1.767   -3.778  5.112   1.00 0.00 ? 116 VAL A HA   4  
ATOM   3632  H HB   . VAL A 1 52 ? 2.215   -6.736  5.700   1.00 0.00 ? 116 VAL A HB   4  
ATOM   3633  H HG11 . VAL A 1 52 ? 4.181   -4.454  5.516   1.00 0.00 ? 116 VAL A HG11 4  
ATOM   3634  H HG12 . VAL A 1 52 ? 4.568   -6.093  6.035   1.00 0.00 ? 116 VAL A HG12 4  
ATOM   3635  H HG13 . VAL A 1 52 ? 4.025   -5.801  4.383   1.00 0.00 ? 116 VAL A HG13 4  
ATOM   3636  H HG21 . VAL A 1 52 ? 1.313   -5.577  7.646   1.00 0.00 ? 116 VAL A HG21 4  
ATOM   3637  H HG22 . VAL A 1 52 ? 3.003   -6.011  7.906   1.00 0.00 ? 116 VAL A HG22 4  
ATOM   3638  H HG23 . VAL A 1 52 ? 2.569   -4.348  7.511   1.00 0.00 ? 116 VAL A HG23 4  
ATOM   3639  N N    . THR A 1 53 ? 1.785   -4.254  2.727   1.00 0.00 ? 117 THR A N    4  
ATOM   3640  C CA   . THR A 1 53 ? 1.763   -4.458  1.308   1.00 0.00 ? 117 THR A CA   4  
ATOM   3641  C C    . THR A 1 53 ? 3.052   -3.892  0.691   1.00 0.00 ? 117 THR A C    4  
ATOM   3642  O O    . THR A 1 53 ? 3.579   -2.893  1.179   1.00 0.00 ? 117 THR A O    4  
ATOM   3643  C CB   . THR A 1 53 ? 0.474   -3.822  0.675   1.00 0.00 ? 117 THR A CB   4  
ATOM   3644  O OG1  . THR A 1 53 ? 0.323   -4.204  -0.701  1.00 0.00 ? 117 THR A OG1  4  
ATOM   3645  C CG2  . THR A 1 53 ? 0.491   -2.310  0.782   1.00 0.00 ? 117 THR A CG2  4  
ATOM   3646  H H    . THR A 1 53 ? 1.989   -3.360  3.095   1.00 0.00 ? 117 THR A H    4  
ATOM   3647  H HA   . THR A 1 53 ? 1.747   -5.526  1.144   1.00 0.00 ? 117 THR A HA   4  
ATOM   3648  H HB   . THR A 1 53 ? -0.380  -4.197  1.221   1.00 0.00 ? 117 THR A HB   4  
ATOM   3649  H HG1  . THR A 1 53 ? -0.498  -4.713  -0.720  1.00 0.00 ? 117 THR A HG1  4  
ATOM   3650  H HG21 . THR A 1 53 ? 1.343   -1.924  0.243   1.00 0.00 ? 117 THR A HG21 4  
ATOM   3651  H HG22 . THR A 1 53 ? -0.419  -1.903  0.367   1.00 0.00 ? 117 THR A HG22 4  
ATOM   3652  H HG23 . THR A 1 53 ? 0.573   -2.031  1.822   1.00 0.00 ? 117 THR A HG23 4  
ATOM   3653  N N    . PRO A 1 54 ? 3.636   -4.576  -0.306  1.00 0.00 ? 118 PRO A N    4  
ATOM   3654  C CA   . PRO A 1 54 ? 4.859   -4.124  -0.957  1.00 0.00 ? 118 PRO A CA   4  
ATOM   3655  C C    . PRO A 1 54 ? 4.697   -2.763  -1.631  1.00 0.00 ? 118 PRO A C    4  
ATOM   3656  O O    . PRO A 1 54 ? 3.626   -2.428  -2.138  1.00 0.00 ? 118 PRO A O    4  
ATOM   3657  C CB   . PRO A 1 54 ? 5.147   -5.208  -1.998  1.00 0.00 ? 118 PRO A CB   4  
ATOM   3658  C CG   . PRO A 1 54 ? 3.845   -5.866  -2.218  1.00 0.00 ? 118 PRO A CG   4  
ATOM   3659  C CD   . PRO A 1 54 ? 3.135   -5.817  -0.899  1.00 0.00 ? 118 PRO A CD   4  
ATOM   3660  H HA   . PRO A 1 54 ? 5.682   -4.071  -0.266  1.00 0.00 ? 118 PRO A HA   4  
ATOM   3661  H HB2  . PRO A 1 54 ? 5.520   -4.749  -2.901  1.00 0.00 ? 118 PRO A HB2  4  
ATOM   3662  H HB3  . PRO A 1 54 ? 5.877   -5.903  -1.609  1.00 0.00 ? 118 PRO A HB3  4  
ATOM   3663  H HG2  . PRO A 1 54 ? 3.286   -5.308  -2.957  1.00 0.00 ? 118 PRO A HG2  4  
ATOM   3664  H HG3  . PRO A 1 54 ? 3.975   -6.884  -2.548  1.00 0.00 ? 118 PRO A HG3  4  
ATOM   3665  H HD2  . PRO A 1 54 ? 2.068   -5.764  -1.055  1.00 0.00 ? 118 PRO A HD2  4  
ATOM   3666  H HD3  . PRO A 1 54 ? 3.377   -6.671  -0.290  1.00 0.00 ? 118 PRO A HD3  4  
ATOM   3667  N N    . LEU A 1 55 ? 5.772   -2.006  -1.645  1.00 0.00 ? 119 LEU A N    4  
ATOM   3668  C CA   . LEU A 1 55 ? 5.842   -0.668  -2.264  1.00 0.00 ? 119 LEU A CA   4  
ATOM   3669  C C    . LEU A 1 55 ? 5.440   -0.712  -3.742  1.00 0.00 ? 119 LEU A C    4  
ATOM   3670  O O    . LEU A 1 55 ? 5.029   0.293   -4.321  1.00 0.00 ? 119 LEU A O    4  
ATOM   3671  C CB   . LEU A 1 55 ? 7.254   -0.090  -2.116  1.00 0.00 ? 119 LEU A CB   4  
ATOM   3672  C CG   . LEU A 1 55 ? 7.803   -0.011  -0.682  1.00 0.00 ? 119 LEU A CG   4  
ATOM   3673  C CD1  . LEU A 1 55 ? 9.207   0.550   -0.666  1.00 0.00 ? 119 LEU A CD1  4  
ATOM   3674  C CD2  . LEU A 1 55 ? 6.895   0.800   0.229   1.00 0.00 ? 119 LEU A CD2  4  
ATOM   3675  H H    . LEU A 1 55 ? 6.569   -2.354  -1.183  1.00 0.00 ? 119 LEU A H    4  
ATOM   3676  H HA   . LEU A 1 55 ? 5.147   -0.021  -1.751  1.00 0.00 ? 119 LEU A HA   4  
ATOM   3677  H HB2  . LEU A 1 55 ? 7.920   -0.713  -2.695  1.00 0.00 ? 119 LEU A HB2  4  
ATOM   3678  H HB3  . LEU A 1 55 ? 7.266   0.902   -2.540  1.00 0.00 ? 119 LEU A HB3  4  
ATOM   3679  H HG   . LEU A 1 55 ? 7.847   -1.022  -0.303  1.00 0.00 ? 119 LEU A HG   4  
ATOM   3680  H HD11 . LEU A 1 55 ? 9.199   1.538   -1.102  1.00 0.00 ? 119 LEU A HD11 4  
ATOM   3681  H HD12 . LEU A 1 55 ? 9.561   0.608   0.352   1.00 0.00 ? 119 LEU A HD12 4  
ATOM   3682  H HD13 . LEU A 1 55 ? 9.859   -0.093  -1.237  1.00 0.00 ? 119 LEU A HD13 4  
ATOM   3683  H HD21 . LEU A 1 55 ? 5.914   0.351   0.255   1.00 0.00 ? 119 LEU A HD21 4  
ATOM   3684  H HD22 . LEU A 1 55 ? 7.310   0.806   1.227   1.00 0.00 ? 119 LEU A HD22 4  
ATOM   3685  H HD23 . LEU A 1 55 ? 6.820   1.816   -0.127  1.00 0.00 ? 119 LEU A HD23 4  
ATOM   3686  N N    . LEU A 1 56 ? 5.612   -1.873  -4.349  1.00 0.00 ? 120 LEU A N    4  
ATOM   3687  C CA   . LEU A 1 56 ? 5.238   -2.103  -5.738  1.00 0.00 ? 120 LEU A CA   4  
ATOM   3688  C C    . LEU A 1 56 ? 3.713   -2.025  -5.892  1.00 0.00 ? 120 LEU A C    4  
ATOM   3689  O O    . LEU A 1 56 ? 3.188   -1.542  -6.903  1.00 0.00 ? 120 LEU A O    4  
ATOM   3690  C CB   . LEU A 1 56 ? 5.791   -3.468  -6.204  1.00 0.00 ? 120 LEU A CB   4  
ATOM   3691  C CG   . LEU A 1 56 ? 5.056   -4.733  -5.755  1.00 0.00 ? 120 LEU A CG   4  
ATOM   3692  C CD1  . LEU A 1 56 ? 4.017   -5.113  -6.792  1.00 0.00 ? 120 LEU A CD1  4  
ATOM   3693  C CD2  . LEU A 1 56 ? 6.041   -5.865  -5.513  1.00 0.00 ? 120 LEU A CD2  4  
ATOM   3694  H H    . LEU A 1 56 ? 6.016   -2.597  -3.828  1.00 0.00 ? 120 LEU A H    4  
ATOM   3695  H HA   . LEU A 1 56 ? 5.671   -1.324  -6.339  1.00 0.00 ? 120 LEU A HA   4  
ATOM   3696  H HB2  . LEU A 1 56 ? 5.820   -3.474  -7.282  1.00 0.00 ? 120 LEU A HB2  4  
ATOM   3697  H HB3  . LEU A 1 56 ? 6.806   -3.540  -5.841  1.00 0.00 ? 120 LEU A HB3  4  
ATOM   3698  H HG   . LEU A 1 56 ? 4.507   -4.533  -4.842  1.00 0.00 ? 120 LEU A HG   4  
ATOM   3699  H HD11 . LEU A 1 56 ? 3.399   -4.238  -6.932  1.00 0.00 ? 120 LEU A HD11 4  
ATOM   3700  H HD12 . LEU A 1 56 ? 4.504   -5.361  -7.722  1.00 0.00 ? 120 LEU A HD12 4  
ATOM   3701  H HD13 . LEU A 1 56 ? 3.425   -5.945  -6.439  1.00 0.00 ? 120 LEU A HD13 4  
ATOM   3702  H HD21 . LEU A 1 56 ? 6.738   -5.575  -4.740  1.00 0.00 ? 120 LEU A HD21 4  
ATOM   3703  H HD22 . LEU A 1 56 ? 5.509   -6.750  -5.202  1.00 0.00 ? 120 LEU A HD22 4  
ATOM   3704  H HD23 . LEU A 1 56 ? 6.583   -6.071  -6.423  1.00 0.00 ? 120 LEU A HD23 4  
ATOM   3705  N N    . ASN A 1 57 ? 3.019   -2.448  -4.853  1.00 0.00 ? 121 ASN A N    4  
ATOM   3706  C CA   . ASN A 1 57 ? 1.579   -2.473  -4.845  1.00 0.00 ? 121 ASN A CA   4  
ATOM   3707  C C    . ASN A 1 57 ? 1.038   -1.092  -4.634  1.00 0.00 ? 121 ASN A C    4  
ATOM   3708  O O    . ASN A 1 57 ? -0.055  -0.768  -5.105  1.00 0.00 ? 121 ASN A O    4  
ATOM   3709  C CB   . ASN A 1 57 ? 1.022   -3.426  -3.774  1.00 0.00 ? 121 ASN A CB   4  
ATOM   3710  C CG   . ASN A 1 57 ? 0.975   -4.878  -4.177  1.00 0.00 ? 121 ASN A CG   4  
ATOM   3711  O OD1  . ASN A 1 57 ? 0.952   -5.210  -5.352  1.00 0.00 ? 121 ASN A OD1  4  
ATOM   3712  N ND2  . ASN A 1 57 ? 0.839   -5.737  -3.205  1.00 0.00 ? 121 ASN A ND2  4  
ATOM   3713  H H    . ASN A 1 57 ? 3.490   -2.717  -4.036  1.00 0.00 ? 121 ASN A H    4  
ATOM   3714  H HA   . ASN A 1 57 ? 1.255   -2.821  -5.815  1.00 0.00 ? 121 ASN A HA   4  
ATOM   3715  H HB2  . ASN A 1 57 ? 1.690   -3.373  -2.927  1.00 0.00 ? 121 ASN A HB2  4  
ATOM   3716  H HB3  . ASN A 1 57 ? 0.051   -3.140  -3.420  1.00 0.00 ? 121 ASN A HB3  4  
ATOM   3717  H HD21 . ASN A 1 57 ? 0.771   -5.380  -2.291  1.00 0.00 ? 121 ASN A HD21 4  
ATOM   3718  H HD22 . ASN A 1 57 ? 0.811   -6.695  -3.418  1.00 0.00 ? 121 ASN A HD22 4  
ATOM   3719  N N    . LEU A 1 58 ? 1.825   -0.261  -3.987  1.00 0.00 ? 122 LEU A N    4  
ATOM   3720  C CA   . LEU A 1 58 ? 1.411   1.080   -3.685  1.00 0.00 ? 122 LEU A CA   4  
ATOM   3721  C C    . LEU A 1 58 ? 1.530   1.961   -4.899  1.00 0.00 ? 122 LEU A C    4  
ATOM   3722  O O    . LEU A 1 58 ? 2.546   1.971   -5.575  1.00 0.00 ? 122 LEU A O    4  
ATOM   3723  C CB   . LEU A 1 58 ? 2.237   1.658   -2.547  1.00 0.00 ? 122 LEU A CB   4  
ATOM   3724  C CG   . LEU A 1 58 ? 2.145   0.935   -1.217  1.00 0.00 ? 122 LEU A CG   4  
ATOM   3725  C CD1  . LEU A 1 58 ? 2.995   1.640   -0.182  1.00 0.00 ? 122 LEU A CD1  4  
ATOM   3726  C CD2  . LEU A 1 58 ? 0.707   0.866   -0.763  1.00 0.00 ? 122 LEU A CD2  4  
ATOM   3727  H H    . LEU A 1 58 ? 2.721   -0.555  -3.726  1.00 0.00 ? 122 LEU A H    4  
ATOM   3728  H HA   . LEU A 1 58 ? 0.379   1.042   -3.375  1.00 0.00 ? 122 LEU A HA   4  
ATOM   3729  H HB2  . LEU A 1 58 ? 3.273   1.654   -2.855  1.00 0.00 ? 122 LEU A HB2  4  
ATOM   3730  H HB3  . LEU A 1 58 ? 1.931   2.682   -2.396  1.00 0.00 ? 122 LEU A HB3  4  
ATOM   3731  H HG   . LEU A 1 58 ? 2.516   -0.072  -1.331  1.00 0.00 ? 122 LEU A HG   4  
ATOM   3732  H HD11 . LEU A 1 58 ? 2.658   2.660   -0.071  1.00 0.00 ? 122 LEU A HD11 4  
ATOM   3733  H HD12 . LEU A 1 58 ? 2.900   1.125   0.762   1.00 0.00 ? 122 LEU A HD12 4  
ATOM   3734  H HD13 . LEU A 1 58 ? 4.029   1.634   -0.494  1.00 0.00 ? 122 LEU A HD13 4  
ATOM   3735  H HD21 . LEU A 1 58 ? 0.130   0.329   -1.501  1.00 0.00 ? 122 LEU A HD21 4  
ATOM   3736  H HD22 . LEU A 1 58 ? 0.643   0.354   0.186   1.00 0.00 ? 122 LEU A HD22 4  
ATOM   3737  H HD23 . LEU A 1 58 ? 0.311   1.866   -0.666  1.00 0.00 ? 122 LEU A HD23 4  
ATOM   3738  N N    . LYS A 1 59 ? 0.478   2.663   -5.177  1.00 0.00 ? 123 LYS A N    4  
ATOM   3739  C CA   . LYS A 1 59 ? 0.423   3.581   -6.287  1.00 0.00 ? 123 LYS A CA   4  
ATOM   3740  C C    . LYS A 1 59 ? 0.232   4.983   -5.751  1.00 0.00 ? 123 LYS A C    4  
ATOM   3741  O O    . LYS A 1 59 ? -0.257  5.144   -4.629  1.00 0.00 ? 123 LYS A O    4  
ATOM   3742  C CB   . LYS A 1 59 ? -0.731  3.224   -7.229  1.00 0.00 ? 123 LYS A CB   4  
ATOM   3743  C CG   . LYS A 1 59 ? -0.739  1.786   -7.676  1.00 0.00 ? 123 LYS A CG   4  
ATOM   3744  C CD   . LYS A 1 59 ? 0.461   1.444   -8.535  1.00 0.00 ? 123 LYS A CD   4  
ATOM   3745  C CE   . LYS A 1 59 ? 0.391   0.004   -8.987  1.00 0.00 ? 123 LYS A CE   4  
ATOM   3746  N NZ   . LYS A 1 59 ? 0.602   -0.957  -7.888  1.00 0.00 ? 123 LYS A NZ   4  
ATOM   3747  H H    . LYS A 1 59 ? -0.291  2.574   -4.569  1.00 0.00 ? 123 LYS A H    4  
ATOM   3748  H HA   . LYS A 1 59 ? 1.357   3.524   -6.825  1.00 0.00 ? 123 LYS A HA   4  
ATOM   3749  H HB2  . LYS A 1 59 ? -1.678  3.465   -6.779  1.00 0.00 ? 123 LYS A HB2  4  
ATOM   3750  H HB3  . LYS A 1 59 ? -0.635  3.834   -8.114  1.00 0.00 ? 123 LYS A HB3  4  
ATOM   3751  H HG2  . LYS A 1 59 ? -0.705  1.171   -6.791  1.00 0.00 ? 123 LYS A HG2  4  
ATOM   3752  H HG3  . LYS A 1 59 ? -1.645  1.600   -8.231  1.00 0.00 ? 123 LYS A HG3  4  
ATOM   3753  H HD2  . LYS A 1 59 ? 0.476   2.088   -9.402  1.00 0.00 ? 123 LYS A HD2  4  
ATOM   3754  H HD3  . LYS A 1 59 ? 1.363   1.589   -7.959  1.00 0.00 ? 123 LYS A HD3  4  
ATOM   3755  H HE2  . LYS A 1 59 ? -0.621  -0.143  -9.339  1.00 0.00 ? 123 LYS A HE2  4  
ATOM   3756  H HE3  . LYS A 1 59 ? 1.102   -0.170  -9.779  1.00 0.00 ? 123 LYS A HE3  4  
ATOM   3757  H HZ1  . LYS A 1 59 ? -0.045  -0.786  -7.092  1.00 0.00 ? 123 LYS A HZ1  4  
ATOM   3758  H HZ2  . LYS A 1 59 ? 0.402   -1.909  -8.257  1.00 0.00 ? 123 LYS A HZ2  4  
ATOM   3759  H HZ3  . LYS A 1 59 ? 1.592   -0.969  -7.559  1.00 0.00 ? 123 LYS A HZ3  4  
ATOM   3760  N N    . PRO A 1 60 ? 0.602   6.004   -6.511  1.00 0.00 ? 124 PRO A N    4  
ATOM   3761  C CA   . PRO A 1 60 ? 0.356   7.383   -6.124  1.00 0.00 ? 124 PRO A CA   4  
ATOM   3762  C C    . PRO A 1 60 ? -1.119  7.722   -6.274  1.00 0.00 ? 124 PRO A C    4  
ATOM   3763  O O    . PRO A 1 60 ? -1.817  7.143   -7.124  1.00 0.00 ? 124 PRO A O    4  
ATOM   3764  C CB   . PRO A 1 60 ? 1.216   8.210   -7.083  1.00 0.00 ? 124 PRO A CB   4  
ATOM   3765  C CG   . PRO A 1 60 ? 1.525   7.313   -8.243  1.00 0.00 ? 124 PRO A CG   4  
ATOM   3766  C CD   . PRO A 1 60 ? 1.285   5.890   -7.804  1.00 0.00 ? 124 PRO A CD   4  
ATOM   3767  H HA   . PRO A 1 60 ? 0.618   7.587   -5.099  1.00 0.00 ? 124 PRO A HA   4  
ATOM   3768  H HB2  . PRO A 1 60 ? 0.663   9.083   -7.395  1.00 0.00 ? 124 PRO A HB2  4  
ATOM   3769  H HB3  . PRO A 1 60 ? 2.119   8.521   -6.577  1.00 0.00 ? 124 PRO A HB3  4  
ATOM   3770  H HG2  . PRO A 1 60 ? 0.874   7.556   -9.070  1.00 0.00 ? 124 PRO A HG2  4  
ATOM   3771  H HG3  . PRO A 1 60 ? 2.556   7.445   -8.539  1.00 0.00 ? 124 PRO A HG3  4  
ATOM   3772  H HD2  . PRO A 1 60 ? 0.627   5.380   -8.491  1.00 0.00 ? 124 PRO A HD2  4  
ATOM   3773  H HD3  . PRO A 1 60 ? 2.192   5.315   -7.700  1.00 0.00 ? 124 PRO A HD3  4  
ATOM   3774  N N    . VAL A 1 61 ? -1.607  8.607   -5.445  1.00 0.00 ? 125 VAL A N    4  
ATOM   3775  C CA   . VAL A 1 61 ? -2.994  8.989   -5.512  1.00 0.00 ? 125 VAL A CA   4  
ATOM   3776  C C    . VAL A 1 61 ? -3.213  10.028  -6.591  1.00 0.00 ? 125 VAL A C    4  
ATOM   3777  O O    . VAL A 1 61 ? -2.284  10.776  -6.956  1.00 0.00 ? 125 VAL A O    4  
ATOM   3778  C CB   . VAL A 1 61 ? -3.560  9.508   -4.163  1.00 0.00 ? 125 VAL A CB   4  
ATOM   3779  C CG1  . VAL A 1 61 ? -3.561  8.410   -3.118  1.00 0.00 ? 125 VAL A CG1  4  
ATOM   3780  C CG2  . VAL A 1 61 ? -2.797  10.736  -3.670  1.00 0.00 ? 125 VAL A CG2  4  
ATOM   3781  H H    . VAL A 1 61 ? -1.018  9.034   -4.784  1.00 0.00 ? 125 VAL A H    4  
ATOM   3782  H HA   . VAL A 1 61 ? -3.521  8.084   -5.777  1.00 0.00 ? 125 VAL A HA   4  
ATOM   3783  H HB   . VAL A 1 61 ? -4.586  9.794   -4.341  1.00 0.00 ? 125 VAL A HB   4  
ATOM   3784  H HG11 . VAL A 1 61 ? -2.549  8.078   -2.938  1.00 0.00 ? 125 VAL A HG11 4  
ATOM   3785  H HG12 . VAL A 1 61 ? -3.988  8.791   -2.202  1.00 0.00 ? 125 VAL A HG12 4  
ATOM   3786  H HG13 . VAL A 1 61 ? -4.155  7.578   -3.470  1.00 0.00 ? 125 VAL A HG13 4  
ATOM   3787  H HG21 . VAL A 1 61 ? -2.856  11.502  -4.430  1.00 0.00 ? 125 VAL A HG21 4  
ATOM   3788  H HG22 . VAL A 1 61 ? -3.240  11.100  -2.754  1.00 0.00 ? 125 VAL A HG22 4  
ATOM   3789  H HG23 . VAL A 1 61 ? -1.764  10.476  -3.501  1.00 0.00 ? 125 VAL A HG23 4  
ATOM   3790  N N    . GLU A 1 62 ? -4.414  10.071  -7.100  1.00 0.00 ? 126 GLU A N    4  
ATOM   3791  C CA   . GLU A 1 62 ? -4.766  11.013  -8.125  1.00 0.00 ? 126 GLU A CA   4  
ATOM   3792  C C    . GLU A 1 62 ? -5.200  12.333  -7.493  1.00 0.00 ? 126 GLU A C    4  
ATOM   3793  O O    . GLU A 1 62 ? -5.372  12.419  -6.259  1.00 0.00 ? 126 GLU A O    4  
ATOM   3794  C CB   . GLU A 1 62 ? -5.866  10.441  -9.034  1.00 0.00 ? 126 GLU A CB   4  
ATOM   3795  C CG   . GLU A 1 62 ? -7.146  10.076  -8.298  1.00 0.00 ? 126 GLU A CG   4  
ATOM   3796  C CD   . GLU A 1 62 ? -8.194  9.478   -9.192  1.00 0.00 ? 126 GLU A CD   4  
ATOM   3797  O OE1  . GLU A 1 62 ? -9.007  10.241  -9.758  1.00 0.00 ? 126 GLU A OE1  4  
ATOM   3798  O OE2  . GLU A 1 62 ? -8.238  8.229   -9.331  1.00 0.00 ? 126 GLU A OE2  4  
ATOM   3799  H H    . GLU A 1 62 ? -5.094  9.450   -6.760  1.00 0.00 ? 126 GLU A H    4  
ATOM   3800  H HA   . GLU A 1 62 ? -3.878  11.188  -8.711  1.00 0.00 ? 126 GLU A HA   4  
ATOM   3801  H HB2  . GLU A 1 62 ? -6.110  11.172  -9.790  1.00 0.00 ? 126 GLU A HB2  4  
ATOM   3802  H HB3  . GLU A 1 62 ? -5.489  9.552   -9.517  1.00 0.00 ? 126 GLU A HB3  4  
ATOM   3803  H HG2  . GLU A 1 62 ? -6.912  9.358   -7.529  1.00 0.00 ? 126 GLU A HG2  4  
ATOM   3804  H HG3  . GLU A 1 62 ? -7.547  10.970  -7.842  1.00 0.00 ? 126 GLU A HG3  4  
ATOM   3805  N N    . GLU A 1 63 ? -5.360  13.343  -8.317  1.00 0.00 ? 127 GLU A N    4  
ATOM   3806  C CA   . GLU A 1 63 ? -5.764  14.648  -7.851  1.00 0.00 ? 127 GLU A CA   4  
ATOM   3807  C C    . GLU A 1 63 ? -7.215  14.636  -7.354  1.00 0.00 ? 127 GLU A C    4  
ATOM   3808  O O    . GLU A 1 63 ? -8.144  14.259  -8.091  1.00 0.00 ? 127 GLU A O    4  
ATOM   3809  C CB   . GLU A 1 63 ? -5.546  15.721  -8.938  1.00 0.00 ? 127 GLU A CB   4  
ATOM   3810  C CG   . GLU A 1 63 ? -6.304  15.475  -10.237 1.00 0.00 ? 127 GLU A CG   4  
ATOM   3811  C CD   . GLU A 1 63 ? -6.034  16.521  -11.281 1.00 0.00 ? 127 GLU A CD   4  
ATOM   3812  O OE1  . GLU A 1 63 ? -6.594  17.630  -11.191 1.00 0.00 ? 127 GLU A OE1  4  
ATOM   3813  O OE2  . GLU A 1 63 ? -5.277  16.242  -12.224 1.00 0.00 ? 127 GLU A OE2  4  
ATOM   3814  H H    . GLU A 1 63 ? -5.185  13.204  -9.272  1.00 0.00 ? 127 GLU A H    4  
ATOM   3815  H HA   . GLU A 1 63 ? -5.124  14.871  -7.013  1.00 0.00 ? 127 GLU A HA   4  
ATOM   3816  H HB2  . GLU A 1 63 ? -5.862  16.677  -8.549  1.00 0.00 ? 127 GLU A HB2  4  
ATOM   3817  H HB3  . GLU A 1 63 ? -4.491  15.773  -9.166  1.00 0.00 ? 127 GLU A HB3  4  
ATOM   3818  H HG2  . GLU A 1 63 ? -6.014  14.515  -10.635 1.00 0.00 ? 127 GLU A HG2  4  
ATOM   3819  H HG3  . GLU A 1 63 ? -7.362  15.464  -10.021 1.00 0.00 ? 127 GLU A HG3  4  
ATOM   3820  N N    . GLY A 1 64 ? -7.403  15.004  -6.121  1.00 0.00 ? 128 GLY A N    4  
ATOM   3821  C CA   . GLY A 1 64 ? -8.717  15.064  -5.563  1.00 0.00 ? 128 GLY A CA   4  
ATOM   3822  C C    . GLY A 1 64 ? -8.643  15.221  -4.084  1.00 0.00 ? 128 GLY A C    4  
ATOM   3823  O O    . GLY A 1 64 ? -7.676  14.709  -3.484  1.00 0.00 ? 128 GLY A O    4  
ATOM   3824  O OXT  . GLY A 1 64 ? -9.515  15.885  -3.500  1.00 0.00 ? 128 GLY A OXT  4  
ATOM   3825  H H    . GLY A 1 64 ? -6.646  15.228  -5.536  1.00 0.00 ? 128 GLY A H    4  
ATOM   3826  H HA2  . GLY A 1 64 ? -9.246  15.905  -5.987  1.00 0.00 ? 128 GLY A HA2  4  
ATOM   3827  H HA3  . GLY A 1 64 ? -9.246  14.152  -5.793  1.00 0.00 ? 128 GLY A HA3  4  
HETATM 3828  N N    . 2MR B 2 .  ? -16.809 -4.895  -1.131  1.00 0.00 ? 201 2MR A N    4  
HETATM 3829  C CA   . 2MR B 2 .  ? -16.879 -3.859  -0.113  1.00 0.00 ? 201 2MR A CA   4  
HETATM 3830  C CB   . 2MR B 2 .  ? -15.547 -3.760  0.657   1.00 0.00 ? 201 2MR A CB   4  
HETATM 3831  C CG   . 2MR B 2 .  ? -15.569 -2.763  1.795   1.00 0.00 ? 201 2MR A CG   4  
HETATM 3832  C CD   . 2MR B 2 .  ? -14.238 -2.680  2.502   1.00 0.00 ? 201 2MR A CD   4  
HETATM 3833  N NE   . 2MR B 2 .  ? -13.207 -2.261  1.591   1.00 0.00 ? 201 2MR A NE   4  
HETATM 3834  C CZ   . 2MR B 2 .  ? -11.974 -2.020  1.906   1.00 0.00 ? 201 2MR A CZ   4  
HETATM 3835  N NH1  . 2MR B 2 .  ? -11.586 -2.164  3.224   1.00 0.00 ? 201 2MR A NH1  4  
HETATM 3836  C CQ1  . 2MR B 2 .  ? -10.281 -1.964  3.884   1.00 0.00 ? 201 2MR A CQ1  4  
HETATM 3837  N NH2  . 2MR B 2 .  ? -11.140 -1.656  0.900   1.00 0.00 ? 201 2MR A NH2  4  
HETATM 3838  C CQ2  . 2MR B 2 .  ? -9.724  -1.318  0.902   1.00 0.00 ? 201 2MR A CQ2  4  
HETATM 3839  C C    . 2MR B 2 .  ? -17.187 -2.560  -0.804  1.00 0.00 ? 201 2MR A C    4  
HETATM 3840  O O    . 2MR B 2 .  ? -18.216 -1.937  -0.512  1.00 0.00 ? 201 2MR A O    4  
HETATM 3841  O OXT  . 2MR B 2 .  ? -16.430 -2.175  -1.704  1.00 0.00 ? 201 2MR A OXT  4  
HETATM 3842  H H2   . 2MR B 2 .  ? -16.067 -4.649  -1.817  1.00 0.00 ? 201 2MR A H2   4  
HETATM 3843  H H    . 2MR B 2 .  ? -16.613 -5.828  -0.721  1.00 0.00 ? 201 2MR A H    4  
HETATM 3844  H H3   . 2MR B 2 .  ? -17.708 -4.930  -1.650  1.00 0.00 ? 201 2MR A H3   4  
HETATM 3845  H HA   . 2MR B 2 .  ? -17.685 -4.081  0.570   1.00 0.00 ? 201 2MR A HA   4  
HETATM 3846  H HB2  . 2MR B 2 .  ? -14.779 -3.434  -0.030  1.00 0.00 ? 201 2MR A HB2  4  
HETATM 3847  H HB3  . 2MR B 2 .  ? -15.268 -4.720  1.063   1.00 0.00 ? 201 2MR A HB3  4  
HETATM 3848  H HG2  . 2MR B 2 .  ? -16.332 -3.059  2.494   1.00 0.00 ? 201 2MR A HG2  4  
HETATM 3849  H HG3  . 2MR B 2 .  ? -15.754 -1.796  1.353   1.00 0.00 ? 201 2MR A HG3  4  
HETATM 3850  H HD2  . 2MR B 2 .  ? -13.969 -3.636  2.923   1.00 0.00 ? 201 2MR A HD2  4  
HETATM 3851  H HD3  . 2MR B 2 .  ? -14.287 -1.932  3.284   1.00 0.00 ? 201 2MR A HD3  4  
HETATM 3852  H HE   . 2MR B 2 .  ? -13.488 -2.149  0.657   1.00 0.00 ? 201 2MR A HE   4  
HETATM 3853  H HQ11 . 2MR B 2 .  ? -9.990  -0.929  3.790   1.00 0.00 ? 201 2MR A HQ11 4  
HETATM 3854  H HQ12 . 2MR B 2 .  ? -10.371 -2.218  4.930   1.00 0.00 ? 201 2MR A HQ12 4  
HETATM 3855  H HQ13 . 2MR B 2 .  ? -9.537  -2.593  3.417   1.00 0.00 ? 201 2MR A HQ13 4  
HETATM 3856  H HH2  . 2MR B 2 .  ? -11.490 -1.602  -0.035  1.00 0.00 ? 201 2MR A HH2  4  
HETATM 3857  H HQ21 . 2MR B 2 .  ? -9.446  -0.945  -0.073  1.00 0.00 ? 201 2MR A HQ21 4  
HETATM 3858  H HQ22 . 2MR B 2 .  ? -9.534  -0.555  1.643   1.00 0.00 ? 201 2MR A HQ22 4  
HETATM 3859  H HQ23 . 2MR B 2 .  ? -9.140  -2.198  1.127   1.00 0.00 ? 201 2MR A HQ23 4  
HETATM 3860  H HH1  . 2MR B 2 .  ? -12.260 -2.468  3.904   1.00 0.00 ? 201 2MR A HH1  4  
ATOM   3861  N N    . ALA A 1 1  ? 14.895  -7.708  0.396   1.00 0.00 ? 65  ALA A N    5  
ATOM   3862  C CA   . ALA A 1 1  ? 14.158  -7.762  -0.858  1.00 0.00 ? 65  ALA A CA   5  
ATOM   3863  C C    . ALA A 1 1  ? 15.120  -8.120  -1.976  1.00 0.00 ? 65  ALA A C    5  
ATOM   3864  O O    . ALA A 1 1  ? 16.324  -7.912  -1.844  1.00 0.00 ? 65  ALA A O    5  
ATOM   3865  C CB   . ALA A 1 1  ? 13.481  -6.423  -1.136  1.00 0.00 ? 65  ALA A CB   5  
ATOM   3866  H H1   . ALA A 1 1  ? 15.705  -7.061  0.300   1.00 0.00 ? 65  ALA A H1   5  
ATOM   3867  H H2   . ALA A 1 1  ? 14.311  -7.414  1.208   1.00 0.00 ? 65  ALA A H2   5  
ATOM   3868  H H3   . ALA A 1 1  ? 15.291  -8.645  0.596   1.00 0.00 ? 65  ALA A H3   5  
ATOM   3869  H HA   . ALA A 1 1  ? 13.399  -8.526  -0.777  1.00 0.00 ? 65  ALA A HA   5  
ATOM   3870  H HB1  . ALA A 1 1  ? 14.226  -5.647  -1.214  1.00 0.00 ? 65  ALA A HB1  5  
ATOM   3871  H HB2  . ALA A 1 1  ? 12.926  -6.478  -2.060  1.00 0.00 ? 65  ALA A HB2  5  
ATOM   3872  H HB3  . ALA A 1 1  ? 12.803  -6.188  -0.329  1.00 0.00 ? 65  ALA A HB3  5  
ATOM   3873  N N    . SER A 1 2  ? 14.614  -8.673  -3.053  1.00 0.00 ? 66  SER A N    5  
ATOM   3874  C CA   . SER A 1 2  ? 15.448  -9.025  -4.179  1.00 0.00 ? 66  SER A CA   5  
ATOM   3875  C C    . SER A 1 2  ? 15.649  -7.810  -5.063  1.00 0.00 ? 66  SER A C    5  
ATOM   3876  O O    . SER A 1 2  ? 16.675  -7.657  -5.730  1.00 0.00 ? 66  SER A O    5  
ATOM   3877  C CB   . SER A 1 2  ? 14.783  -10.137 -4.976  1.00 0.00 ? 66  SER A CB   5  
ATOM   3878  O OG   . SER A 1 2  ? 14.470  -11.242 -4.131  1.00 0.00 ? 66  SER A OG   5  
ATOM   3879  H H    . SER A 1 2  ? 13.652  -8.869  -3.097  1.00 0.00 ? 66  SER A H    5  
ATOM   3880  H HA   . SER A 1 2  ? 16.402  -9.373  -3.813  1.00 0.00 ? 66  SER A HA   5  
ATOM   3881  H HB2  . SER A 1 2  ? 13.883  -9.745  -5.427  1.00 0.00 ? 66  SER A HB2  5  
ATOM   3882  H HB3  . SER A 1 2  ? 15.456  -10.460 -5.757  1.00 0.00 ? 66  SER A HB3  5  
ATOM   3883  H HG   . SER A 1 2  ? 15.126  -11.253 -3.421  1.00 0.00 ? 66  SER A HG   5  
ATOM   3884  N N    . THR A 1 3  ? 14.668  -6.955  -5.075  1.00 0.00 ? 67  THR A N    5  
ATOM   3885  C CA   . THR A 1 3  ? 14.694  -5.781  -5.878  1.00 0.00 ? 67  THR A CA   5  
ATOM   3886  C C    . THR A 1 3  ? 13.912  -4.685  -5.155  1.00 0.00 ? 67  THR A C    5  
ATOM   3887  O O    . THR A 1 3  ? 12.738  -4.877  -4.837  1.00 0.00 ? 67  THR A O    5  
ATOM   3888  C CB   . THR A 1 3  ? 14.015  -6.076  -7.249  1.00 0.00 ? 67  THR A CB   5  
ATOM   3889  O OG1  . THR A 1 3  ? 14.571  -7.276  -7.830  1.00 0.00 ? 67  THR A OG1  5  
ATOM   3890  C CG2  . THR A 1 3  ? 14.230  -4.932  -8.215  1.00 0.00 ? 67  THR A CG2  5  
ATOM   3891  H H    . THR A 1 3  ? 13.874  -7.110  -4.516  1.00 0.00 ? 67  THR A H    5  
ATOM   3892  H HA   . THR A 1 3  ? 15.714  -5.476  -6.048  1.00 0.00 ? 67  THR A HA   5  
ATOM   3893  H HB   . THR A 1 3  ? 12.956  -6.215  -7.090  1.00 0.00 ? 67  THR A HB   5  
ATOM   3894  H HG1  . THR A 1 3  ? 15.496  -7.323  -7.556  1.00 0.00 ? 67  THR A HG1  5  
ATOM   3895  H HG21 . THR A 1 3  ? 15.292  -4.794  -8.355  1.00 0.00 ? 67  THR A HG21 5  
ATOM   3896  H HG22 . THR A 1 3  ? 13.767  -5.178  -9.159  1.00 0.00 ? 67  THR A HG22 5  
ATOM   3897  H HG23 . THR A 1 3  ? 13.793  -4.032  -7.808  1.00 0.00 ? 67  THR A HG23 5  
ATOM   3898  N N    . GLN A 1 4  ? 14.560  -3.580  -4.847  1.00 0.00 ? 68  GLN A N    5  
ATOM   3899  C CA   . GLN A 1 4  ? 13.862  -2.467  -4.238  1.00 0.00 ? 68  GLN A CA   5  
ATOM   3900  C C    . GLN A 1 4  ? 13.101  -1.720  -5.328  1.00 0.00 ? 68  GLN A C    5  
ATOM   3901  O O    . GLN A 1 4  ? 13.664  -1.442  -6.394  1.00 0.00 ? 68  GLN A O    5  
ATOM   3902  C CB   . GLN A 1 4  ? 14.812  -1.499  -3.499  1.00 0.00 ? 68  GLN A CB   5  
ATOM   3903  C CG   . GLN A 1 4  ? 15.639  -2.143  -2.395  1.00 0.00 ? 68  GLN A CG   5  
ATOM   3904  C CD   . GLN A 1 4  ? 16.386  -1.139  -1.516  1.00 0.00 ? 68  GLN A CD   5  
ATOM   3905  O OE1  . GLN A 1 4  ? 16.640  -1.406  -0.339  1.00 0.00 ? 68  GLN A OE1  5  
ATOM   3906  N NE2  . GLN A 1 4  ? 16.727  0.009   -2.049  1.00 0.00 ? 68  GLN A NE2  5  
ATOM   3907  H H    . GLN A 1 4  ? 15.516  -3.499  -5.052  1.00 0.00 ? 68  GLN A H    5  
ATOM   3908  H HA   . GLN A 1 4  ? 13.149  -2.883  -3.540  1.00 0.00 ? 68  GLN A HA   5  
ATOM   3909  H HB2  . GLN A 1 4  ? 15.494  -1.068  -4.216  1.00 0.00 ? 68  GLN A HB2  5  
ATOM   3910  H HB3  . GLN A 1 4  ? 14.223  -0.705  -3.063  1.00 0.00 ? 68  GLN A HB3  5  
ATOM   3911  H HG2  . GLN A 1 4  ? 14.985  -2.727  -1.764  1.00 0.00 ? 68  GLN A HG2  5  
ATOM   3912  H HG3  . GLN A 1 4  ? 16.363  -2.796  -2.856  1.00 0.00 ? 68  GLN A HG3  5  
ATOM   3913  H HE21 . GLN A 1 4  ? 16.505  0.201   -2.984  1.00 0.00 ? 68  GLN A HE21 5  
ATOM   3914  H HE22 . GLN A 1 4  ? 17.183  0.667   -1.482  1.00 0.00 ? 68  GLN A HE22 5  
ATOM   3915  N N    . PRO A 1 5  ? 11.820  -1.434  -5.106  1.00 0.00 ? 69  PRO A N    5  
ATOM   3916  C CA   . PRO A 1 5  ? 10.994  -0.713  -6.074  1.00 0.00 ? 69  PRO A CA   5  
ATOM   3917  C C    . PRO A 1 5  ? 11.401  0.759   -6.173  1.00 0.00 ? 69  PRO A C    5  
ATOM   3918  O O    . PRO A 1 5  ? 11.980  1.313   -5.236  1.00 0.00 ? 69  PRO A O    5  
ATOM   3919  C CB   . PRO A 1 5  ? 9.576   -0.847  -5.510  1.00 0.00 ? 69  PRO A CB   5  
ATOM   3920  C CG   . PRO A 1 5  ? 9.755   -1.098  -4.056  1.00 0.00 ? 69  PRO A CG   5  
ATOM   3921  C CD   . PRO A 1 5  ? 11.071  -1.794  -3.890  1.00 0.00 ? 69  PRO A CD   5  
ATOM   3922  H HA   . PRO A 1 5  ? 11.051  -1.161  -7.056  1.00 0.00 ? 69  PRO A HA   5  
ATOM   3923  H HB2  . PRO A 1 5  ? 9.030   0.067   -5.687  1.00 0.00 ? 69  PRO A HB2  5  
ATOM   3924  H HB3  . PRO A 1 5  ? 9.070   -1.672  -5.990  1.00 0.00 ? 69  PRO A HB3  5  
ATOM   3925  H HG2  . PRO A 1 5  ? 9.766   -0.159  -3.522  1.00 0.00 ? 69  PRO A HG2  5  
ATOM   3926  H HG3  . PRO A 1 5  ? 8.954   -1.728  -3.700  1.00 0.00 ? 69  PRO A HG3  5  
ATOM   3927  H HD2  . PRO A 1 5  ? 11.576  -1.430  -3.008  1.00 0.00 ? 69  PRO A HD2  5  
ATOM   3928  H HD3  . PRO A 1 5  ? 10.925  -2.862  -3.831  1.00 0.00 ? 69  PRO A HD3  5  
ATOM   3929  N N    . THR A 1 6  ? 11.115  1.387   -7.296  1.00 0.00 ? 70  THR A N    5  
ATOM   3930  C CA   . THR A 1 6  ? 11.490  2.779   -7.502  1.00 0.00 ? 70  THR A CA   5  
ATOM   3931  C C    . THR A 1 6  ? 10.496  3.722   -6.829  1.00 0.00 ? 70  THR A C    5  
ATOM   3932  O O    . THR A 1 6  ? 10.743  4.929   -6.719  1.00 0.00 ? 70  THR A O    5  
ATOM   3933  C CB   . THR A 1 6  ? 11.660  3.140   -9.019  1.00 0.00 ? 70  THR A CB   5  
ATOM   3934  O OG1  . THR A 1 6  ? 12.019  4.530   -9.178  1.00 0.00 ? 70  THR A OG1  5  
ATOM   3935  C CG2  . THR A 1 6  ? 10.389  2.853   -9.807  1.00 0.00 ? 70  THR A CG2  5  
ATOM   3936  H H    . THR A 1 6  ? 10.642  0.902   -8.008  1.00 0.00 ? 70  THR A H    5  
ATOM   3937  H HA   . THR A 1 6  ? 12.442  2.914   -7.010  1.00 0.00 ? 70  THR A HA   5  
ATOM   3938  H HB   . THR A 1 6  ? 12.463  2.535   -9.414  1.00 0.00 ? 70  THR A HB   5  
ATOM   3939  H HG1  . THR A 1 6  ? 11.737  4.995   -8.377  1.00 0.00 ? 70  THR A HG1  5  
ATOM   3940  H HG21 . THR A 1 6  ? 9.566   3.405   -9.378  1.00 0.00 ? 70  THR A HG21 5  
ATOM   3941  H HG22 . THR A 1 6  ? 10.524  3.151   -10.836 1.00 0.00 ? 70  THR A HG22 5  
ATOM   3942  H HG23 . THR A 1 6  ? 10.174  1.796   -9.760  1.00 0.00 ? 70  THR A HG23 5  
ATOM   3943  N N    . HIS A 1 7  ? 9.380   3.171   -6.391  1.00 0.00 ? 71  HIS A N    5  
ATOM   3944  C CA   . HIS A 1 7  ? 8.390   3.940   -5.679  1.00 0.00 ? 71  HIS A CA   5  
ATOM   3945  C C    . HIS A 1 7  ? 8.953   4.415   -4.356  1.00 0.00 ? 71  HIS A C    5  
ATOM   3946  O O    . HIS A 1 7  ? 9.397   3.610   -3.524  1.00 0.00 ? 71  HIS A O    5  
ATOM   3947  C CB   . HIS A 1 7  ? 7.106   3.141   -5.448  1.00 0.00 ? 71  HIS A CB   5  
ATOM   3948  C CG   . HIS A 1 7  ? 6.228   2.984   -6.654  1.00 0.00 ? 71  HIS A CG   5  
ATOM   3949  N ND1  . HIS A 1 7  ? 5.266   3.902   -7.015  1.00 0.00 ? 71  HIS A ND1  5  
ATOM   3950  C CD2  . HIS A 1 7  ? 6.153   1.985   -7.565  1.00 0.00 ? 71  HIS A CD2  5  
ATOM   3951  C CE1  . HIS A 1 7  ? 4.643   3.451   -8.098  1.00 0.00 ? 71  HIS A CE1  5  
ATOM   3952  N NE2  . HIS A 1 7  ? 5.146   2.282   -8.485  1.00 0.00 ? 71  HIS A NE2  5  
ATOM   3953  H H    . HIS A 1 7  ? 9.238   2.216   -6.546  1.00 0.00 ? 71  HIS A H    5  
ATOM   3954  H HA   . HIS A 1 7  ? 8.160   4.802   -6.286  1.00 0.00 ? 71  HIS A HA   5  
ATOM   3955  H HB2  . HIS A 1 7  ? 7.368   2.151   -5.108  1.00 0.00 ? 71  HIS A HB2  5  
ATOM   3956  H HB3  . HIS A 1 7  ? 6.528   3.630   -4.678  1.00 0.00 ? 71  HIS A HB3  5  
ATOM   3957  H HD1  . HIS A 1 7  ? 5.083   4.756   -6.560  1.00 0.00 ? 71  HIS A HD1  5  
ATOM   3958  H HD2  . HIS A 1 7  ? 6.767   1.097   -7.582  1.00 0.00 ? 71  HIS A HD2  5  
ATOM   3959  H HE1  . HIS A 1 7  ? 3.836   3.965   -8.597  1.00 0.00 ? 71  HIS A HE1  5  
ATOM   3960  N N    . SER A 1 8  ? 8.969   5.699   -4.179  1.00 0.00 ? 72  SER A N    5  
ATOM   3961  C CA   . SER A 1 8  ? 9.486   6.288   -2.986  1.00 0.00 ? 72  SER A CA   5  
ATOM   3962  C C    . SER A 1 8  ? 8.328   6.704   -2.104  1.00 0.00 ? 72  SER A C    5  
ATOM   3963  O O    . SER A 1 8  ? 7.583   7.630   -2.432  1.00 0.00 ? 72  SER A O    5  
ATOM   3964  C CB   . SER A 1 8  ? 10.352  7.478   -3.358  1.00 0.00 ? 72  SER A CB   5  
ATOM   3965  O OG   . SER A 1 8  ? 11.311  7.089   -4.337  1.00 0.00 ? 72  SER A OG   5  
ATOM   3966  H H    . SER A 1 8  ? 8.596   6.288   -4.871  1.00 0.00 ? 72  SER A H    5  
ATOM   3967  H HA   . SER A 1 8  ? 10.084  5.556   -2.469  1.00 0.00 ? 72  SER A HA   5  
ATOM   3968  H HB2  . SER A 1 8  ? 9.734   8.267   -3.761  1.00 0.00 ? 72  SER A HB2  5  
ATOM   3969  H HB3  . SER A 1 8  ? 10.876  7.837   -2.484  1.00 0.00 ? 72  SER A HB3  5  
ATOM   3970  H HG   . SER A 1 8  ? 10.968  6.312   -4.796  1.00 0.00 ? 72  SER A HG   5  
ATOM   3971  N N    . TRP A 1 9  ? 8.149   5.999   -1.021  1.00 0.00 ? 73  TRP A N    5  
ATOM   3972  C CA   . TRP A 1 9  ? 7.054   6.251   -0.135  1.00 0.00 ? 73  TRP A CA   5  
ATOM   3973  C C    . TRP A 1 9  ? 7.555   6.634   1.224   1.00 0.00 ? 73  TRP A C    5  
ATOM   3974  O O    . TRP A 1 9  ? 8.659   6.229   1.622   1.00 0.00 ? 73  TRP A O    5  
ATOM   3975  C CB   . TRP A 1 9  ? 6.169   5.025   -0.034  1.00 0.00 ? 73  TRP A CB   5  
ATOM   3976  C CG   . TRP A 1 9  ? 5.480   4.671   -1.312  1.00 0.00 ? 73  TRP A CG   5  
ATOM   3977  C CD1  . TRP A 1 9  ? 5.764   3.627   -2.130  1.00 0.00 ? 73  TRP A CD1  5  
ATOM   3978  C CD2  . TRP A 1 9  ? 4.402   5.380   -1.926  1.00 0.00 ? 73  TRP A CD2  5  
ATOM   3979  N NE1  . TRP A 1 9  ? 4.908   3.619   -3.198  1.00 0.00 ? 73  TRP A NE1  5  
ATOM   3980  C CE2  . TRP A 1 9  ? 4.070   4.691   -3.102  1.00 0.00 ? 73  TRP A CE2  5  
ATOM   3981  C CE3  . TRP A 1 9  ? 3.680   6.526   -1.590  1.00 0.00 ? 73  TRP A CE3  5  
ATOM   3982  C CZ2  . TRP A 1 9  ? 3.054   5.105   -3.943  1.00 0.00 ? 73  TRP A CZ2  5  
ATOM   3983  C CZ3  . TRP A 1 9  ? 2.671   6.937   -2.428  1.00 0.00 ? 73  TRP A CZ3  5  
ATOM   3984  C CH2  . TRP A 1 9  ? 2.367   6.225   -3.595  1.00 0.00 ? 73  TRP A CH2  5  
ATOM   3985  H H    . TRP A 1 9  ? 8.773   5.281   -0.777  1.00 0.00 ? 73  TRP A H    5  
ATOM   3986  H HA   . TRP A 1 9  ? 6.469   7.063   -0.540  1.00 0.00 ? 73  TRP A HA   5  
ATOM   3987  H HB2  . TRP A 1 9  ? 6.777   4.184   0.261   1.00 0.00 ? 73  TRP A HB2  5  
ATOM   3988  H HB3  . TRP A 1 9  ? 5.420   5.197   0.724   1.00 0.00 ? 73  TRP A HB3  5  
ATOM   3989  H HD1  . TRP A 1 9  ? 6.547   2.909   -1.933  1.00 0.00 ? 73  TRP A HD1  5  
ATOM   3990  H HE1  . TRP A 1 9  ? 4.891   2.959   -3.927  1.00 0.00 ? 73  TRP A HE1  5  
ATOM   3991  H HE3  . TRP A 1 9  ? 3.902   7.086   -0.693  1.00 0.00 ? 73  TRP A HE3  5  
ATOM   3992  H HZ2  . TRP A 1 9  ? 2.805   4.568   -4.847  1.00 0.00 ? 73  TRP A HZ2  5  
ATOM   3993  H HZ3  . TRP A 1 9  ? 2.105   7.824   -2.179  1.00 0.00 ? 73  TRP A HZ3  5  
ATOM   3994  H HH2  . TRP A 1 9  ? 1.570   6.567   -4.237  1.00 0.00 ? 73  TRP A HH2  5  
ATOM   3995  N N    . LYS A 1 10 ? 6.779   7.416   1.921   1.00 0.00 ? 74  LYS A N    5  
ATOM   3996  C CA   . LYS A 1 10 ? 7.109   7.835   3.253   1.00 0.00 ? 74  LYS A CA   5  
ATOM   3997  C C    . LYS A 1 10 ? 5.897   7.644   4.153   1.00 0.00 ? 74  LYS A C    5  
ATOM   3998  O O    . LYS A 1 10 ? 4.777   7.494   3.665   1.00 0.00 ? 74  LYS A O    5  
ATOM   3999  C CB   . LYS A 1 10 ? 7.529   9.302   3.282   1.00 0.00 ? 74  LYS A CB   5  
ATOM   4000  C CG   . LYS A 1 10 ? 6.445   10.259  2.811   1.00 0.00 ? 74  LYS A CG   5  
ATOM   4001  C CD   . LYS A 1 10 ? 6.787   11.698  3.127   1.00 0.00 ? 74  LYS A CD   5  
ATOM   4002  C CE   . LYS A 1 10 ? 6.885   11.926  4.631   1.00 0.00 ? 74  LYS A CE   5  
ATOM   4003  N NZ   . LYS A 1 10 ? 6.988   13.356  4.980   1.00 0.00 ? 74  LYS A NZ   5  
ATOM   4004  H H    . LYS A 1 10 ? 5.924   7.722   1.550   1.00 0.00 ? 74  LYS A H    5  
ATOM   4005  H HA   . LYS A 1 10 ? 7.925   7.226   3.606   1.00 0.00 ? 74  LYS A HA   5  
ATOM   4006  H HB2  . LYS A 1 10 ? 7.800   9.554   4.297   1.00 0.00 ? 74  LYS A HB2  5  
ATOM   4007  H HB3  . LYS A 1 10 ? 8.393   9.426   2.646   1.00 0.00 ? 74  LYS A HB3  5  
ATOM   4008  H HG2  . LYS A 1 10 ? 6.323   10.155  1.744   1.00 0.00 ? 74  LYS A HG2  5  
ATOM   4009  H HG3  . LYS A 1 10 ? 5.519   10.001  3.305   1.00 0.00 ? 74  LYS A HG3  5  
ATOM   4010  H HD2  . LYS A 1 10 ? 7.746   11.916  2.680   1.00 0.00 ? 74  LYS A HD2  5  
ATOM   4011  H HD3  . LYS A 1 10 ? 6.029   12.346  2.715   1.00 0.00 ? 74  LYS A HD3  5  
ATOM   4012  H HE2  . LYS A 1 10 ? 6.012   11.502  5.107   1.00 0.00 ? 74  LYS A HE2  5  
ATOM   4013  H HE3  . LYS A 1 10 ? 7.757   11.413  5.008   1.00 0.00 ? 74  LYS A HE3  5  
ATOM   4014  H HZ1  . LYS A 1 10 ? 7.774   13.823  4.485   1.00 0.00 ? 74  LYS A HZ1  5  
ATOM   4015  H HZ2  . LYS A 1 10 ? 6.108   13.851  4.727   1.00 0.00 ? 74  LYS A HZ2  5  
ATOM   4016  H HZ3  . LYS A 1 10 ? 7.127   13.458  6.006   1.00 0.00 ? 74  LYS A HZ3  5  
ATOM   4017  N N    . VAL A 1 11 ? 6.127   7.605   5.441   1.00 0.00 ? 75  VAL A N    5  
ATOM   4018  C CA   . VAL A 1 11 ? 5.060   7.525   6.418   1.00 0.00 ? 75  VAL A CA   5  
ATOM   4019  C C    . VAL A 1 11 ? 4.208   8.797   6.343   1.00 0.00 ? 75  VAL A C    5  
ATOM   4020  O O    . VAL A 1 11 ? 4.748   9.912   6.261   1.00 0.00 ? 75  VAL A O    5  
ATOM   4021  C CB   . VAL A 1 11 ? 5.630   7.346   7.846   1.00 0.00 ? 75  VAL A CB   5  
ATOM   4022  C CG1  . VAL A 1 11 ? 4.521   7.313   8.886   1.00 0.00 ? 75  VAL A CG1  5  
ATOM   4023  C CG2  . VAL A 1 11 ? 6.454   6.074   7.931   1.00 0.00 ? 75  VAL A CG2  5  
ATOM   4024  H H    . VAL A 1 11 ? 7.055   7.650   5.757   1.00 0.00 ? 75  VAL A H    5  
ATOM   4025  H HA   . VAL A 1 11 ? 4.449   6.668   6.170   1.00 0.00 ? 75  VAL A HA   5  
ATOM   4026  H HB   . VAL A 1 11 ? 6.282   8.186   8.038   1.00 0.00 ? 75  VAL A HB   5  
ATOM   4027  H HG11 . VAL A 1 11 ? 3.857   6.486   8.680   1.00 0.00 ? 75  VAL A HG11 5  
ATOM   4028  H HG12 . VAL A 1 11 ? 4.954   7.193   9.868   1.00 0.00 ? 75  VAL A HG12 5  
ATOM   4029  H HG13 . VAL A 1 11 ? 3.965   8.238   8.846   1.00 0.00 ? 75  VAL A HG13 5  
ATOM   4030  H HG21 . VAL A 1 11 ? 7.277   6.124   7.234   1.00 0.00 ? 75  VAL A HG21 5  
ATOM   4031  H HG22 . VAL A 1 11 ? 6.837   5.962   8.934   1.00 0.00 ? 75  VAL A HG22 5  
ATOM   4032  H HG23 . VAL A 1 11 ? 5.830   5.227   7.688   1.00 0.00 ? 75  VAL A HG23 5  
ATOM   4033  N N    . GLY A 1 12 ? 2.907   8.634   6.347   1.00 0.00 ? 76  GLY A N    5  
ATOM   4034  C CA   . GLY A 1 12 ? 2.022   9.767   6.260   1.00 0.00 ? 76  GLY A CA   5  
ATOM   4035  C C    . GLY A 1 12 ? 1.767   10.182  4.832   1.00 0.00 ? 76  GLY A C    5  
ATOM   4036  O O    . GLY A 1 12 ? 1.348   11.313  4.569   1.00 0.00 ? 76  GLY A O    5  
ATOM   4037  H H    . GLY A 1 12 ? 2.526   7.732   6.447   1.00 0.00 ? 76  GLY A H    5  
ATOM   4038  H HA2  . GLY A 1 12 ? 1.078   9.512   6.717   1.00 0.00 ? 76  GLY A HA2  5  
ATOM   4039  H HA3  . GLY A 1 12 ? 2.461   10.598  6.792   1.00 0.00 ? 76  GLY A HA3  5  
ATOM   4040  N N    . ASP A 1 13 ? 2.046   9.298   3.902   1.00 0.00 ? 77  ASP A N    5  
ATOM   4041  C CA   . ASP A 1 13 ? 1.793   9.588   2.496   1.00 0.00 ? 77  ASP A CA   5  
ATOM   4042  C C    . ASP A 1 13 ? 0.513   8.940   2.135   1.00 0.00 ? 77  ASP A C    5  
ATOM   4043  O O    . ASP A 1 13 ? 0.109   7.952   2.776   1.00 0.00 ? 77  ASP A O    5  
ATOM   4044  C CB   . ASP A 1 13 ? 2.846   8.968   1.608   1.00 0.00 ? 77  ASP A CB   5  
ATOM   4045  C CG   . ASP A 1 13 ? 3.103   9.750   0.321   1.00 0.00 ? 77  ASP A CG   5  
ATOM   4046  O OD1  . ASP A 1 13 ? 2.144   10.236  -0.316  1.00 0.00 ? 77  ASP A OD1  5  
ATOM   4047  O OD2  . ASP A 1 13 ? 4.287   9.919   -0.049  1.00 0.00 ? 77  ASP A OD2  5  
ATOM   4048  H H    . ASP A 1 13 ? 2.427   8.433   4.156   1.00 0.00 ? 77  ASP A H    5  
ATOM   4049  H HA   . ASP A 1 13 ? 1.755   10.655  2.333   1.00 0.00 ? 77  ASP A HA   5  
ATOM   4050  H HB2  . ASP A 1 13 ? 3.738   8.833   2.184   1.00 0.00 ? 77  ASP A HB2  5  
ATOM   4051  H HB3  . ASP A 1 13 ? 2.492   7.985   1.335   1.00 0.00 ? 77  ASP A HB3  5  
ATOM   4052  N N    . LYS A 1 14 ? -0.107  9.420   1.121   1.00 0.00 ? 78  LYS A N    5  
ATOM   4053  C CA   . LYS A 1 14 ? -1.298  8.817   0.678   1.00 0.00 ? 78  LYS A CA   5  
ATOM   4054  C C    . LYS A 1 14 ? -0.970  7.997   -0.525  1.00 0.00 ? 78  LYS A C    5  
ATOM   4055  O O    . LYS A 1 14 ? -0.372  8.481   -1.483  1.00 0.00 ? 78  LYS A O    5  
ATOM   4056  C CB   . LYS A 1 14 ? -2.374  9.855   0.350   1.00 0.00 ? 78  LYS A CB   5  
ATOM   4057  C CG   . LYS A 1 14 ? -2.917  10.616  1.548   1.00 0.00 ? 78  LYS A CG   5  
ATOM   4058  C CD   . LYS A 1 14 ? -3.733  9.714   2.466   1.00 0.00 ? 78  LYS A CD   5  
ATOM   4059  C CE   . LYS A 1 14 ? -4.311  10.484  3.647   1.00 0.00 ? 78  LYS A CE   5  
ATOM   4060  N NZ   . LYS A 1 14 ? -5.237  11.559  3.228   1.00 0.00 ? 78  LYS A NZ   5  
ATOM   4061  H H    . LYS A 1 14 ? 0.316   10.144  0.607   1.00 0.00 ? 78  LYS A H    5  
ATOM   4062  H HA   . LYS A 1 14 ? -1.638  8.174   1.474   1.00 0.00 ? 78  LYS A HA   5  
ATOM   4063  H HB2  . LYS A 1 14 ? -1.964  10.570  -0.346  1.00 0.00 ? 78  LYS A HB2  5  
ATOM   4064  H HB3  . LYS A 1 14 ? -3.199  9.344   -0.125  1.00 0.00 ? 78  LYS A HB3  5  
ATOM   4065  H HG2  . LYS A 1 14 ? -2.073  10.998  2.103   1.00 0.00 ? 78  LYS A HG2  5  
ATOM   4066  H HG3  . LYS A 1 14 ? -3.531  11.436  1.207   1.00 0.00 ? 78  LYS A HG3  5  
ATOM   4067  H HD2  . LYS A 1 14 ? -4.548  9.287   1.899   1.00 0.00 ? 78  LYS A HD2  5  
ATOM   4068  H HD3  . LYS A 1 14 ? -3.098  8.923   2.836   1.00 0.00 ? 78  LYS A HD3  5  
ATOM   4069  H HE2  . LYS A 1 14 ? -4.845  9.789   4.277   1.00 0.00 ? 78  LYS A HE2  5  
ATOM   4070  H HE3  . LYS A 1 14 ? -3.500  10.914  4.213   1.00 0.00 ? 78  LYS A HE3  5  
ATOM   4071  H HZ1  . LYS A 1 14 ? -6.067  11.173  2.732   1.00 0.00 ? 78  LYS A HZ1  5  
ATOM   4072  H HZ2  . LYS A 1 14 ? -5.583  12.095  4.050   1.00 0.00 ? 78  LYS A HZ2  5  
ATOM   4073  H HZ3  . LYS A 1 14 ? -4.781  12.230  2.577   1.00 0.00 ? 78  LYS A HZ3  5  
ATOM   4074  N N    . CYS A 1 15 ? -1.378  6.801   -0.492  1.00 0.00 ? 79  CYS A N    5  
ATOM   4075  C CA   . CYS A 1 15 ? -1.129  5.892   -1.554  1.00 0.00 ? 79  CYS A CA   5  
ATOM   4076  C C    . CYS A 1 15 ? -2.355  5.078   -1.812  1.00 0.00 ? 79  CYS A C    5  
ATOM   4077  O O    . CYS A 1 15 ? -3.371  5.239   -1.144  1.00 0.00 ? 79  CYS A O    5  
ATOM   4078  C CB   . CYS A 1 15 ? 0.026   4.970   -1.171  1.00 0.00 ? 79  CYS A CB   5  
ATOM   4079  S SG   . CYS A 1 15 ? -0.232  4.032   0.367   1.00 0.00 ? 79  CYS A SG   5  
ATOM   4080  H H    . CYS A 1 15 ? -1.860  6.487   0.306   1.00 0.00 ? 79  CYS A H    5  
ATOM   4081  H HA   . CYS A 1 15 ? -0.849  6.442   -2.438  1.00 0.00 ? 79  CYS A HA   5  
ATOM   4082  H HB2  . CYS A 1 15 ? 0.175   4.261   -1.973  1.00 0.00 ? 79  CYS A HB2  5  
ATOM   4083  H HB3  . CYS A 1 15 ? 0.917   5.569   -1.062  1.00 0.00 ? 79  CYS A HB3  5  
ATOM   4084  H HG   . CYS A 1 15 ? -1.298  4.483   1.018   1.00 0.00 ? 79  CYS A HG   5  
ATOM   4085  N N    . MET A 1 16 ? -2.288  4.253   -2.785  1.00 0.00 ? 80  MET A N    5  
ATOM   4086  C CA   . MET A 1 16 ? -3.322  3.321   -3.035  1.00 0.00 ? 80  MET A CA   5  
ATOM   4087  C C    . MET A 1 16 ? -2.710  1.964   -2.932  1.00 0.00 ? 80  MET A C    5  
ATOM   4088  O O    . MET A 1 16 ? -1.684  1.712   -3.534  1.00 0.00 ? 80  MET A O    5  
ATOM   4089  C CB   . MET A 1 16 ? -3.977  3.519   -4.404  1.00 0.00 ? 80  MET A CB   5  
ATOM   4090  C CG   . MET A 1 16 ? -4.456  4.937   -4.660  1.00 0.00 ? 80  MET A CG   5  
ATOM   4091  S SD   . MET A 1 16 ? -5.528  5.074   -6.097  1.00 0.00 ? 80  MET A SD   5  
ATOM   4092  C CE   . MET A 1 16 ? -6.995  4.253   -5.469  1.00 0.00 ? 80  MET A CE   5  
ATOM   4093  H H    . MET A 1 16 ? -1.495  4.273   -3.368  1.00 0.00 ? 80  MET A H    5  
ATOM   4094  H HA   . MET A 1 16 ? -4.061  3.428   -2.255  1.00 0.00 ? 80  MET A HA   5  
ATOM   4095  H HB2  . MET A 1 16 ? -3.265  3.253   -5.170  1.00 0.00 ? 80  MET A HB2  5  
ATOM   4096  H HB3  . MET A 1 16 ? -4.825  2.854   -4.474  1.00 0.00 ? 80  MET A HB3  5  
ATOM   4097  H HG2  . MET A 1 16 ? -4.999  5.284   -3.793  1.00 0.00 ? 80  MET A HG2  5  
ATOM   4098  H HG3  . MET A 1 16 ? -3.588  5.561   -4.811  1.00 0.00 ? 80  MET A HG3  5  
ATOM   4099  H HE1  . MET A 1 16 ? -7.316  4.755   -4.568  1.00 0.00 ? 80  MET A HE1  5  
ATOM   4100  H HE2  . MET A 1 16 ? -7.781  4.302   -6.207  1.00 0.00 ? 80  MET A HE2  5  
ATOM   4101  H HE3  . MET A 1 16 ? -6.770  3.219   -5.250  1.00 0.00 ? 80  MET A HE3  5  
ATOM   4102  N N    . ALA A 1 17 ? -3.315  1.120   -2.186  1.00 0.00 ? 81  ALA A N    5  
ATOM   4103  C CA   . ALA A 1 17 ? -2.785  -0.182  -1.931  1.00 0.00 ? 81  ALA A CA   5  
ATOM   4104  C C    . ALA A 1 17 ? -3.726  -1.193  -2.462  1.00 0.00 ? 81  ALA A C    5  
ATOM   4105  O O    . ALA A 1 17 ? -4.922  -0.935  -2.554  1.00 0.00 ? 81  ALA A O    5  
ATOM   4106  C CB   . ALA A 1 17 ? -2.629  -0.378  -0.443  1.00 0.00 ? 81  ALA A CB   5  
ATOM   4107  H H    . ALA A 1 17 ? -4.183  1.373   -1.796  1.00 0.00 ? 81  ALA A H    5  
ATOM   4108  H HA   . ALA A 1 17 ? -1.817  -0.288  -2.394  1.00 0.00 ? 81  ALA A HA   5  
ATOM   4109  H HB1  . ALA A 1 17 ? -3.584  -0.208  0.034   1.00 0.00 ? 81  ALA A HB1  5  
ATOM   4110  H HB2  . ALA A 1 17 ? -2.300  -1.386  -0.242  1.00 0.00 ? 81  ALA A HB2  5  
ATOM   4111  H HB3  . ALA A 1 17 ? -1.906  0.325   -0.056  1.00 0.00 ? 81  ALA A HB3  5  
ATOM   4112  N N    . VAL A 1 18 ? -3.210  -2.326  -2.816  1.00 0.00 ? 82  VAL A N    5  
ATOM   4113  C CA   . VAL A 1 18 ? -4.029  -3.380  -3.324  1.00 0.00 ? 82  VAL A CA   5  
ATOM   4114  C C    . VAL A 1 18 ? -4.530  -4.166  -2.144  1.00 0.00 ? 82  VAL A C    5  
ATOM   4115  O O    . VAL A 1 18 ? -3.747  -4.782  -1.430  1.00 0.00 ? 82  VAL A O    5  
ATOM   4116  C CB   . VAL A 1 18 ? -3.224  -4.306  -4.277  1.00 0.00 ? 82  VAL A CB   5  
ATOM   4117  C CG1  . VAL A 1 18 ? -4.100  -5.420  -4.836  1.00 0.00 ? 82  VAL A CG1  5  
ATOM   4118  C CG2  . VAL A 1 18 ? -2.604  -3.498  -5.410  1.00 0.00 ? 82  VAL A CG2  5  
ATOM   4119  H H    . VAL A 1 18 ? -2.245  -2.466  -2.724  1.00 0.00 ? 82  VAL A H    5  
ATOM   4120  H HA   . VAL A 1 18 ? -4.869  -2.958  -3.853  1.00 0.00 ? 82  VAL A HA   5  
ATOM   4121  H HB   . VAL A 1 18 ? -2.424  -4.754  -3.706  1.00 0.00 ? 82  VAL A HB   5  
ATOM   4122  H HG11 . VAL A 1 18 ? -4.918  -4.990  -5.396  1.00 0.00 ? 82  VAL A HG11 5  
ATOM   4123  H HG12 . VAL A 1 18 ? -3.511  -6.051  -5.486  1.00 0.00 ? 82  VAL A HG12 5  
ATOM   4124  H HG13 . VAL A 1 18 ? -4.494  -6.009  -4.021  1.00 0.00 ? 82  VAL A HG13 5  
ATOM   4125  H HG21 . VAL A 1 18 ? -1.963  -2.735  -4.997  1.00 0.00 ? 82  VAL A HG21 5  
ATOM   4126  H HG22 . VAL A 1 18 ? -2.019  -4.155  -6.035  1.00 0.00 ? 82  VAL A HG22 5  
ATOM   4127  H HG23 . VAL A 1 18 ? -3.383  -3.037  -6.000  1.00 0.00 ? 82  VAL A HG23 5  
ATOM   4128  N N    . TRP A 1 19 ? -5.823  -4.102  -1.929  1.00 0.00 ? 83  TRP A N    5  
ATOM   4129  C CA   . TRP A 1 19 ? -6.457  -4.756  -0.827  1.00 0.00 ? 83  TRP A CA   5  
ATOM   4130  C C    . TRP A 1 19 ? -6.372  -6.233  -1.039  1.00 0.00 ? 83  TRP A C    5  
ATOM   4131  O O    . TRP A 1 19 ? -6.947  -6.759  -1.998  1.00 0.00 ? 83  TRP A O    5  
ATOM   4132  C CB   . TRP A 1 19 ? -7.921  -4.319  -0.717  1.00 0.00 ? 83  TRP A CB   5  
ATOM   4133  C CG   . TRP A 1 19 ? -8.582  -4.702  0.580   1.00 0.00 ? 83  TRP A CG   5  
ATOM   4134  C CD1  . TRP A 1 19 ? -7.981  -4.818  1.788   1.00 0.00 ? 83  TRP A CD1  5  
ATOM   4135  C CD2  . TRP A 1 19 ? -9.969  -4.965  0.809   1.00 0.00 ? 83  TRP A CD2  5  
ATOM   4136  N NE1  . TRP A 1 19 ? -8.883  -5.156  2.743   1.00 0.00 ? 83  TRP A NE1  5  
ATOM   4137  C CE2  . TRP A 1 19 ? -10.113 -5.246  2.179   1.00 0.00 ? 83  TRP A CE2  5  
ATOM   4138  C CE3  . TRP A 1 19 ? -11.102 -4.996  0.005   1.00 0.00 ? 83  TRP A CE3  5  
ATOM   4139  C CZ2  . TRP A 1 19 ? -11.334 -5.552  2.751   1.00 0.00 ? 83  TRP A CZ2  5  
ATOM   4140  C CZ3  . TRP A 1 19 ? -12.313 -5.301  0.589   1.00 0.00 ? 83  TRP A CZ3  5  
ATOM   4141  C CH2  . TRP A 1 19 ? -12.406 -5.574  1.951   1.00 0.00 ? 83  TRP A CH2  5  
ATOM   4142  H H    . TRP A 1 19 ? -6.375  -3.592  -2.561  1.00 0.00 ? 83  TRP A H    5  
ATOM   4143  H HA   . TRP A 1 19 ? -5.939  -4.488  0.080   1.00 0.00 ? 83  TRP A HA   5  
ATOM   4144  H HB2  . TRP A 1 19 ? -7.974  -3.248  -0.823  1.00 0.00 ? 83  TRP A HB2  5  
ATOM   4145  H HB3  . TRP A 1 19 ? -8.478  -4.772  -1.524  1.00 0.00 ? 83  TRP A HB3  5  
ATOM   4146  H HD1  . TRP A 1 19 ? -6.927  -4.679  1.945   1.00 0.00 ? 83  TRP A HD1  5  
ATOM   4147  H HE1  . TRP A 1 19 ? -8.669  -5.302  3.690   1.00 0.00 ? 83  TRP A HE1  5  
ATOM   4148  H HE3  . TRP A 1 19 ? -11.044 -4.782  -1.052  1.00 0.00 ? 83  TRP A HE3  5  
ATOM   4149  H HZ2  . TRP A 1 19 ? -11.468 -5.770  3.797   1.00 0.00 ? 83  TRP A HZ2  5  
ATOM   4150  H HZ3  . TRP A 1 19 ? -13.216 -5.335  0.000   1.00 0.00 ? 83  TRP A HZ3  5  
ATOM   4151  H HH2  . TRP A 1 19 ? -13.360 -5.804  2.393   1.00 0.00 ? 83  TRP A HH2  5  
ATOM   4152  N N    . SER A 1 20 ? -5.682  -6.887  -0.147  1.00 0.00 ? 84  SER A N    5  
ATOM   4153  C CA   . SER A 1 20 ? -5.414  -8.312  -0.206  1.00 0.00 ? 84  SER A CA   5  
ATOM   4154  C C    . SER A 1 20 ? -6.708  -9.138  -0.224  1.00 0.00 ? 84  SER A C    5  
ATOM   4155  O O    . SER A 1 20 ? -6.694  -10.310 -0.613  1.00 0.00 ? 84  SER A O    5  
ATOM   4156  C CB   . SER A 1 20 ? -4.522  -8.715  0.986   1.00 0.00 ? 84  SER A CB   5  
ATOM   4157  O OG   . SER A 1 20 ? -4.132  -10.089 0.943   1.00 0.00 ? 84  SER A OG   5  
ATOM   4158  H H    . SER A 1 20 ? -5.305  -6.357  0.597   1.00 0.00 ? 84  SER A H    5  
ATOM   4159  H HA   . SER A 1 20 ? -4.869  -8.510  -1.116  1.00 0.00 ? 84  SER A HA   5  
ATOM   4160  H HB2  . SER A 1 20 ? -3.632  -8.103  0.994   1.00 0.00 ? 84  SER A HB2  5  
ATOM   4161  H HB3  . SER A 1 20 ? -5.075  -8.543  1.898   1.00 0.00 ? 84  SER A HB3  5  
ATOM   4162  H HG   . SER A 1 20 ? -4.825  -10.595 0.503   1.00 0.00 ? 84  SER A HG   5  
ATOM   4163  N N    . GLU A 1 21 ? -7.808  -8.529  0.171   1.00 0.00 ? 85  GLU A N    5  
ATOM   4164  C CA   . GLU A 1 21 ? -9.082  -9.204  0.207   1.00 0.00 ? 85  GLU A CA   5  
ATOM   4165  C C    . GLU A 1 21 ? -9.781  -9.178  -1.151  1.00 0.00 ? 85  GLU A C    5  
ATOM   4166  O O    . GLU A 1 21 ? -10.326 -10.194 -1.604  1.00 0.00 ? 85  GLU A O    5  
ATOM   4167  C CB   . GLU A 1 21 ? -9.977  -8.542  1.226   1.00 0.00 ? 85  GLU A CB   5  
ATOM   4168  C CG   . GLU A 1 21 ? -9.426  -8.539  2.633   1.00 0.00 ? 85  GLU A CG   5  
ATOM   4169  C CD   . GLU A 1 21 ? -9.284  -9.925  3.201   1.00 0.00 ? 85  GLU A CD   5  
ATOM   4170  O OE1  . GLU A 1 21 ? -10.310 -10.531 3.560   1.00 0.00 ? 85  GLU A OE1  5  
ATOM   4171  O OE2  . GLU A 1 21 ? -8.159  -10.443 3.298   1.00 0.00 ? 85  GLU A OE2  5  
ATOM   4172  H H    . GLU A 1 21 ? -7.741  -7.589  0.450   1.00 0.00 ? 85  GLU A H    5  
ATOM   4173  H HA   . GLU A 1 21 ? -8.929  -10.229 0.510   1.00 0.00 ? 85  GLU A HA   5  
ATOM   4174  H HB2  . GLU A 1 21 ? -10.130 -7.516  0.927   1.00 0.00 ? 85  GLU A HB2  5  
ATOM   4175  H HB3  . GLU A 1 21 ? -10.931 -9.044  1.234   1.00 0.00 ? 85  GLU A HB3  5  
ATOM   4176  H HG2  . GLU A 1 21 ? -8.483  -8.020  2.616   1.00 0.00 ? 85  GLU A HG2  5  
ATOM   4177  H HG3  . GLU A 1 21 ? -10.083 -7.946  3.251   1.00 0.00 ? 85  GLU A HG3  5  
ATOM   4178  N N    . ASP A 1 22 ? -9.745  -8.043  -1.817  1.00 0.00 ? 86  ASP A N    5  
ATOM   4179  C CA   . ASP A 1 22 ? -10.543 -7.892  -3.039  1.00 0.00 ? 86  ASP A CA   5  
ATOM   4180  C C    . ASP A 1 22 ? -9.666  -7.927  -4.284  1.00 0.00 ? 86  ASP A C    5  
ATOM   4181  O O    . ASP A 1 22 ? -10.130 -8.245  -5.372  1.00 0.00 ? 86  ASP A O    5  
ATOM   4182  C CB   . ASP A 1 22 ? -11.300 -6.565  -2.967  1.00 0.00 ? 86  ASP A CB   5  
ATOM   4183  C CG   . ASP A 1 22 ? -12.407 -6.423  -3.981  1.00 0.00 ? 86  ASP A CG   5  
ATOM   4184  O OD1  . ASP A 1 22 ? -12.158 -5.984  -5.099  1.00 0.00 ? 86  ASP A OD1  5  
ATOM   4185  O OD2  . ASP A 1 22 ? -13.585 -6.708  -3.630  1.00 0.00 ? 86  ASP A OD2  5  
ATOM   4186  H H    . ASP A 1 22 ? -9.185  -7.307  -1.493  1.00 0.00 ? 86  ASP A H    5  
ATOM   4187  H HA   . ASP A 1 22 ? -11.263 -8.695  -3.081  1.00 0.00 ? 86  ASP A HA   5  
ATOM   4188  H HB2  . ASP A 1 22 ? -11.747 -6.484  -1.988  1.00 0.00 ? 86  ASP A HB2  5  
ATOM   4189  H HB3  . ASP A 1 22 ? -10.599 -5.755  -3.106  1.00 0.00 ? 86  ASP A HB3  5  
ATOM   4190  N N    . GLY A 1 23 ? -8.386  -7.672  -4.103  1.00 0.00 ? 87  GLY A N    5  
ATOM   4191  C CA   . GLY A 1 23 ? -7.458  -7.669  -5.212  1.00 0.00 ? 87  GLY A CA   5  
ATOM   4192  C C    . GLY A 1 23 ? -7.474  -6.365  -5.990  1.00 0.00 ? 87  GLY A C    5  
ATOM   4193  O O    . GLY A 1 23 ? -6.934  -6.290  -7.087  1.00 0.00 ? 87  GLY A O    5  
ATOM   4194  H H    . GLY A 1 23 ? -8.031  -7.492  -3.203  1.00 0.00 ? 87  GLY A H    5  
ATOM   4195  H HA2  . GLY A 1 23 ? -6.460  -7.834  -4.835  1.00 0.00 ? 87  GLY A HA2  5  
ATOM   4196  H HA3  . GLY A 1 23 ? -7.716  -8.476  -5.882  1.00 0.00 ? 87  GLY A HA3  5  
ATOM   4197  N N    . GLN A 1 24 ? -8.101  -5.345  -5.439  1.00 0.00 ? 88  GLN A N    5  
ATOM   4198  C CA   . GLN A 1 24 ? -8.174  -4.039  -6.095  1.00 0.00 ? 88  GLN A CA   5  
ATOM   4199  C C    . GLN A 1 24 ? -7.425  -3.005  -5.294  1.00 0.00 ? 88  GLN A C    5  
ATOM   4200  O O    . GLN A 1 24 ? -7.098  -3.243  -4.138  1.00 0.00 ? 88  GLN A O    5  
ATOM   4201  C CB   . GLN A 1 24 ? -9.616  -3.599  -6.323  1.00 0.00 ? 88  GLN A CB   5  
ATOM   4202  C CG   . GLN A 1 24 ? -10.371 -4.431  -7.339  1.00 0.00 ? 88  GLN A CG   5  
ATOM   4203  C CD   . GLN A 1 24 ? -9.787  -4.358  -8.738  1.00 0.00 ? 88  GLN A CD   5  
ATOM   4204  O OE1  . GLN A 1 24 ? -10.167 -3.510  -9.540  1.00 0.00 ? 88  GLN A OE1  5  
ATOM   4205  N NE2  . GLN A 1 24 ? -8.873  -5.241  -9.048  1.00 0.00 ? 88  GLN A NE2  5  
ATOM   4206  H H    . GLN A 1 24 ? -8.494  -5.452  -4.547  1.00 0.00 ? 88  GLN A H    5  
ATOM   4207  H HA   . GLN A 1 24 ? -7.679  -4.138  -7.049  1.00 0.00 ? 88  GLN A HA   5  
ATOM   4208  H HB2  . GLN A 1 24 ? -10.150 -3.663  -5.388  1.00 0.00 ? 88  GLN A HB2  5  
ATOM   4209  H HB3  . GLN A 1 24 ? -9.616  -2.572  -6.651  1.00 0.00 ? 88  GLN A HB3  5  
ATOM   4210  H HG2  . GLN A 1 24 ? -10.359 -5.458  -7.013  1.00 0.00 ? 88  GLN A HG2  5  
ATOM   4211  H HG3  . GLN A 1 24 ? -11.382 -4.056  -7.367  1.00 0.00 ? 88  GLN A HG3  5  
ATOM   4212  H HE21 . GLN A 1 24 ? -8.599  -5.906  -8.380  1.00 0.00 ? 88  GLN A HE21 5  
ATOM   4213  H HE22 . GLN A 1 24 ? -8.481  -5.220  -9.948  1.00 0.00 ? 88  GLN A HE22 5  
ATOM   4214  N N    . CYS A 1 25 ? -7.191  -1.864  -5.876  1.00 0.00 ? 89  CYS A N    5  
ATOM   4215  C CA   . CYS A 1 25 ? -6.429  -0.827  -5.201  1.00 0.00 ? 89  CYS A CA   5  
ATOM   4216  C C    . CYS A 1 25 ? -7.327  0.246   -4.596  1.00 0.00 ? 89  CYS A C    5  
ATOM   4217  O O    . CYS A 1 25 ? -8.274  0.725   -5.228  1.00 0.00 ? 89  CYS A O    5  
ATOM   4218  C CB   . CYS A 1 25 ? -5.345  -0.229  -6.114  1.00 0.00 ? 89  CYS A CB   5  
ATOM   4219  S SG   . CYS A 1 25 ? -5.937  0.397   -7.697  1.00 0.00 ? 89  CYS A SG   5  
ATOM   4220  H H    . CYS A 1 25 ? -7.576  -1.709  -6.767  1.00 0.00 ? 89  CYS A H    5  
ATOM   4221  H HA   . CYS A 1 25 ? -5.940  -1.312  -4.369  1.00 0.00 ? 89  CYS A HA   5  
ATOM   4222  H HB2  . CYS A 1 25 ? -4.888  0.600   -5.597  1.00 0.00 ? 89  CYS A HB2  5  
ATOM   4223  H HB3  . CYS A 1 25 ? -4.593  -0.979  -6.311  1.00 0.00 ? 89  CYS A HB3  5  
ATOM   4224  H HG   . CYS A 1 25 ? -5.118  1.363   -8.090  1.00 0.00 ? 89  CYS A HG   5  
ATOM   4225  N N    . TYR A 1 26 ? -7.033  0.599   -3.363  1.00 0.00 ? 90  TYR A N    5  
ATOM   4226  C CA   . TYR A 1 26 ? -7.809  1.556   -2.592  1.00 0.00 ? 90  TYR A CA   5  
ATOM   4227  C C    . TYR A 1 26 ? -6.883  2.532   -1.899  1.00 0.00 ? 90  TYR A C    5  
ATOM   4228  O O    . TYR A 1 26 ? -5.730  2.214   -1.660  1.00 0.00 ? 90  TYR A O    5  
ATOM   4229  C CB   . TYR A 1 26 ? -8.653  0.830   -1.550  1.00 0.00 ? 90  TYR A CB   5  
ATOM   4230  C CG   . TYR A 1 26 ? -9.714  -0.086  -2.125  1.00 0.00 ? 90  TYR A CG   5  
ATOM   4231  C CD1  . TYR A 1 26 ? -9.385  -1.356  -2.572  1.00 0.00 ? 90  TYR A CD1  5  
ATOM   4232  C CD2  . TYR A 1 26 ? -11.038 0.315   -2.208  1.00 0.00 ? 90  TYR A CD2  5  
ATOM   4233  C CE1  . TYR A 1 26 ? -10.329 -2.194  -3.090  1.00 0.00 ? 90  TYR A CE1  5  
ATOM   4234  C CE2  . TYR A 1 26 ? -11.999 -0.524  -2.724  1.00 0.00 ? 90  TYR A CE2  5  
ATOM   4235  C CZ   . TYR A 1 26 ? -11.636 -1.778  -3.166  1.00 0.00 ? 90  TYR A CZ   5  
ATOM   4236  O OH   . TYR A 1 26 ? -12.578 -2.615  -3.689  1.00 0.00 ? 90  TYR A OH   5  
ATOM   4237  H H    . TYR A 1 26 ? -6.248  0.189   -2.933  1.00 0.00 ? 90  TYR A H    5  
ATOM   4238  H HA   . TYR A 1 26 ? -8.461  2.090   -3.265  1.00 0.00 ? 90  TYR A HA   5  
ATOM   4239  H HB2  . TYR A 1 26 ? -7.988  0.215   -0.962  1.00 0.00 ? 90  TYR A HB2  5  
ATOM   4240  H HB3  . TYR A 1 26 ? -9.124  1.544   -0.894  1.00 0.00 ? 90  TYR A HB3  5  
ATOM   4241  H HD1  . TYR A 1 26 ? -8.356  -1.681  -2.515  1.00 0.00 ? 90  TYR A HD1  5  
ATOM   4242  H HD2  . TYR A 1 26 ? -11.315 1.298   -1.859  1.00 0.00 ? 90  TYR A HD2  5  
ATOM   4243  H HE1  . TYR A 1 26 ? -10.029 -3.175  -3.427  1.00 0.00 ? 90  TYR A HE1  5  
ATOM   4244  H HE2  . TYR A 1 26 ? -13.026 -0.194  -2.774  1.00 0.00 ? 90  TYR A HE2  5  
ATOM   4245  H HH   . TYR A 1 26 ? -13.149 -2.123  -4.293  1.00 0.00 ? 90  TYR A HH   5  
ATOM   4246  N N    . GLU A 1 27 ? -7.401  3.686   -1.560  1.00 0.00 ? 91  GLU A N    5  
ATOM   4247  C CA   . GLU A 1 27 ? -6.626  4.754   -0.953  1.00 0.00 ? 91  GLU A CA   5  
ATOM   4248  C C    . GLU A 1 27 ? -6.300  4.422   0.509   1.00 0.00 ? 91  GLU A C    5  
ATOM   4249  O O    . GLU A 1 27 ? -7.180  4.093   1.307   1.00 0.00 ? 91  GLU A O    5  
ATOM   4250  C CB   . GLU A 1 27 ? -7.403  6.066   -1.071  1.00 0.00 ? 91  GLU A CB   5  
ATOM   4251  C CG   . GLU A 1 27 ? -6.668  7.300   -0.586  1.00 0.00 ? 91  GLU A CG   5  
ATOM   4252  C CD   . GLU A 1 27 ? -7.465  8.553   -0.825  1.00 0.00 ? 91  GLU A CD   5  
ATOM   4253  O OE1  . GLU A 1 27 ? -7.460  9.071   -1.967  1.00 0.00 ? 91  GLU A OE1  5  
ATOM   4254  O OE2  . GLU A 1 27 ? -8.128  9.043   0.115   1.00 0.00 ? 91  GLU A OE2  5  
ATOM   4255  H H    . GLU A 1 27 ? -8.358  3.837   -1.707  1.00 0.00 ? 91  GLU A H    5  
ATOM   4256  H HA   . GLU A 1 27 ? -5.700  4.845   -1.502  1.00 0.00 ? 91  GLU A HA   5  
ATOM   4257  H HB2  . GLU A 1 27 ? -7.656  6.226   -2.107  1.00 0.00 ? 91  GLU A HB2  5  
ATOM   4258  H HB3  . GLU A 1 27 ? -8.317  5.975   -0.503  1.00 0.00 ? 91  GLU A HB3  5  
ATOM   4259  H HG2  . GLU A 1 27 ? -6.478  7.203   0.473   1.00 0.00 ? 91  GLU A HG2  5  
ATOM   4260  H HG3  . GLU A 1 27 ? -5.729  7.379   -1.114  1.00 0.00 ? 91  GLU A HG3  5  
ATOM   4261  N N    . ALA A 1 28 ? -5.035  4.480   0.830   1.00 0.00 ? 92  ALA A N    5  
ATOM   4262  C CA   . ALA A 1 28 ? -4.530  4.137   2.135   1.00 0.00 ? 92  ALA A CA   5  
ATOM   4263  C C    . ALA A 1 28 ? -3.378  5.046   2.512   1.00 0.00 ? 92  ALA A C    5  
ATOM   4264  O O    . ALA A 1 28 ? -2.670  5.554   1.638   1.00 0.00 ? 92  ALA A O    5  
ATOM   4265  C CB   . ALA A 1 28 ? -4.053  2.705   2.110   1.00 0.00 ? 92  ALA A CB   5  
ATOM   4266  H H    . ALA A 1 28 ? -4.397  4.784   0.143   1.00 0.00 ? 92  ALA A H    5  
ATOM   4267  H HA   . ALA A 1 28 ? -5.301  4.223   2.886   1.00 0.00 ? 92  ALA A HA   5  
ATOM   4268  H HB1  . ALA A 1 28 ? -3.242  2.604   1.404   1.00 0.00 ? 92  ALA A HB1  5  
ATOM   4269  H HB2  . ALA A 1 28 ? -3.715  2.429   3.097   1.00 0.00 ? 92  ALA A HB2  5  
ATOM   4270  H HB3  . ALA A 1 28 ? -4.867  2.057   1.817   1.00 0.00 ? 92  ALA A HB3  5  
ATOM   4271  N N    . GLU A 1 29 ? -3.182  5.249   3.783   1.00 0.00 ? 93  GLU A N    5  
ATOM   4272  C CA   . GLU A 1 29 ? -2.077  6.047   4.247   1.00 0.00 ? 93  GLU A CA   5  
ATOM   4273  C C    . GLU A 1 29 ? -1.046  5.137   4.884   1.00 0.00 ? 93  GLU A C    5  
ATOM   4274  O O    . GLU A 1 29 ? -1.394  4.192   5.598   1.00 0.00 ? 93  GLU A O    5  
ATOM   4275  C CB   . GLU A 1 29 ? -2.522  7.147   5.224   1.00 0.00 ? 93  GLU A CB   5  
ATOM   4276  C CG   . GLU A 1 29 ? -1.373  8.064   5.647   1.00 0.00 ? 93  GLU A CG   5  
ATOM   4277  C CD   . GLU A 1 29 ? -1.792  9.204   6.534   1.00 0.00 ? 93  GLU A CD   5  
ATOM   4278  O OE1  . GLU A 1 29 ? -2.238  10.240  6.012   1.00 0.00 ? 93  GLU A OE1  5  
ATOM   4279  O OE2  . GLU A 1 29 ? -1.635  9.101   7.763   1.00 0.00 ? 93  GLU A OE2  5  
ATOM   4280  H H    . GLU A 1 29 ? -3.778  4.821   4.441   1.00 0.00 ? 93  GLU A H    5  
ATOM   4281  H HA   . GLU A 1 29 ? -1.629  6.501   3.374   1.00 0.00 ? 93  GLU A HA   5  
ATOM   4282  H HB2  . GLU A 1 29 ? -3.291  7.741   4.755   1.00 0.00 ? 93  GLU A HB2  5  
ATOM   4283  H HB3  . GLU A 1 29 ? -2.931  6.680   6.108   1.00 0.00 ? 93  GLU A HB3  5  
ATOM   4284  H HG2  . GLU A 1 29 ? -0.649  7.470   6.185   1.00 0.00 ? 93  GLU A HG2  5  
ATOM   4285  H HG3  . GLU A 1 29 ? -0.894  8.464   4.763   1.00 0.00 ? 93  GLU A HG3  5  
ATOM   4286  N N    . ILE A 1 30 ? 0.192   5.384   4.578   1.00 0.00 ? 94  ILE A N    5  
ATOM   4287  C CA   . ILE A 1 30 ? 1.303   4.598   5.089   1.00 0.00 ? 94  ILE A CA   5  
ATOM   4288  C C    . ILE A 1 30 ? 1.623   4.964   6.530   1.00 0.00 ? 94  ILE A C    5  
ATOM   4289  O O    . ILE A 1 30 ? 1.907   6.119   6.841   1.00 0.00 ? 94  ILE A O    5  
ATOM   4290  C CB   . ILE A 1 30 ? 2.550   4.809   4.226   1.00 0.00 ? 94  ILE A CB   5  
ATOM   4291  C CG1  . ILE A 1 30 ? 2.203   4.491   2.784   1.00 0.00 ? 94  ILE A CG1  5  
ATOM   4292  C CG2  . ILE A 1 30 ? 3.689   3.916   4.718   1.00 0.00 ? 94  ILE A CG2  5  
ATOM   4293  C CD1  . ILE A 1 30 ? 3.238   4.906   1.791   1.00 0.00 ? 94  ILE A CD1  5  
ATOM   4294  H H    . ILE A 1 30 ? 0.356   6.131   3.961   1.00 0.00 ? 94  ILE A H    5  
ATOM   4295  H HA   . ILE A 1 30 ? 1.028   3.555   5.042   1.00 0.00 ? 94  ILE A HA   5  
ATOM   4296  H HB   . ILE A 1 30 ? 2.857   5.842   4.294   1.00 0.00 ? 94  ILE A HB   5  
ATOM   4297  H HG12 . ILE A 1 30 ? 2.088   3.421   2.686   1.00 0.00 ? 94  ILE A HG12 5  
ATOM   4298  H HG13 . ILE A 1 30 ? 1.270   4.975   2.544   1.00 0.00 ? 94  ILE A HG13 5  
ATOM   4299  H HG21 . ILE A 1 30 ? 3.357   2.889   4.721   1.00 0.00 ? 94  ILE A HG21 5  
ATOM   4300  H HG22 . ILE A 1 30 ? 4.549   4.020   4.073   1.00 0.00 ? 94  ILE A HG22 5  
ATOM   4301  H HG23 . ILE A 1 30 ? 3.953   4.198   5.727   1.00 0.00 ? 94  ILE A HG23 5  
ATOM   4302  H HD11 . ILE A 1 30 ? 4.151   4.367   1.996   1.00 0.00 ? 94  ILE A HD11 5  
ATOM   4303  H HD12 . ILE A 1 30 ? 2.882   4.679   0.796   1.00 0.00 ? 94  ILE A HD12 5  
ATOM   4304  H HD13 . ILE A 1 30 ? 3.412   5.968   1.873   1.00 0.00 ? 94  ILE A HD13 5  
ATOM   4305  N N    . GLU A 1 31 ? 1.598   3.972   7.373   1.00 0.00 ? 95  GLU A N    5  
ATOM   4306  C CA   . GLU A 1 31 ? 1.852   4.127   8.794   1.00 0.00 ? 95  GLU A CA   5  
ATOM   4307  C C    . GLU A 1 31 ? 3.286   3.744   9.144   1.00 0.00 ? 95  GLU A C    5  
ATOM   4308  O O    . GLU A 1 31 ? 3.878   4.284   10.092  1.00 0.00 ? 95  GLU A O    5  
ATOM   4309  C CB   . GLU A 1 31 ? 0.885   3.246   9.554   1.00 0.00 ? 95  GLU A CB   5  
ATOM   4310  C CG   . GLU A 1 31 ? -0.557  3.663   9.390   1.00 0.00 ? 95  GLU A CG   5  
ATOM   4311  C CD   . GLU A 1 31 ? -0.913  4.878   10.217  1.00 0.00 ? 95  GLU A CD   5  
ATOM   4312  O OE1  . GLU A 1 31 ? -0.418  5.986   9.941   1.00 0.00 ? 95  GLU A OE1  5  
ATOM   4313  O OE2  . GLU A 1 31 ? -1.699  4.745   11.175  1.00 0.00 ? 95  GLU A OE2  5  
ATOM   4314  H H    . GLU A 1 31 ? 1.382   3.081   7.013   1.00 0.00 ? 95  GLU A H    5  
ATOM   4315  H HA   . GLU A 1 31 ? 1.670   5.156   9.069   1.00 0.00 ? 95  GLU A HA   5  
ATOM   4316  H HB2  . GLU A 1 31 ? 0.988   2.232   9.199   1.00 0.00 ? 95  GLU A HB2  5  
ATOM   4317  H HB3  . GLU A 1 31 ? 1.131   3.280   10.604  1.00 0.00 ? 95  GLU A HB3  5  
ATOM   4318  H HG2  . GLU A 1 31 ? -0.726  3.891   8.348   1.00 0.00 ? 95  GLU A HG2  5  
ATOM   4319  H HG3  . GLU A 1 31 ? -1.179  2.832   9.678   1.00 0.00 ? 95  GLU A HG3  5  
ATOM   4320  N N    . GLU A 1 32 ? 3.834   2.810   8.402   1.00 0.00 ? 96  GLU A N    5  
ATOM   4321  C CA   . GLU A 1 32 ? 5.194   2.333   8.636   1.00 0.00 ? 96  GLU A CA   5  
ATOM   4322  C C    . GLU A 1 32 ? 5.726   1.687   7.373   1.00 0.00 ? 96  GLU A C    5  
ATOM   4323  O O    . GLU A 1 32 ? 4.960   1.128   6.600   1.00 0.00 ? 96  GLU A O    5  
ATOM   4324  C CB   . GLU A 1 32 ? 5.205   1.332   9.803   1.00 0.00 ? 96  GLU A CB   5  
ATOM   4325  C CG   . GLU A 1 32 ? 6.578   0.796   10.177  1.00 0.00 ? 96  GLU A CG   5  
ATOM   4326  C CD   . GLU A 1 32 ? 6.522   -0.159  11.330  1.00 0.00 ? 96  GLU A CD   5  
ATOM   4327  O OE1  . GLU A 1 32 ? 6.295   -1.366  11.111  1.00 0.00 ? 96  GLU A OE1  5  
ATOM   4328  O OE2  . GLU A 1 32 ? 6.695   0.279   12.478  1.00 0.00 ? 96  GLU A OE2  5  
ATOM   4329  H H    . GLU A 1 32 ? 3.305   2.421   7.670   1.00 0.00 ? 96  GLU A H    5  
ATOM   4330  H HA   . GLU A 1 32 ? 5.825   3.176   8.873   1.00 0.00 ? 96  GLU A HA   5  
ATOM   4331  H HB2  . GLU A 1 32 ? 4.788   1.814   10.675  1.00 0.00 ? 96  GLU A HB2  5  
ATOM   4332  H HB3  . GLU A 1 32 ? 4.575   0.494   9.542   1.00 0.00 ? 96  GLU A HB3  5  
ATOM   4333  H HG2  . GLU A 1 32 ? 6.995   0.283   9.324   1.00 0.00 ? 96  GLU A HG2  5  
ATOM   4334  H HG3  . GLU A 1 32 ? 7.216   1.626   10.443  1.00 0.00 ? 96  GLU A HG3  5  
ATOM   4335  N N    . ILE A 1 33 ? 7.008   1.800   7.156   1.00 0.00 ? 97  ILE A N    5  
ATOM   4336  C CA   . ILE A 1 33 ? 7.659   1.235   5.993   1.00 0.00 ? 97  ILE A CA   5  
ATOM   4337  C C    . ILE A 1 33 ? 8.739   0.261   6.434   1.00 0.00 ? 97  ILE A C    5  
ATOM   4338  O O    . ILE A 1 33 ? 9.529   0.561   7.332   1.00 0.00 ? 97  ILE A O    5  
ATOM   4339  C CB   . ILE A 1 33 ? 8.306   2.363   5.152   1.00 0.00 ? 97  ILE A CB   5  
ATOM   4340  C CG1  . ILE A 1 33 ? 7.238   3.330   4.685   1.00 0.00 ? 97  ILE A CG1  5  
ATOM   4341  C CG2  . ILE A 1 33 ? 9.067   1.806   3.944   1.00 0.00 ? 97  ILE A CG2  5  
ATOM   4342  C CD1  . ILE A 1 33 ? 7.763   4.689   4.423   1.00 0.00 ? 97  ILE A CD1  5  
ATOM   4343  H H    . ILE A 1 33 ? 7.570   2.287   7.799   1.00 0.00 ? 97  ILE A H    5  
ATOM   4344  H HA   . ILE A 1 33 ? 6.923   0.728   5.388   1.00 0.00 ? 97  ILE A HA   5  
ATOM   4345  H HB   . ILE A 1 33 ? 9.005   2.898   5.777   1.00 0.00 ? 97  ILE A HB   5  
ATOM   4346  H HG12 . ILE A 1 33 ? 6.827   2.983   3.747   1.00 0.00 ? 97  ILE A HG12 5  
ATOM   4347  H HG13 . ILE A 1 33 ? 6.460   3.400   5.432   1.00 0.00 ? 97  ILE A HG13 5  
ATOM   4348  H HG21 . ILE A 1 33 ? 8.389   1.244   3.319   1.00 0.00 ? 97  ILE A HG21 5  
ATOM   4349  H HG22 . ILE A 1 33 ? 9.481   2.628   3.378   1.00 0.00 ? 97  ILE A HG22 5  
ATOM   4350  H HG23 . ILE A 1 33 ? 9.866   1.162   4.282   1.00 0.00 ? 97  ILE A HG23 5  
ATOM   4351  H HD11 . ILE A 1 33 ? 8.545   4.655   3.680   1.00 0.00 ? 97  ILE A HD11 5  
ATOM   4352  H HD12 . ILE A 1 33 ? 6.947   5.315   4.091   1.00 0.00 ? 97  ILE A HD12 5  
ATOM   4353  H HD13 . ILE A 1 33 ? 8.154   5.071   5.355   1.00 0.00 ? 97  ILE A HD13 5  
ATOM   4354  N N    . ASP A 1 34 ? 8.747   -0.889  5.825   1.00 0.00 ? 98  ASP A N    5  
ATOM   4355  C CA   . ASP A 1 34 ? 9.759   -1.892  6.038   1.00 0.00 ? 98  ASP A CA   5  
ATOM   4356  C C    . ASP A 1 34 ? 10.627  -1.915  4.815   1.00 0.00 ? 98  ASP A C    5  
ATOM   4357  O O    . ASP A 1 34 ? 10.279  -2.507  3.797   1.00 0.00 ? 98  ASP A O    5  
ATOM   4358  C CB   . ASP A 1 34 ? 9.162   -3.279  6.250   1.00 0.00 ? 98  ASP A CB   5  
ATOM   4359  C CG   . ASP A 1 34 ? 10.234  -4.314  6.511   1.00 0.00 ? 98  ASP A CG   5  
ATOM   4360  O OD1  . ASP A 1 34 ? 10.820  -4.833  5.553   1.00 0.00 ? 98  ASP A OD1  5  
ATOM   4361  O OD2  . ASP A 1 34 ? 10.506  -4.617  7.688   1.00 0.00 ? 98  ASP A OD2  5  
ATOM   4362  H H    . ASP A 1 34 ? 8.058   -1.085  5.149   1.00 0.00 ? 98  ASP A H    5  
ATOM   4363  H HA   . ASP A 1 34 ? 10.366  -1.615  6.886   1.00 0.00 ? 98  ASP A HA   5  
ATOM   4364  H HB2  . ASP A 1 34 ? 8.479   -3.260  7.086   1.00 0.00 ? 98  ASP A HB2  5  
ATOM   4365  H HB3  . ASP A 1 34 ? 8.625   -3.572  5.359   1.00 0.00 ? 98  ASP A HB3  5  
ATOM   4366  N N    . GLU A 1 35 ? 11.699  -1.201  4.881   1.00 0.00 ? 99  GLU A N    5  
ATOM   4367  C CA   . GLU A 1 35 ? 12.617  -1.064  3.774   1.00 0.00 ? 99  GLU A CA   5  
ATOM   4368  C C    . GLU A 1 35 ? 13.335  -2.369  3.431   1.00 0.00 ? 99  GLU A C    5  
ATOM   4369  O O    . GLU A 1 35 ? 13.828  -2.530  2.323   1.00 0.00 ? 99  GLU A O    5  
ATOM   4370  C CB   . GLU A 1 35 ? 13.606  0.034   4.063   1.00 0.00 ? 99  GLU A CB   5  
ATOM   4371  C CG   . GLU A 1 35 ? 12.938  1.360   4.368   1.00 0.00 ? 99  GLU A CG   5  
ATOM   4372  C CD   . GLU A 1 35 ? 13.918  2.445   4.656   1.00 0.00 ? 99  GLU A CD   5  
ATOM   4373  O OE1  . GLU A 1 35 ? 14.374  2.551   5.809   1.00 0.00 ? 99  GLU A OE1  5  
ATOM   4374  O OE2  . GLU A 1 35 ? 14.251  3.215   3.735   1.00 0.00 ? 99  GLU A OE2  5  
ATOM   4375  H H    . GLU A 1 35 ? 11.900  -0.739  5.724   1.00 0.00 ? 99  GLU A H    5  
ATOM   4376  H HA   . GLU A 1 35 ? 12.034  -0.770  2.915   1.00 0.00 ? 99  GLU A HA   5  
ATOM   4377  H HB2  . GLU A 1 35 ? 14.220  -0.254  4.904   1.00 0.00 ? 99  GLU A HB2  5  
ATOM   4378  H HB3  . GLU A 1 35 ? 14.225  0.152   3.187   1.00 0.00 ? 99  GLU A HB3  5  
ATOM   4379  H HG2  . GLU A 1 35 ? 12.337  1.653   3.520   1.00 0.00 ? 99  GLU A HG2  5  
ATOM   4380  H HG3  . GLU A 1 35 ? 12.297  1.231   5.228   1.00 0.00 ? 99  GLU A HG3  5  
ATOM   4381  N N    . GLU A 1 36 ? 13.362  -3.299  4.370   1.00 0.00 ? 100 GLU A N    5  
ATOM   4382  C CA   . GLU A 1 36 ? 14.094  -4.544  4.201   1.00 0.00 ? 100 GLU A CA   5  
ATOM   4383  C C    . GLU A 1 36 ? 13.372  -5.405  3.154   1.00 0.00 ? 100 GLU A C    5  
ATOM   4384  O O    . GLU A 1 36 ? 13.992  -5.973  2.261   1.00 0.00 ? 100 GLU A O    5  
ATOM   4385  C CB   . GLU A 1 36 ? 14.165  -5.259  5.563   1.00 0.00 ? 100 GLU A CB   5  
ATOM   4386  C CG   . GLU A 1 36 ? 15.317  -6.264  5.757   1.00 0.00 ? 100 GLU A CG   5  
ATOM   4387  C CD   . GLU A 1 36 ? 15.287  -7.459  4.834   1.00 0.00 ? 100 GLU A CD   5  
ATOM   4388  O OE1  . GLU A 1 36 ? 14.358  -8.282  4.937   1.00 0.00 ? 100 GLU A OE1  5  
ATOM   4389  O OE2  . GLU A 1 36 ? 16.197  -7.600  3.993   1.00 0.00 ? 100 GLU A OE2  5  
ATOM   4390  H H    . GLU A 1 36 ? 12.849  -3.155  5.194   1.00 0.00 ? 100 GLU A H    5  
ATOM   4391  H HA   . GLU A 1 36 ? 15.093  -4.314  3.859   1.00 0.00 ? 100 GLU A HA   5  
ATOM   4392  H HB2  . GLU A 1 36 ? 14.237  -4.507  6.334   1.00 0.00 ? 100 GLU A HB2  5  
ATOM   4393  H HB3  . GLU A 1 36 ? 13.234  -5.788  5.701   1.00 0.00 ? 100 GLU A HB3  5  
ATOM   4394  H HG2  . GLU A 1 36 ? 16.249  -5.746  5.588   1.00 0.00 ? 100 GLU A HG2  5  
ATOM   4395  H HG3  . GLU A 1 36 ? 15.293  -6.612  6.778   1.00 0.00 ? 100 GLU A HG3  5  
ATOM   4396  N N    . ASN A 1 37 ? 12.066  -5.452  3.243   1.00 0.00 ? 101 ASN A N    5  
ATOM   4397  C CA   . ASN A 1 37 ? 11.266  -6.199  2.281   1.00 0.00 ? 101 ASN A CA   5  
ATOM   4398  C C    . ASN A 1 37 ? 10.726  -5.288  1.221   1.00 0.00 ? 101 ASN A C    5  
ATOM   4399  O O    . ASN A 1 37 ? 10.251  -5.748  0.181   1.00 0.00 ? 101 ASN A O    5  
ATOM   4400  C CB   . ASN A 1 37 ? 10.085  -6.895  2.954   1.00 0.00 ? 101 ASN A CB   5  
ATOM   4401  C CG   . ASN A 1 37 ? 10.484  -7.912  3.989   1.00 0.00 ? 101 ASN A CG   5  
ATOM   4402  O OD1  . ASN A 1 37 ? 10.684  -9.090  3.684   1.00 0.00 ? 101 ASN A OD1  5  
ATOM   4403  N ND2  . ASN A 1 37 ? 10.617  -7.478  5.197   1.00 0.00 ? 101 ASN A ND2  5  
ATOM   4404  H H    . ASN A 1 37 ? 11.624  -5.013  4.011   1.00 0.00 ? 101 ASN A H    5  
ATOM   4405  H HA   . ASN A 1 37 ? 11.885  -6.950  1.815   1.00 0.00 ? 101 ASN A HA   5  
ATOM   4406  H HB2  . ASN A 1 37 ? 9.469   -6.149  3.434   1.00 0.00 ? 101 ASN A HB2  5  
ATOM   4407  H HB3  . ASN A 1 37 ? 9.504   -7.390  2.191   1.00 0.00 ? 101 ASN A HB3  5  
ATOM   4408  H HD21 . ASN A 1 37 ? 10.454  -6.512  5.356   1.00 0.00 ? 101 ASN A HD21 5  
ATOM   4409  H HD22 . ASN A 1 37 ? 10.886  -8.094  5.910   1.00 0.00 ? 101 ASN A HD22 5  
ATOM   4410  N N    . GLY A 1 38 ? 10.801  -4.002  1.471   1.00 0.00 ? 102 GLY A N    5  
ATOM   4411  C CA   . GLY A 1 38 ? 10.233  -3.051  0.561   1.00 0.00 ? 102 GLY A CA   5  
ATOM   4412  C C    . GLY A 1 38 ? 8.729   -3.053  0.692   1.00 0.00 ? 102 GLY A C    5  
ATOM   4413  O O    . GLY A 1 38 ? 7.999   -2.880  -0.294  1.00 0.00 ? 102 GLY A O    5  
ATOM   4414  H H    . GLY A 1 38 ? 11.234  -3.681  2.292   1.00 0.00 ? 102 GLY A H    5  
ATOM   4415  H HA2  . GLY A 1 38 ? 10.616  -2.068  0.789   1.00 0.00 ? 102 GLY A HA2  5  
ATOM   4416  H HA3  . GLY A 1 38 ? 10.496  -3.315  -0.452  1.00 0.00 ? 102 GLY A HA3  5  
ATOM   4417  N N    . THR A 1 39 ? 8.260   -3.282  1.899   1.00 0.00 ? 103 THR A N    5  
ATOM   4418  C CA   . THR A 1 39 ? 6.860   -3.320  2.176   1.00 0.00 ? 103 THR A CA   5  
ATOM   4419  C C    . THR A 1 39 ? 6.462   -2.178  3.084   1.00 0.00 ? 103 THR A C    5  
ATOM   4420  O O    . THR A 1 39 ? 7.304   -1.552  3.706   1.00 0.00 ? 103 THR A O    5  
ATOM   4421  C CB   . THR A 1 39 ? 6.446   -4.678  2.784   1.00 0.00 ? 103 THR A CB   5  
ATOM   4422  O OG1  . THR A 1 39 ? 7.331   -5.026  3.856   1.00 0.00 ? 103 THR A OG1  5  
ATOM   4423  C CG2  . THR A 1 39 ? 6.465   -5.785  1.737   1.00 0.00 ? 103 THR A CG2  5  
ATOM   4424  H H    . THR A 1 39 ? 8.869   -3.422  2.662   1.00 0.00 ? 103 THR A H    5  
ATOM   4425  H HA   . THR A 1 39 ? 6.326   -3.179  1.252   1.00 0.00 ? 103 THR A HA   5  
ATOM   4426  H HB   . THR A 1 39 ? 5.442   -4.577  3.170   1.00 0.00 ? 103 THR A HB   5  
ATOM   4427  H HG1  . THR A 1 39 ? 7.446   -5.984  3.810   1.00 0.00 ? 103 THR A HG1  5  
ATOM   4428  H HG21 . THR A 1 39 ? 7.452   -5.858  1.306   1.00 0.00 ? 103 THR A HG21 5  
ATOM   4429  H HG22 . THR A 1 39 ? 6.210   -6.725  2.205   1.00 0.00 ? 103 THR A HG22 5  
ATOM   4430  H HG23 . THR A 1 39 ? 5.739   -5.576  0.965   1.00 0.00 ? 103 THR A HG23 5  
ATOM   4431  N N    . ALA A 1 40 ? 5.209   -1.871  3.109   1.00 0.00 ? 104 ALA A N    5  
ATOM   4432  C CA   . ALA A 1 40 ? 4.713   -0.837  3.944   1.00 0.00 ? 104 ALA A CA   5  
ATOM   4433  C C    . ALA A 1 40 ? 3.440   -1.278  4.604   1.00 0.00 ? 104 ALA A C    5  
ATOM   4434  O O    . ALA A 1 40 ? 2.662   -2.052  4.031   1.00 0.00 ? 104 ALA A O    5  
ATOM   4435  C CB   . ALA A 1 40 ? 4.478   0.428   3.143   1.00 0.00 ? 104 ALA A CB   5  
ATOM   4436  H H    . ALA A 1 40 ? 4.565   -2.341  2.530   1.00 0.00 ? 104 ALA A H    5  
ATOM   4437  H HA   . ALA A 1 40 ? 5.455   -0.625  4.701   1.00 0.00 ? 104 ALA A HA   5  
ATOM   4438  H HB1  . ALA A 1 40 ? 3.735   0.225   2.387   1.00 0.00 ? 104 ALA A HB1  5  
ATOM   4439  H HB2  . ALA A 1 40 ? 4.128   1.212   3.795   1.00 0.00 ? 104 ALA A HB2  5  
ATOM   4440  H HB3  . ALA A 1 40 ? 5.401   0.733   2.671   1.00 0.00 ? 104 ALA A HB3  5  
ATOM   4441  N N    . ALA A 1 41 ? 3.254   -0.827  5.800   1.00 0.00 ? 105 ALA A N    5  
ATOM   4442  C CA   . ALA A 1 41 ? 2.066   -1.074  6.538   1.00 0.00 ? 105 ALA A CA   5  
ATOM   4443  C C    . ALA A 1 41 ? 1.179   0.118   6.334   1.00 0.00 ? 105 ALA A C    5  
ATOM   4444  O O    . ALA A 1 41 ? 1.568   1.264   6.640   1.00 0.00 ? 105 ALA A O    5  
ATOM   4445  C CB   . ALA A 1 41 ? 2.390   -1.276  7.993   1.00 0.00 ? 105 ALA A CB   5  
ATOM   4446  H H    . ALA A 1 41 ? 3.946   -0.252  6.200   1.00 0.00 ? 105 ALA A H    5  
ATOM   4447  H HA   . ALA A 1 41 ? 1.585   -1.956  6.142   1.00 0.00 ? 105 ALA A HA   5  
ATOM   4448  H HB1  . ALA A 1 41 ? 2.897   -0.395  8.358   1.00 0.00 ? 105 ALA A HB1  5  
ATOM   4449  H HB2  . ALA A 1 41 ? 1.475   -1.442  8.542   1.00 0.00 ? 105 ALA A HB2  5  
ATOM   4450  H HB3  . ALA A 1 41 ? 3.038   -2.135  8.077   1.00 0.00 ? 105 ALA A HB3  5  
ATOM   4451  N N    . ILE A 1 42 ? 0.034   -0.118  5.805   1.00 0.00 ? 106 ILE A N    5  
ATOM   4452  C CA   . ILE A 1 42 ? -0.836  0.945   5.391   1.00 0.00 ? 106 ILE A CA   5  
ATOM   4453  C C    . ILE A 1 42 ? -2.197  0.808   6.030   1.00 0.00 ? 106 ILE A C    5  
ATOM   4454  O O    . ILE A 1 42 ? -2.620  -0.302  6.343   1.00 0.00 ? 106 ILE A O    5  
ATOM   4455  C CB   . ILE A 1 42 ? -0.975  0.927   3.835   1.00 0.00 ? 106 ILE A CB   5  
ATOM   4456  C CG1  . ILE A 1 42 ? -1.508  -0.431  3.337   1.00 0.00 ? 106 ILE A CG1  5  
ATOM   4457  C CG2  . ILE A 1 42 ? 0.333   1.268   3.152   1.00 0.00 ? 106 ILE A CG2  5  
ATOM   4458  C CD1  . ILE A 1 42 ? -2.966  -0.413  3.044   1.00 0.00 ? 106 ILE A CD1  5  
ATOM   4459  H H    . ILE A 1 42 ? -0.254  -1.052  5.682   1.00 0.00 ? 106 ILE A H    5  
ATOM   4460  H HA   . ILE A 1 42 ? -0.393  1.887   5.672   1.00 0.00 ? 106 ILE A HA   5  
ATOM   4461  H HB   . ILE A 1 42 ? -1.691  1.691   3.569   1.00 0.00 ? 106 ILE A HB   5  
ATOM   4462  H HG12 . ILE A 1 42 ? -0.993  -0.802  2.465   1.00 0.00 ? 106 ILE A HG12 5  
ATOM   4463  H HG13 . ILE A 1 42 ? -1.367  -1.148  4.133   1.00 0.00 ? 106 ILE A HG13 5  
ATOM   4464  H HG21 . ILE A 1 42 ? 1.093   0.557   3.440   1.00 0.00 ? 106 ILE A HG21 5  
ATOM   4465  H HG22 . ILE A 1 42 ? 0.186   1.234   2.083   1.00 0.00 ? 106 ILE A HG22 5  
ATOM   4466  H HG23 . ILE A 1 42 ? 0.630   2.264   3.444   1.00 0.00 ? 106 ILE A HG23 5  
ATOM   4467  H HD11 . ILE A 1 42 ? -3.127  0.358   2.302   1.00 0.00 ? 106 ILE A HD11 5  
ATOM   4468  H HD12 . ILE A 1 42 ? -3.282  -1.370  2.656   1.00 0.00 ? 106 ILE A HD12 5  
ATOM   4469  H HD13 . ILE A 1 42 ? -3.515  -0.166  3.941   1.00 0.00 ? 106 ILE A HD13 5  
ATOM   4470  N N    . THR A 1 43 ? -2.859  1.913   6.220   1.00 0.00 ? 107 THR A N    5  
ATOM   4471  C CA   . THR A 1 43 ? -4.185  1.926   6.746   1.00 0.00 ? 107 THR A CA   5  
ATOM   4472  C C    . THR A 1 43 ? -5.122  2.503   5.694   1.00 0.00 ? 107 THR A C    5  
ATOM   4473  O O    . THR A 1 43 ? -4.911  3.612   5.201   1.00 0.00 ? 107 THR A O    5  
ATOM   4474  C CB   . THR A 1 43 ? -4.269  2.738   8.065   1.00 0.00 ? 107 THR A CB   5  
ATOM   4475  O OG1  . THR A 1 43 ? -3.438  2.119   9.070   1.00 0.00 ? 107 THR A OG1  5  
ATOM   4476  C CG2  . THR A 1 43 ? -5.706  2.811   8.576   1.00 0.00 ? 107 THR A CG2  5  
ATOM   4477  H H    . THR A 1 43 ? -2.450  2.779   5.985   1.00 0.00 ? 107 THR A H    5  
ATOM   4478  H HA   . THR A 1 43 ? -4.471  0.903   6.942   1.00 0.00 ? 107 THR A HA   5  
ATOM   4479  H HB   . THR A 1 43 ? -3.904  3.739   7.880   1.00 0.00 ? 107 THR A HB   5  
ATOM   4480  H HG1  . THR A 1 43 ? -3.854  2.313   9.919   1.00 0.00 ? 107 THR A HG1  5  
ATOM   4481  H HG21 . THR A 1 43 ? -6.087  1.811   8.734   1.00 0.00 ? 107 THR A HG21 5  
ATOM   4482  H HG22 . THR A 1 43 ? -5.731  3.361   9.504   1.00 0.00 ? 107 THR A HG22 5  
ATOM   4483  H HG23 . THR A 1 43 ? -6.318  3.310   7.839   1.00 0.00 ? 107 THR A HG23 5  
ATOM   4484  N N    . PHE A 1 44 ? -6.124  1.732   5.338   1.00 0.00 ? 108 PHE A N    5  
ATOM   4485  C CA   . PHE A 1 44 ? -7.081  2.105   4.325   1.00 0.00 ? 108 PHE A CA   5  
ATOM   4486  C C    . PHE A 1 44 ? -7.942  3.255   4.765   1.00 0.00 ? 108 PHE A C    5  
ATOM   4487  O O    . PHE A 1 44 ? -8.654  3.163   5.765   1.00 0.00 ? 108 PHE A O    5  
ATOM   4488  C CB   . PHE A 1 44 ? -7.929  0.911   3.903   1.00 0.00 ? 108 PHE A CB   5  
ATOM   4489  C CG   . PHE A 1 44 ? -7.155  -0.112  3.135   1.00 0.00 ? 108 PHE A CG   5  
ATOM   4490  C CD1  . PHE A 1 44 ? -6.844  0.127   1.810   1.00 0.00 ? 108 PHE A CD1  5  
ATOM   4491  C CD2  . PHE A 1 44 ? -6.735  -1.302  3.725   1.00 0.00 ? 108 PHE A CD2  5  
ATOM   4492  C CE1  . PHE A 1 44 ? -6.129  -0.786  1.071   1.00 0.00 ? 108 PHE A CE1  5  
ATOM   4493  C CE2  . PHE A 1 44 ? -6.015  -2.230  2.988   1.00 0.00 ? 108 PHE A CE2  5  
ATOM   4494  C CZ   . PHE A 1 44 ? -5.708  -1.968  1.656   1.00 0.00 ? 108 PHE A CZ   5  
ATOM   4495  H H    . PHE A 1 44 ? -6.218  0.875   5.815   1.00 0.00 ? 108 PHE A H    5  
ATOM   4496  H HA   . PHE A 1 44 ? -6.511  2.427   3.468   1.00 0.00 ? 108 PHE A HA   5  
ATOM   4497  H HB2  . PHE A 1 44 ? -8.343  0.434   4.781   1.00 0.00 ? 108 PHE A HB2  5  
ATOM   4498  H HB3  . PHE A 1 44 ? -8.734  1.258   3.274   1.00 0.00 ? 108 PHE A HB3  5  
ATOM   4499  H HD1  . PHE A 1 44 ? -7.181  1.050   1.360   1.00 0.00 ? 108 PHE A HD1  5  
ATOM   4500  H HD2  . PHE A 1 44 ? -6.989  -1.510  4.756   1.00 0.00 ? 108 PHE A HD2  5  
ATOM   4501  H HE1  . PHE A 1 44 ? -5.911  -0.564  0.037   1.00 0.00 ? 108 PHE A HE1  5  
ATOM   4502  H HE2  . PHE A 1 44 ? -5.691  -3.152  3.448   1.00 0.00 ? 108 PHE A HE2  5  
ATOM   4503  H HZ   . PHE A 1 44 ? -5.146  -2.687  1.080   1.00 0.00 ? 108 PHE A HZ   5  
ATOM   4504  N N    . ALA A 1 45 ? -7.886  4.314   4.004   1.00 0.00 ? 109 ALA A N    5  
ATOM   4505  C CA   . ALA A 1 45 ? -8.585  5.535   4.305   1.00 0.00 ? 109 ALA A CA   5  
ATOM   4506  C C    . ALA A 1 45 ? -10.081 5.349   4.136   1.00 0.00 ? 109 ALA A C    5  
ATOM   4507  O O    . ALA A 1 45 ? -10.554 4.887   3.089   1.00 0.00 ? 109 ALA A O    5  
ATOM   4508  C CB   . ALA A 1 45 ? -8.076  6.657   3.416   1.00 0.00 ? 109 ALA A CB   5  
ATOM   4509  H H    . ALA A 1 45 ? -7.376  4.264   3.164   1.00 0.00 ? 109 ALA A H    5  
ATOM   4510  H HA   . ALA A 1 45 ? -8.376  5.795   5.333   1.00 0.00 ? 109 ALA A HA   5  
ATOM   4511  H HB1  . ALA A 1 45 ? -8.276  6.415   2.383   1.00 0.00 ? 109 ALA A HB1  5  
ATOM   4512  H HB2  . ALA A 1 45 ? -8.573  7.579   3.675   1.00 0.00 ? 109 ALA A HB2  5  
ATOM   4513  H HB3  . ALA A 1 45 ? -7.011  6.772   3.555   1.00 0.00 ? 109 ALA A HB3  5  
ATOM   4514  N N    . GLY A 1 46 ? -10.808 5.650   5.177   1.00 0.00 ? 110 GLY A N    5  
ATOM   4515  C CA   . GLY A 1 46 ? -12.233 5.542   5.154   1.00 0.00 ? 110 GLY A CA   5  
ATOM   4516  C C    . GLY A 1 46 ? -12.700 4.290   5.843   1.00 0.00 ? 110 GLY A C    5  
ATOM   4517  O O    . GLY A 1 46 ? -13.541 4.344   6.738   1.00 0.00 ? 110 GLY A O    5  
ATOM   4518  H H    . GLY A 1 46 ? -10.370 5.946   6.005   1.00 0.00 ? 110 GLY A H    5  
ATOM   4519  H HA2  . GLY A 1 46 ? -12.659 6.400   5.652   1.00 0.00 ? 110 GLY A HA2  5  
ATOM   4520  H HA3  . GLY A 1 46 ? -12.569 5.524   4.129   1.00 0.00 ? 110 GLY A HA3  5  
ATOM   4521  N N    . TYR A 1 47 ? -12.147 3.170   5.439   1.00 0.00 ? 111 TYR A N    5  
ATOM   4522  C CA   . TYR A 1 47 ? -12.517 1.889   5.995   1.00 0.00 ? 111 TYR A CA   5  
ATOM   4523  C C    . TYR A 1 47 ? -11.810 1.675   7.327   1.00 0.00 ? 111 TYR A C    5  
ATOM   4524  O O    . TYR A 1 47 ? -12.420 1.269   8.308   1.00 0.00 ? 111 TYR A O    5  
ATOM   4525  C CB   . TYR A 1 47 ? -12.133 0.791   5.037   1.00 0.00 ? 111 TYR A CB   5  
ATOM   4526  C CG   . TYR A 1 47 ? -12.562 1.033   3.613   1.00 0.00 ? 111 TYR A CG   5  
ATOM   4527  C CD1  . TYR A 1 47 ? -13.840 0.726   3.186   1.00 0.00 ? 111 TYR A CD1  5  
ATOM   4528  C CD2  . TYR A 1 47 ? -11.666 1.552   2.690   1.00 0.00 ? 111 TYR A CD2  5  
ATOM   4529  C CE1  . TYR A 1 47 ? -14.216 0.932   1.875   1.00 0.00 ? 111 TYR A CE1  5  
ATOM   4530  C CE2  . TYR A 1 47 ? -12.029 1.762   1.386   1.00 0.00 ? 111 TYR A CE2  5  
ATOM   4531  C CZ   . TYR A 1 47 ? -13.309 1.449   0.981   1.00 0.00 ? 111 TYR A CZ   5  
ATOM   4532  O OH   . TYR A 1 47 ? -13.688 1.666   -0.325  1.00 0.00 ? 111 TYR A OH   5  
ATOM   4533  H H    . TYR A 1 47 ? -11.485 3.196   4.716   1.00 0.00 ? 111 TYR A H    5  
ATOM   4534  H HA   . TYR A 1 47 ? -13.585 1.873   6.146   1.00 0.00 ? 111 TYR A HA   5  
ATOM   4535  H HB2  . TYR A 1 47 ? -11.061 0.671   5.043   1.00 0.00 ? 111 TYR A HB2  5  
ATOM   4536  H HB3  . TYR A 1 47 ? -12.586 -0.133  5.364   1.00 0.00 ? 111 TYR A HB3  5  
ATOM   4537  H HD1  . TYR A 1 47 ? -14.548 0.322   3.893   1.00 0.00 ? 111 TYR A HD1  5  
ATOM   4538  H HD2  . TYR A 1 47 ? -10.665 1.797   3.013   1.00 0.00 ? 111 TYR A HD2  5  
ATOM   4539  H HE1  . TYR A 1 47 ? -15.215 0.680   1.551   1.00 0.00 ? 111 TYR A HE1  5  
ATOM   4540  H HE2  . TYR A 1 47 ? -11.302 2.161   0.693   1.00 0.00 ? 111 TYR A HE2  5  
ATOM   4541  H HH   . TYR A 1 47 ? -14.584 2.027   -0.307  1.00 0.00 ? 111 TYR A HH   5  
ATOM   4542  N N    . GLY A 1 48 ? -10.524 1.938   7.352   1.00 0.00 ? 112 GLY A N    5  
ATOM   4543  C CA   . GLY A 1 48 ? -9.779  1.851   8.585   1.00 0.00 ? 112 GLY A CA   5  
ATOM   4544  C C    . GLY A 1 48 ? -9.006  0.556   8.783   1.00 0.00 ? 112 GLY A C    5  
ATOM   4545  O O    . GLY A 1 48 ? -8.531  0.302   9.877   1.00 0.00 ? 112 GLY A O    5  
ATOM   4546  H H    . GLY A 1 48 ? -10.064 2.229   6.532   1.00 0.00 ? 112 GLY A H    5  
ATOM   4547  H HA2  . GLY A 1 48 ? -9.081  2.673   8.626   1.00 0.00 ? 112 GLY A HA2  5  
ATOM   4548  H HA3  . GLY A 1 48 ? -10.478 1.962   9.401   1.00 0.00 ? 112 GLY A HA3  5  
ATOM   4549  N N    . ASN A 1 49 ? -8.844  -0.254  7.744   1.00 0.00 ? 113 ASN A N    5  
ATOM   4550  C CA   . ASN A 1 49 ? -8.086  -1.521  7.910   1.00 0.00 ? 113 ASN A CA   5  
ATOM   4551  C C    . ASN A 1 49 ? -6.643  -1.284  7.663   1.00 0.00 ? 113 ASN A C    5  
ATOM   4552  O O    . ASN A 1 49 ? -6.279  -0.246  7.146   1.00 0.00 ? 113 ASN A O    5  
ATOM   4553  C CB   . ASN A 1 49 ? -8.538  -2.657  6.994   1.00 0.00 ? 113 ASN A CB   5  
ATOM   4554  C CG   . ASN A 1 49 ? -9.897  -3.215  7.294   1.00 0.00 ? 113 ASN A CG   5  
ATOM   4555  O OD1  . ASN A 1 49 ? -10.404 -3.125  8.421   1.00 0.00 ? 113 ASN A OD1  5  
ATOM   4556  N ND2  . ASN A 1 49 ? -10.449 -3.871  6.326   1.00 0.00 ? 113 ASN A ND2  5  
ATOM   4557  H H    . ASN A 1 49 ? -9.181  0.018   6.866   1.00 0.00 ? 113 ASN A H    5  
ATOM   4558  H HA   . ASN A 1 49 ? -8.198  -1.825  8.940   1.00 0.00 ? 113 ASN A HA   5  
ATOM   4559  H HB2  . ASN A 1 49 ? -8.555  -2.289  5.980   1.00 0.00 ? 113 ASN A HB2  5  
ATOM   4560  H HB3  . ASN A 1 49 ? -7.814  -3.455  7.050   1.00 0.00 ? 113 ASN A HB3  5  
ATOM   4561  H HD21 . ASN A 1 49 ? -9.921  -3.958  5.503   1.00 0.00 ? 113 ASN A HD21 5  
ATOM   4562  H HD22 . ASN A 1 49 ? -11.364 -4.215  6.399   1.00 0.00 ? 113 ASN A HD22 5  
ATOM   4563  N N    . ALA A 1 50 ? -5.823  -2.247  7.972   1.00 0.00 ? 114 ALA A N    5  
ATOM   4564  C CA   . ALA A 1 50 ? -4.408  -2.097  7.809   1.00 0.00 ? 114 ALA A CA   5  
ATOM   4565  C C    . ALA A 1 50 ? -3.804  -3.380  7.313   1.00 0.00 ? 114 ALA A C    5  
ATOM   4566  O O    . ALA A 1 50 ? -4.200  -4.470  7.751   1.00 0.00 ? 114 ALA A O    5  
ATOM   4567  C CB   . ALA A 1 50 ? -3.768  -1.688  9.120   1.00 0.00 ? 114 ALA A CB   5  
ATOM   4568  H H    . ALA A 1 50 ? -6.161  -3.111  8.296   1.00 0.00 ? 114 ALA A H    5  
ATOM   4569  H HA   . ALA A 1 50 ? -4.229  -1.316  7.086   1.00 0.00 ? 114 ALA A HA   5  
ATOM   4570  H HB1  . ALA A 1 50 ? -3.949  -2.457  9.856   1.00 0.00 ? 114 ALA A HB1  5  
ATOM   4571  H HB2  . ALA A 1 50 ? -2.703  -1.569  8.979   1.00 0.00 ? 114 ALA A HB2  5  
ATOM   4572  H HB3  . ALA A 1 50 ? -4.197  -0.756  9.457   1.00 0.00 ? 114 ALA A HB3  5  
ATOM   4573  N N    . GLU A 1 51 ? -2.879  -3.273  6.398   1.00 0.00 ? 115 GLU A N    5  
ATOM   4574  C CA   . GLU A 1 51 ? -2.213  -4.434  5.890   1.00 0.00 ? 115 GLU A CA   5  
ATOM   4575  C C    . GLU A 1 51 ? -0.795  -4.093  5.477   1.00 0.00 ? 115 GLU A C    5  
ATOM   4576  O O    . GLU A 1 51 ? -0.454  -2.913  5.303   1.00 0.00 ? 115 GLU A O    5  
ATOM   4577  C CB   . GLU A 1 51 ? -2.976  -5.092  4.725   1.00 0.00 ? 115 GLU A CB   5  
ATOM   4578  C CG   . GLU A 1 51 ? -2.894  -4.410  3.374   1.00 0.00 ? 115 GLU A CG   5  
ATOM   4579  C CD   . GLU A 1 51 ? -3.327  -5.366  2.285   1.00 0.00 ? 115 GLU A CD   5  
ATOM   4580  O OE1  . GLU A 1 51 ? -4.531  -5.449  1.967   1.00 0.00 ? 115 GLU A OE1  5  
ATOM   4581  O OE2  . GLU A 1 51 ? -2.459  -6.108  1.775   1.00 0.00 ? 115 GLU A OE2  5  
ATOM   4582  H H    . GLU A 1 51 ? -2.616  -2.383  6.070   1.00 0.00 ? 115 GLU A H    5  
ATOM   4583  H HA   . GLU A 1 51 ? -2.159  -5.139  6.707   1.00 0.00 ? 115 GLU A HA   5  
ATOM   4584  H HB2  . GLU A 1 51 ? -2.631  -6.101  4.583   1.00 0.00 ? 115 GLU A HB2  5  
ATOM   4585  H HB3  . GLU A 1 51 ? -4.022  -5.103  5.000   1.00 0.00 ? 115 GLU A HB3  5  
ATOM   4586  H HG2  . GLU A 1 51 ? -3.522  -3.532  3.369   1.00 0.00 ? 115 GLU A HG2  5  
ATOM   4587  H HG3  . GLU A 1 51 ? -1.869  -4.121  3.189   1.00 0.00 ? 115 GLU A HG3  5  
ATOM   4588  N N    . VAL A 1 52 ? 0.028   -5.110  5.378   1.00 0.00 ? 116 VAL A N    5  
ATOM   4589  C CA   . VAL A 1 52 ? 1.384   -4.975  4.921   1.00 0.00 ? 116 VAL A CA   5  
ATOM   4590  C C    . VAL A 1 52 ? 1.400   -5.293  3.437   1.00 0.00 ? 116 VAL A C    5  
ATOM   4591  O O    . VAL A 1 52 ? 1.028   -6.402  3.016   1.00 0.00 ? 116 VAL A O    5  
ATOM   4592  C CB   . VAL A 1 52 ? 2.350   -5.942  5.666   1.00 0.00 ? 116 VAL A CB   5  
ATOM   4593  C CG1  . VAL A 1 52 ? 3.795   -5.725  5.226   1.00 0.00 ? 116 VAL A CG1  5  
ATOM   4594  C CG2  . VAL A 1 52 ? 2.224   -5.780  7.171   1.00 0.00 ? 116 VAL A CG2  5  
ATOM   4595  H H    . VAL A 1 52 ? -0.296  -6.005  5.611   1.00 0.00 ? 116 VAL A H    5  
ATOM   4596  H HA   . VAL A 1 52 ? 1.699   -3.952  5.075   1.00 0.00 ? 116 VAL A HA   5  
ATOM   4597  H HB   . VAL A 1 52 ? 2.074   -6.953  5.406   1.00 0.00 ? 116 VAL A HB   5  
ATOM   4598  H HG11 . VAL A 1 52 ? 4.083   -4.706  5.436   1.00 0.00 ? 116 VAL A HG11 5  
ATOM   4599  H HG12 . VAL A 1 52 ? 4.442   -6.401  5.767   1.00 0.00 ? 116 VAL A HG12 5  
ATOM   4600  H HG13 . VAL A 1 52 ? 3.880   -5.914  4.167   1.00 0.00 ? 116 VAL A HG13 5  
ATOM   4601  H HG21 . VAL A 1 52 ? 1.218   -6.031  7.472   1.00 0.00 ? 116 VAL A HG21 5  
ATOM   4602  H HG22 . VAL A 1 52 ? 2.925   -6.441  7.661   1.00 0.00 ? 116 VAL A HG22 5  
ATOM   4603  H HG23 . VAL A 1 52 ? 2.443   -4.759  7.447   1.00 0.00 ? 116 VAL A HG23 5  
ATOM   4604  N N    . THR A 1 53 ? 1.775   -4.344  2.659   1.00 0.00 ? 117 THR A N    5  
ATOM   4605  C CA   . THR A 1 53 ? 1.790   -4.514  1.241   1.00 0.00 ? 117 THR A CA   5  
ATOM   4606  C C    . THR A 1 53 ? 3.078   -3.904  0.666   1.00 0.00 ? 117 THR A C    5  
ATOM   4607  O O    . THR A 1 53 ? 3.574   -2.903  1.190   1.00 0.00 ? 117 THR A O    5  
ATOM   4608  C CB   . THR A 1 53 ? 0.501   -3.905  0.592   1.00 0.00 ? 117 THR A CB   5  
ATOM   4609  O OG1  . THR A 1 53 ? 0.385   -4.287  -0.789  1.00 0.00 ? 117 THR A OG1  5  
ATOM   4610  C CG2  . THR A 1 53 ? 0.487   -2.393  0.703   1.00 0.00 ? 117 THR A CG2  5  
ATOM   4611  H H    . THR A 1 53 ? 2.052   -3.484  3.059   1.00 0.00 ? 117 THR A H    5  
ATOM   4612  H HA   . THR A 1 53 ? 1.809   -5.576  1.052   1.00 0.00 ? 117 THR A HA   5  
ATOM   4613  H HB   . THR A 1 53 ? -0.355  -4.298  1.120   1.00 0.00 ? 117 THR A HB   5  
ATOM   4614  H HG1  . THR A 1 53 ? -0.442  -4.778  -0.859  1.00 0.00 ? 117 THR A HG1  5  
ATOM   4615  H HG21 . THR A 1 53 ? 1.351   -1.992  0.195   1.00 0.00 ? 117 THR A HG21 5  
ATOM   4616  H HG22 . THR A 1 53 ? -0.410  -2.001  0.249   1.00 0.00 ? 117 THR A HG22 5  
ATOM   4617  H HG23 . THR A 1 53 ? 0.519   -2.111  1.745   1.00 0.00 ? 117 THR A HG23 5  
ATOM   4618  N N    . PRO A 1 54 ? 3.703   -4.553  -0.332  1.00 0.00 ? 118 PRO A N    5  
ATOM   4619  C CA   . PRO A 1 54 ? 4.926   -4.053  -0.946  1.00 0.00 ? 118 PRO A CA   5  
ATOM   4620  C C    . PRO A 1 54 ? 4.726   -2.687  -1.590  1.00 0.00 ? 118 PRO A C    5  
ATOM   4621  O O    . PRO A 1 54 ? 3.650   -2.385  -2.094  1.00 0.00 ? 118 PRO A O    5  
ATOM   4622  C CB   . PRO A 1 54 ? 5.262   -5.105  -2.009  1.00 0.00 ? 118 PRO A CB   5  
ATOM   4623  C CG   . PRO A 1 54 ? 3.989   -5.807  -2.263  1.00 0.00 ? 118 PRO A CG   5  
ATOM   4624  C CD   . PRO A 1 54 ? 3.250   -5.800  -0.961  1.00 0.00 ? 118 PRO A CD   5  
ATOM   4625  H HA   . PRO A 1 54 ? 5.736   -3.989  -0.239  1.00 0.00 ? 118 PRO A HA   5  
ATOM   4626  H HB2  . PRO A 1 54 ? 5.635   -4.620  -2.899  1.00 0.00 ? 118 PRO A HB2  5  
ATOM   4627  H HB3  . PRO A 1 54 ? 6.008   -5.787  -1.630  1.00 0.00 ? 118 PRO A HB3  5  
ATOM   4628  H HG2  . PRO A 1 54 ? 3.428   -5.271  -3.014  1.00 0.00 ? 118 PRO A HG2  5  
ATOM   4629  H HG3  . PRO A 1 54 ? 4.175   -6.818  -2.592  1.00 0.00 ? 118 PRO A HG3  5  
ATOM   4630  H HD2  . PRO A 1 54 ? 2.186   -5.771  -1.140  1.00 0.00 ? 118 PRO A HD2  5  
ATOM   4631  H HD3  . PRO A 1 54 ? 3.502   -6.656  -0.357  1.00 0.00 ? 118 PRO A HD3  5  
ATOM   4632  N N    . LEU A 1 55 ? 5.776   -1.883  -1.580  1.00 0.00 ? 119 LEU A N    5  
ATOM   4633  C CA   . LEU A 1 55 ? 5.777   -0.529  -2.166  1.00 0.00 ? 119 LEU A CA   5  
ATOM   4634  C C    . LEU A 1 55 ? 5.398   -0.570  -3.640  1.00 0.00 ? 119 LEU A C    5  
ATOM   4635  O O    . LEU A 1 55 ? 4.889   0.392   -4.185  1.00 0.00 ? 119 LEU A O    5  
ATOM   4636  C CB   . LEU A 1 55 ? 7.151   0.123   -2.009  1.00 0.00 ? 119 LEU A CB   5  
ATOM   4637  C CG   . LEU A 1 55 ? 7.700   0.250   -0.585  1.00 0.00 ? 119 LEU A CG   5  
ATOM   4638  C CD1  . LEU A 1 55 ? 9.075   0.891   -0.595  1.00 0.00 ? 119 LEU A CD1  5  
ATOM   4639  C CD2  . LEU A 1 55 ? 6.756   1.031   0.312   1.00 0.00 ? 119 LEU A CD2  5  
ATOM   4640  H H    . LEU A 1 55 ? 6.592   -2.197  -1.128  1.00 0.00 ? 119 LEU A H    5  
ATOM   4641  H HA   . LEU A 1 55 ? 5.043   0.070   -1.653  1.00 0.00 ? 119 LEU A HA   5  
ATOM   4642  H HB2  . LEU A 1 55 ? 7.850   -0.473  -2.574  1.00 0.00 ? 119 LEU A HB2  5  
ATOM   4643  H HB3  . LEU A 1 55 ? 7.117   1.104   -2.455  1.00 0.00 ? 119 LEU A HB3  5  
ATOM   4644  H HG   . LEU A 1 55 ? 7.799   -0.749  -0.189  1.00 0.00 ? 119 LEU A HG   5  
ATOM   4645  H HD11 . LEU A 1 55 ? 9.013   1.868   -1.054  1.00 0.00 ? 119 LEU A HD11 5  
ATOM   4646  H HD12 . LEU A 1 55 ? 9.434   0.991   0.419   1.00 0.00 ? 119 LEU A HD12 5  
ATOM   4647  H HD13 . LEU A 1 55 ? 9.757   0.273   -1.160  1.00 0.00 ? 119 LEU A HD13 5  
ATOM   4648  H HD21 . LEU A 1 55 ? 5.809   0.516   0.371   1.00 0.00 ? 119 LEU A HD21 5  
ATOM   4649  H HD22 . LEU A 1 55 ? 7.183   1.110   1.301   1.00 0.00 ? 119 LEU A HD22 5  
ATOM   4650  H HD23 . LEU A 1 55 ? 6.602   2.021   -0.091  1.00 0.00 ? 119 LEU A HD23 5  
ATOM   4651  N N    . LEU A 1 56 ? 5.661   -1.707  -4.266  1.00 0.00 ? 120 LEU A N    5  
ATOM   4652  C CA   . LEU A 1 56 ? 5.339   -1.937  -5.668  1.00 0.00 ? 120 LEU A CA   5  
ATOM   4653  C C    . LEU A 1 56 ? 3.818   -1.939  -5.868  1.00 0.00 ? 120 LEU A C    5  
ATOM   4654  O O    . LEU A 1 56 ? 3.306   -1.582  -6.931  1.00 0.00 ? 120 LEU A O    5  
ATOM   4655  C CB   . LEU A 1 56 ? 5.970   -3.272  -6.122  1.00 0.00 ? 120 LEU A CB   5  
ATOM   4656  C CG   . LEU A 1 56 ? 5.271   -4.575  -5.702  1.00 0.00 ? 120 LEU A CG   5  
ATOM   4657  C CD1  . LEU A 1 56 ? 4.252   -4.974  -6.749  1.00 0.00 ? 120 LEU A CD1  5  
ATOM   4658  C CD2  . LEU A 1 56 ? 6.280   -5.686  -5.471  1.00 0.00 ? 120 LEU A CD2  5  
ATOM   4659  H H    . LEU A 1 56 ? 6.096   -2.410  -3.742  1.00 0.00 ? 120 LEU A H    5  
ATOM   4660  H HA   . LEU A 1 56 ? 5.752   -1.137  -6.256  1.00 0.00 ? 120 LEU A HA   5  
ATOM   4661  H HB2  . LEU A 1 56 ? 6.015   -3.270  -7.199  1.00 0.00 ? 120 LEU A HB2  5  
ATOM   4662  H HB3  . LEU A 1 56 ? 6.977   -3.300  -5.734  1.00 0.00 ? 120 LEU A HB3  5  
ATOM   4663  H HG   . LEU A 1 56 ? 4.709   -4.407  -4.793  1.00 0.00 ? 120 LEU A HG   5  
ATOM   4664  H HD11 . LEU A 1 56 ? 3.597   -4.126  -6.889  1.00 0.00 ? 120 LEU A HD11 5  
ATOM   4665  H HD12 . LEU A 1 56 ? 4.775   -5.177  -7.672  1.00 0.00 ? 120 LEU A HD12 5  
ATOM   4666  H HD13 . LEU A 1 56 ? 3.693   -5.841  -6.433  1.00 0.00 ? 120 LEU A HD13 5  
ATOM   4667  H HD21 . LEU A 1 56 ? 6.961   -5.393  -4.687  1.00 0.00 ? 120 LEU A HD21 5  
ATOM   4668  H HD22 . LEU A 1 56 ? 5.762   -6.587  -5.178  1.00 0.00 ? 120 LEU A HD22 5  
ATOM   4669  H HD23 . LEU A 1 56 ? 6.833   -5.867  -6.381  1.00 0.00 ? 120 LEU A HD23 5  
ATOM   4670  N N    . ASN A 1 57 ? 3.115   -2.327  -4.821  1.00 0.00 ? 121 ASN A N    5  
ATOM   4671  C CA   . ASN A 1 57 ? 1.668   -2.406  -4.833  1.00 0.00 ? 121 ASN A CA   5  
ATOM   4672  C C    . ASN A 1 57 ? 1.061   -1.099  -4.470  1.00 0.00 ? 121 ASN A C    5  
ATOM   4673  O O    . ASN A 1 57 ? -0.156  -0.924  -4.577  1.00 0.00 ? 121 ASN A O    5  
ATOM   4674  C CB   . ASN A 1 57 ? 1.136   -3.472  -3.878  1.00 0.00 ? 121 ASN A CB   5  
ATOM   4675  C CG   . ASN A 1 57 ? 1.130   -4.862  -4.429  1.00 0.00 ? 121 ASN A CG   5  
ATOM   4676  O OD1  . ASN A 1 57 ? 1.082   -5.072  -5.635  1.00 0.00 ? 121 ASN A OD1  5  
ATOM   4677  N ND2  . ASN A 1 57 ? 1.083   -5.816  -3.554  1.00 0.00 ? 121 ASN A ND2  5  
ATOM   4678  H H    . ASN A 1 57 ? 3.582   -2.541  -3.986  1.00 0.00 ? 121 ASN A H    5  
ATOM   4679  H HA   . ASN A 1 57 ? 1.360   -2.665  -5.834  1.00 0.00 ? 121 ASN A HA   5  
ATOM   4680  H HB2  . ASN A 1 57 ? 1.786   -3.486  -3.016  1.00 0.00 ? 121 ASN A HB2  5  
ATOM   4681  H HB3  . ASN A 1 57 ? 0.148   -3.232  -3.531  1.00 0.00 ? 121 ASN A HB3  5  
ATOM   4682  H HD21 . ASN A 1 57 ? 1.043   -5.561  -2.607  1.00 0.00 ? 121 ASN A HD21 5  
ATOM   4683  H HD22 . ASN A 1 57 ? 1.112   -6.743  -3.872  1.00 0.00 ? 121 ASN A HD22 5  
ATOM   4684  N N    . LEU A 1 58 ? 1.879   -0.179  -4.033  1.00 0.00 ? 122 LEU A N    5  
ATOM   4685  C CA   . LEU A 1 58 ? 1.386   1.098   -3.682  1.00 0.00 ? 122 LEU A CA   5  
ATOM   4686  C C    . LEU A 1 58 ? 1.410   1.962   -4.893  1.00 0.00 ? 122 LEU A C    5  
ATOM   4687  O O    . LEU A 1 58 ? 2.409   2.040   -5.608  1.00 0.00 ? 122 LEU A O    5  
ATOM   4688  C CB   . LEU A 1 58 ? 2.209   1.705   -2.556  1.00 0.00 ? 122 LEU A CB   5  
ATOM   4689  C CG   . LEU A 1 58 ? 2.182   0.955   -1.235  1.00 0.00 ? 122 LEU A CG   5  
ATOM   4690  C CD1  . LEU A 1 58 ? 3.025   1.673   -0.206  1.00 0.00 ? 122 LEU A CD1  5  
ATOM   4691  C CD2  . LEU A 1 58 ? 0.759   0.814   -0.744  1.00 0.00 ? 122 LEU A CD2  5  
ATOM   4692  H H    . LEU A 1 58 ? 2.844   -0.343  -3.984  1.00 0.00 ? 122 LEU A H    5  
ATOM   4693  H HA   . LEU A 1 58 ? 0.364   0.989   -3.354  1.00 0.00 ? 122 LEU A HA   5  
ATOM   4694  H HB2  . LEU A 1 58 ? 3.238   1.744   -2.884  1.00 0.00 ? 122 LEU A HB2  5  
ATOM   4695  H HB3  . LEU A 1 58 ? 1.863   2.713   -2.380  1.00 0.00 ? 122 LEU A HB3  5  
ATOM   4696  H HG   . LEU A 1 58 ? 2.593   -0.033  -1.377  1.00 0.00 ? 122 LEU A HG   5  
ATOM   4697  H HD11 . LEU A 1 58 ? 2.625   2.664   -0.052  1.00 0.00 ? 122 LEU A HD11 5  
ATOM   4698  H HD12 . LEU A 1 58 ? 2.998   1.126   0.723   1.00 0.00 ? 122 LEU A HD12 5  
ATOM   4699  H HD13 . LEU A 1 58 ? 4.045   1.746   -0.556  1.00 0.00 ? 122 LEU A HD13 5  
ATOM   4700  H HD21 . LEU A 1 58 ? 0.183   0.258   -1.469  1.00 0.00 ? 122 LEU A HD21 5  
ATOM   4701  H HD22 . LEU A 1 58 ? 0.753   0.281   0.196   1.00 0.00 ? 122 LEU A HD22 5  
ATOM   4702  H HD23 . LEU A 1 58 ? 0.322   1.792   -0.615  1.00 0.00 ? 122 LEU A HD23 5  
ATOM   4703  N N    . LYS A 1 59 ? 0.310   2.568   -5.141  1.00 0.00 ? 123 LYS A N    5  
ATOM   4704  C CA   . LYS A 1 59 ? 0.139   3.401   -6.278  1.00 0.00 ? 123 LYS A CA   5  
ATOM   4705  C C    . LYS A 1 59 ? -0.103  4.808   -5.790  1.00 0.00 ? 123 LYS A C    5  
ATOM   4706  O O    . LYS A 1 59 ? -0.486  4.995   -4.635  1.00 0.00 ? 123 LYS A O    5  
ATOM   4707  C CB   . LYS A 1 59 ? -1.054  2.912   -7.132  1.00 0.00 ? 123 LYS A CB   5  
ATOM   4708  C CG   . LYS A 1 59 ? -1.114  1.406   -7.360  1.00 0.00 ? 123 LYS A CG   5  
ATOM   4709  C CD   . LYS A 1 59 ? 0.136   0.843   -8.025  1.00 0.00 ? 123 LYS A CD   5  
ATOM   4710  C CE   . LYS A 1 59 ? 0.028   -0.668  -8.151  1.00 0.00 ? 123 LYS A CE   5  
ATOM   4711  N NZ   . LYS A 1 59 ? 1.250   -1.287  -8.706  1.00 0.00 ? 123 LYS A NZ   5  
ATOM   4712  H H    . LYS A 1 59 ? -0.426  2.457   -4.499  1.00 0.00 ? 123 LYS A H    5  
ATOM   4713  H HA   . LYS A 1 59 ? 1.042   3.378   -6.868  1.00 0.00 ? 123 LYS A HA   5  
ATOM   4714  H HB2  . LYS A 1 59 ? -1.975  3.219   -6.661  1.00 0.00 ? 123 LYS A HB2  5  
ATOM   4715  H HB3  . LYS A 1 59 ? -0.999  3.388   -8.100  1.00 0.00 ? 123 LYS A HB3  5  
ATOM   4716  H HG2  . LYS A 1 59 ? -1.230  0.928   -6.399  1.00 0.00 ? 123 LYS A HG2  5  
ATOM   4717  H HG3  . LYS A 1 59 ? -1.971  1.196   -7.980  1.00 0.00 ? 123 LYS A HG3  5  
ATOM   4718  H HD2  . LYS A 1 59 ? 0.232   1.278   -9.010  1.00 0.00 ? 123 LYS A HD2  5  
ATOM   4719  H HD3  . LYS A 1 59 ? 0.999   1.090   -7.426  1.00 0.00 ? 123 LYS A HD3  5  
ATOM   4720  H HE2  . LYS A 1 59 ? -0.152  -1.084  -7.171  1.00 0.00 ? 123 LYS A HE2  5  
ATOM   4721  H HE3  . LYS A 1 59 ? -0.808  -0.898  -8.794  1.00 0.00 ? 123 LYS A HE3  5  
ATOM   4722  H HZ1  . LYS A 1 59 ? 2.065   -1.145  -8.070  1.00 0.00 ? 123 LYS A HZ1  5  
ATOM   4723  H HZ2  . LYS A 1 59 ? 1.107   -2.311  -8.807  1.00 0.00 ? 123 LYS A HZ2  5  
ATOM   4724  H HZ3  . LYS A 1 59 ? 1.498   -0.892  -9.634  1.00 0.00 ? 123 LYS A HZ3  5  
ATOM   4725  N N    . PRO A 1 60 ? 0.110   5.804   -6.621  1.00 0.00 ? 124 PRO A N    5  
ATOM   4726  C CA   . PRO A 1 60 ? -0.193  7.164   -6.265  1.00 0.00 ? 124 PRO A CA   5  
ATOM   4727  C C    . PRO A 1 60 ? -1.704  7.391   -6.298  1.00 0.00 ? 124 PRO A C    5  
ATOM   4728  O O    . PRO A 1 60 ? -2.418  6.774   -7.113  1.00 0.00 ? 124 PRO A O    5  
ATOM   4729  C CB   . PRO A 1 60 ? 0.522   8.012   -7.318  1.00 0.00 ? 124 PRO A CB   5  
ATOM   4730  C CG   . PRO A 1 60 ? 0.879   7.084   -8.439  1.00 0.00 ? 124 PRO A CG   5  
ATOM   4731  C CD   . PRO A 1 60 ? 0.649   5.672   -7.969  1.00 0.00 ? 124 PRO A CD   5  
ATOM   4732  H HA   . PRO A 1 60 ? 0.166   7.398   -5.274  1.00 0.00 ? 124 PRO A HA   5  
ATOM   4733  H HB2  . PRO A 1 60 ? -0.145  8.791   -7.654  1.00 0.00 ? 124 PRO A HB2  5  
ATOM   4734  H HB3  . PRO A 1 60 ? 1.405   8.455   -6.881  1.00 0.00 ? 124 PRO A HB3  5  
ATOM   4735  H HG2  . PRO A 1 60 ? 0.257   7.290   -9.297  1.00 0.00 ? 124 PRO A HG2  5  
ATOM   4736  H HG3  . PRO A 1 60 ? 1.918   7.222   -8.701  1.00 0.00 ? 124 PRO A HG3  5  
ATOM   4737  H HD2  . PRO A 1 60 ? -0.088  5.172   -8.577  1.00 0.00 ? 124 PRO A HD2  5  
ATOM   4738  H HD3  . PRO A 1 60 ? 1.553   5.080   -7.954  1.00 0.00 ? 124 PRO A HD3  5  
ATOM   4739  N N    . VAL A 1 61 ? -2.191  8.229   -5.406  1.00 0.00 ? 125 VAL A N    5  
ATOM   4740  C CA   . VAL A 1 61 ? -3.620  8.500   -5.316  1.00 0.00 ? 125 VAL A CA   5  
ATOM   4741  C C    . VAL A 1 61 ? -4.121  9.260   -6.528  1.00 0.00 ? 125 VAL A C    5  
ATOM   4742  O O    . VAL A 1 61 ? -3.362  9.996   -7.180  1.00 0.00 ? 125 VAL A O    5  
ATOM   4743  C CB   . VAL A 1 61 ? -4.017  9.237   -4.015  1.00 0.00 ? 125 VAL A CB   5  
ATOM   4744  C CG1  . VAL A 1 61 ? -3.776  8.350   -2.814  1.00 0.00 ? 125 VAL A CG1  5  
ATOM   4745  C CG2  . VAL A 1 61 ? -3.262  10.550  -3.863  1.00 0.00 ? 125 VAL A CG2  5  
ATOM   4746  H H    . VAL A 1 61 ? -1.565  8.689   -4.806  1.00 0.00 ? 125 VAL A H    5  
ATOM   4747  H HA   . VAL A 1 61 ? -4.115  7.539   -5.327  1.00 0.00 ? 125 VAL A HA   5  
ATOM   4748  H HB   . VAL A 1 61 ? -5.074  9.452   -4.065  1.00 0.00 ? 125 VAL A HB   5  
ATOM   4749  H HG11 . VAL A 1 61 ? -2.727  8.103   -2.745  1.00 0.00 ? 125 VAL A HG11 5  
ATOM   4750  H HG12 . VAL A 1 61 ? -4.082  8.873   -1.920  1.00 0.00 ? 125 VAL A HG12 5  
ATOM   4751  H HG13 . VAL A 1 61 ? -4.355  7.444   -2.915  1.00 0.00 ? 125 VAL A HG13 5  
ATOM   4752  H HG21 . VAL A 1 61 ? -3.469  11.188  -4.709  1.00 0.00 ? 125 VAL A HG21 5  
ATOM   4753  H HG22 . VAL A 1 61 ? -3.575  11.040  -2.954  1.00 0.00 ? 125 VAL A HG22 5  
ATOM   4754  H HG23 . VAL A 1 61 ? -2.202  10.352  -3.816  1.00 0.00 ? 125 VAL A HG23 5  
ATOM   4755  N N    . GLU A 1 62 ? -5.369  9.086   -6.837  1.00 0.00 ? 126 GLU A N    5  
ATOM   4756  C CA   . GLU A 1 62 ? -5.937  9.688   -8.004  1.00 0.00 ? 126 GLU A CA   5  
ATOM   4757  C C    . GLU A 1 62 ? -6.939  10.769  -7.648  1.00 0.00 ? 126 GLU A C    5  
ATOM   4758  O O    . GLU A 1 62 ? -7.479  10.803  -6.525  1.00 0.00 ? 126 GLU A O    5  
ATOM   4759  C CB   . GLU A 1 62 ? -6.579  8.628   -8.895  1.00 0.00 ? 126 GLU A CB   5  
ATOM   4760  C CG   . GLU A 1 62 ? -7.646  7.787   -8.214  1.00 0.00 ? 126 GLU A CG   5  
ATOM   4761  C CD   . GLU A 1 62 ? -8.326  6.857   -9.176  1.00 0.00 ? 126 GLU A CD   5  
ATOM   4762  O OE1  . GLU A 1 62 ? -7.856  5.710   -9.374  1.00 0.00 ? 126 GLU A OE1  5  
ATOM   4763  O OE2  . GLU A 1 62 ? -9.341  7.246   -9.776  1.00 0.00 ? 126 GLU A OE2  5  
ATOM   4764  H H    . GLU A 1 62 ? -5.954  8.550   -6.257  1.00 0.00 ? 126 GLU A H    5  
ATOM   4765  H HA   . GLU A 1 62 ? -5.125  10.139  -8.554  1.00 0.00 ? 126 GLU A HA   5  
ATOM   4766  H HB2  . GLU A 1 62 ? -7.034  9.113   -9.745  1.00 0.00 ? 126 GLU A HB2  5  
ATOM   4767  H HB3  . GLU A 1 62 ? -5.799  7.966   -9.242  1.00 0.00 ? 126 GLU A HB3  5  
ATOM   4768  H HG2  . GLU A 1 62 ? -7.183  7.202   -7.432  1.00 0.00 ? 126 GLU A HG2  5  
ATOM   4769  H HG3  . GLU A 1 62 ? -8.386  8.445   -7.782  1.00 0.00 ? 126 GLU A HG3  5  
ATOM   4770  N N    . GLU A 1 63 ? -7.161  11.648  -8.587  1.00 0.00 ? 127 GLU A N    5  
ATOM   4771  C CA   . GLU A 1 63 ? -8.113  12.714  -8.478  1.00 0.00 ? 127 GLU A CA   5  
ATOM   4772  C C    . GLU A 1 63 ? -8.685  12.957  -9.868  1.00 0.00 ? 127 GLU A C    5  
ATOM   4773  O O    . GLU A 1 63 ? -8.017  13.542  -10.738 1.00 0.00 ? 127 GLU A O    5  
ATOM   4774  C CB   . GLU A 1 63 ? -7.437  13.991  -7.945  1.00 0.00 ? 127 GLU A CB   5  
ATOM   4775  C CG   . GLU A 1 63 ? -8.378  15.180  -7.765  1.00 0.00 ? 127 GLU A CG   5  
ATOM   4776  C CD   . GLU A 1 63 ? -9.446  14.937  -6.731  1.00 0.00 ? 127 GLU A CD   5  
ATOM   4777  O OE1  . GLU A 1 63 ? -10.477 14.309  -7.045  1.00 0.00 ? 127 GLU A OE1  5  
ATOM   4778  O OE2  . GLU A 1 63 ? -9.284  15.389  -5.592  1.00 0.00 ? 127 GLU A OE2  5  
ATOM   4779  H H    . GLU A 1 63 ? -6.643  11.594  -9.421  1.00 0.00 ? 127 GLU A H    5  
ATOM   4780  H HA   . GLU A 1 63 ? -8.898  12.406  -7.805  1.00 0.00 ? 127 GLU A HA   5  
ATOM   4781  H HB2  . GLU A 1 63 ? -6.992  13.770  -6.987  1.00 0.00 ? 127 GLU A HB2  5  
ATOM   4782  H HB3  . GLU A 1 63 ? -6.654  14.278  -8.632  1.00 0.00 ? 127 GLU A HB3  5  
ATOM   4783  H HG2  . GLU A 1 63 ? -7.801  16.039  -7.461  1.00 0.00 ? 127 GLU A HG2  5  
ATOM   4784  H HG3  . GLU A 1 63 ? -8.856  15.386  -8.711  1.00 0.00 ? 127 GLU A HG3  5  
ATOM   4785  N N    . GLY A 1 64 ? -9.870  12.478  -10.105 1.00 0.00 ? 128 GLY A N    5  
ATOM   4786  C CA   . GLY A 1 64 ? -10.460 12.622  -11.399 1.00 0.00 ? 128 GLY A CA   5  
ATOM   4787  C C    . GLY A 1 64 ? -11.313 11.444  -11.702 1.00 0.00 ? 128 GLY A C    5  
ATOM   4788  O O    . GLY A 1 64 ? -11.431 11.057  -12.881 1.00 0.00 ? 128 GLY A O    5  
ATOM   4789  O OXT  . GLY A 1 64 ? -11.886 10.868  -10.750 1.00 0.00 ? 128 GLY A OXT  5  
ATOM   4790  H H    . GLY A 1 64 ? -10.384 11.996  -9.420  1.00 0.00 ? 128 GLY A H    5  
ATOM   4791  H HA2  . GLY A 1 64 ? -11.061 13.519  -11.421 1.00 0.00 ? 128 GLY A HA2  5  
ATOM   4792  H HA3  . GLY A 1 64 ? -9.681  12.692  -12.144 1.00 0.00 ? 128 GLY A HA3  5  
HETATM 4793  N N    . 2MR B 2 .  ? -16.679 -4.480  -1.416  1.00 0.00 ? 201 2MR A N    5  
HETATM 4794  C CA   . 2MR B 2 .  ? -16.796 -3.586  -0.274  1.00 0.00 ? 201 2MR A CA   5  
HETATM 4795  C CB   . 2MR B 2 .  ? -15.522 -3.628  0.599   1.00 0.00 ? 201 2MR A CB   5  
HETATM 4796  C CG   . 2MR B 2 .  ? -15.588 -2.725  1.806   1.00 0.00 ? 201 2MR A CG   5  
HETATM 4797  C CD   . 2MR B 2 .  ? -14.263 -2.648  2.512   1.00 0.00 ? 201 2MR A CD   5  
HETATM 4798  N NE   . 2MR B 2 .  ? -13.220 -2.243  1.592   1.00 0.00 ? 201 2MR A NE   5  
HETATM 4799  C CZ   . 2MR B 2 .  ? -11.991 -1.998  1.924   1.00 0.00 ? 201 2MR A CZ   5  
HETATM 4800  N NH1  . 2MR B 2 .  ? -11.626 -2.122  3.243   1.00 0.00 ? 201 2MR A NH1  5  
HETATM 4801  C CQ1  . 2MR B 2 .  ? -10.333 -1.913  3.920   1.00 0.00 ? 201 2MR A CQ1  5  
HETATM 4802  N NH2  . 2MR B 2 .  ? -11.132 -1.666  0.927   1.00 0.00 ? 201 2MR A NH2  5  
HETATM 4803  C CQ2  . 2MR B 2 .  ? -9.714  -1.336  0.955   1.00 0.00 ? 201 2MR A CQ2  5  
HETATM 4804  C C    . 2MR B 2 .  ? -17.010 -2.186  -0.807  1.00 0.00 ? 201 2MR A C    5  
HETATM 4805  O O    . 2MR B 2 .  ? -18.043 -1.569  -0.503  1.00 0.00 ? 201 2MR A O    5  
HETATM 4806  O OXT  . 2MR B 2 .  ? -16.162 -1.705  -1.562  1.00 0.00 ? 201 2MR A OXT  5  
HETATM 4807  H H2   . 2MR B 2 .  ? -16.442 -5.460  -1.170  1.00 0.00 ? 201 2MR A H2   5  
HETATM 4808  H H    . 2MR B 2 .  ? -17.559 -4.459  -1.969  1.00 0.00 ? 201 2MR A H    5  
HETATM 4809  H H3   . 2MR B 2 .  ? -15.934 -4.098  -2.034  1.00 0.00 ? 201 2MR A H3   5  
HETATM 4810  H HA   . 2MR B 2 .  ? -17.657 -3.878  0.310   1.00 0.00 ? 201 2MR A HA   5  
HETATM 4811  H HB2  . 2MR B 2 .  ? -14.685 -3.291  0.007   1.00 0.00 ? 201 2MR A HB2  5  
HETATM 4812  H HB3  . 2MR B 2 .  ? -15.306 -4.627  0.954   1.00 0.00 ? 201 2MR A HB3  5  
HETATM 4813  H HG2  . 2MR B 2 .  ? -16.323 -3.132  2.482   1.00 0.00 ? 201 2MR A HG2  5  
HETATM 4814  H HG3  . 2MR B 2 .  ? -15.854 -1.733  1.476   1.00 0.00 ? 201 2MR A HG3  5  
HETATM 4815  H HD2  . 2MR B 2 .  ? -14.004 -3.607  2.936   1.00 0.00 ? 201 2MR A HD2  5  
HETATM 4816  H HD3  . 2MR B 2 .  ? -14.310 -1.898  3.291   1.00 0.00 ? 201 2MR A HD3  5  
HETATM 4817  H HE   . 2MR B 2 .  ? -13.497 -2.151  0.655   1.00 0.00 ? 201 2MR A HE   5  
HETATM 4818  H HQ11 . 2MR B 2 .  ? -9.635  -2.676  3.609   1.00 0.00 ? 201 2MR A HQ11 5  
HETATM 4819  H HQ12 . 2MR B 2 .  ? -9.949  -0.939  3.659   1.00 0.00 ? 201 2MR A HQ12 5  
HETATM 4820  H HQ13 . 2MR B 2 .  ? -10.473 -1.974  4.989   1.00 0.00 ? 201 2MR A HQ13 5  
HETATM 4821  H HH2  . 2MR B 2 .  ? -11.451 -1.635  -0.019  1.00 0.00 ? 201 2MR A HH2  5  
HETATM 4822  H HQ21 . 2MR B 2 .  ? -9.182  -2.084  1.525   1.00 0.00 ? 201 2MR A HQ21 5  
HETATM 4823  H HQ22 . 2MR B 2 .  ? -9.334  -1.325  -0.057  1.00 0.00 ? 201 2MR A HQ22 5  
HETATM 4824  H HQ23 . 2MR B 2 .  ? -9.573  -0.367  1.408   1.00 0.00 ? 201 2MR A HQ23 5  
HETATM 4825  H HH1  . 2MR B 2 .  ? -12.313 -2.402  3.921   1.00 0.00 ? 201 2MR A HH1  5  
ATOM   4826  N N    . ALA A 1 1  ? 18.024  -2.391  3.421   1.00 0.00 ? 65  ALA A N    6  
ATOM   4827  C CA   . ALA A 1 1  ? 19.156  -2.278  2.490   1.00 0.00 ? 65  ALA A CA   6  
ATOM   4828  C C    . ALA A 1 1  ? 18.984  -3.192  1.265   1.00 0.00 ? 65  ALA A C    6  
ATOM   4829  O O    . ALA A 1 1  ? 19.471  -2.881  0.178   1.00 0.00 ? 65  ALA A O    6  
ATOM   4830  C CB   . ALA A 1 1  ? 20.463  -2.610  3.194   1.00 0.00 ? 65  ALA A CB   6  
ATOM   4831  H H1   . ALA A 1 1  ? 17.888  -3.367  3.763   1.00 0.00 ? 65  ALA A H1   6  
ATOM   4832  H H2   . ALA A 1 1  ? 18.143  -1.770  4.246   1.00 0.00 ? 65  ALA A H2   6  
ATOM   4833  H H3   . ALA A 1 1  ? 17.146  -2.099  2.950   1.00 0.00 ? 65  ALA A H3   6  
ATOM   4834  H HA   . ALA A 1 1  ? 19.214  -1.254  2.151   1.00 0.00 ? 65  ALA A HA   6  
ATOM   4835  H HB1  . ALA A 1 1  ? 20.434  -3.638  3.521   1.00 0.00 ? 65  ALA A HB1  6  
ATOM   4836  H HB2  . ALA A 1 1  ? 21.282  -2.476  2.503   1.00 0.00 ? 65  ALA A HB2  6  
ATOM   4837  H HB3  . ALA A 1 1  ? 20.599  -1.962  4.046   1.00 0.00 ? 65  ALA A HB3  6  
ATOM   4838  N N    . SER A 1 2  ? 18.280  -4.298  1.439   1.00 0.00 ? 66  SER A N    6  
ATOM   4839  C CA   . SER A 1 2  ? 18.149  -5.299  0.400   1.00 0.00 ? 66  SER A CA   6  
ATOM   4840  C C    . SER A 1 2  ? 17.220  -4.859  -0.752  1.00 0.00 ? 66  SER A C    6  
ATOM   4841  O O    . SER A 1 2  ? 17.639  -4.810  -1.914  1.00 0.00 ? 66  SER A O    6  
ATOM   4842  C CB   . SER A 1 2  ? 17.630  -6.586  1.032   1.00 0.00 ? 66  SER A CB   6  
ATOM   4843  O OG   . SER A 1 2  ? 18.371  -6.886  2.223   1.00 0.00 ? 66  SER A OG   6  
ATOM   4844  H H    . SER A 1 2  ? 17.830  -4.488  2.295   1.00 0.00 ? 66  SER A H    6  
ATOM   4845  H HA   . SER A 1 2  ? 19.131  -5.502  0.002   1.00 0.00 ? 66  SER A HA   6  
ATOM   4846  H HB2  . SER A 1 2  ? 16.585  -6.465  1.280   1.00 0.00 ? 66  SER A HB2  6  
ATOM   4847  H HB3  . SER A 1 2  ? 17.743  -7.403  0.335   1.00 0.00 ? 66  SER A HB3  6  
ATOM   4848  H HG   . SER A 1 2  ? 18.047  -6.285  2.915   1.00 0.00 ? 66  SER A HG   6  
ATOM   4849  N N    . THR A 1 3  ? 16.002  -4.494  -0.423  1.00 0.00 ? 67  THR A N    6  
ATOM   4850  C CA   . THR A 1 3  ? 15.004  -4.231  -1.434  1.00 0.00 ? 67  THR A CA   6  
ATOM   4851  C C    . THR A 1 3  ? 14.927  -2.738  -1.777  1.00 0.00 ? 67  THR A C    6  
ATOM   4852  O O    . THR A 1 3  ? 14.491  -1.928  -0.959  1.00 0.00 ? 67  THR A O    6  
ATOM   4853  C CB   . THR A 1 3  ? 13.624  -4.731  -0.949  1.00 0.00 ? 67  THR A CB   6  
ATOM   4854  O OG1  . THR A 1 3  ? 13.765  -6.072  -0.419  1.00 0.00 ? 67  THR A OG1  6  
ATOM   4855  C CG2  . THR A 1 3  ? 12.626  -4.762  -2.101  1.00 0.00 ? 67  THR A CG2  6  
ATOM   4856  H H    . THR A 1 3  ? 15.764  -4.357  0.516   1.00 0.00 ? 67  THR A H    6  
ATOM   4857  H HA   . THR A 1 3  ? 15.271  -4.786  -2.320  1.00 0.00 ? 67  THR A HA   6  
ATOM   4858  H HB   . THR A 1 3  ? 13.260  -4.072  -0.173  1.00 0.00 ? 67  THR A HB   6  
ATOM   4859  H HG1  . THR A 1 3  ? 13.994  -5.987  0.517   1.00 0.00 ? 67  THR A HG1  6  
ATOM   4860  H HG21 . THR A 1 3  ? 12.989  -5.431  -2.867  1.00 0.00 ? 67  THR A HG21 6  
ATOM   4861  H HG22 . THR A 1 3  ? 11.671  -5.112  -1.741  1.00 0.00 ? 67  THR A HG22 6  
ATOM   4862  H HG23 . THR A 1 3  ? 12.518  -3.769  -2.512  1.00 0.00 ? 67  THR A HG23 6  
ATOM   4863  N N    . GLN A 1 4  ? 15.380  -2.386  -2.967  1.00 0.00 ? 68  GLN A N    6  
ATOM   4864  C CA   . GLN A 1 4  ? 15.309  -1.011  -3.439  1.00 0.00 ? 68  GLN A CA   6  
ATOM   4865  C C    . GLN A 1 4  ? 13.878  -0.645  -3.795  1.00 0.00 ? 68  GLN A C    6  
ATOM   4866  O O    . GLN A 1 4  ? 13.271  -1.294  -4.656  1.00 0.00 ? 68  GLN A O    6  
ATOM   4867  C CB   . GLN A 1 4  ? 16.199  -0.796  -4.657  1.00 0.00 ? 68  GLN A CB   6  
ATOM   4868  C CG   . GLN A 1 4  ? 17.675  -0.826  -4.358  1.00 0.00 ? 68  GLN A CG   6  
ATOM   4869  C CD   . GLN A 1 4  ? 18.508  -0.604  -5.592  1.00 0.00 ? 68  GLN A CD   6  
ATOM   4870  O OE1  . GLN A 1 4  ? 18.900  -1.556  -6.271  1.00 0.00 ? 68  GLN A OE1  6  
ATOM   4871  N NE2  . GLN A 1 4  ? 18.762  0.626   -5.916  1.00 0.00 ? 68  GLN A NE2  6  
ATOM   4872  H H    . GLN A 1 4  ? 15.771  -3.079  -3.541  1.00 0.00 ? 68  GLN A H    6  
ATOM   4873  H HA   . GLN A 1 4  ? 15.654  -0.376  -2.638  1.00 0.00 ? 68  GLN A HA   6  
ATOM   4874  H HB2  . GLN A 1 4  ? 15.989  -1.569  -5.381  1.00 0.00 ? 68  GLN A HB2  6  
ATOM   4875  H HB3  . GLN A 1 4  ? 15.961  0.164   -5.094  1.00 0.00 ? 68  GLN A HB3  6  
ATOM   4876  H HG2  . GLN A 1 4  ? 17.894  -0.046  -3.646  1.00 0.00 ? 68  GLN A HG2  6  
ATOM   4877  H HG3  . GLN A 1 4  ? 17.926  -1.787  -3.934  1.00 0.00 ? 68  GLN A HG3  6  
ATOM   4878  H HE21 . GLN A 1 4  ? 18.405  1.348   -5.351  1.00 0.00 ? 68  GLN A HE21 6  
ATOM   4879  H HE22 . GLN A 1 4  ? 19.299  0.794   -6.721  1.00 0.00 ? 68  GLN A HE22 6  
ATOM   4880  N N    . PRO A 1 5  ? 13.308  0.368   -3.131  1.00 0.00 ? 69  PRO A N    6  
ATOM   4881  C CA   . PRO A 1 5  ? 11.949  0.830   -3.411  1.00 0.00 ? 69  PRO A CA   6  
ATOM   4882  C C    . PRO A 1 5  ? 11.788  1.300   -4.851  1.00 0.00 ? 69  PRO A C    6  
ATOM   4883  O O    . PRO A 1 5  ? 12.642  2.025   -5.383  1.00 0.00 ? 69  PRO A O    6  
ATOM   4884  C CB   . PRO A 1 5  ? 11.782  2.028   -2.471  1.00 0.00 ? 69  PRO A CB   6  
ATOM   4885  C CG   . PRO A 1 5  ? 12.744  1.777   -1.377  1.00 0.00 ? 69  PRO A CG   6  
ATOM   4886  C CD   . PRO A 1 5  ? 13.924  1.129   -2.027  1.00 0.00 ? 69  PRO A CD   6  
ATOM   4887  H HA   . PRO A 1 5  ? 11.203  0.084   -3.187  1.00 0.00 ? 69  PRO A HA   6  
ATOM   4888  H HB2  . PRO A 1 5  ? 12.015  2.937   -3.005  1.00 0.00 ? 69  PRO A HB2  6  
ATOM   4889  H HB3  . PRO A 1 5  ? 10.766  2.069   -2.107  1.00 0.00 ? 69  PRO A HB3  6  
ATOM   4890  H HG2  . PRO A 1 5  ? 13.023  2.706   -0.906  1.00 0.00 ? 69  PRO A HG2  6  
ATOM   4891  H HG3  . PRO A 1 5  ? 12.292  1.102   -0.665  1.00 0.00 ? 69  PRO A HG3  6  
ATOM   4892  H HD2  . PRO A 1 5  ? 14.618  1.869   -2.398  1.00 0.00 ? 69  PRO A HD2  6  
ATOM   4893  H HD3  . PRO A 1 5  ? 14.407  0.463   -1.326  1.00 0.00 ? 69  PRO A HD3  6  
ATOM   4894  N N    . THR A 1 6  ? 10.718  0.883   -5.477  1.00 0.00 ? 70  THR A N    6  
ATOM   4895  C CA   . THR A 1 6  ? 10.411  1.325   -6.816  1.00 0.00 ? 70  THR A CA   6  
ATOM   4896  C C    . THR A 1 6  ? 9.836   2.740   -6.760  1.00 0.00 ? 70  THR A C    6  
ATOM   4897  O O    . THR A 1 6  ? 9.973   3.515   -7.689  1.00 0.00 ? 70  THR A O    6  
ATOM   4898  C CB   . THR A 1 6  ? 9.457   0.344   -7.567  1.00 0.00 ? 70  THR A CB   6  
ATOM   4899  O OG1  . THR A 1 6  ? 9.169   0.824   -8.887  1.00 0.00 ? 70  THR A OG1  6  
ATOM   4900  C CG2  . THR A 1 6  ? 8.156   0.134   -6.814  1.00 0.00 ? 70  THR A CG2  6  
ATOM   4901  H H    . THR A 1 6  ? 10.142  0.230   -5.023  1.00 0.00 ? 70  THR A H    6  
ATOM   4902  H HA   . THR A 1 6  ? 11.354  1.379   -7.342  1.00 0.00 ? 70  THR A HA   6  
ATOM   4903  H HB   . THR A 1 6  ? 9.965   -0.604  -7.652  1.00 0.00 ? 70  THR A HB   6  
ATOM   4904  H HG1  . THR A 1 6  ? 9.686   1.624   -9.054  1.00 0.00 ? 70  THR A HG1  6  
ATOM   4905  H HG21 . THR A 1 6  ? 7.692   1.095   -6.658  1.00 0.00 ? 70  THR A HG21 6  
ATOM   4906  H HG22 . THR A 1 6  ? 7.499   -0.490  -7.401  1.00 0.00 ? 70  THR A HG22 6  
ATOM   4907  H HG23 . THR A 1 6  ? 8.352   -0.333  -5.861  1.00 0.00 ? 70  THR A HG23 6  
ATOM   4908  N N    . HIS A 1 7  ? 9.222   3.060   -5.650  1.00 0.00 ? 71  HIS A N    6  
ATOM   4909  C CA   . HIS A 1 7  ? 8.740   4.387   -5.377  1.00 0.00 ? 71  HIS A CA   6  
ATOM   4910  C C    . HIS A 1 7  ? 9.182   4.690   -3.978  1.00 0.00 ? 71  HIS A C    6  
ATOM   4911  O O    . HIS A 1 7  ? 9.075   3.817   -3.111  1.00 0.00 ? 71  HIS A O    6  
ATOM   4912  C CB   . HIS A 1 7  ? 7.195   4.495   -5.446  1.00 0.00 ? 71  HIS A CB   6  
ATOM   4913  C CG   . HIS A 1 7  ? 6.562   4.201   -6.777  1.00 0.00 ? 71  HIS A CG   6  
ATOM   4914  N ND1  . HIS A 1 7  ? 6.342   5.141   -7.760  1.00 0.00 ? 71  HIS A ND1  6  
ATOM   4915  C CD2  . HIS A 1 7  ? 6.074   3.044   -7.264  1.00 0.00 ? 71  HIS A CD2  6  
ATOM   4916  C CE1  . HIS A 1 7  ? 5.744   4.541   -8.788  1.00 0.00 ? 71  HIS A CE1  6  
ATOM   4917  N NE2  . HIS A 1 7  ? 5.557   3.257   -8.539  1.00 0.00 ? 71  HIS A NE2  6  
ATOM   4918  H H    . HIS A 1 7  ? 9.100   2.395   -4.942  1.00 0.00 ? 71  HIS A H    6  
ATOM   4919  H HA   . HIS A 1 7  ? 9.197   5.068   -6.078  1.00 0.00 ? 71  HIS A HA   6  
ATOM   4920  H HB2  . HIS A 1 7  ? 6.775   3.794   -4.739  1.00 0.00 ? 71  HIS A HB2  6  
ATOM   4921  H HB3  . HIS A 1 7  ? 6.906   5.491   -5.145  1.00 0.00 ? 71  HIS A HB3  6  
ATOM   4922  H HD1  . HIS A 1 7  ? 6.572   6.095   -7.726  1.00 0.00 ? 71  HIS A HD1  6  
ATOM   4923  H HD2  . HIS A 1 7  ? 6.065   2.103   -6.740  1.00 0.00 ? 71  HIS A HD2  6  
ATOM   4924  H HE1  . HIS A 1 7  ? 5.453   5.037   -9.702  1.00 0.00 ? 71  HIS A HE1  6  
ATOM   4925  N N    . SER A 1 8  ? 9.718   5.850   -3.755  1.00 0.00 ? 72  SER A N    6  
ATOM   4926  C CA   . SER A 1 8  ? 10.143  6.217   -2.436  1.00 0.00 ? 72  SER A CA   6  
ATOM   4927  C C    . SER A 1 8  ? 8.943   6.733   -1.660  1.00 0.00 ? 72  SER A C    6  
ATOM   4928  O O    . SER A 1 8  ? 8.416   7.803   -1.950  1.00 0.00 ? 72  SER A O    6  
ATOM   4929  C CB   . SER A 1 8  ? 11.262  7.258   -2.495  1.00 0.00 ? 72  SER A CB   6  
ATOM   4930  O OG   . SER A 1 8  ? 12.393  6.760   -3.217  1.00 0.00 ? 72  SER A OG   6  
ATOM   4931  H H    . SER A 1 8  ? 9.814   6.497   -4.487  1.00 0.00 ? 72  SER A H    6  
ATOM   4932  H HA   . SER A 1 8  ? 10.504  5.323   -1.950  1.00 0.00 ? 72  SER A HA   6  
ATOM   4933  H HB2  . SER A 1 8  ? 10.898  8.148   -2.988  1.00 0.00 ? 72  SER A HB2  6  
ATOM   4934  H HB3  . SER A 1 8  ? 11.573  7.506   -1.491  1.00 0.00 ? 72  SER A HB3  6  
ATOM   4935  H HG   . SER A 1 8  ? 12.167  6.787   -4.157  1.00 0.00 ? 72  SER A HG   6  
ATOM   4936  N N    . TRP A 1 9  ? 8.494   5.945   -0.730  1.00 0.00 ? 73  TRP A N    6  
ATOM   4937  C CA   . TRP A 1 9  ? 7.339   6.254   0.059   1.00 0.00 ? 73  TRP A CA   6  
ATOM   4938  C C    . TRP A 1 9  ? 7.734   6.691   1.437   1.00 0.00 ? 73  TRP A C    6  
ATOM   4939  O O    . TRP A 1 9  ? 8.811   6.323   1.936   1.00 0.00 ? 73  TRP A O    6  
ATOM   4940  C CB   . TRP A 1 9  ? 6.428   5.039   0.155   1.00 0.00 ? 73  TRP A CB   6  
ATOM   4941  C CG   . TRP A 1 9  ? 5.783   4.665   -1.137  1.00 0.00 ? 73  TRP A CG   6  
ATOM   4942  C CD1  . TRP A 1 9  ? 6.063   3.585   -1.919  1.00 0.00 ? 73  TRP A CD1  6  
ATOM   4943  C CD2  . TRP A 1 9  ? 4.751   5.389   -1.801  1.00 0.00 ? 73  TRP A CD2  6  
ATOM   4944  N NE1  . TRP A 1 9  ? 5.244   3.579   -3.019  1.00 0.00 ? 73  TRP A NE1  6  
ATOM   4945  C CE2  . TRP A 1 9  ? 4.434   4.685   -2.972  1.00 0.00 ? 73  TRP A CE2  6  
ATOM   4946  C CE3  . TRP A 1 9  ? 4.057   6.569   -1.511  1.00 0.00 ? 73  TRP A CE3  6  
ATOM   4947  C CZ2  . TRP A 1 9  ? 3.456   5.120   -3.856  1.00 0.00 ? 73  TRP A CZ2  6  
ATOM   4948  C CZ3  . TRP A 1 9  ? 3.089   6.998   -2.388  1.00 0.00 ? 73  TRP A CZ3  6  
ATOM   4949  C CH2  . TRP A 1 9  ? 2.797   6.276   -3.546  1.00 0.00 ? 73  TRP A CH2  6  
ATOM   4950  H H    . TRP A 1 9  ? 8.967   5.107   -0.531  1.00 0.00 ? 73  TRP A H    6  
ATOM   4951  H HA   . TRP A 1 9  ? 6.786   7.047   -0.420  1.00 0.00 ? 73  TRP A HA   6  
ATOM   4952  H HB2  . TRP A 1 9  ? 7.005   4.191   0.495   1.00 0.00 ? 73  TRP A HB2  6  
ATOM   4953  H HB3  . TRP A 1 9  ? 5.650   5.250   0.871   1.00 0.00 ? 73  TRP A HB3  6  
ATOM   4954  H HD1  . TRP A 1 9  ? 6.812   2.842   -1.687  1.00 0.00 ? 73  TRP A HD1  6  
ATOM   4955  H HE1  . TRP A 1 9  ? 5.237   2.900   -3.727  1.00 0.00 ? 73  TRP A HE1  6  
ATOM   4956  H HE3  . TRP A 1 9  ? 4.271   7.139   -0.619  1.00 0.00 ? 73  TRP A HE3  6  
ATOM   4957  H HZ2  . TRP A 1 9  ? 3.215   4.573   -4.756  1.00 0.00 ? 73  TRP A HZ2  6  
ATOM   4958  H HZ3  . TRP A 1 9  ? 2.542   7.907   -2.185  1.00 0.00 ? 73  TRP A HZ3  6  
ATOM   4959  H HH2  . TRP A 1 9  ? 2.028   6.648   -4.203  1.00 0.00 ? 73  TRP A HH2  6  
ATOM   4960  N N    . LYS A 1 10 ? 6.917   7.511   2.042   1.00 0.00 ? 74  LYS A N    6  
ATOM   4961  C CA   . LYS A 1 10 ? 7.127   7.908   3.402   1.00 0.00 ? 74  LYS A CA   6  
ATOM   4962  C C    . LYS A 1 10 ? 5.863   7.695   4.202   1.00 0.00 ? 74  LYS A C    6  
ATOM   4963  O O    . LYS A 1 10 ? 4.775   7.527   3.641   1.00 0.00 ? 74  LYS A O    6  
ATOM   4964  C CB   . LYS A 1 10 ? 7.580   9.365   3.530   1.00 0.00 ? 74  LYS A CB   6  
ATOM   4965  C CG   . LYS A 1 10 ? 6.596   10.391  2.984   1.00 0.00 ? 74  LYS A CG   6  
ATOM   4966  C CD   . LYS A 1 10 ? 7.012   11.805  3.360   1.00 0.00 ? 74  LYS A CD   6  
ATOM   4967  C CE   . LYS A 1 10 ? 6.742   12.129  4.839   1.00 0.00 ? 74  LYS A CE   6  
ATOM   4968  N NZ   . LYS A 1 10 ? 5.302   12.286  5.129   1.00 0.00 ? 74  LYS A NZ   6  
ATOM   4969  H H    . LYS A 1 10 ? 6.134   7.862   1.566   1.00 0.00 ? 74  LYS A H    6  
ATOM   4970  H HA   . LYS A 1 10 ? 7.897   7.265   3.803   1.00 0.00 ? 74  LYS A HA   6  
ATOM   4971  H HB2  . LYS A 1 10 ? 7.756   9.585   4.571   1.00 0.00 ? 74  LYS A HB2  6  
ATOM   4972  H HB3  . LYS A 1 10 ? 8.510   9.473   2.992   1.00 0.00 ? 74  LYS A HB3  6  
ATOM   4973  H HG2  . LYS A 1 10 ? 6.568   10.311  1.908   1.00 0.00 ? 74  LYS A HG2  6  
ATOM   4974  H HG3  . LYS A 1 10 ? 5.616   10.183  3.388   1.00 0.00 ? 74  LYS A HG3  6  
ATOM   4975  H HD2  . LYS A 1 10 ? 8.070   11.909  3.173   1.00 0.00 ? 74  LYS A HD2  6  
ATOM   4976  H HD3  . LYS A 1 10 ? 6.473   12.505  2.739   1.00 0.00 ? 74  LYS A HD3  6  
ATOM   4977  H HE2  . LYS A 1 10 ? 7.087   11.306  5.450   1.00 0.00 ? 74  LYS A HE2  6  
ATOM   4978  H HE3  . LYS A 1 10 ? 7.259   13.034  5.118   1.00 0.00 ? 74  LYS A HE3  6  
ATOM   4979  H HZ1  . LYS A 1 10 ? 4.845   12.952  4.472   1.00 0.00 ? 74  LYS A HZ1  6  
ATOM   4980  H HZ2  . LYS A 1 10 ? 4.789   11.381  5.108   1.00 0.00 ? 74  LYS A HZ2  6  
ATOM   4981  H HZ3  . LYS A 1 10 ? 5.173   12.680  6.084   1.00 0.00 ? 74  LYS A HZ3  6  
ATOM   4982  N N    . VAL A 1 11 ? 6.025   7.672   5.492   1.00 0.00 ? 75  VAL A N    6  
ATOM   4983  C CA   . VAL A 1 11 ? 4.940   7.558   6.425   1.00 0.00 ? 75  VAL A CA   6  
ATOM   4984  C C    . VAL A 1 11 ? 4.022   8.788   6.302   1.00 0.00 ? 75  VAL A C    6  
ATOM   4985  O O    . VAL A 1 11 ? 4.502   9.903   6.107   1.00 0.00 ? 75  VAL A O    6  
ATOM   4986  C CB   . VAL A 1 11 ? 5.513   7.449   7.864   1.00 0.00 ? 75  VAL A CB   6  
ATOM   4987  C CG1  . VAL A 1 11 ? 4.422   7.526   8.902   1.00 0.00 ? 75  VAL A CG1  6  
ATOM   4988  C CG2  . VAL A 1 11 ? 6.306   6.156   8.022   1.00 0.00 ? 75  VAL A CG2  6  
ATOM   4989  H H    . VAL A 1 11 ? 6.934   7.745   5.855   1.00 0.00 ? 75  VAL A H    6  
ATOM   4990  H HA   . VAL A 1 11 ? 4.386   6.659   6.201   1.00 0.00 ? 75  VAL A HA   6  
ATOM   4991  H HB   . VAL A 1 11 ? 6.189   8.275   8.026   1.00 0.00 ? 75  VAL A HB   6  
ATOM   4992  H HG11 . VAL A 1 11 ? 3.705   6.735   8.740   1.00 0.00 ? 75  VAL A HG11 6  
ATOM   4993  H HG12 . VAL A 1 11 ? 4.852   7.453   9.890   1.00 0.00 ? 75  VAL A HG12 6  
ATOM   4994  H HG13 . VAL A 1 11 ? 3.936   8.484   8.784   1.00 0.00 ? 75  VAL A HG13 6  
ATOM   4995  H HG21 . VAL A 1 11 ? 7.121   6.140   7.315   1.00 0.00 ? 75  VAL A HG21 6  
ATOM   4996  H HG22 . VAL A 1 11 ? 6.700   6.090   9.025   1.00 0.00 ? 75  VAL A HG22 6  
ATOM   4997  H HG23 . VAL A 1 11 ? 5.658   5.311   7.836   1.00 0.00 ? 75  VAL A HG23 6  
ATOM   4998  N N    . GLY A 1 12 ? 2.726   8.571   6.355   1.00 0.00 ? 76  GLY A N    6  
ATOM   4999  C CA   . GLY A 1 12 ? 1.780   9.665   6.295   1.00 0.00 ? 76  GLY A CA   6  
ATOM   5000  C C    . GLY A 1 12 ? 1.446   10.091  4.881   1.00 0.00 ? 76  GLY A C    6  
ATOM   5001  O O    . GLY A 1 12 ? 0.780   11.120  4.673   1.00 0.00 ? 76  GLY A O    6  
ATOM   5002  H H    . GLY A 1 12 ? 2.386   7.653   6.469   1.00 0.00 ? 76  GLY A H    6  
ATOM   5003  H HA2  . GLY A 1 12 ? 0.868   9.362   6.787   1.00 0.00 ? 76  GLY A HA2  6  
ATOM   5004  H HA3  . GLY A 1 12 ? 2.196   10.510  6.824   1.00 0.00 ? 76  GLY A HA3  6  
ATOM   5005  N N    . ASP A 1 13 ? 1.894   9.323   3.911   1.00 0.00 ? 77  ASP A N    6  
ATOM   5006  C CA   . ASP A 1 13 ? 1.626   9.645   2.516   1.00 0.00 ? 77  ASP A CA   6  
ATOM   5007  C C    . ASP A 1 13 ? 0.388   8.936   2.107   1.00 0.00 ? 77  ASP A C    6  
ATOM   5008  O O    . ASP A 1 13 ? 0.006   7.925   2.732   1.00 0.00 ? 77  ASP A O    6  
ATOM   5009  C CB   . ASP A 1 13 ? 2.736   9.145   1.619   1.00 0.00 ? 77  ASP A CB   6  
ATOM   5010  C CG   . ASP A 1 13 ? 3.011   10.065  0.437   1.00 0.00 ? 77  ASP A CG   6  
ATOM   5011  O OD1  . ASP A 1 13 ? 2.133   10.259  -0.413  1.00 0.00 ? 77  ASP A OD1  6  
ATOM   5012  O OD2  . ASP A 1 13 ? 4.118   10.655  0.384   1.00 0.00 ? 77  ASP A OD2  6  
ATOM   5013  H H    . ASP A 1 13 ? 2.409   8.518   4.131   1.00 0.00 ? 77  ASP A H    6  
ATOM   5014  H HA   . ASP A 1 13 ? 1.514   10.712  2.396   1.00 0.00 ? 77  ASP A HA   6  
ATOM   5015  H HB2  . ASP A 1 13 ? 3.604   9.005   2.232   1.00 0.00 ? 77  ASP A HB2  6  
ATOM   5016  H HB3  . ASP A 1 13 ? 2.442   8.177   1.239   1.00 0.00 ? 77  ASP A HB3  6  
ATOM   5017  N N    . LYS A 1 14 ? -0.232  9.403   1.084   1.00 0.00 ? 78  LYS A N    6  
ATOM   5018  C CA   . LYS A 1 14 ? -1.372  8.748   0.593   1.00 0.00 ? 78  LYS A CA   6  
ATOM   5019  C C    . LYS A 1 14 ? -0.958  7.955   -0.602  1.00 0.00 ? 78  LYS A C    6  
ATOM   5020  O O    . LYS A 1 14 ? -0.337  8.469   -1.529  1.00 0.00 ? 78  LYS A O    6  
ATOM   5021  C CB   . LYS A 1 14 ? -2.495  9.719   0.218   1.00 0.00 ? 78  LYS A CB   6  
ATOM   5022  C CG   . LYS A 1 14 ? -3.102  10.496  1.372   1.00 0.00 ? 78  LYS A CG   6  
ATOM   5023  C CD   . LYS A 1 14 ? -3.776  9.582   2.386   1.00 0.00 ? 78  LYS A CD   6  
ATOM   5024  C CE   . LYS A 1 14 ? -4.652  10.367  3.363   1.00 0.00 ? 78  LYS A CE   6  
ATOM   5025  N NZ   . LYS A 1 14 ? -3.911  11.407  4.117   1.00 0.00 ? 78  LYS A NZ   6  
ATOM   5026  H H    . LYS A 1 14 ? 0.145   10.168  0.598   1.00 0.00 ? 78  LYS A H    6  
ATOM   5027  H HA   . LYS A 1 14 ? -1.710  8.083   1.372   1.00 0.00 ? 78  LYS A HA   6  
ATOM   5028  H HB2  . LYS A 1 14 ? -2.112  10.432  -0.496  1.00 0.00 ? 78  LYS A HB2  6  
ATOM   5029  H HB3  . LYS A 1 14 ? -3.283  9.153   -0.257  1.00 0.00 ? 78  LYS A HB3  6  
ATOM   5030  H HG2  . LYS A 1 14 ? -2.285  10.995  1.868   1.00 0.00 ? 78  LYS A HG2  6  
ATOM   5031  H HG3  . LYS A 1 14 ? -3.811  11.218  0.995   1.00 0.00 ? 78  LYS A HG3  6  
ATOM   5032  H HD2  . LYS A 1 14 ? -4.393  8.870   1.857   1.00 0.00 ? 78  LYS A HD2  6  
ATOM   5033  H HD3  . LYS A 1 14 ? -3.013  9.057   2.941   1.00 0.00 ? 78  LYS A HD3  6  
ATOM   5034  H HE2  . LYS A 1 14 ? -5.442  10.841  2.802   1.00 0.00 ? 78  LYS A HE2  6  
ATOM   5035  H HE3  . LYS A 1 14 ? -5.090  9.666   4.058   1.00 0.00 ? 78  LYS A HE3  6  
ATOM   5036  H HZ1  . LYS A 1 14 ? -3.454  12.097  3.487   1.00 0.00 ? 78  LYS A HZ1  6  
ATOM   5037  H HZ2  . LYS A 1 14 ? -4.562  11.926  4.742   1.00 0.00 ? 78  LYS A HZ2  6  
ATOM   5038  H HZ3  . LYS A 1 14 ? -3.181  10.979  4.733   1.00 0.00 ? 78  LYS A HZ3  6  
ATOM   5039  N N    . CYS A 1 15 ? -1.319  6.750   -0.590  1.00 0.00 ? 79  CYS A N    6  
ATOM   5040  C CA   . CYS A 1 15 ? -1.007  5.858   -1.649  1.00 0.00 ? 79  CYS A CA   6  
ATOM   5041  C C    . CYS A 1 15 ? -2.208  5.020   -1.939  1.00 0.00 ? 79  CYS A C    6  
ATOM   5042  O O    . CYS A 1 15 ? -3.231  5.128   -1.258  1.00 0.00 ? 79  CYS A O    6  
ATOM   5043  C CB   . CYS A 1 15 ? 0.169   4.974   -1.241  1.00 0.00 ? 79  CYS A CB   6  
ATOM   5044  S SG   . CYS A 1 15 ? -0.101  4.036   0.291   1.00 0.00 ? 79  CYS A SG   6  
ATOM   5045  H H    . CYS A 1 15 ? -1.815  6.426   0.195   1.00 0.00 ? 79  CYS A H    6  
ATOM   5046  H HA   . CYS A 1 15 ? -0.737  6.421   -2.530  1.00 0.00 ? 79  CYS A HA   6  
ATOM   5047  H HB2  . CYS A 1 15 ? 0.358   4.265   -2.034  1.00 0.00 ? 79  CYS A HB2  6  
ATOM   5048  H HB3  . CYS A 1 15 ? 1.048   5.587   -1.108  1.00 0.00 ? 79  CYS A HB3  6  
ATOM   5049  H HG   . CYS A 1 15 ? -1.206  4.458   0.894   1.00 0.00 ? 79  CYS A HG   6  
ATOM   5050  N N    . MET A 1 16 ? -2.124  4.227   -2.943  1.00 0.00 ? 80  MET A N    6  
ATOM   5051  C CA   . MET A 1 16 ? -3.171  3.321   -3.232  1.00 0.00 ? 80  MET A CA   6  
ATOM   5052  C C    . MET A 1 16 ? -2.591  1.963   -3.124  1.00 0.00 ? 80  MET A C    6  
ATOM   5053  O O    . MET A 1 16 ? -1.556  1.687   -3.719  1.00 0.00 ? 80  MET A O    6  
ATOM   5054  C CB   . MET A 1 16 ? -3.760  3.547   -4.626  1.00 0.00 ? 80  MET A CB   6  
ATOM   5055  C CG   . MET A 1 16 ? -4.081  4.999   -4.924  1.00 0.00 ? 80  MET A CG   6  
ATOM   5056  S SD   . MET A 1 16 ? -5.148  5.219   -6.354  1.00 0.00 ? 80  MET A SD   6  
ATOM   5057  C CE   . MET A 1 16 ? -6.687  4.561   -5.701  1.00 0.00 ? 80  MET A CE   6  
ATOM   5058  H H    . MET A 1 16 ? -1.311  4.248   -3.501  1.00 0.00 ? 80  MET A H    6  
ATOM   5059  H HA   . MET A 1 16 ? -3.941  3.443   -2.484  1.00 0.00 ? 80  MET A HA   6  
ATOM   5060  H HB2  . MET A 1 16 ? -3.056  3.192   -5.363  1.00 0.00 ? 80  MET A HB2  6  
ATOM   5061  H HB3  . MET A 1 16 ? -4.668  2.971   -4.710  1.00 0.00 ? 80  MET A HB3  6  
ATOM   5062  H HG2  . MET A 1 16 ? -4.561  5.435   -4.061  1.00 0.00 ? 80  MET A HG2  6  
ATOM   5063  H HG3  . MET A 1 16 ? -3.142  5.496   -5.113  1.00 0.00 ? 80  MET A HG3  6  
ATOM   5064  H HE1  . MET A 1 16 ? -6.958  5.123   -4.818  1.00 0.00 ? 80  MET A HE1  6  
ATOM   5065  H HE2  . MET A 1 16 ? -7.465  4.660   -6.443  1.00 0.00 ? 80  MET A HE2  6  
ATOM   5066  H HE3  . MET A 1 16 ? -6.559  3.520   -5.443  1.00 0.00 ? 80  MET A HE3  6  
ATOM   5067  N N    . ALA A 1 17 ? -3.229  1.136   -2.385  1.00 0.00 ? 81  ALA A N    6  
ATOM   5068  C CA   . ALA A 1 17 ? -2.753  -0.181  -2.132  1.00 0.00 ? 81  ALA A CA   6  
ATOM   5069  C C    . ALA A 1 17 ? -3.741  -1.158  -2.652  1.00 0.00 ? 81  ALA A C    6  
ATOM   5070  O O    . ALA A 1 17 ? -4.925  -0.851  -2.728  1.00 0.00 ? 81  ALA A O    6  
ATOM   5071  C CB   . ALA A 1 17 ? -2.579  -0.381  -0.647  1.00 0.00 ? 81  ALA A CB   6  
ATOM   5072  H H    . ALA A 1 17 ? -4.089  1.413   -1.993  1.00 0.00 ? 81  ALA A H    6  
ATOM   5073  H HA   . ALA A 1 17 ? -1.794  -0.319  -2.608  1.00 0.00 ? 81  ALA A HA   6  
ATOM   5074  H HB1  . ALA A 1 17 ? -3.525  -0.196  -0.158  1.00 0.00 ? 81  ALA A HB1  6  
ATOM   5075  H HB2  . ALA A 1 17 ? -2.272  -1.397  -0.452  1.00 0.00 ? 81  ALA A HB2  6  
ATOM   5076  H HB3  . ALA A 1 17 ? -1.837  0.307   -0.270  1.00 0.00 ? 81  ALA A HB3  6  
ATOM   5077  N N    . VAL A 1 18 ? -3.277  -2.307  -3.016  1.00 0.00 ? 82  VAL A N    6  
ATOM   5078  C CA   . VAL A 1 18 ? -4.148  -3.344  -3.475  1.00 0.00 ? 82  VAL A CA   6  
ATOM   5079  C C    . VAL A 1 18 ? -4.607  -4.112  -2.272  1.00 0.00 ? 82  VAL A C    6  
ATOM   5080  O O    . VAL A 1 18 ? -3.801  -4.741  -1.600  1.00 0.00 ? 82  VAL A O    6  
ATOM   5081  C CB   . VAL A 1 18 ? -3.427  -4.302  -4.463  1.00 0.00 ? 82  VAL A CB   6  
ATOM   5082  C CG1  . VAL A 1 18 ? -4.352  -5.425  -4.917  1.00 0.00 ? 82  VAL A CG1  6  
ATOM   5083  C CG2  . VAL A 1 18 ? -2.905  -3.533  -5.663  1.00 0.00 ? 82  VAL A CG2  6  
ATOM   5084  H H    . VAL A 1 18 ? -2.315  -2.474  -2.965  1.00 0.00 ? 82  VAL A H    6  
ATOM   5085  H HA   . VAL A 1 18 ? -5.008  -2.906  -3.958  1.00 0.00 ? 82  VAL A HA   6  
ATOM   5086  H HB   . VAL A 1 18 ? -2.586  -4.744  -3.951  1.00 0.00 ? 82  VAL A HB   6  
ATOM   5087  H HG11 . VAL A 1 18 ? -5.207  -5.004  -5.425  1.00 0.00 ? 82  VAL A HG11 6  
ATOM   5088  H HG12 . VAL A 1 18 ? -3.822  -6.083  -5.590  1.00 0.00 ? 82  VAL A HG12 6  
ATOM   5089  H HG13 . VAL A 1 18 ? -4.686  -5.983  -4.055  1.00 0.00 ? 82  VAL A HG13 6  
ATOM   5090  H HG21 . VAL A 1 18 ? -2.214  -2.773  -5.331  1.00 0.00 ? 82  VAL A HG21 6  
ATOM   5091  H HG22 . VAL A 1 18 ? -2.402  -4.212  -6.333  1.00 0.00 ? 82  VAL A HG22 6  
ATOM   5092  H HG23 . VAL A 1 18 ? -3.733  -3.066  -6.177  1.00 0.00 ? 82  VAL A HG23 6  
ATOM   5093  N N    . TRP A 1 19 ? -5.882  -4.024  -1.992  1.00 0.00 ? 83  TRP A N    6  
ATOM   5094  C CA   . TRP A 1 19 ? -6.469  -4.680  -0.870  1.00 0.00 ? 83  TRP A CA   6  
ATOM   5095  C C    . TRP A 1 19 ? -6.412  -6.151  -1.114  1.00 0.00 ? 83  TRP A C    6  
ATOM   5096  O O    . TRP A 1 19 ? -7.036  -6.654  -2.057  1.00 0.00 ? 83  TRP A O    6  
ATOM   5097  C CB   . TRP A 1 19 ? -7.916  -4.231  -0.696  1.00 0.00 ? 83  TRP A CB   6  
ATOM   5098  C CG   . TRP A 1 19 ? -8.529  -4.633  0.609   1.00 0.00 ? 83  TRP A CG   6  
ATOM   5099  C CD1  . TRP A 1 19 ? -7.890  -4.758  1.796   1.00 0.00 ? 83  TRP A CD1  6  
ATOM   5100  C CD2  . TRP A 1 19 ? -9.905  -4.908  0.875   1.00 0.00 ? 83  TRP A CD2  6  
ATOM   5101  N NE1  . TRP A 1 19 ? -8.761  -5.096  2.778   1.00 0.00 ? 83  TRP A NE1  6  
ATOM   5102  C CE2  . TRP A 1 19 ? -10.007 -5.191  2.248   1.00 0.00 ? 83  TRP A CE2  6  
ATOM   5103  C CE3  . TRP A 1 19 ? -11.060 -4.943  0.097   1.00 0.00 ? 83  TRP A CE3  6  
ATOM   5104  C CZ2  . TRP A 1 19 ? -11.204 -5.504  2.856   1.00 0.00 ? 83  TRP A CZ2  6  
ATOM   5105  C CZ3  . TRP A 1 19 ? -12.250 -5.258  0.708   1.00 0.00 ? 83  TRP A CZ3  6  
ATOM   5106  C CH2  . TRP A 1 19 ? -12.308 -5.532  2.076   1.00 0.00 ? 83  TRP A CH2  6  
ATOM   5107  H H    . TRP A 1 19 ? -6.455  -3.501  -2.594  1.00 0.00 ? 83  TRP A H    6  
ATOM   5108  H HA   . TRP A 1 19 ? -5.906  -4.428  0.017   1.00 0.00 ? 83  TRP A HA   6  
ATOM   5109  H HB2  . TRP A 1 19 ? -7.948  -3.156  -0.758  1.00 0.00 ? 83  TRP A HB2  6  
ATOM   5110  H HB3  . TRP A 1 19 ? -8.511  -4.650  -1.493  1.00 0.00 ? 83  TRP A HB3  6  
ATOM   5111  H HD1  . TRP A 1 19 ? -6.829  -4.617  1.913   1.00 0.00 ? 83  TRP A HD1  6  
ATOM   5112  H HE1  . TRP A 1 19 ? -8.520  -5.241  3.722   1.00 0.00 ? 83  TRP A HE1  6  
ATOM   5113  H HE3  . TRP A 1 19 ? -11.038 -4.729  -0.961  1.00 0.00 ? 83  TRP A HE3  6  
ATOM   5114  H HZ2  . TRP A 1 19 ? -11.269 -5.717  3.911   1.00 0.00 ? 83  TRP A HZ2  6  
ATOM   5115  H HZ3  . TRP A 1 19 ? -13.163 -5.292  0.133   1.00 0.00 ? 83  TRP A HZ3  6  
ATOM   5116  H HH2  . TRP A 1 19 ? -13.257 -5.776  2.523   1.00 0.00 ? 83  TRP A HH2  6  
ATOM   5117  N N    . SER A 1 20 ? -5.693  -6.830  -0.271  1.00 0.00 ? 84  SER A N    6  
ATOM   5118  C CA   . SER A 1 20 ? -5.446  -8.252  -0.400  1.00 0.00 ? 84  SER A CA   6  
ATOM   5119  C C    . SER A 1 20 ? -6.757  -9.068  -0.330  1.00 0.00 ? 84  SER A C    6  
ATOM   5120  O O    . SER A 1 20 ? -6.811  -10.234 -0.761  1.00 0.00 ? 84  SER A O    6  
ATOM   5121  C CB   . SER A 1 20 ? -4.440  -8.699  0.682   1.00 0.00 ? 84  SER A CB   6  
ATOM   5122  O OG   . SER A 1 20 ? -4.041  -10.053 0.514   1.00 0.00 ? 84  SER A OG   6  
ATOM   5123  H H    . SER A 1 20 ? -5.284  -6.326  0.475   1.00 0.00 ? 84  SER A H    6  
ATOM   5124  H HA   . SER A 1 20 ? -4.999  -8.414  -1.369  1.00 0.00 ? 84  SER A HA   6  
ATOM   5125  H HB2  . SER A 1 20 ? -3.560  -8.075  0.630   1.00 0.00 ? 84  SER A HB2  6  
ATOM   5126  H HB3  . SER A 1 20 ? -4.896  -8.587  1.653   1.00 0.00 ? 84  SER A HB3  6  
ATOM   5127  H HG   . SER A 1 20 ? -3.466  -10.084 -0.259  1.00 0.00 ? 84  SER A HG   6  
ATOM   5128  N N    . GLU A 1 21 ? -7.815  -8.449  0.166   1.00 0.00 ? 85  GLU A N    6  
ATOM   5129  C CA   . GLU A 1 21 ? -9.068  -9.136  0.309   1.00 0.00 ? 85  GLU A CA   6  
ATOM   5130  C C    . GLU A 1 21 ? -9.874  -9.139  -0.978  1.00 0.00 ? 85  GLU A C    6  
ATOM   5131  O O    . GLU A 1 21 ? -10.425 -10.169 -1.355  1.00 0.00 ? 85  GLU A O    6  
ATOM   5132  C CB   . GLU A 1 21 ? -9.879  -8.528  1.424   1.00 0.00 ? 85  GLU A CB   6  
ATOM   5133  C CG   . GLU A 1 21 ? -9.151  -8.475  2.755   1.00 0.00 ? 85  GLU A CG   6  
ATOM   5134  C CD   . GLU A 1 21 ? -8.753  -9.840  3.278   1.00 0.00 ? 85  GLU A CD   6  
ATOM   5135  O OE1  . GLU A 1 21 ? -7.649  -10.326 2.968   1.00 0.00 ? 85  GLU A OE1  6  
ATOM   5136  O OE2  . GLU A 1 21 ? -9.553  -10.468 4.011   1.00 0.00 ? 85  GLU A OE2  6  
ATOM   5137  H H    . GLU A 1 21 ? -7.725  -7.512  0.445   1.00 0.00 ? 85  GLU A H    6  
ATOM   5138  H HA   . GLU A 1 21 ? -8.855  -10.158 0.570   1.00 0.00 ? 85  GLU A HA   6  
ATOM   5139  H HB2  . GLU A 1 21 ? -10.148 -7.520  1.140   1.00 0.00 ? 85  GLU A HB2  6  
ATOM   5140  H HB3  . GLU A 1 21 ? -10.780 -9.109  1.540   1.00 0.00 ? 85  GLU A HB3  6  
ATOM   5141  H HG2  . GLU A 1 21 ? -8.287  -7.851  2.604   1.00 0.00 ? 85  GLU A HG2  6  
ATOM   5142  H HG3  . GLU A 1 21 ? -9.777  -7.962  3.467   1.00 0.00 ? 85  GLU A HG3  6  
ATOM   5143  N N    . ASP A 1 22 ? -9.924  -8.015  -1.671  1.00 0.00 ? 86  ASP A N    6  
ATOM   5144  C CA   . ASP A 1 22 ? -10.768 -7.941  -2.889  1.00 0.00 ? 86  ASP A CA   6  
ATOM   5145  C C    . ASP A 1 22 ? -9.932  -7.943  -4.168  1.00 0.00 ? 86  ASP A C    6  
ATOM   5146  O O    . ASP A 1 22 ? -10.415 -8.293  -5.249  1.00 0.00 ? 86  ASP A O    6  
ATOM   5147  C CB   . ASP A 1 22 ? -11.668 -6.695  -2.850  1.00 0.00 ? 86  ASP A CB   6  
ATOM   5148  C CG   . ASP A 1 22 ? -12.689 -6.673  -3.974  1.00 0.00 ? 86  ASP A CG   6  
ATOM   5149  O OD1  . ASP A 1 22 ? -13.734 -7.350  -3.852  1.00 0.00 ? 86  ASP A OD1  6  
ATOM   5150  O OD2  . ASP A 1 22 ? -12.469 -6.005  -4.988  1.00 0.00 ? 86  ASP A OD2  6  
ATOM   5151  H H    . ASP A 1 22 ? -9.410  -7.242  -1.354  1.00 0.00 ? 86  ASP A H    6  
ATOM   5152  H HA   . ASP A 1 22 ? -11.397 -8.818  -2.898  1.00 0.00 ? 86  ASP A HA   6  
ATOM   5153  H HB2  . ASP A 1 22 ? -12.195 -6.669  -1.907  1.00 0.00 ? 86  ASP A HB2  6  
ATOM   5154  H HB3  . ASP A 1 22 ? -11.046 -5.817  -2.933  1.00 0.00 ? 86  ASP A HB3  6  
ATOM   5155  N N    . GLY A 1 23 ? -8.669  -7.609  -4.032  1.00 0.00 ? 87  GLY A N    6  
ATOM   5156  C CA   . GLY A 1 23 ? -7.772  -7.583  -5.176  1.00 0.00 ? 87  GLY A CA   6  
ATOM   5157  C C    . GLY A 1 23 ? -7.808  -6.264  -5.938  1.00 0.00 ? 87  GLY A C    6  
ATOM   5158  O O    . GLY A 1 23 ? -7.310  -6.171  -7.054  1.00 0.00 ? 87  GLY A O    6  
ATOM   5159  H H    . GLY A 1 23 ? -8.314  -7.394  -3.140  1.00 0.00 ? 87  GLY A H    6  
ATOM   5160  H HA2  . GLY A 1 23 ? -6.764  -7.750  -4.827  1.00 0.00 ? 87  GLY A HA2  6  
ATOM   5161  H HA3  . GLY A 1 23 ? -8.046  -8.382  -5.848  1.00 0.00 ? 87  GLY A HA3  6  
ATOM   5162  N N    . GLN A 1 24 ? -8.396  -5.252  -5.347  1.00 0.00 ? 88  GLN A N    6  
ATOM   5163  C CA   . GLN A 1 24 ? -8.491  -3.941  -5.985  1.00 0.00 ? 88  GLN A CA   6  
ATOM   5164  C C    . GLN A 1 24 ? -7.683  -2.924  -5.229  1.00 0.00 ? 88  GLN A C    6  
ATOM   5165  O O    . GLN A 1 24 ? -7.311  -3.162  -4.089  1.00 0.00 ? 88  GLN A O    6  
ATOM   5166  C CB   . GLN A 1 24 ? -9.939  -3.481  -6.113  1.00 0.00 ? 88  GLN A CB   6  
ATOM   5167  C CG   . GLN A 1 24 ? -10.755 -4.250  -7.127  1.00 0.00 ? 88  GLN A CG   6  
ATOM   5168  C CD   . GLN A 1 24 ? -10.209 -4.119  -8.525  1.00 0.00 ? 88  GLN A CD   6  
ATOM   5169  O OE1  . GLN A 1 24 ? -10.564 -3.195  -9.256  1.00 0.00 ? 88  GLN A OE1  6  
ATOM   5170  N NE2  . GLN A 1 24 ? -9.374  -5.024  -8.923  1.00 0.00 ? 88  GLN A NE2  6  
ATOM   5171  H H    . GLN A 1 24 ? -8.747  -5.371  -4.440  1.00 0.00 ? 88  GLN A H    6  
ATOM   5172  H HA   . GLN A 1 24 ? -8.067  -4.039  -6.974  1.00 0.00 ? 88  GLN A HA   6  
ATOM   5173  H HB2  . GLN A 1 24 ? -10.424 -3.589  -5.154  1.00 0.00 ? 88  GLN A HB2  6  
ATOM   5174  H HB3  . GLN A 1 24 ? -9.948  -2.438  -6.391  1.00 0.00 ? 88  GLN A HB3  6  
ATOM   5175  H HG2  . GLN A 1 24 ? -10.760 -5.293  -6.849  1.00 0.00 ? 88  GLN A HG2  6  
ATOM   5176  H HG3  . GLN A 1 24 ? -11.757 -3.852  -7.112  1.00 0.00 ? 88  GLN A HG3  6  
ATOM   5177  H HE21 . GLN A 1 24 ? -9.129  -5.757  -8.317  1.00 0.00 ? 88  GLN A HE21 6  
ATOM   5178  H HE22 . GLN A 1 24 ? -8.992  -4.948  -9.824  1.00 0.00 ? 88  GLN A HE22 6  
ATOM   5179  N N    . CYS A 1 25 ? -7.448  -1.791  -5.828  1.00 0.00 ? 89  CYS A N    6  
ATOM   5180  C CA   . CYS A 1 25 ? -6.631  -0.769  -5.204  1.00 0.00 ? 89  CYS A CA   6  
ATOM   5181  C C    . CYS A 1 25 ? -7.486  0.298   -4.551  1.00 0.00 ? 89  CYS A C    6  
ATOM   5182  O O    . CYS A 1 25 ? -8.474  0.763   -5.124  1.00 0.00 ? 89  CYS A O    6  
ATOM   5183  C CB   . CYS A 1 25 ? -5.629  -0.155  -6.185  1.00 0.00 ? 89  CYS A CB   6  
ATOM   5184  S SG   . CYS A 1 25 ? -6.360  0.696   -7.593  1.00 0.00 ? 89  CYS A SG   6  
ATOM   5185  H H    . CYS A 1 25 ? -7.868  -1.635  -6.703  1.00 0.00 ? 89  CYS A H    6  
ATOM   5186  H HA   . CYS A 1 25 ? -6.084  -1.258  -4.412  1.00 0.00 ? 89  CYS A HA   6  
ATOM   5187  H HB2  . CYS A 1 25 ? -5.027  0.566   -5.653  1.00 0.00 ? 89  CYS A HB2  6  
ATOM   5188  H HB3  . CYS A 1 25 ? -4.987  -0.936  -6.564  1.00 0.00 ? 89  CYS A HB3  6  
ATOM   5189  H HG   . CYS A 1 25 ? -7.679  0.634   -7.470  1.00 0.00 ? 89  CYS A HG   6  
ATOM   5190  N N    . TYR A 1 26 ? -7.122  0.662   -3.353  1.00 0.00 ? 90  TYR A N    6  
ATOM   5191  C CA   . TYR A 1 26 ? -7.850  1.621   -2.555  1.00 0.00 ? 90  TYR A CA   6  
ATOM   5192  C C    . TYR A 1 26 ? -6.883  2.592   -1.920  1.00 0.00 ? 90  TYR A C    6  
ATOM   5193  O O    . TYR A 1 26 ? -5.692  2.285   -1.790  1.00 0.00 ? 90  TYR A O    6  
ATOM   5194  C CB   . TYR A 1 26 ? -8.659  0.909   -1.482  1.00 0.00 ? 90  TYR A CB   6  
ATOM   5195  C CG   . TYR A 1 26 ? -9.737  -0.021  -2.013  1.00 0.00 ? 90  TYR A CG   6  
ATOM   5196  C CD1  . TYR A 1 26 ? -9.421  -1.310  -2.415  1.00 0.00 ? 90  TYR A CD1  6  
ATOM   5197  C CD2  . TYR A 1 26 ? -11.065 0.374   -2.085  1.00 0.00 ? 90  TYR A CD2  6  
ATOM   5198  C CE1  . TYR A 1 26 ? -10.376 -2.169  -2.877  1.00 0.00 ? 90  TYR A CE1  6  
ATOM   5199  C CE2  . TYR A 1 26 ? -12.037 -0.494  -2.543  1.00 0.00 ? 90  TYR A CE2  6  
ATOM   5200  C CZ   . TYR A 1 26 ? -11.684 -1.764  -2.940  1.00 0.00 ? 90  TYR A CZ   6  
ATOM   5201  O OH   . TYR A 1 26 ? -12.639 -2.634  -3.384  1.00 0.00 ? 90  TYR A OH   6  
ATOM   5202  H H    . TYR A 1 26 ? -6.307  0.263   -2.968  1.00 0.00 ? 90  TYR A H    6  
ATOM   5203  H HA   . TYR A 1 26 ? -8.523  2.162   -3.205  1.00 0.00 ? 90  TYR A HA   6  
ATOM   5204  H HB2  . TYR A 1 26 ? -7.975  0.304   -0.907  1.00 0.00 ? 90  TYR A HB2  6  
ATOM   5205  H HB3  . TYR A 1 26 ? -9.112  1.629   -0.819  1.00 0.00 ? 90  TYR A HB3  6  
ATOM   5206  H HD1  . TYR A 1 26 ? -8.391  -1.632  -2.368  1.00 0.00 ? 90  TYR A HD1  6  
ATOM   5207  H HD2  . TYR A 1 26 ? -11.340 1.371   -1.778  1.00 0.00 ? 90  TYR A HD2  6  
ATOM   5208  H HE1  . TYR A 1 26 ? -10.081 -3.158  -3.193  1.00 0.00 ? 90  TYR A HE1  6  
ATOM   5209  H HE2  . TYR A 1 26 ? -13.067 -0.174  -2.593  1.00 0.00 ? 90  TYR A HE2  6  
ATOM   5210  H HH   . TYR A 1 26 ? -13.229 -2.192  -4.005  1.00 0.00 ? 90  TYR A HH   6  
ATOM   5211  N N    . GLU A 1 27 ? -7.381  3.743   -1.551  1.00 0.00 ? 91  GLU A N    6  
ATOM   5212  C CA   . GLU A 1 27 ? -6.585  4.803   -0.976  1.00 0.00 ? 91  GLU A CA   6  
ATOM   5213  C C    . GLU A 1 27 ? -6.225  4.456   0.468   1.00 0.00 ? 91  GLU A C    6  
ATOM   5214  O O    . GLU A 1 27 ? -7.098  4.199   1.310   1.00 0.00 ? 91  GLU A O    6  
ATOM   5215  C CB   . GLU A 1 27 ? -7.377  6.105   -1.058  1.00 0.00 ? 91  GLU A CB   6  
ATOM   5216  C CG   . GLU A 1 27 ? -6.682  7.343   -0.528  1.00 0.00 ? 91  GLU A CG   6  
ATOM   5217  C CD   . GLU A 1 27 ? -7.545  8.565   -0.708  1.00 0.00 ? 91  GLU A CD   6  
ATOM   5218  O OE1  . GLU A 1 27 ? -8.428  8.814   0.132   1.00 0.00 ? 91  GLU A OE1  6  
ATOM   5219  O OE2  . GLU A 1 27 ? -7.382  9.285   -1.718  1.00 0.00 ? 91  GLU A OE2  6  
ATOM   5220  H H    . GLU A 1 27 ? -8.348  3.891   -1.618  1.00 0.00 ? 91  GLU A H    6  
ATOM   5221  H HA   . GLU A 1 27 ? -5.680  4.902   -1.556  1.00 0.00 ? 91  GLU A HA   6  
ATOM   5222  H HB2  . GLU A 1 27 ? -7.636  6.293   -2.089  1.00 0.00 ? 91  GLU A HB2  6  
ATOM   5223  H HB3  . GLU A 1 27 ? -8.287  5.967   -0.495  1.00 0.00 ? 91  GLU A HB3  6  
ATOM   5224  H HG2  . GLU A 1 27 ? -6.488  7.205   0.526   1.00 0.00 ? 91  GLU A HG2  6  
ATOM   5225  H HG3  . GLU A 1 27 ? -5.752  7.490   -1.057  1.00 0.00 ? 91  GLU A HG3  6  
ATOM   5226  N N    . ALA A 1 28 ? -4.960  4.452   0.745   1.00 0.00 ? 92  ALA A N    6  
ATOM   5227  C CA   . ALA A 1 28 ? -4.458  4.083   2.028   1.00 0.00 ? 92  ALA A CA   6  
ATOM   5228  C C    . ALA A 1 28 ? -3.323  4.979   2.416   1.00 0.00 ? 92  ALA A C    6  
ATOM   5229  O O    . ALA A 1 28 ? -2.609  5.500   1.556   1.00 0.00 ? 92  ALA A O    6  
ATOM   5230  C CB   . ALA A 1 28 ? -3.988  2.651   1.986   1.00 0.00 ? 92  ALA A CB   6  
ATOM   5231  H H    . ALA A 1 28 ? -4.319  4.718   0.043   1.00 0.00 ? 92  ALA A H    6  
ATOM   5232  H HA   . ALA A 1 28 ? -5.237  4.157   2.772   1.00 0.00 ? 92  ALA A HA   6  
ATOM   5233  H HB1  . ALA A 1 28 ? -3.186  2.554   1.270   1.00 0.00 ? 92  ALA A HB1  6  
ATOM   5234  H HB2  . ALA A 1 28 ? -3.633  2.363   2.965   1.00 0.00 ? 92  ALA A HB2  6  
ATOM   5235  H HB3  . ALA A 1 28 ? -4.809  2.011   1.698   1.00 0.00 ? 92  ALA A HB3  6  
ATOM   5236  N N    . GLU A 1 29 ? -3.148  5.159   3.684   1.00 0.00 ? 93  GLU A N    6  
ATOM   5237  C CA   . GLU A 1 29 ? -2.083  5.968   4.179   1.00 0.00 ? 93  GLU A CA   6  
ATOM   5238  C C    . GLU A 1 29 ? -1.067  5.076   4.852   1.00 0.00 ? 93  GLU A C    6  
ATOM   5239  O O    . GLU A 1 29 ? -1.430  4.141   5.575   1.00 0.00 ? 93  GLU A O    6  
ATOM   5240  C CB   . GLU A 1 29 ? -2.602  7.045   5.130   1.00 0.00 ? 93  GLU A CB   6  
ATOM   5241  C CG   . GLU A 1 29 ? -1.523  8.004   5.612   1.00 0.00 ? 93  GLU A CG   6  
ATOM   5242  C CD   . GLU A 1 29 ? -2.071  9.133   6.428   1.00 0.00 ? 93  GLU A CD   6  
ATOM   5243  O OE1  . GLU A 1 29 ? -2.216  8.987   7.654   1.00 0.00 ? 93  GLU A OE1  6  
ATOM   5244  O OE2  . GLU A 1 29 ? -2.363  10.192  5.866   1.00 0.00 ? 93  GLU A OE2  6  
ATOM   5245  H H    . GLU A 1 29 ? -3.742  4.703   4.321   1.00 0.00 ? 93  GLU A H    6  
ATOM   5246  H HA   . GLU A 1 29 ? -1.615  6.440   3.328   1.00 0.00 ? 93  GLU A HA   6  
ATOM   5247  H HB2  . GLU A 1 29 ? -3.373  7.613   4.632   1.00 0.00 ? 93  GLU A HB2  6  
ATOM   5248  H HB3  . GLU A 1 29 ? -3.032  6.553   5.991   1.00 0.00 ? 93  GLU A HB3  6  
ATOM   5249  H HG2  . GLU A 1 29 ? -0.815  7.455   6.217   1.00 0.00 ? 93  GLU A HG2  6  
ATOM   5250  H HG3  . GLU A 1 29 ? -1.001  8.410   4.756   1.00 0.00 ? 93  GLU A HG3  6  
ATOM   5251  N N    . ILE A 1 30 ? 0.168   5.322   4.556   1.00 0.00 ? 94  ILE A N    6  
ATOM   5252  C CA   . ILE A 1 30 ? 1.280   4.552   5.084   1.00 0.00 ? 94  ILE A CA   6  
ATOM   5253  C C    . ILE A 1 30 ? 1.551   4.894   6.546   1.00 0.00 ? 94  ILE A C    6  
ATOM   5254  O O    . ILE A 1 30 ? 1.753   6.054   6.895   1.00 0.00 ? 94  ILE A O    6  
ATOM   5255  C CB   . ILE A 1 30 ? 2.541   4.814   4.252   1.00 0.00 ? 94  ILE A CB   6  
ATOM   5256  C CG1  . ILE A 1 30 ? 2.234   4.517   2.790   1.00 0.00 ? 94  ILE A CG1  6  
ATOM   5257  C CG2  . ILE A 1 30 ? 3.686   3.938   4.750   1.00 0.00 ? 94  ILE A CG2  6  
ATOM   5258  C CD1  . ILE A 1 30 ? 3.267   5.001   1.815   1.00 0.00 ? 94  ILE A CD1  6  
ATOM   5259  H H    . ILE A 1 30 ? 0.338   6.057   3.926   1.00 0.00 ? 94  ILE A H    6  
ATOM   5260  H HA   . ILE A 1 30 ? 1.034   3.504   5.010   1.00 0.00 ? 94  ILE A HA   6  
ATOM   5261  H HB   . ILE A 1 30 ? 2.818   5.852   4.348   1.00 0.00 ? 94  ILE A HB   6  
ATOM   5262  H HG12 . ILE A 1 30 ? 2.166   3.446   2.667   1.00 0.00 ? 94  ILE A HG12 6  
ATOM   5263  H HG13 . ILE A 1 30 ? 1.281   4.963   2.549   1.00 0.00 ? 94  ILE A HG13 6  
ATOM   5264  H HG21 . ILE A 1 30 ? 3.402   2.898   4.685   1.00 0.00 ? 94  ILE A HG21 6  
ATOM   5265  H HG22 . ILE A 1 30 ? 4.565   4.114   4.149   1.00 0.00 ? 94  ILE A HG22 6  
ATOM   5266  H HG23 . ILE A 1 30 ? 3.896   4.179   5.782   1.00 0.00 ? 94  ILE A HG23 6  
ATOM   5267  H HD11 . ILE A 1 30 ? 4.202   4.505   2.023   1.00 0.00 ? 94  ILE A HD11 6  
ATOM   5268  H HD12 . ILE A 1 30 ? 2.940   4.766   0.811   1.00 0.00 ? 94  ILE A HD12 6  
ATOM   5269  H HD13 . ILE A 1 30 ? 3.386   6.070   1.914   1.00 0.00 ? 94  ILE A HD13 6  
ATOM   5270  N N    . GLU A 1 31 ? 1.580   3.875   7.365   1.00 0.00 ? 95  GLU A N    6  
ATOM   5271  C CA   . GLU A 1 31 ? 1.813   4.011   8.795   1.00 0.00 ? 95  GLU A CA   6  
ATOM   5272  C C    . GLU A 1 31 ? 3.273   3.756   9.139   1.00 0.00 ? 95  GLU A C    6  
ATOM   5273  O O    . GLU A 1 31 ? 3.840   4.388   10.044  1.00 0.00 ? 95  GLU A O    6  
ATOM   5274  C CB   . GLU A 1 31 ? 0.950   3.007   9.527   1.00 0.00 ? 95  GLU A CB   6  
ATOM   5275  C CG   . GLU A 1 31 ? -0.524  3.238   9.347   1.00 0.00 ? 95  GLU A CG   6  
ATOM   5276  C CD   . GLU A 1 31 ? -1.002  4.473   10.060  1.00 0.00 ? 95  GLU A CD   6  
ATOM   5277  O OE1  . GLU A 1 31 ? -1.302  4.382   11.275  1.00 0.00 ? 95  GLU A OE1  6  
ATOM   5278  O OE2  . GLU A 1 31 ? -1.088  5.543   9.448   1.00 0.00 ? 95  GLU A OE2  6  
ATOM   5279  H H    . GLU A 1 31 ? 1.426   2.981   6.984   1.00 0.00 ? 95  GLU A H    6  
ATOM   5280  H HA   . GLU A 1 31 ? 1.524   5.004   9.104   1.00 0.00 ? 95  GLU A HA   6  
ATOM   5281  H HB2  . GLU A 1 31 ? 1.187   2.017   9.163   1.00 0.00 ? 95  GLU A HB2  6  
ATOM   5282  H HB3  . GLU A 1 31 ? 1.178   3.057   10.581  1.00 0.00 ? 95  GLU A HB3  6  
ATOM   5283  H HG2  . GLU A 1 31 ? -0.722  3.355   8.291   1.00 0.00 ? 95  GLU A HG2  6  
ATOM   5284  H HG3  . GLU A 1 31 ? -1.060  2.378   9.715   1.00 0.00 ? 95  GLU A HG3  6  
ATOM   5285  N N    . GLU A 1 32 ? 3.870   2.820   8.440   1.00 0.00 ? 96  GLU A N    6  
ATOM   5286  C CA   . GLU A 1 32 ? 5.249   2.449   8.664   1.00 0.00 ? 96  GLU A CA   6  
ATOM   5287  C C    . GLU A 1 32 ? 5.758   1.740   7.429   1.00 0.00 ? 96  GLU A C    6  
ATOM   5288  O O    . GLU A 1 32 ? 4.976   1.135   6.707   1.00 0.00 ? 96  GLU A O    6  
ATOM   5289  C CB   . GLU A 1 32 ? 5.363   1.537   9.893   1.00 0.00 ? 96  GLU A CB   6  
ATOM   5290  C CG   . GLU A 1 32 ? 6.784   1.158   10.248  1.00 0.00 ? 96  GLU A CG   6  
ATOM   5291  C CD   . GLU A 1 32 ? 6.855   0.243   11.426  1.00 0.00 ? 96  GLU A CD   6  
ATOM   5292  O OE1  . GLU A 1 32 ? 6.820   -0.990  11.226  1.00 0.00 ? 96  GLU A OE1  6  
ATOM   5293  O OE2  . GLU A 1 32 ? 6.955   0.727   12.571  1.00 0.00 ? 96  GLU A OE2  6  
ATOM   5294  H H    . GLU A 1 32 ? 3.379   2.345   7.734   1.00 0.00 ? 96  GLU A H    6  
ATOM   5295  H HA   . GLU A 1 32 ? 5.831   3.346   8.819   1.00 0.00 ? 96  GLU A HA   6  
ATOM   5296  H HB2  . GLU A 1 32 ? 4.925   2.042   10.741  1.00 0.00 ? 96  GLU A HB2  6  
ATOM   5297  H HB3  . GLU A 1 32 ? 4.810   0.630   9.699   1.00 0.00 ? 96  GLU A HB3  6  
ATOM   5298  H HG2  . GLU A 1 32 ? 7.198   0.649   9.390   1.00 0.00 ? 96  GLU A HG2  6  
ATOM   5299  H HG3  . GLU A 1 32 ? 7.348   2.055   10.450  1.00 0.00 ? 96  GLU A HG3  6  
ATOM   5300  N N    . ILE A 1 33 ? 7.037   1.840   7.177   1.00 0.00 ? 97  ILE A N    6  
ATOM   5301  C CA   . ILE A 1 33 ? 7.657   1.239   6.017   1.00 0.00 ? 97  ILE A CA   6  
ATOM   5302  C C    . ILE A 1 33 ? 8.787   0.319   6.448   1.00 0.00 ? 97  ILE A C    6  
ATOM   5303  O O    . ILE A 1 33 ? 9.558   0.645   7.359   1.00 0.00 ? 97  ILE A O    6  
ATOM   5304  C CB   . ILE A 1 33 ? 8.237   2.358   5.123   1.00 0.00 ? 97  ILE A CB   6  
ATOM   5305  C CG1  . ILE A 1 33 ? 7.130   3.291   4.711   1.00 0.00 ? 97  ILE A CG1  6  
ATOM   5306  C CG2  . ILE A 1 33 ? 8.937   1.799   3.883   1.00 0.00 ? 97  ILE A CG2  6  
ATOM   5307  C CD1  . ILE A 1 33 ? 7.607   4.634   4.329   1.00 0.00 ? 97  ILE A CD1  6  
ATOM   5308  H H    . ILE A 1 33 ? 7.622   2.340   7.786   1.00 0.00 ? 97  ILE A H    6  
ATOM   5309  H HA   . ILE A 1 33 ? 6.917   0.697   5.449   1.00 0.00 ? 97  ILE A HA   6  
ATOM   5310  H HB   . ILE A 1 33 ? 8.957   2.918   5.699   1.00 0.00 ? 97  ILE A HB   6  
ATOM   5311  H HG12 . ILE A 1 33 ? 6.638   2.879   3.841   1.00 0.00 ? 97  ILE A HG12 6  
ATOM   5312  H HG13 . ILE A 1 33 ? 6.423   3.387   5.521   1.00 0.00 ? 97  ILE A HG13 6  
ATOM   5313  H HG21 . ILE A 1 33 ? 8.237   1.211   3.308   1.00 0.00 ? 97  ILE A HG21 6  
ATOM   5314  H HG22 . ILE A 1 33 ? 9.291   2.625   3.284   1.00 0.00 ? 97  ILE A HG22 6  
ATOM   5315  H HG23 . ILE A 1 33 ? 9.771   1.182   4.184   1.00 0.00 ? 97  ILE A HG23 6  
ATOM   5316  H HD11 . ILE A 1 33 ? 8.300   4.556   3.504   1.00 0.00 ? 97  ILE A HD11 6  
ATOM   5317  H HD12 . ILE A 1 33 ? 6.766   5.247   4.045   1.00 0.00 ? 97  ILE A HD12 6  
ATOM   5318  H HD13 . ILE A 1 33 ? 8.097   5.068   5.188   1.00 0.00 ? 97  ILE A HD13 6  
ATOM   5319  N N    . ASP A 1 34 ? 8.872   -0.811  5.811   1.00 0.00 ? 98  ASP A N    6  
ATOM   5320  C CA   . ASP A 1 34 ? 9.956   -1.735  6.005   1.00 0.00 ? 98  ASP A CA   6  
ATOM   5321  C C    . ASP A 1 34 ? 10.701  -1.810  4.707   1.00 0.00 ? 98  ASP A C    6  
ATOM   5322  O O    . ASP A 1 34 ? 10.331  -2.559  3.797   1.00 0.00 ? 98  ASP A O    6  
ATOM   5323  C CB   . ASP A 1 34 ? 9.471   -3.121  6.386   1.00 0.00 ? 98  ASP A CB   6  
ATOM   5324  C CG   . ASP A 1 34 ? 10.619  -4.029  6.752   1.00 0.00 ? 98  ASP A CG   6  
ATOM   5325  O OD1  . ASP A 1 34 ? 11.285  -4.560  5.856   1.00 0.00 ? 98  ASP A OD1  6  
ATOM   5326  O OD2  . ASP A 1 34 ? 10.887  -4.210  7.960   1.00 0.00 ? 98  ASP A OD2  6  
ATOM   5327  H H    . ASP A 1 34 ? 8.186   -1.041  5.142   1.00 0.00 ? 98  ASP A H    6  
ATOM   5328  H HA   . ASP A 1 34 ? 10.636  -1.360  6.758   1.00 0.00 ? 98  ASP A HA   6  
ATOM   5329  H HB2  . ASP A 1 34 ? 8.774   -3.055  7.209   1.00 0.00 ? 98  ASP A HB2  6  
ATOM   5330  H HB3  . ASP A 1 34 ? 8.961   -3.548  5.536   1.00 0.00 ? 98  ASP A HB3  6  
ATOM   5331  N N    . GLU A 1 35 ? 11.703  -0.988  4.590   1.00 0.00 ? 99  GLU A N    6  
ATOM   5332  C CA   . GLU A 1 35 ? 12.491  -0.874  3.376   1.00 0.00 ? 99  GLU A CA   6  
ATOM   5333  C C    . GLU A 1 35 ? 13.251  -2.159  3.084   1.00 0.00 ? 99  GLU A C    6  
ATOM   5334  O O    . GLU A 1 35 ? 13.548  -2.464  1.930   1.00 0.00 ? 99  GLU A O    6  
ATOM   5335  C CB   . GLU A 1 35 ? 13.474  0.278   3.509   1.00 0.00 ? 99  GLU A CB   6  
ATOM   5336  C CG   . GLU A 1 35 ? 12.822  1.615   3.800   1.00 0.00 ? 99  GLU A CG   6  
ATOM   5337  C CD   . GLU A 1 35 ? 13.828  2.692   4.088   1.00 0.00 ? 99  GLU A CD   6  
ATOM   5338  O OE1  . GLU A 1 35 ? 14.369  2.735   5.221   1.00 0.00 ? 99  GLU A OE1  6  
ATOM   5339  O OE2  . GLU A 1 35 ? 14.104  3.520   3.203   1.00 0.00 ? 99  GLU A OE2  6  
ATOM   5340  H H    . GLU A 1 35 ? 11.937  -0.426  5.360   1.00 0.00 ? 99  GLU A H    6  
ATOM   5341  H HA   . GLU A 1 35 ? 11.822  -0.659  2.556   1.00 0.00 ? 99  GLU A HA   6  
ATOM   5342  H HB2  . GLU A 1 35 ? 14.168  0.059   4.306   1.00 0.00 ? 99  GLU A HB2  6  
ATOM   5343  H HB3  . GLU A 1 35 ? 14.016  0.356   2.578   1.00 0.00 ? 99  GLU A HB3  6  
ATOM   5344  H HG2  . GLU A 1 35 ? 12.241  1.913   2.938   1.00 0.00 ? 99  GLU A HG2  6  
ATOM   5345  H HG3  . GLU A 1 35 ? 12.167  1.512   4.652   1.00 0.00 ? 99  GLU A HG3  6  
ATOM   5346  N N    . GLU A 1 36 ? 13.525  -2.920  4.125   1.00 0.00 ? 100 GLU A N    6  
ATOM   5347  C CA   . GLU A 1 36 ? 14.309  -4.125  4.017   1.00 0.00 ? 100 GLU A CA   6  
ATOM   5348  C C    . GLU A 1 36 ? 13.568  -5.183  3.179   1.00 0.00 ? 100 GLU A C    6  
ATOM   5349  O O    . GLU A 1 36 ? 14.167  -5.838  2.303   1.00 0.00 ? 100 GLU A O    6  
ATOM   5350  C CB   . GLU A 1 36 ? 14.592  -4.660  5.414   1.00 0.00 ? 100 GLU A CB   6  
ATOM   5351  C CG   . GLU A 1 36 ? 15.716  -5.675  5.469   1.00 0.00 ? 100 GLU A CG   6  
ATOM   5352  C CD   . GLU A 1 36 ? 17.038  -5.085  5.041   1.00 0.00 ? 100 GLU A CD   6  
ATOM   5353  O OE1  . GLU A 1 36 ? 17.290  -4.947  3.827   1.00 0.00 ? 100 GLU A OE1  6  
ATOM   5354  O OE2  . GLU A 1 36 ? 17.865  -4.748  5.899   1.00 0.00 ? 100 GLU A OE2  6  
ATOM   5355  H H    . GLU A 1 36 ? 13.185  -2.652  5.007   1.00 0.00 ? 100 GLU A H    6  
ATOM   5356  H HA   . GLU A 1 36 ? 15.247  -3.884  3.539   1.00 0.00 ? 100 GLU A HA   6  
ATOM   5357  H HB2  . GLU A 1 36 ? 14.801  -3.834  6.078   1.00 0.00 ? 100 GLU A HB2  6  
ATOM   5358  H HB3  . GLU A 1 36 ? 13.688  -5.143  5.755   1.00 0.00 ? 100 GLU A HB3  6  
ATOM   5359  H HG2  . GLU A 1 36 ? 15.813  -6.041  6.480   1.00 0.00 ? 100 GLU A HG2  6  
ATOM   5360  H HG3  . GLU A 1 36 ? 15.475  -6.494  4.808   1.00 0.00 ? 100 GLU A HG3  6  
ATOM   5361  N N    . ASN A 1 37 ? 12.275  -5.328  3.420   1.00 0.00 ? 101 ASN A N    6  
ATOM   5362  C CA   . ASN A 1 37 ? 11.438  -6.251  2.626   1.00 0.00 ? 101 ASN A CA   6  
ATOM   5363  C C    . ASN A 1 37 ? 10.829  -5.521  1.469   1.00 0.00 ? 101 ASN A C    6  
ATOM   5364  O O    . ASN A 1 37 ? 10.274  -6.135  0.548   1.00 0.00 ? 101 ASN A O    6  
ATOM   5365  C CB   . ASN A 1 37 ? 10.293  -6.844  3.445   1.00 0.00 ? 101 ASN A CB   6  
ATOM   5366  C CG   . ASN A 1 37 ? 10.727  -7.749  4.559   1.00 0.00 ? 101 ASN A CG   6  
ATOM   5367  O OD1  . ASN A 1 37 ? 10.832  -8.965  4.391   1.00 0.00 ? 101 ASN A OD1  6  
ATOM   5368  N ND2  . ASN A 1 37 ? 10.993  -7.180  5.681   1.00 0.00 ? 101 ASN A ND2  6  
ATOM   5369  H H    . ASN A 1 37 ? 11.876  -4.840  4.183   1.00 0.00 ? 101 ASN A H    6  
ATOM   5370  H HA   . ASN A 1 37 ? 12.054  -7.055  2.251   1.00 0.00 ? 101 ASN A HA   6  
ATOM   5371  H HB2  . ASN A 1 37 ? 9.704   -6.045  3.870   1.00 0.00 ? 101 ASN A HB2  6  
ATOM   5372  H HB3  . ASN A 1 37 ? 9.680   -7.413  2.762   1.00 0.00 ? 101 ASN A HB3  6  
ATOM   5373  H HD21 . ASN A 1 37 ? 10.901  -6.192  5.720   1.00 0.00 ? 101 ASN A HD21 6  
ATOM   5374  H HD22 . ASN A 1 37 ? 11.266  -7.721  6.452   1.00 0.00 ? 101 ASN A HD22 6  
ATOM   5375  N N    . GLY A 1 38 ? 10.902  -4.212  1.530   1.00 0.00 ? 102 GLY A N    6  
ATOM   5376  C CA   . GLY A 1 38 ? 10.304  -3.383  0.530   1.00 0.00 ? 102 GLY A CA   6  
ATOM   5377  C C    . GLY A 1 38 ? 8.814   -3.335  0.718   1.00 0.00 ? 102 GLY A C    6  
ATOM   5378  O O    . GLY A 1 38 ? 8.055   -3.206  -0.248  1.00 0.00 ? 102 GLY A O    6  
ATOM   5379  H H    . GLY A 1 38 ? 11.370  -3.793  2.285   1.00 0.00 ? 102 GLY A H    6  
ATOM   5380  H HA2  . GLY A 1 38 ? 10.710  -2.385  0.604   1.00 0.00 ? 102 GLY A HA2  6  
ATOM   5381  H HA3  . GLY A 1 38 ? 10.517  -3.788  -0.448  1.00 0.00 ? 102 GLY A HA3  6  
ATOM   5382  N N    . THR A 1 39 ? 8.387   -3.465  1.953   1.00 0.00 ? 103 THR A N    6  
ATOM   5383  C CA   . THR A 1 39 ? 6.992   -3.457  2.273   1.00 0.00 ? 103 THR A CA   6  
ATOM   5384  C C    . THR A 1 39 ? 6.622   -2.255  3.117   1.00 0.00 ? 103 THR A C    6  
ATOM   5385  O O    . THR A 1 39 ? 7.491   -1.553  3.624   1.00 0.00 ? 103 THR A O    6  
ATOM   5386  C CB   . THR A 1 39 ? 6.585   -4.765  2.971   1.00 0.00 ? 103 THR A CB   6  
ATOM   5387  O OG1  . THR A 1 39 ? 7.503   -5.053  4.047   1.00 0.00 ? 103 THR A OG1  6  
ATOM   5388  C CG2  . THR A 1 39 ? 6.576   -5.919  1.982   1.00 0.00 ? 103 THR A CG2  6  
ATOM   5389  H H    . THR A 1 39 ? 9.022   -3.562  2.701   1.00 0.00 ? 103 THR A H    6  
ATOM   5390  H HA   . THR A 1 39 ? 6.438   -3.376  1.354   1.00 0.00 ? 103 THR A HA   6  
ATOM   5391  H HB   . THR A 1 39 ? 5.591   -4.633  3.369   1.00 0.00 ? 103 THR A HB   6  
ATOM   5392  H HG1  . THR A 1 39 ? 7.265   -4.470  4.783   1.00 0.00 ? 103 THR A HG1  6  
ATOM   5393  H HG21 . THR A 1 39 ? 7.560   -6.023  1.551   1.00 0.00 ? 103 THR A HG21 6  
ATOM   5394  H HG22 . THR A 1 39 ? 6.300   -6.833  2.488   1.00 0.00 ? 103 THR A HG22 6  
ATOM   5395  H HG23 . THR A 1 39 ? 5.866   -5.706  1.197   1.00 0.00 ? 103 THR A HG23 6  
ATOM   5396  N N    . ALA A 1 40 ? 5.359   -1.990  3.214   1.00 0.00 ? 104 ALA A N    6  
ATOM   5397  C CA   . ALA A 1 40 ? 4.867   -0.930  4.035   1.00 0.00 ? 104 ALA A CA   6  
ATOM   5398  C C    . ALA A 1 40 ? 3.569   -1.340  4.665   1.00 0.00 ? 104 ALA A C    6  
ATOM   5399  O O    . ALA A 1 40 ? 2.776   -2.083  4.068   1.00 0.00 ? 104 ALA A O    6  
ATOM   5400  C CB   . ALA A 1 40 ? 4.674   0.340   3.225   1.00 0.00 ? 104 ALA A CB   6  
ATOM   5401  H H    . ALA A 1 40 ? 4.696   -2.505  2.703   1.00 0.00 ? 104 ALA A H    6  
ATOM   5402  H HA   . ALA A 1 40 ? 5.590   -0.735  4.813   1.00 0.00 ? 104 ALA A HA   6  
ATOM   5403  H HB1  . ALA A 1 40 ? 3.959   0.157   2.437   1.00 0.00 ? 104 ALA A HB1  6  
ATOM   5404  H HB2  . ALA A 1 40 ? 4.306   1.126   3.868   1.00 0.00 ? 104 ALA A HB2  6  
ATOM   5405  H HB3  . ALA A 1 40 ? 5.616   0.639   2.791   1.00 0.00 ? 104 ALA A HB3  6  
ATOM   5406  N N    . ALA A 1 41 ? 3.364   -0.893  5.861   1.00 0.00 ? 105 ALA A N    6  
ATOM   5407  C CA   . ALA A 1 41 ? 2.143   -1.112  6.552   1.00 0.00 ? 105 ALA A CA   6  
ATOM   5408  C C    . ALA A 1 41 ? 1.260   0.069   6.271   1.00 0.00 ? 105 ALA A C    6  
ATOM   5409  O O    . ALA A 1 41 ? 1.633   1.225   6.548   1.00 0.00 ? 105 ALA A O    6  
ATOM   5410  C CB   . ALA A 1 41 ? 2.402   -1.257  8.026   1.00 0.00 ? 105 ALA A CB   6  
ATOM   5411  H H    . ALA A 1 41 ? 4.066   -0.356  6.296   1.00 0.00 ? 105 ALA A H    6  
ATOM   5412  H HA   . ALA A 1 41 ? 1.682   -2.011  6.173   1.00 0.00 ? 105 ALA A HA   6  
ATOM   5413  H HB1  . ALA A 1 41 ? 2.886   -0.360  8.383   1.00 0.00 ? 105 ALA A HB1  6  
ATOM   5414  H HB2  . ALA A 1 41 ? 1.462   -1.414  8.534   1.00 0.00 ? 105 ALA A HB2  6  
ATOM   5415  H HB3  . ALA A 1 41 ? 3.049   -2.108  8.165   1.00 0.00 ? 105 ALA A HB3  6  
ATOM   5416  N N    . ILE A 1 42 ? 0.128   -0.185  5.716   1.00 0.00 ? 106 ILE A N    6  
ATOM   5417  C CA   . ILE A 1 42 ? -0.741  0.867   5.276   1.00 0.00 ? 106 ILE A CA   6  
ATOM   5418  C C    . ILE A 1 42 ? -2.104  0.714   5.895   1.00 0.00 ? 106 ILE A C    6  
ATOM   5419  O O    . ILE A 1 42 ? -2.511  -0.386  6.233   1.00 0.00 ? 106 ILE A O    6  
ATOM   5420  C CB   . ILE A 1 42 ? -0.848  0.870   3.717   1.00 0.00 ? 106 ILE A CB   6  
ATOM   5421  C CG1  . ILE A 1 42 ? -1.373  -0.475  3.188   1.00 0.00 ? 106 ILE A CG1  6  
ATOM   5422  C CG2  . ILE A 1 42 ? 0.473   1.215   3.067   1.00 0.00 ? 106 ILE A CG2  6  
ATOM   5423  C CD1  . ILE A 1 42 ? -2.829  -0.460  2.880   1.00 0.00 ? 106 ILE A CD1  6  
ATOM   5424  H H    . ILE A 1 42 ? -0.150  -1.123  5.594   1.00 0.00 ? 106 ILE A H    6  
ATOM   5425  H HA   . ILE A 1 42 ? -0.316  1.809   5.586   1.00 0.00 ? 106 ILE A HA   6  
ATOM   5426  H HB   . ILE A 1 42 ? -1.555  1.641   3.449   1.00 0.00 ? 106 ILE A HB   6  
ATOM   5427  H HG12 . ILE A 1 42 ? -0.850  -0.815  2.309   1.00 0.00 ? 106 ILE A HG12 6  
ATOM   5428  H HG13 . ILE A 1 42 ? -1.227  -1.205  3.970   1.00 0.00 ? 106 ILE A HG13 6  
ATOM   5429  H HG21 . ILE A 1 42 ? 1.211   0.470   3.324   1.00 0.00 ? 106 ILE A HG21 6  
ATOM   5430  H HG22 . ILE A 1 42 ? 0.332   1.237   1.996   1.00 0.00 ? 106 ILE A HG22 6  
ATOM   5431  H HG23 . ILE A 1 42 ? 0.793   2.187   3.409   1.00 0.00 ? 106 ILE A HG23 6  
ATOM   5432  H HD11 . ILE A 1 42 ? -2.986  0.319   2.146   1.00 0.00 ? 106 ILE A HD11 6  
ATOM   5433  H HD12 . ILE A 1 42 ? -3.132  -1.414  2.477   1.00 0.00 ? 106 ILE A HD12 6  
ATOM   5434  H HD13 . ILE A 1 42 ? -3.389  -0.231  3.775   1.00 0.00 ? 106 ILE A HD13 6  
ATOM   5435  N N    . THR A 1 43 ? -2.784  1.803   6.069   1.00 0.00 ? 107 THR A N    6  
ATOM   5436  C CA   . THR A 1 43 ? -4.104  1.799   6.612   1.00 0.00 ? 107 THR A CA   6  
ATOM   5437  C C    . THR A 1 43 ? -5.064  2.459   5.630   1.00 0.00 ? 107 THR A C    6  
ATOM   5438  O O    . THR A 1 43 ? -4.861  3.611   5.223   1.00 0.00 ? 107 THR A O    6  
ATOM   5439  C CB   . THR A 1 43 ? -4.118  2.506   7.981   1.00 0.00 ? 107 THR A CB   6  
ATOM   5440  O OG1  . THR A 1 43 ? -3.215  1.814   8.848   1.00 0.00 ? 107 THR A OG1  6  
ATOM   5441  C CG2  . THR A 1 43 ? -5.505  2.501   8.602   1.00 0.00 ? 107 THR A CG2  6  
ATOM   5442  H H    . THR A 1 43 ? -2.385  2.672   5.825   1.00 0.00 ? 107 THR A H    6  
ATOM   5443  H HA   . THR A 1 43 ? -4.402  0.770   6.749   1.00 0.00 ? 107 THR A HA   6  
ATOM   5444  H HB   . THR A 1 43 ? -3.778  3.523   7.853   1.00 0.00 ? 107 THR A HB   6  
ATOM   5445  H HG1  . THR A 1 43 ? -2.709  1.206   8.297   1.00 0.00 ? 107 THR A HG1  6  
ATOM   5446  H HG21 . THR A 1 43 ? -5.822  1.481   8.766   1.00 0.00 ? 107 THR A HG21 6  
ATOM   5447  H HG22 . THR A 1 43 ? -5.480  3.027   9.544   1.00 0.00 ? 107 THR A HG22 6  
ATOM   5448  H HG23 . THR A 1 43 ? -6.192  2.991   7.928   1.00 0.00 ? 107 THR A HG23 6  
ATOM   5449  N N    . PHE A 1 44 ? -6.082  1.718   5.253   1.00 0.00 ? 108 PHE A N    6  
ATOM   5450  C CA   . PHE A 1 44 ? -7.065  2.140   4.279   1.00 0.00 ? 108 PHE A CA   6  
ATOM   5451  C C    . PHE A 1 44 ? -7.922  3.250   4.816   1.00 0.00 ? 108 PHE A C    6  
ATOM   5452  O O    . PHE A 1 44 ? -8.554  3.102   5.872   1.00 0.00 ? 108 PHE A O    6  
ATOM   5453  C CB   . PHE A 1 44 ? -7.924  0.963   3.838   1.00 0.00 ? 108 PHE A CB   6  
ATOM   5454  C CG   . PHE A 1 44 ? -7.151  -0.068  3.079   1.00 0.00 ? 108 PHE A CG   6  
ATOM   5455  C CD1  . PHE A 1 44 ? -6.840  0.159   1.753   1.00 0.00 ? 108 PHE A CD1  6  
ATOM   5456  C CD2  . PHE A 1 44 ? -6.729  -1.257  3.679   1.00 0.00 ? 108 PHE A CD2  6  
ATOM   5457  C CE1  . PHE A 1 44 ? -6.126  -0.757  1.024   1.00 0.00 ? 108 PHE A CE1  6  
ATOM   5458  C CE2  . PHE A 1 44 ? -6.009  -2.185  2.950   1.00 0.00 ? 108 PHE A CE2  6  
ATOM   5459  C CZ   . PHE A 1 44 ? -5.706  -1.933  1.619   1.00 0.00 ? 108 PHE A CZ   6  
ATOM   5460  H H    . PHE A 1 44 ? -6.195  0.844   5.691   1.00 0.00 ? 108 PHE A H    6  
ATOM   5461  H HA   . PHE A 1 44 ? -6.527  2.507   3.417   1.00 0.00 ? 108 PHE A HA   6  
ATOM   5462  H HB2  . PHE A 1 44 ? -8.378  0.493   4.699   1.00 0.00 ? 108 PHE A HB2  6  
ATOM   5463  H HB3  . PHE A 1 44 ? -8.705  1.331   3.189   1.00 0.00 ? 108 PHE A HB3  6  
ATOM   5464  H HD1  . PHE A 1 44 ? -7.172  1.078   1.292   1.00 0.00 ? 108 PHE A HD1  6  
ATOM   5465  H HD2  . PHE A 1 44 ? -6.981  -1.468  4.710   1.00 0.00 ? 108 PHE A HD2  6  
ATOM   5466  H HE1  . PHE A 1 44 ? -5.908  -0.544  -0.012  1.00 0.00 ? 108 PHE A HE1  6  
ATOM   5467  H HE2  . PHE A 1 44 ? -5.685  -3.102  3.418   1.00 0.00 ? 108 PHE A HE2  6  
ATOM   5468  H HZ   . PHE A 1 44 ? -5.143  -2.656  1.047   1.00 0.00 ? 108 PHE A HZ   6  
ATOM   5469  N N    . ALA A 1 45 ? -7.964  4.334   4.082   1.00 0.00 ? 109 ALA A N    6  
ATOM   5470  C CA   . ALA A 1 45 ? -8.669  5.513   4.490   1.00 0.00 ? 109 ALA A CA   6  
ATOM   5471  C C    . ALA A 1 45 ? -10.159 5.318   4.332   1.00 0.00 ? 109 ALA A C    6  
ATOM   5472  O O    . ALA A 1 45 ? -10.622 4.749   3.336   1.00 0.00 ? 109 ALA A O    6  
ATOM   5473  C CB   . ALA A 1 45 ? -8.194  6.714   3.691   1.00 0.00 ? 109 ALA A CB   6  
ATOM   5474  H H    . ALA A 1 45 ? -7.539  4.326   3.193   1.00 0.00 ? 109 ALA A H    6  
ATOM   5475  H HA   . ALA A 1 45 ? -8.439  5.686   5.531   1.00 0.00 ? 109 ALA A HA   6  
ATOM   5476  H HB1  . ALA A 1 45 ? -8.444  6.571   2.650   1.00 0.00 ? 109 ALA A HB1  6  
ATOM   5477  H HB2  . ALA A 1 45 ? -8.683  7.604   4.059   1.00 0.00 ? 109 ALA A HB2  6  
ATOM   5478  H HB3  . ALA A 1 45 ? -7.124  6.820   3.793   1.00 0.00 ? 109 ALA A HB3  6  
ATOM   5479  N N    . GLY A 1 46 ? -10.896 5.715   5.329   1.00 0.00 ? 110 GLY A N    6  
ATOM   5480  C CA   . GLY A 1 46 ? -12.327 5.620   5.284   1.00 0.00 ? 110 GLY A CA   6  
ATOM   5481  C C    . GLY A 1 46 ? -12.821 4.350   5.906   1.00 0.00 ? 110 GLY A C    6  
ATOM   5482  O O    . GLY A 1 46 ? -13.710 4.372   6.747   1.00 0.00 ? 110 GLY A O    6  
ATOM   5483  H H    . GLY A 1 46 ? -10.465 6.073   6.134   1.00 0.00 ? 110 GLY A H    6  
ATOM   5484  H HA2  . GLY A 1 46 ? -12.751 6.459   5.817   1.00 0.00 ? 110 GLY A HA2  6  
ATOM   5485  H HA3  . GLY A 1 46 ? -12.655 5.653   4.256   1.00 0.00 ? 110 GLY A HA3  6  
ATOM   5486  N N    . TYR A 1 47 ? -12.244 3.239   5.503   1.00 0.00 ? 111 TYR A N    6  
ATOM   5487  C CA   . TYR A 1 47 ? -12.653 1.952   6.011   1.00 0.00 ? 111 TYR A CA   6  
ATOM   5488  C C    . TYR A 1 47 ? -12.018 1.693   7.371   1.00 0.00 ? 111 TYR A C    6  
ATOM   5489  O O    . TYR A 1 47 ? -12.716 1.378   8.340   1.00 0.00 ? 111 TYR A O    6  
ATOM   5490  C CB   . TYR A 1 47 ? -12.227 0.871   5.055   1.00 0.00 ? 111 TYR A CB   6  
ATOM   5491  C CG   . TYR A 1 47 ? -12.646 1.087   3.625   1.00 0.00 ? 111 TYR A CG   6  
ATOM   5492  C CD1  . TYR A 1 47 ? -13.938 0.822   3.201   1.00 0.00 ? 111 TYR A CD1  6  
ATOM   5493  C CD2  . TYR A 1 47 ? -11.727 1.528   2.689   1.00 0.00 ? 111 TYR A CD2  6  
ATOM   5494  C CE1  . TYR A 1 47 ? -14.297 0.994   1.877   1.00 0.00 ? 111 TYR A CE1  6  
ATOM   5495  C CE2  . TYR A 1 47 ? -12.069 1.700   1.375   1.00 0.00 ? 111 TYR A CE2  6  
ATOM   5496  C CZ   . TYR A 1 47 ? -13.354 1.431   0.968   1.00 0.00 ? 111 TYR A CZ   6  
ATOM   5497  O OH   . TYR A 1 47 ? -13.703 1.598   -0.359  1.00 0.00 ? 111 TYR A OH   6  
ATOM   5498  H H    . TYR A 1 47 ? -11.539 3.292   4.822   1.00 0.00 ? 111 TYR A H    6  
ATOM   5499  H HA   . TYR A 1 47 ? -13.728 1.939   6.098   1.00 0.00 ? 111 TYR A HA   6  
ATOM   5500  H HB2  . TYR A 1 47 ? -11.148 0.808   5.069   1.00 0.00 ? 111 TYR A HB2  6  
ATOM   5501  H HB3  . TYR A 1 47 ? -12.624 -0.078  5.383   1.00 0.00 ? 111 TYR A HB3  6  
ATOM   5502  H HD1  . TYR A 1 47 ? -14.668 0.481   3.920   1.00 0.00 ? 111 TYR A HD1  6  
ATOM   5503  H HD2  . TYR A 1 47 ? -10.718 1.739   3.009   1.00 0.00 ? 111 TYR A HD2  6  
ATOM   5504  H HE1  . TYR A 1 47 ? -15.300 0.760   1.554   1.00 0.00 ? 111 TYR A HE1  6  
ATOM   5505  H HE2  . TYR A 1 47 ? -11.321 2.043   0.674   1.00 0.00 ? 111 TYR A HE2  6  
ATOM   5506  H HH   . TYR A 1 47 ? -12.999 1.219   -0.895  1.00 0.00 ? 111 TYR A HH   6  
ATOM   5507  N N    . GLY A 1 48 ? -10.705 1.871   7.450   1.00 0.00 ? 112 GLY A N    6  
ATOM   5508  C CA   . GLY A 1 48 ? -10.016 1.690   8.704   1.00 0.00 ? 112 GLY A CA   6  
ATOM   5509  C C    . GLY A 1 48 ? -9.355  0.323   8.893   1.00 0.00 ? 112 GLY A C    6  
ATOM   5510  O O    . GLY A 1 48 ? -9.313  -0.191  10.012  1.00 0.00 ? 112 GLY A O    6  
ATOM   5511  H H    . GLY A 1 48 ? -10.193 2.163   6.665   1.00 0.00 ? 112 GLY A H    6  
ATOM   5512  H HA2  . GLY A 1 48 ? -9.251  2.446   8.786   1.00 0.00 ? 112 GLY A HA2  6  
ATOM   5513  H HA3  . GLY A 1 48 ? -10.730 1.837   9.499   1.00 0.00 ? 112 GLY A HA3  6  
ATOM   5514  N N    . ASN A 1 49 ? -8.861  -0.288  7.830   1.00 0.00 ? 113 ASN A N    6  
ATOM   5515  C CA   . ASN A 1 49 ? -8.105  -1.542  7.996   1.00 0.00 ? 113 ASN A CA   6  
ATOM   5516  C C    . ASN A 1 49 ? -6.677  -1.283  7.667   1.00 0.00 ? 113 ASN A C    6  
ATOM   5517  O O    . ASN A 1 49 ? -6.360  -0.263  7.068   1.00 0.00 ? 113 ASN A O    6  
ATOM   5518  C CB   . ASN A 1 49 ? -8.569  -2.699  7.112   1.00 0.00 ? 113 ASN A CB   6  
ATOM   5519  C CG   . ASN A 1 49 ? -9.987  -3.145  7.305   1.00 0.00 ? 113 ASN A CG   6  
ATOM   5520  O OD1  . ASN A 1 49 ? -10.598 -2.962  8.363   1.00 0.00 ? 113 ASN A OD1  6  
ATOM   5521  N ND2  . ASN A 1 49 ? -10.479 -3.818  6.328   1.00 0.00 ? 113 ASN A ND2  6  
ATOM   5522  H H    . ASN A 1 49 ? -8.975  0.096   6.938   1.00 0.00 ? 113 ASN A H    6  
ATOM   5523  H HA   . ASN A 1 49 ? -8.174  -1.824  9.037   1.00 0.00 ? 113 ASN A HA   6  
ATOM   5524  H HB2  . ASN A 1 49 ? -8.460  -2.409  6.080   1.00 0.00 ? 113 ASN A HB2  6  
ATOM   5525  H HB3  . ASN A 1 49 ? -7.917  -3.541  7.296   1.00 0.00 ? 113 ASN A HB3  6  
ATOM   5526  H HD21 . ASN A 1 49 ? -9.875  -3.995  5.572   1.00 0.00 ? 113 ASN A HD21 6  
ATOM   5527  H HD22 . ASN A 1 49 ? -11.422 -4.072  6.324   1.00 0.00 ? 113 ASN A HD22 6  
ATOM   5528  N N    . ALA A 1 50 ? -5.826  -2.203  7.994   1.00 0.00 ? 114 ALA A N    6  
ATOM   5529  C CA   . ALA A 1 50 ? -4.425  -2.049  7.751   1.00 0.00 ? 114 ALA A CA   6  
ATOM   5530  C C    . ALA A 1 50 ? -3.835  -3.348  7.280   1.00 0.00 ? 114 ALA A C    6  
ATOM   5531  O O    . ALA A 1 50 ? -4.201  -4.415  7.788   1.00 0.00 ? 114 ALA A O    6  
ATOM   5532  C CB   . ALA A 1 50 ? -3.724  -1.581  9.012   1.00 0.00 ? 114 ALA A CB   6  
ATOM   5533  H H    . ALA A 1 50 ? -6.133  -3.038  8.410   1.00 0.00 ? 114 ALA A H    6  
ATOM   5534  H HA   . ALA A 1 50 ? -4.283  -1.298  6.988   1.00 0.00 ? 114 ALA A HA   6  
ATOM   5535  H HB1  . ALA A 1 50 ? -3.861  -2.317  9.792   1.00 0.00 ? 114 ALA A HB1  6  
ATOM   5536  H HB2  . ALA A 1 50 ? -2.670  -1.455  8.814   1.00 0.00 ? 114 ALA A HB2  6  
ATOM   5537  H HB3  . ALA A 1 50 ? -4.147  -0.640  9.329   1.00 0.00 ? 114 ALA A HB3  6  
ATOM   5538  N N    . GLU A 1 51 ? -2.953  -3.276  6.320   1.00 0.00 ? 115 GLU A N    6  
ATOM   5539  C CA   . GLU A 1 51 ? -2.289  -4.447  5.815   1.00 0.00 ? 115 GLU A CA   6  
ATOM   5540  C C    . GLU A 1 51 ? -0.856  -4.107  5.477   1.00 0.00 ? 115 GLU A C    6  
ATOM   5541  O O    . GLU A 1 51 ? -0.510  -2.924  5.339   1.00 0.00 ? 115 GLU A O    6  
ATOM   5542  C CB   . GLU A 1 51 ? -2.986  -5.039  4.573   1.00 0.00 ? 115 GLU A CB   6  
ATOM   5543  C CG   . GLU A 1 51 ? -2.885  -4.226  3.293   1.00 0.00 ? 115 GLU A CG   6  
ATOM   5544  C CD   . GLU A 1 51 ? -3.204  -5.077  2.078   1.00 0.00 ? 115 GLU A CD   6  
ATOM   5545  O OE1  . GLU A 1 51 ? -4.394  -5.302  1.772   1.00 0.00 ? 115 GLU A OE1  6  
ATOM   5546  O OE2  . GLU A 1 51 ? -2.251  -5.595  1.455   1.00 0.00 ? 115 GLU A OE2  6  
ATOM   5547  H H    . GLU A 1 51 ? -2.705  -2.400  5.945   1.00 0.00 ? 115 GLU A H    6  
ATOM   5548  H HA   . GLU A 1 51 ? -2.292  -5.184  6.606   1.00 0.00 ? 115 GLU A HA   6  
ATOM   5549  H HB2  . GLU A 1 51 ? -2.577  -6.011  4.357   1.00 0.00 ? 115 GLU A HB2  6  
ATOM   5550  H HB3  . GLU A 1 51 ? -4.038  -5.127  4.805   1.00 0.00 ? 115 GLU A HB3  6  
ATOM   5551  H HG2  . GLU A 1 51 ? -3.579  -3.400  3.341   1.00 0.00 ? 115 GLU A HG2  6  
ATOM   5552  H HG3  . GLU A 1 51 ? -1.878  -3.848  3.195   1.00 0.00 ? 115 GLU A HG3  6  
ATOM   5553  N N    . VAL A 1 52 ? -0.029  -5.113  5.395   1.00 0.00 ? 116 VAL A N    6  
ATOM   5554  C CA   . VAL A 1 52 ? 1.336   -4.944  4.968   1.00 0.00 ? 116 VAL A CA   6  
ATOM   5555  C C    . VAL A 1 52 ? 1.418   -5.298  3.498   1.00 0.00 ? 116 VAL A C    6  
ATOM   5556  O O    . VAL A 1 52 ? 1.167   -6.449  3.105   1.00 0.00 ? 116 VAL A O    6  
ATOM   5557  C CB   . VAL A 1 52 ? 2.315   -5.822  5.787   1.00 0.00 ? 116 VAL A CB   6  
ATOM   5558  C CG1  . VAL A 1 52 ? 3.734   -5.709  5.239   1.00 0.00 ? 116 VAL A CG1  6  
ATOM   5559  C CG2  . VAL A 1 52 ? 2.291   -5.399  7.244   1.00 0.00 ? 116 VAL A CG2  6  
ATOM   5560  H H    . VAL A 1 52 ? -0.348  -6.015  5.620   1.00 0.00 ? 116 VAL A H    6  
ATOM   5561  H HA   . VAL A 1 52 ? 1.597   -3.904  5.088   1.00 0.00 ? 116 VAL A HA   6  
ATOM   5562  H HB   . VAL A 1 52 ? 1.996   -6.851  5.725   1.00 0.00 ? 116 VAL A HB   6  
ATOM   5563  H HG11 . VAL A 1 52 ? 4.061   -4.682  5.315   1.00 0.00 ? 116 VAL A HG11 6  
ATOM   5564  H HG12 . VAL A 1 52 ? 4.396   -6.347  5.808   1.00 0.00 ? 116 VAL A HG12 6  
ATOM   5565  H HG13 . VAL A 1 52 ? 3.744   -6.014  4.204   1.00 0.00 ? 116 VAL A HG13 6  
ATOM   5566  H HG21 . VAL A 1 52 ? 1.283   -5.471  7.621   1.00 0.00 ? 116 VAL A HG21 6  
ATOM   5567  H HG22 . VAL A 1 52 ? 2.945   -6.034  7.823   1.00 0.00 ? 116 VAL A HG22 6  
ATOM   5568  H HG23 . VAL A 1 52 ? 2.625   -4.375  7.321   1.00 0.00 ? 116 VAL A HG23 6  
ATOM   5569  N N    . THR A 1 53 ? 1.741   -4.334  2.707   1.00 0.00 ? 117 THR A N    6  
ATOM   5570  C CA   . THR A 1 53 ? 1.774   -4.505  1.282   1.00 0.00 ? 117 THR A CA   6  
ATOM   5571  C C    . THR A 1 53 ? 3.092   -3.934  0.729   1.00 0.00 ? 117 THR A C    6  
ATOM   5572  O O    . THR A 1 53 ? 3.628   -2.967  1.282   1.00 0.00 ? 117 THR A O    6  
ATOM   5573  C CB   . THR A 1 53 ? 0.523   -3.851  0.602   1.00 0.00 ? 117 THR A CB   6  
ATOM   5574  O OG1  . THR A 1 53 ? 0.414   -4.254  -0.775  1.00 0.00 ? 117 THR A OG1  6  
ATOM   5575  C CG2  . THR A 1 53 ? 0.583   -2.338  0.677   1.00 0.00 ? 117 THR A CG2  6  
ATOM   5576  H H    . THR A 1 53 ? 1.986   -3.463  3.104   1.00 0.00 ? 117 THR A H    6  
ATOM   5577  H HA   . THR A 1 53 ? 1.761   -5.569  1.095   1.00 0.00 ? 117 THR A HA   6  
ATOM   5578  H HB   . THR A 1 53 ? -0.360  -4.190  1.122   1.00 0.00 ? 117 THR A HB   6  
ATOM   5579  H HG1  . THR A 1 53 ? -0.400  -4.769  -0.823  1.00 0.00 ? 117 THR A HG1  6  
ATOM   5580  H HG21 . THR A 1 53 ? 1.456   -1.988  0.145   1.00 0.00 ? 117 THR A HG21 6  
ATOM   5581  H HG22 . THR A 1 53 ? -0.305  -1.918  0.228   1.00 0.00 ? 117 THR A HG22 6  
ATOM   5582  H HG23 . THR A 1 53 ? 0.650   -2.038  1.711   1.00 0.00 ? 117 THR A HG23 6  
ATOM   5583  N N    . PRO A 1 54 ? 3.702   -4.590  -0.271  1.00 0.00 ? 118 PRO A N    6  
ATOM   5584  C CA   . PRO A 1 54 ? 4.941   -4.119  -0.874  1.00 0.00 ? 118 PRO A CA   6  
ATOM   5585  C C    . PRO A 1 54 ? 4.793   -2.738  -1.509  1.00 0.00 ? 118 PRO A C    6  
ATOM   5586  O O    . PRO A 1 54 ? 3.734   -2.391  -2.028  1.00 0.00 ? 118 PRO A O    6  
ATOM   5587  C CB   . PRO A 1 54 ? 5.247   -5.156  -1.954  1.00 0.00 ? 118 PRO A CB   6  
ATOM   5588  C CG   . PRO A 1 54 ? 3.968   -5.844  -2.202  1.00 0.00 ? 118 PRO A CG   6  
ATOM   5589  C CD   . PRO A 1 54 ? 3.223   -5.821  -0.906  1.00 0.00 ? 118 PRO A CD   6  
ATOM   5590  H HA   . PRO A 1 54 ? 5.751   -4.097  -0.164  1.00 0.00 ? 118 PRO A HA   6  
ATOM   5591  H HB2  . PRO A 1 54 ? 5.611   -4.661  -2.841  1.00 0.00 ? 118 PRO A HB2  6  
ATOM   5592  H HB3  . PRO A 1 54 ? 5.993   -5.845  -1.592  1.00 0.00 ? 118 PRO A HB3  6  
ATOM   5593  H HG2  . PRO A 1 54 ? 3.415   -5.314  -2.964  1.00 0.00 ? 118 PRO A HG2  6  
ATOM   5594  H HG3  . PRO A 1 54 ? 4.154   -6.860  -2.517  1.00 0.00 ? 118 PRO A HG3  6  
ATOM   5595  H HD2  . PRO A 1 54 ? 2.160   -5.771  -1.088  1.00 0.00 ? 118 PRO A HD2  6  
ATOM   5596  H HD3  . PRO A 1 54 ? 3.456   -6.686  -0.309  1.00 0.00 ? 118 PRO A HD3  6  
ATOM   5597  N N    . LEU A 1 55 ? 5.867   -1.979  -1.477  1.00 0.00 ? 119 LEU A N    6  
ATOM   5598  C CA   . LEU A 1 55 ? 5.945   -0.634  -2.068  1.00 0.00 ? 119 LEU A CA   6  
ATOM   5599  C C    . LEU A 1 55 ? 5.615   -0.665  -3.557  1.00 0.00 ? 119 LEU A C    6  
ATOM   5600  O O    . LEU A 1 55 ? 5.172   0.328   -4.127  1.00 0.00 ? 119 LEU A O    6  
ATOM   5601  C CB   . LEU A 1 55 ? 7.341   -0.045  -1.851  1.00 0.00 ? 119 LEU A CB   6  
ATOM   5602  C CG   . LEU A 1 55 ? 7.806   0.044   -0.394  1.00 0.00 ? 119 LEU A CG   6  
ATOM   5603  C CD1  . LEU A 1 55 ? 9.216   0.576   -0.306  1.00 0.00 ? 119 LEU A CD1  6  
ATOM   5604  C CD2  . LEU A 1 55 ? 6.867   0.895   0.437   1.00 0.00 ? 119 LEU A CD2  6  
ATOM   5605  H H    . LEU A 1 55 ? 6.648   -2.343  -1.005  1.00 0.00 ? 119 LEU A H    6  
ATOM   5606  H HA   . LEU A 1 55 ? 5.220   0.000   -1.581  1.00 0.00 ? 119 LEU A HA   6  
ATOM   5607  H HB2  . LEU A 1 55 ? 8.043   -0.662  -2.393  1.00 0.00 ? 119 LEU A HB2  6  
ATOM   5608  H HB3  . LEU A 1 55 ? 7.361   0.946   -2.277  1.00 0.00 ? 119 LEU A HB3  6  
ATOM   5609  H HG   . LEU A 1 55 ? 7.799   -0.956  0.010   1.00 0.00 ? 119 LEU A HG   6  
ATOM   5610  H HD11 . LEU A 1 55 ? 9.247   1.573   -0.719  1.00 0.00 ? 119 LEU A HD11 6  
ATOM   5611  H HD12 . LEU A 1 55 ? 9.522   0.599   0.729   1.00 0.00 ? 119 LEU A HD12 6  
ATOM   5612  H HD13 . LEU A 1 55 ? 9.880   -0.069  -0.862  1.00 0.00 ? 119 LEU A HD13 6  
ATOM   5613  H HD21 . LEU A 1 55 ? 5.880   0.458   0.426   1.00 0.00 ? 119 LEU A HD21 6  
ATOM   5614  H HD22 . LEU A 1 55 ? 7.234   0.925   1.451   1.00 0.00 ? 119 LEU A HD22 6  
ATOM   5615  H HD23 . LEU A 1 55 ? 6.826   1.899   0.045   1.00 0.00 ? 119 LEU A HD23 6  
ATOM   5616  N N    . LEU A 1 56 ? 5.852   -1.819  -4.173  1.00 0.00 ? 120 LEU A N    6  
ATOM   5617  C CA   . LEU A 1 56 ? 5.551   -2.045  -5.580  1.00 0.00 ? 120 LEU A CA   6  
ATOM   5618  C C    . LEU A 1 56 ? 4.044   -2.002  -5.815  1.00 0.00 ? 120 LEU A C    6  
ATOM   5619  O O    . LEU A 1 56 ? 3.579   -1.634  -6.883  1.00 0.00 ? 120 LEU A O    6  
ATOM   5620  C CB   . LEU A 1 56 ? 6.151   -3.399  -6.039  1.00 0.00 ? 120 LEU A CB   6  
ATOM   5621  C CG   . LEU A 1 56 ? 5.355   -4.686  -5.732  1.00 0.00 ? 120 LEU A CG   6  
ATOM   5622  C CD1  . LEU A 1 56 ? 4.386   -4.988  -6.859  1.00 0.00 ? 120 LEU A CD1  6  
ATOM   5623  C CD2  . LEU A 1 56 ? 6.280   -5.858  -5.490  1.00 0.00 ? 120 LEU A CD2  6  
ATOM   5624  H H    . LEU A 1 56 ? 6.285   -2.529  -3.652  1.00 0.00 ? 120 LEU A H    6  
ATOM   5625  H HA   . LEU A 1 56 ? 5.995   -1.253  -6.155  1.00 0.00 ? 120 LEU A HA   6  
ATOM   5626  H HB2  . LEU A 1 56 ? 6.292   -3.354  -7.107  1.00 0.00 ? 120 LEU A HB2  6  
ATOM   5627  H HB3  . LEU A 1 56 ? 7.122   -3.493  -5.574  1.00 0.00 ? 120 LEU A HB3  6  
ATOM   5628  H HG   . LEU A 1 56 ? 4.752   -4.522  -4.849  1.00 0.00 ? 120 LEU A HG   6  
ATOM   5629  H HD11 . LEU A 1 56 ? 4.938   -5.143  -7.775  1.00 0.00 ? 120 LEU A HD11 6  
ATOM   5630  H HD12 . LEU A 1 56 ? 3.796   -5.860  -6.621  1.00 0.00 ? 120 LEU A HD12 6  
ATOM   5631  H HD13 . LEU A 1 56 ? 3.752   -4.118  -6.967  1.00 0.00 ? 120 LEU A HD13 6  
ATOM   5632  H HD21 . LEU A 1 56 ? 6.895   -5.654  -4.627  1.00 0.00 ? 120 LEU A HD21 6  
ATOM   5633  H HD22 . LEU A 1 56 ? 5.695   -6.747  -5.306  1.00 0.00 ? 120 LEU A HD22 6  
ATOM   5634  H HD23 . LEU A 1 56 ? 6.910   -6.011  -6.354  1.00 0.00 ? 120 LEU A HD23 6  
ATOM   5635  N N    . ASN A 1 57 ? 3.296   -2.374  -4.801  1.00 0.00 ? 121 ASN A N    6  
ATOM   5636  C CA   . ASN A 1 57 ? 1.846   -2.416  -4.879  1.00 0.00 ? 121 ASN A CA   6  
ATOM   5637  C C    . ASN A 1 57 ? 1.254   -1.078  -4.593  1.00 0.00 ? 121 ASN A C    6  
ATOM   5638  O O    . ASN A 1 57 ? 0.063   -0.850  -4.840  1.00 0.00 ? 121 ASN A O    6  
ATOM   5639  C CB   . ASN A 1 57 ? 1.248   -3.461  -3.925  1.00 0.00 ? 121 ASN A CB   6  
ATOM   5640  C CG   . ASN A 1 57 ? 1.197   -4.851  -4.498  1.00 0.00 ? 121 ASN A CG   6  
ATOM   5641  O OD1  . ASN A 1 57 ? 1.119   -5.037  -5.703  1.00 0.00 ? 121 ASN A OD1  6  
ATOM   5642  N ND2  . ASN A 1 57 ? 1.168   -5.831  -3.638  1.00 0.00 ? 121 ASN A ND2  6  
ATOM   5643  H H    . ASN A 1 57 ? 3.732   -2.602  -3.951  1.00 0.00 ? 121 ASN A H    6  
ATOM   5644  H HA   . ASN A 1 57 ? 1.587   -2.694  -5.890  1.00 0.00 ? 121 ASN A HA   6  
ATOM   5645  H HB2  . ASN A 1 57 ? 1.883   -3.506  -3.052  1.00 0.00 ? 121 ASN A HB2  6  
ATOM   5646  H HB3  . ASN A 1 57 ? 0.263   -3.185  -3.595  1.00 0.00 ? 121 ASN A HB3  6  
ATOM   5647  H HD21 . ASN A 1 57 ? 1.170   -5.599  -2.684  1.00 0.00 ? 121 ASN A HD21 6  
ATOM   5648  H HD22 . ASN A 1 57 ? 1.181   -6.754  -3.976  1.00 0.00 ? 121 ASN A HD22 6  
ATOM   5649  N N    . LEU A 1 58 ? 2.065   -0.184  -4.089  1.00 0.00 ? 122 LEU A N    6  
ATOM   5650  C CA   . LEU A 1 58 ? 1.600   1.120   -3.764  1.00 0.00 ? 122 LEU A CA   6  
ATOM   5651  C C    . LEU A 1 58 ? 1.676   2.009   -4.973  1.00 0.00 ? 122 LEU A C    6  
ATOM   5652  O O    . LEU A 1 58 ? 2.696   2.059   -5.675  1.00 0.00 ? 122 LEU A O    6  
ATOM   5653  C CB   . LEU A 1 58 ? 2.410   1.707   -2.611  1.00 0.00 ? 122 LEU A CB   6  
ATOM   5654  C CG   . LEU A 1 58 ? 2.315   0.976   -1.277  1.00 0.00 ? 122 LEU A CG   6  
ATOM   5655  C CD1  . LEU A 1 58 ? 3.141   1.691   -0.225  1.00 0.00 ? 122 LEU A CD1  6  
ATOM   5656  C CD2  . LEU A 1 58 ? 0.869   0.865   -0.838  1.00 0.00 ? 122 LEU A CD2  6  
ATOM   5657  H H    . LEU A 1 58 ? 3.014   -0.399  -3.962  1.00 0.00 ? 122 LEU A H    6  
ATOM   5658  H HA   . LEU A 1 58 ? 0.566   1.045   -3.459  1.00 0.00 ? 122 LEU A HA   6  
ATOM   5659  H HB2  . LEU A 1 58 ? 3.451   1.690   -2.901  1.00 0.00 ? 122 LEU A HB2  6  
ATOM   5660  H HB3  . LEU A 1 58 ? 2.108   2.732   -2.457  1.00 0.00 ? 122 LEU A HB3  6  
ATOM   5661  H HG   . LEU A 1 58 ? 2.713   -0.023  -1.394  1.00 0.00 ? 122 LEU A HG   6  
ATOM   5662  H HD11 . LEU A 1 58 ? 2.779   2.703   -0.110  1.00 0.00 ? 122 LEU A HD11 6  
ATOM   5663  H HD12 . LEU A 1 58 ? 3.059   1.169   0.716   1.00 0.00 ? 122 LEU A HD12 6  
ATOM   5664  H HD13 . LEU A 1 58 ? 4.175   1.722   -0.533  1.00 0.00 ? 122 LEU A HD13 6  
ATOM   5665  H HD21 . LEU A 1 58 ? 0.305   0.325   -1.585  1.00 0.00 ? 122 LEU A HD21 6  
ATOM   5666  H HD22 . LEU A 1 58 ? 0.817   0.331   0.099   1.00 0.00 ? 122 LEU A HD22 6  
ATOM   5667  H HD23 . LEU A 1 58 ? 0.447   1.853   -0.724  1.00 0.00 ? 122 LEU A HD23 6  
ATOM   5668  N N    . LYS A 1 59 ? 0.593   2.668   -5.235  1.00 0.00 ? 123 LYS A N    6  
ATOM   5669  C CA   . LYS A 1 59 ? 0.498   3.596   -6.332  1.00 0.00 ? 123 LYS A CA   6  
ATOM   5670  C C    . LYS A 1 59 ? 0.269   4.973   -5.793  1.00 0.00 ? 123 LYS A C    6  
ATOM   5671  O O    . LYS A 1 59 ? -0.247  5.111   -4.685  1.00 0.00 ? 123 LYS A O    6  
ATOM   5672  C CB   . LYS A 1 59 ? -0.637  3.220   -7.290  1.00 0.00 ? 123 LYS A CB   6  
ATOM   5673  C CG   . LYS A 1 59 ? -0.494  1.844   -7.869  1.00 0.00 ? 123 LYS A CG   6  
ATOM   5674  C CD   . LYS A 1 59 ? -1.471  1.586   -9.007  1.00 0.00 ? 123 LYS A CD   6  
ATOM   5675  C CE   . LYS A 1 59 ? -2.926  1.633   -8.555  1.00 0.00 ? 123 LYS A CE   6  
ATOM   5676  N NZ   . LYS A 1 59 ? -3.852  1.295   -9.655  1.00 0.00 ? 123 LYS A NZ   6  
ATOM   5677  H H    . LYS A 1 59 ? -0.171  2.524   -4.632  1.00 0.00 ? 123 LYS A H    6  
ATOM   5678  H HA   . LYS A 1 59 ? 1.434   3.575   -6.870  1.00 0.00 ? 123 LYS A HA   6  
ATOM   5679  H HB2  . LYS A 1 59 ? -1.572  3.268   -6.753  1.00 0.00 ? 123 LYS A HB2  6  
ATOM   5680  H HB3  . LYS A 1 59 ? -0.669  3.928   -8.104  1.00 0.00 ? 123 LYS A HB3  6  
ATOM   5681  H HG2  . LYS A 1 59 ? 0.519   1.713   -8.215  1.00 0.00 ? 123 LYS A HG2  6  
ATOM   5682  H HG3  . LYS A 1 59 ? -0.701  1.163   -7.056  1.00 0.00 ? 123 LYS A HG3  6  
ATOM   5683  H HD2  . LYS A 1 59 ? -1.309  2.359   -9.745  1.00 0.00 ? 123 LYS A HD2  6  
ATOM   5684  H HD3  . LYS A 1 59 ? -1.257  0.621   -9.444  1.00 0.00 ? 123 LYS A HD3  6  
ATOM   5685  H HE2  . LYS A 1 59 ? -3.062  0.930   -7.748  1.00 0.00 ? 123 LYS A HE2  6  
ATOM   5686  H HE3  . LYS A 1 59 ? -3.151  2.629   -8.201  1.00 0.00 ? 123 LYS A HE3  6  
ATOM   5687  H HZ1  . LYS A 1 59 ? -3.715  0.321   -9.994  1.00 0.00 ? 123 LYS A HZ1  6  
ATOM   5688  H HZ2  . LYS A 1 59 ? -4.848  1.388   -9.361  1.00 0.00 ? 123 LYS A HZ2  6  
ATOM   5689  H HZ3  . LYS A 1 59 ? -3.729  1.937   -10.462 1.00 0.00 ? 123 LYS A HZ3  6  
ATOM   5690  N N    . PRO A 1 60 ? 0.637   6.009   -6.533  1.00 0.00 ? 124 PRO A N    6  
ATOM   5691  C CA   . PRO A 1 60 ? 0.356   7.367   -6.128  1.00 0.00 ? 124 PRO A CA   6  
ATOM   5692  C C    . PRO A 1 60 ? -1.136  7.662   -6.244  1.00 0.00 ? 124 PRO A C    6  
ATOM   5693  O O    . PRO A 1 60 ? -1.853  7.047   -7.065  1.00 0.00 ? 124 PRO A O    6  
ATOM   5694  C CB   . PRO A 1 60 ? 1.170   8.229   -7.101  1.00 0.00 ? 124 PRO A CB   6  
ATOM   5695  C CG   . PRO A 1 60 ? 1.402   7.366   -8.295  1.00 0.00 ? 124 PRO A CG   6  
ATOM   5696  C CD   . PRO A 1 60 ? 1.362   5.941   -7.815  1.00 0.00 ? 124 PRO A CD   6  
ATOM   5697  H HA   . PRO A 1 60 ? 0.656   7.555   -5.110  1.00 0.00 ? 124 PRO A HA   6  
ATOM   5698  H HB2  . PRO A 1 60 ? 0.610   9.117   -7.356  1.00 0.00 ? 124 PRO A HB2  6  
ATOM   5699  H HB3  . PRO A 1 60 ? 2.103   8.511   -6.638  1.00 0.00 ? 124 PRO A HB3  6  
ATOM   5700  H HG2  . PRO A 1 60 ? 0.621   7.534   -9.022  1.00 0.00 ? 124 PRO A HG2  6  
ATOM   5701  H HG3  . PRO A 1 60 ? 2.366   7.589   -8.727  1.00 0.00 ? 124 PRO A HG3  6  
ATOM   5702  H HD2  . PRO A 1 60 ? 0.810   5.324   -8.507  1.00 0.00 ? 124 PRO A HD2  6  
ATOM   5703  H HD3  . PRO A 1 60 ? 2.352   5.532   -7.678  1.00 0.00 ? 124 PRO A HD3  6  
ATOM   5704  N N    . VAL A 1 61 ? -1.616  8.541   -5.410  1.00 0.00 ? 125 VAL A N    6  
ATOM   5705  C CA   . VAL A 1 61 ? -3.004  8.936   -5.449  1.00 0.00 ? 125 VAL A CA   6  
ATOM   5706  C C    . VAL A 1 61 ? -3.180  10.082  -6.423  1.00 0.00 ? 125 VAL A C    6  
ATOM   5707  O O    . VAL A 1 61 ? -2.197  10.559  -7.018  1.00 0.00 ? 125 VAL A O    6  
ATOM   5708  C CB   . VAL A 1 61 ? -3.546  9.375   -4.056  1.00 0.00 ? 125 VAL A CB   6  
ATOM   5709  C CG1  . VAL A 1 61 ? -3.562  8.218   -3.088  1.00 0.00 ? 125 VAL A CG1  6  
ATOM   5710  C CG2  . VAL A 1 61 ? -2.739  10.540  -3.484  1.00 0.00 ? 125 VAL A CG2  6  
ATOM   5711  H H    . VAL A 1 61 ? -1.004  8.952   -4.759  1.00 0.00 ? 125 VAL A H    6  
ATOM   5712  H HA   . VAL A 1 61 ? -3.560  8.071   -5.781  1.00 0.00 ? 125 VAL A HA   6  
ATOM   5713  H HB   . VAL A 1 61 ? -4.564  9.706   -4.195  1.00 0.00 ? 125 VAL A HB   6  
ATOM   5714  H HG11 . VAL A 1 61 ? -2.556  7.848   -2.950  1.00 0.00 ? 125 VAL A HG11 6  
ATOM   5715  H HG12 . VAL A 1 61 ? -3.951  8.552   -2.138  1.00 0.00 ? 125 VAL A HG12 6  
ATOM   5716  H HG13 . VAL A 1 61 ? -4.190  7.429   -3.474  1.00 0.00 ? 125 VAL A HG13 6  
ATOM   5717  H HG21 . VAL A 1 61 ? -2.774  11.374  -4.170  1.00 0.00 ? 125 VAL A HG21 6  
ATOM   5718  H HG22 . VAL A 1 61 ? -3.159  10.839  -2.534  1.00 0.00 ? 125 VAL A HG22 6  
ATOM   5719  H HG23 . VAL A 1 61 ? -1.714  10.235  -3.343  1.00 0.00 ? 125 VAL A HG23 6  
ATOM   5720  N N    . GLU A 1 62 ? -4.388  10.516  -6.599  1.00 0.00 ? 126 GLU A N    6  
ATOM   5721  C CA   . GLU A 1 62 ? -4.648  11.674  -7.407  1.00 0.00 ? 126 GLU A CA   6  
ATOM   5722  C C    . GLU A 1 62 ? -4.595  12.887  -6.506  1.00 0.00 ? 126 GLU A C    6  
ATOM   5723  O O    . GLU A 1 62 ? -4.845  12.778  -5.300  1.00 0.00 ? 126 GLU A O    6  
ATOM   5724  C CB   . GLU A 1 62 ? -6.006  11.593  -8.156  1.00 0.00 ? 126 GLU A CB   6  
ATOM   5725  C CG   . GLU A 1 62 ? -7.254  11.401  -7.285  1.00 0.00 ? 126 GLU A CG   6  
ATOM   5726  C CD   . GLU A 1 62 ? -7.335  10.029  -6.663  1.00 0.00 ? 126 GLU A CD   6  
ATOM   5727  O OE1  . GLU A 1 62 ? -7.774  9.083   -7.342  1.00 0.00 ? 126 GLU A OE1  6  
ATOM   5728  O OE2  . GLU A 1 62 ? -6.929  9.865   -5.498  1.00 0.00 ? 126 GLU A OE2  6  
ATOM   5729  H H    . GLU A 1 62 ? -5.147  10.077  -6.148  1.00 0.00 ? 126 GLU A H    6  
ATOM   5730  H HA   . GLU A 1 62 ? -3.843  11.753  -8.121  1.00 0.00 ? 126 GLU A HA   6  
ATOM   5731  H HB2  . GLU A 1 62 ? -6.137  12.507  -8.717  1.00 0.00 ? 126 GLU A HB2  6  
ATOM   5732  H HB3  . GLU A 1 62 ? -5.955  10.771  -8.854  1.00 0.00 ? 126 GLU A HB3  6  
ATOM   5733  H HG2  . GLU A 1 62 ? -7.231  12.133  -6.492  1.00 0.00 ? 126 GLU A HG2  6  
ATOM   5734  H HG3  . GLU A 1 62 ? -8.129  11.563  -7.897  1.00 0.00 ? 126 GLU A HG3  6  
ATOM   5735  N N    . GLU A 1 63 ? -4.252  14.006  -7.049  1.00 0.00 ? 127 GLU A N    6  
ATOM   5736  C CA   . GLU A 1 63 ? -4.147  15.204  -6.270  1.00 0.00 ? 127 GLU A CA   6  
ATOM   5737  C C    . GLU A 1 63 ? -5.450  15.967  -6.293  1.00 0.00 ? 127 GLU A C    6  
ATOM   5738  O O    . GLU A 1 63 ? -6.284  15.774  -7.195  1.00 0.00 ? 127 GLU A O    6  
ATOM   5739  C CB   . GLU A 1 63 ? -2.963  16.105  -6.713  1.00 0.00 ? 127 GLU A CB   6  
ATOM   5740  C CG   . GLU A 1 63 ? -2.958  16.554  -8.180  1.00 0.00 ? 127 GLU A CG   6  
ATOM   5741  C CD   . GLU A 1 63 ? -2.685  15.429  -9.147  1.00 0.00 ? 127 GLU A CD   6  
ATOM   5742  O OE1  . GLU A 1 63 ? -1.510  15.152  -9.432  1.00 0.00 ? 127 GLU A OE1  6  
ATOM   5743  O OE2  . GLU A 1 63 ? -3.644  14.782  -9.611  1.00 0.00 ? 127 GLU A OE2  6  
ATOM   5744  H H    . GLU A 1 63 ? -4.080  14.067  -8.019  1.00 0.00 ? 127 GLU A H    6  
ATOM   5745  H HA   . GLU A 1 63 ? -3.975  14.889  -5.251  1.00 0.00 ? 127 GLU A HA   6  
ATOM   5746  H HB2  . GLU A 1 63 ? -2.976  16.999  -6.105  1.00 0.00 ? 127 GLU A HB2  6  
ATOM   5747  H HB3  . GLU A 1 63 ? -2.042  15.575  -6.519  1.00 0.00 ? 127 GLU A HB3  6  
ATOM   5748  H HG2  . GLU A 1 63 ? -3.925  16.974  -8.416  1.00 0.00 ? 127 GLU A HG2  6  
ATOM   5749  H HG3  . GLU A 1 63 ? -2.201  17.313  -8.306  1.00 0.00 ? 127 GLU A HG3  6  
ATOM   5750  N N    . GLY A 1 64 ? -5.645  16.776  -5.304  1.00 0.00 ? 128 GLY A N    6  
ATOM   5751  C CA   . GLY A 1 64 ? -6.803  17.585  -5.207  1.00 0.00 ? 128 GLY A CA   6  
ATOM   5752  C C    . GLY A 1 64 ? -6.635  18.489  -4.049  1.00 0.00 ? 128 GLY A C    6  
ATOM   5753  O O    . GLY A 1 64 ? -5.949  18.078  -3.087  1.00 0.00 ? 128 GLY A O    6  
ATOM   5754  O OXT  . GLY A 1 64 ? -7.122  19.627  -4.079  1.00 0.00 ? 128 GLY A OXT  6  
ATOM   5755  H H    . GLY A 1 64 ? -4.994  16.856  -4.571  1.00 0.00 ? 128 GLY A H    6  
ATOM   5756  H HA2  . GLY A 1 64 ? -6.919  18.163  -6.112  1.00 0.00 ? 128 GLY A HA2  6  
ATOM   5757  H HA3  . GLY A 1 64 ? -7.673  16.967  -5.049  1.00 0.00 ? 128 GLY A HA3  6  
HETATM 5758  N N    . 2MR B 2 .  ? -17.793 -4.634  1.087   1.00 0.00 ? 201 2MR A N    6  
HETATM 5759  C CA   . 2MR B 2 .  ? -16.794 -4.093  0.170   1.00 0.00 ? 201 2MR A CA   6  
HETATM 5760  C CB   . 2MR B 2 .  ? -15.485 -3.795  0.888   1.00 0.00 ? 201 2MR A CB   6  
HETATM 5761  C CG   . 2MR B 2 .  ? -15.597 -2.793  2.001   1.00 0.00 ? 201 2MR A CG   6  
HETATM 5762  C CD   . 2MR B 2 .  ? -14.271 -2.593  2.669   1.00 0.00 ? 201 2MR A CD   6  
HETATM 5763  N NE   . 2MR B 2 .  ? -13.249 -2.216  1.708   1.00 0.00 ? 201 2MR A NE   6  
HETATM 5764  C CZ   . 2MR B 2 .  ? -12.003 -1.957  2.012   1.00 0.00 ? 201 2MR A CZ   6  
HETATM 5765  N NH1  . 2MR B 2 .  ? -11.617 -2.044  3.328   1.00 0.00 ? 201 2MR A NH1  6  
HETATM 5766  C CQ1  . 2MR B 2 .  ? -10.312 -1.819  3.983   1.00 0.00 ? 201 2MR A CQ1  6  
HETATM 5767  N NH2  . 2MR B 2 .  ? -11.162 -1.670  0.997   1.00 0.00 ? 201 2MR A NH2  6  
HETATM 5768  C CQ2  . 2MR B 2 .  ? -9.741  -1.342  1.000   1.00 0.00 ? 201 2MR A CQ2  6  
HETATM 5769  C C    . 2MR B 2 .  ? -16.570 -5.108  -0.893  1.00 0.00 ? 201 2MR A C    6  
HETATM 5770  O O    . 2MR B 2 .  ? -16.789 -4.816  -2.070  1.00 0.00 ? 201 2MR A O    6  
HETATM 5771  O OXT  . 2MR B 2 .  ? -16.273 -6.239  -0.539  1.00 0.00 ? 201 2MR A OXT  6  
HETATM 5772  H H2   . 2MR B 2 .  ? -18.668 -4.831  0.559   1.00 0.00 ? 201 2MR A H2   6  
HETATM 5773  H H    . 2MR B 2 .  ? -17.433 -5.540  1.449   1.00 0.00 ? 201 2MR A H    6  
HETATM 5774  H H3   . 2MR B 2 .  ? -18.008 -4.005  1.883   1.00 0.00 ? 201 2MR A H3   6  
HETATM 5775  H HA   . 2MR B 2 .  ? -17.183 -3.195  -0.285  1.00 0.00 ? 201 2MR A HA   6  
HETATM 5776  H HB2  . 2MR B 2 .  ? -14.800 -3.367  0.170   1.00 0.00 ? 201 2MR A HB2  6  
HETATM 5777  H HB3  . 2MR B 2 .  ? -15.058 -4.695  1.298   1.00 0.00 ? 201 2MR A HB3  6  
HETATM 5778  H HG2  . 2MR B 2 .  ? -16.299 -3.171  2.725   1.00 0.00 ? 201 2MR A HG2  6  
HETATM 5779  H HG3  . 2MR B 2 .  ? -15.910 -1.848  1.587   1.00 0.00 ? 201 2MR A HG3  6  
HETATM 5780  H HD2  . 2MR B 2 .  ? -13.972 -3.510  3.154   1.00 0.00 ? 201 2MR A HD2  6  
HETATM 5781  H HD3  . 2MR B 2 .  ? -14.358 -1.801  3.401   1.00 0.00 ? 201 2MR A HD3  6  
HETATM 5782  H HE   . 2MR B 2 .  ? -13.568 -2.137  0.779   1.00 0.00 ? 201 2MR A HE   6  
HETATM 5783  H HQ11 . 2MR B 2 .  ? -10.420 -1.974  5.046   1.00 0.00 ? 201 2MR A HQ11 6  
HETATM 5784  H HQ12 . 2MR B 2 .  ? -9.579  -2.508  3.589   1.00 0.00 ? 201 2MR A HQ12 6  
HETATM 5785  H HQ13 . 2MR B 2 .  ? -9.995  -0.803  3.805   1.00 0.00 ? 201 2MR A HQ13 6  
HETATM 5786  H HH2  . 2MR B 2 .  ? -11.493 -1.702  0.056   1.00 0.00 ? 201 2MR A HH2  6  
HETATM 5787  H HQ21 . 2MR B 2 .  ? -9.180  -2.172  1.402   1.00 0.00 ? 201 2MR A HQ21 6  
HETATM 5788  H HQ22 . 2MR B 2 .  ? -9.420  -1.152  -0.014  1.00 0.00 ? 201 2MR A HQ22 6  
HETATM 5789  H HQ23 . 2MR B 2 .  ? -9.568  -0.465  1.606   1.00 0.00 ? 201 2MR A HQ23 6  
HETATM 5790  H HH1  . 2MR B 2 .  ? -12.294 -2.311  4.022   1.00 0.00 ? 201 2MR A HH1  6  
ATOM   5791  N N    . ALA A 1 1  ? 16.038  -8.535  1.648   1.00 0.00 ? 65  ALA A N    7  
ATOM   5792  C CA   . ALA A 1 1  ? 15.481  -7.767  0.524   1.00 0.00 ? 65  ALA A CA   7  
ATOM   5793  C C    . ALA A 1 1  ? 15.271  -8.696  -0.652  1.00 0.00 ? 65  ALA A C    7  
ATOM   5794  O O    . ALA A 1 1  ? 15.883  -9.756  -0.712  1.00 0.00 ? 65  ALA A O    7  
ATOM   5795  C CB   . ALA A 1 1  ? 16.426  -6.632  0.140   1.00 0.00 ? 65  ALA A CB   7  
ATOM   5796  H H1   . ALA A 1 1  ? 15.407  -9.339  1.846   1.00 0.00 ? 65  ALA A H1   7  
ATOM   5797  H H2   . ALA A 1 1  ? 16.963  -8.933  1.392   1.00 0.00 ? 65  ALA A H2   7  
ATOM   5798  H H3   . ALA A 1 1  ? 16.129  -7.976  2.526   1.00 0.00 ? 65  ALA A H3   7  
ATOM   5799  H HA   . ALA A 1 1  ? 14.533  -7.345  0.825   1.00 0.00 ? 65  ALA A HA   7  
ATOM   5800  H HB1  . ALA A 1 1  ? 17.380  -7.037  -0.163  1.00 0.00 ? 65  ALA A HB1  7  
ATOM   5801  H HB2  . ALA A 1 1  ? 16.000  -6.071  -0.679  1.00 0.00 ? 65  ALA A HB2  7  
ATOM   5802  H HB3  . ALA A 1 1  ? 16.567  -5.977  0.988   1.00 0.00 ? 65  ALA A HB3  7  
ATOM   5803  N N    . SER A 1 2  ? 14.384  -8.356  -1.558  1.00 0.00 ? 66  SER A N    7  
ATOM   5804  C CA   . SER A 1 2  ? 14.159  -9.188  -2.727  1.00 0.00 ? 66  SER A CA   7  
ATOM   5805  C C    . SER A 1 2  ? 13.659  -8.358  -3.898  1.00 0.00 ? 66  SER A C    7  
ATOM   5806  O O    . SER A 1 2  ? 14.369  -8.167  -4.887  1.00 0.00 ? 66  SER A O    7  
ATOM   5807  C CB   . SER A 1 2  ? 13.172  -10.337 -2.425  1.00 0.00 ? 66  SER A CB   7  
ATOM   5808  O OG   . SER A 1 2  ? 13.637  -11.159 -1.353  1.00 0.00 ? 66  SER A OG   7  
ATOM   5809  H H    . SER A 1 2  ? 13.871  -7.520  -1.470  1.00 0.00 ? 66  SER A H    7  
ATOM   5810  H HA   . SER A 1 2  ? 15.112  -9.617  -3.001  1.00 0.00 ? 66  SER A HA   7  
ATOM   5811  H HB2  . SER A 1 2  ? 12.205  -9.934  -2.164  1.00 0.00 ? 66  SER A HB2  7  
ATOM   5812  H HB3  . SER A 1 2  ? 13.070  -10.949 -3.308  1.00 0.00 ? 66  SER A HB3  7  
ATOM   5813  H HG   . SER A 1 2  ? 14.480  -10.774 -1.071  1.00 0.00 ? 66  SER A HG   7  
ATOM   5814  N N    . THR A 1 3  ? 12.469  -7.850  -3.784  1.00 0.00 ? 67  THR A N    7  
ATOM   5815  C CA   . THR A 1 3  ? 11.882  -7.111  -4.851  1.00 0.00 ? 67  THR A CA   7  
ATOM   5816  C C    . THR A 1 3  ? 12.063  -5.620  -4.589  1.00 0.00 ? 67  THR A C    7  
ATOM   5817  O O    . THR A 1 3  ? 11.453  -5.064  -3.655  1.00 0.00 ? 67  THR A O    7  
ATOM   5818  C CB   . THR A 1 3  ? 10.387  -7.449  -4.964  1.00 0.00 ? 67  THR A CB   7  
ATOM   5819  O OG1  . THR A 1 3  ? 10.209  -8.881  -4.834  1.00 0.00 ? 67  THR A OG1  7  
ATOM   5820  C CG2  . THR A 1 3  ? 9.846   -7.010  -6.315  1.00 0.00 ? 67  THR A CG2  7  
ATOM   5821  H H    . THR A 1 3  ? 11.948  -7.959  -2.956  1.00 0.00 ? 67  THR A H    7  
ATOM   5822  H HA   . THR A 1 3  ? 12.374  -7.382  -5.773  1.00 0.00 ? 67  THR A HA   7  
ATOM   5823  H HB   . THR A 1 3  ? 9.849   -6.939  -4.179  1.00 0.00 ? 67  THR A HB   7  
ATOM   5824  H HG1  . THR A 1 3  ? 9.458   -8.992  -4.238  1.00 0.00 ? 67  THR A HG1  7  
ATOM   5825  H HG21 . THR A 1 3  ? 10.398  -7.508  -7.098  1.00 0.00 ? 67  THR A HG21 7  
ATOM   5826  H HG22 . THR A 1 3  ? 8.802   -7.275  -6.388  1.00 0.00 ? 67  THR A HG22 7  
ATOM   5827  H HG23 . THR A 1 3  ? 9.959   -5.941  -6.419  1.00 0.00 ? 67  THR A HG23 7  
ATOM   5828  N N    . GLN A 1 4  ? 12.940  -4.995  -5.350  1.00 0.00 ? 68  GLN A N    7  
ATOM   5829  C CA   . GLN A 1 4  ? 13.196  -3.579  -5.209  1.00 0.00 ? 68  GLN A CA   7  
ATOM   5830  C C    . GLN A 1 4  ? 12.105  -2.786  -5.917  1.00 0.00 ? 68  GLN A C    7  
ATOM   5831  O O    . GLN A 1 4  ? 11.951  -2.868  -7.145  1.00 0.00 ? 68  GLN A O    7  
ATOM   5832  C CB   . GLN A 1 4  ? 14.577  -3.211  -5.756  1.00 0.00 ? 68  GLN A CB   7  
ATOM   5833  C CG   . GLN A 1 4  ? 15.726  -3.895  -5.027  1.00 0.00 ? 68  GLN A CG   7  
ATOM   5834  C CD   . GLN A 1 4  ? 15.778  -3.557  -3.545  1.00 0.00 ? 68  GLN A CD   7  
ATOM   5835  O OE1  . GLN A 1 4  ? 15.391  -2.463  -3.119  1.00 0.00 ? 68  GLN A OE1  7  
ATOM   5836  N NE2  . GLN A 1 4  ? 16.244  -4.478  -2.754  1.00 0.00 ? 68  GLN A NE2  7  
ATOM   5837  H H    . GLN A 1 4  ? 13.431  -5.497  -6.037  1.00 0.00 ? 68  GLN A H    7  
ATOM   5838  H HA   . GLN A 1 4  ? 13.161  -3.355  -4.154  1.00 0.00 ? 68  GLN A HA   7  
ATOM   5839  H HB2  . GLN A 1 4  ? 14.622  -3.488  -6.799  1.00 0.00 ? 68  GLN A HB2  7  
ATOM   5840  H HB3  . GLN A 1 4  ? 14.709  -2.142  -5.672  1.00 0.00 ? 68  GLN A HB3  7  
ATOM   5841  H HG2  . GLN A 1 4  ? 15.608  -4.965  -5.128  1.00 0.00 ? 68  GLN A HG2  7  
ATOM   5842  H HG3  . GLN A 1 4  ? 16.654  -3.590  -5.485  1.00 0.00 ? 68  GLN A HG3  7  
ATOM   5843  H HE21 . GLN A 1 4  ? 16.532  -5.330  -3.151  1.00 0.00 ? 68  GLN A HE21 7  
ATOM   5844  H HE22 . GLN A 1 4  ? 16.297  -4.309  -1.792  1.00 0.00 ? 68  GLN A HE22 7  
ATOM   5845  N N    . PRO A 1 5  ? 11.323  -2.027  -5.165  1.00 0.00 ? 69  PRO A N    7  
ATOM   5846  C CA   . PRO A 1 5  ? 10.205  -1.279  -5.706  1.00 0.00 ? 69  PRO A CA   7  
ATOM   5847  C C    . PRO A 1 5  ? 10.626  0.019   -6.396  1.00 0.00 ? 69  PRO A C    7  
ATOM   5848  O O    . PRO A 1 5  ? 11.565  0.697   -5.967  1.00 0.00 ? 69  PRO A O    7  
ATOM   5849  C CB   . PRO A 1 5  ? 9.362   -0.983  -4.474  1.00 0.00 ? 69  PRO A CB   7  
ATOM   5850  C CG   . PRO A 1 5  ? 10.339  -0.914  -3.347  1.00 0.00 ? 69  PRO A CG   7  
ATOM   5851  C CD   . PRO A 1 5  ? 11.477  -1.823  -3.706  1.00 0.00 ? 69  PRO A CD   7  
ATOM   5852  H HA   . PRO A 1 5  ? 9.628   -1.881  -6.394  1.00 0.00 ? 69  PRO A HA   7  
ATOM   5853  H HB2  . PRO A 1 5  ? 8.844   -0.044  -4.612  1.00 0.00 ? 69  PRO A HB2  7  
ATOM   5854  H HB3  . PRO A 1 5  ? 8.644   -1.775  -4.324  1.00 0.00 ? 69  PRO A HB3  7  
ATOM   5855  H HG2  . PRO A 1 5  ? 10.696  0.099   -3.236  1.00 0.00 ? 69  PRO A HG2  7  
ATOM   5856  H HG3  . PRO A 1 5  ? 9.872   -1.247  -2.433  1.00 0.00 ? 69  PRO A HG3  7  
ATOM   5857  H HD2  . PRO A 1 5  ? 12.423  -1.354  -3.478  1.00 0.00 ? 69  PRO A HD2  7  
ATOM   5858  H HD3  . PRO A 1 5  ? 11.382  -2.760  -3.177  1.00 0.00 ? 69  PRO A HD3  7  
ATOM   5859  N N    . THR A 1 6  ? 9.944   0.341   -7.463  1.00 0.00 ? 70  THR A N    7  
ATOM   5860  C CA   . THR A 1 6  ? 10.170  1.543   -8.199  1.00 0.00 ? 70  THR A CA   7  
ATOM   5861  C C    . THR A 1 6  ? 9.535   2.730   -7.455  1.00 0.00 ? 70  THR A C    7  
ATOM   5862  O O    . THR A 1 6  ? 9.999   3.869   -7.542  1.00 0.00 ? 70  THR A O    7  
ATOM   5863  C CB   . THR A 1 6  ? 9.505   1.406   -9.581  1.00 0.00 ? 70  THR A CB   7  
ATOM   5864  O OG1  . THR A 1 6  ? 9.965   0.213   -10.234 1.00 0.00 ? 70  THR A OG1  7  
ATOM   5865  C CG2  . THR A 1 6  ? 9.822   2.593   -10.444 1.00 0.00 ? 70  THR A CG2  7  
ATOM   5866  H H    . THR A 1 6  ? 9.257   -0.256  -7.830  1.00 0.00 ? 70  THR A H    7  
ATOM   5867  H HA   . THR A 1 6  ? 11.229  1.697   -8.336  1.00 0.00 ? 70  THR A HA   7  
ATOM   5868  H HB   . THR A 1 6  ? 8.436   1.344   -9.443  1.00 0.00 ? 70  THR A HB   7  
ATOM   5869  H HG1  . THR A 1 6  ? 9.618   0.273   -11.134 1.00 0.00 ? 70  THR A HG1  7  
ATOM   5870  H HG21 . THR A 1 6  ? 10.886  2.639   -10.615 1.00 0.00 ? 70  THR A HG21 7  
ATOM   5871  H HG22 . THR A 1 6  ? 9.285   2.519   -11.376 1.00 0.00 ? 70  THR A HG22 7  
ATOM   5872  H HG23 . THR A 1 6  ? 9.506   3.467   -9.896  1.00 0.00 ? 70  THR A HG23 7  
ATOM   5873  N N    . HIS A 1 7  ? 8.500   2.437   -6.707  1.00 0.00 ? 71  HIS A N    7  
ATOM   5874  C CA   . HIS A 1 7  ? 7.741   3.451   -6.010  1.00 0.00 ? 71  HIS A CA   7  
ATOM   5875  C C    . HIS A 1 7  ? 8.417   3.813   -4.691  1.00 0.00 ? 71  HIS A C    7  
ATOM   5876  O O    . HIS A 1 7  ? 8.714   2.933   -3.867  1.00 0.00 ? 71  HIS A O    7  
ATOM   5877  C CB   . HIS A 1 7  ? 6.319   2.964   -5.725  1.00 0.00 ? 71  HIS A CB   7  
ATOM   5878  C CG   . HIS A 1 7  ? 5.509   2.547   -6.921  1.00 0.00 ? 71  HIS A CG   7  
ATOM   5879  N ND1  . HIS A 1 7  ? 4.560   3.338   -7.529  1.00 0.00 ? 71  HIS A ND1  7  
ATOM   5880  C CD2  . HIS A 1 7  ? 5.486   1.368   -7.580  1.00 0.00 ? 71  HIS A CD2  7  
ATOM   5881  C CE1  . HIS A 1 7  ? 4.001   2.631   -8.512  1.00 0.00 ? 71  HIS A CE1  7  
ATOM   5882  N NE2  . HIS A 1 7  ? 4.533   1.421   -8.587  1.00 0.00 ? 71  HIS A NE2  7  
ATOM   5883  H H    . HIS A 1 7  ? 8.243   1.497   -6.609  1.00 0.00 ? 71  HIS A H    7  
ATOM   5884  H HA   . HIS A 1 7  ? 7.688   4.327   -6.638  1.00 0.00 ? 71  HIS A HA   7  
ATOM   5885  H HB2  . HIS A 1 7  ? 6.382   2.108   -5.069  1.00 0.00 ? 71  HIS A HB2  7  
ATOM   5886  H HB3  . HIS A 1 7  ? 5.787   3.757   -5.220  1.00 0.00 ? 71  HIS A HB3  7  
ATOM   5887  H HD1  . HIS A 1 7  ? 4.331   4.261   -7.280  1.00 0.00 ? 71  HIS A HD1  7  
ATOM   5888  H HD2  . HIS A 1 7  ? 6.110   0.515   -7.362  1.00 0.00 ? 71  HIS A HD2  7  
ATOM   5889  H HE1  . HIS A 1 7  ? 3.218   2.994   -9.159  1.00 0.00 ? 71  HIS A HE1  7  
ATOM   5890  N N    . SER A 1 8  ? 8.674   5.080   -4.499  1.00 0.00 ? 72  SER A N    7  
ATOM   5891  C CA   . SER A 1 8  ? 9.274   5.560   -3.288  1.00 0.00 ? 72  SER A CA   7  
ATOM   5892  C C    . SER A 1 8  ? 8.189   6.172   -2.394  1.00 0.00 ? 72  SER A C    7  
ATOM   5893  O O    . SER A 1 8  ? 7.410   7.031   -2.838  1.00 0.00 ? 72  SER A O    7  
ATOM   5894  C CB   . SER A 1 8  ? 10.373  6.570   -3.615  1.00 0.00 ? 72  SER A CB   7  
ATOM   5895  O OG   . SER A 1 8  ? 11.069  6.969   -2.447  1.00 0.00 ? 72  SER A OG   7  
ATOM   5896  H H    . SER A 1 8  ? 8.450   5.723   -5.206  1.00 0.00 ? 72  SER A H    7  
ATOM   5897  H HA   . SER A 1 8  ? 9.705   4.714   -2.775  1.00 0.00 ? 72  SER A HA   7  
ATOM   5898  H HB2  . SER A 1 8  ? 11.076  6.117   -4.297  1.00 0.00 ? 72  SER A HB2  7  
ATOM   5899  H HB3  . SER A 1 8  ? 9.934   7.439   -4.080  1.00 0.00 ? 72  SER A HB3  7  
ATOM   5900  H HG   . SER A 1 8  ? 10.912  7.916   -2.348  1.00 0.00 ? 72  SER A HG   7  
ATOM   5901  N N    . TRP A 1 9  ? 8.097   5.684   -1.177  1.00 0.00 ? 73  TRP A N    7  
ATOM   5902  C CA   . TRP A 1 9  ? 7.072   6.110   -0.248  1.00 0.00 ? 73  TRP A CA   7  
ATOM   5903  C C    . TRP A 1 9  ? 7.654   6.592   1.069   1.00 0.00 ? 73  TRP A C    7  
ATOM   5904  O O    . TRP A 1 9  ? 8.739   6.152   1.459   1.00 0.00 ? 73  TRP A O    7  
ATOM   5905  C CB   . TRP A 1 9  ? 6.116   4.962   -0.002  1.00 0.00 ? 73  TRP A CB   7  
ATOM   5906  C CG   . TRP A 1 9  ? 5.393   4.544   -1.235  1.00 0.00 ? 73  TRP A CG   7  
ATOM   5907  C CD1  . TRP A 1 9  ? 5.618   3.433   -1.973  1.00 0.00 ? 73  TRP A CD1  7  
ATOM   5908  C CD2  . TRP A 1 9  ? 4.357   5.261   -1.900  1.00 0.00 ? 73  TRP A CD2  7  
ATOM   5909  N NE1  . TRP A 1 9  ? 4.772   3.397   -3.038  1.00 0.00 ? 73  TRP A NE1  7  
ATOM   5910  C CE2  . TRP A 1 9  ? 3.992   4.507   -3.022  1.00 0.00 ? 73  TRP A CE2  7  
ATOM   5911  C CE3  . TRP A 1 9  ? 3.696   6.464   -1.650  1.00 0.00 ? 73  TRP A CE3  7  
ATOM   5912  C CZ2  . TRP A 1 9  ? 3.006   4.907   -3.894  1.00 0.00 ? 73  TRP A CZ2  7  
ATOM   5913  C CZ3  . TRP A 1 9  ? 2.713   6.861   -2.520  1.00 0.00 ? 73  TRP A CZ3  7  
ATOM   5914  C CH2  . TRP A 1 9  ? 2.377   6.079   -3.633  1.00 0.00 ? 73  TRP A CH2  7  
ATOM   5915  H H    . TRP A 1 9  ? 8.744   5.020   -0.858  1.00 0.00 ? 73  TRP A H    7  
ATOM   5916  H HA   . TRP A 1 9  ? 6.516   6.908   -0.715  1.00 0.00 ? 73  TRP A HA   7  
ATOM   5917  H HB2  . TRP A 1 9  ? 6.681   4.115   0.359   1.00 0.00 ? 73  TRP A HB2  7  
ATOM   5918  H HB3  . TRP A 1 9  ? 5.396   5.251   0.748   1.00 0.00 ? 73  TRP A HB3  7  
ATOM   5919  H HD1  . TRP A 1 9  ? 6.358   2.688   -1.729  1.00 0.00 ? 73  TRP A HD1  7  
ATOM   5920  H HE1  . TRP A 1 9  ? 4.723   2.686   -3.715  1.00 0.00 ? 73  TRP A HE1  7  
ATOM   5921  H HE3  . TRP A 1 9  ? 3.944   7.075   -0.796  1.00 0.00 ? 73  TRP A HE3  7  
ATOM   5922  H HZ2  . TRP A 1 9  ? 2.733   4.318   -4.758  1.00 0.00 ? 73  TRP A HZ2  7  
ATOM   5923  H HZ3  . TRP A 1 9  ? 2.195   7.790   -2.334  1.00 0.00 ? 73  TRP A HZ3  7  
ATOM   5924  H HH2  . TRP A 1 9  ? 1.600   6.403   -4.308  1.00 0.00 ? 73  TRP A HH2  7  
ATOM   5925  N N    . LYS A 1 10 ? 6.956   7.506   1.732   1.00 0.00 ? 74  LYS A N    7  
ATOM   5926  C CA   . LYS A 1 10 ? 7.326   7.935   3.065   1.00 0.00 ? 74  LYS A CA   7  
ATOM   5927  C C    . LYS A 1 10 ? 6.145   7.801   4.018   1.00 0.00 ? 74  LYS A C    7  
ATOM   5928  O O    . LYS A 1 10 ? 4.981   7.761   3.591   1.00 0.00 ? 74  LYS A O    7  
ATOM   5929  C CB   . LYS A 1 10 ? 7.874   9.371   3.119   1.00 0.00 ? 74  LYS A CB   7  
ATOM   5930  C CG   . LYS A 1 10 ? 6.933   10.459  2.615   1.00 0.00 ? 74  LYS A CG   7  
ATOM   5931  C CD   . LYS A 1 10 ? 7.365   11.838  3.104   1.00 0.00 ? 74  LYS A CD   7  
ATOM   5932  C CE   . LYS A 1 10 ? 6.951   12.064  4.561   1.00 0.00 ? 74  LYS A CE   7  
ATOM   5933  N NZ   . LYS A 1 10 ? 5.495   12.322  4.694   1.00 0.00 ? 74  LYS A NZ   7  
ATOM   5934  H H    . LYS A 1 10 ? 6.162   7.910   1.320   1.00 0.00 ? 74  LYS A H    7  
ATOM   5935  H HA   . LYS A 1 10 ? 8.092   7.252   3.406   1.00 0.00 ? 74  LYS A HA   7  
ATOM   5936  H HB2  . LYS A 1 10 ? 8.151   9.605   4.136   1.00 0.00 ? 74  LYS A HB2  7  
ATOM   5937  H HB3  . LYS A 1 10 ? 8.763   9.390   2.504   1.00 0.00 ? 74  LYS A HB3  7  
ATOM   5938  H HG2  . LYS A 1 10 ? 6.937   10.461  1.536   1.00 0.00 ? 74  LYS A HG2  7  
ATOM   5939  H HG3  . LYS A 1 10 ? 5.936   10.255  2.974   1.00 0.00 ? 74  LYS A HG3  7  
ATOM   5940  H HD2  . LYS A 1 10 ? 8.439   11.915  3.028   1.00 0.00 ? 74  LYS A HD2  7  
ATOM   5941  H HD3  . LYS A 1 10 ? 6.902   12.591  2.485   1.00 0.00 ? 74  LYS A HD3  7  
ATOM   5942  H HE2  . LYS A 1 10 ? 7.181   11.182  5.141   1.00 0.00 ? 74  LYS A HE2  7  
ATOM   5943  H HE3  . LYS A 1 10 ? 7.496   12.908  4.957   1.00 0.00 ? 74  LYS A HE3  7  
ATOM   5944  H HZ1  . LYS A 1 10 ? 4.916   11.694  4.092   1.00 0.00 ? 74  LYS A HZ1  7  
ATOM   5945  H HZ2  . LYS A 1 10 ? 5.188   12.182  5.678   1.00 0.00 ? 74  LYS A HZ2  7  
ATOM   5946  H HZ3  . LYS A 1 10 ? 5.263   13.298  4.426   1.00 0.00 ? 74  LYS A HZ3  7  
ATOM   5947  N N    . VAL A 1 11 ? 6.452   7.719   5.296   1.00 0.00 ? 75  VAL A N    7  
ATOM   5948  C CA   . VAL A 1 11 ? 5.452   7.600   6.343   1.00 0.00 ? 75  VAL A CA   7  
ATOM   5949  C C    . VAL A 1 11 ? 4.561   8.838   6.382   1.00 0.00 ? 75  VAL A C    7  
ATOM   5950  O O    . VAL A 1 11 ? 5.051   9.975   6.320   1.00 0.00 ? 75  VAL A O    7  
ATOM   5951  C CB   . VAL A 1 11 ? 6.112   7.384   7.737   1.00 0.00 ? 75  VAL A CB   7  
ATOM   5952  C CG1  . VAL A 1 11 ? 5.081   7.406   8.856   1.00 0.00 ? 75  VAL A CG1  7  
ATOM   5953  C CG2  . VAL A 1 11 ? 6.885   6.077   7.770   1.00 0.00 ? 75  VAL A CG2  7  
ATOM   5954  H H    . VAL A 1 11 ? 7.400   7.746   5.548   1.00 0.00 ? 75  VAL A H    7  
ATOM   5955  H HA   . VAL A 1 11 ? 4.838   6.740   6.118   1.00 0.00 ? 75  VAL A HA   7  
ATOM   5956  H HB   . VAL A 1 11 ? 6.808   8.192   7.904   1.00 0.00 ? 75  VAL A HB   7  
ATOM   5957  H HG11 . VAL A 1 11 ? 4.357   6.620   8.695   1.00 0.00 ? 75  VAL A HG11 7  
ATOM   5958  H HG12 . VAL A 1 11 ? 5.573   7.267   9.806   1.00 0.00 ? 75  VAL A HG12 7  
ATOM   5959  H HG13 . VAL A 1 11 ? 4.584   8.365   8.840   1.00 0.00 ? 75  VAL A HG13 7  
ATOM   5960  H HG21 . VAL A 1 11 ? 7.680   6.118   7.041   1.00 0.00 ? 75  VAL A HG21 7  
ATOM   5961  H HG22 . VAL A 1 11 ? 7.310   5.932   8.751   1.00 0.00 ? 75  VAL A HG22 7  
ATOM   5962  H HG23 . VAL A 1 11 ? 6.222   5.257   7.538   1.00 0.00 ? 75  VAL A HG23 7  
ATOM   5963  N N    . GLY A 1 12 ? 3.268   8.610   6.434   1.00 0.00 ? 76  GLY A N    7  
ATOM   5964  C CA   . GLY A 1 12 ? 2.331   9.692   6.536   1.00 0.00 ? 76  GLY A CA   7  
ATOM   5965  C C    . GLY A 1 12 ? 1.702   10.026  5.223   1.00 0.00 ? 76  GLY A C    7  
ATOM   5966  O O    . GLY A 1 12 ? 0.785   10.837  5.146   1.00 0.00 ? 76  GLY A O    7  
ATOM   5967  H H    . GLY A 1 12 ? 2.924   7.689   6.409   1.00 0.00 ? 76  GLY A H    7  
ATOM   5968  H HA2  . GLY A 1 12 ? 1.556   9.404   7.229   1.00 0.00 ? 76  GLY A HA2  7  
ATOM   5969  H HA3  . GLY A 1 12 ? 2.847   10.560  6.915   1.00 0.00 ? 76  GLY A HA3  7  
ATOM   5970  N N    . ASP A 1 13 ? 2.174   9.395   4.198   1.00 0.00 ? 77  ASP A N    7  
ATOM   5971  C CA   . ASP A 1 13 ? 1.675   9.632   2.869   1.00 0.00 ? 77  ASP A CA   7  
ATOM   5972  C C    . ASP A 1 13 ? 0.667   8.630   2.509   1.00 0.00 ? 77  ASP A C    7  
ATOM   5973  O O    . ASP A 1 13 ? 0.737   7.483   2.951   1.00 0.00 ? 77  ASP A O    7  
ATOM   5974  C CB   . ASP A 1 13 ? 2.789   9.589   1.860   1.00 0.00 ? 77  ASP A CB   7  
ATOM   5975  C CG   . ASP A 1 13 ? 3.590   10.873  1.780   1.00 0.00 ? 77  ASP A CG   7  
ATOM   5976  O OD1  . ASP A 1 13 ? 3.802   11.542  2.817   1.00 0.00 ? 77  ASP A OD1  7  
ATOM   5977  O OD2  . ASP A 1 13 ? 4.039   11.232  0.674   1.00 0.00 ? 77  ASP A OD2  7  
ATOM   5978  H H    . ASP A 1 13 ? 2.879   8.726   4.323   1.00 0.00 ? 77  ASP A H    7  
ATOM   5979  H HA   . ASP A 1 13 ? 1.228   10.613  2.837   1.00 0.00 ? 77  ASP A HA   7  
ATOM   5980  H HB2  . ASP A 1 13 ? 3.415   8.771   2.172   1.00 0.00 ? 77  ASP A HB2  7  
ATOM   5981  H HB3  . ASP A 1 13 ? 2.391   9.319   0.895   1.00 0.00 ? 77  ASP A HB3  7  
ATOM   5982  N N    . LYS A 1 14 ? -0.289  9.036   1.751   1.00 0.00 ? 78  LYS A N    7  
ATOM   5983  C CA   . LYS A 1 14 ? -1.246  8.162   1.303   1.00 0.00 ? 78  LYS A CA   7  
ATOM   5984  C C    . LYS A 1 14 ? -1.029  7.728   -0.111  1.00 0.00 ? 78  LYS A C    7  
ATOM   5985  O O    . LYS A 1 14 ? -0.544  8.479   -0.970  1.00 0.00 ? 78  LYS A O    7  
ATOM   5986  C CB   . LYS A 1 14 ? -2.618  8.628   1.661   1.00 0.00 ? 78  LYS A CB   7  
ATOM   5987  C CG   . LYS A 1 14 ? -2.946  10.025  1.261   1.00 0.00 ? 78  LYS A CG   7  
ATOM   5988  C CD   . LYS A 1 14 ? -3.358  10.084  -0.157  1.00 0.00 ? 78  LYS A CD   7  
ATOM   5989  C CE   . LYS A 1 14 ? -3.992  11.426  -0.515  1.00 0.00 ? 78  LYS A CE   7  
ATOM   5990  N NZ   . LYS A 1 14 ? -5.266  11.652  0.206   1.00 0.00 ? 78  LYS A NZ   7  
ATOM   5991  H H    . LYS A 1 14 ? -0.398  9.970   1.478   1.00 0.00 ? 78  LYS A H    7  
ATOM   5992  H HA   . LYS A 1 14 ? -1.076  7.246   1.832   1.00 0.00 ? 78  LYS A HA   7  
ATOM   5993  H HB2  . LYS A 1 14 ? -3.325  7.961   1.192   1.00 0.00 ? 78  LYS A HB2  7  
ATOM   5994  H HB3  . LYS A 1 14 ? -2.696  8.556   2.735   1.00 0.00 ? 78  LYS A HB3  7  
ATOM   5995  H HG2  . LYS A 1 14 ? -3.691  10.393  1.932   1.00 0.00 ? 78  LYS A HG2  7  
ATOM   5996  H HG3  . LYS A 1 14 ? -2.062  10.632  1.397   1.00 0.00 ? 78  LYS A HG3  7  
ATOM   5997  H HD2  . LYS A 1 14 ? -2.461  9.871   -0.722  1.00 0.00 ? 78  LYS A HD2  7  
ATOM   5998  H HD3  . LYS A 1 14 ? -4.059  9.276   -0.294  1.00 0.00 ? 78  LYS A HD3  7  
ATOM   5999  H HE2  . LYS A 1 14 ? -3.312  12.215  -0.234  1.00 0.00 ? 78  LYS A HE2  7  
ATOM   6000  H HE3  . LYS A 1 14 ? -4.180  11.470  -1.578  1.00 0.00 ? 78  LYS A HE3  7  
ATOM   6001  H HZ1  . LYS A 1 14 ? -5.911  10.844  0.058   1.00 0.00 ? 78  LYS A HZ1  7  
ATOM   6002  H HZ2  . LYS A 1 14 ? -5.120  11.754  1.229   1.00 0.00 ? 78  LYS A HZ2  7  
ATOM   6003  H HZ3  . LYS A 1 14 ? -5.750  12.504  -0.149  1.00 0.00 ? 78  LYS A HZ3  7  
ATOM   6004  N N    . CYS A 1 15 ? -1.376  6.531   -0.318  1.00 0.00 ? 79  CYS A N    7  
ATOM   6005  C CA   . CYS A 1 15 ? -1.120  5.809   -1.514  1.00 0.00 ? 79  CYS A CA   7  
ATOM   6006  C C    . CYS A 1 15 ? -2.308  4.963   -1.821  1.00 0.00 ? 79  CYS A C    7  
ATOM   6007  O O    . CYS A 1 15 ? -3.292  5.005   -1.107  1.00 0.00 ? 79  CYS A O    7  
ATOM   6008  C CB   . CYS A 1 15 ? 0.084   4.913   -1.297  1.00 0.00 ? 79  CYS A CB   7  
ATOM   6009  S SG   . CYS A 1 15 ? -0.043  3.870   0.186   1.00 0.00 ? 79  CYS A SG   7  
ATOM   6010  H H    . CYS A 1 15 ? -1.883  6.082   0.396   1.00 0.00 ? 79  CYS A H    7  
ATOM   6011  H HA   . CYS A 1 15 ? -0.904  6.505   -2.308  1.00 0.00 ? 79  CYS A HA   7  
ATOM   6012  H HB2  . CYS A 1 15 ? 0.168   4.259   -2.153  1.00 0.00 ? 79  CYS A HB2  7  
ATOM   6013  H HB3  . CYS A 1 15 ? 0.980   5.509   -1.231  1.00 0.00 ? 79  CYS A HB3  7  
ATOM   6014  H HG   . CYS A 1 15 ? -1.104  4.202   0.916   1.00 0.00 ? 79  CYS A HG   7  
ATOM   6015  N N    . MET A 1 16 ? -2.256  4.253   -2.883  1.00 0.00 ? 80  MET A N    7  
ATOM   6016  C CA   . MET A 1 16 ? -3.282  3.319   -3.169  1.00 0.00 ? 80  MET A CA   7  
ATOM   6017  C C    . MET A 1 16 ? -2.700  1.962   -3.019  1.00 0.00 ? 80  MET A C    7  
ATOM   6018  O O    . MET A 1 16 ? -1.645  1.685   -3.559  1.00 0.00 ? 80  MET A O    7  
ATOM   6019  C CB   . MET A 1 16 ? -3.867  3.499   -4.557  1.00 0.00 ? 80  MET A CB   7  
ATOM   6020  C CG   . MET A 1 16 ? -4.326  4.907   -4.835  1.00 0.00 ? 80  MET A CG   7  
ATOM   6021  S SD   . MET A 1 16 ? -5.380  5.038   -6.279  1.00 0.00 ? 80  MET A SD   7  
ATOM   6022  C CE   . MET A 1 16 ? -6.803  4.132   -5.677  1.00 0.00 ? 80  MET A CE   7  
ATOM   6023  H H    . MET A 1 16 ? -1.485  4.341   -3.491  1.00 0.00 ? 80  MET A H    7  
ATOM   6024  H HA   . MET A 1 16 ? -4.058  3.443   -2.428  1.00 0.00 ? 80  MET A HA   7  
ATOM   6025  H HB2  . MET A 1 16 ? -3.116  3.231   -5.284  1.00 0.00 ? 80  MET A HB2  7  
ATOM   6026  H HB3  . MET A 1 16 ? -4.710  2.833   -4.662  1.00 0.00 ? 80  MET A HB3  7  
ATOM   6027  H HG2  . MET A 1 16 ? -4.862  5.279   -3.973  1.00 0.00 ? 80  MET A HG2  7  
ATOM   6028  H HG3  . MET A 1 16 ? -3.436  5.496   -4.993  1.00 0.00 ? 80  MET A HG3  7  
ATOM   6029  H HE1  . MET A 1 16 ? -7.108  4.588   -4.745  1.00 0.00 ? 80  MET A HE1  7  
ATOM   6030  H HE2  . MET A 1 16 ? -7.611  4.192   -6.391  1.00 0.00 ? 80  MET A HE2  7  
ATOM   6031  H HE3  . MET A 1 16 ? -6.538  3.101   -5.498  1.00 0.00 ? 80  MET A HE3  7  
ATOM   6032  N N    . ALA A 1 17 ? -3.354  1.142   -2.291  1.00 0.00 ? 81  ALA A N    7  
ATOM   6033  C CA   . ALA A 1 17 ? -2.875  -0.171  -2.023  1.00 0.00 ? 81  ALA A CA   7  
ATOM   6034  C C    . ALA A 1 17 ? -3.837  -1.151  -2.579  1.00 0.00 ? 81  ALA A C    7  
ATOM   6035  O O    . ALA A 1 17 ? -5.026  -0.850  -2.709  1.00 0.00 ? 81  ALA A O    7  
ATOM   6036  C CB   . ALA A 1 17 ? -2.744  -0.380  -0.530  1.00 0.00 ? 81  ALA A CB   7  
ATOM   6037  H H    . ALA A 1 17 ? -4.228  1.416   -1.929  1.00 0.00 ? 81  ALA A H    7  
ATOM   6038  H HA   . ALA A 1 17 ? -1.902  -0.299  -2.473  1.00 0.00 ? 81  ALA A HA   7  
ATOM   6039  H HB1  . ALA A 1 17 ? -3.699  -0.200  -0.060  1.00 0.00 ? 81  ALA A HB1  7  
ATOM   6040  H HB2  . ALA A 1 17 ? -2.438  -1.396  -0.329  1.00 0.00 ? 81  ALA A HB2  7  
ATOM   6041  H HB3  . ALA A 1 17 ? -2.015  0.307   -0.127  1.00 0.00 ? 81  ALA A HB3  7  
ATOM   6042  N N    . VAL A 1 18 ? -3.350  -2.291  -2.929  1.00 0.00 ? 82  VAL A N    7  
ATOM   6043  C CA   . VAL A 1 18 ? -4.188  -3.331  -3.417  1.00 0.00 ? 82  VAL A CA   7  
ATOM   6044  C C    . VAL A 1 18 ? -4.686  -4.099  -2.223  1.00 0.00 ? 82  VAL A C    7  
ATOM   6045  O O    . VAL A 1 18 ? -3.896  -4.724  -1.518  1.00 0.00 ? 82  VAL A O    7  
ATOM   6046  C CB   . VAL A 1 18 ? -3.419  -4.278  -4.382  1.00 0.00 ? 82  VAL A CB   7  
ATOM   6047  C CG1  . VAL A 1 18 ? -4.319  -5.387  -4.904  1.00 0.00 ? 82  VAL A CG1  7  
ATOM   6048  C CG2  . VAL A 1 18 ? -2.816  -3.494  -5.544  1.00 0.00 ? 82  VAL A CG2  7  
ATOM   6049  H H    . VAL A 1 18 ? -2.386  -2.450  -2.851  1.00 0.00 ? 82  VAL A H    7  
ATOM   6050  H HA   . VAL A 1 18 ? -5.037  -2.898  -3.931  1.00 0.00 ? 82  VAL A HA   7  
ATOM   6051  H HB   . VAL A 1 18 ? -2.611  -4.733  -3.827  1.00 0.00 ? 82  VAL A HB   7  
ATOM   6052  H HG11 . VAL A 1 18 ? -5.140  -4.957  -5.456  1.00 0.00 ? 82  VAL A HG11 7  
ATOM   6053  H HG12 . VAL A 1 18 ? -3.748  -6.033  -5.554  1.00 0.00 ? 82  VAL A HG12 7  
ATOM   6054  H HG13 . VAL A 1 18 ? -4.703  -5.960  -4.074  1.00 0.00 ? 82  VAL A HG13 7  
ATOM   6055  H HG21 . VAL A 1 18 ? -2.125  -2.756  -5.161  1.00 0.00 ? 82  VAL A HG21 7  
ATOM   6056  H HG22 . VAL A 1 18 ? -2.290  -4.172  -6.200  1.00 0.00 ? 82  VAL A HG22 7  
ATOM   6057  H HG23 . VAL A 1 18 ? -3.604  -2.999  -6.093  1.00 0.00 ? 82  VAL A HG23 7  
ATOM   6058  N N    . TRP A 1 19 ? -5.978  -4.015  -1.985  1.00 0.00 ? 83  TRP A N    7  
ATOM   6059  C CA   . TRP A 1 19 ? -6.599  -4.668  -0.875  1.00 0.00 ? 83  TRP A CA   7  
ATOM   6060  C C    . TRP A 1 19 ? -6.519  -6.128  -1.115  1.00 0.00 ? 83  TRP A C    7  
ATOM   6061  O O    . TRP A 1 19 ? -7.114  -6.628  -2.066  1.00 0.00 ? 83  TRP A O    7  
ATOM   6062  C CB   . TRP A 1 19 ? -8.065  -4.248  -0.744  1.00 0.00 ? 83  TRP A CB   7  
ATOM   6063  C CG   . TRP A 1 19 ? -8.696  -4.656  0.565   1.00 0.00 ? 83  TRP A CG   7  
ATOM   6064  C CD1  . TRP A 1 19 ? -8.064  -4.777  1.753   1.00 0.00 ? 83  TRP A CD1  7  
ATOM   6065  C CD2  . TRP A 1 19 ? -10.073 -4.942  0.829   1.00 0.00 ? 83  TRP A CD2  7  
ATOM   6066  N NE1  . TRP A 1 19 ? -8.930  -5.136  2.726   1.00 0.00 ? 83  TRP A NE1  7  
ATOM   6067  C CE2  . TRP A 1 19 ? -10.172 -5.240  2.199   1.00 0.00 ? 83  TRP A CE2  7  
ATOM   6068  C CE3  . TRP A 1 19 ? -11.223 -4.981  0.057   1.00 0.00 ? 83  TRP A CE3  7  
ATOM   6069  C CZ2  . TRP A 1 19 ? -11.369 -5.573  2.809   1.00 0.00 ? 83  TRP A CZ2  7  
ATOM   6070  C CZ3  . TRP A 1 19 ? -12.417 -5.313  0.665   1.00 0.00 ? 83  TRP A CZ3  7  
ATOM   6071  C CH2  . TRP A 1 19 ? -12.476 -5.604  2.031   1.00 0.00 ? 83  TRP A CH2  7  
ATOM   6072  H H    . TRP A 1 19 ? -6.530  -3.493  -2.607  1.00 0.00 ? 83  TRP A H    7  
ATOM   6073  H HA   . TRP A 1 19 ? -6.066  -4.399  0.022   1.00 0.00 ? 83  TRP A HA   7  
ATOM   6074  H HB2  . TRP A 1 19 ? -8.120  -3.177  -0.844  1.00 0.00 ? 83  TRP A HB2  7  
ATOM   6075  H HB3  . TRP A 1 19 ? -8.629  -4.700  -1.546  1.00 0.00 ? 83  TRP A HB3  7  
ATOM   6076  H HD1  . TRP A 1 19 ? -7.008  -4.627  1.888   1.00 0.00 ? 83  TRP A HD1  7  
ATOM   6077  H HE1  . TRP A 1 19 ? -8.686  -5.288  3.665   1.00 0.00 ? 83  TRP A HE1  7  
ATOM   6078  H HE3  . TRP A 1 19 ? -11.188 -4.753  -0.997  1.00 0.00 ? 83  TRP A HE3  7  
ATOM   6079  H HZ2  . TRP A 1 19 ? -11.429 -5.801  3.863   1.00 0.00 ? 83  TRP A HZ2  7  
ATOM   6080  H HZ3  . TRP A 1 19 ? -13.332 -5.349  0.091   1.00 0.00 ? 83  TRP A HZ3  7  
ATOM   6081  H HH2  . TRP A 1 19 ? -13.425 -5.860  2.474   1.00 0.00 ? 83  TRP A HH2  7  
ATOM   6082  N N    . SER A 1 20 ? -5.819  -6.807  -0.264  1.00 0.00 ? 84  SER A N    7  
ATOM   6083  C CA   . SER A 1 20 ? -5.556  -8.217  -0.426  1.00 0.00 ? 84  SER A CA   7  
ATOM   6084  C C    . SER A 1 20 ? -6.863  -9.047  -0.407  1.00 0.00 ? 84  SER A C    7  
ATOM   6085  O O    . SER A 1 20 ? -6.907  -10.179 -0.902  1.00 0.00 ? 84  SER A O    7  
ATOM   6086  C CB   . SER A 1 20 ? -4.570  -8.683  0.655   1.00 0.00 ? 84  SER A CB   7  
ATOM   6087  O OG   . SER A 1 20 ? -4.028  -9.957  0.347   1.00 0.00 ? 84  SER A OG   7  
ATOM   6088  H H    . SER A 1 20 ? -5.430  -6.322  0.505   1.00 0.00 ? 84  SER A H    7  
ATOM   6089  H HA   . SER A 1 20 ? -5.091  -8.346  -1.392  1.00 0.00 ? 84  SER A HA   7  
ATOM   6090  H HB2  . SER A 1 20 ? -3.763  -7.973  0.738   1.00 0.00 ? 84  SER A HB2  7  
ATOM   6091  H HB3  . SER A 1 20 ? -5.088  -8.745  1.601   1.00 0.00 ? 84  SER A HB3  7  
ATOM   6092  H HG   . SER A 1 20 ? -4.435  -10.592 0.948   1.00 0.00 ? 84  SER A HG   7  
ATOM   6093  N N    . GLU A 1 21 ? -7.930  -8.462  0.104   1.00 0.00 ? 85  GLU A N    7  
ATOM   6094  C CA   . GLU A 1 21 ? -9.193  -9.157  0.189   1.00 0.00 ? 85  GLU A CA   7  
ATOM   6095  C C    . GLU A 1 21 ? -9.957  -9.090  -1.136  1.00 0.00 ? 85  GLU A C    7  
ATOM   6096  O O    . GLU A 1 21 ? -10.509 -10.089 -1.590  1.00 0.00 ? 85  GLU A O    7  
ATOM   6097  C CB   . GLU A 1 21 ? -10.047 -8.554  1.281   1.00 0.00 ? 85  GLU A CB   7  
ATOM   6098  C CG   . GLU A 1 21 ? -9.403  -8.549  2.653   1.00 0.00 ? 85  GLU A CG   7  
ATOM   6099  C CD   . GLU A 1 21 ? -9.132  -9.934  3.188   1.00 0.00 ? 85  GLU A CD   7  
ATOM   6100  O OE1  . GLU A 1 21 ? -10.092 -10.712 3.372   1.00 0.00 ? 85  GLU A OE1  7  
ATOM   6101  O OE2  . GLU A 1 21 ? -7.950  -10.281 3.436   1.00 0.00 ? 85  GLU A OE2  7  
ATOM   6102  H H    . GLU A 1 21 ? -7.844  -7.537  0.425   1.00 0.00 ? 85  GLU A H    7  
ATOM   6103  H HA   . GLU A 1 21 ? -8.998  -10.189 0.436   1.00 0.00 ? 85  GLU A HA   7  
ATOM   6104  H HB2  . GLU A 1 21 ? -10.268 -7.531  1.016   1.00 0.00 ? 85  GLU A HB2  7  
ATOM   6105  H HB3  . GLU A 1 21 ? -10.973 -9.103  1.343   1.00 0.00 ? 85  GLU A HB3  7  
ATOM   6106  H HG2  . GLU A 1 21 ? -8.486  -7.991  2.557   1.00 0.00 ? 85  GLU A HG2  7  
ATOM   6107  H HG3  . GLU A 1 21 ? -10.024 -7.989  3.335   1.00 0.00 ? 85  GLU A HG3  7  
ATOM   6108  N N    . ASP A 1 22 ? -9.958  -7.925  -1.770  1.00 0.00 ? 86  ASP A N    7  
ATOM   6109  C CA   . ASP A 1 22 ? -10.777 -7.720  -2.988  1.00 0.00 ? 86  ASP A CA   7  
ATOM   6110  C C    . ASP A 1 22 ? -9.918  -7.745  -4.248  1.00 0.00 ? 86  ASP A C    7  
ATOM   6111  O O    . ASP A 1 22 ? -10.409 -7.947  -5.351  1.00 0.00 ? 86  ASP A O    7  
ATOM   6112  C CB   . ASP A 1 22 ? -11.517 -6.384  -2.880  1.00 0.00 ? 86  ASP A CB   7  
ATOM   6113  C CG   . ASP A 1 22 ? -12.581 -6.172  -3.926  1.00 0.00 ? 86  ASP A CG   7  
ATOM   6114  O OD1  . ASP A 1 22 ? -13.673 -6.764  -3.798  1.00 0.00 ? 86  ASP A OD1  7  
ATOM   6115  O OD2  . ASP A 1 22 ? -12.379 -5.359  -4.844  1.00 0.00 ? 86  ASP A OD2  7  
ATOM   6116  H H    . ASP A 1 22 ? -9.402  -7.195  -1.425  1.00 0.00 ? 86  ASP A H    7  
ATOM   6117  H HA   . ASP A 1 22 ? -11.504 -8.516  -3.039  1.00 0.00 ? 86  ASP A HA   7  
ATOM   6118  H HB2  . ASP A 1 22 ? -12.001 -6.336  -1.916  1.00 0.00 ? 86  ASP A HB2  7  
ATOM   6119  H HB3  . ASP A 1 22 ? -10.793 -5.586  -2.963  1.00 0.00 ? 86  ASP A HB3  7  
ATOM   6120  N N    . GLY A 1 23 ? -8.631  -7.548  -4.066  1.00 0.00 ? 87  GLY A N    7  
ATOM   6121  C CA   . GLY A 1 23 ? -7.688  -7.580  -5.165  1.00 0.00 ? 87  GLY A CA   7  
ATOM   6122  C C    . GLY A 1 23 ? -7.660  -6.293  -5.962  1.00 0.00 ? 87  GLY A C    7  
ATOM   6123  O O    . GLY A 1 23 ? -7.093  -6.242  -7.050  1.00 0.00 ? 87  GLY A O    7  
ATOM   6124  H H    . GLY A 1 23 ? -8.270  -7.379  -3.166  1.00 0.00 ? 87  GLY A H    7  
ATOM   6125  H HA2  . GLY A 1 23 ? -6.703  -7.747  -4.754  1.00 0.00 ? 87  GLY A HA2  7  
ATOM   6126  H HA3  . GLY A 1 23 ? -7.936  -8.401  -5.820  1.00 0.00 ? 87  GLY A HA3  7  
ATOM   6127  N N    . GLN A 1 24 ? -8.288  -5.267  -5.446  1.00 0.00 ? 88  GLN A N    7  
ATOM   6128  C CA   . GLN A 1 24 ? -8.341  -3.991  -6.128  1.00 0.00 ? 88  GLN A CA   7  
ATOM   6129  C C    . GLN A 1 24 ? -7.613  -2.928  -5.349  1.00 0.00 ? 88  GLN A C    7  
ATOM   6130  O O    . GLN A 1 24 ? -7.301  -3.125  -4.175  1.00 0.00 ? 88  GLN A O    7  
ATOM   6131  C CB   . GLN A 1 24 ? -9.772  -3.578  -6.419  1.00 0.00 ? 88  GLN A CB   7  
ATOM   6132  C CG   . GLN A 1 24 ? -10.472 -4.463  -7.431  1.00 0.00 ? 88  GLN A CG   7  
ATOM   6133  C CD   . GLN A 1 24 ? -9.866  -4.394  -8.815  1.00 0.00 ? 88  GLN A CD   7  
ATOM   6134  O OE1  . GLN A 1 24 ? -10.265 -3.574  -9.626  1.00 0.00 ? 88  GLN A OE1  7  
ATOM   6135  N NE2  . GLN A 1 24 ? -8.917  -5.234  -9.103  1.00 0.00 ? 88  GLN A NE2  7  
ATOM   6136  H H    . GLN A 1 24 ? -8.689  -5.361  -4.558  1.00 0.00 ? 88  GLN A H    7  
ATOM   6137  H HA   . GLN A 1 24 ? -7.824  -4.128  -7.065  1.00 0.00 ? 88  GLN A HA   7  
ATOM   6138  H HB2  . GLN A 1 24 ? -10.335 -3.622  -5.500  1.00 0.00 ? 88  GLN A HB2  7  
ATOM   6139  H HB3  . GLN A 1 24 ? -9.777  -2.563  -6.784  1.00 0.00 ? 88  GLN A HB3  7  
ATOM   6140  H HG2  . GLN A 1 24 ? -10.440 -5.485  -7.089  1.00 0.00 ? 88  GLN A HG2  7  
ATOM   6141  H HG3  . GLN A 1 24 ? -11.491 -4.120  -7.493  1.00 0.00 ? 88  GLN A HG3  7  
ATOM   6142  H HE21 . GLN A 1 24 ? -8.632  -5.877  -8.415  1.00 0.00 ? 88  GLN A HE21 7  
ATOM   6143  H HE22 . GLN A 1 24 ? -8.519  -5.205  -9.999  1.00 0.00 ? 88  GLN A HE22 7  
ATOM   6144  N N    . CYS A 1 25 ? -7.376  -1.813  -5.970  1.00 0.00 ? 89  CYS A N    7  
ATOM   6145  C CA   . CYS A 1 25 ? -6.634  -0.739  -5.348  1.00 0.00 ? 89  CYS A CA   7  
ATOM   6146  C C    . CYS A 1 25 ? -7.564  0.290   -4.708  1.00 0.00 ? 89  CYS A C    7  
ATOM   6147  O O    . CYS A 1 25 ? -8.569  0.695   -5.303  1.00 0.00 ? 89  CYS A O    7  
ATOM   6148  C CB   . CYS A 1 25 ? -5.697  -0.091  -6.368  1.00 0.00 ? 89  CYS A CB   7  
ATOM   6149  S SG   . CYS A 1 25 ? -6.532  0.531   -7.844  1.00 0.00 ? 89  CYS A SG   7  
ATOM   6150  H H    . CYS A 1 25 ? -7.725  -1.709  -6.882  1.00 0.00 ? 89  CYS A H    7  
ATOM   6151  H HA   . CYS A 1 25 ? -6.035  -1.173  -4.562  1.00 0.00 ? 89  CYS A HA   7  
ATOM   6152  H HB2  . CYS A 1 25 ? -5.172  0.730   -5.904  1.00 0.00 ? 89  CYS A HB2  7  
ATOM   6153  H HB3  . CYS A 1 25 ? -4.975  -0.829  -6.687  1.00 0.00 ? 89  CYS A HB3  7  
ATOM   6154  H HG   . CYS A 1 25 ? -7.777  0.817   -7.484  1.00 0.00 ? 89  CYS A HG   7  
ATOM   6155  N N    . TYR A 1 26 ? -7.233  0.672   -3.489  1.00 0.00 ? 90  TYR A N    7  
ATOM   6156  C CA   . TYR A 1 26 ? -7.996  1.624   -2.687  1.00 0.00 ? 90  TYR A CA   7  
ATOM   6157  C C    . TYR A 1 26 ? -7.011  2.550   -2.007  1.00 0.00 ? 90  TYR A C    7  
ATOM   6158  O O    . TYR A 1 26 ? -5.846  2.183   -1.853  1.00 0.00 ? 90  TYR A O    7  
ATOM   6159  C CB   . TYR A 1 26 ? -8.817  0.886   -1.619  1.00 0.00 ? 90  TYR A CB   7  
ATOM   6160  C CG   . TYR A 1 26 ? -9.876  -0.062  -2.170  1.00 0.00 ? 90  TYR A CG   7  
ATOM   6161  C CD1  . TYR A 1 26 ? -9.528  -1.315  -2.657  1.00 0.00 ? 90  TYR A CD1  7  
ATOM   6162  C CD2  . TYR A 1 26 ? -11.216 0.297   -2.195  1.00 0.00 ? 90  TYR A CD2  7  
ATOM   6163  C CE1  . TYR A 1 26 ? -10.467 -2.176  -3.159  1.00 0.00 ? 90  TYR A CE1  7  
ATOM   6164  C CE2  . TYR A 1 26 ? -12.172 -0.567  -2.693  1.00 0.00 ? 90  TYR A CE2  7  
ATOM   6165  C CZ   . TYR A 1 26 ? -11.788 -1.802  -3.178  1.00 0.00 ? 90  TYR A CZ   7  
ATOM   6166  O OH   . TYR A 1 26 ? -12.735 -2.666  -3.689  1.00 0.00 ? 90  TYR A OH   7  
ATOM   6167  H H    . TYR A 1 26 ? -6.418  0.291   -3.087  1.00 0.00 ? 90  TYR A H    7  
ATOM   6168  H HA   . TYR A 1 26 ? -8.652  2.187   -3.335  1.00 0.00 ? 90  TYR A HA   7  
ATOM   6169  H HB2  . TYR A 1 26 ? -8.130  0.308   -1.021  1.00 0.00 ? 90  TYR A HB2  7  
ATOM   6170  H HB3  . TYR A 1 26 ? -9.293  1.603   -0.969  1.00 0.00 ? 90  TYR A HB3  7  
ATOM   6171  H HD1  . TYR A 1 26 ? -8.488  -1.613  -2.641  1.00 0.00 ? 90  TYR A HD1  7  
ATOM   6172  H HD2  . TYR A 1 26 ? -11.511 1.264   -1.815  1.00 0.00 ? 90  TYR A HD2  7  
ATOM   6173  H HE1  . TYR A 1 26 ? -10.151 -3.139  -3.533  1.00 0.00 ? 90  TYR A HE1  7  
ATOM   6174  H HE2  . TYR A 1 26 ? -13.212 -0.276  -2.702  1.00 0.00 ? 90  TYR A HE2  7  
ATOM   6175  H HH   . TYR A 1 26 ? -12.450 -3.580  -3.550  1.00 0.00 ? 90  TYR A HH   7  
ATOM   6176  N N    . GLU A 1 27 ? -7.445  3.728   -1.607  1.00 0.00 ? 91  GLU A N    7  
ATOM   6177  C CA   . GLU A 1 27 ? -6.540  4.679   -0.996  1.00 0.00 ? 91  GLU A CA   7  
ATOM   6178  C C    . GLU A 1 27 ? -6.254  4.290   0.454   1.00 0.00 ? 91  GLU A C    7  
ATOM   6179  O O    . GLU A 1 27 ? -7.163  4.019   1.240   1.00 0.00 ? 91  GLU A O    7  
ATOM   6180  C CB   . GLU A 1 27 ? -7.076  6.111   -1.093  1.00 0.00 ? 91  GLU A CB   7  
ATOM   6181  C CG   . GLU A 1 27 ? -6.081  7.170   -0.626  1.00 0.00 ? 91  GLU A CG   7  
ATOM   6182  C CD   . GLU A 1 27 ? -6.574  8.582   -0.815  1.00 0.00 ? 91  GLU A CD   7  
ATOM   6183  O OE1  . GLU A 1 27 ? -6.860  8.980   -1.963  1.00 0.00 ? 91  GLU A OE1  7  
ATOM   6184  O OE2  . GLU A 1 27 ? -6.688  9.330   0.181   1.00 0.00 ? 91  GLU A OE2  7  
ATOM   6185  H H    . GLU A 1 27 ? -8.394  3.965   -1.676  1.00 0.00 ? 91  GLU A H    7  
ATOM   6186  H HA   . GLU A 1 27 ? -5.610  4.614   -1.541  1.00 0.00 ? 91  GLU A HA   7  
ATOM   6187  H HB2  . GLU A 1 27 ? -7.343  6.318   -2.119  1.00 0.00 ? 91  GLU A HB2  7  
ATOM   6188  H HB3  . GLU A 1 27 ? -7.958  6.175   -0.475  1.00 0.00 ? 91  GLU A HB3  7  
ATOM   6189  H HG2  . GLU A 1 27 ? -5.889  7.017   0.426   1.00 0.00 ? 91  GLU A HG2  7  
ATOM   6190  H HG3  . GLU A 1 27 ? -5.160  7.044   -1.174  1.00 0.00 ? 91  GLU A HG3  7  
ATOM   6191  N N    . ALA A 1 28 ? -5.001  4.248   0.780   1.00 0.00 ? 92  ALA A N    7  
ATOM   6192  C CA   . ALA A 1 28 ? -4.537  3.870   2.085   1.00 0.00 ? 92  ALA A CA   7  
ATOM   6193  C C    . ALA A 1 28 ? -3.352  4.720   2.480   1.00 0.00 ? 92  ALA A C    7  
ATOM   6194  O O    . ALA A 1 28 ? -2.517  5.047   1.646   1.00 0.00 ? 92  ALA A O    7  
ATOM   6195  C CB   . ALA A 1 28 ? -4.139  2.424   2.069   1.00 0.00 ? 92  ALA A CB   7  
ATOM   6196  H H    . ALA A 1 28 ? -4.342  4.491   0.087   1.00 0.00 ? 92  ALA A H    7  
ATOM   6197  H HA   . ALA A 1 28 ? -5.326  4.003   2.810   1.00 0.00 ? 92  ALA A HA   7  
ATOM   6198  H HB1  . ALA A 1 28 ? -3.332  2.281   1.368   1.00 0.00 ? 92  ALA A HB1  7  
ATOM   6199  H HB2  . ALA A 1 28 ? -3.816  2.132   3.057   1.00 0.00 ? 92  ALA A HB2  7  
ATOM   6200  H HB3  . ALA A 1 28 ? -4.984  1.818   1.774   1.00 0.00 ? 92  ALA A HB3  7  
ATOM   6201  N N    . GLU A 1 29 ? -3.262  5.057   3.732   1.00 0.00 ? 93  GLU A N    7  
ATOM   6202  C CA   . GLU A 1 29 ? -2.200  5.897   4.205   1.00 0.00 ? 93  GLU A CA   7  
ATOM   6203  C C    . GLU A 1 29 ? -1.132  5.055   4.872   1.00 0.00 ? 93  GLU A C    7  
ATOM   6204  O O    . GLU A 1 29 ? -1.436  4.128   5.628   1.00 0.00 ? 93  GLU A O    7  
ATOM   6205  C CB   . GLU A 1 29 ? -2.736  6.978   5.140   1.00 0.00 ? 93  GLU A CB   7  
ATOM   6206  C CG   . GLU A 1 29 ? -1.704  8.018   5.554   1.00 0.00 ? 93  GLU A CG   7  
ATOM   6207  C CD   . GLU A 1 29 ? -2.306  9.106   6.394   1.00 0.00 ? 93  GLU A CD   7  
ATOM   6208  O OE1  . GLU A 1 29 ? -2.938  10.023  5.845   1.00 0.00 ? 93  GLU A OE1  7  
ATOM   6209  O OE2  . GLU A 1 29 ? -2.196  9.056   7.622   1.00 0.00 ? 93  GLU A OE2  7  
ATOM   6210  H H    . GLU A 1 29 ? -3.916  4.699   4.376   1.00 0.00 ? 93  GLU A H    7  
ATOM   6211  H HA   . GLU A 1 29 ? -1.759  6.367   3.342   1.00 0.00 ? 93  GLU A HA   7  
ATOM   6212  H HB2  . GLU A 1 29 ? -3.554  7.487   4.654   1.00 0.00 ? 93  GLU A HB2  7  
ATOM   6213  H HB3  . GLU A 1 29 ? -3.110  6.498   6.033   1.00 0.00 ? 93  GLU A HB3  7  
ATOM   6214  H HG2  . GLU A 1 29 ? -0.935  7.524   6.129   1.00 0.00 ? 93  GLU A HG2  7  
ATOM   6215  H HG3  . GLU A 1 29 ? -1.261  8.455   4.670   1.00 0.00 ? 93  GLU A HG3  7  
ATOM   6216  N N    . ILE A 1 30 ? 0.094   5.342   4.541   1.00 0.00 ? 94  ILE A N    7  
ATOM   6217  C CA   . ILE A 1 30 ? 1.245   4.634   5.052   1.00 0.00 ? 94  ILE A CA   7  
ATOM   6218  C C    . ILE A 1 30 ? 1.551   5.025   6.492   1.00 0.00 ? 94  ILE A C    7  
ATOM   6219  O O    . ILE A 1 30 ? 1.785   6.205   6.804   1.00 0.00 ? 94  ILE A O    7  
ATOM   6220  C CB   . ILE A 1 30 ? 2.473   4.910   4.172   1.00 0.00 ? 94  ILE A CB   7  
ATOM   6221  C CG1  . ILE A 1 30 ? 2.154   4.494   2.749   1.00 0.00 ? 94  ILE A CG1  7  
ATOM   6222  C CG2  . ILE A 1 30 ? 3.678   4.124   4.692   1.00 0.00 ? 94  ILE A CG2  7  
ATOM   6223  C CD1  . ILE A 1 30 ? 3.145   4.974   1.743   1.00 0.00 ? 94  ILE A CD1  7  
ATOM   6224  H H    . ILE A 1 30 ? 0.247   6.071   3.896   1.00 0.00 ? 94  ILE A H    7  
ATOM   6225  H HA   . ILE A 1 30 ? 1.038   3.576   5.015   1.00 0.00 ? 94  ILE A HA   7  
ATOM   6226  H HB   . ILE A 1 30 ? 2.691   5.971   4.177   1.00 0.00 ? 94  ILE A HB   7  
ATOM   6227  H HG12 . ILE A 1 30 ? 2.145   3.416   2.698   1.00 0.00 ? 94  ILE A HG12 7  
ATOM   6228  H HG13 . ILE A 1 30 ? 1.180   4.875   2.485   1.00 0.00 ? 94  ILE A HG13 7  
ATOM   6229  H HG21 . ILE A 1 30 ? 3.426   3.073   4.717   1.00 0.00 ? 94  ILE A HG21 7  
ATOM   6230  H HG22 . ILE A 1 30 ? 4.526   4.278   4.044   1.00 0.00 ? 94  ILE A HG22 7  
ATOM   6231  H HG23 . ILE A 1 30 ? 3.915   4.449   5.694   1.00 0.00 ? 94  ILE A HG23 7  
ATOM   6232  H HD11 . ILE A 1 30 ? 4.108   4.560   2.004   1.00 0.00 ? 94  ILE A HD11 7  
ATOM   6233  H HD12 . ILE A 1 30 ? 2.854   4.638   0.758   1.00 0.00 ? 94  ILE A HD12 7  
ATOM   6234  H HD13 . ILE A 1 30 ? 3.188   6.054   1.762   1.00 0.00 ? 94  ILE A HD13 7  
ATOM   6235  N N    . GLU A 1 31 ? 1.565   4.032   7.342   1.00 0.00 ? 95  GLU A N    7  
ATOM   6236  C CA   . GLU A 1 31 ? 1.834   4.196   8.755   1.00 0.00 ? 95  GLU A CA   7  
ATOM   6237  C C    . GLU A 1 31 ? 3.289   3.883   9.065   1.00 0.00 ? 95  GLU A C    7  
ATOM   6238  O O    . GLU A 1 31 ? 3.905   4.504   9.933   1.00 0.00 ? 95  GLU A O    7  
ATOM   6239  C CB   . GLU A 1 31 ? 0.940   3.254   9.536   1.00 0.00 ? 95  GLU A CB   7  
ATOM   6240  C CG   . GLU A 1 31 ? -0.533  3.554   9.394   1.00 0.00 ? 95  GLU A CG   7  
ATOM   6241  C CD   . GLU A 1 31 ? -0.954  4.797   10.139  1.00 0.00 ? 95  GLU A CD   7  
ATOM   6242  O OE1  . GLU A 1 31 ? -1.244  4.702   11.359  1.00 0.00 ? 95  GLU A OE1  7  
ATOM   6243  O OE2  . GLU A 1 31 ? -1.013  5.888   9.537   1.00 0.00 ? 95  GLU A OE2  7  
ATOM   6244  H H    . GLU A 1 31 ? 1.376   3.130   6.993   1.00 0.00 ? 95  GLU A H    7  
ATOM   6245  H HA   . GLU A 1 31 ? 1.607   5.209   9.047   1.00 0.00 ? 95  GLU A HA   7  
ATOM   6246  H HB2  . GLU A 1 31 ? 1.120   2.244   9.195   1.00 0.00 ? 95  GLU A HB2  7  
ATOM   6247  H HB3  . GLU A 1 31 ? 1.200   3.321   10.582  1.00 0.00 ? 95  GLU A HB3  7  
ATOM   6248  H HG2  . GLU A 1 31 ? -0.741  3.703   8.344   1.00 0.00 ? 95  GLU A HG2  7  
ATOM   6249  H HG3  . GLU A 1 31 ? -1.095  2.703   9.745   1.00 0.00 ? 95  GLU A HG3  7  
ATOM   6250  N N    . GLU A 1 32 ? 3.834   2.928   8.351   1.00 0.00 ? 96  GLU A N    7  
ATOM   6251  C CA   . GLU A 1 32 ? 5.193   2.480   8.585   1.00 0.00 ? 96  GLU A CA   7  
ATOM   6252  C C    . GLU A 1 32 ? 5.720   1.823   7.328   1.00 0.00 ? 96  GLU A C    7  
ATOM   6253  O O    . GLU A 1 32 ? 4.943   1.301   6.536   1.00 0.00 ? 96  GLU A O    7  
ATOM   6254  C CB   . GLU A 1 32 ? 5.197   1.477   9.747   1.00 0.00 ? 96  GLU A CB   7  
ATOM   6255  C CG   . GLU A 1 32 ? 6.567   1.002   10.180  1.00 0.00 ? 96  GLU A CG   7  
ATOM   6256  C CD   . GLU A 1 32 ? 6.494   -0.059  11.239  1.00 0.00 ? 96  GLU A CD   7  
ATOM   6257  O OE1  . GLU A 1 32 ? 6.213   0.263   12.410  1.00 0.00 ? 96  GLU A OE1  7  
ATOM   6258  O OE2  . GLU A 1 32 ? 6.731   -1.250  10.913  1.00 0.00 ? 96  GLU A OE2  7  
ATOM   6259  H H    . GLU A 1 32 ? 3.320   2.499   7.633   1.00 0.00 ? 96  GLU A H    7  
ATOM   6260  H HA   . GLU A 1 32 ? 5.822   3.322   8.831   1.00 0.00 ? 96  GLU A HA   7  
ATOM   6261  H HB2  . GLU A 1 32 ? 4.720   1.936   10.599  1.00 0.00 ? 96  GLU A HB2  7  
ATOM   6262  H HB3  . GLU A 1 32 ? 4.618   0.613   9.454   1.00 0.00 ? 96  GLU A HB3  7  
ATOM   6263  H HG2  . GLU A 1 32 ? 7.065   0.591   9.314   1.00 0.00 ? 96  GLU A HG2  7  
ATOM   6264  H HG3  . GLU A 1 32 ? 7.131   1.843   10.557  1.00 0.00 ? 96  GLU A HG3  7  
ATOM   6265  N N    . ILE A 1 33 ? 7.009   1.876   7.138   1.00 0.00 ? 97  ILE A N    7  
ATOM   6266  C CA   . ILE A 1 33 ? 7.668   1.284   6.000   1.00 0.00 ? 97  ILE A CA   7  
ATOM   6267  C C    . ILE A 1 33 ? 8.738   0.317   6.502   1.00 0.00 ? 97  ILE A C    7  
ATOM   6268  O O    . ILE A 1 33 ? 9.289   0.493   7.591   1.00 0.00 ? 97  ILE A O    7  
ATOM   6269  C CB   . ILE A 1 33 ? 8.322   2.402   5.135   1.00 0.00 ? 97  ILE A CB   7  
ATOM   6270  C CG1  . ILE A 1 33 ? 7.249   3.366   4.665   1.00 0.00 ? 97  ILE A CG1  7  
ATOM   6271  C CG2  . ILE A 1 33 ? 9.069   1.829   3.922   1.00 0.00 ? 97  ILE A CG2  7  
ATOM   6272  C CD1  . ILE A 1 33 ? 7.782   4.706   4.342   1.00 0.00 ? 97  ILE A CD1  7  
ATOM   6273  H H    . ILE A 1 33 ? 7.590   2.337   7.783   1.00 0.00 ? 97  ILE A H    7  
ATOM   6274  H HA   . ILE A 1 33 ? 6.939   0.756   5.405   1.00 0.00 ? 97  ILE A HA   7  
ATOM   6275  H HB   . ILE A 1 33 ? 9.029   2.952   5.739   1.00 0.00 ? 97  ILE A HB   7  
ATOM   6276  H HG12 . ILE A 1 33 ? 6.784   2.993   3.764   1.00 0.00 ? 97  ILE A HG12 7  
ATOM   6277  H HG13 . ILE A 1 33 ? 6.506   3.479   5.440   1.00 0.00 ? 97  ILE A HG13 7  
ATOM   6278  H HG21 . ILE A 1 33 ? 8.373   1.299   3.290   1.00 0.00 ? 97  ILE A HG21 7  
ATOM   6279  H HG22 . ILE A 1 33 ? 9.525   2.635   3.363   1.00 0.00 ? 97  ILE A HG22 7  
ATOM   6280  H HG23 . ILE A 1 33 ? 9.834   1.148   4.262   1.00 0.00 ? 97  ILE A HG23 7  
ATOM   6281  H HD11 . ILE A 1 33 ? 8.566   4.630   3.603   1.00 0.00 ? 97  ILE A HD11 7  
ATOM   6282  H HD12 . ILE A 1 33 ? 6.976   5.333   3.993   1.00 0.00 ? 97  ILE A HD12 7  
ATOM   6283  H HD13 . ILE A 1 33 ? 8.166   5.107   5.268   1.00 0.00 ? 97  ILE A HD13 7  
ATOM   6284  N N    . ASP A 1 34 ? 8.958   -0.719  5.761   1.00 0.00 ? 98  ASP A N    7  
ATOM   6285  C CA   . ASP A 1 34 ? 9.993   -1.677  6.030   1.00 0.00 ? 98  ASP A CA   7  
ATOM   6286  C C    . ASP A 1 34 ? 10.879  -1.721  4.802   1.00 0.00 ? 98  ASP A C    7  
ATOM   6287  O O    . ASP A 1 34 ? 10.525  -2.332  3.799   1.00 0.00 ? 98  ASP A O    7  
ATOM   6288  C CB   . ASP A 1 34 ? 9.387   -3.064  6.300   1.00 0.00 ? 98  ASP A CB   7  
ATOM   6289  C CG   . ASP A 1 34 ? 10.420  -4.109  6.670   1.00 0.00 ? 98  ASP A CG   7  
ATOM   6290  O OD1  . ASP A 1 34 ? 11.146  -4.582  5.789   1.00 0.00 ? 98  ASP A OD1  7  
ATOM   6291  O OD2  . ASP A 1 34 ? 10.516  -4.479  7.875   1.00 0.00 ? 98  ASP A OD2  7  
ATOM   6292  H H    . ASP A 1 34 ? 8.406   -0.861  4.956   1.00 0.00 ? 98  ASP A H    7  
ATOM   6293  H HA   . ASP A 1 34 ? 10.575  -1.352  6.880   1.00 0.00 ? 98  ASP A HA   7  
ATOM   6294  H HB2  . ASP A 1 34 ? 8.672   -2.988  7.107   1.00 0.00 ? 98  ASP A HB2  7  
ATOM   6295  H HB3  . ASP A 1 34 ? 8.872   -3.394  5.410   1.00 0.00 ? 98  ASP A HB3  7  
ATOM   6296  N N    . GLU A 1 35 ? 11.984  -1.002  4.849   1.00 0.00 ? 99  GLU A N    7  
ATOM   6297  C CA   . GLU A 1 35 ? 12.912  -0.908  3.712   1.00 0.00 ? 99  GLU A CA   7  
ATOM   6298  C C    . GLU A 1 35 ? 13.573  -2.238  3.382   1.00 0.00 ? 99  GLU A C    7  
ATOM   6299  O O    . GLU A 1 35 ? 14.016  -2.456  2.246   1.00 0.00 ? 99  GLU A O    7  
ATOM   6300  C CB   . GLU A 1 35 ? 14.003  0.117   3.970   1.00 0.00 ? 99  GLU A CB   7  
ATOM   6301  C CG   . GLU A 1 35 ? 13.534  1.555   4.076   1.00 0.00 ? 99  GLU A CG   7  
ATOM   6302  C CD   . GLU A 1 35 ? 14.690  2.506   4.269   1.00 0.00 ? 99  GLU A CD   7  
ATOM   6303  O OE1  . GLU A 1 35 ? 15.416  2.785   3.298   1.00 0.00 ? 99  GLU A OE1  7  
ATOM   6304  O OE2  . GLU A 1 35 ? 14.908  2.976   5.388   1.00 0.00 ? 99  GLU A OE2  7  
ATOM   6305  H H    . GLU A 1 35 ? 12.184  -0.513  5.677   1.00 0.00 ? 99  GLU A H    7  
ATOM   6306  H HA   . GLU A 1 35 ? 12.342  -0.583  2.853   1.00 0.00 ? 99  GLU A HA   7  
ATOM   6307  H HB2  . GLU A 1 35 ? 14.502  -0.148  4.890   1.00 0.00 ? 99  GLU A HB2  7  
ATOM   6308  H HB3  . GLU A 1 35 ? 14.708  0.043   3.157   1.00 0.00 ? 99  GLU A HB3  7  
ATOM   6309  H HG2  . GLU A 1 35 ? 13.015  1.821   3.167   1.00 0.00 ? 99  GLU A HG2  7  
ATOM   6310  H HG3  . GLU A 1 35 ? 12.863  1.649   4.917   1.00 0.00 ? 99  GLU A HG3  7  
ATOM   6311  N N    . GLU A 1 36 ? 13.626  -3.117  4.359   1.00 0.00 ? 100 GLU A N    7  
ATOM   6312  C CA   . GLU A 1 36 ? 14.294  -4.390  4.222   1.00 0.00 ? 100 GLU A CA   7  
ATOM   6313  C C    . GLU A 1 36 ? 13.520  -5.263  3.211   1.00 0.00 ? 100 GLU A C    7  
ATOM   6314  O O    . GLU A 1 36 ? 14.112  -5.901  2.354   1.00 0.00 ? 100 GLU A O    7  
ATOM   6315  C CB   . GLU A 1 36 ? 14.364  -5.049  5.611   1.00 0.00 ? 100 GLU A CB   7  
ATOM   6316  C CG   . GLU A 1 36 ? 15.525  -6.021  5.853   1.00 0.00 ? 100 GLU A CG   7  
ATOM   6317  C CD   . GLU A 1 36 ? 15.505  -7.247  4.987   1.00 0.00 ? 100 GLU A CD   7  
ATOM   6318  O OE1  . GLU A 1 36 ? 14.683  -8.151  5.246   1.00 0.00 ? 100 GLU A OE1  7  
ATOM   6319  O OE2  . GLU A 1 36 ? 16.324  -7.334  4.038   1.00 0.00 ? 100 GLU A OE2  7  
ATOM   6320  H H    . GLU A 1 36 ? 13.190  -2.902  5.212   1.00 0.00 ? 100 GLU A H    7  
ATOM   6321  H HA   . GLU A 1 36 ? 15.295  -4.215  3.857   1.00 0.00 ? 100 GLU A HA   7  
ATOM   6322  H HB2  . GLU A 1 36 ? 14.419  -4.270  6.356   1.00 0.00 ? 100 GLU A HB2  7  
ATOM   6323  H HB3  . GLU A 1 36 ? 13.439  -5.585  5.763   1.00 0.00 ? 100 GLU A HB3  7  
ATOM   6324  H HG2  . GLU A 1 36 ? 16.452  -5.500  5.668   1.00 0.00 ? 100 GLU A HG2  7  
ATOM   6325  H HG3  . GLU A 1 36 ? 15.504  -6.326  6.889   1.00 0.00 ? 100 GLU A HG3  7  
ATOM   6326  N N    . ASN A 1 37 ? 12.207  -5.251  3.300   1.00 0.00 ? 101 ASN A N    7  
ATOM   6327  C CA   . ASN A 1 37 ? 11.377  -6.019  2.357   1.00 0.00 ? 101 ASN A CA   7  
ATOM   6328  C C    . ASN A 1 37 ? 10.845  -5.130  1.265   1.00 0.00 ? 101 ASN A C    7  
ATOM   6329  O O    . ASN A 1 37 ? 10.357  -5.613  0.226   1.00 0.00 ? 101 ASN A O    7  
ATOM   6330  C CB   . ASN A 1 37 ? 10.172  -6.644  3.062   1.00 0.00 ? 101 ASN A CB   7  
ATOM   6331  C CG   . ASN A 1 37 ? 10.525  -7.650  4.118   1.00 0.00 ? 101 ASN A CG   7  
ATOM   6332  O OD1  . ASN A 1 37 ? 10.607  -8.850  3.858   1.00 0.00 ? 101 ASN A OD1  7  
ATOM   6333  N ND2  . ASN A 1 37 ? 10.749  -7.189  5.295   1.00 0.00 ? 101 ASN A ND2  7  
ATOM   6334  H H    . ASN A 1 37 ? 11.790  -4.750  4.041   1.00 0.00 ? 101 ASN A H    7  
ATOM   6335  H HA   . ASN A 1 37 ? 11.969  -6.809  1.923   1.00 0.00 ? 101 ASN A HA   7  
ATOM   6336  H HB2  . ASN A 1 37 ? 9.586   -5.864  3.523   1.00 0.00 ? 101 ASN A HB2  7  
ATOM   6337  H HB3  . ASN A 1 37 ? 9.576   -7.133  2.306   1.00 0.00 ? 101 ASN A HB3  7  
ATOM   6338  H HD21 . ASN A 1 37 ? 10.683  -6.208  5.427   1.00 0.00 ? 101 ASN A HD21 7  
ATOM   6339  H HD22 . ASN A 1 37 ? 10.990  -7.802  6.020   1.00 0.00 ? 101 ASN A HD22 7  
ATOM   6340  N N    . GLY A 1 38 ? 10.944  -3.838  1.477   1.00 0.00 ? 102 GLY A N    7  
ATOM   6341  C CA   . GLY A 1 38 ? 10.347  -2.905  0.570   1.00 0.00 ? 102 GLY A CA   7  
ATOM   6342  C C    . GLY A 1 38 ? 8.845   -2.944  0.725   1.00 0.00 ? 102 GLY A C    7  
ATOM   6343  O O    . GLY A 1 38 ? 8.099   -2.844  -0.252  1.00 0.00 ? 102 GLY A O    7  
ATOM   6344  H H    . GLY A 1 38 ? 11.419  -3.512  2.273   1.00 0.00 ? 102 GLY A H    7  
ATOM   6345  H HA2  . GLY A 1 38 ? 10.711  -1.911  0.785   1.00 0.00 ? 102 GLY A HA2  7  
ATOM   6346  H HA3  . GLY A 1 38 ? 10.599  -3.174  -0.445  1.00 0.00 ? 102 GLY A HA3  7  
ATOM   6347  N N    . THR A 1 39 ? 8.399   -3.127  1.947   1.00 0.00 ? 103 THR A N    7  
ATOM   6348  C CA   . THR A 1 39 ? 6.998   -3.209  2.248   1.00 0.00 ? 103 THR A CA   7  
ATOM   6349  C C    . THR A 1 39 ? 6.555   -2.033  3.099   1.00 0.00 ? 103 THR A C    7  
ATOM   6350  O O    . THR A 1 39 ? 7.383   -1.322  3.669   1.00 0.00 ? 103 THR A O    7  
ATOM   6351  C CB   . THR A 1 39 ? 6.669   -4.546  2.949   1.00 0.00 ? 103 THR A CB   7  
ATOM   6352  O OG1  . THR A 1 39 ? 7.597   -4.766  4.018   1.00 0.00 ? 103 THR A OG1  7  
ATOM   6353  C CG2  . THR A 1 39 ? 6.731   -5.714  1.975   1.00 0.00 ? 103 THR A CG2  7  
ATOM   6354  H H    . THR A 1 39 ? 9.025   -3.216  2.701   1.00 0.00 ? 103 THR A H    7  
ATOM   6355  H HA   . THR A 1 39 ? 6.447   -3.157  1.326   1.00 0.00 ? 103 THR A HA   7  
ATOM   6356  H HB   . THR A 1 39 ? 5.673   -4.476  3.359   1.00 0.00 ? 103 THR A HB   7  
ATOM   6357  H HG1  . THR A 1 39 ? 7.290   -5.524  4.530   1.00 0.00 ? 103 THR A HG1  7  
ATOM   6358  H HG21 . THR A 1 39 ? 7.700   -5.745  1.501   1.00 0.00 ? 103 THR A HG21 7  
ATOM   6359  H HG22 . THR A 1 39 ? 6.561   -6.636  2.513   1.00 0.00 ? 103 THR A HG22 7  
ATOM   6360  H HG23 . THR A 1 39 ? 5.963   -5.598  1.225   1.00 0.00 ? 103 THR A HG23 7  
ATOM   6361  N N    . ALA A 1 40 ? 5.274   -1.793  3.139   1.00 0.00 ? 104 ALA A N    7  
ATOM   6362  C CA   . ALA A 1 40 ? 4.730   -0.745  3.938   1.00 0.00 ? 104 ALA A CA   7  
ATOM   6363  C C    . ALA A 1 40 ? 3.473   -1.205  4.609   1.00 0.00 ? 104 ALA A C    7  
ATOM   6364  O O    . ALA A 1 40 ? 2.716   -2.015  4.062   1.00 0.00 ? 104 ALA A O    7  
ATOM   6365  C CB   . ALA A 1 40 ? 4.440   0.479   3.101   1.00 0.00 ? 104 ALA A CB   7  
ATOM   6366  H H    . ALA A 1 40 ? 4.641   -2.325  2.604   1.00 0.00 ? 104 ALA A H    7  
ATOM   6367  H HA   . ALA A 1 40 ? 5.457   -0.476  4.690   1.00 0.00 ? 104 ALA A HA   7  
ATOM   6368  H HB1  . ALA A 1 40 ? 3.711   0.214   2.351   1.00 0.00 ? 104 ALA A HB1  7  
ATOM   6369  H HB2  . ALA A 1 40 ? 4.046   1.264   3.728   1.00 0.00 ? 104 ALA A HB2  7  
ATOM   6370  H HB3  . ALA A 1 40 ? 5.348   0.817   2.622   1.00 0.00 ? 104 ALA A HB3  7  
ATOM   6371  N N    . ALA A 1 41 ? 3.274   -0.720  5.784   1.00 0.00 ? 105 ALA A N    7  
ATOM   6372  C CA   . ALA A 1 41 ? 2.097   -0.980  6.532   1.00 0.00 ? 105 ALA A CA   7  
ATOM   6373  C C    . ALA A 1 41 ? 1.177   0.180   6.299   1.00 0.00 ? 105 ALA A C    7  
ATOM   6374  O O    . ALA A 1 41 ? 1.534   1.344   6.571   1.00 0.00 ? 105 ALA A O    7  
ATOM   6375  C CB   . ALA A 1 41 ? 2.437   -1.125  7.985   1.00 0.00 ? 105 ALA A CB   7  
ATOM   6376  H H    . ALA A 1 41 ? 3.949   -0.114  6.165   1.00 0.00 ? 105 ALA A H    7  
ATOM   6377  H HA   . ALA A 1 41 ? 1.641   -1.888  6.168   1.00 0.00 ? 105 ALA A HA   7  
ATOM   6378  H HB1  . ALA A 1 41 ? 2.921   -0.217  8.313   1.00 0.00 ? 105 ALA A HB1  7  
ATOM   6379  H HB2  . ALA A 1 41 ? 1.534   -1.298  8.550   1.00 0.00 ? 105 ALA A HB2  7  
ATOM   6380  H HB3  . ALA A 1 41 ? 3.104   -1.969  8.079   1.00 0.00 ? 105 ALA A HB3  7  
ATOM   6381  N N    . ILE A 1 42 ? 0.037   -0.104  5.778   1.00 0.00 ? 106 ILE A N    7  
ATOM   6382  C CA   . ILE A 1 42 ? -0.865  0.919   5.342   1.00 0.00 ? 106 ILE A CA   7  
ATOM   6383  C C    . ILE A 1 42 ? -2.226  0.758   5.980   1.00 0.00 ? 106 ILE A C    7  
ATOM   6384  O O    . ILE A 1 42 ? -2.634  -0.349  6.302   1.00 0.00 ? 106 ILE A O    7  
ATOM   6385  C CB   . ILE A 1 42 ? -0.994  0.884   3.783   1.00 0.00 ? 106 ILE A CB   7  
ATOM   6386  C CG1  . ILE A 1 42 ? -1.454  -0.503  3.290   1.00 0.00 ? 106 ILE A CG1  7  
ATOM   6387  C CG2  . ILE A 1 42 ? 0.297   1.281   3.101   1.00 0.00 ? 106 ILE A CG2  7  
ATOM   6388  C CD1  . ILE A 1 42 ? -2.912  -0.583  3.010   1.00 0.00 ? 106 ILE A CD1  7  
ATOM   6389  H H    . ILE A 1 42 ? -0.228  -1.049  5.679   1.00 0.00 ? 106 ILE A H    7  
ATOM   6390  H HA   . ILE A 1 42 ? -0.446  1.876   5.617   1.00 0.00 ? 106 ILE A HA   7  
ATOM   6391  H HB   . ILE A 1 42 ? -1.745  1.609   3.508   1.00 0.00 ? 106 ILE A HB   7  
ATOM   6392  H HG12 . ILE A 1 42 ? -0.930  -0.831  2.407   1.00 0.00 ? 106 ILE A HG12 7  
ATOM   6393  H HG13 . ILE A 1 42 ? -1.254  -1.210  4.082   1.00 0.00 ? 106 ILE A HG13 7  
ATOM   6394  H HG21 . ILE A 1 42 ? 1.079   0.593   3.385   1.00 0.00 ? 106 ILE A HG21 7  
ATOM   6395  H HG22 . ILE A 1 42 ? 0.146   1.237   2.032   1.00 0.00 ? 106 ILE A HG22 7  
ATOM   6396  H HG23 . ILE A 1 42 ? 0.562   2.286   3.394   1.00 0.00 ? 106 ILE A HG23 7  
ATOM   6397  H HD11 . ILE A 1 42 ? -3.117  0.180   2.270   1.00 0.00 ? 106 ILE A HD11 7  
ATOM   6398  H HD12 . ILE A 1 42 ? -3.160  -1.550  2.600   1.00 0.00 ? 106 ILE A HD12 7  
ATOM   6399  H HD13 . ILE A 1 42 ? -3.473  -0.387  3.911   1.00 0.00 ? 106 ILE A HD13 7  
ATOM   6400  N N    . THR A 1 43 ? -2.899  1.849   6.172   1.00 0.00 ? 107 THR A N    7  
ATOM   6401  C CA   . THR A 1 43 ? -4.227  1.852   6.702   1.00 0.00 ? 107 THR A CA   7  
ATOM   6402  C C    . THR A 1 43 ? -5.174  2.439   5.657   1.00 0.00 ? 107 THR A C    7  
ATOM   6403  O O    . THR A 1 43 ? -4.974  3.555   5.194   1.00 0.00 ? 107 THR A O    7  
ATOM   6404  C CB   . THR A 1 43 ? -4.285  2.672   8.005   1.00 0.00 ? 107 THR A CB   7  
ATOM   6405  O OG1  . THR A 1 43 ? -3.336  2.129   8.934   1.00 0.00 ? 107 THR A OG1  7  
ATOM   6406  C CG2  . THR A 1 43 ? -5.676  2.626   8.625   1.00 0.00 ? 107 THR A CG2  7  
ATOM   6407  H H    . THR A 1 43 ? -2.487  2.716   5.944   1.00 0.00 ? 107 THR A H    7  
ATOM   6408  H HA   . THR A 1 43 ? -4.513  0.832   6.911   1.00 0.00 ? 107 THR A HA   7  
ATOM   6409  H HB   . THR A 1 43 ? -4.021  3.697   7.785   1.00 0.00 ? 107 THR A HB   7  
ATOM   6410  H HG1  . THR A 1 43 ? -2.851  1.429   8.482   1.00 0.00 ? 107 THR A HG1  7  
ATOM   6411  H HG21 . THR A 1 43 ? -5.940  1.600   8.837   1.00 0.00 ? 107 THR A HG21 7  
ATOM   6412  H HG22 . THR A 1 43 ? -5.679  3.200   9.540   1.00 0.00 ? 107 THR A HG22 7  
ATOM   6413  H HG23 . THR A 1 43 ? -6.391  3.041   7.930   1.00 0.00 ? 107 THR A HG23 7  
ATOM   6414  N N    . PHE A 1 44 ? -6.176  1.675   5.286   1.00 0.00 ? 108 PHE A N    7  
ATOM   6415  C CA   . PHE A 1 44 ? -7.129  2.076   4.273   1.00 0.00 ? 108 PHE A CA   7  
ATOM   6416  C C    . PHE A 1 44 ? -7.965  3.240   4.724   1.00 0.00 ? 108 PHE A C    7  
ATOM   6417  O O    . PHE A 1 44 ? -8.573  3.202   5.806   1.00 0.00 ? 108 PHE A O    7  
ATOM   6418  C CB   . PHE A 1 44 ? -8.004  0.907   3.838   1.00 0.00 ? 108 PHE A CB   7  
ATOM   6419  C CG   . PHE A 1 44 ? -7.250  -0.106  3.040   1.00 0.00 ? 108 PHE A CG   7  
ATOM   6420  C CD1  . PHE A 1 44 ? -6.984  0.144   1.708   1.00 0.00 ? 108 PHE A CD1  7  
ATOM   6421  C CD2  . PHE A 1 44 ? -6.796  -1.292  3.611   1.00 0.00 ? 108 PHE A CD2  7  
ATOM   6422  C CE1  . PHE A 1 44 ? -6.278  -0.755  0.944   1.00 0.00 ? 108 PHE A CE1  7  
ATOM   6423  C CE2  . PHE A 1 44 ? -6.088  -2.204  2.849   1.00 0.00 ? 108 PHE A CE2  7  
ATOM   6424  C CZ   . PHE A 1 44 ? -5.826  -1.933  1.511   1.00 0.00 ? 108 PHE A CZ   7  
ATOM   6425  H H    . PHE A 1 44 ? -6.281  0.809   5.745   1.00 0.00 ? 108 PHE A H    7  
ATOM   6426  H HA   . PHE A 1 44 ? -6.555  2.400   3.419   1.00 0.00 ? 108 PHE A HA   7  
ATOM   6427  H HB2  . PHE A 1 44 ? -8.411  0.417   4.709   1.00 0.00 ? 108 PHE A HB2  7  
ATOM   6428  H HB3  . PHE A 1 44 ? -8.811  1.280   3.225   1.00 0.00 ? 108 PHE A HB3  7  
ATOM   6429  H HD1  . PHE A 1 44 ? -7.349  1.064   1.270   1.00 0.00 ? 108 PHE A HD1  7  
ATOM   6430  H HD2  . PHE A 1 44 ? -7.013  -1.511  4.649   1.00 0.00 ? 108 PHE A HD2  7  
ATOM   6431  H HE1  . PHE A 1 44 ? -6.093  -0.530  -0.096  1.00 0.00 ? 108 PHE A HE1  7  
ATOM   6432  H HE2  . PHE A 1 44 ? -5.737  -3.123  3.292   1.00 0.00 ? 108 PHE A HE2  7  
ATOM   6433  H HZ   . PHE A 1 44 ? -5.271  -2.641  0.914   1.00 0.00 ? 108 PHE A HZ   7  
ATOM   6434  N N    . ALA A 1 45 ? -8.001  4.254   3.895   1.00 0.00 ? 109 ALA A N    7  
ATOM   6435  C CA   . ALA A 1 45 ? -8.704  5.472   4.180   1.00 0.00 ? 109 ALA A CA   7  
ATOM   6436  C C    . ALA A 1 45 ? -10.192 5.229   4.103   1.00 0.00 ? 109 ALA A C    7  
ATOM   6437  O O    . ALA A 1 45 ? -10.674 4.519   3.210   1.00 0.00 ? 109 ALA A O    7  
ATOM   6438  C CB   . ALA A 1 45 ? -8.282  6.562   3.202   1.00 0.00 ? 109 ALA A CB   7  
ATOM   6439  H H    . ALA A 1 45 ? -7.567  4.169   3.015   1.00 0.00 ? 109 ALA A H    7  
ATOM   6440  H HA   . ALA A 1 45 ? -8.447  5.790   5.179   1.00 0.00 ? 109 ALA A HA   7  
ATOM   6441  H HB1  . ALA A 1 45 ? -8.507  6.249   2.193   1.00 0.00 ? 109 ALA A HB1  7  
ATOM   6442  H HB2  . ALA A 1 45 ? -8.814  7.476   3.421   1.00 0.00 ? 109 ALA A HB2  7  
ATOM   6443  H HB3  . ALA A 1 45 ? -7.218  6.734   3.289   1.00 0.00 ? 109 ALA A HB3  7  
ATOM   6444  N N    . GLY A 1 46 ? -10.906 5.743   5.060   1.00 0.00 ? 110 GLY A N    7  
ATOM   6445  C CA   . GLY A 1 46 ? -12.336 5.599   5.083   1.00 0.00 ? 110 GLY A CA   7  
ATOM   6446  C C    . GLY A 1 46 ? -12.789 4.327   5.753   1.00 0.00 ? 110 GLY A C    7  
ATOM   6447  O O    . GLY A 1 46 ? -13.670 4.356   6.598   1.00 0.00 ? 110 GLY A O    7  
ATOM   6448  H H    . GLY A 1 46 ? -10.455 6.249   5.772   1.00 0.00 ? 110 GLY A H    7  
ATOM   6449  H HA2  . GLY A 1 46 ? -12.762 6.437   5.612   1.00 0.00 ? 110 GLY A HA2  7  
ATOM   6450  H HA3  . GLY A 1 46 ? -12.703 5.605   4.068   1.00 0.00 ? 110 GLY A HA3  7  
ATOM   6451  N N    . TYR A 1 47 ? -12.198 3.219   5.377   1.00 0.00 ? 111 TYR A N    7  
ATOM   6452  C CA   . TYR A 1 47 ? -12.575 1.940   5.925   1.00 0.00 ? 111 TYR A CA   7  
ATOM   6453  C C    . TYR A 1 47 ? -11.897 1.690   7.273   1.00 0.00 ? 111 TYR A C    7  
ATOM   6454  O O    . TYR A 1 47 ? -12.548 1.306   8.230   1.00 0.00 ? 111 TYR A O    7  
ATOM   6455  C CB   . TYR A 1 47 ? -12.214 0.839   4.968   1.00 0.00 ? 111 TYR A CB   7  
ATOM   6456  C CG   . TYR A 1 47 ? -12.702 1.039   3.554   1.00 0.00 ? 111 TYR A CG   7  
ATOM   6457  C CD1  . TYR A 1 47 ? -14.011 0.761   3.195   1.00 0.00 ? 111 TYR A CD1  7  
ATOM   6458  C CD2  . TYR A 1 47 ? -11.829 1.475   2.570   1.00 0.00 ? 111 TYR A CD2  7  
ATOM   6459  C CE1  . TYR A 1 47 ? -14.435 0.912   1.889   1.00 0.00 ? 111 TYR A CE1  7  
ATOM   6460  C CE2  . TYR A 1 47 ? -12.237 1.630   1.271   1.00 0.00 ? 111 TYR A CE2  7  
ATOM   6461  C CZ   . TYR A 1 47 ? -13.545 1.343   0.932   1.00 0.00 ? 111 TYR A CZ   7  
ATOM   6462  O OH   . TYR A 1 47 ? -13.968 1.496   -0.370  1.00 0.00 ? 111 TYR A OH   7  
ATOM   6463  H H    . TYR A 1 47 ? -11.511 3.260   4.677   1.00 0.00 ? 111 TYR A H    7  
ATOM   6464  H HA   . TYR A 1 47 ? -13.647 1.937   6.066   1.00 0.00 ? 111 TYR A HA   7  
ATOM   6465  H HB2  . TYR A 1 47 ? -11.140 0.740   4.927   1.00 0.00 ? 111 TYR A HB2  7  
ATOM   6466  H HB3  . TYR A 1 47 ? -12.631 -0.088  5.333   1.00 0.00 ? 111 TYR A HB3  7  
ATOM   6467  H HD1  . TYR A 1 47 ? -14.703 0.423   3.952   1.00 0.00 ? 111 TYR A HD1  7  
ATOM   6468  H HD2  . TYR A 1 47 ? -10.807 1.698   2.836   1.00 0.00 ? 111 TYR A HD2  7  
ATOM   6469  H HE1  . TYR A 1 47 ? -15.449 0.660   1.616   1.00 0.00 ? 111 TYR A HE1  7  
ATOM   6470  H HE2  . TYR A 1 47 ? -11.519 1.966   0.537   1.00 0.00 ? 111 TYR A HE2  7  
ATOM   6471  H HH   . TYR A 1 47 ? -13.318 1.069   -0.938  1.00 0.00 ? 111 TYR A HH   7  
ATOM   6472  N N    . GLY A 1 48 ? -10.590 1.883   7.339   1.00 0.00 ? 112 GLY A N    7  
ATOM   6473  C CA   . GLY A 1 48 ? -9.893  1.712   8.603   1.00 0.00 ? 112 GLY A CA   7  
ATOM   6474  C C    . GLY A 1 48 ? -9.200  0.358   8.789   1.00 0.00 ? 112 GLY A C    7  
ATOM   6475  O O    . GLY A 1 48 ? -8.958  -0.061  9.923   1.00 0.00 ? 112 GLY A O    7  
ATOM   6476  H H    . GLY A 1 48 ? -10.091 2.182   6.549   1.00 0.00 ? 112 GLY A H    7  
ATOM   6477  H HA2  . GLY A 1 48 ? -9.146  2.486   8.689   1.00 0.00 ? 112 GLY A HA2  7  
ATOM   6478  H HA3  . GLY A 1 48 ? -10.610 1.843   9.400   1.00 0.00 ? 112 GLY A HA3  7  
ATOM   6479  N N    . ASN A 1 49 ? -8.884  -0.344  7.712   1.00 0.00 ? 113 ASN A N    7  
ATOM   6480  C CA   . ASN A 1 49 ? -8.121  -1.598  7.864   1.00 0.00 ? 113 ASN A CA   7  
ATOM   6481  C C    . ASN A 1 49 ? -6.674  -1.328  7.637   1.00 0.00 ? 113 ASN A C    7  
ATOM   6482  O O    . ASN A 1 49 ? -6.324  -0.293  7.099   1.00 0.00 ? 113 ASN A O    7  
ATOM   6483  C CB   . ASN A 1 49 ? -8.547  -2.736  6.929   1.00 0.00 ? 113 ASN A CB   7  
ATOM   6484  C CG   . ASN A 1 49 ? -9.929  -3.272  7.176   1.00 0.00 ? 113 ASN A CG   7  
ATOM   6485  O OD1  . ASN A 1 49 ? -10.473 -3.161  8.270   1.00 0.00 ? 113 ASN A OD1  7  
ATOM   6486  N ND2  . ASN A 1 49 ? -10.454 -3.933  6.196   1.00 0.00 ? 113 ASN A ND2  7  
ATOM   6487  H H    . ASN A 1 49 ? -9.143  -0.020  6.826   1.00 0.00 ? 113 ASN A H    7  
ATOM   6488  H HA   . ASN A 1 49 ? -8.246  -1.911  8.891   1.00 0.00 ? 113 ASN A HA   7  
ATOM   6489  H HB2  . ASN A 1 49 ? -8.514  -2.380  5.910   1.00 0.00 ? 113 ASN A HB2  7  
ATOM   6490  H HB3  . ASN A 1 49 ? -7.842  -3.548  7.029   1.00 0.00 ? 113 ASN A HB3  7  
ATOM   6491  H HD21 . ASN A 1 49 ? -9.911  -4.048  5.387   1.00 0.00 ? 113 ASN A HD21 7  
ATOM   6492  H HD22 . ASN A 1 49 ? -11.377 -4.248  6.260   1.00 0.00 ? 113 ASN A HD22 7  
ATOM   6493  N N    . ALA A 1 50 ? -5.842  -2.258  7.990   1.00 0.00 ? 114 ALA A N    7  
ATOM   6494  C CA   . ALA A 1 50 ? -4.422  -2.096  7.852   1.00 0.00 ? 114 ALA A CA   7  
ATOM   6495  C C    . ALA A 1 50 ? -3.807  -3.377  7.364   1.00 0.00 ? 114 ALA A C    7  
ATOM   6496  O O    . ALA A 1 50 ? -4.138  -4.460  7.871   1.00 0.00 ? 114 ALA A O    7  
ATOM   6497  C CB   . ALA A 1 50 ? -3.798  -1.685  9.180   1.00 0.00 ? 114 ALA A CB   7  
ATOM   6498  H H    . ALA A 1 50 ? -6.181  -3.113  8.336   1.00 0.00 ? 114 ALA A H    7  
ATOM   6499  H HA   . ALA A 1 50 ? -4.233  -1.315  7.130   1.00 0.00 ? 114 ALA A HA   7  
ATOM   6500  H HB1  . ALA A 1 50 ? -3.988  -2.451  9.918   1.00 0.00 ? 114 ALA A HB1  7  
ATOM   6501  H HB2  . ALA A 1 50 ? -2.731  -1.561  9.055   1.00 0.00 ? 114 ALA A HB2  7  
ATOM   6502  H HB3  . ALA A 1 50 ? -4.230  -0.752  9.508   1.00 0.00 ? 114 ALA A HB3  7  
ATOM   6503  N N    . GLU A 1 51 ? -2.947  -3.277  6.383   1.00 0.00 ? 115 GLU A N    7  
ATOM   6504  C CA   . GLU A 1 51 ? -2.255  -4.428  5.875   1.00 0.00 ? 115 GLU A CA   7  
ATOM   6505  C C    . GLU A 1 51 ? -0.843  -4.044  5.510   1.00 0.00 ? 115 GLU A C    7  
ATOM   6506  O O    . GLU A 1 51 ? -0.541  -2.852  5.360   1.00 0.00 ? 115 GLU A O    7  
ATOM   6507  C CB   . GLU A 1 51 ? -2.973  -5.091  4.674   1.00 0.00 ? 115 GLU A CB   7  
ATOM   6508  C CG   . GLU A 1 51 ? -2.889  -4.405  3.323   1.00 0.00 ? 115 GLU A CG   7  
ATOM   6509  C CD   . GLU A 1 51 ? -3.356  -5.350  2.225   1.00 0.00 ? 115 GLU A CD   7  
ATOM   6510  O OE1  . GLU A 1 51 ? -2.525  -6.137  1.716   1.00 0.00 ? 115 GLU A OE1  7  
ATOM   6511  O OE2  . GLU A 1 51 ? -4.565  -5.370  1.898   1.00 0.00 ? 115 GLU A OE2  7  
ATOM   6512  H H    . GLU A 1 51 ? -2.737  -2.392  6.008   1.00 0.00 ? 115 GLU A H    7  
ATOM   6513  H HA   . GLU A 1 51 ? -2.207  -5.136  6.689   1.00 0.00 ? 115 GLU A HA   7  
ATOM   6514  H HB2  . GLU A 1 51 ? -2.610  -6.093  4.523   1.00 0.00 ? 115 GLU A HB2  7  
ATOM   6515  H HB3  . GLU A 1 51 ? -4.024  -5.124  4.925   1.00 0.00 ? 115 GLU A HB3  7  
ATOM   6516  H HG2  . GLU A 1 51 ? -3.521  -3.531  3.333   1.00 0.00 ? 115 GLU A HG2  7  
ATOM   6517  H HG3  . GLU A 1 51 ? -1.865  -4.122  3.127   1.00 0.00 ? 115 GLU A HG3  7  
ATOM   6518  N N    . VAL A 1 52 ? 0.019   -5.018  5.419   1.00 0.00 ? 116 VAL A N    7  
ATOM   6519  C CA   . VAL A 1 52 ? 1.372   -4.789  5.009   1.00 0.00 ? 116 VAL A CA   7  
ATOM   6520  C C    . VAL A 1 52 ? 1.499   -5.245  3.577   1.00 0.00 ? 116 VAL A C    7  
ATOM   6521  O O    . VAL A 1 52 ? 1.330   -6.431  3.266   1.00 0.00 ? 116 VAL A O    7  
ATOM   6522  C CB   . VAL A 1 52 ? 2.395   -5.530  5.901   1.00 0.00 ? 116 VAL A CB   7  
ATOM   6523  C CG1  . VAL A 1 52 ? 3.821   -5.194  5.483   1.00 0.00 ? 116 VAL A CG1  7  
ATOM   6524  C CG2  . VAL A 1 52 ? 2.181   -5.180  7.356   1.00 0.00 ? 116 VAL A CG2  7  
ATOM   6525  H H    . VAL A 1 52 ? -0.264  -5.936  5.612   1.00 0.00 ? 116 VAL A H    7  
ATOM   6526  H HA   . VAL A 1 52 ? 1.556   -3.725  5.050   1.00 0.00 ? 116 VAL A HA   7  
ATOM   6527  H HB   . VAL A 1 52 ? 2.245   -6.593  5.778   1.00 0.00 ? 116 VAL A HB   7  
ATOM   6528  H HG11 . VAL A 1 52 ? 3.980   -4.130  5.575   1.00 0.00 ? 116 VAL A HG11 7  
ATOM   6529  H HG12 . VAL A 1 52 ? 4.514   -5.720  6.123   1.00 0.00 ? 116 VAL A HG12 7  
ATOM   6530  H HG13 . VAL A 1 52 ? 3.976   -5.494  4.457   1.00 0.00 ? 116 VAL A HG13 7  
ATOM   6531  H HG21 . VAL A 1 52 ? 1.172   -5.440  7.641   1.00 0.00 ? 116 VAL A HG21 7  
ATOM   6532  H HG22 . VAL A 1 52 ? 2.882   -5.736  7.961   1.00 0.00 ? 116 VAL A HG22 7  
ATOM   6533  H HG23 . VAL A 1 52 ? 2.333   -4.121  7.500   1.00 0.00 ? 116 VAL A HG23 7  
ATOM   6534  N N    . THR A 1 53 ? 1.769   -4.327  2.727   1.00 0.00 ? 117 THR A N    7  
ATOM   6535  C CA   . THR A 1 53 ? 1.818   -4.584  1.320   1.00 0.00 ? 117 THR A CA   7  
ATOM   6536  C C    . THR A 1 53 ? 3.101   -3.966  0.744   1.00 0.00 ? 117 THR A C    7  
ATOM   6537  O O    . THR A 1 53 ? 3.562   -2.928  1.243   1.00 0.00 ? 117 THR A O    7  
ATOM   6538  C CB   . THR A 1 53 ? 0.521   -4.056  0.608   1.00 0.00 ? 117 THR A CB   7  
ATOM   6539  O OG1  . THR A 1 53 ? 0.469   -4.471  -0.769  1.00 0.00 ? 117 THR A OG1  7  
ATOM   6540  C CG2  . THR A 1 53 ? 0.421   -2.545  0.689   1.00 0.00 ? 117 THR A CG2  7  
ATOM   6541  H H    . THR A 1 53 ? 1.972   -3.425  3.074   1.00 0.00 ? 117 THR A H    7  
ATOM   6542  H HA   . THR A 1 53 ? 1.878   -5.656  1.198   1.00 0.00 ? 117 THR A HA   7  
ATOM   6543  H HB   . THR A 1 53 ? -0.329  -4.486  1.118   1.00 0.00 ? 117 THR A HB   7  
ATOM   6544  H HG1  . THR A 1 53 ? -0.275  -5.081  -0.837  1.00 0.00 ? 117 THR A HG1  7  
ATOM   6545  H HG21 . THR A 1 53 ? 1.266   -2.103  0.183   1.00 0.00 ? 117 THR A HG21 7  
ATOM   6546  H HG22 . THR A 1 53 ? -0.495  -2.212  0.223   1.00 0.00 ? 117 THR A HG22 7  
ATOM   6547  H HG23 . THR A 1 53 ? 0.434   -2.241  1.725   1.00 0.00 ? 117 THR A HG23 7  
ATOM   6548  N N    . PRO A 1 54 ? 3.765   -4.642  -0.212  1.00 0.00 ? 118 PRO A N    7  
ATOM   6549  C CA   . PRO A 1 54 ? 4.996   -4.144  -0.809  1.00 0.00 ? 118 PRO A CA   7  
ATOM   6550  C C    . PRO A 1 54 ? 4.792   -2.796  -1.492  1.00 0.00 ? 118 PRO A C    7  
ATOM   6551  O O    . PRO A 1 54 ? 3.721   -2.525  -2.035  1.00 0.00 ? 118 PRO A O    7  
ATOM   6552  C CB   . PRO A 1 54 ? 5.371   -5.216  -1.837  1.00 0.00 ? 118 PRO A CB   7  
ATOM   6553  C CG   . PRO A 1 54 ? 4.115   -5.946  -2.100  1.00 0.00 ? 118 PRO A CG   7  
ATOM   6554  C CD   . PRO A 1 54 ? 3.342   -5.913  -0.817  1.00 0.00 ? 118 PRO A CD   7  
ATOM   6555  H HA   . PRO A 1 54 ? 5.783   -4.056  -0.080  1.00 0.00 ? 118 PRO A HA   7  
ATOM   6556  H HB2  . PRO A 1 54 ? 5.755   -4.747  -2.730  1.00 0.00 ? 118 PRO A HB2  7  
ATOM   6557  H HB3  . PRO A 1 54 ? 6.118   -5.876  -1.423  1.00 0.00 ? 118 PRO A HB3  7  
ATOM   6558  H HG2  . PRO A 1 54 ? 3.565   -5.447  -2.883  1.00 0.00 ? 118 PRO A HG2  7  
ATOM   6559  H HG3  . PRO A 1 54 ? 4.334   -6.962  -2.390  1.00 0.00 ? 118 PRO A HG3  7  
ATOM   6560  H HD2  . PRO A 1 54 ? 2.282   -5.900  -1.028  1.00 0.00 ? 118 PRO A HD2  7  
ATOM   6561  H HD3  . PRO A 1 54 ? 3.584   -6.752  -0.187  1.00 0.00 ? 118 PRO A HD3  7  
ATOM   6562  N N    . LEU A 1 55 ? 5.832   -1.970  -1.485  1.00 0.00 ? 119 LEU A N    7  
ATOM   6563  C CA   . LEU A 1 55 ? 5.809   -0.630  -2.091  1.00 0.00 ? 119 LEU A CA   7  
ATOM   6564  C C    . LEU A 1 55 ? 5.465   -0.707  -3.568  1.00 0.00 ? 119 LEU A C    7  
ATOM   6565  O O    . LEU A 1 55 ? 4.951   0.237   -4.143  1.00 0.00 ? 119 LEU A O    7  
ATOM   6566  C CB   . LEU A 1 55 ? 7.157   0.075   -1.916  1.00 0.00 ? 119 LEU A CB   7  
ATOM   6567  C CG   . LEU A 1 55 ? 7.684   0.240   -0.484  1.00 0.00 ? 119 LEU A CG   7  
ATOM   6568  C CD1  . LEU A 1 55 ? 8.988   1.015   -0.472  1.00 0.00 ? 119 LEU A CD1  7  
ATOM   6569  C CD2  . LEU A 1 55 ? 6.667   0.901   0.422   1.00 0.00 ? 119 LEU A CD2  7  
ATOM   6570  H H    . LEU A 1 55 ? 6.657   -2.260  -1.032  1.00 0.00 ? 119 LEU A H    7  
ATOM   6571  H HA   . LEU A 1 55 ? 5.042   -0.046  -1.606  1.00 0.00 ? 119 LEU A HA   7  
ATOM   6572  H HB2  . LEU A 1 55 ? 7.883   -0.506  -2.466  1.00 0.00 ? 119 LEU A HB2  7  
ATOM   6573  H HB3  . LEU A 1 55 ? 7.102   1.046   -2.382  1.00 0.00 ? 119 LEU A HB3  7  
ATOM   6574  H HG   . LEU A 1 55 ? 7.885   -0.752  -0.104  1.00 0.00 ? 119 LEU A HG   7  
ATOM   6575  H HD11 . LEU A 1 55 ? 8.831   1.996   -0.895  1.00 0.00 ? 119 LEU A HD11 7  
ATOM   6576  H HD12 . LEU A 1 55 ? 9.334   1.115   0.546   1.00 0.00 ? 119 LEU A HD12 7  
ATOM   6577  H HD13 . LEU A 1 55 ? 9.732   0.489   -1.052  1.00 0.00 ? 119 LEU A HD13 7  
ATOM   6578  H HD21 . LEU A 1 55 ? 5.772   0.298   0.460   1.00 0.00 ? 119 LEU A HD21 7  
ATOM   6579  H HD22 . LEU A 1 55 ? 7.090   0.981   1.413   1.00 0.00 ? 119 LEU A HD22 7  
ATOM   6580  H HD23 . LEU A 1 55 ? 6.424   1.887   0.059   1.00 0.00 ? 119 LEU A HD23 7  
ATOM   6581  N N    . LEU A 1 56 ? 5.769   -1.851  -4.164  1.00 0.00 ? 120 LEU A N    7  
ATOM   6582  C CA   . LEU A 1 56 ? 5.491   -2.114  -5.572  1.00 0.00 ? 120 LEU A CA   7  
ATOM   6583  C C    . LEU A 1 56 ? 3.973   -2.139  -5.817  1.00 0.00 ? 120 LEU A C    7  
ATOM   6584  O O    . LEU A 1 56 ? 3.493   -1.796  -6.899  1.00 0.00 ? 120 LEU A O    7  
ATOM   6585  C CB   . LEU A 1 56 ? 6.157   -3.449  -5.984  1.00 0.00 ? 120 LEU A CB   7  
ATOM   6586  C CG   . LEU A 1 56 ? 5.459   -4.755  -5.582  1.00 0.00 ? 120 LEU A CG   7  
ATOM   6587  C CD1  . LEU A 1 56 ? 4.500   -5.192  -6.672  1.00 0.00 ? 120 LEU A CD1  7  
ATOM   6588  C CD2  . LEU A 1 56 ? 6.473   -5.835  -5.286  1.00 0.00 ? 120 LEU A CD2  7  
ATOM   6589  H H    . LEU A 1 56 ? 6.203   -2.534  -3.612  1.00 0.00 ? 120 LEU A H    7  
ATOM   6590  H HA   . LEU A 1 56 ? 5.900   -1.319  -6.169  1.00 0.00 ? 120 LEU A HA   7  
ATOM   6591  H HB2  . LEU A 1 56 ? 6.263   -3.462  -7.057  1.00 0.00 ? 120 LEU A HB2  7  
ATOM   6592  H HB3  . LEU A 1 56 ? 7.142   -3.462  -5.542  1.00 0.00 ? 120 LEU A HB3  7  
ATOM   6593  H HG   . LEU A 1 56 ? 4.859   -4.582  -4.699  1.00 0.00 ? 120 LEU A HG   7  
ATOM   6594  H HD11 . LEU A 1 56 ? 3.839   -4.355  -6.851  1.00 0.00 ? 120 LEU A HD11 7  
ATOM   6595  H HD12 . LEU A 1 56 ? 5.052   -5.413  -7.574  1.00 0.00 ? 120 LEU A HD12 7  
ATOM   6596  H HD13 . LEU A 1 56 ? 3.935   -6.054  -6.350  1.00 0.00 ? 120 LEU A HD13 7  
ATOM   6597  H HD21 . LEU A 1 56 ? 7.119   -5.516  -4.482  1.00 0.00 ? 120 LEU A HD21 7  
ATOM   6598  H HD22 . LEU A 1 56 ? 5.959   -6.740  -4.997  1.00 0.00 ? 120 LEU A HD22 7  
ATOM   6599  H HD23 . LEU A 1 56 ? 7.065   -6.021  -6.170  1.00 0.00 ? 120 LEU A HD23 7  
ATOM   6600  N N    . ASN A 1 57 ? 3.239   -2.527  -4.790  1.00 0.00 ? 121 ASN A N    7  
ATOM   6601  C CA   . ASN A 1 57 ? 1.790   -2.630  -4.852  1.00 0.00 ? 121 ASN A CA   7  
ATOM   6602  C C    . ASN A 1 57 ? 1.139   -1.330  -4.489  1.00 0.00 ? 121 ASN A C    7  
ATOM   6603  O O    . ASN A 1 57 ? -0.076  -1.178  -4.626  1.00 0.00 ? 121 ASN A O    7  
ATOM   6604  C CB   . ASN A 1 57 ? 1.254   -3.751  -3.948  1.00 0.00 ? 121 ASN A CB   7  
ATOM   6605  C CG   . ASN A 1 57 ? 1.346   -5.131  -4.549  1.00 0.00 ? 121 ASN A CG   7  
ATOM   6606  O OD1  . ASN A 1 57 ? 1.327   -5.307  -5.766  1.00 0.00 ? 121 ASN A OD1  7  
ATOM   6607  N ND2  . ASN A 1 57 ? 1.375   -6.115  -3.713  1.00 0.00 ? 121 ASN A ND2  7  
ATOM   6608  H H    . ASN A 1 57 ? 3.685   -2.726  -3.939  1.00 0.00 ? 121 ASN A H    7  
ATOM   6609  H HA   . ASN A 1 57 ? 1.528   -2.863  -5.873  1.00 0.00 ? 121 ASN A HA   7  
ATOM   6610  H HB2  . ASN A 1 57 ? 1.862   -3.762  -3.057  1.00 0.00 ? 121 ASN A HB2  7  
ATOM   6611  H HB3  . ASN A 1 57 ? 0.240   -3.571  -3.641  1.00 0.00 ? 121 ASN A HB3  7  
ATOM   6612  H HD21 . ASN A 1 57 ? 1.324   -5.913  -2.755  1.00 0.00 ? 121 ASN A HD21 7  
ATOM   6613  H HD22 . ASN A 1 57 ? 1.465   -7.038  -4.036  1.00 0.00 ? 121 ASN A HD22 7  
ATOM   6614  N N    . LEU A 1 58 ? 1.929   -0.391  -4.027  1.00 0.00 ? 122 LEU A N    7  
ATOM   6615  C CA   . LEU A 1 58 ? 1.409   0.892   -3.691  1.00 0.00 ? 122 LEU A CA   7  
ATOM   6616  C C    . LEU A 1 58 ? 1.480   1.767   -4.895  1.00 0.00 ? 122 LEU A C    7  
ATOM   6617  O O    . LEU A 1 58 ? 2.507   1.861   -5.552  1.00 0.00 ? 122 LEU A O    7  
ATOM   6618  C CB   . LEU A 1 58 ? 2.178   1.515   -2.543  1.00 0.00 ? 122 LEU A CB   7  
ATOM   6619  C CG   . LEU A 1 58 ? 2.120   0.787   -1.220  1.00 0.00 ? 122 LEU A CG   7  
ATOM   6620  C CD1  . LEU A 1 58 ? 2.912   1.547   -0.176  1.00 0.00 ? 122 LEU A CD1  7  
ATOM   6621  C CD2  . LEU A 1 58 ? 0.685   0.622   -0.781  1.00 0.00 ? 122 LEU A CD2  7  
ATOM   6622  H H    . LEU A 1 58 ? 2.893   -0.544  -3.944  1.00 0.00 ? 122 LEU A H    7  
ATOM   6623  H HA   . LEU A 1 58 ? 0.375   0.774   -3.405  1.00 0.00 ? 122 LEU A HA   7  
ATOM   6624  H HB2  . LEU A 1 58 ? 3.217   1.577   -2.838  1.00 0.00 ? 122 LEU A HB2  7  
ATOM   6625  H HB3  . LEU A 1 58 ? 1.808   2.519   -2.393  1.00 0.00 ? 122 LEU A HB3  7  
ATOM   6626  H HG   . LEU A 1 58 ? 2.555   -0.193  -1.341  1.00 0.00 ? 122 LEU A HG   7  
ATOM   6627  H HD11 . LEU A 1 58 ? 2.506   2.541   -0.071  1.00 0.00 ? 122 LEU A HD11 7  
ATOM   6628  H HD12 . LEU A 1 58 ? 2.847   1.028   0.769   1.00 0.00 ? 122 LEU A HD12 7  
ATOM   6629  H HD13 . LEU A 1 58 ? 3.947   1.617   -0.481  1.00 0.00 ? 122 LEU A HD13 7  
ATOM   6630  H HD21 . LEU A 1 58 ? 0.151   0.040   -1.518  1.00 0.00 ? 122 LEU A HD21 7  
ATOM   6631  H HD22 . LEU A 1 58 ? 0.649   0.112   0.170   1.00 0.00 ? 122 LEU A HD22 7  
ATOM   6632  H HD23 . LEU A 1 58 ? 0.222   1.595   -0.697  1.00 0.00 ? 122 LEU A HD23 7  
ATOM   6633  N N    . LYS A 1 59 ? 0.396   2.386   -5.188  1.00 0.00 ? 123 LYS A N    7  
ATOM   6634  C CA   . LYS A 1 59 ? 0.284   3.212   -6.349  1.00 0.00 ? 123 LYS A CA   7  
ATOM   6635  C C    . LYS A 1 59 ? 0.058   4.637   -5.923  1.00 0.00 ? 123 LYS A C    7  
ATOM   6636  O O    . LYS A 1 59 ? -0.421  4.880   -4.805  1.00 0.00 ? 123 LYS A O    7  
ATOM   6637  C CB   . LYS A 1 59 ? -0.880  2.733   -7.237  1.00 0.00 ? 123 LYS A CB   7  
ATOM   6638  C CG   . LYS A 1 59 ? -0.909  1.238   -7.480  1.00 0.00 ? 123 LYS A CG   7  
ATOM   6639  C CD   . LYS A 1 59 ? 0.371   0.715   -8.123  1.00 0.00 ? 123 LYS A CD   7  
ATOM   6640  C CE   . LYS A 1 59 ? 0.320   -0.796  -8.246  1.00 0.00 ? 123 LYS A CE   7  
ATOM   6641  N NZ   . LYS A 1 59 ? 1.568   -1.363  -8.810  1.00 0.00 ? 123 LYS A NZ   7  
ATOM   6642  H H    . LYS A 1 59 ? -0.366  2.286   -4.575  1.00 0.00 ? 123 LYS A H    7  
ATOM   6643  H HA   . LYS A 1 59 ? 1.203   3.159   -6.911  1.00 0.00 ? 123 LYS A HA   7  
ATOM   6644  H HB2  . LYS A 1 59 ? -1.813  3.017   -6.776  1.00 0.00 ? 123 LYS A HB2  7  
ATOM   6645  H HB3  . LYS A 1 59 ? -0.816  3.224   -8.196  1.00 0.00 ? 123 LYS A HB3  7  
ATOM   6646  H HG2  . LYS A 1 59 ? -1.029  0.769   -6.515  1.00 0.00 ? 123 LYS A HG2  7  
ATOM   6647  H HG3  . LYS A 1 59 ? -1.754  1.018   -8.112  1.00 0.00 ? 123 LYS A HG3  7  
ATOM   6648  H HD2  . LYS A 1 59 ? 0.479   1.150   -9.106  1.00 0.00 ? 123 LYS A HD2  7  
ATOM   6649  H HD3  . LYS A 1 59 ? 1.216   0.989   -7.508  1.00 0.00 ? 123 LYS A HD3  7  
ATOM   6650  H HE2  . LYS A 1 59 ? 0.158   -1.209  -7.262  1.00 0.00 ? 123 LYS A HE2  7  
ATOM   6651  H HE3  . LYS A 1 59 ? -0.517  -1.061  -8.875  1.00 0.00 ? 123 LYS A HE3  7  
ATOM   6652  H HZ1  . LYS A 1 59 ? 1.796   -0.938  -9.731  1.00 0.00 ? 123 LYS A HZ1  7  
ATOM   6653  H HZ2  . LYS A 1 59 ? 2.382   -1.256  -8.167  1.00 0.00 ? 123 LYS A HZ2  7  
ATOM   6654  H HZ3  . LYS A 1 59 ? 1.433   -2.381  -8.968  1.00 0.00 ? 123 LYS A HZ3  7  
ATOM   6655  N N    . PRO A 1 60 ? 0.384   5.596   -6.780  1.00 0.00 ? 124 PRO A N    7  
ATOM   6656  C CA   . PRO A 1 60 ? 0.113   6.983   -6.503  1.00 0.00 ? 124 PRO A CA   7  
ATOM   6657  C C    . PRO A 1 60 ? -1.389  7.217   -6.533  1.00 0.00 ? 124 PRO A C    7  
ATOM   6658  O O    . PRO A 1 60 ? -2.108  6.615   -7.355  1.00 0.00 ? 124 PRO A O    7  
ATOM   6659  C CB   . PRO A 1 60 ? 0.810   7.762   -7.621  1.00 0.00 ? 124 PRO A CB   7  
ATOM   6660  C CG   . PRO A 1 60 ? 1.269   6.756   -8.634  1.00 0.00 ? 124 PRO A CG   7  
ATOM   6661  C CD   . PRO A 1 60 ? 1.015   5.380   -8.085  1.00 0.00 ? 124 PRO A CD   7  
ATOM   6662  H HA   . PRO A 1 60 ? 0.479   7.284   -5.531  1.00 0.00 ? 124 PRO A HA   7  
ATOM   6663  H HB2  . PRO A 1 60 ? 0.108   8.461   -8.046  1.00 0.00 ? 124 PRO A HB2  7  
ATOM   6664  H HB3  . PRO A 1 60 ? 1.641   8.315   -7.211  1.00 0.00 ? 124 PRO A HB3  7  
ATOM   6665  H HG2  . PRO A 1 60 ? 0.713   6.890   -9.550  1.00 0.00 ? 124 PRO A HG2  7  
ATOM   6666  H HG3  . PRO A 1 60 ? 2.322   6.893   -8.826  1.00 0.00 ? 124 PRO A HG3  7  
ATOM   6667  H HD2  . PRO A 1 60 ? 0.321   4.840   -8.709  1.00 0.00 ? 124 PRO A HD2  7  
ATOM   6668  H HD3  . PRO A 1 60 ? 1.917   4.798   -7.974  1.00 0.00 ? 124 PRO A HD3  7  
ATOM   6669  N N    . VAL A 1 61 ? -1.870  8.036   -5.638  1.00 0.00 ? 125 VAL A N    7  
ATOM   6670  C CA   . VAL A 1 61 ? -3.295  8.288   -5.534  1.00 0.00 ? 125 VAL A CA   7  
ATOM   6671  C C    . VAL A 1 61 ? -3.812  9.096   -6.685  1.00 0.00 ? 125 VAL A C    7  
ATOM   6672  O O    . VAL A 1 61 ? -3.070  9.855   -7.316  1.00 0.00 ? 125 VAL A O    7  
ATOM   6673  C CB   . VAL A 1 61 ? -3.679  8.981   -4.212  1.00 0.00 ? 125 VAL A CB   7  
ATOM   6674  C CG1  . VAL A 1 61 ? -3.369  8.089   -3.043  1.00 0.00 ? 125 VAL A CG1  7  
ATOM   6675  C CG2  . VAL A 1 61 ? -2.976  10.322  -4.071  1.00 0.00 ? 125 VAL A CG2  7  
ATOM   6676  H H    . VAL A 1 61 ? -1.248  8.494   -5.032  1.00 0.00 ? 125 VAL A H    7  
ATOM   6677  H HA   . VAL A 1 61 ? -3.800  7.335   -5.565  1.00 0.00 ? 125 VAL A HA   7  
ATOM   6678  H HB   . VAL A 1 61 ? -4.743  9.159   -4.223  1.00 0.00 ? 125 VAL A HB   7  
ATOM   6679  H HG11 . VAL A 1 61 ? -2.314  7.862   -3.034  1.00 0.00 ? 125 VAL A HG11 7  
ATOM   6680  H HG12 . VAL A 1 61 ? -3.622  8.594   -2.123  1.00 0.00 ? 125 VAL A HG12 7  
ATOM   6681  H HG13 . VAL A 1 61 ? -3.935  7.172   -3.131  1.00 0.00 ? 125 VAL A HG13 7  
ATOM   6682  H HG21 . VAL A 1 61 ? -1.912  10.177  -4.180  1.00 0.00 ? 125 VAL A HG21 7  
ATOM   6683  H HG22 . VAL A 1 61 ? -3.316  10.989  -4.850  1.00 0.00 ? 125 VAL A HG22 7  
ATOM   6684  H HG23 . VAL A 1 61 ? -3.182  10.753  -3.104  1.00 0.00 ? 125 VAL A HG23 7  
ATOM   6685  N N    . GLU A 1 62 ? -5.051  8.901   -6.984  1.00 0.00 ? 126 GLU A N    7  
ATOM   6686  C CA   . GLU A 1 62 ? -5.718  9.669   -7.971  1.00 0.00 ? 126 GLU A CA   7  
ATOM   6687  C C    . GLU A 1 62 ? -6.607  10.659  -7.310  1.00 0.00 ? 126 GLU A C    7  
ATOM   6688  O O    . GLU A 1 62 ? -7.093  10.434  -6.194  1.00 0.00 ? 126 GLU A O    7  
ATOM   6689  C CB   . GLU A 1 62 ? -6.480  8.800   -8.943  1.00 0.00 ? 126 GLU A CB   7  
ATOM   6690  C CG   . GLU A 1 62 ? -5.618  8.237   -10.040 1.00 0.00 ? 126 GLU A CG   7  
ATOM   6691  C CD   . GLU A 1 62 ? -5.113  9.323   -10.955 1.00 0.00 ? 126 GLU A CD   7  
ATOM   6692  O OE1  . GLU A 1 62 ? -5.856  9.738   -11.857 1.00 0.00 ? 126 GLU A OE1  7  
ATOM   6693  O OE2  . GLU A 1 62 ? -3.987  9.810   -10.768 1.00 0.00 ? 126 GLU A OE2  7  
ATOM   6694  H H    . GLU A 1 62 ? -5.566  8.221   -6.500  1.00 0.00 ? 126 GLU A H    7  
ATOM   6695  H HA   . GLU A 1 62 ? -4.956  10.211  -8.512  1.00 0.00 ? 126 GLU A HA   7  
ATOM   6696  H HB2  . GLU A 1 62 ? -6.937  7.982   -8.405  1.00 0.00 ? 126 GLU A HB2  7  
ATOM   6697  H HB3  . GLU A 1 62 ? -7.251  9.404   -9.397  1.00 0.00 ? 126 GLU A HB3  7  
ATOM   6698  H HG2  . GLU A 1 62 ? -4.767  7.764   -9.576  1.00 0.00 ? 126 GLU A HG2  7  
ATOM   6699  H HG3  . GLU A 1 62 ? -6.193  7.528   -10.615 1.00 0.00 ? 126 GLU A HG3  7  
ATOM   6700  N N    . GLU A 1 63 ? -6.808  11.739  -7.969  1.00 0.00 ? 127 GLU A N    7  
ATOM   6701  C CA   . GLU A 1 63 ? -7.569  12.835  -7.427  1.00 0.00 ? 127 GLU A CA   7  
ATOM   6702  C C    . GLU A 1 63 ? -8.713  13.162  -8.370  1.00 0.00 ? 127 GLU A C    7  
ATOM   6703  O O    . GLU A 1 63 ? -9.092  14.326  -8.543  1.00 0.00 ? 127 GLU A O    7  
ATOM   6704  C CB   . GLU A 1 63 ? -6.646  14.052  -7.245  1.00 0.00 ? 127 GLU A CB   7  
ATOM   6705  C CG   . GLU A 1 63 ? -5.404  13.763  -6.402  1.00 0.00 ? 127 GLU A CG   7  
ATOM   6706  C CD   . GLU A 1 63 ? -4.555  14.982  -6.156  1.00 0.00 ? 127 GLU A CD   7  
ATOM   6707  O OE1  . GLU A 1 63 ? -3.928  15.498  -7.098  1.00 0.00 ? 127 GLU A OE1  7  
ATOM   6708  O OE2  . GLU A 1 63 ? -4.505  15.462  -5.007  1.00 0.00 ? 127 GLU A OE2  7  
ATOM   6709  H H    . GLU A 1 63 ? -6.431  11.799  -8.876  1.00 0.00 ? 127 GLU A H    7  
ATOM   6710  H HA   . GLU A 1 63 ? -7.965  12.543  -6.467  1.00 0.00 ? 127 GLU A HA   7  
ATOM   6711  H HB2  . GLU A 1 63 ? -6.327  14.392  -8.219  1.00 0.00 ? 127 GLU A HB2  7  
ATOM   6712  H HB3  . GLU A 1 63 ? -7.207  14.841  -6.768  1.00 0.00 ? 127 GLU A HB3  7  
ATOM   6713  H HG2  . GLU A 1 63 ? -5.717  13.369  -5.447  1.00 0.00 ? 127 GLU A HG2  7  
ATOM   6714  H HG3  . GLU A 1 63 ? -4.807  13.021  -6.913  1.00 0.00 ? 127 GLU A HG3  7  
ATOM   6715  N N    . GLY A 1 64 ? -9.283  12.140  -8.951  1.00 0.00 ? 128 GLY A N    7  
ATOM   6716  C CA   . GLY A 1 64 ? -10.349 12.333  -9.884  1.00 0.00 ? 128 GLY A CA   7  
ATOM   6717  C C    . GLY A 1 64 ? -11.382 11.259  -9.755  1.00 0.00 ? 128 GLY A C    7  
ATOM   6718  O O    . GLY A 1 64 ? -12.314 11.412  -8.955  1.00 0.00 ? 128 GLY A O    7  
ATOM   6719  O OXT  . GLY A 1 64 ? -11.278 10.239  -10.450 1.00 0.00 ? 128 GLY A OXT  7  
ATOM   6720  H H    . GLY A 1 64 ? -9.005  11.229  -8.716  1.00 0.00 ? 128 GLY A H    7  
ATOM   6721  H HA2  . GLY A 1 64 ? -10.804 13.294  -9.699  1.00 0.00 ? 128 GLY A HA2  7  
ATOM   6722  H HA3  . GLY A 1 64 ? -9.947  12.315  -10.886 1.00 0.00 ? 128 GLY A HA3  7  
HETATM 6723  N N    . 2MR B 2 .  ? -17.839 -4.865  1.486   1.00 0.00 ? 201 2MR A N    7  
HETATM 6724  C CA   . 2MR B 2 .  ? -16.954 -4.403  0.436   1.00 0.00 ? 201 2MR A CA   7  
HETATM 6725  C CB   . 2MR B 2 .  ? -15.618 -3.943  1.015   1.00 0.00 ? 201 2MR A CB   7  
HETATM 6726  C CG   . 2MR B 2 .  ? -15.709 -2.859  2.050   1.00 0.00 ? 201 2MR A CG   7  
HETATM 6727  C CD   . 2MR B 2 .  ? -14.367 -2.618  2.683   1.00 0.00 ? 201 2MR A CD   7  
HETATM 6728  N NE   . 2MR B 2 .  ? -13.366 -2.249  1.694   1.00 0.00 ? 201 2MR A NE   7  
HETATM 6729  C CZ   . 2MR B 2 .  ? -12.109 -2.009  1.963   1.00 0.00 ? 201 2MR A CZ   7  
HETATM 6730  N NH1  . 2MR B 2 .  ? -11.692 -2.107  3.267   1.00 0.00 ? 201 2MR A NH1  7  
HETATM 6731  C CQ1  . 2MR B 2 .  ? -10.371 -1.901  3.883   1.00 0.00 ? 201 2MR A CQ1  7  
HETATM 6732  N NH2  . 2MR B 2 .  ? -11.293 -1.697  0.926   1.00 0.00 ? 201 2MR A NH2  7  
HETATM 6733  C CQ2  . 2MR B 2 .  ? -9.870  -1.378  0.884   1.00 0.00 ? 201 2MR A CQ2  7  
HETATM 6734  C C    . 2MR B 2 .  ? -16.727 -5.563  -0.494  1.00 0.00 ? 201 2MR A C    7  
HETATM 6735  O O    . 2MR B 2 .  ? -17.053 -5.470  -1.680  1.00 0.00 ? 201 2MR A O    7  
HETATM 6736  O OXT  . 2MR B 2 .  ? -16.270 -6.609  -0.024  1.00 0.00 ? 201 2MR A OXT  7  
HETATM 6737  H H2   . 2MR B 2 .  ? -18.007 -4.179  2.247   1.00 0.00 ? 201 2MR A H2   7  
HETATM 6738  H H    . 2MR B 2 .  ? -18.745 -5.151  1.063   1.00 0.00 ? 201 2MR A H    7  
HETATM 6739  H H3   . 2MR B 2 .  ? -17.421 -5.733  1.875   1.00 0.00 ? 201 2MR A H3   7  
HETATM 6740  H HA   . 2MR B 2 .  ? -17.430 -3.594  -0.099  1.00 0.00 ? 201 2MR A HA   7  
HETATM 6741  H HB2  . 2MR B 2 .  ? -15.021 -3.528  0.215   1.00 0.00 ? 201 2MR A HB2  7  
HETATM 6742  H HB3  . 2MR B 2 .  ? -15.086 -4.768  1.460   1.00 0.00 ? 201 2MR A HB3  7  
HETATM 6743  H HG2  . 2MR B 2 .  ? -16.415 -3.154  2.809   1.00 0.00 ? 201 2MR A HG2  7  
HETATM 6744  H HG3  . 2MR B 2 .  ? -16.003 -1.948  1.550   1.00 0.00 ? 201 2MR A HG3  7  
HETATM 6745  H HD2  . 2MR B 2 .  ? -14.044 -3.521  3.178   1.00 0.00 ? 201 2MR A HD2  7  
HETATM 6746  H HD3  . 2MR B 2 .  ? -14.443 -1.812  3.399   1.00 0.00 ? 201 2MR A HD3  7  
HETATM 6747  H HE   . 2MR B 2 .  ? -13.706 -2.157  0.775   1.00 0.00 ? 201 2MR A HE   7  
HETATM 6748  H HQ11 . 2MR B 2 .  ? -10.428 -2.154  4.930   1.00 0.00 ? 201 2MR A HQ11 7  
HETATM 6749  H HQ12 . 2MR B 2 .  ? -9.639  -2.530  3.398   1.00 0.00 ? 201 2MR A HQ12 7  
HETATM 6750  H HQ13 . 2MR B 2 .  ? -10.085 -0.863  3.782   1.00 0.00 ? 201 2MR A HQ13 7  
HETATM 6751  H HH2  . 2MR B 2 .  ? -11.659 -1.685  -0.003  1.00 0.00 ? 201 2MR A HH2  7  
HETATM 6752  H HQ21 . 2MR B 2 .  ? -9.298  -2.266  1.110   1.00 0.00 ? 201 2MR A HQ21 7  
HETATM 6753  H HQ22 . 2MR B 2 .  ? -9.610  -1.027  -0.104  1.00 0.00 ? 201 2MR A HQ22 7  
HETATM 6754  H HQ23 . 2MR B 2 .  ? -9.645  -0.613  1.611   1.00 0.00 ? 201 2MR A HQ23 7  
HETATM 6755  H HH1  . 2MR B 2 .  ? -12.353 -2.377  3.973   1.00 0.00 ? 201 2MR A HH1  7  
ATOM   6756  N N    . ALA A 1 1  ? 18.336  -5.161  1.730   1.00 0.00 ? 65  ALA A N    8  
ATOM   6757  C CA   . ALA A 1 1  ? 17.655  -5.411  0.468   1.00 0.00 ? 65  ALA A CA   8  
ATOM   6758  C C    . ALA A 1 1  ? 18.645  -5.250  -0.659  1.00 0.00 ? 65  ALA A C    8  
ATOM   6759  O O    . ALA A 1 1  ? 19.232  -4.173  -0.821  1.00 0.00 ? 65  ALA A O    8  
ATOM   6760  C CB   . ALA A 1 1  ? 16.492  -4.446  0.285   1.00 0.00 ? 65  ALA A CB   8  
ATOM   6761  H H1   . ALA A 1 1  ? 18.737  -4.203  1.724   1.00 0.00 ? 65  ALA A H1   8  
ATOM   6762  H H2   . ALA A 1 1  ? 17.718  -5.277  2.565   1.00 0.00 ? 65  ALA A H2   8  
ATOM   6763  H H3   . ALA A 1 1  ? 19.130  -5.819  1.841   1.00 0.00 ? 65  ALA A H3   8  
ATOM   6764  H HA   . ALA A 1 1  ? 17.272  -6.420  0.465   1.00 0.00 ? 65  ALA A HA   8  
ATOM   6765  H HB1  . ALA A 1 1  ? 16.861  -3.431  0.269   1.00 0.00 ? 65  ALA A HB1  8  
ATOM   6766  H HB2  . ALA A 1 1  ? 15.992  -4.657  -0.649  1.00 0.00 ? 65  ALA A HB2  8  
ATOM   6767  H HB3  . ALA A 1 1  ? 15.793  -4.564  1.101   1.00 0.00 ? 65  ALA A HB3  8  
ATOM   6768  N N    . SER A 1 2  ? 18.856  -6.315  -1.417  1.00 0.00 ? 66  SER A N    8  
ATOM   6769  C CA   . SER A 1 2  ? 19.769  -6.298  -2.542  1.00 0.00 ? 66  SER A CA   8  
ATOM   6770  C C    . SER A 1 2  ? 19.231  -5.366  -3.614  1.00 0.00 ? 66  SER A C    8  
ATOM   6771  O O    . SER A 1 2  ? 19.930  -4.475  -4.104  1.00 0.00 ? 66  SER A O    8  
ATOM   6772  C CB   . SER A 1 2  ? 19.890  -7.709  -3.099  1.00 0.00 ? 66  SER A CB   8  
ATOM   6773  O OG   . SER A 1 2  ? 20.201  -8.617  -2.054  1.00 0.00 ? 66  SER A OG   8  
ATOM   6774  H H    . SER A 1 2  ? 18.378  -7.152  -1.224  1.00 0.00 ? 66  SER A H    8  
ATOM   6775  H HA   . SER A 1 2  ? 20.740  -5.962  -2.209  1.00 0.00 ? 66  SER A HA   8  
ATOM   6776  H HB2  . SER A 1 2  ? 18.951  -7.987  -3.558  1.00 0.00 ? 66  SER A HB2  8  
ATOM   6777  H HB3  . SER A 1 2  ? 20.673  -7.739  -3.841  1.00 0.00 ? 66  SER A HB3  8  
ATOM   6778  H HG   . SER A 1 2  ? 20.739  -8.132  -1.416  1.00 0.00 ? 66  SER A HG   8  
ATOM   6779  N N    . THR A 1 3  ? 17.986  -5.550  -3.931  1.00 0.00 ? 67  THR A N    8  
ATOM   6780  C CA   . THR A 1 3  ? 17.330  -4.757  -4.901  1.00 0.00 ? 67  THR A CA   8  
ATOM   6781  C C    . THR A 1 3  ? 16.402  -3.813  -4.165  1.00 0.00 ? 67  THR A C    8  
ATOM   6782  O O    . THR A 1 3  ? 15.598  -4.258  -3.324  1.00 0.00 ? 67  THR A O    8  
ATOM   6783  C CB   . THR A 1 3  ? 16.505  -5.658  -5.832  1.00 0.00 ? 67  THR A CB   8  
ATOM   6784  O OG1  . THR A 1 3  ? 17.307  -6.793  -6.220  1.00 0.00 ? 67  THR A OG1  8  
ATOM   6785  C CG2  . THR A 1 3  ? 16.086  -4.904  -7.079  1.00 0.00 ? 67  THR A CG2  8  
ATOM   6786  H H    . THR A 1 3  ? 17.460  -6.243  -3.476  1.00 0.00 ? 67  THR A H    8  
ATOM   6787  H HA   . THR A 1 3  ? 18.056  -4.208  -5.481  1.00 0.00 ? 67  THR A HA   8  
ATOM   6788  H HB   . THR A 1 3  ? 15.628  -5.998  -5.303  1.00 0.00 ? 67  THR A HB   8  
ATOM   6789  H HG1  . THR A 1 3  ? 18.145  -6.441  -6.546  1.00 0.00 ? 67  THR A HG1  8  
ATOM   6790  H HG21 . THR A 1 3  ? 16.973  -4.574  -7.596  1.00 0.00 ? 67  THR A HG21 8  
ATOM   6791  H HG22 . THR A 1 3  ? 15.513  -5.559  -7.721  1.00 0.00 ? 67  THR A HG22 8  
ATOM   6792  H HG23 . THR A 1 3  ? 15.488  -4.047  -6.801  1.00 0.00 ? 67  THR A HG23 8  
ATOM   6793  N N    . GLN A 1 4  ? 16.542  -2.535  -4.417  1.00 0.00 ? 68  GLN A N    8  
ATOM   6794  C CA   . GLN A 1 4  ? 15.684  -1.559  -3.797  1.00 0.00 ? 68  GLN A CA   8  
ATOM   6795  C C    . GLN A 1 4  ? 14.251  -1.701  -4.329  1.00 0.00 ? 68  GLN A C    8  
ATOM   6796  O O    . GLN A 1 4  ? 14.047  -2.154  -5.472  1.00 0.00 ? 68  GLN A O    8  
ATOM   6797  C CB   . GLN A 1 4  ? 16.213  -0.139  -4.026  1.00 0.00 ? 68  GLN A CB   8  
ATOM   6798  C CG   . GLN A 1 4  ? 16.326  0.263   -5.480  1.00 0.00 ? 68  GLN A CG   8  
ATOM   6799  C CD   . GLN A 1 4  ? 16.826  1.676   -5.664  1.00 0.00 ? 68  GLN A CD   8  
ATOM   6800  O OE1  . GLN A 1 4  ? 17.578  2.210   -4.837  1.00 0.00 ? 68  GLN A OE1  8  
ATOM   6801  N NE2  . GLN A 1 4  ? 16.427  2.287   -6.737  1.00 0.00 ? 68  GLN A NE2  8  
ATOM   6802  H H    . GLN A 1 4  ? 17.244  -2.236  -5.036  1.00 0.00 ? 68  GLN A H    8  
ATOM   6803  H HA   . GLN A 1 4  ? 15.681  -1.768  -2.737  1.00 0.00 ? 68  GLN A HA   8  
ATOM   6804  H HB2  . GLN A 1 4  ? 15.537  0.554   -3.549  1.00 0.00 ? 68  GLN A HB2  8  
ATOM   6805  H HB3  . GLN A 1 4  ? 17.186  -0.050  -3.569  1.00 0.00 ? 68  GLN A HB3  8  
ATOM   6806  H HG2  . GLN A 1 4  ? 16.993  -0.416  -5.991  1.00 0.00 ? 68  GLN A HG2  8  
ATOM   6807  H HG3  . GLN A 1 4  ? 15.343  0.186   -5.921  1.00 0.00 ? 68  GLN A HG3  8  
ATOM   6808  H HE21 . GLN A 1 4  ? 15.832  1.800   -7.347  1.00 0.00 ? 68  GLN A HE21 8  
ATOM   6809  H HE22 . GLN A 1 4  ? 16.727  3.204   -6.913  1.00 0.00 ? 68  GLN A HE22 8  
ATOM   6810  N N    . PRO A 1 5  ? 13.251  -1.383  -3.497  1.00 0.00 ? 69  PRO A N    8  
ATOM   6811  C CA   . PRO A 1 5  ? 11.841  -1.419  -3.879  1.00 0.00 ? 69  PRO A CA   8  
ATOM   6812  C C    . PRO A 1 5  ? 11.541  -0.547  -5.095  1.00 0.00 ? 69  PRO A C    8  
ATOM   6813  O O    . PRO A 1 5  ? 12.262  0.415   -5.387  1.00 0.00 ? 69  PRO A O    8  
ATOM   6814  C CB   . PRO A 1 5  ? 11.102  -0.890  -2.645  1.00 0.00 ? 69  PRO A CB   8  
ATOM   6815  C CG   . PRO A 1 5  ? 12.155  -0.245  -1.816  1.00 0.00 ? 69  PRO A CG   8  
ATOM   6816  C CD   . PRO A 1 5  ? 13.408  -0.997  -2.095  1.00 0.00 ? 69  PRO A CD   8  
ATOM   6817  H HA   . PRO A 1 5  ? 11.517  -2.424  -4.096  1.00 0.00 ? 69  PRO A HA   8  
ATOM   6818  H HB2  . PRO A 1 5  ? 10.350  -0.180  -2.954  1.00 0.00 ? 69  PRO A HB2  8  
ATOM   6819  H HB3  . PRO A 1 5  ? 10.635  -1.711  -2.121  1.00 0.00 ? 69  PRO A HB3  8  
ATOM   6820  H HG2  . PRO A 1 5  ? 12.268  0.785   -2.115  1.00 0.00 ? 69  PRO A HG2  8  
ATOM   6821  H HG3  . PRO A 1 5  ? 11.901  -0.309  -0.768  1.00 0.00 ? 69  PRO A HG3  8  
ATOM   6822  H HD2  . PRO A 1 5  ? 14.266  -0.353  -1.963  1.00 0.00 ? 69  PRO A HD2  8  
ATOM   6823  H HD3  . PRO A 1 5  ? 13.482  -1.867  -1.460  1.00 0.00 ? 69  PRO A HD3  8  
ATOM   6824  N N    . THR A 1 6  ? 10.456  -0.860  -5.760  1.00 0.00 ? 70  THR A N    8  
ATOM   6825  C CA   . THR A 1 6  ? 10.078  -0.231  -6.993  1.00 0.00 ? 70  THR A CA   8  
ATOM   6826  C C    . THR A 1 6  ? 9.575   1.227   -6.793  1.00 0.00 ? 70  THR A C    8  
ATOM   6827  O O    . THR A 1 6  ? 9.522   2.004   -7.746  1.00 0.00 ? 70  THR A O    8  
ATOM   6828  C CB   . THR A 1 6  ? 8.964   -1.099  -7.621  1.00 0.00 ? 70  THR A CB   8  
ATOM   6829  O OG1  . THR A 1 6  ? 9.396   -2.471  -7.645  1.00 0.00 ? 70  THR A OG1  8  
ATOM   6830  C CG2  . THR A 1 6  ? 8.627   -0.667  -9.029  1.00 0.00 ? 70  THR A CG2  8  
ATOM   6831  H H    . THR A 1 6  ? 9.883   -1.597  -5.459  1.00 0.00 ? 70  THR A H    8  
ATOM   6832  H HA   . THR A 1 6  ? 10.918  -0.243  -7.668  1.00 0.00 ? 70  THR A HA   8  
ATOM   6833  H HB   . THR A 1 6  ? 8.090   -1.026  -6.992  1.00 0.00 ? 70  THR A HB   8  
ATOM   6834  H HG1  . THR A 1 6  ? 10.362  -2.479  -7.622  1.00 0.00 ? 70  THR A HG1  8  
ATOM   6835  H HG21 . THR A 1 6  ? 9.516   -0.758  -9.636  1.00 0.00 ? 70  THR A HG21 8  
ATOM   6836  H HG22 . THR A 1 6  ? 7.845   -1.300  -9.419  1.00 0.00 ? 70  THR A HG22 8  
ATOM   6837  H HG23 . THR A 1 6  ? 8.298   0.361   -9.007  1.00 0.00 ? 70  THR A HG23 8  
ATOM   6838  N N    . HIS A 1 7  ? 9.256   1.611   -5.569  1.00 0.00 ? 71  HIS A N    8  
ATOM   6839  C CA   . HIS A 1 7  ? 8.728   2.951   -5.326  1.00 0.00 ? 71  HIS A CA   8  
ATOM   6840  C C    . HIS A 1 7  ? 9.361   3.582   -4.091  1.00 0.00 ? 71  HIS A C    8  
ATOM   6841  O O    . HIS A 1 7  ? 9.928   2.873   -3.240  1.00 0.00 ? 71  HIS A O    8  
ATOM   6842  C CB   . HIS A 1 7  ? 7.199   2.935   -5.176  1.00 0.00 ? 71  HIS A CB   8  
ATOM   6843  C CG   . HIS A 1 7  ? 6.420   2.512   -6.391  1.00 0.00 ? 71  HIS A CG   8  
ATOM   6844  N ND1  . HIS A 1 7  ? 5.554   1.447   -6.415  1.00 0.00 ? 71  HIS A ND1  8  
ATOM   6845  C CD2  . HIS A 1 7  ? 6.371   3.053   -7.621  1.00 0.00 ? 71  HIS A CD2  8  
ATOM   6846  C CE1  . HIS A 1 7  ? 5.022   1.368   -7.633  1.00 0.00 ? 71  HIS A CE1  8  
ATOM   6847  N NE2  . HIS A 1 7  ? 5.486   2.325   -8.411  1.00 0.00 ? 71  HIS A NE2  8  
ATOM   6848  H H    . HIS A 1 7  ? 9.414   1.017   -4.807  1.00 0.00 ? 71  HIS A H    8  
ATOM   6849  H HA   . HIS A 1 7  ? 8.983   3.557   -6.183  1.00 0.00 ? 71  HIS A HA   8  
ATOM   6850  H HB2  . HIS A 1 7  ? 6.938   2.251   -4.383  1.00 0.00 ? 71  HIS A HB2  8  
ATOM   6851  H HB3  . HIS A 1 7  ? 6.869   3.924   -4.894  1.00 0.00 ? 71  HIS A HB3  8  
ATOM   6852  H HD1  . HIS A 1 7  ? 5.300   0.883   -5.649  1.00 0.00 ? 71  HIS A HD1  8  
ATOM   6853  H HD2  . HIS A 1 7  ? 6.919   3.927   -7.933  1.00 0.00 ? 71  HIS A HD2  8  
ATOM   6854  H HE1  . HIS A 1 7  ? 4.307   0.620   -7.939  1.00 0.00 ? 71  HIS A HE1  8  
ATOM   6855  N N    . SER A 1 8  ? 9.240   4.891   -3.988  1.00 0.00 ? 72  SER A N    8  
ATOM   6856  C CA   . SER A 1 8  ? 9.786   5.668   -2.897  1.00 0.00 ? 72  SER A CA   8  
ATOM   6857  C C    . SER A 1 8  ? 8.636   6.253   -2.066  1.00 0.00 ? 72  SER A C    8  
ATOM   6858  O O    . SER A 1 8  ? 7.931   7.157   -2.510  1.00 0.00 ? 72  SER A O    8  
ATOM   6859  C CB   . SER A 1 8  ? 10.652  6.792   -3.472  1.00 0.00 ? 72  SER A CB   8  
ATOM   6860  O OG   . SER A 1 8  ? 11.693  6.267   -4.308  1.00 0.00 ? 72  SER A OG   8  
ATOM   6861  H H    . SER A 1 8  ? 8.738   5.392   -4.669  1.00 0.00 ? 72  SER A H    8  
ATOM   6862  H HA   . SER A 1 8  ? 10.395  5.027   -2.279  1.00 0.00 ? 72  SER A HA   8  
ATOM   6863  H HB2  . SER A 1 8  ? 10.031  7.447   -4.064  1.00 0.00 ? 72  SER A HB2  8  
ATOM   6864  H HB3  . SER A 1 8  ? 11.099  7.354   -2.666  1.00 0.00 ? 72  SER A HB3  8  
ATOM   6865  H HG   . SER A 1 8  ? 12.328  5.838   -3.717  1.00 0.00 ? 72  SER A HG   8  
ATOM   6866  N N    . TRP A 1 9  ? 8.436   5.731   -0.882  1.00 0.00 ? 73  TRP A N    8  
ATOM   6867  C CA   . TRP A 1 9  ? 7.319   6.127   -0.046  1.00 0.00 ? 73  TRP A CA   8  
ATOM   6868  C C    . TRP A 1 9  ? 7.756   6.634   1.311   1.00 0.00 ? 73  TRP A C    8  
ATOM   6869  O O    . TRP A 1 9  ? 8.847   6.295   1.785   1.00 0.00 ? 73  TRP A O    8  
ATOM   6870  C CB   . TRP A 1 9  ? 6.341   4.974   0.115   1.00 0.00 ? 73  TRP A CB   8  
ATOM   6871  C CG   . TRP A 1 9  ? 5.656   4.619   -1.157  1.00 0.00 ? 73  TRP A CG   8  
ATOM   6872  C CD1  . TRP A 1 9  ? 5.941   3.583   -1.982  1.00 0.00 ? 73  TRP A CD1  8  
ATOM   6873  C CD2  . TRP A 1 9  ? 4.581   5.329   -1.764  1.00 0.00 ? 73  TRP A CD2  8  
ATOM   6874  N NE1  . TRP A 1 9  ? 5.101   3.600   -3.061  1.00 0.00 ? 73  TRP A NE1  8  
ATOM   6875  C CE2  . TRP A 1 9  ? 4.262   4.660   -2.951  1.00 0.00 ? 73  TRP A CE2  8  
ATOM   6876  C CE3  . TRP A 1 9  ? 3.854   6.466   -1.414  1.00 0.00 ? 73  TRP A CE3  8  
ATOM   6877  C CZ2  . TRP A 1 9  ? 3.257   5.083   -3.792  1.00 0.00 ? 73  TRP A CZ2  8  
ATOM   6878  C CZ3  . TRP A 1 9  ? 2.853   6.884   -2.254  1.00 0.00 ? 73  TRP A CZ3  8  
ATOM   6879  C CH2  . TRP A 1 9  ? 2.567   6.191   -3.428  1.00 0.00 ? 73  TRP A CH2  8  
ATOM   6880  H H    . TRP A 1 9  ? 9.057   5.056   -0.533  1.00 0.00 ? 73  TRP A H    8  
ATOM   6881  H HA   . TRP A 1 9  ? 6.802   6.922   -0.562  1.00 0.00 ? 73  TRP A HA   8  
ATOM   6882  H HB2  . TRP A 1 9  ? 6.871   4.104   0.472   1.00 0.00 ? 73  TRP A HB2  8  
ATOM   6883  H HB3  . TRP A 1 9  ? 5.589   5.256   0.835   1.00 0.00 ? 73  TRP A HB3  8  
ATOM   6884  H HD1  . TRP A 1 9  ? 6.720   2.859   -1.796  1.00 0.00 ? 73  TRP A HD1  8  
ATOM   6885  H HE1  . TRP A 1 9  ? 5.094   2.962   -3.808  1.00 0.00 ? 73  TRP A HE1  8  
ATOM   6886  H HE3  . TRP A 1 9  ? 4.066   7.010   -0.506  1.00 0.00 ? 73  TRP A HE3  8  
ATOM   6887  H HZ2  . TRP A 1 9  ? 3.018   4.561   -4.706  1.00 0.00 ? 73  TRP A HZ2  8  
ATOM   6888  H HZ3  . TRP A 1 9  ? 2.272   7.759   -2.006  1.00 0.00 ? 73  TRP A HZ3  8  
ATOM   6889  H HH2  . TRP A 1 9  ? 1.773   6.541   -4.067  1.00 0.00 ? 73  TRP A HH2  8  
ATOM   6890  N N    . LYS A 1 10 ? 6.954   7.501   1.901   1.00 0.00 ? 74  LYS A N    8  
ATOM   6891  C CA   . LYS A 1 10 ? 7.197   7.962   3.254   1.00 0.00 ? 74  LYS A CA   8  
ATOM   6892  C C    . LYS A 1 10 ? 5.957   7.730   4.115   1.00 0.00 ? 74  LYS A C    8  
ATOM   6893  O O    . LYS A 1 10 ? 4.854   7.555   3.592   1.00 0.00 ? 74  LYS A O    8  
ATOM   6894  C CB   . LYS A 1 10 ? 7.596   9.436   3.324   1.00 0.00 ? 74  LYS A CB   8  
ATOM   6895  C CG   . LYS A 1 10 ? 6.534   10.407  2.815   1.00 0.00 ? 74  LYS A CG   8  
ATOM   6896  C CD   . LYS A 1 10 ? 6.783   11.818  3.317   1.00 0.00 ? 74  LYS A CD   8  
ATOM   6897  C CE   . LYS A 1 10 ? 6.564   11.901  4.825   1.00 0.00 ? 74  LYS A CE   8  
ATOM   6898  N NZ   . LYS A 1 10 ? 6.801   13.248  5.367   1.00 0.00 ? 74  LYS A NZ   8  
ATOM   6899  H H    . LYS A 1 10 ? 6.159   7.836   1.432   1.00 0.00 ? 74  LYS A H    8  
ATOM   6900  H HA   . LYS A 1 10 ? 7.993   7.352   3.654   1.00 0.00 ? 74  LYS A HA   8  
ATOM   6901  H HB2  . LYS A 1 10 ? 7.826   9.670   4.351   1.00 0.00 ? 74  LYS A HB2  8  
ATOM   6902  H HB3  . LYS A 1 10 ? 8.492   9.573   2.736   1.00 0.00 ? 74  LYS A HB3  8  
ATOM   6903  H HG2  . LYS A 1 10 ? 6.550   10.416  1.736   1.00 0.00 ? 74  LYS A HG2  8  
ATOM   6904  H HG3  . LYS A 1 10 ? 5.565   10.076  3.158   1.00 0.00 ? 74  LYS A HG3  8  
ATOM   6905  H HD2  . LYS A 1 10 ? 7.807   12.081  3.097   1.00 0.00 ? 74  LYS A HD2  8  
ATOM   6906  H HD3  . LYS A 1 10 ? 6.109   12.500  2.821   1.00 0.00 ? 74  LYS A HD3  8  
ATOM   6907  H HE2  . LYS A 1 10 ? 5.544   11.624  5.040   1.00 0.00 ? 74  LYS A HE2  8  
ATOM   6908  H HE3  . LYS A 1 10 ? 7.223   11.206  5.325   1.00 0.00 ? 74  LYS A HE3  8  
ATOM   6909  H HZ1  . LYS A 1 10 ? 6.160   13.943  4.935   1.00 0.00 ? 74  LYS A HZ1  8  
ATOM   6910  H HZ2  . LYS A 1 10 ? 6.641   13.218  6.394   1.00 0.00 ? 74  LYS A HZ2  8  
ATOM   6911  H HZ3  . LYS A 1 10 ? 7.788   13.530  5.190   1.00 0.00 ? 74  LYS A HZ3  8  
ATOM   6912  N N    . VAL A 1 11 ? 6.157   7.690   5.414   1.00 0.00 ? 75  VAL A N    8  
ATOM   6913  C CA   . VAL A 1 11 ? 5.080   7.517   6.375   1.00 0.00 ? 75  VAL A CA   8  
ATOM   6914  C C    . VAL A 1 11 ? 4.115   8.710   6.325   1.00 0.00 ? 75  VAL A C    8  
ATOM   6915  O O    . VAL A 1 11 ? 4.545   9.862   6.202   1.00 0.00 ? 75  VAL A O    8  
ATOM   6916  C CB   . VAL A 1 11 ? 5.640   7.336   7.818   1.00 0.00 ? 75  VAL A CB   8  
ATOM   6917  C CG1  . VAL A 1 11 ? 4.523   7.224   8.840   1.00 0.00 ? 75  VAL A CG1  8  
ATOM   6918  C CG2  . VAL A 1 11 ? 6.526   6.107   7.888   1.00 0.00 ? 75  VAL A CG2  8  
ATOM   6919  H H    . VAL A 1 11 ? 7.068   7.801   5.762   1.00 0.00 ? 75  VAL A H    8  
ATOM   6920  H HA   . VAL A 1 11 ? 4.536   6.625   6.101   1.00 0.00 ? 75  VAL A HA   8  
ATOM   6921  H HB   . VAL A 1 11 ? 6.243   8.198   8.062   1.00 0.00 ? 75  VAL A HB   8  
ATOM   6922  H HG11 . VAL A 1 11 ? 3.902   6.373   8.604   1.00 0.00 ? 75  VAL A HG11 8  
ATOM   6923  H HG12 . VAL A 1 11 ? 4.947   7.099   9.824   1.00 0.00 ? 75  VAL A HG12 8  
ATOM   6924  H HG13 . VAL A 1 11 ? 3.927   8.123   8.813   1.00 0.00 ? 75  VAL A HG13 8  
ATOM   6925  H HG21 . VAL A 1 11 ? 7.353   6.220   7.203   1.00 0.00 ? 75  VAL A HG21 8  
ATOM   6926  H HG22 . VAL A 1 11 ? 6.901   5.984   8.893   1.00 0.00 ? 75  VAL A HG22 8  
ATOM   6927  H HG23 . VAL A 1 11 ? 5.950   5.238   7.607   1.00 0.00 ? 75  VAL A HG23 8  
ATOM   6928  N N    . GLY A 1 12 ? 2.832   8.425   6.389   1.00 0.00 ? 76  GLY A N    8  
ATOM   6929  C CA   . GLY A 1 12 ? 1.832   9.455   6.390   1.00 0.00 ? 76  GLY A CA   8  
ATOM   6930  C C    . GLY A 1 12 ? 1.479   9.929   5.010   1.00 0.00 ? 76  GLY A C    8  
ATOM   6931  O O    . GLY A 1 12 ? 0.779   10.930  4.854   1.00 0.00 ? 76  GLY A O    8  
ATOM   6932  H H    . GLY A 1 12 ? 2.539   7.489   6.473   1.00 0.00 ? 76  GLY A H    8  
ATOM   6933  H HA2  . GLY A 1 12 ? 0.941   9.064   6.859   1.00 0.00 ? 76  GLY A HA2  8  
ATOM   6934  H HA3  . GLY A 1 12 ? 2.191   10.291  6.971   1.00 0.00 ? 76  GLY A HA3  8  
ATOM   6935  N N    . ASP A 1 13 ? 1.953   9.224   4.010   1.00 0.00 ? 77  ASP A N    8  
ATOM   6936  C CA   . ASP A 1 13 ? 1.676   9.584   2.629   1.00 0.00 ? 77  ASP A CA   8  
ATOM   6937  C C    . ASP A 1 13 ? 0.436   8.882   2.210   1.00 0.00 ? 77  ASP A C    8  
ATOM   6938  O O    . ASP A 1 13 ? 0.013   7.905   2.855   1.00 0.00 ? 77  ASP A O    8  
ATOM   6939  C CB   . ASP A 1 13 ? 2.775   9.093   1.728   1.00 0.00 ? 77  ASP A CB   8  
ATOM   6940  C CG   . ASP A 1 13 ? 3.030   9.993   0.508   1.00 0.00 ? 77  ASP A CG   8  
ATOM   6941  O OD1  . ASP A 1 13 ? 2.095   10.262  -0.284  1.00 0.00 ? 77  ASP A OD1  8  
ATOM   6942  O OD2  . ASP A 1 13 ? 4.174   10.451  0.330   1.00 0.00 ? 77  ASP A OD2  8  
ATOM   6943  H H    . ASP A 1 13 ? 2.505   8.438   4.202   1.00 0.00 ? 77  ASP A H    8  
ATOM   6944  H HA   . ASP A 1 13 ? 1.577   10.654  2.532   1.00 0.00 ? 77  ASP A HA   8  
ATOM   6945  H HB2  . ASP A 1 13 ? 3.629   8.959   2.362   1.00 0.00 ? 77  ASP A HB2  8  
ATOM   6946  H HB3  . ASP A 1 13 ? 2.483   8.112   1.381   1.00 0.00 ? 77  ASP A HB3  8  
ATOM   6947  N N    . LYS A 1 14 ? -0.126  9.311   1.139   1.00 0.00 ? 78  LYS A N    8  
ATOM   6948  C CA   . LYS A 1 14 ? -1.274  8.670   0.638   1.00 0.00 ? 78  LYS A CA   8  
ATOM   6949  C C    . LYS A 1 14 ? -0.855  7.844   -0.532  1.00 0.00 ? 78  LYS A C    8  
ATOM   6950  O O    . LYS A 1 14 ? -0.169  8.316   -1.441  1.00 0.00 ? 78  LYS A O    8  
ATOM   6951  C CB   . LYS A 1 14 ? -2.338  9.664   0.203   1.00 0.00 ? 78  LYS A CB   8  
ATOM   6952  C CG   . LYS A 1 14 ? -2.778  10.634  1.268   1.00 0.00 ? 78  LYS A CG   8  
ATOM   6953  C CD   . LYS A 1 14 ? -3.496  9.972   2.423   1.00 0.00 ? 78  LYS A CD   8  
ATOM   6954  C CE   . LYS A 1 14 ? -4.042  11.043  3.352   1.00 0.00 ? 78  LYS A CE   8  
ATOM   6955  N NZ   . LYS A 1 14 ? -4.767  10.495  4.506   1.00 0.00 ? 78  LYS A NZ   8  
ATOM   6956  H H    . LYS A 1 14 ? 0.298   10.039  0.635   1.00 0.00 ? 78  LYS A H    8  
ATOM   6957  H HA   . LYS A 1 14 ? -1.660  8.038   1.421   1.00 0.00 ? 78  LYS A HA   8  
ATOM   6958  H HB2  . LYS A 1 14 ? -1.968  10.232  -0.636  1.00 0.00 ? 78  LYS A HB2  8  
ATOM   6959  H HB3  . LYS A 1 14 ? -3.204  9.105   -0.115  1.00 0.00 ? 78  LYS A HB3  8  
ATOM   6960  H HG2  . LYS A 1 14 ? -1.876  11.074  1.662   1.00 0.00 ? 78  LYS A HG2  8  
ATOM   6961  H HG3  . LYS A 1 14 ? -3.409  11.392  0.831   1.00 0.00 ? 78  LYS A HG3  8  
ATOM   6962  H HD2  . LYS A 1 14 ? -4.299  9.360   2.037   1.00 0.00 ? 78  LYS A HD2  8  
ATOM   6963  H HD3  . LYS A 1 14 ? -2.799  9.350   2.965   1.00 0.00 ? 78  LYS A HD3  8  
ATOM   6964  H HE2  . LYS A 1 14 ? -3.212  11.627  3.720   1.00 0.00 ? 78  LYS A HE2  8  
ATOM   6965  H HE3  . LYS A 1 14 ? -4.704  11.687  2.791   1.00 0.00 ? 78  LYS A HE3  8  
ATOM   6966  H HZ1  . LYS A 1 14 ? -5.517  9.838   4.205   1.00 0.00 ? 78  LYS A HZ1  8  
ATOM   6967  H HZ2  . LYS A 1 14 ? -4.111  10.033  5.175   1.00 0.00 ? 78  LYS A HZ2  8  
ATOM   6968  H HZ3  . LYS A 1 14 ? -5.213  11.279  5.023   1.00 0.00 ? 78  LYS A HZ3  8  
ATOM   6969  N N    . CYS A 1 15 ? -1.256  6.659   -0.517  1.00 0.00 ? 79  CYS A N    8  
ATOM   6970  C CA   . CYS A 1 15 ? -0.960  5.749   -1.566  1.00 0.00 ? 79  CYS A CA   8  
ATOM   6971  C C    . CYS A 1 15 ? -2.182  4.946   -1.874  1.00 0.00 ? 79  CYS A C    8  
ATOM   6972  O O    . CYS A 1 15 ? -3.217  5.111   -1.227  1.00 0.00 ? 79  CYS A O    8  
ATOM   6973  C CB   . CYS A 1 15 ? 0.171   4.830   -1.140  1.00 0.00 ? 79  CYS A CB   8  
ATOM   6974  S SG   . CYS A 1 15 ? -0.169  3.892   0.375   1.00 0.00 ? 79  CYS A SG   8  
ATOM   6975  H H    . CYS A 1 15 ? -1.778  6.372   0.266   1.00 0.00 ? 79  CYS A H    8  
ATOM   6976  H HA   . CYS A 1 15 ? -0.650  6.303   -2.439  1.00 0.00 ? 79  CYS A HA   8  
ATOM   6977  H HB2  . CYS A 1 15 ? 0.363   4.143   -1.952  1.00 0.00 ? 79  CYS A HB2  8  
ATOM   6978  H HB3  . CYS A 1 15 ? 1.054   5.429   -0.983  1.00 0.00 ? 79  CYS A HB3  8  
ATOM   6979  H HG   . CYS A 1 15 ? -1.235  4.401   0.981   1.00 0.00 ? 79  CYS A HG   8  
ATOM   6980  N N    . MET A 1 16 ? -2.100  4.126   -2.860  1.00 0.00 ? 80  MET A N    8  
ATOM   6981  C CA   . MET A 1 16 ? -3.160  3.236   -3.155  1.00 0.00 ? 80  MET A CA   8  
ATOM   6982  C C    . MET A 1 16 ? -2.615  1.862   -3.030  1.00 0.00 ? 80  MET A C    8  
ATOM   6983  O O    . MET A 1 16 ? -1.566  1.561   -3.590  1.00 0.00 ? 80  MET A O    8  
ATOM   6984  C CB   . MET A 1 16 ? -3.736  3.458   -4.553  1.00 0.00 ? 80  MET A CB   8  
ATOM   6985  C CG   . MET A 1 16 ? -4.039  4.908   -4.863  1.00 0.00 ? 80  MET A CG   8  
ATOM   6986  S SD   . MET A 1 16 ? -5.179  5.131   -6.235  1.00 0.00 ? 80  MET A SD   8  
ATOM   6987  C CE   . MET A 1 16 ? -6.655  4.392   -5.528  1.00 0.00 ? 80  MET A CE   8  
ATOM   6988  H H    . MET A 1 16 ? -1.284  4.121   -3.414  1.00 0.00 ? 80  MET A H    8  
ATOM   6989  H HA   . MET A 1 16 ? -3.934  3.379   -2.414  1.00 0.00 ? 80  MET A HA   8  
ATOM   6990  H HB2  . MET A 1 16 ? -3.031  3.086   -5.281  1.00 0.00 ? 80  MET A HB2  8  
ATOM   6991  H HB3  . MET A 1 16 ? -4.649  2.888   -4.638  1.00 0.00 ? 80  MET A HB3  8  
ATOM   6992  H HG2  . MET A 1 16 ? -4.443  5.388   -3.984  1.00 0.00 ? 80  MET A HG2  8  
ATOM   6993  H HG3  . MET A 1 16 ? -3.092  5.356   -5.127  1.00 0.00 ? 80  MET A HG3  8  
ATOM   6994  H HE1  . MET A 1 16 ? -6.895  4.882   -4.595  1.00 0.00 ? 80  MET A HE1  8  
ATOM   6995  H HE2  . MET A 1 16 ? -7.484  4.500   -6.208  1.00 0.00 ? 80  MET A HE2  8  
ATOM   6996  H HE3  . MET A 1 16 ? -6.484  3.342   -5.344  1.00 0.00 ? 80  MET A HE3  8  
ATOM   6997  N N    . ALA A 1 17 ? -3.290  1.052   -2.302  1.00 0.00 ? 81  ALA A N    8  
ATOM   6998  C CA   . ALA A 1 17 ? -2.859  -0.281  -2.050  1.00 0.00 ? 81  ALA A CA   8  
ATOM   6999  C C    . ALA A 1 17 ? -3.876  -1.222  -2.594  1.00 0.00 ? 81  ALA A C    8  
ATOM   7000  O O    . ALA A 1 17 ? -5.057  -0.879  -2.675  1.00 0.00 ? 81  ALA A O    8  
ATOM   7001  C CB   . ALA A 1 17 ? -2.705  -0.497  -0.561  1.00 0.00 ? 81  ALA A CB   8  
ATOM   7002  H H    . ALA A 1 17 ? -4.147  1.356   -1.924  1.00 0.00 ? 81  ALA A H    8  
ATOM   7003  H HA   . ALA A 1 17 ? -1.903  -0.445  -2.522  1.00 0.00 ? 81  ALA A HA   8  
ATOM   7004  H HB1  . ALA A 1 17 ? -3.650  -0.290  -0.080  1.00 0.00 ? 81  ALA A HB1  8  
ATOM   7005  H HB2  . ALA A 1 17 ? -2.420  -1.521  -0.365  1.00 0.00 ? 81  ALA A HB2  8  
ATOM   7006  H HB3  . ALA A 1 17 ? -1.955  0.175   -0.171  1.00 0.00 ? 81  ALA A HB3  8  
ATOM   7007  N N    . VAL A 1 18 ? -3.440  -2.368  -2.998  1.00 0.00 ? 82  VAL A N    8  
ATOM   7008  C CA   . VAL A 1 18 ? -4.337  -3.367  -3.486  1.00 0.00 ? 82  VAL A CA   8  
ATOM   7009  C C    . VAL A 1 18 ? -4.812  -4.180  -2.312  1.00 0.00 ? 82  VAL A C    8  
ATOM   7010  O O    . VAL A 1 18 ? -4.020  -4.841  -1.659  1.00 0.00 ? 82  VAL A O    8  
ATOM   7011  C CB   . VAL A 1 18 ? -3.665  -4.284  -4.544  1.00 0.00 ? 82  VAL A CB   8  
ATOM   7012  C CG1  . VAL A 1 18 ? -4.626  -5.364  -5.025  1.00 0.00 ? 82  VAL A CG1  8  
ATOM   7013  C CG2  . VAL A 1 18 ? -3.178  -3.456  -5.721  1.00 0.00 ? 82  VAL A CG2  8  
ATOM   7014  H H    . VAL A 1 18 ? -2.482  -2.565  -2.945  1.00 0.00 ? 82  VAL A H    8  
ATOM   7015  H HA   . VAL A 1 18 ? -5.189  -2.874  -3.929  1.00 0.00 ? 82  VAL A HA   8  
ATOM   7016  H HB   . VAL A 1 18 ? -2.810  -4.763  -4.089  1.00 0.00 ? 82  VAL A HB   8  
ATOM   7017  H HG11 . VAL A 1 18 ? -5.488  -4.904  -5.484  1.00 0.00 ? 82  VAL A HG11 8  
ATOM   7018  H HG12 . VAL A 1 18 ? -4.127  -5.995  -5.746  1.00 0.00 ? 82  VAL A HG12 8  
ATOM   7019  H HG13 . VAL A 1 18 ? -4.941  -5.964  -4.184  1.00 0.00 ? 82  VAL A HG13 8  
ATOM   7020  H HG21 . VAL A 1 18 ? -2.435  -2.748  -5.385  1.00 0.00 ? 82  VAL A HG21 8  
ATOM   7021  H HG22 . VAL A 1 18 ? -2.750  -4.109  -6.465  1.00 0.00 ? 82  VAL A HG22 8  
ATOM   7022  H HG23 . VAL A 1 18 ? -4.013  -2.922  -6.151  1.00 0.00 ? 82  VAL A HG23 8  
ATOM   7023  N N    . TRP A 1 19 ? -6.084  -4.082  -2.026  1.00 0.00 ? 83  TRP A N    8  
ATOM   7024  C CA   . TRP A 1 19 ? -6.689  -4.789  -0.935  1.00 0.00 ? 83  TRP A CA   8  
ATOM   7025  C C    . TRP A 1 19 ? -6.669  -6.210  -1.251  1.00 0.00 ? 83  TRP A C    8  
ATOM   7026  O O    . TRP A 1 19 ? -7.324  -6.673  -2.189  1.00 0.00 ? 83  TRP A O    8  
ATOM   7027  C CB   . TRP A 1 19 ? -8.113  -4.300  -0.692  1.00 0.00 ? 83  TRP A CB   8  
ATOM   7028  C CG   . TRP A 1 19 ? -8.713  -4.732  0.619   1.00 0.00 ? 83  TRP A CG   8  
ATOM   7029  C CD1  . TRP A 1 19 ? -8.060  -4.893  1.793   1.00 0.00 ? 83  TRP A CD1  8  
ATOM   7030  C CD2  . TRP A 1 19 ? -10.088 -4.999  0.894   1.00 0.00 ? 83  TRP A CD2  8  
ATOM   7031  N NE1  . TRP A 1 19 ? -8.928  -5.255  2.781   1.00 0.00 ? 83  TRP A NE1  8  
ATOM   7032  C CE2  . TRP A 1 19 ? -10.183 -5.324  2.258   1.00 0.00 ? 83  TRP A CE2  8  
ATOM   7033  C CE3  . TRP A 1 19 ? -11.243 -5.002  0.126   1.00 0.00 ? 83  TRP A CE3  8  
ATOM   7034  C CZ2  . TRP A 1 19 ? -11.390 -5.645  2.861   1.00 0.00 ? 83  TRP A CZ2  8  
ATOM   7035  C CZ3  . TRP A 1 19 ? -12.438 -5.323  0.729   1.00 0.00 ? 83  TRP A CZ3  8  
ATOM   7036  C CH2  . TRP A 1 19 ? -12.497 -5.639  2.084   1.00 0.00 ? 83  TRP A CH2  8  
ATOM   7037  H H    . TRP A 1 19 ? -6.646  -3.511  -2.595  1.00 0.00 ? 83  TRP A H    8  
ATOM   7038  H HA   . TRP A 1 19 ? -6.118  -4.755  -0.021  1.00 0.00 ? 83  TRP A HA   8  
ATOM   7039  H HB2  . TRP A 1 19 ? -8.132  -3.225  -0.750  1.00 0.00 ? 83  TRP A HB2  8  
ATOM   7040  H HB3  . TRP A 1 19 ? -8.736  -4.688  -1.484  1.00 0.00 ? 83  TRP A HB3  8  
ATOM   7041  H HD1  . TRP A 1 19 ? -6.998  -4.766  1.894   1.00 0.00 ? 83  TRP A HD1  8  
ATOM   7042  H HE1  . TRP A 1 19 ? -8.676  -5.432  3.715   1.00 0.00 ? 83  TRP A HE1  8  
ATOM   7043  H HE3  . TRP A 1 19 ? -11.211 -4.755  -0.924  1.00 0.00 ? 83  TRP A HE3  8  
ATOM   7044  H HZ2  . TRP A 1 19 ? -11.468 -5.894  3.907   1.00 0.00 ? 83  TRP A HZ2  8  
ATOM   7045  H HZ3  . TRP A 1 19 ? -13.354 -5.332  0.158   1.00 0.00 ? 83  TRP A HZ3  8  
ATOM   7046  H HH2  . TRP A 1 19 ? -13.451 -5.884  2.522   1.00 0.00 ? 83  TRP A HH2  8  
ATOM   7047  N N    . SER A 1 20 ? -5.946  -6.890  -0.456  1.00 0.00 ? 84  SER A N    8  
ATOM   7048  C CA   . SER A 1 20 ? -5.692  -8.270  -0.595  1.00 0.00 ? 84  SER A CA   8  
ATOM   7049  C C    . SER A 1 20 ? -6.966  -9.132  -0.506  1.00 0.00 ? 84  SER A C    8  
ATOM   7050  O O    . SER A 1 20 ? -6.971  -10.299 -0.905  1.00 0.00 ? 84  SER A O    8  
ATOM   7051  C CB   . SER A 1 20 ? -4.673  -8.637  0.437   1.00 0.00 ? 84  SER A CB   8  
ATOM   7052  O OG   . SER A 1 20 ? -3.453  -7.941  0.200   1.00 0.00 ? 84  SER A OG   8  
ATOM   7053  H H    . SER A 1 20 ? -5.523  -6.417  0.299   1.00 0.00 ? 84  SER A H    8  
ATOM   7054  H HA   . SER A 1 20 ? -5.241  -8.423  -1.564  1.00 0.00 ? 84  SER A HA   8  
ATOM   7055  H HB2  . SER A 1 20 ? -5.044  -8.398  1.424   1.00 0.00 ? 84  SER A HB2  8  
ATOM   7056  H HB3  . SER A 1 20 ? -4.503  -9.687  0.350   1.00 0.00 ? 84  SER A HB3  8  
ATOM   7057  H HG   . SER A 1 20 ? -3.418  -7.154  0.774   1.00 0.00 ? 84  SER A HG   8  
ATOM   7058  N N    . GLU A 1 21 ? -8.028  -8.550  0.010   1.00 0.00 ? 85  GLU A N    8  
ATOM   7059  C CA   . GLU A 1 21 ? -9.286  -9.242  0.142   1.00 0.00 ? 85  GLU A CA   8  
ATOM   7060  C C    . GLU A 1 21 ? -10.101 -9.184  -1.135  1.00 0.00 ? 85  GLU A C    8  
ATOM   7061  O O    . GLU A 1 21 ? -10.715 -10.172 -1.538  1.00 0.00 ? 85  GLU A O    8  
ATOM   7062  C CB   . GLU A 1 21 ? -10.087 -8.633  1.259   1.00 0.00 ? 85  GLU A CB   8  
ATOM   7063  C CG   . GLU A 1 21 ? -9.373  -8.633  2.580   1.00 0.00 ? 85  GLU A CG   8  
ATOM   7064  C CD   . GLU A 1 21 ? -9.006  -10.023 3.016   1.00 0.00 ? 85  GLU A CD   8  
ATOM   7065  O OE1  . GLU A 1 21 ? -9.897  -10.776 3.447   1.00 0.00 ? 85  GLU A OE1  8  
ATOM   7066  O OE2  . GLU A 1 21 ? -7.826  -10.409 2.919   1.00 0.00 ? 85  GLU A OE2  8  
ATOM   7067  H H    . GLU A 1 21 ? -7.945  -7.622  0.316   1.00 0.00 ? 85  GLU A H    8  
ATOM   7068  H HA   . GLU A 1 21 ? -9.091  -10.272 0.392   1.00 0.00 ? 85  GLU A HA   8  
ATOM   7069  H HB2  . GLU A 1 21 ? -10.318 -7.611  0.995   1.00 0.00 ? 85  GLU A HB2  8  
ATOM   7070  H HB3  . GLU A 1 21 ? -11.009 -9.183  1.360   1.00 0.00 ? 85  GLU A HB3  8  
ATOM   7071  H HG2  . GLU A 1 21 ? -8.505  -8.004  2.465   1.00 0.00 ? 85  GLU A HG2  8  
ATOM   7072  H HG3  . GLU A 1 21 ? -9.992  -8.148  3.316   1.00 0.00 ? 85  GLU A HG3  8  
ATOM   7073  N N    . ASP A 1 22 ? -10.086 -8.042  -1.781  1.00 0.00 ? 86  ASP A N    8  
ATOM   7074  C CA   . ASP A 1 22 ? -10.976 -7.821  -2.927  1.00 0.00 ? 86  ASP A CA   8  
ATOM   7075  C C    . ASP A 1 22 ? -10.212 -7.800  -4.244  1.00 0.00 ? 86  ASP A C    8  
ATOM   7076  O O    . ASP A 1 22 ? -10.786 -7.985  -5.316  1.00 0.00 ? 86  ASP A O    8  
ATOM   7077  C CB   . ASP A 1 22 ? -11.708 -6.501  -2.724  1.00 0.00 ? 86  ASP A CB   8  
ATOM   7078  C CG   . ASP A 1 22 ? -12.876 -6.290  -3.640  1.00 0.00 ? 86  ASP A CG   8  
ATOM   7079  O OD1  . ASP A 1 22 ? -13.976 -6.802  -3.331  1.00 0.00 ? 86  ASP A OD1  8  
ATOM   7080  O OD2  . ASP A 1 22 ? -12.743 -5.579  -4.641  1.00 0.00 ? 86  ASP A OD2  8  
ATOM   7081  H H    . ASP A 1 22 ? -9.468  -7.344  -1.478  1.00 0.00 ? 86  ASP A H    8  
ATOM   7082  H HA   . ASP A 1 22 ? -11.707 -8.615  -2.948  1.00 0.00 ? 86  ASP A HA   8  
ATOM   7083  H HB2  . ASP A 1 22 ? -12.079 -6.466  -1.711  1.00 0.00 ? 86  ASP A HB2  8  
ATOM   7084  H HB3  . ASP A 1 22 ? -11.005 -5.694  -2.870  1.00 0.00 ? 86  ASP A HB3  8  
ATOM   7085  N N    . GLY A 1 23 ? -8.918  -7.589  -4.159  1.00 0.00 ? 87  GLY A N    8  
ATOM   7086  C CA   . GLY A 1 23 ? -8.082  -7.568  -5.341  1.00 0.00 ? 87  GLY A CA   8  
ATOM   7087  C C    . GLY A 1 23 ? -8.070  -6.224  -6.050  1.00 0.00 ? 87  GLY A C    8  
ATOM   7088  O O    . GLY A 1 23 ? -7.548  -6.112  -7.158  1.00 0.00 ? 87  GLY A O    8  
ATOM   7089  H H    . GLY A 1 23 ? -8.495  -7.459  -3.280  1.00 0.00 ? 87  GLY A H    8  
ATOM   7090  H HA2  . GLY A 1 23 ? -7.070  -7.815  -5.055  1.00 0.00 ? 87  GLY A HA2  8  
ATOM   7091  H HA3  . GLY A 1 23 ? -8.441  -8.321  -6.028  1.00 0.00 ? 87  GLY A HA3  8  
ATOM   7092  N N    . GLN A 1 24 ? -8.631  -5.208  -5.433  1.00 0.00 ? 88  GLN A N    8  
ATOM   7093  C CA   . GLN A 1 24 ? -8.682  -3.883  -6.044  1.00 0.00 ? 88  GLN A CA   8  
ATOM   7094  C C    . GLN A 1 24 ? -7.853  -2.882  -5.281  1.00 0.00 ? 88  GLN A C    8  
ATOM   7095  O O    . GLN A 1 24 ? -7.459  -3.142  -4.152  1.00 0.00 ? 88  GLN A O    8  
ATOM   7096  C CB   . GLN A 1 24 ? -10.111 -3.410  -6.193  1.00 0.00 ? 88  GLN A CB   8  
ATOM   7097  C CG   . GLN A 1 24 ? -10.906 -4.202  -7.201  1.00 0.00 ? 88  GLN A CG   8  
ATOM   7098  C CD   . GLN A 1 24 ? -10.417 -4.031  -8.624  1.00 0.00 ? 88  GLN A CD   8  
ATOM   7099  O OE1  . GLN A 1 24 ? -10.879 -3.149  -9.345  1.00 0.00 ? 88  GLN A OE1  8  
ATOM   7100  N NE2  . GLN A 1 24 ? -9.489  -4.857  -9.043  1.00 0.00 ? 88  GLN A NE2  8  
ATOM   7101  H H    . GLN A 1 24 ? -9.005  -5.347  -4.538  1.00 0.00 ? 88  GLN A H    8  
ATOM   7102  H HA   . GLN A 1 24 ? -8.248  -3.979  -7.027  1.00 0.00 ? 88  GLN A HA   8  
ATOM   7103  H HB2  . GLN A 1 24 ? -10.601 -3.508  -5.236  1.00 0.00 ? 88  GLN A HB2  8  
ATOM   7104  H HB3  . GLN A 1 24 ? -10.117 -2.370  -6.481  1.00 0.00 ? 88  GLN A HB3  8  
ATOM   7105  H HG2  . GLN A 1 24 ? -10.872 -5.250  -6.943  1.00 0.00 ? 88  GLN A HG2  8  
ATOM   7106  H HG3  . GLN A 1 24 ? -11.920 -3.844  -7.145  1.00 0.00 ? 88  GLN A HG3  8  
ATOM   7107  H HE21 . GLN A 1 24 ? -9.149  -5.545  -8.431  1.00 0.00 ? 88  GLN A HE21 8  
ATOM   7108  H HE22 . GLN A 1 24 ? -9.165  -4.752  -9.964  1.00 0.00 ? 88  GLN A HE22 8  
ATOM   7109  N N    . CYS A 1 25 ? -7.617  -1.743  -5.879  1.00 0.00 ? 89  CYS A N    8  
ATOM   7110  C CA   . CYS A 1 25 ? -6.782  -0.723  -5.274  1.00 0.00 ? 89  CYS A CA   8  
ATOM   7111  C C    . CYS A 1 25 ? -7.626  0.325   -4.588  1.00 0.00 ? 89  CYS A C    8  
ATOM   7112  O O    . CYS A 1 25 ? -8.630  0.794   -5.137  1.00 0.00 ? 89  CYS A O    8  
ATOM   7113  C CB   . CYS A 1 25 ? -5.860  -0.082  -6.314  1.00 0.00 ? 89  CYS A CB   8  
ATOM   7114  S SG   . CYS A 1 25 ? -6.719  0.702   -7.698  1.00 0.00 ? 89  CYS A SG   8  
ATOM   7115  H H    . CYS A 1 25 ? -8.036  -1.575  -6.750  1.00 0.00 ? 89  CYS A H    8  
ATOM   7116  H HA   . CYS A 1 25 ? -6.172  -1.202  -4.523  1.00 0.00 ? 89  CYS A HA   8  
ATOM   7117  H HB2  . CYS A 1 25 ? -5.246  0.670   -5.841  1.00 0.00 ? 89  CYS A HB2  8  
ATOM   7118  H HB3  . CYS A 1 25 ? -5.217  -0.851  -6.716  1.00 0.00 ? 89  CYS A HB3  8  
ATOM   7119  H HG   . CYS A 1 25 ? -7.905  1.067   -7.226  1.00 0.00 ? 89  CYS A HG   8  
ATOM   7120  N N    . TYR A 1 26 ? -7.230  0.672   -3.391  1.00 0.00 ? 90  TYR A N    8  
ATOM   7121  C CA   . TYR A 1 26 ? -7.936  1.627   -2.583  1.00 0.00 ? 90  TYR A CA   8  
ATOM   7122  C C    . TYR A 1 26 ? -6.939  2.571   -1.953  1.00 0.00 ? 90  TYR A C    8  
ATOM   7123  O O    . TYR A 1 26 ? -5.759  2.229   -1.808  1.00 0.00 ? 90  TYR A O    8  
ATOM   7124  C CB   . TYR A 1 26 ? -8.745  0.914   -1.495  1.00 0.00 ? 90  TYR A CB   8  
ATOM   7125  C CG   . TYR A 1 26 ? -9.810  -0.034  -2.019  1.00 0.00 ? 90  TYR A CG   8  
ATOM   7126  C CD1  . TYR A 1 26 ? -9.478  -1.318  -2.432  1.00 0.00 ? 90  TYR A CD1  8  
ATOM   7127  C CD2  . TYR A 1 26 ? -11.137 0.349   -2.095  1.00 0.00 ? 90  TYR A CD2  8  
ATOM   7128  C CE1  . TYR A 1 26 ? -10.426 -2.184  -2.905  1.00 0.00 ? 90  TYR A CE1  8  
ATOM   7129  C CE2  . TYR A 1 26 ? -12.098 -0.521  -2.569  1.00 0.00 ? 90  TYR A CE2  8  
ATOM   7130  C CZ   . TYR A 1 26 ? -11.732 -1.786  -2.971  1.00 0.00 ? 90  TYR A CZ   8  
ATOM   7131  O OH   . TYR A 1 26 ? -12.683 -2.655  -3.450  1.00 0.00 ? 90  TYR A OH   8  
ATOM   7132  H H    . TYR A 1 26 ? -6.412  0.267   -3.019  1.00 0.00 ? 90  TYR A H    8  
ATOM   7133  H HA   . TYR A 1 26 ? -8.609  2.182   -3.218  1.00 0.00 ? 90  TYR A HA   8  
ATOM   7134  H HB2  . TYR A 1 26 ? -8.064  0.333   -0.892  1.00 0.00 ? 90  TYR A HB2  8  
ATOM   7135  H HB3  . TYR A 1 26 ? -9.223  1.648   -0.863  1.00 0.00 ? 90  TYR A HB3  8  
ATOM   7136  H HD1  . TYR A 1 26 ? -8.447  -1.638  -2.377  1.00 0.00 ? 90  TYR A HD1  8  
ATOM   7137  H HD2  . TYR A 1 26 ? -11.420 1.342   -1.778  1.00 0.00 ? 90  TYR A HD2  8  
ATOM   7138  H HE1  . TYR A 1 26 ? -10.133 -3.172  -3.227  1.00 0.00 ? 90  TYR A HE1  8  
ATOM   7139  H HE2  . TYR A 1 26 ? -13.134 -0.214  -2.614  1.00 0.00 ? 90  TYR A HE2  8  
ATOM   7140  H HH   . TYR A 1 26 ? -12.550 -3.535  -3.082  1.00 0.00 ? 90  TYR A HH   8  
ATOM   7141  N N    . GLU A 1 27 ? -7.405  3.730   -1.590  1.00 0.00 ? 91  GLU A N    8  
ATOM   7142  C CA   . GLU A 1 27 ? -6.581  4.775   -1.028  1.00 0.00 ? 91  GLU A CA   8  
ATOM   7143  C C    . GLU A 1 27 ? -6.239  4.436   0.422   1.00 0.00 ? 91  GLU A C    8  
ATOM   7144  O O    . GLU A 1 27 ? -7.120  4.108   1.226   1.00 0.00 ? 91  GLU A O    8  
ATOM   7145  C CB   . GLU A 1 27 ? -7.327  6.097   -1.128  1.00 0.00 ? 91  GLU A CB   8  
ATOM   7146  C CG   . GLU A 1 27 ? -6.526  7.322   -0.751  1.00 0.00 ? 91  GLU A CG   8  
ATOM   7147  C CD   . GLU A 1 27 ? -7.340  8.573   -0.915  1.00 0.00 ? 91  GLU A CD   8  
ATOM   7148  O OE1  . GLU A 1 27 ? -7.541  9.022   -2.061  1.00 0.00 ? 91  GLU A OE1  8  
ATOM   7149  O OE2  . GLU A 1 27 ? -7.830  9.124   0.101   1.00 0.00 ? 91  GLU A OE2  8  
ATOM   7150  H H    . GLU A 1 27 ? -8.366  3.889   -1.680  1.00 0.00 ? 91  GLU A H    8  
ATOM   7151  H HA   . GLU A 1 27 ? -5.670  4.836   -1.606  1.00 0.00 ? 91  GLU A HA   8  
ATOM   7152  H HB2  . GLU A 1 27 ? -7.672  6.223   -2.143  1.00 0.00 ? 91  GLU A HB2  8  
ATOM   7153  H HB3  . GLU A 1 27 ? -8.189  6.043   -0.478  1.00 0.00 ? 91  GLU A HB3  8  
ATOM   7154  H HG2  . GLU A 1 27 ? -6.215  7.239   0.281   1.00 0.00 ? 91  GLU A HG2  8  
ATOM   7155  H HG3  . GLU A 1 27 ? -5.656  7.386   -1.387  1.00 0.00 ? 91  GLU A HG3  8  
ATOM   7156  N N    . ALA A 1 28 ? -4.980  4.500   0.742   1.00 0.00 ? 92  ALA A N    8  
ATOM   7157  C CA   . ALA A 1 28 ? -4.494  4.128   2.034   1.00 0.00 ? 92  ALA A CA   8  
ATOM   7158  C C    . ALA A 1 28 ? -3.365  5.032   2.443   1.00 0.00 ? 92  ALA A C    8  
ATOM   7159  O O    . ALA A 1 28 ? -2.649  5.567   1.592   1.00 0.00 ? 92  ALA A O    8  
ATOM   7160  C CB   . ALA A 1 28 ? -4.012  2.695   1.989   1.00 0.00 ? 92  ALA A CB   8  
ATOM   7161  H H    . ALA A 1 28 ? -4.328  4.836   0.082   1.00 0.00 ? 92  ALA A H    8  
ATOM   7162  H HA   . ALA A 1 28 ? -5.289  4.192   2.763   1.00 0.00 ? 92  ALA A HA   8  
ATOM   7163  H HB1  . ALA A 1 28 ? -3.200  2.611   1.281   1.00 0.00 ? 92  ALA A HB1  8  
ATOM   7164  H HB2  . ALA A 1 28 ? -3.668  2.403   2.971   1.00 0.00 ? 92  ALA A HB2  8  
ATOM   7165  H HB3  . ALA A 1 28 ? -4.823  2.052   1.686   1.00 0.00 ? 92  ALA A HB3  8  
ATOM   7166  N N    . GLU A 1 29 ? -3.191  5.198   3.712   1.00 0.00 ? 93  GLU A N    8  
ATOM   7167  C CA   . GLU A 1 29 ? -2.127  6.004   4.221   1.00 0.00 ? 93  GLU A CA   8  
ATOM   7168  C C    . GLU A 1 29 ? -1.096  5.085   4.834   1.00 0.00 ? 93  GLU A C    8  
ATOM   7169  O O    . GLU A 1 29 ? -1.449  4.111   5.513   1.00 0.00 ? 93  GLU A O    8  
ATOM   7170  C CB   . GLU A 1 29 ? -2.643  7.005   5.248   1.00 0.00 ? 93  GLU A CB   8  
ATOM   7171  C CG   . GLU A 1 29 ? -1.594  7.996   5.740   1.00 0.00 ? 93  GLU A CG   8  
ATOM   7172  C CD   . GLU A 1 29 ? -2.158  8.942   6.766   1.00 0.00 ? 93  GLU A CD   8  
ATOM   7173  O OE1  . GLU A 1 29 ? -2.986  9.804   6.407   1.00 0.00 ? 93  GLU A OE1  8  
ATOM   7174  O OE2  . GLU A 1 29 ? -1.818  8.819   7.959   1.00 0.00 ? 93  GLU A OE2  8  
ATOM   7175  H H    . GLU A 1 29 ? -3.783  4.728   4.344   1.00 0.00 ? 93  GLU A H    8  
ATOM   7176  H HA   . GLU A 1 29 ? -1.680  6.531   3.390   1.00 0.00 ? 93  GLU A HA   8  
ATOM   7177  H HB2  . GLU A 1 29 ? -3.452  7.567   4.806   1.00 0.00 ? 93  GLU A HB2  8  
ATOM   7178  H HB3  . GLU A 1 29 ? -3.021  6.461   6.099   1.00 0.00 ? 93  GLU A HB3  8  
ATOM   7179  H HG2  . GLU A 1 29 ? -0.777  7.439   6.177   1.00 0.00 ? 93  GLU A HG2  8  
ATOM   7180  H HG3  . GLU A 1 29 ? -1.193  8.560   4.908   1.00 0.00 ? 93  GLU A HG3  8  
ATOM   7181  N N    . ILE A 1 30 ? 0.138   5.344   4.546   1.00 0.00 ? 94  ILE A N    8  
ATOM   7182  C CA   . ILE A 1 30 ? 1.236   4.539   5.047   1.00 0.00 ? 94  ILE A CA   8  
ATOM   7183  C C    . ILE A 1 30 ? 1.509   4.832   6.507   1.00 0.00 ? 94  ILE A C    8  
ATOM   7184  O O    . ILE A 1 30 ? 1.767   5.963   6.881   1.00 0.00 ? 94  ILE A O    8  
ATOM   7185  C CB   . ILE A 1 30 ? 2.509   4.781   4.235   1.00 0.00 ? 94  ILE A CB   8  
ATOM   7186  C CG1  . ILE A 1 30 ? 2.220   4.497   2.773   1.00 0.00 ? 94  ILE A CG1  8  
ATOM   7187  C CG2  . ILE A 1 30 ? 3.634   3.882   4.746   1.00 0.00 ? 94  ILE A CG2  8  
ATOM   7188  C CD1  . ILE A 1 30 ? 3.296   4.942   1.834   1.00 0.00 ? 94  ILE A CD1  8  
ATOM   7189  H H    . ILE A 1 30 ? 0.310   6.108   3.952   1.00 0.00 ? 94  ILE A H    8  
ATOM   7190  H HA   . ILE A 1 30 ? 0.962   3.499   4.954   1.00 0.00 ? 94  ILE A HA   8  
ATOM   7191  H HB   . ILE A 1 30 ? 2.805   5.813   4.342   1.00 0.00 ? 94  ILE A HB   8  
ATOM   7192  H HG12 . ILE A 1 30 ? 2.109   3.431   2.647   1.00 0.00 ? 94  ILE A HG12 8  
ATOM   7193  H HG13 . ILE A 1 30 ? 1.295   4.985   2.507   1.00 0.00 ? 94  ILE A HG13 8  
ATOM   7194  H HG21 . ILE A 1 30 ? 3.308   2.853   4.702   1.00 0.00 ? 94  ILE A HG21 8  
ATOM   7195  H HG22 . ILE A 1 30 ? 4.520   4.013   4.142   1.00 0.00 ? 94  ILE A HG22 8  
ATOM   7196  H HG23 . ILE A 1 30 ? 3.849   4.135   5.774   1.00 0.00 ? 94  ILE A HG23 8  
ATOM   7197  H HD11 . ILE A 1 30 ? 4.207   4.413   2.072   1.00 0.00 ? 94  ILE A HD11 8  
ATOM   7198  H HD12 . ILE A 1 30 ? 3.001   4.719   0.819   1.00 0.00 ? 94  ILE A HD12 8  
ATOM   7199  H HD13 . ILE A 1 30 ? 3.446   6.005   1.942   1.00 0.00 ? 94  ILE A HD13 8  
ATOM   7200  N N    . GLU A 1 31 ? 1.482   3.801   7.293   1.00 0.00 ? 95  GLU A N    8  
ATOM   7201  C CA   . GLU A 1 31 ? 1.700   3.889   8.718   1.00 0.00 ? 95  GLU A CA   8  
ATOM   7202  C C    . GLU A 1 31 ? 3.171   3.707   9.054   1.00 0.00 ? 95  GLU A C    8  
ATOM   7203  O O    . GLU A 1 31 ? 3.701   4.372   9.944   1.00 0.00 ? 95  GLU A O    8  
ATOM   7204  C CB   . GLU A 1 31 ? 0.888   2.818   9.414   1.00 0.00 ? 95  GLU A CB   8  
ATOM   7205  C CG   . GLU A 1 31 ? -0.600  2.982   9.261   1.00 0.00 ? 95  GLU A CG   8  
ATOM   7206  C CD   . GLU A 1 31 ? -1.130  4.164   10.027  1.00 0.00 ? 95  GLU A CD   8  
ATOM   7207  O OE1  . GLU A 1 31 ? -1.126  5.282   9.505   1.00 0.00 ? 95  GLU A OE1  8  
ATOM   7208  O OE2  . GLU A 1 31 ? -1.574  3.991   11.189  1.00 0.00 ? 95  GLU A OE2  8  
ATOM   7209  H H    . GLU A 1 31 ? 1.312   2.919   6.890   1.00 0.00 ? 95  GLU A H    8  
ATOM   7210  H HA   . GLU A 1 31 ? 1.362   4.855   9.060   1.00 0.00 ? 95  GLU A HA   8  
ATOM   7211  H HB2  . GLU A 1 31 ? 1.168   1.851   9.026   1.00 0.00 ? 95  GLU A HB2  8  
ATOM   7212  H HB3  . GLU A 1 31 ? 1.118   2.860   10.467  1.00 0.00 ? 95  GLU A HB3  8  
ATOM   7213  H HG2  . GLU A 1 31 ? -0.824  3.122   8.213   1.00 0.00 ? 95  GLU A HG2  8  
ATOM   7214  H HG3  . GLU A 1 31 ? -1.087  2.085   9.610   1.00 0.00 ? 95  GLU A HG3  8  
ATOM   7215  N N    . GLU A 1 32 ? 3.824   2.808   8.352   1.00 0.00 ? 96  GLU A N    8  
ATOM   7216  C CA   . GLU A 1 32 ? 5.223   2.523   8.577   1.00 0.00 ? 96  GLU A CA   8  
ATOM   7217  C C    . GLU A 1 32 ? 5.771   1.796   7.370   1.00 0.00 ? 96  GLU A C    8  
ATOM   7218  O O    . GLU A 1 32 ? 5.025   1.132   6.666   1.00 0.00 ? 96  GLU A O    8  
ATOM   7219  C CB   . GLU A 1 32 ? 5.421   1.679   9.850   1.00 0.00 ? 96  GLU A CB   8  
ATOM   7220  C CG   . GLU A 1 32 ? 6.875   1.417   10.170  1.00 0.00 ? 96  GLU A CG   8  
ATOM   7221  C CD   . GLU A 1 32 ? 7.087   0.613   11.412  1.00 0.00 ? 96  GLU A CD   8  
ATOM   7222  O OE1  . GLU A 1 32 ? 7.078   1.184   12.519  1.00 0.00 ? 96  GLU A OE1  8  
ATOM   7223  O OE2  . GLU A 1 32 ? 7.302   -0.605  11.300  1.00 0.00 ? 96  GLU A OE2  8  
ATOM   7224  H H    . GLU A 1 32 ? 3.366   2.314   7.638   1.00 0.00 ? 96  GLU A H    8  
ATOM   7225  H HA   . GLU A 1 32 ? 5.749   3.460   8.682   1.00 0.00 ? 96  GLU A HA   8  
ATOM   7226  H HB2  . GLU A 1 32 ? 4.970   2.194   10.685  1.00 0.00 ? 96  GLU A HB2  8  
ATOM   7227  H HB3  . GLU A 1 32 ? 4.927   0.728   9.711   1.00 0.00 ? 96  GLU A HB3  8  
ATOM   7228  H HG2  . GLU A 1 32 ? 7.268   0.859   9.331   1.00 0.00 ? 96  GLU A HG2  8  
ATOM   7229  H HG3  . GLU A 1 32 ? 7.395   2.360   10.248  1.00 0.00 ? 96  GLU A HG3  8  
ATOM   7230  N N    . ILE A 1 33 ? 7.046   1.949   7.122   1.00 0.00 ? 97  ILE A N    8  
ATOM   7231  C CA   . ILE A 1 33 ? 7.705   1.345   5.995   1.00 0.00 ? 97  ILE A CA   8  
ATOM   7232  C C    . ILE A 1 33 ? 8.832   0.440   6.476   1.00 0.00 ? 97  ILE A C    8  
ATOM   7233  O O    . ILE A 1 33 ? 9.506   0.734   7.477   1.00 0.00 ? 97  ILE A O    8  
ATOM   7234  C CB   . ILE A 1 33 ? 8.282   2.463   5.099   1.00 0.00 ? 97  ILE A CB   8  
ATOM   7235  C CG1  . ILE A 1 33 ? 7.155   3.366   4.657   1.00 0.00 ? 97  ILE A CG1  8  
ATOM   7236  C CG2  . ILE A 1 33 ? 9.016   1.899   3.878   1.00 0.00 ? 97  ILE A CG2  8  
ATOM   7237  C CD1  . ILE A 1 33 ? 7.605   4.692   4.213   1.00 0.00 ? 97  ILE A CD1  8  
ATOM   7238  H H    . ILE A 1 33 ? 7.601   2.499   7.715   1.00 0.00 ? 97  ILE A H    8  
ATOM   7239  H HA   . ILE A 1 33 ? 6.988   0.779   5.420   1.00 0.00 ? 97  ILE A HA   8  
ATOM   7240  H HB   . ILE A 1 33 ? 8.979   3.048   5.682   1.00 0.00 ? 97  ILE A HB   8  
ATOM   7241  H HG12 . ILE A 1 33 ? 6.650   2.924   3.812   1.00 0.00 ? 97  ILE A HG12 8  
ATOM   7242  H HG13 . ILE A 1 33 ? 6.462   3.496   5.474   1.00 0.00 ? 97  ILE A HG13 8  
ATOM   7243  H HG21 . ILE A 1 33 ? 8.335   1.301   3.291   1.00 0.00 ? 97  ILE A HG21 8  
ATOM   7244  H HG22 . ILE A 1 33 ? 9.385   2.720   3.280   1.00 0.00 ? 97  ILE A HG22 8  
ATOM   7245  H HG23 . ILE A 1 33 ? 9.846   1.289   4.205   1.00 0.00 ? 97  ILE A HG23 8  
ATOM   7246  H HD11 . ILE A 1 33 ? 8.334   4.596   3.422   1.00 0.00 ? 97  ILE A HD11 8  
ATOM   7247  H HD12 . ILE A 1 33 ? 6.749   5.258   3.879   1.00 0.00 ? 97  ILE A HD12 8  
ATOM   7248  H HD13 . ILE A 1 33 ? 8.037   5.188   5.069   1.00 0.00 ? 97  ILE A HD13 8  
ATOM   7249  N N    . ASP A 1 34 ? 8.995   -0.652  5.804   1.00 0.00 ? 98  ASP A N    8  
ATOM   7250  C CA   . ASP A 1 34 ? 10.066  -1.578  6.031   1.00 0.00 ? 98  ASP A CA   8  
ATOM   7251  C C    . ASP A 1 34 ? 10.854  -1.644  4.756   1.00 0.00 ? 98  ASP A C    8  
ATOM   7252  O O    . ASP A 1 34 ? 10.503  -2.362  3.831   1.00 0.00 ? 98  ASP A O    8  
ATOM   7253  C CB   . ASP A 1 34 ? 9.539   -2.966  6.384   1.00 0.00 ? 98  ASP A CB   8  
ATOM   7254  C CG   . ASP A 1 34 ? 10.649  -3.939  6.701   1.00 0.00 ? 98  ASP A CG   8  
ATOM   7255  O OD1  . ASP A 1 34 ? 11.285  -4.454  5.778   1.00 0.00 ? 98  ASP A OD1  8  
ATOM   7256  O OD2  . ASP A 1 34 ? 10.910  -4.190  7.905   1.00 0.00 ? 98  ASP A OD2  8  
ATOM   7257  H H    . ASP A 1 34 ? 8.366   -0.859  5.073   1.00 0.00 ? 98  ASP A H    8  
ATOM   7258  H HA   . ASP A 1 34 ? 10.724  -1.223  6.811   1.00 0.00 ? 98  ASP A HA   8  
ATOM   7259  H HB2  . ASP A 1 34 ? 8.884   -2.896  7.239   1.00 0.00 ? 98  ASP A HB2  8  
ATOM   7260  H HB3  . ASP A 1 34 ? 8.978   -3.349  5.544   1.00 0.00 ? 98  ASP A HB3  8  
ATOM   7261  N N    . GLU A 1 35 ? 11.867  -0.831  4.675   1.00 0.00 ? 99  GLU A N    8  
ATOM   7262  C CA   . GLU A 1 35 ? 12.702  -0.735  3.487   1.00 0.00 ? 99  GLU A CA   8  
ATOM   7263  C C    . GLU A 1 35 ? 13.481  -2.011  3.210   1.00 0.00 ? 99  GLU A C    8  
ATOM   7264  O O    . GLU A 1 35 ? 13.956  -2.214  2.095   1.00 0.00 ? 99  GLU A O    8  
ATOM   7265  C CB   . GLU A 1 35 ? 13.644  0.439   3.598   1.00 0.00 ? 99  GLU A CB   8  
ATOM   7266  C CG   . GLU A 1 35 ? 12.944  1.774   3.678   1.00 0.00 ? 99  GLU A CG   8  
ATOM   7267  C CD   . GLU A 1 35 ? 13.913  2.904   3.773   1.00 0.00 ? 99  GLU A CD   8  
ATOM   7268  O OE1  . GLU A 1 35 ? 14.333  3.429   2.724   1.00 0.00 ? 99  GLU A OE1  8  
ATOM   7269  O OE2  . GLU A 1 35 ? 14.273  3.297   4.905   1.00 0.00 ? 99  GLU A OE2  8  
ATOM   7270  H H    . GLU A 1 35 ? 12.066  -0.250  5.440   1.00 0.00 ? 99  GLU A H    8  
ATOM   7271  H HA   . GLU A 1 35 ? 12.043  -0.556  2.651   1.00 0.00 ? 99  GLU A HA   8  
ATOM   7272  H HB2  . GLU A 1 35 ? 14.236  0.311   4.491   1.00 0.00 ? 99  GLU A HB2  8  
ATOM   7273  H HB3  . GLU A 1 35 ? 14.300  0.445   2.741   1.00 0.00 ? 99  GLU A HB3  8  
ATOM   7274  H HG2  . GLU A 1 35 ? 12.342  1.906   2.791   1.00 0.00 ? 99  GLU A HG2  8  
ATOM   7275  H HG3  . GLU A 1 35 ? 12.306  1.784   4.549   1.00 0.00 ? 99  GLU A HG3  8  
ATOM   7276  N N    . GLU A 1 36 ? 13.596  -2.858  4.215   1.00 0.00 ? 100 GLU A N    8  
ATOM   7277  C CA   . GLU A 1 36 ? 14.356  -4.088  4.118   1.00 0.00 ? 100 GLU A CA   8  
ATOM   7278  C C    . GLU A 1 36 ? 13.657  -5.063  3.166   1.00 0.00 ? 100 GLU A C    8  
ATOM   7279  O O    . GLU A 1 36 ? 14.287  -5.699  2.317   1.00 0.00 ? 100 GLU A O    8  
ATOM   7280  C CB   . GLU A 1 36 ? 14.459  -4.704  5.511   1.00 0.00 ? 100 GLU A CB   8  
ATOM   7281  C CG   . GLU A 1 36 ? 15.387  -5.899  5.596   1.00 0.00 ? 100 GLU A CG   8  
ATOM   7282  C CD   . GLU A 1 36 ? 16.790  -5.546  5.202   1.00 0.00 ? 100 GLU A CD   8  
ATOM   7283  O OE1  . GLU A 1 36 ? 17.560  -5.059  6.066   1.00 0.00 ? 100 GLU A OE1  8  
ATOM   7284  O OE2  . GLU A 1 36 ? 17.151  -5.716  4.030   1.00 0.00 ? 100 GLU A OE2  8  
ATOM   7285  H H    . GLU A 1 36 ? 13.125  -2.665  5.053   1.00 0.00 ? 100 GLU A H    8  
ATOM   7286  H HA   . GLU A 1 36 ? 15.349  -3.865  3.758   1.00 0.00 ? 100 GLU A HA   8  
ATOM   7287  H HB2  . GLU A 1 36 ? 14.755  -3.942  6.216   1.00 0.00 ? 100 GLU A HB2  8  
ATOM   7288  H HB3  . GLU A 1 36 ? 13.467  -5.034  5.787   1.00 0.00 ? 100 GLU A HB3  8  
ATOM   7289  H HG2  . GLU A 1 36 ? 15.393  -6.265  6.612   1.00 0.00 ? 100 GLU A HG2  8  
ATOM   7290  H HG3  . GLU A 1 36 ? 15.024  -6.671  4.935   1.00 0.00 ? 100 GLU A HG3  8  
ATOM   7291  N N    . ASN A 1 37 ? 12.359  -5.154  3.297   1.00 0.00 ? 101 ASN A N    8  
ATOM   7292  C CA   . ASN A 1 37 ? 11.561  -6.005  2.423   1.00 0.00 ? 101 ASN A CA   8  
ATOM   7293  C C    . ASN A 1 37 ? 10.957  -5.187  1.334   1.00 0.00 ? 101 ASN A C    8  
ATOM   7294  O O    . ASN A 1 37 ? 10.464  -5.719  0.334   1.00 0.00 ? 101 ASN A O    8  
ATOM   7295  C CB   . ASN A 1 37 ? 10.435  -6.680  3.196   1.00 0.00 ? 101 ASN A CB   8  
ATOM   7296  C CG   . ASN A 1 37 ? 10.918  -7.624  4.257   1.00 0.00 ? 101 ASN A CG   8  
ATOM   7297  O OD1  . ASN A 1 37 ? 11.095  -8.818  4.009   1.00 0.00 ? 101 ASN A OD1  8  
ATOM   7298  N ND2  . ASN A 1 37 ? 11.156  -7.111  5.420   1.00 0.00 ? 101 ASN A ND2  8  
ATOM   7299  H H    . ASN A 1 37 ? 11.928  -4.673  4.044   1.00 0.00 ? 101 ASN A H    8  
ATOM   7300  H HA   . ASN A 1 37 ? 12.193  -6.769  1.996   1.00 0.00 ? 101 ASN A HA   8  
ATOM   7301  H HB2  . ASN A 1 37 ? 9.818   -5.926  3.662   1.00 0.00 ? 101 ASN A HB2  8  
ATOM   7302  H HB3  . ASN A 1 37 ? 9.840   -7.236  2.487   1.00 0.00 ? 101 ASN A HB3  8  
ATOM   7303  H HD21 . ASN A 1 37 ? 11.008  -6.135  5.526   1.00 0.00 ? 101 ASN A HD21 8  
ATOM   7304  H HD22 . ASN A 1 37 ? 11.473  -7.682  6.152   1.00 0.00 ? 101 ASN A HD22 8  
ATOM   7305  N N    . GLY A 1 38 ? 11.003  -3.891  1.519   1.00 0.00 ? 102 GLY A N    8  
ATOM   7306  C CA   . GLY A 1 38 ? 10.378  -2.999  0.606   1.00 0.00 ? 102 GLY A CA   8  
ATOM   7307  C C    . GLY A 1 38 ? 8.890   -3.039  0.810   1.00 0.00 ? 102 GLY A C    8  
ATOM   7308  O O    . GLY A 1 38 ? 8.121   -2.975  -0.138  1.00 0.00 ? 102 GLY A O    8  
ATOM   7309  H H    . GLY A 1 38 ? 11.464  -3.547  2.312   1.00 0.00 ? 102 GLY A H    8  
ATOM   7310  H HA2  . GLY A 1 38 ? 10.744  -1.997  0.778   1.00 0.00 ? 102 GLY A HA2  8  
ATOM   7311  H HA3  . GLY A 1 38 ? 10.599  -3.298  -0.408  1.00 0.00 ? 102 GLY A HA3  8  
ATOM   7312  N N    . THR A 1 39 ? 8.486   -3.188  2.045   1.00 0.00 ? 103 THR A N    8  
ATOM   7313  C CA   . THR A 1 39 ? 7.101   -3.268  2.388   1.00 0.00 ? 103 THR A CA   8  
ATOM   7314  C C    . THR A 1 39 ? 6.668   -2.079  3.215   1.00 0.00 ? 103 THR A C    8  
ATOM   7315  O O    . THR A 1 39 ? 7.500   -1.312  3.700   1.00 0.00 ? 103 THR A O    8  
ATOM   7316  C CB   . THR A 1 39 ? 6.807   -4.585  3.128   1.00 0.00 ? 103 THR A CB   8  
ATOM   7317  O OG1  . THR A 1 39 ? 7.793   -4.784  4.157   1.00 0.00 ? 103 THR A OG1  8  
ATOM   7318  C CG2  . THR A 1 39 ? 6.829   -5.765  2.168   1.00 0.00 ? 103 THR A CG2  8  
ATOM   7319  H H    . THR A 1 39 ? 9.131   -3.249  2.789   1.00 0.00 ? 103 THR A H    8  
ATOM   7320  H HA   . THR A 1 39 ? 6.523   -3.252  1.482   1.00 0.00 ? 103 THR A HA   8  
ATOM   7321  H HB   . THR A 1 39 ? 5.826   -4.502  3.572   1.00 0.00 ? 103 THR A HB   8  
ATOM   7322  H HG1  . THR A 1 39 ? 7.444   -5.345  4.860   1.00 0.00 ? 103 THR A HG1  8  
ATOM   7323  H HG21 . THR A 1 39 ? 7.798   -5.819  1.696   1.00 0.00 ? 103 THR A HG21 8  
ATOM   7324  H HG22 . THR A 1 39 ? 6.638   -6.679  2.710   1.00 0.00 ? 103 THR A HG22 8  
ATOM   7325  H HG23 . THR A 1 39 ? 6.070   -5.625  1.412   1.00 0.00 ? 103 THR A HG23 8  
ATOM   7326  N N    . ALA A 1 40 ? 5.385   -1.886  3.317   1.00 0.00 ? 104 ALA A N    8  
ATOM   7327  C CA   . ALA A 1 40 ? 4.837   -0.848  4.125   1.00 0.00 ? 104 ALA A CA   8  
ATOM   7328  C C    . ALA A 1 40 ? 3.552   -1.310  4.749   1.00 0.00 ? 104 ALA A C    8  
ATOM   7329  O O    . ALA A 1 40 ? 2.801   -2.094  4.156   1.00 0.00 ? 104 ALA A O    8  
ATOM   7330  C CB   . ALA A 1 40 ? 4.589   0.399   3.305   1.00 0.00 ? 104 ALA A CB   8  
ATOM   7331  H H    . ALA A 1 40 ? 4.752   -2.440  2.805   1.00 0.00 ? 104 ALA A H    8  
ATOM   7332  H HA   . ALA A 1 40 ? 5.547   -0.610  4.903   1.00 0.00 ? 104 ALA A HA   8  
ATOM   7333  H HB1  . ALA A 1 40 ? 3.880   0.176   2.523   1.00 0.00 ? 104 ALA A HB1  8  
ATOM   7334  H HB2  . ALA A 1 40 ? 4.189   1.172   3.943   1.00 0.00 ? 104 ALA A HB2  8  
ATOM   7335  H HB3  . ALA A 1 40 ? 5.517   0.736   2.870   1.00 0.00 ? 104 ALA A HB3  8  
ATOM   7336  N N    . ALA A 1 41 ? 3.325   -0.872  5.943   1.00 0.00 ? 105 ALA A N    8  
ATOM   7337  C CA   . ALA A 1 41 ? 2.098   -1.126  6.615   1.00 0.00 ? 105 ALA A CA   8  
ATOM   7338  C C    . ALA A 1 41 ? 1.209   0.044   6.322   1.00 0.00 ? 105 ALA A C    8  
ATOM   7339  O O    . ALA A 1 41 ? 1.597   1.195   6.555   1.00 0.00 ? 105 ALA A O    8  
ATOM   7340  C CB   . ALA A 1 41 ? 2.336   -1.264  8.092   1.00 0.00 ? 105 ALA A CB   8  
ATOM   7341  H H    . ALA A 1 41 ? 4.007   -0.319  6.391   1.00 0.00 ? 105 ALA A H    8  
ATOM   7342  H HA   . ALA A 1 41 ? 1.660   -2.032  6.223   1.00 0.00 ? 105 ALA A HA   8  
ATOM   7343  H HB1  . ALA A 1 41 ? 2.813   -0.365  8.450   1.00 0.00 ? 105 ALA A HB1  8  
ATOM   7344  H HB2  . ALA A 1 41 ? 1.390   -1.406  8.592   1.00 0.00 ? 105 ALA A HB2  8  
ATOM   7345  H HB3  . ALA A 1 41 ? 2.973   -2.121  8.254   1.00 0.00 ? 105 ALA A HB3  8  
ATOM   7346  N N    . ILE A 1 42 ? 0.064   -0.214  5.790   1.00 0.00 ? 106 ILE A N    8  
ATOM   7347  C CA   . ILE A 1 42 ? -0.808  0.843   5.346   1.00 0.00 ? 106 ILE A CA   8  
ATOM   7348  C C    . ILE A 1 42 ? -2.172  0.714   5.975   1.00 0.00 ? 106 ILE A C    8  
ATOM   7349  O O    . ILE A 1 42 ? -2.565  -0.370  6.379   1.00 0.00 ? 106 ILE A O    8  
ATOM   7350  C CB   . ILE A 1 42 ? -0.941  0.825   3.791   1.00 0.00 ? 106 ILE A CB   8  
ATOM   7351  C CG1  . ILE A 1 42 ? -1.502  -0.518  3.293   1.00 0.00 ? 106 ILE A CG1  8  
ATOM   7352  C CG2  . ILE A 1 42 ? 0.381   1.132   3.115   1.00 0.00 ? 106 ILE A CG2  8  
ATOM   7353  C CD1  . ILE A 1 42 ? -2.961  -0.469  2.969   1.00 0.00 ? 106 ILE A CD1  8  
ATOM   7354  H H    . ILE A 1 42 ? -0.221  -1.152  5.691   1.00 0.00 ? 106 ILE A H    8  
ATOM   7355  H HA   . ILE A 1 42 ? -0.370  1.788   5.631   1.00 0.00 ? 106 ILE A HA   8  
ATOM   7356  H HB   . ILE A 1 42 ? -1.637  1.608   3.524   1.00 0.00 ? 106 ILE A HB   8  
ATOM   7357  H HG12 . ILE A 1 42 ? -0.977  -0.895  2.430   1.00 0.00 ? 106 ILE A HG12 8  
ATOM   7358  H HG13 . ILE A 1 42 ? -1.387  -1.232  4.095   1.00 0.00 ? 106 ILE A HG13 8  
ATOM   7359  H HG21 . ILE A 1 42 ? 1.112   0.388   3.395   1.00 0.00 ? 106 ILE A HG21 8  
ATOM   7360  H HG22 . ILE A 1 42 ? 0.233   1.113   2.045   1.00 0.00 ? 106 ILE A HG22 8  
ATOM   7361  H HG23 . ILE A 1 42 ? 0.719   2.111   3.418   1.00 0.00 ? 106 ILE A HG23 8  
ATOM   7362  H HD11 . ILE A 1 42 ? -3.089  0.294   2.211   1.00 0.00 ? 106 ILE A HD11 8  
ATOM   7363  H HD12 . ILE A 1 42 ? -3.284  -1.421  2.574   1.00 0.00 ? 106 ILE A HD12 8  
ATOM   7364  H HD13 . ILE A 1 42 ? -3.525  -0.210  3.852   1.00 0.00 ? 106 ILE A HD13 8  
ATOM   7365  N N    . THR A 1 43 ? -2.866  1.807   6.083   1.00 0.00 ? 107 THR A N    8  
ATOM   7366  C CA   . THR A 1 43 ? -4.202  1.818   6.583   1.00 0.00 ? 107 THR A CA   8  
ATOM   7367  C C    . THR A 1 43 ? -5.134  2.446   5.560   1.00 0.00 ? 107 THR A C    8  
ATOM   7368  O O    . THR A 1 43 ? -4.917  3.572   5.118   1.00 0.00 ? 107 THR A O    8  
ATOM   7369  C CB   . THR A 1 43 ? -4.269  2.538   7.940   1.00 0.00 ? 107 THR A CB   8  
ATOM   7370  O OG1  . THR A 1 43 ? -3.431  1.823   8.853   1.00 0.00 ? 107 THR A OG1  8  
ATOM   7371  C CG2  . THR A 1 43 ? -5.688  2.577   8.491   1.00 0.00 ? 107 THR A CG2  8  
ATOM   7372  H H    . THR A 1 43 ? -2.469  2.669   5.814   1.00 0.00 ? 107 THR A H    8  
ATOM   7373  H HA   . THR A 1 43 ? -4.498  0.788   6.723   1.00 0.00 ? 107 THR A HA   8  
ATOM   7374  H HB   . THR A 1 43 ? -3.890  3.543   7.823   1.00 0.00 ? 107 THR A HB   8  
ATOM   7375  H HG1  . THR A 1 43 ? -2.979  1.149   8.331   1.00 0.00 ? 107 THR A HG1  8  
ATOM   7376  H HG21 . THR A 1 43 ? -6.055  1.568   8.614   1.00 0.00 ? 107 THR A HG21 8  
ATOM   7377  H HG22 . THR A 1 43 ? -5.684  3.081   9.446   1.00 0.00 ? 107 THR A HG22 8  
ATOM   7378  H HG23 . THR A 1 43 ? -6.325  3.113   7.803   1.00 0.00 ? 107 THR A HG23 8  
ATOM   7379  N N    . PHE A 1 44 ? -6.138  1.691   5.174   1.00 0.00 ? 108 PHE A N    8  
ATOM   7380  C CA   . PHE A 1 44 ? -7.105  2.097   4.182   1.00 0.00 ? 108 PHE A CA   8  
ATOM   7381  C C    . PHE A 1 44 ? -7.939  3.255   4.664   1.00 0.00 ? 108 PHE A C    8  
ATOM   7382  O O    . PHE A 1 44 ? -8.594  3.161   5.707   1.00 0.00 ? 108 PHE A O    8  
ATOM   7383  C CB   . PHE A 1 44 ? -7.979  0.920   3.763   1.00 0.00 ? 108 PHE A CB   8  
ATOM   7384  C CG   . PHE A 1 44 ? -7.232  -0.096  2.954   1.00 0.00 ? 108 PHE A CG   8  
ATOM   7385  C CD1  . PHE A 1 44 ? -6.926  0.185   1.634   1.00 0.00 ? 108 PHE A CD1  8  
ATOM   7386  C CD2  . PHE A 1 44 ? -6.813  -1.314  3.502   1.00 0.00 ? 108 PHE A CD2  8  
ATOM   7387  C CE1  . PHE A 1 44 ? -6.225  -0.717  0.860   1.00 0.00 ? 108 PHE A CE1  8  
ATOM   7388  C CE2  . PHE A 1 44 ? -6.104  -2.215  2.729   1.00 0.00 ? 108 PHE A CE2  8  
ATOM   7389  C CZ   . PHE A 1 44 ? -5.809  -1.916  1.407   1.00 0.00 ? 108 PHE A CZ   8  
ATOM   7390  H H    . PHE A 1 44 ? -6.234  0.817   5.615   1.00 0.00 ? 108 PHE A H    8  
ATOM   7391  H HA   . PHE A 1 44 ? -6.548  2.424   3.320   1.00 0.00 ? 108 PHE A HA   8  
ATOM   7392  H HB2  . PHE A 1 44 ? -8.364  0.430   4.646   1.00 0.00 ? 108 PHE A HB2  8  
ATOM   7393  H HB3  . PHE A 1 44 ? -8.800  1.285   3.167   1.00 0.00 ? 108 PHE A HB3  8  
ATOM   7394  H HD1  . PHE A 1 44 ? -7.271  1.122   1.217   1.00 0.00 ? 108 PHE A HD1  8  
ATOM   7395  H HD2  . PHE A 1 44 ? -7.048  -1.575  4.526   1.00 0.00 ? 108 PHE A HD2  8  
ATOM   7396  H HE1  . PHE A 1 44 ? -5.999  -0.479  -0.169  1.00 0.00 ? 108 PHE A HE1  8  
ATOM   7397  H HE2  . PHE A 1 44 ? -5.783  -3.154  3.154   1.00 0.00 ? 108 PHE A HE2  8  
ATOM   7398  H HZ   . PHE A 1 44 ? -5.255  -2.619  0.804   1.00 0.00 ? 108 PHE A HZ   8  
ATOM   7399  N N    . ALA A 1 45 ? -7.926  4.320   3.892   1.00 0.00 ? 109 ALA A N    8  
ATOM   7400  C CA   . ALA A 1 45 ? -8.601  5.544   4.240   1.00 0.00 ? 109 ALA A CA   8  
ATOM   7401  C C    . ALA A 1 45 ? -10.097 5.342   4.254   1.00 0.00 ? 109 ALA A C    8  
ATOM   7402  O O    . ALA A 1 45 ? -10.671 4.760   3.318   1.00 0.00 ? 109 ALA A O    8  
ATOM   7403  C CB   . ALA A 1 45 ? -8.221  6.652   3.271   1.00 0.00 ? 109 ALA A CB   8  
ATOM   7404  H H    . ALA A 1 45 ? -7.469  4.268   3.021   1.00 0.00 ? 109 ALA A H    8  
ATOM   7405  H HA   . ALA A 1 45 ? -8.273  5.832   5.227   1.00 0.00 ? 109 ALA A HA   8  
ATOM   7406  H HB1  . ALA A 1 45 ? -8.538  6.383   2.275   1.00 0.00 ? 109 ALA A HB1  8  
ATOM   7407  H HB2  . ALA A 1 45 ? -8.703  7.571   3.570   1.00 0.00 ? 109 ALA A HB2  8  
ATOM   7408  H HB3  . ALA A 1 45 ? -7.149  6.786   3.281   1.00 0.00 ? 109 ALA A HB3  8  
ATOM   7409  N N    . GLY A 1 46 ? -10.713 5.756   5.325   1.00 0.00 ? 110 GLY A N    8  
ATOM   7410  C CA   . GLY A 1 46 ? -12.137 5.643   5.453   1.00 0.00 ? 110 GLY A CA   8  
ATOM   7411  C C    . GLY A 1 46 ? -12.533 4.348   6.109   1.00 0.00 ? 110 GLY A C    8  
ATOM   7412  O O    . GLY A 1 46 ? -13.149 4.349   7.179   1.00 0.00 ? 110 GLY A O    8  
ATOM   7413  H H    . GLY A 1 46 ? -10.183 6.133   6.062   1.00 0.00 ? 110 GLY A H    8  
ATOM   7414  H HA2  . GLY A 1 46 ? -12.505 6.467   6.046   1.00 0.00 ? 110 GLY A HA2  8  
ATOM   7415  H HA3  . GLY A 1 46 ? -12.584 5.686   4.471   1.00 0.00 ? 110 GLY A HA3  8  
ATOM   7416  N N    . TYR A 1 47 ? -12.160 3.242   5.490   1.00 0.00 ? 111 TYR A N    8  
ATOM   7417  C CA   . TYR A 1 47 ? -12.491 1.930   5.990   1.00 0.00 ? 111 TYR A CA   8  
ATOM   7418  C C    . TYR A 1 47 ? -11.761 1.663   7.308   1.00 0.00 ? 111 TYR A C    8  
ATOM   7419  O O    . TYR A 1 47 ? -12.351 1.199   8.275   1.00 0.00 ? 111 TYR A O    8  
ATOM   7420  C CB   . TYR A 1 47 ? -12.096 0.878   4.987   1.00 0.00 ? 111 TYR A CB   8  
ATOM   7421  C CG   . TYR A 1 47 ? -12.612 1.075   3.572   1.00 0.00 ? 111 TYR A CG   8  
ATOM   7422  C CD1  . TYR A 1 47 ? -13.908 0.713   3.213   1.00 0.00 ? 111 TYR A CD1  8  
ATOM   7423  C CD2  . TYR A 1 47 ? -11.770 1.562   2.582   1.00 0.00 ? 111 TYR A CD2  8  
ATOM   7424  C CE1  . TYR A 1 47 ? -14.350 0.839   1.904   1.00 0.00 ? 111 TYR A CE1  8  
ATOM   7425  C CE2  . TYR A 1 47 ? -12.194 1.700   1.281   1.00 0.00 ? 111 TYR A CE2  8  
ATOM   7426  C CZ   . TYR A 1 47 ? -13.492 1.334   0.941   1.00 0.00 ? 111 TYR A CZ   8  
ATOM   7427  O OH   . TYR A 1 47 ? -13.937 1.461   -0.364  1.00 0.00 ? 111 TYR A OH   8  
ATOM   7428  H H    . TYR A 1 47 ? -11.649 3.310   4.653   1.00 0.00 ? 111 TYR A H    8  
ATOM   7429  H HA   . TYR A 1 47 ? -13.557 1.884   6.149   1.00 0.00 ? 111 TYR A HA   8  
ATOM   7430  H HB2  . TYR A 1 47 ? -11.017 0.852   4.932   1.00 0.00 ? 111 TYR A HB2  8  
ATOM   7431  H HB3  . TYR A 1 47 ? -12.444 -0.083  5.337   1.00 0.00 ? 111 TYR A HB3  8  
ATOM   7432  H HD1  . TYR A 1 47 ? -14.575 0.333   3.972   1.00 0.00 ? 111 TYR A HD1  8  
ATOM   7433  H HD2  . TYR A 1 47 ? -10.763 1.849   2.846   1.00 0.00 ? 111 TYR A HD2  8  
ATOM   7434  H HE1  . TYR A 1 47 ? -15.354 0.537   1.630   1.00 0.00 ? 111 TYR A HE1  8  
ATOM   7435  H HE2  . TYR A 1 47 ? -11.490 2.082   0.554   1.00 0.00 ? 111 TYR A HE2  8  
ATOM   7436  H HH   . TYR A 1 47 ? -14.795 1.906   -0.317  1.00 0.00 ? 111 TYR A HH   8  
ATOM   7437  N N    . GLY A 1 48 ? -10.475 1.952   7.333   1.00 0.00 ? 112 GLY A N    8  
ATOM   7438  C CA   . GLY A 1 48 ? -9.713  1.818   8.552   1.00 0.00 ? 112 GLY A CA   8  
ATOM   7439  C C    . GLY A 1 48 ? -9.001  0.486   8.724   1.00 0.00 ? 112 GLY A C    8  
ATOM   7440  O O    . GLY A 1 48 ? -8.595  0.157   9.834   1.00 0.00 ? 112 GLY A O    8  
ATOM   7441  H H    . GLY A 1 48 ? -10.025 2.297   6.530   1.00 0.00 ? 112 GLY A H    8  
ATOM   7442  H HA2  . GLY A 1 48 ? -8.968  2.600   8.573   1.00 0.00 ? 112 GLY A HA2  8  
ATOM   7443  H HA3  . GLY A 1 48 ? -10.382 1.965   9.387   1.00 0.00 ? 112 GLY A HA3  8  
ATOM   7444  N N    . ASN A 1 49 ? -8.825  -0.288  7.658   1.00 0.00 ? 113 ASN A N    8  
ATOM   7445  C CA   . ASN A 1 49 ? -8.088  -1.559  7.814   1.00 0.00 ? 113 ASN A CA   8  
ATOM   7446  C C    . ASN A 1 49 ? -6.644  -1.340  7.565   1.00 0.00 ? 113 ASN A C    8  
ATOM   7447  O O    . ASN A 1 49 ? -6.268  -0.343  6.968   1.00 0.00 ? 113 ASN A O    8  
ATOM   7448  C CB   . ASN A 1 49 ? -8.543  -2.702  6.907   1.00 0.00 ? 113 ASN A CB   8  
ATOM   7449  C CG   . ASN A 1 49 ? -9.911  -3.250  7.192   1.00 0.00 ? 113 ASN A CG   8  
ATOM   7450  O OD1  . ASN A 1 49 ? -10.457 -3.103  8.288   1.00 0.00 ? 113 ASN A OD1  8  
ATOM   7451  N ND2  . ASN A 1 49 ? -10.429 -3.967  6.249   1.00 0.00 ? 113 ASN A ND2  8  
ATOM   7452  H H    . ASN A 1 49 ? -9.142  0.006   6.779   1.00 0.00 ? 113 ASN A H    8  
ATOM   7453  H HA   . ASN A 1 49 ? -8.203  -1.859  8.846   1.00 0.00 ? 113 ASN A HA   8  
ATOM   7454  H HB2  . ASN A 1 49 ? -8.540  -2.348  5.888   1.00 0.00 ? 113 ASN A HB2  8  
ATOM   7455  H HB3  . ASN A 1 49 ? -7.825  -3.504  6.985   1.00 0.00 ? 113 ASN A HB3  8  
ATOM   7456  H HD21 . ASN A 1 49 ? -9.899  -4.104  5.434   1.00 0.00 ? 113 ASN A HD21 8  
ATOM   7457  H HD22 . ASN A 1 49 ? -11.323 -4.340  6.352   1.00 0.00 ? 113 ASN A HD22 8  
ATOM   7458  N N    . ALA A 1 50 ? -5.839  -2.281  7.949   1.00 0.00 ? 114 ALA A N    8  
ATOM   7459  C CA   . ALA A 1 50 ? -4.424  -2.156  7.811   1.00 0.00 ? 114 ALA A CA   8  
ATOM   7460  C C    . ALA A 1 50 ? -3.840  -3.455  7.335   1.00 0.00 ? 114 ALA A C    8  
ATOM   7461  O O    . ALA A 1 50 ? -4.267  -4.529  7.779   1.00 0.00 ? 114 ALA A O    8  
ATOM   7462  C CB   . ALA A 1 50 ? -3.800  -1.736  9.131   1.00 0.00 ? 114 ALA A CB   8  
ATOM   7463  H H    . ALA A 1 50 ? -6.189  -3.123  8.313   1.00 0.00 ? 114 ALA A H    8  
ATOM   7464  H HA   . ALA A 1 50 ? -4.221  -1.387  7.080   1.00 0.00 ? 114 ALA A HA   8  
ATOM   7465  H HB1  . ALA A 1 50 ? -3.967  -2.504  9.872   1.00 0.00 ? 114 ALA A HB1  8  
ATOM   7466  H HB2  . ALA A 1 50 ? -2.739  -1.589  8.995   1.00 0.00 ? 114 ALA A HB2  8  
ATOM   7467  H HB3  . ALA A 1 50 ? -4.247  -0.811  9.462   1.00 0.00 ? 114 ALA A HB3  8  
ATOM   7468  N N    . GLU A 1 51 ? -2.908  -3.373  6.420   1.00 0.00 ? 115 GLU A N    8  
ATOM   7469  C CA   . GLU A 1 51 ? -2.254  -4.542  5.908   1.00 0.00 ? 115 GLU A CA   8  
ATOM   7470  C C    . GLU A 1 51 ? -0.815  -4.206  5.540   1.00 0.00 ? 115 GLU A C    8  
ATOM   7471  O O    . GLU A 1 51 ? -0.472  -3.020  5.374   1.00 0.00 ? 115 GLU A O    8  
ATOM   7472  C CB   . GLU A 1 51 ? -3.006  -5.141  4.703   1.00 0.00 ? 115 GLU A CB   8  
ATOM   7473  C CG   . GLU A 1 51 ? -2.970  -4.350  3.409   1.00 0.00 ? 115 GLU A CG   8  
ATOM   7474  C CD   . GLU A 1 51 ? -3.467  -5.201  2.260   1.00 0.00 ? 115 GLU A CD   8  
ATOM   7475  O OE1  . GLU A 1 51 ? -2.650  -5.931  1.671   1.00 0.00 ? 115 GLU A OE1  8  
ATOM   7476  O OE2  . GLU A 1 51 ? -4.674  -5.210  1.959   1.00 0.00 ? 115 GLU A OE2  8  
ATOM   7477  H H    . GLU A 1 51 ? -2.624  -2.494  6.085   1.00 0.00 ? 115 GLU A H    8  
ATOM   7478  H HA   . GLU A 1 51 ? -2.237  -5.269  6.707   1.00 0.00 ? 115 GLU A HA   8  
ATOM   7479  H HB2  . GLU A 1 51 ? -2.626  -6.122  4.477   1.00 0.00 ? 115 GLU A HB2  8  
ATOM   7480  H HB3  . GLU A 1 51 ? -4.048  -5.209  4.988   1.00 0.00 ? 115 GLU A HB3  8  
ATOM   7481  H HG2  . GLU A 1 51 ? -3.590  -3.472  3.506   1.00 0.00 ? 115 GLU A HG2  8  
ATOM   7482  H HG3  . GLU A 1 51 ? -1.952  -4.056  3.206   1.00 0.00 ? 115 GLU A HG3  8  
ATOM   7483  N N    . VAL A 1 52 ? 0.022   -5.216  5.451   1.00 0.00 ? 116 VAL A N    8  
ATOM   7484  C CA   . VAL A 1 52 ? 1.398   -5.029  5.060   1.00 0.00 ? 116 VAL A CA   8  
ATOM   7485  C C    . VAL A 1 52 ? 1.528   -5.373  3.588   1.00 0.00 ? 116 VAL A C    8  
ATOM   7486  O O    . VAL A 1 52 ? 1.363   -6.532  3.180   1.00 0.00 ? 116 VAL A O    8  
ATOM   7487  C CB   . VAL A 1 52 ? 2.382   -5.896  5.900   1.00 0.00 ? 116 VAL A CB   8  
ATOM   7488  C CG1  . VAL A 1 52 ? 3.829   -5.641  5.483   1.00 0.00 ? 116 VAL A CG1  8  
ATOM   7489  C CG2  . VAL A 1 52 ? 2.208   -5.623  7.386   1.00 0.00 ? 116 VAL A CG2  8  
ATOM   7490  H H    . VAL A 1 52 ? -0.289  -6.129  5.630   1.00 0.00 ? 116 VAL A H    8  
ATOM   7491  H HA   . VAL A 1 52 ? 1.637   -3.983  5.189   1.00 0.00 ? 116 VAL A HA   8  
ATOM   7492  H HB   . VAL A 1 52 ? 2.158   -6.936  5.714   1.00 0.00 ? 116 VAL A HB   8  
ATOM   7493  H HG11 . VAL A 1 52 ? 4.064   -4.596  5.621   1.00 0.00 ? 116 VAL A HG11 8  
ATOM   7494  H HG12 . VAL A 1 52 ? 4.489   -6.241  6.092   1.00 0.00 ? 116 VAL A HG12 8  
ATOM   7495  H HG13 . VAL A 1 52 ? 3.957   -5.905  4.443   1.00 0.00 ? 116 VAL A HG13 8  
ATOM   7496  H HG21 . VAL A 1 52 ? 1.199   -5.872  7.682   1.00 0.00 ? 116 VAL A HG21 8  
ATOM   7497  H HG22 . VAL A 1 52 ? 2.909   -6.223  7.947   1.00 0.00 ? 116 VAL A HG22 8  
ATOM   7498  H HG23 . VAL A 1 52 ? 2.392   -4.579  7.586   1.00 0.00 ? 116 VAL A HG23 8  
ATOM   7499  N N    . THR A 1 53 ? 1.798   -4.385  2.810   1.00 0.00 ? 117 THR A N    8  
ATOM   7500  C CA   . THR A 1 53 ? 1.864   -4.537  1.387   1.00 0.00 ? 117 THR A CA   8  
ATOM   7501  C C    . THR A 1 53 ? 3.184   -3.957  0.864   1.00 0.00 ? 117 THR A C    8  
ATOM   7502  O O    . THR A 1 53 ? 3.691   -2.973  1.413   1.00 0.00 ? 117 THR A O    8  
ATOM   7503  C CB   . THR A 1 53 ? 0.628   -3.881  0.690   1.00 0.00 ? 117 THR A CB   8  
ATOM   7504  O OG1  . THR A 1 53 ? 0.638   -4.130  -0.723  1.00 0.00 ? 117 THR A OG1  8  
ATOM   7505  C CG2  . THR A 1 53 ? 0.584   -2.388  0.939   1.00 0.00 ? 117 THR A CG2  8  
ATOM   7506  H H    . THR A 1 53 ? 1.981   -3.503  3.214   1.00 0.00 ? 117 THR A H    8  
ATOM   7507  H HA   . THR A 1 53 ? 1.855   -5.599  1.184   1.00 0.00 ? 117 THR A HA   8  
ATOM   7508  H HB   . THR A 1 53 ? -0.268  -4.327  1.098   1.00 0.00 ? 117 THR A HB   8  
ATOM   7509  H HG1  . THR A 1 53 ? -0.169  -4.624  -0.902  1.00 0.00 ? 117 THR A HG1  8  
ATOM   7510  H HG21 . THR A 1 53 ? 1.469   -1.930  0.522   1.00 0.00 ? 117 THR A HG21 8  
ATOM   7511  H HG22 . THR A 1 53 ? -0.295  -1.969  0.472   1.00 0.00 ? 117 THR A HG22 8  
ATOM   7512  H HG23 . THR A 1 53 ? 0.555   -2.206  2.004   1.00 0.00 ? 117 THR A HG23 8  
ATOM   7513  N N    . PRO A 1 54 ? 3.816   -4.614  -0.122  1.00 0.00 ? 118 PRO A N    8  
ATOM   7514  C CA   . PRO A 1 54 ? 5.055   -4.134  -0.703  1.00 0.00 ? 118 PRO A CA   8  
ATOM   7515  C C    . PRO A 1 54 ? 4.868   -2.783  -1.386  1.00 0.00 ? 118 PRO A C    8  
ATOM   7516  O O    . PRO A 1 54 ? 3.805   -2.499  -1.949  1.00 0.00 ? 118 PRO A O    8  
ATOM   7517  C CB   . PRO A 1 54 ? 5.420   -5.206  -1.732  1.00 0.00 ? 118 PRO A CB   8  
ATOM   7518  C CG   . PRO A 1 54 ? 4.147   -5.884  -2.036  1.00 0.00 ? 118 PRO A CG   8  
ATOM   7519  C CD   . PRO A 1 54 ? 3.356   -5.851  -0.765  1.00 0.00 ? 118 PRO A CD   8  
ATOM   7520  H HA   . PRO A 1 54 ? 5.837   -4.059  0.032   1.00 0.00 ? 118 PRO A HA   8  
ATOM   7521  H HB2  . PRO A 1 54 ? 5.845   -4.743  -2.609  1.00 0.00 ? 118 PRO A HB2  8  
ATOM   7522  H HB3  . PRO A 1 54 ? 6.133   -5.898  -1.309  1.00 0.00 ? 118 PRO A HB3  8  
ATOM   7523  H HG2  . PRO A 1 54 ? 3.627   -5.343  -2.814  1.00 0.00 ? 118 PRO A HG2  8  
ATOM   7524  H HG3  . PRO A 1 54 ? 4.330   -6.900  -2.348  1.00 0.00 ? 118 PRO A HG3  8  
ATOM   7525  H HD2  . PRO A 1 54 ? 2.299   -5.797  -0.985  1.00 0.00 ? 118 PRO A HD2  8  
ATOM   7526  H HD3  . PRO A 1 54 ? 3.566   -6.710  -0.152  1.00 0.00 ? 118 PRO A HD3  8  
ATOM   7527  N N    . LEU A 1 55 ? 5.904   -1.976  -1.357  1.00 0.00 ? 119 LEU A N    8  
ATOM   7528  C CA   . LEU A 1 55 ? 5.919   -0.641  -1.965  1.00 0.00 ? 119 LEU A CA   8  
ATOM   7529  C C    . LEU A 1 55 ? 5.608   -0.709  -3.447  1.00 0.00 ? 119 LEU A C    8  
ATOM   7530  O O    . LEU A 1 55 ? 5.119   0.241   -4.026  1.00 0.00 ? 119 LEU A O    8  
ATOM   7531  C CB   . LEU A 1 55 ? 7.274   0.038   -1.749  1.00 0.00 ? 119 LEU A CB   8  
ATOM   7532  C CG   . LEU A 1 55 ? 7.713   0.226   -0.294  1.00 0.00 ? 119 LEU A CG   8  
ATOM   7533  C CD1  . LEU A 1 55 ? 9.054   0.916   -0.218  1.00 0.00 ? 119 LEU A CD1  8  
ATOM   7534  C CD2  . LEU A 1 55 ? 6.683   0.994   0.502   1.00 0.00 ? 119 LEU A CD2  8  
ATOM   7535  H H    . LEU A 1 55 ? 6.709   -2.297  -0.888  1.00 0.00 ? 119 LEU A H    8  
ATOM   7536  H HA   . LEU A 1 55 ? 5.153   -0.043  -1.498  1.00 0.00 ? 119 LEU A HA   8  
ATOM   7537  H HB2  . LEU A 1 55 ? 8.024   -0.557  -2.250  1.00 0.00 ? 119 LEU A HB2  8  
ATOM   7538  H HB3  . LEU A 1 55 ? 7.247   1.004   -2.226  1.00 0.00 ? 119 LEU A HB3  8  
ATOM   7539  H HG   . LEU A 1 55 ? 7.810   -0.760  0.138   1.00 0.00 ? 119 LEU A HG   8  
ATOM   7540  H HD11 . LEU A 1 55 ? 8.984   1.889   -0.682  1.00 0.00 ? 119 LEU A HD11 8  
ATOM   7541  H HD12 . LEU A 1 55 ? 9.342   1.029   0.817   1.00 0.00 ? 119 LEU A HD12 8  
ATOM   7542  H HD13 . LEU A 1 55 ? 9.792   0.322   -0.735  1.00 0.00 ? 119 LEU A HD13 8  
ATOM   7543  H HD21 . LEU A 1 55 ? 5.761   0.432   0.542   1.00 0.00 ? 119 LEU A HD21 8  
ATOM   7544  H HD22 . LEU A 1 55 ? 7.059   1.144   1.504   1.00 0.00 ? 119 LEU A HD22 8  
ATOM   7545  H HD23 . LEU A 1 55 ? 6.504   1.955   0.045   1.00 0.00 ? 119 LEU A HD23 8  
ATOM   7546  N N    . LEU A 1 56 ? 5.908   -1.844  -4.045  1.00 0.00 ? 120 LEU A N    8  
ATOM   7547  C CA   . LEU A 1 56 ? 5.640   -2.102  -5.452  1.00 0.00 ? 120 LEU A CA   8  
ATOM   7548  C C    . LEU A 1 56 ? 4.140   -2.091  -5.720  1.00 0.00 ? 120 LEU A C    8  
ATOM   7549  O O    . LEU A 1 56 ? 3.698   -1.773  -6.818  1.00 0.00 ? 120 LEU A O    8  
ATOM   7550  C CB   . LEU A 1 56 ? 6.268   -3.450  -5.867  1.00 0.00 ? 120 LEU A CB   8  
ATOM   7551  C CG   . LEU A 1 56 ? 5.551   -4.741  -5.426  1.00 0.00 ? 120 LEU A CG   8  
ATOM   7552  C CD1  . LEU A 1 56 ? 4.540   -5.160  -6.471  1.00 0.00 ? 120 LEU A CD1  8  
ATOM   7553  C CD2  . LEU A 1 56 ? 6.546   -5.851  -5.161  1.00 0.00 ? 120 LEU A CD2  8  
ATOM   7554  H H    . LEU A 1 56 ? 6.360   -2.520  -3.491  1.00 0.00 ? 120 LEU A H    8  
ATOM   7555  H HA   . LEU A 1 56 ? 6.075   -1.319  -6.047  1.00 0.00 ? 120 LEU A HA   8  
ATOM   7556  H HB2  . LEU A 1 56 ? 6.325   -3.464  -6.944  1.00 0.00 ? 120 LEU A HB2  8  
ATOM   7557  H HB3  . LEU A 1 56 ? 7.271   -3.474  -5.469  1.00 0.00 ? 120 LEU A HB3  8  
ATOM   7558  H HG   . LEU A 1 56 ? 4.982   -4.546  -4.526  1.00 0.00 ? 120 LEU A HG   8  
ATOM   7559  H HD11 . LEU A 1 56 ? 3.916   -4.300  -6.669  1.00 0.00 ? 120 LEU A HD11 8  
ATOM   7560  H HD12 . LEU A 1 56 ? 5.074   -5.434  -7.369  1.00 0.00 ? 120 LEU A HD12 8  
ATOM   7561  H HD13 . LEU A 1 56 ? 3.949   -5.993  -6.122  1.00 0.00 ? 120 LEU A HD13 8  
ATOM   7562  H HD21 . LEU A 1 56 ? 7.227   -5.547  -4.379  1.00 0.00 ? 120 LEU A HD21 8  
ATOM   7563  H HD22 . LEU A 1 56 ? 6.017   -6.740  -4.849  1.00 0.00 ? 120 LEU A HD22 8  
ATOM   7564  H HD23 . LEU A 1 56 ? 7.101   -6.061  -6.063  1.00 0.00 ? 120 LEU A HD23 8  
ATOM   7565  N N    . ASN A 1 57 ? 3.381   -2.441  -4.710  1.00 0.00 ? 121 ASN A N    8  
ATOM   7566  C CA   . ASN A 1 57 ? 1.940   -2.507  -4.801  1.00 0.00 ? 121 ASN A CA   8  
ATOM   7567  C C    . ASN A 1 57 ? 1.320   -1.180  -4.513  1.00 0.00 ? 121 ASN A C    8  
ATOM   7568  O O    . ASN A 1 57 ? 0.147   -0.957  -4.821  1.00 0.00 ? 121 ASN A O    8  
ATOM   7569  C CB   . ASN A 1 57 ? 1.364   -3.561  -3.852  1.00 0.00 ? 121 ASN A CB   8  
ATOM   7570  C CG   . ASN A 1 57 ? 1.358   -4.958  -4.407  1.00 0.00 ? 121 ASN A CG   8  
ATOM   7571  O OD1  . ASN A 1 57 ? 1.291   -5.166  -5.618  1.00 0.00 ? 121 ASN A OD1  8  
ATOM   7572  N ND2  . ASN A 1 57 ? 1.359   -5.915  -3.533  1.00 0.00 ? 121 ASN A ND2  8  
ATOM   7573  H H    . ASN A 1 57 ? 3.805   -2.640  -3.847  1.00 0.00 ? 121 ASN A H    8  
ATOM   7574  H HA   . ASN A 1 57 ? 1.693   -2.795  -5.812  1.00 0.00 ? 121 ASN A HA   8  
ATOM   7575  H HB2  . ASN A 1 57 ? 1.996   -3.583  -2.977  1.00 0.00 ? 121 ASN A HB2  8  
ATOM   7576  H HB3  . ASN A 1 57 ? 0.373   -3.310  -3.527  1.00 0.00 ? 121 ASN A HB3  8  
ATOM   7577  H HD21 . ASN A 1 57 ? 1.353   -5.654  -2.587  1.00 0.00 ? 121 ASN A HD21 8  
ATOM   7578  H HD22 . ASN A 1 57 ? 1.377   -6.855  -3.815  1.00 0.00 ? 121 ASN A HD22 8  
ATOM   7579  N N    . LEU A 1 58 ? 2.092   -0.293  -3.928  1.00 0.00 ? 122 LEU A N    8  
ATOM   7580  C CA   . LEU A 1 58 ? 1.592   1.005   -3.607  1.00 0.00 ? 122 LEU A CA   8  
ATOM   7581  C C    . LEU A 1 58 ? 1.679   1.887   -4.810  1.00 0.00 ? 122 LEU A C    8  
ATOM   7582  O O    . LEU A 1 58 ? 2.713   1.967   -5.463  1.00 0.00 ? 122 LEU A O    8  
ATOM   7583  C CB   . LEU A 1 58 ? 2.363   1.618   -2.449  1.00 0.00 ? 122 LEU A CB   8  
ATOM   7584  C CG   . LEU A 1 58 ? 2.272   0.891   -1.122  1.00 0.00 ? 122 LEU A CG   8  
ATOM   7585  C CD1  . LEU A 1 58 ? 3.055   1.643   -0.065  1.00 0.00 ? 122 LEU A CD1  8  
ATOM   7586  C CD2  . LEU A 1 58 ? 0.821   0.741   -0.708  1.00 0.00 ? 122 LEU A CD2  8  
ATOM   7587  H H    . LEU A 1 58 ? 3.028   -0.505  -3.732  1.00 0.00 ? 122 LEU A H    8  
ATOM   7588  H HA   . LEU A 1 58 ? 0.554   0.910   -3.324  1.00 0.00 ? 122 LEU A HA   8  
ATOM   7589  H HB2  . LEU A 1 58 ? 3.407   1.650   -2.730  1.00 0.00 ? 122 LEU A HB2  8  
ATOM   7590  H HB3  . LEU A 1 58 ? 2.016   2.630   -2.305  1.00 0.00 ? 122 LEU A HB3  8  
ATOM   7591  H HG   . LEU A 1 58 ? 2.701   -0.095  -1.226  1.00 0.00 ? 122 LEU A HG   8  
ATOM   7592  H HD11 . LEU A 1 58 ? 2.644   2.635   0.049   1.00 0.00 ? 122 LEU A HD11 8  
ATOM   7593  H HD12 . LEU A 1 58 ? 2.992   1.116   0.875   1.00 0.00 ? 122 LEU A HD12 8  
ATOM   7594  H HD13 . LEU A 1 58 ? 4.090   1.726   -0.365  1.00 0.00 ? 122 LEU A HD13 8  
ATOM   7595  H HD21 . LEU A 1 58 ? 0.291   0.171   -1.456  1.00 0.00 ? 122 LEU A HD21 8  
ATOM   7596  H HD22 . LEU A 1 58 ? 0.771   0.224   0.237   1.00 0.00 ? 122 LEU A HD22 8  
ATOM   7597  H HD23 . LEU A 1 58 ? 0.371   1.719   -0.617  1.00 0.00 ? 122 LEU A HD23 8  
ATOM   7598  N N    . LYS A 1 59 ? 0.600   2.517   -5.098  1.00 0.00 ? 123 LYS A N    8  
ATOM   7599  C CA   . LYS A 1 59 ? 0.503   3.405   -6.216  1.00 0.00 ? 123 LYS A CA   8  
ATOM   7600  C C    . LYS A 1 59 ? 0.253   4.801   -5.724  1.00 0.00 ? 123 LYS A C    8  
ATOM   7601  O O    . LYS A 1 59 ? -0.209  4.970   -4.592  1.00 0.00 ? 123 LYS A O    8  
ATOM   7602  C CB   . LYS A 1 59 ? -0.622  2.962   -7.146  1.00 0.00 ? 123 LYS A CB   8  
ATOM   7603  C CG   . LYS A 1 59 ? -0.455  1.567   -7.679  1.00 0.00 ? 123 LYS A CG   8  
ATOM   7604  C CD   . LYS A 1 59 ? -1.509  1.265   -8.716  1.00 0.00 ? 123 LYS A CD   8  
ATOM   7605  C CE   . LYS A 1 59 ? -1.266  -0.057  -9.433  1.00 0.00 ? 123 LYS A CE   8  
ATOM   7606  N NZ   . LYS A 1 59 ? -1.291  -1.225  -8.523  1.00 0.00 ? 123 LYS A NZ   8  
ATOM   7607  H H    . LYS A 1 59 ? -0.176  2.379   -4.509  1.00 0.00 ? 123 LYS A H    8  
ATOM   7608  H HA   . LYS A 1 59 ? 1.437   3.387   -6.757  1.00 0.00 ? 123 LYS A HA   8  
ATOM   7609  H HB2  . LYS A 1 59 ? -1.557  3.007   -6.609  1.00 0.00 ? 123 LYS A HB2  8  
ATOM   7610  H HB3  . LYS A 1 59 ? -0.676  3.639   -7.985  1.00 0.00 ? 123 LYS A HB3  8  
ATOM   7611  H HG2  . LYS A 1 59 ? 0.534   1.457   -8.095  1.00 0.00 ? 123 LYS A HG2  8  
ATOM   7612  H HG3  . LYS A 1 59 ? -0.590  0.912   -6.831  1.00 0.00 ? 123 LYS A HG3  8  
ATOM   7613  H HD2  . LYS A 1 59 ? -2.480  1.243   -8.245  1.00 0.00 ? 123 LYS A HD2  8  
ATOM   7614  H HD3  . LYS A 1 59 ? -1.471  2.068   -9.437  1.00 0.00 ? 123 LYS A HD3  8  
ATOM   7615  H HE2  . LYS A 1 59 ? -2.047  -0.185  -10.168 1.00 0.00 ? 123 LYS A HE2  8  
ATOM   7616  H HE3  . LYS A 1 59 ? -0.311  -0.013  -9.934  1.00 0.00 ? 123 LYS A HE3  8  
ATOM   7617  H HZ1  . LYS A 1 59 ? -2.231  -1.347  -8.098  1.00 0.00 ? 123 LYS A HZ1  8  
ATOM   7618  H HZ2  . LYS A 1 59 ? -1.087  -2.086  -9.072  1.00 0.00 ? 123 LYS A HZ2  8  
ATOM   7619  H HZ3  . LYS A 1 59 ? -0.565  -1.167  -7.780  1.00 0.00 ? 123 LYS A HZ3  8  
ATOM   7620  N N    . PRO A 1 60 ? 0.548   5.821   -6.525  1.00 0.00 ? 124 PRO A N    8  
ATOM   7621  C CA   . PRO A 1 60 ? 0.237   7.182   -6.157  1.00 0.00 ? 124 PRO A CA   8  
ATOM   7622  C C    . PRO A 1 60 ? -1.265  7.407   -6.221  1.00 0.00 ? 124 PRO A C    8  
ATOM   7623  O O    . PRO A 1 60 ? -1.987  6.697   -6.946  1.00 0.00 ? 124 PRO A O    8  
ATOM   7624  C CB   . PRO A 1 60 ? 0.972   8.033   -7.192  1.00 0.00 ? 124 PRO A CB   8  
ATOM   7625  C CG   . PRO A 1 60 ? 1.146   7.143   -8.375  1.00 0.00 ? 124 PRO A CG   8  
ATOM   7626  C CD   . PRO A 1 60 ? 1.212   5.735   -7.845  1.00 0.00 ? 124 PRO A CD   8  
ATOM   7627  H HA   . PRO A 1 60 ? 0.568   7.412   -5.159  1.00 0.00 ? 124 PRO A HA   8  
ATOM   7628  H HB2  . PRO A 1 60 ? 0.370   8.898   -7.430  1.00 0.00 ? 124 PRO A HB2  8  
ATOM   7629  H HB3  . PRO A 1 60 ? 1.924   8.349   -6.792  1.00 0.00 ? 124 PRO A HB3  8  
ATOM   7630  H HG2  . PRO A 1 60 ? 0.303   7.255   -9.040  1.00 0.00 ? 124 PRO A HG2  8  
ATOM   7631  H HG3  . PRO A 1 60 ? 2.062   7.394   -8.889  1.00 0.00 ? 124 PRO A HG3  8  
ATOM   7632  H HD2  . PRO A 1 60 ? 0.671   5.064   -8.495  1.00 0.00 ? 124 PRO A HD2  8  
ATOM   7633  H HD3  . PRO A 1 60 ? 2.231   5.397   -7.740  1.00 0.00 ? 124 PRO A HD3  8  
ATOM   7634  N N    . VAL A 1 61 ? -1.749  8.338   -5.452  1.00 0.00 ? 125 VAL A N    8  
ATOM   7635  C CA   . VAL A 1 61 ? -3.163  8.584   -5.415  1.00 0.00 ? 125 VAL A CA   8  
ATOM   7636  C C    . VAL A 1 61 ? -3.638  9.385   -6.603  1.00 0.00 ? 125 VAL A C    8  
ATOM   7637  O O    . VAL A 1 61 ? -3.047  10.414  -6.976  1.00 0.00 ? 125 VAL A O    8  
ATOM   7638  C CB   . VAL A 1 61 ? -3.645  9.240   -4.097  1.00 0.00 ? 125 VAL A CB   8  
ATOM   7639  C CG1  . VAL A 1 61 ? -3.497  8.276   -2.945  1.00 0.00 ? 125 VAL A CG1  8  
ATOM   7640  C CG2  . VAL A 1 61 ? -2.889  10.533  -3.807  1.00 0.00 ? 125 VAL A CG2  8  
ATOM   7641  H H    . VAL A 1 61 ? -1.135  8.881   -4.910  1.00 0.00 ? 125 VAL A H    8  
ATOM   7642  H HA   . VAL A 1 61 ? -3.632  7.614   -5.488  1.00 0.00 ? 125 VAL A HA   8  
ATOM   7643  H HB   . VAL A 1 61 ? -4.694  9.474   -4.206  1.00 0.00 ? 125 VAL A HB   8  
ATOM   7644  H HG11 . VAL A 1 61 ? -2.458  8.009   -2.822  1.00 0.00 ? 125 VAL A HG11 8  
ATOM   7645  H HG12 . VAL A 1 61 ? -3.857  8.744   -2.042  1.00 0.00 ? 125 VAL A HG12 8  
ATOM   7646  H HG13 . VAL A 1 61 ? -4.073  7.385   -3.144  1.00 0.00 ? 125 VAL A HG13 8  
ATOM   7647  H HG21 . VAL A 1 61 ? -3.063  11.229  -4.614  1.00 0.00 ? 125 VAL A HG21 8  
ATOM   7648  H HG22 . VAL A 1 61 ? -3.239  10.958  -2.878  1.00 0.00 ? 125 VAL A HG22 8  
ATOM   7649  H HG23 . VAL A 1 61 ? -1.832  10.324  -3.733  1.00 0.00 ? 125 VAL A HG23 8  
ATOM   7650  N N    . GLU A 1 62 ? -4.659  8.890   -7.230  1.00 0.00 ? 126 GLU A N    8  
ATOM   7651  C CA   . GLU A 1 62 ? -5.302  9.605   -8.283  1.00 0.00 ? 126 GLU A CA   8  
ATOM   7652  C C    . GLU A 1 62 ? -6.511  10.300  -7.698  1.00 0.00 ? 126 GLU A C    8  
ATOM   7653  O O    . GLU A 1 62 ? -6.810  10.139  -6.499  1.00 0.00 ? 126 GLU A O    8  
ATOM   7654  C CB   . GLU A 1 62 ? -5.715  8.680   -9.426  1.00 0.00 ? 126 GLU A CB   8  
ATOM   7655  C CG   . GLU A 1 62 ? -4.558  7.973   -10.101 1.00 0.00 ? 126 GLU A CG   8  
ATOM   7656  C CD   . GLU A 1 62 ? -5.000  7.181   -11.300 1.00 0.00 ? 126 GLU A CD   8  
ATOM   7657  O OE1  . GLU A 1 62 ? -5.599  6.112   -11.135 1.00 0.00 ? 126 GLU A OE1  8  
ATOM   7658  O OE2  . GLU A 1 62 ? -4.753  7.611   -12.439 1.00 0.00 ? 126 GLU A OE2  8  
ATOM   7659  H H    . GLU A 1 62 ? -5.000  8.009   -6.969  1.00 0.00 ? 126 GLU A H    8  
ATOM   7660  H HA   . GLU A 1 62 ? -4.608  10.349  -8.644  1.00 0.00 ? 126 GLU A HA   8  
ATOM   7661  H HB2  . GLU A 1 62 ? -6.383  7.926   -9.034  1.00 0.00 ? 126 GLU A HB2  8  
ATOM   7662  H HB3  . GLU A 1 62 ? -6.243  9.254   -10.172 1.00 0.00 ? 126 GLU A HB3  8  
ATOM   7663  H HG2  . GLU A 1 62 ? -3.838  8.711   -10.422 1.00 0.00 ? 126 GLU A HG2  8  
ATOM   7664  H HG3  . GLU A 1 62 ? -4.094  7.304   -9.392  1.00 0.00 ? 126 GLU A HG3  8  
ATOM   7665  N N    . GLU A 1 63 ? -7.197  11.052  -8.497  1.00 0.00 ? 127 GLU A N    8  
ATOM   7666  C CA   . GLU A 1 63 ? -8.359  11.782  -8.035  1.00 0.00 ? 127 GLU A CA   8  
ATOM   7667  C C    . GLU A 1 63 ? -9.625  11.001  -8.323  1.00 0.00 ? 127 GLU A C    8  
ATOM   7668  O O    . GLU A 1 63 ? -10.720 11.369  -7.879  1.00 0.00 ? 127 GLU A O    8  
ATOM   7669  C CB   . GLU A 1 63 ? -8.417  13.148  -8.701  1.00 0.00 ? 127 GLU A CB   8  
ATOM   7670  C CG   . GLU A 1 63 ? -7.161  13.985  -8.508  1.00 0.00 ? 127 GLU A CG   8  
ATOM   7671  C CD   . GLU A 1 63 ? -6.842  14.242  -7.060  1.00 0.00 ? 127 GLU A CD   8  
ATOM   7672  O OE1  . GLU A 1 63 ? -7.536  15.045  -6.421  1.00 0.00 ? 127 GLU A OE1  8  
ATOM   7673  O OE2  . GLU A 1 63 ? -5.868  13.668  -6.535  1.00 0.00 ? 127 GLU A OE2  8  
ATOM   7674  H H    . GLU A 1 63 ? -6.923  11.147  -9.436  1.00 0.00 ? 127 GLU A H    8  
ATOM   7675  H HA   . GLU A 1 63 ? -8.290  11.910  -6.968  1.00 0.00 ? 127 GLU A HA   8  
ATOM   7676  H HB2  . GLU A 1 63 ? -8.574  13.011  -9.760  1.00 0.00 ? 127 GLU A HB2  8  
ATOM   7677  H HB3  . GLU A 1 63 ? -9.253  13.696  -8.292  1.00 0.00 ? 127 GLU A HB3  8  
ATOM   7678  H HG2  . GLU A 1 63 ? -6.327  13.463  -8.954  1.00 0.00 ? 127 GLU A HG2  8  
ATOM   7679  H HG3  . GLU A 1 63 ? -7.298  14.931  -9.007  1.00 0.00 ? 127 GLU A HG3  8  
ATOM   7680  N N    . GLY A 1 64 ? -9.472  9.923   -9.022  1.00 0.00 ? 128 GLY A N    8  
ATOM   7681  C CA   . GLY A 1 64 ? -10.580 9.129   -9.396  1.00 0.00 ? 128 GLY A CA   8  
ATOM   7682  C C    . GLY A 1 64 ? -10.187 7.695   -9.426  1.00 0.00 ? 128 GLY A C    8  
ATOM   7683  O O    . GLY A 1 64 ? -8.997  7.418   -9.652  1.00 0.00 ? 128 GLY A O    8  
ATOM   7684  O OXT  . GLY A 1 64 ? -11.049 6.813   -9.237  1.00 0.00 ? 128 GLY A OXT  8  
ATOM   7685  H H    . GLY A 1 64 ? -8.581  9.603   -9.277  1.00 0.00 ? 128 GLY A H    8  
ATOM   7686  H HA2  . GLY A 1 64 ? -11.361 9.287   -8.667  1.00 0.00 ? 128 GLY A HA2  8  
ATOM   7687  H HA3  . GLY A 1 64 ? -10.924 9.429   -10.374 1.00 0.00 ? 128 GLY A HA3  8  
HETATM 7688  N N    . 2MR B 2 .  ? -17.373 -2.374  -0.100  1.00 0.00 ? 201 2MR A N    8  
HETATM 7689  C CA   . 2MR B 2 .  ? -16.952 -3.732  0.205   1.00 0.00 ? 201 2MR A CA   8  
HETATM 7690  C CB   . 2MR B 2 .  ? -15.648 -3.735  1.000   1.00 0.00 ? 201 2MR A CB   8  
HETATM 7691  C CG   . 2MR B 2 .  ? -15.637 -2.771  2.152   1.00 0.00 ? 201 2MR A CG   8  
HETATM 7692  C CD   . 2MR B 2 .  ? -14.294 -2.695  2.778   1.00 0.00 ? 201 2MR A CD   8  
HETATM 7693  N NE   . 2MR B 2 .  ? -13.301 -2.316  1.804   1.00 0.00 ? 201 2MR A NE   8  
HETATM 7694  C CZ   . 2MR B 2 .  ? -12.074 -2.047  2.080   1.00 0.00 ? 201 2MR A CZ   8  
HETATM 7695  N NH1  . 2MR B 2 .  ? -11.670 -2.121  3.384   1.00 0.00 ? 201 2MR A NH1  8  
HETATM 7696  C CQ1  . 2MR B 2 .  ? -10.363 -1.877  4.004   1.00 0.00 ? 201 2MR A CQ1  8  
HETATM 7697  N NH2  . 2MR B 2 .  ? -11.257 -1.731  1.046   1.00 0.00 ? 201 2MR A NH2  8  
HETATM 7698  C CQ2  . 2MR B 2 .  ? -9.843  -1.380  1.011   1.00 0.00 ? 201 2MR A CQ2  8  
HETATM 7699  C C    . 2MR B 2 .  ? -18.051 -4.435  0.944   1.00 0.00 ? 201 2MR A C    8  
HETATM 7700  O O    . 2MR B 2 .  ? -18.540 -5.453  0.449   1.00 0.00 ? 201 2MR A O    8  
HETATM 7701  O OXT  . 2MR B 2 .  ? -18.458 -3.949  2.010   1.00 0.00 ? 201 2MR A OXT  8  
HETATM 7702  H H2   . 2MR B 2 .  ? -16.645 -1.776  -0.538  1.00 0.00 ? 201 2MR A H2   8  
HETATM 7703  H H    . 2MR B 2 .  ? -18.201 -2.418  -0.723  1.00 0.00 ? 201 2MR A H    8  
HETATM 7704  H H3   . 2MR B 2 .  ? -17.709 -1.931  0.778   1.00 0.00 ? 201 2MR A H3   8  
HETATM 7705  H HA   . 2MR B 2 .  ? -16.786 -4.192  -0.755  1.00 0.00 ? 201 2MR A HA   8  
HETATM 7706  H HB2  . 2MR B 2 .  ? -14.821 -3.497  0.351   1.00 0.00 ? 201 2MR A HB2  8  
HETATM 7707  H HB3  . 2MR B 2 .  ? -15.478 -4.722  1.407   1.00 0.00 ? 201 2MR A HB3  8  
HETATM 7708  H HG2  . 2MR B 2 .  ? -16.360 -3.106  2.878   1.00 0.00 ? 201 2MR A HG2  8  
HETATM 7709  H HG3  . 2MR B 2 .  ? -15.867 -1.796  1.747   1.00 0.00 ? 201 2MR A HG3  8  
HETATM 7710  H HD2  . 2MR B 2 .  ? -14.023 -3.649  3.205   1.00 0.00 ? 201 2MR A HD2  8  
HETATM 7711  H HD3  . 2MR B 2 .  ? -14.307 -1.931  3.543   1.00 0.00 ? 201 2MR A HD3  8  
HETATM 7712  H HE   . 2MR B 2 .  ? -13.621 -2.242  0.877   1.00 0.00 ? 201 2MR A HE   8  
HETATM 7713  H HQ11 . 2MR B 2 .  ? -10.119 -0.828  3.913   1.00 0.00 ? 201 2MR A HQ11 8  
HETATM 7714  H HQ12 . 2MR B 2 .  ? -10.421 -2.137  5.052   1.00 0.00 ? 201 2MR A HQ12 8  
HETATM 7715  H HQ13 . 2MR B 2 .  ? -9.606  -2.476  3.520   1.00 0.00 ? 201 2MR A HQ13 8  
HETATM 7716  H HH2  . 2MR B 2 .  ? -11.613 -1.724  0.113   1.00 0.00 ? 201 2MR A HH2  8  
HETATM 7717  H HQ21 . 2MR B 2 .  ? -9.252  -2.250  1.260   1.00 0.00 ? 201 2MR A HQ21 8  
HETATM 7718  H HQ22 . 2MR B 2 .  ? -9.582  -1.047  0.018   1.00 0.00 ? 201 2MR A HQ22 8  
HETATM 7719  H HQ23 . 2MR B 2 .  ? -9.644  -0.593  1.722   1.00 0.00 ? 201 2MR A HQ23 8  
HETATM 7720  H HH1  . 2MR B 2 .  ? -12.341 -2.376  4.088   1.00 0.00 ? 201 2MR A HH1  8  
ATOM   7721  N N    . ALA A 1 1  ? 15.019  -6.576  -0.652  1.00 0.00 ? 65  ALA A N    9  
ATOM   7722  C CA   . ALA A 1 1  ? 13.774  -7.166  -1.116  1.00 0.00 ? 65  ALA A CA   9  
ATOM   7723  C C    . ALA A 1 1  ? 14.009  -7.853  -2.436  1.00 0.00 ? 65  ALA A C    9  
ATOM   7724  O O    . ALA A 1 1  ? 14.946  -7.507  -3.150  1.00 0.00 ? 65  ALA A O    9  
ATOM   7725  C CB   . ALA A 1 1  ? 12.707  -6.097  -1.274  1.00 0.00 ? 65  ALA A CB   9  
ATOM   7726  H H1   . ALA A 1 1  ? 15.374  -5.900  -1.358  1.00 0.00 ? 65  ALA A H1   9  
ATOM   7727  H H2   . ALA A 1 1  ? 14.898  -6.085  0.257   1.00 0.00 ? 65  ALA A H2   9  
ATOM   7728  H H3   . ALA A 1 1  ? 15.741  -7.314  -0.530  1.00 0.00 ? 65  ALA A H3   9  
ATOM   7729  H HA   . ALA A 1 1  ? 13.436  -7.882  -0.382  1.00 0.00 ? 65  ALA A HA   9  
ATOM   7730  H HB1  . ALA A 1 1  ? 13.021  -5.376  -2.014  1.00 0.00 ? 65  ALA A HB1  9  
ATOM   7731  H HB2  . ALA A 1 1  ? 11.783  -6.557  -1.592  1.00 0.00 ? 65  ALA A HB2  9  
ATOM   7732  H HB3  . ALA A 1 1  ? 12.553  -5.598  -0.329  1.00 0.00 ? 65  ALA A HB3  9  
ATOM   7733  N N    . SER A 1 2  ? 13.177  -8.822  -2.767  1.00 0.00 ? 66  SER A N    9  
ATOM   7734  C CA   . SER A 1 2  ? 13.284  -9.501  -4.040  1.00 0.00 ? 66  SER A CA   9  
ATOM   7735  C C    . SER A 1 2  ? 12.727  -8.607  -5.156  1.00 0.00 ? 66  SER A C    9  
ATOM   7736  O O    . SER A 1 2  ? 13.177  -8.657  -6.301  1.00 0.00 ? 66  SER A O    9  
ATOM   7737  C CB   . SER A 1 2  ? 12.532  -10.829 -3.985  1.00 0.00 ? 66  SER A CB   9  
ATOM   7738  O OG   . SER A 1 2  ? 13.035  -11.657 -2.934  1.00 0.00 ? 66  SER A OG   9  
ATOM   7739  H H    . SER A 1 2  ? 12.470  -9.102  -2.143  1.00 0.00 ? 66  SER A H    9  
ATOM   7740  H HA   . SER A 1 2  ? 14.328  -9.691  -4.235  1.00 0.00 ? 66  SER A HA   9  
ATOM   7741  H HB2  . SER A 1 2  ? 11.486  -10.635 -3.800  1.00 0.00 ? 66  SER A HB2  9  
ATOM   7742  H HB3  . SER A 1 2  ? 12.640  -11.350 -4.924  1.00 0.00 ? 66  SER A HB3  9  
ATOM   7743  H HG   . SER A 1 2  ? 13.866  -11.281 -2.607  1.00 0.00 ? 66  SER A HG   9  
ATOM   7744  N N    . THR A 1 3  ? 11.751  -7.808  -4.811  1.00 0.00 ? 67  THR A N    9  
ATOM   7745  C CA   . THR A 1 3  ? 11.163  -6.875  -5.722  1.00 0.00 ? 67  THR A CA   9  
ATOM   7746  C C    . THR A 1 3  ? 11.554  -5.445  -5.354  1.00 0.00 ? 67  THR A C    9  
ATOM   7747  O O    . THR A 1 3  ? 11.148  -4.915  -4.312  1.00 0.00 ? 67  THR A O    9  
ATOM   7748  C CB   . THR A 1 3  ? 9.646   -7.057  -5.745  1.00 0.00 ? 67  THR A CB   9  
ATOM   7749  O OG1  . THR A 1 3  ? 9.183   -7.330  -4.402  1.00 0.00 ? 67  THR A OG1  9  
ATOM   7750  C CG2  . THR A 1 3  ? 9.265   -8.204  -6.662  1.00 0.00 ? 67  THR A CG2  9  
ATOM   7751  H H    . THR A 1 3  ? 11.373  -7.825  -3.905  1.00 0.00 ? 67  THR A H    9  
ATOM   7752  H HA   . THR A 1 3  ? 11.552  -7.095  -6.705  1.00 0.00 ? 67  THR A HA   9  
ATOM   7753  H HB   . THR A 1 3  ? 9.192   -6.145  -6.101  1.00 0.00 ? 67  THR A HB   9  
ATOM   7754  H HG1  . THR A 1 3  ? 8.817   -8.223  -4.381  1.00 0.00 ? 67  THR A HG1  9  
ATOM   7755  H HG21 . THR A 1 3  ? 9.732   -9.111  -6.310  1.00 0.00 ? 67  THR A HG21 9  
ATOM   7756  H HG22 . THR A 1 3  ? 8.192   -8.327  -6.660  1.00 0.00 ? 67  THR A HG22 9  
ATOM   7757  H HG23 . THR A 1 3  ? 9.602   -7.994  -7.666  1.00 0.00 ? 67  THR A HG23 9  
ATOM   7758  N N    . GLN A 1 4  ? 12.381  -4.860  -6.187  1.00 0.00 ? 68  GLN A N    9  
ATOM   7759  C CA   . GLN A 1 4  ? 12.914  -3.536  -5.977  1.00 0.00 ? 68  GLN A CA   9  
ATOM   7760  C C    . GLN A 1 4  ? 11.853  -2.485  -6.279  1.00 0.00 ? 68  GLN A C    9  
ATOM   7761  O O    . GLN A 1 4  ? 11.386  -2.381  -7.418  1.00 0.00 ? 68  GLN A O    9  
ATOM   7762  C CB   . GLN A 1 4  ? 14.157  -3.285  -6.865  1.00 0.00 ? 68  GLN A CB   9  
ATOM   7763  C CG   . GLN A 1 4  ? 15.281  -4.319  -6.730  1.00 0.00 ? 68  GLN A CG   9  
ATOM   7764  C CD   . GLN A 1 4  ? 15.118  -5.554  -7.624  1.00 0.00 ? 68  GLN A CD   9  
ATOM   7765  O OE1  . GLN A 1 4  ? 14.008  -5.968  -7.984  1.00 0.00 ? 68  GLN A OE1  9  
ATOM   7766  N NE2  . GLN A 1 4  ? 16.212  -6.158  -7.972  1.00 0.00 ? 68  GLN A NE2  9  
ATOM   7767  H H    . GLN A 1 4  ? 12.663  -5.348  -6.992  1.00 0.00 ? 68  GLN A H    9  
ATOM   7768  H HA   . GLN A 1 4  ? 13.208  -3.461  -4.941  1.00 0.00 ? 68  GLN A HA   9  
ATOM   7769  H HB2  . GLN A 1 4  ? 13.841  -3.279  -7.898  1.00 0.00 ? 68  GLN A HB2  9  
ATOM   7770  H HB3  . GLN A 1 4  ? 14.558  -2.311  -6.624  1.00 0.00 ? 68  GLN A HB3  9  
ATOM   7771  H HG2  . GLN A 1 4  ? 16.215  -3.842  -6.987  1.00 0.00 ? 68  GLN A HG2  9  
ATOM   7772  H HG3  . GLN A 1 4  ? 15.325  -4.642  -5.700  1.00 0.00 ? 68  GLN A HG3  9  
ATOM   7773  H HE21 . GLN A 1 4  ? 17.065  -5.795  -7.648  1.00 0.00 ? 68  GLN A HE21 9  
ATOM   7774  H HE22 . GLN A 1 4  ? 16.171  -6.957  -8.539  1.00 0.00 ? 68  GLN A HE22 9  
ATOM   7775  N N    . PRO A 1 5  ? 11.446  -1.704  -5.280  1.00 0.00 ? 69  PRO A N    9  
ATOM   7776  C CA   . PRO A 1 5  ? 10.445  -0.670  -5.467  1.00 0.00 ? 69  PRO A CA   9  
ATOM   7777  C C    . PRO A 1 5  ? 11.009  0.549   -6.201  1.00 0.00 ? 69  PRO A C    9  
ATOM   7778  O O    . PRO A 1 5  ? 12.119  1.006   -5.916  1.00 0.00 ? 69  PRO A O    9  
ATOM   7779  C CB   . PRO A 1 5  ? 10.032  -0.314  -4.050  1.00 0.00 ? 69  PRO A CB   9  
ATOM   7780  C CG   . PRO A 1 5  ? 11.213  -0.639  -3.203  1.00 0.00 ? 69  PRO A CG   9  
ATOM   7781  C CD   . PRO A 1 5  ? 11.929  -1.771  -3.882  1.00 0.00 ? 69  PRO A CD   9  
ATOM   7782  H HA   . PRO A 1 5  ? 9.595   -1.050  -6.015  1.00 0.00 ? 69  PRO A HA   9  
ATOM   7783  H HB2  . PRO A 1 5  ? 9.764   0.731   -3.993  1.00 0.00 ? 69  PRO A HB2  9  
ATOM   7784  H HB3  . PRO A 1 5  ? 9.186   -0.932  -3.791  1.00 0.00 ? 69  PRO A HB3  9  
ATOM   7785  H HG2  . PRO A 1 5  ? 11.857  0.225   -3.136  1.00 0.00 ? 69  PRO A HG2  9  
ATOM   7786  H HG3  . PRO A 1 5  ? 10.890  -0.939  -2.217  1.00 0.00 ? 69  PRO A HG3  9  
ATOM   7787  H HD2  . PRO A 1 5  ? 12.997  -1.621  -3.832  1.00 0.00 ? 69  PRO A HD2  9  
ATOM   7788  H HD3  . PRO A 1 5  ? 11.659  -2.714  -3.430  1.00 0.00 ? 69  PRO A HD3  9  
ATOM   7789  N N    . THR A 1 6  ? 10.267  1.044   -7.152  1.00 0.00 ? 70  THR A N    9  
ATOM   7790  C CA   . THR A 1 6  ? 10.697  2.179   -7.922  1.00 0.00 ? 70  THR A CA   9  
ATOM   7791  C C    . THR A 1 6  ? 10.180  3.467   -7.273  1.00 0.00 ? 70  THR A C    9  
ATOM   7792  O O    . THR A 1 6  ? 10.783  4.541   -7.401  1.00 0.00 ? 70  THR A O    9  
ATOM   7793  C CB   . THR A 1 6  ? 10.234  2.066   -9.412  1.00 0.00 ? 70  THR A CB   9  
ATOM   7794  O OG1  . THR A 1 6  ? 10.846  3.088   -10.218 1.00 0.00 ? 70  THR A OG1  9  
ATOM   7795  C CG2  . THR A 1 6  ? 8.711   2.159   -9.544  1.00 0.00 ? 70  THR A CG2  9  
ATOM   7796  H H    . THR A 1 6  ? 9.404   0.624   -7.356  1.00 0.00 ? 70  THR A H    9  
ATOM   7797  H HA   . THR A 1 6  ? 11.778  2.193   -7.892  1.00 0.00 ? 70  THR A HA   9  
ATOM   7798  H HB   . THR A 1 6  ? 10.559  1.105   -9.782  1.00 0.00 ? 70  THR A HB   9  
ATOM   7799  H HG1  . THR A 1 6  ? 10.966  2.700   -11.095 1.00 0.00 ? 70  THR A HG1  9  
ATOM   7800  H HG21 . THR A 1 6  ? 8.372   3.113   -9.165  1.00 0.00 ? 70  THR A HG21 9  
ATOM   7801  H HG22 . THR A 1 6  ? 8.435   2.067   -10.582 1.00 0.00 ? 70  THR A HG22 9  
ATOM   7802  H HG23 . THR A 1 6  ? 8.248   1.366   -8.977  1.00 0.00 ? 70  THR A HG23 9  
ATOM   7803  N N    . HIS A 1 7  ? 9.096   3.339   -6.537  1.00 0.00 ? 71  HIS A N    9  
ATOM   7804  C CA   . HIS A 1 7  ? 8.506   4.459   -5.862  1.00 0.00 ? 71  HIS A CA   9  
ATOM   7805  C C    . HIS A 1 7  ? 9.211   4.732   -4.556  1.00 0.00 ? 71  HIS A C    9  
ATOM   7806  O O    . HIS A 1 7  ? 9.857   3.843   -3.975  1.00 0.00 ? 71  HIS A O    9  
ATOM   7807  C CB   . HIS A 1 7  ? 7.013   4.245   -5.616  1.00 0.00 ? 71  HIS A CB   9  
ATOM   7808  C CG   . HIS A 1 7  ? 6.122   4.459   -6.804  1.00 0.00 ? 71  HIS A CG   9  
ATOM   7809  N ND1  . HIS A 1 7  ? 5.678   3.465   -7.644  1.00 0.00 ? 71  HIS A ND1  9  
ATOM   7810  C CD2  . HIS A 1 7  ? 5.566   5.599   -7.254  1.00 0.00 ? 71  HIS A CD2  9  
ATOM   7811  C CE1  . HIS A 1 7  ? 4.881   4.023   -8.562  1.00 0.00 ? 71  HIS A CE1  9  
ATOM   7812  N NE2  . HIS A 1 7  ? 4.779   5.327   -8.369  1.00 0.00 ? 71  HIS A NE2  9  
ATOM   7813  H H    . HIS A 1 7  ? 8.691   2.453   -6.430  1.00 0.00 ? 71  HIS A H    9  
ATOM   7814  H HA   . HIS A 1 7  ? 8.627   5.320   -6.503  1.00 0.00 ? 71  HIS A HA   9  
ATOM   7815  H HB2  . HIS A 1 7  ? 6.855   3.236   -5.269  1.00 0.00 ? 71  HIS A HB2  9  
ATOM   7816  H HB3  . HIS A 1 7  ? 6.697   4.925   -4.837  1.00 0.00 ? 71  HIS A HB3  9  
ATOM   7817  H HD1  . HIS A 1 7  ? 5.889   2.507   -7.599  1.00 0.00 ? 71  HIS A HD1  9  
ATOM   7818  H HD2  . HIS A 1 7  ? 5.705   6.567   -6.801  1.00 0.00 ? 71  HIS A HD2  9  
ATOM   7819  H HE1  . HIS A 1 7  ? 4.388   3.481   -9.354  1.00 0.00 ? 71  HIS A HE1  9  
ATOM   7820  N N    . SER A 1 8  ? 9.092   5.938   -4.109  1.00 0.00 ? 72  SER A N    9  
ATOM   7821  C CA   . SER A 1 8  ? 9.682   6.385   -2.901  1.00 0.00 ? 72  SER A CA   9  
ATOM   7822  C C    . SER A 1 8  ? 8.547   6.821   -1.984  1.00 0.00 ? 72  SER A C    9  
ATOM   7823  O O    . SER A 1 8  ? 7.837   7.788   -2.276  1.00 0.00 ? 72  SER A O    9  
ATOM   7824  C CB   . SER A 1 8  ? 10.617  7.554   -3.225  1.00 0.00 ? 72  SER A CB   9  
ATOM   7825  O OG   . SER A 1 8  ? 11.463  7.885   -2.139  1.00 0.00 ? 72  SER A OG   9  
ATOM   7826  H H    . SER A 1 8  ? 8.558   6.584   -4.620  1.00 0.00 ? 72  SER A H    9  
ATOM   7827  H HA   . SER A 1 8  ? 10.245  5.580   -2.451  1.00 0.00 ? 72  SER A HA   9  
ATOM   7828  H HB2  . SER A 1 8  ? 11.232  7.275   -4.065  1.00 0.00 ? 72  SER A HB2  9  
ATOM   7829  H HB3  . SER A 1 8  ? 10.024  8.420   -3.486  1.00 0.00 ? 72  SER A HB3  9  
ATOM   7830  H HG   . SER A 1 8  ? 12.161  7.212   -2.155  1.00 0.00 ? 72  SER A HG   9  
ATOM   7831  N N    . TRP A 1 9  ? 8.348   6.092   -0.917  1.00 0.00 ? 73  TRP A N    9  
ATOM   7832  C CA   . TRP A 1 9  ? 7.246   6.337   -0.024  1.00 0.00 ? 73  TRP A CA   9  
ATOM   7833  C C    . TRP A 1 9  ? 7.722   6.735   1.361   1.00 0.00 ? 73  TRP A C    9  
ATOM   7834  O O    . TRP A 1 9  ? 8.812   6.319   1.796   1.00 0.00 ? 73  TRP A O    9  
ATOM   7835  C CB   . TRP A 1 9  ? 6.375   5.087   0.063   1.00 0.00 ? 73  TRP A CB   9  
ATOM   7836  C CG   . TRP A 1 9  ? 5.712   4.727   -1.231  1.00 0.00 ? 73  TRP A CG   9  
ATOM   7837  C CD1  . TRP A 1 9  ? 6.009   3.678   -2.049  1.00 0.00 ? 73  TRP A CD1  9  
ATOM   7838  C CD2  . TRP A 1 9  ? 4.647   5.441   -1.863  1.00 0.00 ? 73  TRP A CD2  9  
ATOM   7839  N NE1  . TRP A 1 9  ? 5.173   3.686   -3.138  1.00 0.00 ? 73  TRP A NE1  9  
ATOM   7840  C CE2  . TRP A 1 9  ? 4.337   4.760   -3.050  1.00 0.00 ? 73  TRP A CE2  9  
ATOM   7841  C CE3  . TRP A 1 9  ? 3.921   6.587   -1.533  1.00 0.00 ? 73  TRP A CE3  9  
ATOM   7842  C CZ2  . TRP A 1 9  ? 3.338   5.182   -3.910  1.00 0.00 ? 73  TRP A CZ2  9  
ATOM   7843  C CZ3  . TRP A 1 9  ? 2.930   7.010   -2.385  1.00 0.00 ? 73  TRP A CZ3  9  
ATOM   7844  C CH2  . TRP A 1 9  ? 2.646   6.300   -3.569  1.00 0.00 ? 73  TRP A CH2  9  
ATOM   7845  H H    . TRP A 1 9  ? 8.972   5.364   -0.701  1.00 0.00 ? 73  TRP A H    9  
ATOM   7846  H HA   . TRP A 1 9  ? 6.643   7.131   -0.436  1.00 0.00 ? 73  TRP A HA   9  
ATOM   7847  H HB2  . TRP A 1 9  ? 6.989   4.253   0.365   1.00 0.00 ? 73  TRP A HB2  9  
ATOM   7848  H HB3  . TRP A 1 9  ? 5.605   5.242   0.802   1.00 0.00 ? 73  TRP A HB3  9  
ATOM   7849  H HD1  . TRP A 1 9  ? 6.780   2.948   -1.849  1.00 0.00 ? 73  TRP A HD1  9  
ATOM   7850  H HE1  . TRP A 1 9  ? 5.165   3.042   -3.880  1.00 0.00 ? 73  TRP A HE1  9  
ATOM   7851  H HE3  . TRP A 1 9  ? 4.130   7.138   -0.629  1.00 0.00 ? 73  TRP A HE3  9  
ATOM   7852  H HZ2  . TRP A 1 9  ? 3.109   4.648   -4.821  1.00 0.00 ? 73  TRP A HZ2  9  
ATOM   7853  H HZ3  . TRP A 1 9  ? 2.374   7.898   -2.123  1.00 0.00 ? 73  TRP A HZ3  9  
ATOM   7854  H HH2  . TRP A 1 9  ? 1.863   6.632   -4.235  1.00 0.00 ? 73  TRP A HH2  9  
ATOM   7855  N N    . LYS A 1 10 ? 6.914   7.532   2.050   1.00 0.00 ? 74  LYS A N    9  
ATOM   7856  C CA   . LYS A 1 10 ? 7.196   7.950   3.412   1.00 0.00 ? 74  LYS A CA   9  
ATOM   7857  C C    . LYS A 1 10 ? 5.961   7.733   4.287   1.00 0.00 ? 74  LYS A C    9  
ATOM   7858  O O    . LYS A 1 10 ? 4.850   7.553   3.776   1.00 0.00 ? 74  LYS A O    9  
ATOM   7859  C CB   . LYS A 1 10 ? 7.609   9.426   3.497   1.00 0.00 ? 74  LYS A CB   9  
ATOM   7860  C CG   . LYS A 1 10 ? 6.529   10.407  3.058   1.00 0.00 ? 74  LYS A CG   9  
ATOM   7861  C CD   . LYS A 1 10 ? 6.844   11.837  3.482   1.00 0.00 ? 74  LYS A CD   9  
ATOM   7862  C CE   . LYS A 1 10 ? 6.778   11.993  5.004   1.00 0.00 ? 74  LYS A CE   9  
ATOM   7863  N NZ   . LYS A 1 10 ? 6.974   13.385  5.440   1.00 0.00 ? 74  LYS A NZ   9  
ATOM   7864  H H    . LYS A 1 10 ? 6.078   7.848   1.646   1.00 0.00 ? 74  LYS A H    9  
ATOM   7865  H HA   . LYS A 1 10 ? 8.002   7.335   3.783   1.00 0.00 ? 74  LYS A HA   9  
ATOM   7866  H HB2  . LYS A 1 10 ? 7.880   9.643   4.519   1.00 0.00 ? 74  LYS A HB2  9  
ATOM   7867  H HB3  . LYS A 1 10 ? 8.476   9.572   2.870   1.00 0.00 ? 74  LYS A HB3  9  
ATOM   7868  H HG2  . LYS A 1 10 ? 6.439   10.368  1.984   1.00 0.00 ? 74  LYS A HG2  9  
ATOM   7869  H HG3  . LYS A 1 10 ? 5.593   10.106  3.504   1.00 0.00 ? 74  LYS A HG3  9  
ATOM   7870  H HD2  . LYS A 1 10 ? 7.847   12.067  3.154   1.00 0.00 ? 74  LYS A HD2  9  
ATOM   7871  H HD3  . LYS A 1 10 ? 6.140   12.511  3.022   1.00 0.00 ? 74  LYS A HD3  9  
ATOM   7872  H HE2  . LYS A 1 10 ? 5.811   11.658  5.350   1.00 0.00 ? 74  LYS A HE2  9  
ATOM   7873  H HE3  . LYS A 1 10 ? 7.542   11.376  5.454   1.00 0.00 ? 74  LYS A HE3  9  
ATOM   7874  H HZ1  . LYS A 1 10 ? 6.242   14.008  5.046   1.00 0.00 ? 74  LYS A HZ1  9  
ATOM   7875  H HZ2  . LYS A 1 10 ? 6.921   13.436  6.478   1.00 0.00 ? 74  LYS A HZ2  9  
ATOM   7876  H HZ3  . LYS A 1 10 ? 7.912   13.735  5.162   1.00 0.00 ? 74  LYS A HZ3  9  
ATOM   7877  N N    . VAL A 1 11 ? 6.169   7.712   5.583   1.00 0.00 ? 75  VAL A N    9  
ATOM   7878  C CA   . VAL A 1 11 ? 5.093   7.605   6.551   1.00 0.00 ? 75  VAL A CA   9  
ATOM   7879  C C    . VAL A 1 11 ? 4.188   8.837   6.476   1.00 0.00 ? 75  VAL A C    9  
ATOM   7880  O O    . VAL A 1 11 ? 4.674   9.965   6.399   1.00 0.00 ? 75  VAL A O    9  
ATOM   7881  C CB   . VAL A 1 11 ? 5.653   7.440   7.995   1.00 0.00 ? 75  VAL A CB   9  
ATOM   7882  C CG1  . VAL A 1 11 ? 4.538   7.442   9.034   1.00 0.00 ? 75  VAL A CG1  9  
ATOM   7883  C CG2  . VAL A 1 11 ? 6.450   6.152   8.099   1.00 0.00 ? 75  VAL A CG2  9  
ATOM   7884  H H    . VAL A 1 11 ? 7.089   7.798   5.917   1.00 0.00 ? 75  VAL A H    9  
ATOM   7885  H HA   . VAL A 1 11 ? 4.518   6.725   6.300   1.00 0.00 ? 75  VAL A HA   9  
ATOM   7886  H HB   . VAL A 1 11 ? 6.318   8.265   8.204   1.00 0.00 ? 75  VAL A HB   9  
ATOM   7887  H HG11 . VAL A 1 11 ? 3.870   6.613   8.848   1.00 0.00 ? 75  VAL A HG11 9  
ATOM   7888  H HG12 . VAL A 1 11 ? 4.964   7.348   10.021  1.00 0.00 ? 75  VAL A HG12 9  
ATOM   7889  H HG13 . VAL A 1 11 ? 3.988   8.369   8.967   1.00 0.00 ? 75  VAL A HG13 9  
ATOM   7890  H HG21 . VAL A 1 11 ? 7.285   6.185   7.416   1.00 0.00 ? 75  VAL A HG21 9  
ATOM   7891  H HG22 . VAL A 1 11 ? 6.809   6.037   9.110   1.00 0.00 ? 75  VAL A HG22 9  
ATOM   7892  H HG23 . VAL A 1 11 ? 5.814   5.316   7.848   1.00 0.00 ? 75  VAL A HG23 9  
ATOM   7893  N N    . GLY A 1 12 ? 2.895   8.609   6.458   1.00 0.00 ? 76  GLY A N    9  
ATOM   7894  C CA   . GLY A 1 12 ? 1.948   9.693   6.439   1.00 0.00 ? 76  GLY A CA   9  
ATOM   7895  C C    . GLY A 1 12 ? 1.619   10.144  5.047   1.00 0.00 ? 76  GLY A C    9  
ATOM   7896  O O    . GLY A 1 12 ? 1.062   11.234  4.848   1.00 0.00 ? 76  GLY A O    9  
ATOM   7897  H H    . GLY A 1 12 ? 2.567   7.683   6.472   1.00 0.00 ? 76  GLY A H    9  
ATOM   7898  H HA2  . GLY A 1 12 ? 1.039   9.358   6.916   1.00 0.00 ? 76  GLY A HA2  9  
ATOM   7899  H HA3  . GLY A 1 12 ? 2.356   10.524  6.994   1.00 0.00 ? 76  GLY A HA3  9  
ATOM   7900  N N    . ASP A 1 13 ? 1.963   9.338   4.076   1.00 0.00 ? 77  ASP A N    9  
ATOM   7901  C CA   . ASP A 1 13 ? 1.681   9.678   2.698   1.00 0.00 ? 77  ASP A CA   9  
ATOM   7902  C C    . ASP A 1 13 ? 0.475   8.943   2.252   1.00 0.00 ? 77  ASP A C    9  
ATOM   7903  O O    . ASP A 1 13 ? 0.123   7.896   2.829   1.00 0.00 ? 77  ASP A O    9  
ATOM   7904  C CB   . ASP A 1 13 ? 2.798   9.261   1.782   1.00 0.00 ? 77  ASP A CB   9  
ATOM   7905  C CG   . ASP A 1 13 ? 3.104   10.318  0.749   1.00 0.00 ? 77  ASP A CG   9  
ATOM   7906  O OD1  . ASP A 1 13 ? 2.189   10.743  0.027   1.00 0.00 ? 77  ASP A OD1  9  
ATOM   7907  O OD2  . ASP A 1 13 ? 4.262   10.760  0.668   1.00 0.00 ? 77  ASP A OD2  9  
ATOM   7908  H H    . ASP A 1 13 ? 2.419   8.496   4.281   1.00 0.00 ? 77  ASP A H    9  
ATOM   7909  H HA   . ASP A 1 13 ? 1.533   10.745  2.614   1.00 0.00 ? 77  ASP A HA   9  
ATOM   7910  H HB2  . ASP A 1 13 ? 3.647   8.984   2.376   1.00 0.00 ? 77  ASP A HB2  9  
ATOM   7911  H HB3  . ASP A 1 13 ? 2.466   8.371   1.266   1.00 0.00 ? 77  ASP A HB3  9  
ATOM   7912  N N    . LYS A 1 14 ? -0.131  9.432   1.227   1.00 0.00 ? 78  LYS A N    9  
ATOM   7913  C CA   . LYS A 1 14 ? -1.248  8.785   0.669   1.00 0.00 ? 78  LYS A CA   9  
ATOM   7914  C C    . LYS A 1 14 ? -0.814  7.979   -0.519  1.00 0.00 ? 78  LYS A C    9  
ATOM   7915  O O    . LYS A 1 14 ? -0.121  8.473   -1.415  1.00 0.00 ? 78  LYS A O    9  
ATOM   7916  C CB   . LYS A 1 14 ? -2.328  9.778   0.260   1.00 0.00 ? 78  LYS A CB   9  
ATOM   7917  C CG   . LYS A 1 14 ? -3.083  10.422  1.402   1.00 0.00 ? 78  LYS A CG   9  
ATOM   7918  C CD   . LYS A 1 14 ? -3.860  9.382   2.198   1.00 0.00 ? 78  LYS A CD   9  
ATOM   7919  C CE   . LYS A 1 14 ? -4.839  10.033  3.156   1.00 0.00 ? 78  LYS A CE   9  
ATOM   7920  N NZ   . LYS A 1 14 ? -5.902  10.768  2.436   1.00 0.00 ? 78  LYS A NZ   9  
ATOM   7921  H H    . LYS A 1 14 ? 0.229   10.241  0.802   1.00 0.00 ? 78  LYS A H    9  
ATOM   7922  H HA   . LYS A 1 14 ? -1.645  8.124   1.422   1.00 0.00 ? 78  LYS A HA   9  
ATOM   7923  H HB2  . LYS A 1 14 ? -1.875  10.565  -0.324  1.00 0.00 ? 78  LYS A HB2  9  
ATOM   7924  H HB3  . LYS A 1 14 ? -3.043  9.258   -0.359  1.00 0.00 ? 78  LYS A HB3  9  
ATOM   7925  H HG2  . LYS A 1 14 ? -2.364  10.892  2.054   1.00 0.00 ? 78  LYS A HG2  9  
ATOM   7926  H HG3  . LYS A 1 14 ? -3.764  11.163  1.015   1.00 0.00 ? 78  LYS A HG3  9  
ATOM   7927  H HD2  . LYS A 1 14 ? -4.411  8.751   1.516   1.00 0.00 ? 78  LYS A HD2  9  
ATOM   7928  H HD3  . LYS A 1 14 ? -3.164  8.780   2.763   1.00 0.00 ? 78  LYS A HD3  9  
ATOM   7929  H HE2  . LYS A 1 14 ? -5.293  9.265   3.764   1.00 0.00 ? 78  LYS A HE2  9  
ATOM   7930  H HE3  . LYS A 1 14 ? -4.300  10.723  3.789   1.00 0.00 ? 78  LYS A HE3  9  
ATOM   7931  H HZ1  . LYS A 1 14 ? -6.449  10.124  1.819   1.00 0.00 ? 78  LYS A HZ1  9  
ATOM   7932  H HZ2  . LYS A 1 14 ? -6.570  11.214  3.097   1.00 0.00 ? 78  LYS A HZ2  9  
ATOM   7933  H HZ3  . LYS A 1 14 ? -5.495  11.512  1.833   1.00 0.00 ? 78  LYS A HZ3  9  
ATOM   7934  N N    . CYS A 1 15 ? -1.225  6.773   -0.529  1.00 0.00 ? 79  CYS A N    9  
ATOM   7935  C CA   . CYS A 1 15 ? -0.949  5.879   -1.597  1.00 0.00 ? 79  CYS A CA   9  
ATOM   7936  C C    . CYS A 1 15 ? -2.191  5.085   -1.880  1.00 0.00 ? 79  CYS A C    9  
ATOM   7937  O O    . CYS A 1 15 ? -3.207  5.250   -1.204  1.00 0.00 ? 79  CYS A O    9  
ATOM   7938  C CB   . CYS A 1 15 ? 0.185   4.938   -1.203  1.00 0.00 ? 79  CYS A CB   9  
ATOM   7939  S SG   . CYS A 1 15 ? -0.133  3.966   0.304   1.00 0.00 ? 79  CYS A SG   9  
ATOM   7940  H H    . CYS A 1 15 ? -1.741  6.438   0.237   1.00 0.00 ? 79  CYS A H    9  
ATOM   7941  H HA   . CYS A 1 15 ? -0.659  6.438   -2.474  1.00 0.00 ? 79  CYS A HA   9  
ATOM   7942  H HB2  . CYS A 1 15 ? 0.342   4.255   -2.026  1.00 0.00 ? 79  CYS A HB2  9  
ATOM   7943  H HB3  . CYS A 1 15 ? 1.091   5.507   -1.060  1.00 0.00 ? 79  CYS A HB3  9  
ATOM   7944  H HG   . CYS A 1 15 ? -1.197  4.426   0.952   1.00 0.00 ? 79  CYS A HG   9  
ATOM   7945  N N    . MET A 1 16 ? -2.149  4.285   -2.873  1.00 0.00 ? 80  MET A N    9  
ATOM   7946  C CA   . MET A 1 16 ? -3.225  3.393   -3.134  1.00 0.00 ? 80  MET A CA   9  
ATOM   7947  C C    . MET A 1 16 ? -2.677  2.015   -3.026  1.00 0.00 ? 80  MET A C    9  
ATOM   7948  O O    . MET A 1 16 ? -1.633  1.717   -3.602  1.00 0.00 ? 80  MET A O    9  
ATOM   7949  C CB   . MET A 1 16 ? -3.870  3.613   -4.501  1.00 0.00 ? 80  MET A CB   9  
ATOM   7950  C CG   . MET A 1 16 ? -4.290  5.048   -4.768  1.00 0.00 ? 80  MET A CG   9  
ATOM   7951  S SD   . MET A 1 16 ? -5.333  5.226   -6.228  1.00 0.00 ? 80  MET A SD   9  
ATOM   7952  C CE   . MET A 1 16 ? -6.815  4.385   -5.666  1.00 0.00 ? 80  MET A CE   9  
ATOM   7953  H H    . MET A 1 16 ? -1.350  4.297   -3.449  1.00 0.00 ? 80  MET A H    9  
ATOM   7954  H HA   . MET A 1 16 ? -3.958  3.533   -2.353  1.00 0.00 ? 80  MET A HA   9  
ATOM   7955  H HB2  . MET A 1 16 ? -3.185  3.295   -5.270  1.00 0.00 ? 80  MET A HB2  9  
ATOM   7956  H HB3  . MET A 1 16 ? -4.748  2.988   -4.552  1.00 0.00 ? 80  MET A HB3  9  
ATOM   7957  H HG2  . MET A 1 16 ? -4.830  5.418   -3.910  1.00 0.00 ? 80  MET A HG2  9  
ATOM   7958  H HG3  . MET A 1 16 ? -3.391  5.627   -4.911  1.00 0.00 ? 80  MET A HG3  9  
ATOM   7959  H HE1  . MET A 1 16 ? -7.152  4.864   -4.757  1.00 0.00 ? 80  MET A HE1  9  
ATOM   7960  H HE2  . MET A 1 16 ? -7.584  4.455   -6.420  1.00 0.00 ? 80  MET A HE2  9  
ATOM   7961  H HE3  . MET A 1 16 ? -6.595  3.349   -5.461  1.00 0.00 ? 80  MET A HE3  9  
ATOM   7962  N N    . ALA A 1 17 ? -3.343  1.195   -2.300  1.00 0.00 ? 81  ALA A N    9  
ATOM   7963  C CA   . ALA A 1 17 ? -2.885  -0.129  -2.041  1.00 0.00 ? 81  ALA A CA   9  
ATOM   7964  C C    . ALA A 1 17 ? -3.864  -1.106  -2.588  1.00 0.00 ? 81  ALA A C    9  
ATOM   7965  O O    . ALA A 1 17 ? -5.050  -0.792  -2.733  1.00 0.00 ? 81  ALA A O    9  
ATOM   7966  C CB   . ALA A 1 17 ? -2.731  -0.337  -0.552  1.00 0.00 ? 81  ALA A CB   9  
ATOM   7967  H H    . ALA A 1 17 ? -4.212  1.482   -1.936  1.00 0.00 ? 81  ALA A H    9  
ATOM   7968  H HA   . ALA A 1 17 ? -1.920  -0.269  -2.505  1.00 0.00 ? 81  ALA A HA   9  
ATOM   7969  H HB1  . ALA A 1 17 ? -3.682  -0.154  -0.073  1.00 0.00 ? 81  ALA A HB1  9  
ATOM   7970  H HB2  . ALA A 1 17 ? -2.426  -1.355  -0.354  1.00 0.00 ? 81  ALA A HB2  9  
ATOM   7971  H HB3  . ALA A 1 17 ? -1.993  0.346   -0.159  1.00 0.00 ? 81  ALA A HB3  9  
ATOM   7972  N N    . VAL A 1 18 ? -3.380  -2.258  -2.926  1.00 0.00 ? 82  VAL A N    9  
ATOM   7973  C CA   . VAL A 1 18 ? -4.218  -3.310  -3.399  1.00 0.00 ? 82  VAL A CA   9  
ATOM   7974  C C    . VAL A 1 18 ? -4.651  -4.111  -2.197  1.00 0.00 ? 82  VAL A C    9  
ATOM   7975  O O    . VAL A 1 18 ? -3.822  -4.731  -1.542  1.00 0.00 ? 82  VAL A O    9  
ATOM   7976  C CB   . VAL A 1 18 ? -3.462  -4.227  -4.401  1.00 0.00 ? 82  VAL A CB   9  
ATOM   7977  C CG1  . VAL A 1 18 ? -4.373  -5.324  -4.938  1.00 0.00 ? 82  VAL A CG1  9  
ATOM   7978  C CG2  . VAL A 1 18 ? -2.880  -3.410  -5.545  1.00 0.00 ? 82  VAL A CG2  9  
ATOM   7979  H H    . VAL A 1 18 ? -2.419  -2.424  -2.832  1.00 0.00 ? 82  VAL A H    9  
ATOM   7980  H HA   . VAL A 1 18 ? -5.090  -2.889  -3.877  1.00 0.00 ? 82  VAL A HA   9  
ATOM   7981  H HB   . VAL A 1 18 ? -2.647  -4.699  -3.871  1.00 0.00 ? 82  VAL A HB   9  
ATOM   7982  H HG11 . VAL A 1 18 ? -5.214  -4.878  -5.450  1.00 0.00 ? 82  VAL A HG11 9  
ATOM   7983  H HG12 . VAL A 1 18 ? -3.823  -5.948  -5.626  1.00 0.00 ? 82  VAL A HG12 9  
ATOM   7984  H HG13 . VAL A 1 18 ? -4.736  -5.925  -4.118  1.00 0.00 ? 82  VAL A HG13 9  
ATOM   7985  H HG21 . VAL A 1 18 ? -2.192  -2.677  -5.150  1.00 0.00 ? 82  VAL A HG21 9  
ATOM   7986  H HG22 . VAL A 1 18 ? -2.364  -4.063  -6.233  1.00 0.00 ? 82  VAL A HG22 9  
ATOM   7987  H HG23 . VAL A 1 18 ? -3.683  -2.907  -6.062  1.00 0.00 ? 82  VAL A HG23 9  
ATOM   7988  N N    . TRP A 1 19 ? -5.929  -4.062  -1.902  1.00 0.00 ? 83  TRP A N    9  
ATOM   7989  C CA   . TRP A 1 19 ? -6.494  -4.752  -0.778  1.00 0.00 ? 83  TRP A CA   9  
ATOM   7990  C C    . TRP A 1 19 ? -6.378  -6.218  -1.031  1.00 0.00 ? 83  TRP A C    9  
ATOM   7991  O O    . TRP A 1 19 ? -6.958  -6.724  -2.005  1.00 0.00 ? 83  TRP A O    9  
ATOM   7992  C CB   . TRP A 1 19 ? -7.964  -4.369  -0.618  1.00 0.00 ? 83  TRP A CB   9  
ATOM   7993  C CG   . TRP A 1 19 ? -8.591  -4.796  0.683   1.00 0.00 ? 83  TRP A CG   9  
ATOM   7994  C CD1  . TRP A 1 19 ? -7.965  -4.936  1.879   1.00 0.00 ? 83  TRP A CD1  9  
ATOM   7995  C CD2  . TRP A 1 19 ? -9.969  -5.080  0.927   1.00 0.00 ? 83  TRP A CD2  9  
ATOM   7996  N NE1  . TRP A 1 19 ? -8.846  -5.298  2.848   1.00 0.00 ? 83  TRP A NE1  9  
ATOM   7997  C CE2  . TRP A 1 19 ? -10.091 -5.391  2.295   1.00 0.00 ? 83  TRP A CE2  9  
ATOM   7998  C CE3  . TRP A 1 19 ? -11.110 -5.107  0.132   1.00 0.00 ? 83  TRP A CE3  9  
ATOM   7999  C CZ2  . TRP A 1 19 ? -11.306 -5.720  2.873   1.00 0.00 ? 83  TRP A CZ2  9  
ATOM   8000  C CZ3  . TRP A 1 19 ? -12.313 -5.438  0.717   1.00 0.00 ? 83  TRP A CZ3  9  
ATOM   8001  C CH2  . TRP A 1 19 ? -12.393 -5.738  2.074   1.00 0.00 ? 83  TRP A CH2  9  
ATOM   8002  H H    . TRP A 1 19 ? -6.516  -3.536  -2.486  1.00 0.00 ? 83  TRP A H    9  
ATOM   8003  H HA   . TRP A 1 19 ? -5.952  -4.482  0.115   1.00 0.00 ? 83  TRP A HA   9  
ATOM   8004  H HB2  . TRP A 1 19 ? -8.048  -3.299  -0.703  1.00 0.00 ? 83  TRP A HB2  9  
ATOM   8005  H HB3  . TRP A 1 19 ? -8.521  -4.825  -1.425  1.00 0.00 ? 83  TRP A HB3  9  
ATOM   8006  H HD1  . TRP A 1 19 ? -6.907  -4.792  2.011   1.00 0.00 ? 83  TRP A HD1  9  
ATOM   8007  H HE1  . TRP A 1 19 ? -8.600  -5.457  3.788   1.00 0.00 ? 83  TRP A HE1  9  
ATOM   8008  H HE3  . TRP A 1 19 ? -11.065 -4.872  -0.921  1.00 0.00 ? 83  TRP A HE3  9  
ATOM   8009  H HZ2  . TRP A 1 19 ? -11.413 -5.959  3.919   1.00 0.00 ? 83  TRP A HZ2  9  
ATOM   8010  H HZ3  . TRP A 1 19 ? -13.223 -5.466  0.138   1.00 0.00 ? 83  TRP A HZ3  9  
ATOM   8011  H HH2  . TRP A 1 19 ? -13.350 -5.991  2.499   1.00 0.00 ? 83  TRP A HH2  9  
ATOM   8012  N N    . SER A 1 20 ? -5.665  -6.900  -0.169  1.00 0.00 ? 84  SER A N    9  
ATOM   8013  C CA   . SER A 1 20 ? -5.404  -8.324  -0.311  1.00 0.00 ? 84  SER A CA   9  
ATOM   8014  C C    . SER A 1 20 ? -6.707  -9.135  -0.336  1.00 0.00 ? 84  SER A C    9  
ATOM   8015  O O    . SER A 1 20 ? -6.745  -10.247 -0.854  1.00 0.00 ? 84  SER A O    9  
ATOM   8016  C CB   . SER A 1 20 ? -4.479  -8.807  0.825   1.00 0.00 ? 84  SER A CB   9  
ATOM   8017  O OG   . SER A 1 20 ? -4.123  -10.186 0.685   1.00 0.00 ? 84  SER A OG   9  
ATOM   8018  H H    . SER A 1 20 ? -5.273  -6.407  0.595   1.00 0.00 ? 84  SER A H    9  
ATOM   8019  H HA   . SER A 1 20 ? -4.894  -8.469  -1.252  1.00 0.00 ? 84  SER A HA   9  
ATOM   8020  H HB2  . SER A 1 20 ? -3.575  -8.218  0.815   1.00 0.00 ? 84  SER A HB2  9  
ATOM   8021  H HB3  . SER A 1 20 ? -4.983  -8.671  1.770   1.00 0.00 ? 84  SER A HB3  9  
ATOM   8022  H HG   . SER A 1 20 ? -4.946  -10.696 0.623   1.00 0.00 ? 84  SER A HG   9  
ATOM   8023  N N    . GLU A 1 21 ? -7.771  -8.561  0.178   1.00 0.00 ? 85  GLU A N    9  
ATOM   8024  C CA   . GLU A 1 21 ? -9.030  -9.249  0.247   1.00 0.00 ? 85  GLU A CA   9  
ATOM   8025  C C    . GLU A 1 21 ? -9.775  -9.226  -1.067  1.00 0.00 ? 85  GLU A C    9  
ATOM   8026  O O    . GLU A 1 21 ? -10.335 -10.234 -1.480  1.00 0.00 ? 85  GLU A O    9  
ATOM   8027  C CB   . GLU A 1 21 ? -9.896  -8.639  1.308   1.00 0.00 ? 85  GLU A CB   9  
ATOM   8028  C CG   . GLU A 1 21 ? -9.301  -8.696  2.683   1.00 0.00 ? 85  GLU A CG   9  
ATOM   8029  C CD   . GLU A 1 21 ? -9.044  -10.113 3.131   1.00 0.00 ? 85  GLU A CD   9  
ATOM   8030  O OE1  . GLU A 1 21 ? -10.018 -10.854 3.381   1.00 0.00 ? 85  GLU A OE1  9  
ATOM   8031  O OE2  . GLU A 1 21 ? -7.876  -10.514 3.245   1.00 0.00 ? 85  GLU A OE2  9  
ATOM   8032  H H    . GLU A 1 21 ? -7.692  -7.644  0.524   1.00 0.00 ? 85  GLU A H    9  
ATOM   8033  H HA   . GLU A 1 21 ? -8.841  -10.275 0.525   1.00 0.00 ? 85  GLU A HA   9  
ATOM   8034  H HB2  . GLU A 1 21 ? -10.067 -7.602  1.056   1.00 0.00 ? 85  GLU A HB2  9  
ATOM   8035  H HB3  . GLU A 1 21 ? -10.844 -9.152  1.322   1.00 0.00 ? 85  GLU A HB3  9  
ATOM   8036  H HG2  . GLU A 1 21 ? -8.398  -8.109  2.650   1.00 0.00 ? 85  GLU A HG2  9  
ATOM   8037  H HG3  . GLU A 1 21 ? -9.958  -8.182  3.365   1.00 0.00 ? 85  GLU A HG3  9  
ATOM   8038  N N    . ASP A 1 22 ? -9.777  -8.097  -1.732  1.00 0.00 ? 86  ASP A N    9  
ATOM   8039  C CA   . ASP A 1 22 ? -10.609 -7.977  -2.932  1.00 0.00 ? 86  ASP A CA   9  
ATOM   8040  C C    . ASP A 1 22 ? -9.769  -7.967  -4.197  1.00 0.00 ? 86  ASP A C    9  
ATOM   8041  O O    . ASP A 1 22 ? -10.259 -8.269  -5.281  1.00 0.00 ? 86  ASP A O    9  
ATOM   8042  C CB   . ASP A 1 22 ? -11.433 -6.697  -2.849  1.00 0.00 ? 86  ASP A CB   9  
ATOM   8043  C CG   . ASP A 1 22 ? -12.644 -6.693  -3.750  1.00 0.00 ? 86  ASP A CG   9  
ATOM   8044  O OD1  . ASP A 1 22 ? -12.557 -6.287  -4.906  1.00 0.00 ? 86  ASP A OD1  9  
ATOM   8045  O OD2  . ASP A 1 22 ? -13.739 -7.059  -3.268  1.00 0.00 ? 86  ASP A OD2  9  
ATOM   8046  H H    . ASP A 1 22 ? -9.225  -7.357  -1.406  1.00 0.00 ? 86  ASP A H    9  
ATOM   8047  H HA   . ASP A 1 22 ? -11.286 -8.817  -2.960  1.00 0.00 ? 86  ASP A HA   9  
ATOM   8048  H HB2  . ASP A 1 22 ? -11.783 -6.579  -1.835  1.00 0.00 ? 86  ASP A HB2  9  
ATOM   8049  H HB3  . ASP A 1 22 ? -10.807 -5.856  -3.109  1.00 0.00 ? 86  ASP A HB3  9  
ATOM   8050  N N    . GLY A 1 23 ? -8.494  -7.666  -4.050  1.00 0.00 ? 87  GLY A N    9  
ATOM   8051  C CA   . GLY A 1 23 ? -7.602  -7.597  -5.192  1.00 0.00 ? 87  GLY A CA   9  
ATOM   8052  C C    . GLY A 1 23 ? -7.756  -6.294  -5.958  1.00 0.00 ? 87  GLY A C    9  
ATOM   8053  O O    . GLY A 1 23 ? -7.368  -6.192  -7.118  1.00 0.00 ? 87  GLY A O    9  
ATOM   8054  H H    . GLY A 1 23 ? -8.114  -7.502  -3.157  1.00 0.00 ? 87  GLY A H    9  
ATOM   8055  H HA2  . GLY A 1 23 ? -6.582  -7.685  -4.847  1.00 0.00 ? 87  GLY A HA2  9  
ATOM   8056  H HA3  . GLY A 1 23 ? -7.823  -8.421  -5.853  1.00 0.00 ? 87  GLY A HA3  9  
ATOM   8057  N N    . GLN A 1 24 ? -8.343  -5.308  -5.317  1.00 0.00 ? 88  GLN A N    9  
ATOM   8058  C CA   . GLN A 1 24 ? -8.560  -4.006  -5.929  1.00 0.00 ? 88  GLN A CA   9  
ATOM   8059  C C    . GLN A 1 24 ? -7.751  -2.947  -5.237  1.00 0.00 ? 88  GLN A C    9  
ATOM   8060  O O    . GLN A 1 24 ? -7.270  -3.169  -4.131  1.00 0.00 ? 88  GLN A O    9  
ATOM   8061  C CB   . GLN A 1 24 ? -10.030 -3.640  -5.935  1.00 0.00 ? 88  GLN A CB   9  
ATOM   8062  C CG   . GLN A 1 24 ? -10.866 -4.484  -6.856  1.00 0.00 ? 88  GLN A CG   9  
ATOM   8063  C CD   . GLN A 1 24 ? -10.503 -4.312  -8.313  1.00 0.00 ? 88  GLN A CD   9  
ATOM   8064  O OE1  . GLN A 1 24 ? -11.054 -3.459  -8.993  1.00 0.00 ? 88  GLN A OE1  9  
ATOM   8065  N NE2  . GLN A 1 24 ? -9.597  -5.111  -8.802  1.00 0.00 ? 88  GLN A NE2  9  
ATOM   8066  H H    . GLN A 1 24 ? -8.611  -5.449  -4.386  1.00 0.00 ? 88  GLN A H    9  
ATOM   8067  H HA   . GLN A 1 24 ? -8.223  -4.083  -6.950  1.00 0.00 ? 88  GLN A HA   9  
ATOM   8068  H HB2  . GLN A 1 24 ? -10.421 -3.756  -4.935  1.00 0.00 ? 88  GLN A HB2  9  
ATOM   8069  H HB3  . GLN A 1 24 ? -10.133 -2.607  -6.232  1.00 0.00 ? 88  GLN A HB3  9  
ATOM   8070  H HG2  . GLN A 1 24 ? -10.746 -5.522  -6.587  1.00 0.00 ? 88  GLN A HG2  9  
ATOM   8071  H HG3  . GLN A 1 24 ? -11.889 -4.175  -6.718  1.00 0.00 ? 88  GLN A HG3  9  
ATOM   8072  H HE21 . GLN A 1 24 ? -9.188  -5.787  -8.217  1.00 0.00 ? 88  GLN A HE21 9  
ATOM   8073  H HE22 . GLN A 1 24 ? -9.352  -5.013  -9.747  1.00 0.00 ? 88  GLN A HE22 9  
ATOM   8074  N N    . CYS A 1 25 ? -7.636  -1.797  -5.849  1.00 0.00 ? 89  CYS A N    9  
ATOM   8075  C CA   . CYS A 1 25 ? -6.827  -0.733  -5.284  1.00 0.00 ? 89  CYS A CA   9  
ATOM   8076  C C    . CYS A 1 25 ? -7.687  0.343   -4.631  1.00 0.00 ? 89  CYS A C    9  
ATOM   8077  O O    . CYS A 1 25 ? -8.698  0.778   -5.196  1.00 0.00 ? 89  CYS A O    9  
ATOM   8078  C CB   . CYS A 1 25 ? -5.853  -0.149  -6.323  1.00 0.00 ? 89  CYS A CB   9  
ATOM   8079  S SG   . CYS A 1 25 ? -6.608  0.429   -7.865  1.00 0.00 ? 89  CYS A SG   9  
ATOM   8080  H H    . CYS A 1 25 ? -8.140  -1.659  -6.680  1.00 0.00 ? 89  CYS A H    9  
ATOM   8081  H HA   . CYS A 1 25 ? -6.249  -1.185  -4.491  1.00 0.00 ? 89  CYS A HA   9  
ATOM   8082  H HB2  . CYS A 1 25 ? -5.349  0.698   -5.883  1.00 0.00 ? 89  CYS A HB2  9  
ATOM   8083  H HB3  . CYS A 1 25 ? -5.121  -0.903  -6.573  1.00 0.00 ? 89  CYS A HB3  9  
ATOM   8084  H HG   . CYS A 1 25 ? -7.925  0.312   -7.746  1.00 0.00 ? 89  CYS A HG   9  
ATOM   8085  N N    . TYR A 1 26 ? -7.289  0.739   -3.441  1.00 0.00 ? 90  TYR A N    9  
ATOM   8086  C CA   . TYR A 1 26 ? -8.012  1.697   -2.614  1.00 0.00 ? 90  TYR A CA   9  
ATOM   8087  C C    . TYR A 1 26 ? -7.009  2.652   -1.987  1.00 0.00 ? 90  TYR A C    9  
ATOM   8088  O O    . TYR A 1 26 ? -5.827  2.312   -1.894  1.00 0.00 ? 90  TYR A O    9  
ATOM   8089  C CB   . TYR A 1 26 ? -8.768  0.950   -1.505  1.00 0.00 ? 90  TYR A CB   9  
ATOM   8090  C CG   . TYR A 1 26 ? -9.801  -0.056  -1.994  1.00 0.00 ? 90  TYR A CG   9  
ATOM   8091  C CD1  . TYR A 1 26 ? -9.425  -1.347  -2.337  1.00 0.00 ? 90  TYR A CD1  9  
ATOM   8092  C CD2  . TYR A 1 26 ? -11.138 0.279   -2.098  1.00 0.00 ? 90  TYR A CD2  9  
ATOM   8093  C CE1  . TYR A 1 26 ? -10.345 -2.267  -2.769  1.00 0.00 ? 90  TYR A CE1  9  
ATOM   8094  C CE2  . TYR A 1 26 ? -12.071 -0.643  -2.532  1.00 0.00 ? 90  TYR A CE2  9  
ATOM   8095  C CZ   . TYR A 1 26 ? -11.665 -1.915  -2.866  1.00 0.00 ? 90  TYR A CZ   9  
ATOM   8096  O OH   . TYR A 1 26 ? -12.584 -2.835  -3.309  1.00 0.00 ? 90  TYR A OH   9  
ATOM   8097  H H    . TYR A 1 26 ? -6.453  0.371   -3.072  1.00 0.00 ? 90  TYR A H    9  
ATOM   8098  H HA   . TYR A 1 26 ? -8.713  2.240   -3.228  1.00 0.00 ? 90  TYR A HA   9  
ATOM   8099  H HB2  . TYR A 1 26 ? -8.040  0.400   -0.927  1.00 0.00 ? 90  TYR A HB2  9  
ATOM   8100  H HB3  . TYR A 1 26 ? -9.253  1.656   -0.850  1.00 0.00 ? 90  TYR A HB3  9  
ATOM   8101  H HD1  . TYR A 1 26 ? -8.385  -1.625  -2.263  1.00 0.00 ? 90  TYR A HD1  9  
ATOM   8102  H HD2  . TYR A 1 26 ? -11.451 1.277   -1.834  1.00 0.00 ? 90  TYR A HD2  9  
ATOM   8103  H HE1  . TYR A 1 26 ? -10.015 -3.261  -3.031  1.00 0.00 ? 90  TYR A HE1  9  
ATOM   8104  H HE2  . TYR A 1 26 ? -13.112 -0.367  -2.606  1.00 0.00 ? 90  TYR A HE2  9  
ATOM   8105  H HH   . TYR A 1 26 ? -13.088 -2.399  -4.009  1.00 0.00 ? 90  TYR A HH   9  
ATOM   8106  N N    . GLU A 1 27 ? -7.454  3.826   -1.577  1.00 0.00 ? 91  GLU A N    9  
ATOM   8107  C CA   . GLU A 1 27 ? -6.568  4.816   -0.983  1.00 0.00 ? 91  GLU A CA   9  
ATOM   8108  C C    . GLU A 1 27 ? -6.193  4.394   0.431   1.00 0.00 ? 91  GLU A C    9  
ATOM   8109  O O    . GLU A 1 27 ? -7.051  4.036   1.249   1.00 0.00 ? 91  GLU A O    9  
ATOM   8110  C CB   . GLU A 1 27 ? -7.211  6.212   -0.955  1.00 0.00 ? 91  GLU A CB   9  
ATOM   8111  C CG   . GLU A 1 27 ? -6.272  7.308   -0.448  1.00 0.00 ? 91  GLU A CG   9  
ATOM   8112  C CD   . GLU A 1 27 ? -6.937  8.652   -0.304  1.00 0.00 ? 91  GLU A CD   9  
ATOM   8113  O OE1  . GLU A 1 27 ? -7.223  9.323   -1.328  1.00 0.00 ? 91  GLU A OE1  9  
ATOM   8114  O OE2  . GLU A 1 27 ? -7.197  9.074   0.834   1.00 0.00 ? 91  GLU A OE2  9  
ATOM   8115  H H    . GLU A 1 27 ? -8.413  4.026   -1.635  1.00 0.00 ? 91  GLU A H    9  
ATOM   8116  H HA   . GLU A 1 27 ? -5.669  4.852   -1.581  1.00 0.00 ? 91  GLU A HA   9  
ATOM   8117  H HB2  . GLU A 1 27 ? -7.519  6.472   -1.956  1.00 0.00 ? 91  GLU A HB2  9  
ATOM   8118  H HB3  . GLU A 1 27 ? -8.077  6.185   -0.311  1.00 0.00 ? 91  GLU A HB3  9  
ATOM   8119  H HG2  . GLU A 1 27 ? -5.902  7.014   0.523   1.00 0.00 ? 91  GLU A HG2  9  
ATOM   8120  H HG3  . GLU A 1 27 ? -5.444  7.396   -1.135  1.00 0.00 ? 91  GLU A HG3  9  
ATOM   8121  N N    . ALA A 1 28 ? -4.932  4.432   0.708   1.00 0.00 ? 92  ALA A N    9  
ATOM   8122  C CA   . ALA A 1 28 ? -4.418  4.046   1.980   1.00 0.00 ? 92  ALA A CA   9  
ATOM   8123  C C    . ALA A 1 28 ? -3.286  4.960   2.388   1.00 0.00 ? 92  ALA A C    9  
ATOM   8124  O O    . ALA A 1 28 ? -2.542  5.455   1.539   1.00 0.00 ? 92  ALA A O    9  
ATOM   8125  C CB   . ALA A 1 28 ? -3.938  2.620   1.917   1.00 0.00 ? 92  ALA A CB   9  
ATOM   8126  H H    . ALA A 1 28 ? -4.303  4.744   0.015   1.00 0.00 ? 92  ALA A H    9  
ATOM   8127  H HA   . ALA A 1 28 ? -5.213  4.104   2.708   1.00 0.00 ? 92  ALA A HA   9  
ATOM   8128  H HB1  . ALA A 1 28 ? -3.116  2.548   1.219   1.00 0.00 ? 92  ALA A HB1  9  
ATOM   8129  H HB2  . ALA A 1 28 ? -3.606  2.316   2.900   1.00 0.00 ? 92  ALA A HB2  9  
ATOM   8130  H HB3  . ALA A 1 28 ? -4.745  1.977   1.595   1.00 0.00 ? 92  ALA A HB3  9  
ATOM   8131  N N    . GLU A 1 29 ? -3.153  5.186   3.659   1.00 0.00 ? 93  GLU A N    9  
ATOM   8132  C CA   . GLU A 1 29 ? -2.100  6.019   4.169   1.00 0.00 ? 93  GLU A CA   9  
ATOM   8133  C C    . GLU A 1 29 ? -1.054  5.136   4.815   1.00 0.00 ? 93  GLU A C    9  
ATOM   8134  O O    . GLU A 1 29 ? -1.385  4.176   5.517   1.00 0.00 ? 93  GLU A O    9  
ATOM   8135  C CB   . GLU A 1 29 ? -2.647  7.052   5.156   1.00 0.00 ? 93  GLU A CB   9  
ATOM   8136  C CG   . GLU A 1 29 ? -1.622  8.079   5.632   1.00 0.00 ? 93  GLU A CG   9  
ATOM   8137  C CD   . GLU A 1 29 ? -2.247  9.121   6.519   1.00 0.00 ? 93  GLU A CD   9  
ATOM   8138  O OE1  . GLU A 1 29 ? -2.868  10.060  6.005   1.00 0.00 ? 93  GLU A OE1  9  
ATOM   8139  O OE2  . GLU A 1 29 ? -2.156  9.015   7.757   1.00 0.00 ? 93  GLU A OE2  9  
ATOM   8140  H H    . GLU A 1 29 ? -3.776  4.754   4.288   1.00 0.00 ? 93  GLU A H    9  
ATOM   8141  H HA   . GLU A 1 29 ? -1.649  6.526   3.329   1.00 0.00 ? 93  GLU A HA   9  
ATOM   8142  H HB2  . GLU A 1 29 ? -3.462  7.583   4.687   1.00 0.00 ? 93  GLU A HB2  9  
ATOM   8143  H HB3  . GLU A 1 29 ? -3.026  6.529   6.021   1.00 0.00 ? 93  GLU A HB3  9  
ATOM   8144  H HG2  . GLU A 1 29 ? -0.846  7.566   6.180   1.00 0.00 ? 93  GLU A HG2  9  
ATOM   8145  H HG3  . GLU A 1 29 ? -1.165  8.565   4.778   1.00 0.00 ? 93  GLU A HG3  9  
ATOM   8146  N N    . ILE A 1 30 ? 0.180   5.418   4.527   1.00 0.00 ? 94  ILE A N    9  
ATOM   8147  C CA   . ILE A 1 30 ? 1.303   4.651   5.046   1.00 0.00 ? 94  ILE A CA   9  
ATOM   8148  C C    . ILE A 1 30 ? 1.585   4.985   6.505   1.00 0.00 ? 94  ILE A C    9  
ATOM   8149  O O    . ILE A 1 30 ? 1.789   6.145   6.863   1.00 0.00 ? 94  ILE A O    9  
ATOM   8150  C CB   . ILE A 1 30 ? 2.562   4.902   4.201   1.00 0.00 ? 94  ILE A CB   9  
ATOM   8151  C CG1  . ILE A 1 30 ? 2.248   4.576   2.750   1.00 0.00 ? 94  ILE A CG1  9  
ATOM   8152  C CG2  . ILE A 1 30 ? 3.728   4.047   4.705   1.00 0.00 ? 94  ILE A CG2  9  
ATOM   8153  C CD1  . ILE A 1 30 ? 3.294   5.009   1.773   1.00 0.00 ? 94  ILE A CD1  9  
ATOM   8154  H H    . ILE A 1 30 ? 0.332   6.172   3.914   1.00 0.00 ? 94  ILE A H    9  
ATOM   8155  H HA   . ILE A 1 30 ? 1.054   3.602   4.984   1.00 0.00 ? 94  ILE A HA   9  
ATOM   8156  H HB   . ILE A 1 30 ? 2.832   5.946   4.273   1.00 0.00 ? 94  ILE A HB   9  
ATOM   8157  H HG12 . ILE A 1 30 ? 2.153   3.504   2.657   1.00 0.00 ? 94  ILE A HG12 9  
ATOM   8158  H HG13 . ILE A 1 30 ? 1.308   5.041   2.494   1.00 0.00 ? 94  ILE A HG13 9  
ATOM   8159  H HG21 . ILE A 1 30 ? 3.447   3.005   4.666   1.00 0.00 ? 94  ILE A HG21 9  
ATOM   8160  H HG22 . ILE A 1 30 ? 4.599   4.219   4.090   1.00 0.00 ? 94  ILE A HG22 9  
ATOM   8161  H HG23 . ILE A 1 30 ? 3.947   4.312   5.729   1.00 0.00 ? 94  ILE A HG23 9  
ATOM   8162  H HD11 . ILE A 1 30 ? 4.216   4.501   2.009   1.00 0.00 ? 94  ILE A HD11 9  
ATOM   8163  H HD12 . ILE A 1 30 ? 2.982   4.746   0.772   1.00 0.00 ? 94  ILE A HD12 9  
ATOM   8164  H HD13 . ILE A 1 30 ? 3.430   6.079   1.841   1.00 0.00 ? 94  ILE A HD13 9  
ATOM   8165  N N    . GLU A 1 31 ? 1.596   3.967   7.317   1.00 0.00 ? 95  GLU A N    9  
ATOM   8166  C CA   . GLU A 1 31 ? 1.850   4.075   8.743   1.00 0.00 ? 95  GLU A CA   9  
ATOM   8167  C C    . GLU A 1 31 ? 3.309   3.803   9.063   1.00 0.00 ? 95  GLU A C    9  
ATOM   8168  O O    . GLU A 1 31 ? 3.900   4.447   9.929   1.00 0.00 ? 95  GLU A O    9  
ATOM   8169  C CB   . GLU A 1 31 ? 0.985   3.075   9.479   1.00 0.00 ? 95  GLU A CB   9  
ATOM   8170  C CG   . GLU A 1 31 ? -0.493  3.345   9.352   1.00 0.00 ? 95  GLU A CG   9  
ATOM   8171  C CD   . GLU A 1 31 ? -0.919  4.585   10.094  1.00 0.00 ? 95  GLU A CD   9  
ATOM   8172  O OE1  . GLU A 1 31 ? -1.063  4.538   11.328  1.00 0.00 ? 95  GLU A OE1  9  
ATOM   8173  O OE2  . GLU A 1 31 ? -1.093  5.638   9.469   1.00 0.00 ? 95  GLU A OE2  9  
ATOM   8174  H H    . GLU A 1 31 ? 1.409   3.078   6.937   1.00 0.00 ? 95  GLU A H    9  
ATOM   8175  H HA   . GLU A 1 31 ? 1.585   5.067   9.074   1.00 0.00 ? 95  GLU A HA   9  
ATOM   8176  H HB2  . GLU A 1 31 ? 1.186   2.089   9.086   1.00 0.00 ? 95  GLU A HB2  9  
ATOM   8177  H HB3  . GLU A 1 31 ? 1.244   3.095   10.527  1.00 0.00 ? 95  GLU A HB3  9  
ATOM   8178  H HG2  . GLU A 1 31 ? -0.716  3.484   8.304   1.00 0.00 ? 95  GLU A HG2  9  
ATOM   8179  H HG3  . GLU A 1 31 ? -1.036  2.488   9.713   1.00 0.00 ? 95  GLU A HG3  9  
ATOM   8180  N N    . GLU A 1 32 ? 3.892   2.859   8.361   1.00 0.00 ? 96  GLU A N    9  
ATOM   8181  C CA   . GLU A 1 32 ? 5.259   2.474   8.612   1.00 0.00 ? 96  GLU A CA   9  
ATOM   8182  C C    . GLU A 1 32 ? 5.837   1.810   7.378   1.00 0.00 ? 96  GLU A C    9  
ATOM   8183  O O    . GLU A 1 32 ? 5.099   1.252   6.578   1.00 0.00 ? 96  GLU A O    9  
ATOM   8184  C CB   . GLU A 1 32 ? 5.338   1.537   9.828   1.00 0.00 ? 96  GLU A CB   9  
ATOM   8185  C CG   . GLU A 1 32 ? 6.754   1.220   10.257  1.00 0.00 ? 96  GLU A CG   9  
ATOM   8186  C CD   . GLU A 1 32 ? 7.535   2.472   10.574  1.00 0.00 ? 96  GLU A CD   9  
ATOM   8187  O OE1  . GLU A 1 32 ? 8.100   3.097   9.644   1.00 0.00 ? 96  GLU A OE1  9  
ATOM   8188  O OE2  . GLU A 1 32 ? 7.571   2.882   11.757  1.00 0.00 ? 96  GLU A OE2  9  
ATOM   8189  H H    . GLU A 1 32 ? 3.405   2.406   7.640   1.00 0.00 ? 96  GLU A H    9  
ATOM   8190  H HA   . GLU A 1 32 ? 5.823   3.370   8.823   1.00 0.00 ? 96  GLU A HA   9  
ATOM   8191  H HB2  . GLU A 1 32 ? 4.834   2.009   10.657  1.00 0.00 ? 96  GLU A HB2  9  
ATOM   8192  H HB3  . GLU A 1 32 ? 4.835   0.612   9.589   1.00 0.00 ? 96  GLU A HB3  9  
ATOM   8193  H HG2  . GLU A 1 32 ? 6.728   0.583   11.129  1.00 0.00 ? 96  GLU A HG2  9  
ATOM   8194  H HG3  . GLU A 1 32 ? 7.237   0.702   9.439   1.00 0.00 ? 96  GLU A HG3  9  
ATOM   8195  N N    . ILE A 1 33 ? 7.135   1.901   7.218   1.00 0.00 ? 97  ILE A N    9  
ATOM   8196  C CA   . ILE A 1 33 ? 7.829   1.345   6.071   1.00 0.00 ? 97  ILE A CA   9  
ATOM   8197  C C    . ILE A 1 33 ? 8.902   0.353   6.529   1.00 0.00 ? 97  ILE A C    9  
ATOM   8198  O O    . ILE A 1 33 ? 9.589   0.582   7.522   1.00 0.00 ? 97  ILE A O    9  
ATOM   8199  C CB   . ILE A 1 33 ? 8.493   2.491   5.269   1.00 0.00 ? 97  ILE A CB   9  
ATOM   8200  C CG1  . ILE A 1 33 ? 7.428   3.472   4.820   1.00 0.00 ? 97  ILE A CG1  9  
ATOM   8201  C CG2  . ILE A 1 33 ? 9.259   1.960   4.051   1.00 0.00 ? 97  ILE A CG2  9  
ATOM   8202  C CD1  . ILE A 1 33 ? 7.953   4.833   4.585   1.00 0.00 ? 97  ILE A CD1  9  
ATOM   8203  H H    . ILE A 1 33 ? 7.663   2.355   7.916   1.00 0.00 ? 97  ILE A H    9  
ATOM   8204  H HA   . ILE A 1 33 ? 7.112   0.848   5.433   1.00 0.00 ? 97  ILE A HA   9  
ATOM   8205  H HB   . ILE A 1 33 ? 9.186   3.010   5.914   1.00 0.00 ? 97  ILE A HB   9  
ATOM   8206  H HG12 . ILE A 1 33 ? 7.028   3.139   3.872   1.00 0.00 ? 97  ILE A HG12 9  
ATOM   8207  H HG13 . ILE A 1 33 ? 6.642   3.526   5.558   1.00 0.00 ? 97  ILE A HG13 9  
ATOM   8208  H HG21 . ILE A 1 33 ? 8.577   1.435   3.399   1.00 0.00 ? 97  ILE A HG21 9  
ATOM   8209  H HG22 . ILE A 1 33 ? 9.703   2.788   3.518   1.00 0.00 ? 97  ILE A HG22 9  
ATOM   8210  H HG23 . ILE A 1 33 ? 10.035  1.284   4.378   1.00 0.00 ? 97  ILE A HG23 9  
ATOM   8211  H HD11 . ILE A 1 33 ? 8.699   4.818   3.805   1.00 0.00 ? 97  ILE A HD11 9  
ATOM   8212  H HD12 . ILE A 1 33 ? 7.128   5.469   4.301   1.00 0.00 ? 97  ILE A HD12 9  
ATOM   8213  H HD13 . ILE A 1 33 ? 8.378   5.188   5.511   1.00 0.00 ? 97  ILE A HD13 9  
ATOM   8214  N N    . ASP A 1 34 ? 9.002   -0.735  5.821   1.00 0.00 ? 98  ASP A N    9  
ATOM   8215  C CA   . ASP A 1 34 ? 10.009  -1.754  6.029   1.00 0.00 ? 98  ASP A CA   9  
ATOM   8216  C C    . ASP A 1 34 ? 10.796  -1.870  4.742   1.00 0.00 ? 98  ASP A C    9  
ATOM   8217  O O    . ASP A 1 34 ? 10.361  -2.532  3.790   1.00 0.00 ? 98  ASP A O    9  
ATOM   8218  C CB   . ASP A 1 34 ? 9.349   -3.098  6.342   1.00 0.00 ? 98  ASP A CB   9  
ATOM   8219  C CG   . ASP A 1 34 ? 10.351  -4.190  6.644   1.00 0.00 ? 98  ASP A CG   9  
ATOM   8220  O OD1  . ASP A 1 34 ? 10.935  -4.744  5.703   1.00 0.00 ? 98  ASP A OD1  9  
ATOM   8221  O OD2  . ASP A 1 34 ? 10.551  -4.523  7.841   1.00 0.00 ? 98  ASP A OD2  9  
ATOM   8222  H H    . ASP A 1 34 ? 8.364   -0.890  5.087   1.00 0.00 ? 98  ASP A H    9  
ATOM   8223  H HA   . ASP A 1 34 ? 10.686  -1.479  6.824   1.00 0.00 ? 98  ASP A HA   9  
ATOM   8224  H HB2  . ASP A 1 34 ? 8.660   -2.989  7.165   1.00 0.00 ? 98  ASP A HB2  9  
ATOM   8225  H HB3  . ASP A 1 34 ? 8.786   -3.394  5.471   1.00 0.00 ? 98  ASP A HB3  9  
ATOM   8226  N N    . GLU A 1 35 ? 11.902  -1.172  4.681   1.00 0.00 ? 99  GLU A N    9  
ATOM   8227  C CA   . GLU A 1 35 ? 12.732  -1.116  3.485   1.00 0.00 ? 99  GLU A CA   9  
ATOM   8228  C C    . GLU A 1 35 ? 13.357  -2.466  3.136   1.00 0.00 ? 99  GLU A C    9  
ATOM   8229  O O    . GLU A 1 35 ? 13.638  -2.735  1.970   1.00 0.00 ? 99  GLU A O    9  
ATOM   8230  C CB   . GLU A 1 35 ? 13.819  -0.049  3.625   1.00 0.00 ? 99  GLU A CB   9  
ATOM   8231  C CG   . GLU A 1 35 ? 13.288  1.362   3.818   1.00 0.00 ? 99  GLU A CG   9  
ATOM   8232  C CD   . GLU A 1 35 ? 14.391  2.385   3.925   1.00 0.00 ? 99  GLU A CD   9  
ATOM   8233  O OE1  . GLU A 1 35 ? 14.902  2.611   5.039   1.00 0.00 ? 99  GLU A OE1  9  
ATOM   8234  O OE2  . GLU A 1 35 ? 14.763  2.996   2.898   1.00 0.00 ? 99  GLU A OE2  9  
ATOM   8235  H H    . GLU A 1 35 ? 12.178  -0.667  5.478   1.00 0.00 ? 99  GLU A H    9  
ATOM   8236  H HA   . GLU A 1 35 ? 12.086  -0.829  2.669   1.00 0.00 ? 99  GLU A HA   9  
ATOM   8237  H HB2  . GLU A 1 35 ? 14.443  -0.294  4.472   1.00 0.00 ? 99  GLU A HB2  9  
ATOM   8238  H HB3  . GLU A 1 35 ? 14.425  -0.061  2.731   1.00 0.00 ? 99  GLU A HB3  9  
ATOM   8239  H HG2  . GLU A 1 35 ? 12.662  1.620   2.976   1.00 0.00 ? 99  GLU A HG2  9  
ATOM   8240  H HG3  . GLU A 1 35 ? 12.697  1.392   4.722   1.00 0.00 ? 99  GLU A HG3  9  
ATOM   8241  N N    . GLU A 1 36 ? 13.539  -3.322  4.133   1.00 0.00 ? 100 GLU A N    9  
ATOM   8242  C CA   . GLU A 1 36 ? 14.207  -4.607  3.932   1.00 0.00 ? 100 GLU A CA   9  
ATOM   8243  C C    . GLU A 1 36 ? 13.360  -5.485  2.999   1.00 0.00 ? 100 GLU A C    9  
ATOM   8244  O O    . GLU A 1 36 ? 13.861  -6.053  2.020   1.00 0.00 ? 100 GLU A O    9  
ATOM   8245  C CB   . GLU A 1 36 ? 14.344  -5.303  5.297   1.00 0.00 ? 100 GLU A CB   9  
ATOM   8246  C CG   . GLU A 1 36 ? 15.507  -6.302  5.427   1.00 0.00 ? 100 GLU A CG   9  
ATOM   8247  C CD   . GLU A 1 36 ? 15.511  -7.410  4.395   1.00 0.00 ? 100 GLU A CD   9  
ATOM   8248  O OE1  . GLU A 1 36 ? 14.760  -8.388  4.532   1.00 0.00 ? 100 GLU A OE1  9  
ATOM   8249  O OE2  . GLU A 1 36 ? 16.279  -7.326  3.425   1.00 0.00 ? 100 GLU A OE2  9  
ATOM   8250  H H    . GLU A 1 36 ? 13.229  -3.077  5.032   1.00 0.00 ? 100 GLU A H    9  
ATOM   8251  H HA   . GLU A 1 36 ? 15.188  -4.443  3.514   1.00 0.00 ? 100 GLU A HA   9  
ATOM   8252  H HB2  . GLU A 1 36 ? 14.424  -4.546  6.064   1.00 0.00 ? 100 GLU A HB2  9  
ATOM   8253  H HB3  . GLU A 1 36 ? 13.423  -5.842  5.471   1.00 0.00 ? 100 GLU A HB3  9  
ATOM   8254  H HG2  . GLU A 1 36 ? 16.433  -5.756  5.328   1.00 0.00 ? 100 GLU A HG2  9  
ATOM   8255  H HG3  . GLU A 1 36 ? 15.467  -6.744  6.411   1.00 0.00 ? 100 GLU A HG3  9  
ATOM   8256  N N    . ASN A 1 37 ? 12.070  -5.511  3.248   1.00 0.00 ? 101 ASN A N    9  
ATOM   8257  C CA   . ASN A 1 37 ? 11.162  -6.314  2.438   1.00 0.00 ? 101 ASN A CA   9  
ATOM   8258  C C    . ASN A 1 37 ? 10.539  -5.477  1.378   1.00 0.00 ? 101 ASN A C    9  
ATOM   8259  O O    . ASN A 1 37 ? 9.871   -5.993  0.477   1.00 0.00 ? 101 ASN A O    9  
ATOM   8260  C CB   . ASN A 1 37 ? 10.055  -6.943  3.284   1.00 0.00 ? 101 ASN A CB   9  
ATOM   8261  C CG   . ASN A 1 37 ? 10.566  -7.901  4.327   1.00 0.00 ? 101 ASN A CG   9  
ATOM   8262  O OD1  . ASN A 1 37 ? 10.690  -9.102  4.084   1.00 0.00 ? 101 ASN A OD1  9  
ATOM   8263  N ND2  . ASN A 1 37 ? 10.885  -7.389  5.469   1.00 0.00 ? 101 ASN A ND2  9  
ATOM   8264  H H    . ASN A 1 37 ? 11.726  -5.012  4.029   1.00 0.00 ? 101 ASN A H    9  
ATOM   8265  H HA   . ASN A 1 37 ? 11.725  -7.107  1.968   1.00 0.00 ? 101 ASN A HA   9  
ATOM   8266  H HB2  . ASN A 1 37 ? 9.494   -6.165  3.780   1.00 0.00 ? 101 ASN A HB2  9  
ATOM   8267  H HB3  . ASN A 1 37 ? 9.400   -7.483  2.618   1.00 0.00 ? 101 ASN A HB3  9  
ATOM   8268  H HD21 . ASN A 1 37 ? 10.775  -6.406  5.557   1.00 0.00 ? 101 ASN A HD21 9  
ATOM   8269  H HD22 . ASN A 1 37 ? 11.217  -7.954  6.199   1.00 0.00 ? 101 ASN A HD22 9  
ATOM   8270  N N    . GLY A 1 38 ? 10.760  -4.184  1.476   1.00 0.00 ? 102 GLY A N    9  
ATOM   8271  C CA   . GLY A 1 38 ? 10.165  -3.256  0.562   1.00 0.00 ? 102 GLY A CA   9  
ATOM   8272  C C    . GLY A 1 38 ? 8.681   -3.174  0.796   1.00 0.00 ? 102 GLY A C    9  
ATOM   8273  O O    . GLY A 1 38 ? 7.912   -2.935  -0.118  1.00 0.00 ? 102 GLY A O    9  
ATOM   8274  H H    . GLY A 1 38 ? 11.349  -3.856  2.188   1.00 0.00 ? 102 GLY A H    9  
ATOM   8275  H HA2  . GLY A 1 38 ? 10.608  -2.282  0.711   1.00 0.00 ? 102 GLY A HA2  9  
ATOM   8276  H HA3  . GLY A 1 38 ? 10.342  -3.582  -0.451  1.00 0.00 ? 102 GLY A HA3  9  
ATOM   8277  N N    . THR A 1 39 ? 8.271   -3.389  2.023   1.00 0.00 ? 103 THR A N    9  
ATOM   8278  C CA   . THR A 1 39 ? 6.873   -3.383  2.339   1.00 0.00 ? 103 THR A CA   9  
ATOM   8279  C C    . THR A 1 39 ? 6.523   -2.236  3.245   1.00 0.00 ? 103 THR A C    9  
ATOM   8280  O O    . THR A 1 39 ? 7.375   -1.714  3.942   1.00 0.00 ? 103 THR A O    9  
ATOM   8281  C CB   . THR A 1 39 ? 6.439   -4.717  2.965   1.00 0.00 ? 103 THR A CB   9  
ATOM   8282  O OG1  . THR A 1 39 ? 7.289   -5.031  4.092   1.00 0.00 ? 103 THR A OG1  9  
ATOM   8283  C CG2  . THR A 1 39 ? 6.504   -5.847  1.948   1.00 0.00 ? 103 THR A CG2  9  
ATOM   8284  H H    . THR A 1 39 ? 8.940   -3.540  2.730   1.00 0.00 ? 103 THR A H    9  
ATOM   8285  H HA   . THR A 1 39 ? 6.320   -3.239  1.428   1.00 0.00 ? 103 THR A HA   9  
ATOM   8286  H HB   . THR A 1 39 ? 5.418   -4.596  3.294   1.00 0.00 ? 103 THR A HB   9  
ATOM   8287  H HG1  . THR A 1 39 ? 7.771   -4.230  4.320   1.00 0.00 ? 103 THR A HG1  9  
ATOM   8288  H HG21 . THR A 1 39 ? 7.510   -5.922  1.564   1.00 0.00 ? 103 THR A HG21 9  
ATOM   8289  H HG22 . THR A 1 39 ? 6.217   -6.778  2.414   1.00 0.00 ? 103 THR A HG22 9  
ATOM   8290  H HG23 . THR A 1 39 ? 5.830   -5.628  1.132   1.00 0.00 ? 103 THR A HG23 9  
ATOM   8291  N N    . ALA A 1 40 ? 5.299   -1.836  3.218   1.00 0.00 ? 104 ALA A N    9  
ATOM   8292  C CA   . ALA A 1 40 ? 4.831   -0.777  4.045   1.00 0.00 ? 104 ALA A CA   9  
ATOM   8293  C C    . ALA A 1 40 ? 3.536   -1.176  4.688   1.00 0.00 ? 104 ALA A C    9  
ATOM   8294  O O    . ALA A 1 40 ? 2.740   -1.922  4.105   1.00 0.00 ? 104 ALA A O    9  
ATOM   8295  C CB   . ALA A 1 40 ? 4.638   0.485   3.230   1.00 0.00 ? 104 ALA A CB   9  
ATOM   8296  H H    . ALA A 1 40 ? 4.645   -2.257  2.614   1.00 0.00 ? 104 ALA A H    9  
ATOM   8297  H HA   . ALA A 1 40 ? 5.570   -0.581  4.806   1.00 0.00 ? 104 ALA A HA   9  
ATOM   8298  H HB1  . ALA A 1 40 ? 3.901   0.303   2.461   1.00 0.00 ? 104 ALA A HB1  9  
ATOM   8299  H HB2  . ALA A 1 40 ? 4.301   1.283   3.873   1.00 0.00 ? 104 ALA A HB2  9  
ATOM   8300  H HB3  . ALA A 1 40 ? 5.576   0.759   2.772   1.00 0.00 ? 104 ALA A HB3  9  
ATOM   8301  N N    . ALA A 1 41 ? 3.349   -0.730  5.884   1.00 0.00 ? 105 ALA A N    9  
ATOM   8302  C CA   . ALA A 1 41 ? 2.132   -0.950  6.589   1.00 0.00 ? 105 ALA A CA   9  
ATOM   8303  C C    . ALA A 1 41 ? 1.230   0.209   6.286   1.00 0.00 ? 105 ALA A C    9  
ATOM   8304  O O    . ALA A 1 41 ? 1.595   1.370   6.521   1.00 0.00 ? 105 ALA A O    9  
ATOM   8305  C CB   . ALA A 1 41 ? 2.402   -1.052  8.057   1.00 0.00 ? 105 ALA A CB   9  
ATOM   8306  H H    . ALA A 1 41 ? 4.057   -0.190  6.305   1.00 0.00 ? 105 ALA A H    9  
ATOM   8307  H HA   . ALA A 1 41 ? 1.682   -1.866  6.236   1.00 0.00 ? 105 ALA A HA   9  
ATOM   8308  H HB1  . ALA A 1 41 ? 2.885   -0.145  8.391   1.00 0.00 ? 105 ALA A HB1  9  
ATOM   8309  H HB2  . ALA A 1 41 ? 1.469   -1.195  8.579   1.00 0.00 ? 105 ALA A HB2  9  
ATOM   8310  H HB3  . ALA A 1 41 ? 3.049   -1.902  8.210   1.00 0.00 ? 105 ALA A HB3  9  
ATOM   8311  N N    . ILE A 1 42 ? 0.094   -0.076  5.748   1.00 0.00 ? 106 ILE A N    9  
ATOM   8312  C CA   . ILE A 1 42 ? -0.795  0.948   5.286   1.00 0.00 ? 106 ILE A CA   9  
ATOM   8313  C C    . ILE A 1 42 ? -2.161  0.798   5.911   1.00 0.00 ? 106 ILE A C    9  
ATOM   8314  O O    . ILE A 1 42 ? -2.559  -0.298  6.277   1.00 0.00 ? 106 ILE A O    9  
ATOM   8315  C CB   . ILE A 1 42 ? -0.905  0.908   3.727   1.00 0.00 ? 106 ILE A CB   9  
ATOM   8316  C CG1  . ILE A 1 42 ? -1.419  -0.454  3.234   1.00 0.00 ? 106 ILE A CG1  9  
ATOM   8317  C CG2  . ILE A 1 42 ? 0.410   1.248   3.062   1.00 0.00 ? 106 ILE A CG2  9  
ATOM   8318  C CD1  . ILE A 1 42 ? -2.886  -0.474  2.968   1.00 0.00 ? 106 ILE A CD1  9  
ATOM   8319  H H    . ILE A 1 42 ? -0.173  -1.019  5.655   1.00 0.00 ? 106 ILE A H    9  
ATOM   8320  H HA   . ILE A 1 42 ? -0.379  1.903   5.566   1.00 0.00 ? 106 ILE A HA   9  
ATOM   8321  H HB   . ILE A 1 42 ? -1.619  1.667   3.438   1.00 0.00 ? 106 ILE A HB   9  
ATOM   8322  H HG12 . ILE A 1 42 ? -0.915  -0.792  2.344   1.00 0.00 ? 106 ILE A HG12 9  
ATOM   8323  H HG13 . ILE A 1 42 ? -1.235  -1.167  4.023   1.00 0.00 ? 106 ILE A HG13 9  
ATOM   8324  H HG21 . ILE A 1 42 ? 1.162   0.532   3.357   1.00 0.00 ? 106 ILE A HG21 9  
ATOM   8325  H HG22 . ILE A 1 42 ? 0.269   1.212   1.992   1.00 0.00 ? 106 ILE A HG22 9  
ATOM   8326  H HG23 . ILE A 1 42 ? 0.709   2.242   3.358   1.00 0.00 ? 106 ILE A HG23 9  
ATOM   8327  H HD11 . ILE A 1 42 ? -3.069  0.320   2.255   1.00 0.00 ? 106 ILE A HD11 9  
ATOM   8328  H HD12 . ILE A 1 42 ? -3.178  -1.425  2.551   1.00 0.00 ? 106 ILE A HD12 9  
ATOM   8329  H HD13 . ILE A 1 42 ? -3.428  -0.266  3.878   1.00 0.00 ? 106 ILE A HD13 9  
ATOM   8330  N N    . THR A 1 43 ? -2.846  1.889   6.058   1.00 0.00 ? 107 THR A N    9  
ATOM   8331  C CA   . THR A 1 43 ? -4.182  1.896   6.571   1.00 0.00 ? 107 THR A CA   9  
ATOM   8332  C C    . THR A 1 43 ? -5.143  2.457   5.522   1.00 0.00 ? 107 THR A C    9  
ATOM   8333  O O    . THR A 1 43 ? -4.925  3.539   4.983   1.00 0.00 ? 107 THR A O    9  
ATOM   8334  C CB   . THR A 1 43 ? -4.250  2.709   7.866   1.00 0.00 ? 107 THR A CB   9  
ATOM   8335  O OG1  . THR A 1 43 ? -3.338  2.129   8.808   1.00 0.00 ? 107 THR A OG1  9  
ATOM   8336  C CG2  . THR A 1 43 ? -5.655  2.707   8.447   1.00 0.00 ? 107 THR A CG2  9  
ATOM   8337  H H    . THR A 1 43 ? -2.437  2.754   5.823   1.00 0.00 ? 107 THR A H    9  
ATOM   8338  H HA   . THR A 1 43 ? -4.459  0.875   6.786   1.00 0.00 ? 107 THR A HA   9  
ATOM   8339  H HB   . THR A 1 43 ? -3.947  3.720   7.644   1.00 0.00 ? 107 THR A HB   9  
ATOM   8340  H HG1  . THR A 1 43 ? -2.768  1.543   8.299   1.00 0.00 ? 107 THR A HG1  9  
ATOM   8341  H HG21 . THR A 1 43 ? -5.972  1.683   8.585   1.00 0.00 ? 107 THR A HG21 9  
ATOM   8342  H HG22 . THR A 1 43 ? -5.656  3.224   9.394   1.00 0.00 ? 107 THR A HG22 9  
ATOM   8343  H HG23 . THR A 1 43 ? -6.328  3.193   7.756   1.00 0.00 ? 107 THR A HG23 9  
ATOM   8344  N N    . PHE A 1 44 ? -6.175  1.699   5.231   1.00 0.00 ? 108 PHE A N    9  
ATOM   8345  C CA   . PHE A 1 44 ? -7.162  2.052   4.240   1.00 0.00 ? 108 PHE A CA   9  
ATOM   8346  C C    . PHE A 1 44 ? -8.043  3.184   4.693   1.00 0.00 ? 108 PHE A C    9  
ATOM   8347  O O    . PHE A 1 44 ? -8.750  3.072   5.707   1.00 0.00 ? 108 PHE A O    9  
ATOM   8348  C CB   . PHE A 1 44 ? -7.988  0.843   3.839   1.00 0.00 ? 108 PHE A CB   9  
ATOM   8349  C CG   . PHE A 1 44 ? -7.215  -0.135  3.025   1.00 0.00 ? 108 PHE A CG   9  
ATOM   8350  C CD1  . PHE A 1 44 ? -6.902  0.179   1.716   1.00 0.00 ? 108 PHE A CD1  9  
ATOM   8351  C CD2  . PHE A 1 44 ? -6.785  -1.349  3.553   1.00 0.00 ? 108 PHE A CD2  9  
ATOM   8352  C CE1  . PHE A 1 44 ? -6.183  -0.687  0.932   1.00 0.00 ? 108 PHE A CE1  9  
ATOM   8353  C CE2  . PHE A 1 44 ? -6.056  -2.224  2.773   1.00 0.00 ? 108 PHE A CE2  9  
ATOM   8354  C CZ   . PHE A 1 44 ? -5.754  -1.893  1.456   1.00 0.00 ? 108 PHE A CZ   9  
ATOM   8355  H H    . PHE A 1 44 ? -6.281  0.865   5.742   1.00 0.00 ? 108 PHE A H    9  
ATOM   8356  H HA   . PHE A 1 44 ? -6.618  2.385   3.370   1.00 0.00 ? 108 PHE A HA   9  
ATOM   8357  H HB2  . PHE A 1 44 ? -8.343  0.340   4.726   1.00 0.00 ? 108 PHE A HB2  9  
ATOM   8358  H HB3  . PHE A 1 44 ? -8.831  1.172   3.250   1.00 0.00 ? 108 PHE A HB3  9  
ATOM   8359  H HD1  . PHE A 1 44 ? -7.248  1.122   1.314   1.00 0.00 ? 108 PHE A HD1  9  
ATOM   8360  H HD2  . PHE A 1 44 ? -7.029  -1.621  4.573   1.00 0.00 ? 108 PHE A HD2  9  
ATOM   8361  H HE1  . PHE A 1 44 ? -5.967  -0.411  -0.091  1.00 0.00 ? 108 PHE A HE1  9  
ATOM   8362  H HE2  . PHE A 1 44 ? -5.725  -3.166  3.185   1.00 0.00 ? 108 PHE A HE2  9  
ATOM   8363  H HZ   . PHE A 1 44 ? -5.183  -2.575  0.845   1.00 0.00 ? 108 PHE A HZ   9  
ATOM   8364  N N    . ALA A 1 45 ? -8.029  4.244   3.919   1.00 0.00 ? 109 ALA A N    9  
ATOM   8365  C CA   . ALA A 1 45 ? -8.752  5.448   4.230   1.00 0.00 ? 109 ALA A CA   9  
ATOM   8366  C C    . ALA A 1 45 ? -10.240 5.232   4.067   1.00 0.00 ? 109 ALA A C    9  
ATOM   8367  O O    . ALA A 1 45 ? -10.703 4.743   3.032   1.00 0.00 ? 109 ALA A O    9  
ATOM   8368  C CB   . ALA A 1 45 ? -8.276  6.591   3.349   1.00 0.00 ? 109 ALA A CB   9  
ATOM   8369  H H    . ALA A 1 45 ? -7.536  4.199   3.068   1.00 0.00 ? 109 ALA A H    9  
ATOM   8370  H HA   . ALA A 1 45 ? -8.546  5.705   5.258   1.00 0.00 ? 109 ALA A HA   9  
ATOM   8371  H HB1  . ALA A 1 45 ? -8.482  6.356   2.315   1.00 0.00 ? 109 ALA A HB1  9  
ATOM   8372  H HB2  . ALA A 1 45 ? -8.797  7.497   3.621   1.00 0.00 ? 109 ALA A HB2  9  
ATOM   8373  H HB3  . ALA A 1 45 ? -7.213  6.732   3.481   1.00 0.00 ? 109 ALA A HB3  9  
ATOM   8374  N N    . GLY A 1 46 ? -10.974 5.529   5.104   1.00 0.00 ? 110 GLY A N    9  
ATOM   8375  C CA   . GLY A 1 46 ? -12.402 5.398   5.065   1.00 0.00 ? 110 GLY A CA   9  
ATOM   8376  C C    . GLY A 1 46 ? -12.868 4.134   5.732   1.00 0.00 ? 110 GLY A C    9  
ATOM   8377  O O    . GLY A 1 46 ? -13.814 4.144   6.512   1.00 0.00 ? 110 GLY A O    9  
ATOM   8378  H H    . GLY A 1 46 ? -10.551 5.842   5.934   1.00 0.00 ? 110 GLY A H    9  
ATOM   8379  H HA2  . GLY A 1 46 ? -12.845 6.246   5.564   1.00 0.00 ? 110 GLY A HA2  9  
ATOM   8380  H HA3  . GLY A 1 46 ? -12.717 5.383   4.033   1.00 0.00 ? 110 GLY A HA3  9  
ATOM   8381  N N    . TYR A 1 47 ? -12.204 3.048   5.434   1.00 0.00 ? 111 TYR A N    9  
ATOM   8382  C CA   . TYR A 1 47 ? -12.570 1.762   5.964   1.00 0.00 ? 111 TYR A CA   9  
ATOM   8383  C C    . TYR A 1 47 ? -11.888 1.508   7.309   1.00 0.00 ? 111 TYR A C    9  
ATOM   8384  O O    . TYR A 1 47 ? -12.506 1.015   8.242   1.00 0.00 ? 111 TYR A O    9  
ATOM   8385  C CB   . TYR A 1 47 ? -12.163 0.701   4.990   1.00 0.00 ? 111 TYR A CB   9  
ATOM   8386  C CG   . TYR A 1 47 ? -12.628 0.928   3.567   1.00 0.00 ? 111 TYR A CG   9  
ATOM   8387  C CD1  . TYR A 1 47 ? -13.909 0.588   3.165   1.00 0.00 ? 111 TYR A CD1  9  
ATOM   8388  C CD2  . TYR A 1 47 ? -11.756 1.439   2.615   1.00 0.00 ? 111 TYR A CD2  9  
ATOM   8389  C CE1  . TYR A 1 47 ? -14.309 0.748   1.852   1.00 0.00 ? 111 TYR A CE1  9  
ATOM   8390  C CE2  . TYR A 1 47 ? -12.143 1.611   1.309   1.00 0.00 ? 111 TYR A CE2  9  
ATOM   8391  C CZ   . TYR A 1 47 ? -13.425 1.259   0.927   1.00 0.00 ? 111 TYR A CZ   9  
ATOM   8392  O OH   . TYR A 1 47 ? -13.826 1.424   -0.384  1.00 0.00 ? 111 TYR A OH   9  
ATOM   8393  H H    . TYR A 1 47 ? -11.457 3.102   4.802   1.00 0.00 ? 111 TYR A H    9  
ATOM   8394  H HA   . TYR A 1 47 ? -13.642 1.729   6.084   1.00 0.00 ? 111 TYR A HA   9  
ATOM   8395  H HB2  . TYR A 1 47 ? -11.085 0.641   4.975   1.00 0.00 ? 111 TYR A HB2  9  
ATOM   8396  H HB3  . TYR A 1 47 ? -12.559 -0.247  5.322   1.00 0.00 ? 111 TYR A HB3  9  
ATOM   8397  H HD1  . TYR A 1 47 ? -14.603 0.191   3.892   1.00 0.00 ? 111 TYR A HD1  9  
ATOM   8398  H HD2  . TYR A 1 47 ? -10.757 1.715   2.918   1.00 0.00 ? 111 TYR A HD2  9  
ATOM   8399  H HE1  . TYR A 1 47 ? -15.310 0.471   1.554   1.00 0.00 ? 111 TYR A HE1  9  
ATOM   8400  H HE2  . TYR A 1 47 ? -11.425 2.010   0.606   1.00 0.00 ? 111 TYR A HE2  9  
ATOM   8401  H HH   . TYR A 1 47 ? -14.771 1.620   -0.387  1.00 0.00 ? 111 TYR A HH   9  
ATOM   8402  N N    . GLY A 1 48 ? -10.606 1.815   7.391   1.00 0.00 ? 112 GLY A N    9  
ATOM   8403  C CA   . GLY A 1 48 ? -9.902  1.670   8.649   1.00 0.00 ? 112 GLY A CA   9  
ATOM   8404  C C    . GLY A 1 48 ? -9.133  0.360   8.816   1.00 0.00 ? 112 GLY A C    9  
ATOM   8405  O O    . GLY A 1 48 ? -8.757  0.004   9.940   1.00 0.00 ? 112 GLY A O    9  
ATOM   8406  H H    . GLY A 1 48 ? -10.127 2.176   6.613   1.00 0.00 ? 112 GLY A H    9  
ATOM   8407  H HA2  . GLY A 1 48 ? -9.199  2.485   8.740   1.00 0.00 ? 112 GLY A HA2  9  
ATOM   8408  H HA3  . GLY A 1 48 ? -10.622 1.753   9.450   1.00 0.00 ? 112 GLY A HA3  9  
ATOM   8409  N N    . ASN A 1 49 ? -8.875  -0.366  7.735   1.00 0.00 ? 113 ASN A N    9  
ATOM   8410  C CA   . ASN A 1 49 ? -8.079  -1.602  7.871   1.00 0.00 ? 113 ASN A CA   9  
ATOM   8411  C C    . ASN A 1 49 ? -6.650  -1.298  7.630   1.00 0.00 ? 113 ASN A C    9  
ATOM   8412  O O    . ASN A 1 49 ? -6.329  -0.256  7.082   1.00 0.00 ? 113 ASN A O    9  
ATOM   8413  C CB   . ASN A 1 49 ? -8.471  -2.752  6.932   1.00 0.00 ? 113 ASN A CB   9  
ATOM   8414  C CG   . ASN A 1 49 ? -9.780  -3.425  7.243   1.00 0.00 ? 113 ASN A CG   9  
ATOM   8415  O OD1  . ASN A 1 49 ? -10.273 -3.396  8.368   1.00 0.00 ? 113 ASN A OD1  9  
ATOM   8416  N ND2  . ASN A 1 49 ? -10.303 -4.107  6.276   1.00 0.00 ? 113 ASN A ND2  9  
ATOM   8417  H H    . ASN A 1 49 ? -9.167  -0.052  6.855   1.00 0.00 ? 113 ASN A H    9  
ATOM   8418  H HA   . ASN A 1 49 ? -8.182  -1.927  8.896   1.00 0.00 ? 113 ASN A HA   9  
ATOM   8419  H HB2  . ASN A 1 49 ? -8.537  -2.367  5.926   1.00 0.00 ? 113 ASN A HB2  9  
ATOM   8420  H HB3  . ASN A 1 49 ? -7.688  -3.495  6.961   1.00 0.00 ? 113 ASN A HB3  9  
ATOM   8421  H HD21 . ASN A 1 49 ? -9.815  -4.139  5.425   1.00 0.00 ? 113 ASN A HD21 9  
ATOM   8422  H HD22 . ASN A 1 49 ? -11.158 -4.558  6.409   1.00 0.00 ? 113 ASN A HD22 9  
ATOM   8423  N N    . ALA A 1 50 ? -5.803  -2.206  7.978   1.00 0.00 ? 114 ALA A N    9  
ATOM   8424  C CA   . ALA A 1 50 ? -4.398  -2.029  7.811   1.00 0.00 ? 114 ALA A CA   9  
ATOM   8425  C C    . ALA A 1 50 ? -3.784  -3.316  7.348   1.00 0.00 ? 114 ALA A C    9  
ATOM   8426  O O    . ALA A 1 50 ? -4.147  -4.386  7.841   1.00 0.00 ? 114 ALA A O    9  
ATOM   8427  C CB   . ALA A 1 50 ? -3.756  -1.569  9.108   1.00 0.00 ? 114 ALA A CB   9  
ATOM   8428  H H    . ALA A 1 50 ? -6.114  -3.065  8.338   1.00 0.00 ? 114 ALA A H    9  
ATOM   8429  H HA   . ALA A 1 50 ? -4.235  -1.271  7.060   1.00 0.00 ? 114 ALA A HA   9  
ATOM   8430  H HB1  . ALA A 1 50 ? -3.893  -2.324  9.866   1.00 0.00 ? 114 ALA A HB1  9  
ATOM   8431  H HB2  . ALA A 1 50 ? -2.701  -1.404  8.948   1.00 0.00 ? 114 ALA A HB2  9  
ATOM   8432  H HB3  . ALA A 1 50 ? -4.220  -0.649  9.431   1.00 0.00 ? 114 ALA A HB3  9  
ATOM   8433  N N    . GLU A 1 51 ? -2.900  -3.224  6.394   1.00 0.00 ? 115 GLU A N    9  
ATOM   8434  C CA   . GLU A 1 51 ? -2.217  -4.376  5.900   1.00 0.00 ? 115 GLU A CA   9  
ATOM   8435  C C    . GLU A 1 51 ? -0.796  -4.012  5.552   1.00 0.00 ? 115 GLU A C    9  
ATOM   8436  O O    . GLU A 1 51 ? -0.471  -2.826  5.388   1.00 0.00 ? 115 GLU A O    9  
ATOM   8437  C CB   . GLU A 1 51 ? -2.925  -5.023  4.691   1.00 0.00 ? 115 GLU A CB   9  
ATOM   8438  C CG   . GLU A 1 51 ? -2.936  -4.246  3.390   1.00 0.00 ? 115 GLU A CG   9  
ATOM   8439  C CD   . GLU A 1 51 ? -3.323  -5.156  2.235   1.00 0.00 ? 115 GLU A CD   9  
ATOM   8440  O OE1  . GLU A 1 51 ? -4.533  -5.367  1.981   1.00 0.00 ? 115 GLU A OE1  9  
ATOM   8441  O OE2  . GLU A 1 51 ? -2.416  -5.725  1.605   1.00 0.00 ? 115 GLU A OE2  9  
ATOM   8442  H H    . GLU A 1 51 ? -2.675  -2.343  6.023   1.00 0.00 ? 115 GLU A H    9  
ATOM   8443  H HA   . GLU A 1 51 ? -2.186  -5.091  6.708   1.00 0.00 ? 115 GLU A HA   9  
ATOM   8444  H HB2  . GLU A 1 51 ? -2.459  -5.966  4.461   1.00 0.00 ? 115 GLU A HB2  9  
ATOM   8445  H HB3  . GLU A 1 51 ? -3.957  -5.177  4.969   1.00 0.00 ? 115 GLU A HB3  9  
ATOM   8446  H HG2  . GLU A 1 51 ? -3.641  -3.433  3.466   1.00 0.00 ? 115 GLU A HG2  9  
ATOM   8447  H HG3  . GLU A 1 51 ? -1.947  -3.855  3.205   1.00 0.00 ? 115 GLU A HG3  9  
ATOM   8448  N N    . VAL A 1 52 ? 0.050   -5.003  5.479   1.00 0.00 ? 116 VAL A N    9  
ATOM   8449  C CA   . VAL A 1 52 ? 1.421   -4.804  5.101   1.00 0.00 ? 116 VAL A CA   9  
ATOM   8450  C C    . VAL A 1 52 ? 1.553   -5.194  3.639   1.00 0.00 ? 116 VAL A C    9  
ATOM   8451  O O    . VAL A 1 52 ? 1.440   -6.372  3.284   1.00 0.00 ? 116 VAL A O    9  
ATOM   8452  C CB   . VAL A 1 52 ? 2.390   -5.651  5.973   1.00 0.00 ? 116 VAL A CB   9  
ATOM   8453  C CG1  . VAL A 1 52 ? 3.838   -5.405  5.571   1.00 0.00 ? 116 VAL A CG1  9  
ATOM   8454  C CG2  . VAL A 1 52 ? 2.192   -5.340  7.452   1.00 0.00 ? 116 VAL A CG2  9  
ATOM   8455  H H    . VAL A 1 52 ? -0.266  -5.914  5.658   1.00 0.00 ? 116 VAL A H    9  
ATOM   8456  H HA   . VAL A 1 52 ? 1.655   -3.755  5.206   1.00 0.00 ? 116 VAL A HA   9  
ATOM   8457  H HB   . VAL A 1 52 ? 2.165   -6.695  5.811   1.00 0.00 ? 116 VAL A HB   9  
ATOM   8458  H HG11 . VAL A 1 52 ? 4.081   -4.362  5.714   1.00 0.00 ? 116 VAL A HG11 9  
ATOM   8459  H HG12 . VAL A 1 52 ? 4.489   -6.017  6.177   1.00 0.00 ? 116 VAL A HG12 9  
ATOM   8460  H HG13 . VAL A 1 52 ? 3.964   -5.664  4.530   1.00 0.00 ? 116 VAL A HG13 9  
ATOM   8461  H HG21 . VAL A 1 52 ? 1.178   -5.576  7.738   1.00 0.00 ? 116 VAL A HG21 9  
ATOM   8462  H HG22 . VAL A 1 52 ? 2.880   -5.929  8.040   1.00 0.00 ? 116 VAL A HG22 9  
ATOM   8463  H HG23 . VAL A 1 52 ? 2.380   -4.292  7.626   1.00 0.00 ? 116 VAL A HG23 9  
ATOM   8464  N N    . THR A 1 53 ? 1.769   -4.226  2.812   1.00 0.00 ? 117 THR A N    9  
ATOM   8465  C CA   . THR A 1 53 ? 1.798   -4.441  1.389   1.00 0.00 ? 117 THR A CA   9  
ATOM   8466  C C    . THR A 1 53 ? 3.089   -3.843  0.795   1.00 0.00 ? 117 THR A C    9  
ATOM   8467  O O    . THR A 1 53 ? 3.593   -2.829  1.297   1.00 0.00 ? 117 THR A O    9  
ATOM   8468  C CB   . THR A 1 53 ? 0.507   -3.869  0.702   1.00 0.00 ? 117 THR A CB   9  
ATOM   8469  O OG1  . THR A 1 53 ? 0.385   -4.335  -0.658  1.00 0.00 ? 117 THR A OG1  9  
ATOM   8470  C CG2  . THR A 1 53 ? 0.500   -2.355  0.712   1.00 0.00 ? 117 THR A CG2  9  
ATOM   8471  H H    . THR A 1 53 ? 1.928   -3.325  3.181   1.00 0.00 ? 117 THR A H    9  
ATOM   8472  H HA   . THR A 1 53 ? 1.828   -5.512  1.241   1.00 0.00 ? 117 THR A HA   9  
ATOM   8473  H HB   . THR A 1 53 ? -0.350  -4.224  1.255   1.00 0.00 ? 117 THR A HB   9  
ATOM   8474  H HG1  . THR A 1 53 ? -0.449  -4.823  -0.676  1.00 0.00 ? 117 THR A HG1  9  
ATOM   8475  H HG21 . THR A 1 53 ? 1.339   -1.987  0.140   1.00 0.00 ? 117 THR A HG21 9  
ATOM   8476  H HG22 . THR A 1 53 ? -0.420  -1.995  0.279   1.00 0.00 ? 117 THR A HG22 9  
ATOM   8477  H HG23 . THR A 1 53 ? 0.581   -2.008  1.731   1.00 0.00 ? 117 THR A HG23 9  
ATOM   8478  N N    . PRO A 1 54 ? 3.704   -4.519  -0.193  1.00 0.00 ? 118 PRO A N    9  
ATOM   8479  C CA   . PRO A 1 54 ? 4.933   -4.052  -0.822  1.00 0.00 ? 118 PRO A CA   9  
ATOM   8480  C C    . PRO A 1 54 ? 4.758   -2.707  -1.515  1.00 0.00 ? 118 PRO A C    9  
ATOM   8481  O O    . PRO A 1 54 ? 3.687   -2.398  -2.045  1.00 0.00 ? 118 PRO A O    9  
ATOM   8482  C CB   . PRO A 1 54 ? 5.259   -5.142  -1.845  1.00 0.00 ? 118 PRO A CB   9  
ATOM   8483  C CG   . PRO A 1 54 ? 3.970   -5.809  -2.103  1.00 0.00 ? 118 PRO A CG   9  
ATOM   8484  C CD   . PRO A 1 54 ? 3.220   -5.760  -0.810  1.00 0.00 ? 118 PRO A CD   9  
ATOM   8485  H HA   . PRO A 1 54 ? 5.743   -3.975  -0.115  1.00 0.00 ? 118 PRO A HA   9  
ATOM   8486  H HB2  . PRO A 1 54 ? 5.664   -4.688  -2.739  1.00 0.00 ? 118 PRO A HB2  9  
ATOM   8487  H HB3  . PRO A 1 54 ? 5.979   -5.829  -1.425  1.00 0.00 ? 118 PRO A HB3  9  
ATOM   8488  H HG2  . PRO A 1 54 ? 3.431   -5.269  -2.866  1.00 0.00 ? 118 PRO A HG2  9  
ATOM   8489  H HG3  . PRO A 1 54 ? 4.127   -6.831  -2.413  1.00 0.00 ? 118 PRO A HG3  9  
ATOM   8490  H HD2  . PRO A 1 54 ? 2.158   -5.700  -1.002  1.00 0.00 ? 118 PRO A HD2  9  
ATOM   8491  H HD3  . PRO A 1 54 ? 3.430   -6.617  -0.194  1.00 0.00 ? 118 PRO A HD3  9  
ATOM   8492  N N    . LEU A 1 55 ? 5.812   -1.931  -1.513  1.00 0.00 ? 119 LEU A N    9  
ATOM   8493  C CA   . LEU A 1 55 ? 5.867   -0.607  -2.139  1.00 0.00 ? 119 LEU A CA   9  
ATOM   8494  C C    . LEU A 1 55 ? 5.568   -0.690  -3.634  1.00 0.00 ? 119 LEU A C    9  
ATOM   8495  O O    . LEU A 1 55 ? 5.168   0.296   -4.253  1.00 0.00 ? 119 LEU A O    9  
ATOM   8496  C CB   . LEU A 1 55 ? 7.228   0.044   -1.906  1.00 0.00 ? 119 LEU A CB   9  
ATOM   8497  C CG   . LEU A 1 55 ? 7.667   0.214   -0.450  1.00 0.00 ? 119 LEU A CG   9  
ATOM   8498  C CD1  . LEU A 1 55 ? 9.038   0.854   -0.370  1.00 0.00 ? 119 LEU A CD1  9  
ATOM   8499  C CD2  . LEU A 1 55 ? 6.665   1.016   0.350   1.00 0.00 ? 119 LEU A CD2  9  
ATOM   8500  H H    . LEU A 1 55 ? 6.612   -2.268  -1.045  1.00 0.00 ? 119 LEU A H    9  
ATOM   8501  H HA   . LEU A 1 55 ? 5.103   0.012   -1.696  1.00 0.00 ? 119 LEU A HA   9  
ATOM   8502  H HB2  . LEU A 1 55 ? 7.961   -0.585  -2.386  1.00 0.00 ? 119 LEU A HB2  9  
ATOM   8503  H HB3  . LEU A 1 55 ? 7.238   1.010   -2.384  1.00 0.00 ? 119 LEU A HB3  9  
ATOM   8504  H HG   . LEU A 1 55 ? 7.728   -0.777  -0.028  1.00 0.00 ? 119 LEU A HG   9  
ATOM   8505  H HD11 . LEU A 1 55 ? 9.011   1.823   -0.846  1.00 0.00 ? 119 LEU A HD11 9  
ATOM   8506  H HD12 . LEU A 1 55 ? 9.319   0.971   0.667   1.00 0.00 ? 119 LEU A HD12 9  
ATOM   8507  H HD13 . LEU A 1 55 ? 9.760   0.223   -0.867  1.00 0.00 ? 119 LEU A HD13 9  
ATOM   8508  H HD21 . LEU A 1 55 ? 5.720   0.495   0.377   1.00 0.00 ? 119 LEU A HD21 9  
ATOM   8509  H HD22 . LEU A 1 55 ? 7.034   1.141   1.356   1.00 0.00 ? 119 LEU A HD22 9  
ATOM   8510  H HD23 . LEU A 1 55 ? 6.527   1.987   -0.101  1.00 0.00 ? 119 LEU A HD23 9  
ATOM   8511  N N    . LEU A 1 56 ? 5.829   -1.852  -4.213  1.00 0.00 ? 120 LEU A N    9  
ATOM   8512  C CA   . LEU A 1 56 ? 5.526   -2.128  -5.617  1.00 0.00 ? 120 LEU A CA   9  
ATOM   8513  C C    . LEU A 1 56 ? 4.019   -2.065  -5.858  1.00 0.00 ? 120 LEU A C    9  
ATOM   8514  O O    . LEU A 1 56 ? 3.562   -1.689  -6.934  1.00 0.00 ? 120 LEU A O    9  
ATOM   8515  C CB   . LEU A 1 56 ? 6.095   -3.510  -6.029  1.00 0.00 ? 120 LEU A CB   9  
ATOM   8516  C CG   . LEU A 1 56 ? 5.315   -4.767  -5.592  1.00 0.00 ? 120 LEU A CG   9  
ATOM   8517  C CD1  . LEU A 1 56 ? 4.289   -5.141  -6.641  1.00 0.00 ? 120 LEU A CD1  9  
ATOM   8518  C CD2  . LEU A 1 56 ? 6.248   -5.924  -5.323  1.00 0.00 ? 120 LEU A CD2  9  
ATOM   8519  H H    . LEU A 1 56 ? 6.277   -2.536  -3.666  1.00 0.00 ? 120 LEU A H    9  
ATOM   8520  H HA   . LEU A 1 56 ? 5.979   -1.368  -6.228  1.00 0.00 ? 120 LEU A HA   9  
ATOM   8521  H HB2  . LEU A 1 56 ? 6.151   -3.525  -7.106  1.00 0.00 ? 120 LEU A HB2  9  
ATOM   8522  H HB3  . LEU A 1 56 ? 7.100   -3.585  -5.643  1.00 0.00 ? 120 LEU A HB3  9  
ATOM   8523  H HG   . LEU A 1 56 ? 4.754   -4.545  -4.694  1.00 0.00 ? 120 LEU A HG   9  
ATOM   8524  H HD11 . LEU A 1 56 ? 3.692   -4.256  -6.812  1.00 0.00 ? 120 LEU A HD11 9  
ATOM   8525  H HD12 . LEU A 1 56 ? 4.788   -5.422  -7.555  1.00 0.00 ? 120 LEU A HD12 9  
ATOM   8526  H HD13 . LEU A 1 56 ? 3.669   -5.948  -6.282  1.00 0.00 ? 120 LEU A HD13 9  
ATOM   8527  H HD21 . LEU A 1 56 ? 6.936   -5.660  -4.535  1.00 0.00 ? 120 LEU A HD21 9  
ATOM   8528  H HD22 . LEU A 1 56 ? 5.672   -6.787  -5.025  1.00 0.00 ? 120 LEU A HD22 9  
ATOM   8529  H HD23 . LEU A 1 56 ? 6.801   -6.153  -6.222  1.00 0.00 ? 120 LEU A HD23 9  
ATOM   8530  N N    . ASN A 1 57 ? 3.264   -2.430  -4.835  1.00 0.00 ? 121 ASN A N    9  
ATOM   8531  C CA   . ASN A 1 57 ? 1.814   -2.470  -4.905  1.00 0.00 ? 121 ASN A CA   9  
ATOM   8532  C C    . ASN A 1 57 ? 1.228   -1.109  -4.709  1.00 0.00 ? 121 ASN A C    9  
ATOM   8533  O O    . ASN A 1 57 ? 0.108   -0.840  -5.154  1.00 0.00 ? 121 ASN A O    9  
ATOM   8534  C CB   . ASN A 1 57 ? 1.214   -3.432  -3.862  1.00 0.00 ? 121 ASN A CB   9  
ATOM   8535  C CG   . ASN A 1 57 ? 1.173   -4.872  -4.284  1.00 0.00 ? 121 ASN A CG   9  
ATOM   8536  O OD1  . ASN A 1 57 ? 1.165   -5.192  -5.465  1.00 0.00 ? 121 ASN A OD1  9  
ATOM   8537  N ND2  . ASN A 1 57 ? 1.047   -5.744  -3.326  1.00 0.00 ? 121 ASN A ND2  9  
ATOM   8538  H H    . ASN A 1 57 ? 3.700   -2.659  -3.986  1.00 0.00 ? 121 ASN A H    9  
ATOM   8539  H HA   . ASN A 1 57 ? 1.545   -2.827  -5.887  1.00 0.00 ? 121 ASN A HA   9  
ATOM   8540  H HB2  . ASN A 1 57 ? 1.858   -3.396  -2.996  1.00 0.00 ? 121 ASN A HB2  9  
ATOM   8541  H HB3  . ASN A 1 57 ? 0.234   -3.142  -3.533  1.00 0.00 ? 121 ASN A HB3  9  
ATOM   8542  H HD21 . ASN A 1 57 ? 0.978   -5.397  -2.408  1.00 0.00 ? 121 ASN A HD21 9  
ATOM   8543  H HD22 . ASN A 1 57 ? 1.044   -6.700  -3.546  1.00 0.00 ? 121 ASN A HD22 9  
ATOM   8544  N N    . LEU A 1 58 ? 1.981   -0.248  -4.073  1.00 0.00 ? 122 LEU A N    9  
ATOM   8545  C CA   . LEU A 1 58 ? 1.513   1.070   -3.762  1.00 0.00 ? 122 LEU A CA   9  
ATOM   8546  C C    . LEU A 1 58 ? 1.546   1.952   -4.979  1.00 0.00 ? 122 LEU A C    9  
ATOM   8547  O O    . LEU A 1 58 ? 2.536   2.000   -5.712  1.00 0.00 ? 122 LEU A O    9  
ATOM   8548  C CB   . LEU A 1 58 ? 2.329   1.686   -2.630  1.00 0.00 ? 122 LEU A CB   9  
ATOM   8549  C CG   . LEU A 1 58 ? 2.269   0.965   -1.289  1.00 0.00 ? 122 LEU A CG   9  
ATOM   8550  C CD1  . LEU A 1 58 ? 3.073   1.719   -0.249  1.00 0.00 ? 122 LEU A CD1  9  
ATOM   8551  C CD2  . LEU A 1 58 ? 0.830   0.799   -0.838  1.00 0.00 ? 122 LEU A CD2  9  
ATOM   8552  H H    . LEU A 1 58 ? 2.895   -0.501  -3.833  1.00 0.00 ? 122 LEU A H    9  
ATOM   8553  H HA   . LEU A 1 58 ? 0.487   0.987   -3.436  1.00 0.00 ? 122 LEU A HA   9  
ATOM   8554  H HB2  . LEU A 1 58 ? 3.364   1.700   -2.940  1.00 0.00 ? 122 LEU A HB2  9  
ATOM   8555  H HB3  . LEU A 1 58 ? 1.998   2.704   -2.482  1.00 0.00 ? 122 LEU A HB3  9  
ATOM   8556  H HG   . LEU A 1 58 ? 2.706   -0.017  -1.400  1.00 0.00 ? 122 LEU A HG   9  
ATOM   8557  H HD11 . LEU A 1 58 ? 2.664   2.711   -0.127  1.00 0.00 ? 122 LEU A HD11 9  
ATOM   8558  H HD12 . LEU A 1 58 ? 3.028   1.194   0.693   1.00 0.00 ? 122 LEU A HD12 9  
ATOM   8559  H HD13 . LEU A 1 58 ? 4.100   1.798   -0.573  1.00 0.00 ? 122 LEU A HD13 9  
ATOM   8560  H HD21 . LEU A 1 58 ? 0.288   0.208   -1.561  1.00 0.00 ? 122 LEU A HD21 9  
ATOM   8561  H HD22 . LEU A 1 58 ? 0.808   0.295   0.117   1.00 0.00 ? 122 LEU A HD22 9  
ATOM   8562  H HD23 . LEU A 1 58 ? 0.365   1.770   -0.748  1.00 0.00 ? 122 LEU A HD23 9  
ATOM   8563  N N    . LYS A 1 59 ? 0.460   2.616   -5.201  1.00 0.00 ? 123 LYS A N    9  
ATOM   8564  C CA   . LYS A 1 59 ? 0.315   3.524   -6.310  1.00 0.00 ? 123 LYS A CA   9  
ATOM   8565  C C    . LYS A 1 59 ? 0.159   4.917   -5.768  1.00 0.00 ? 123 LYS A C    9  
ATOM   8566  O O    . LYS A 1 59 ? -0.194  5.080   -4.597  1.00 0.00 ? 123 LYS A O    9  
ATOM   8567  C CB   . LYS A 1 59 ? -0.939  3.203   -7.126  1.00 0.00 ? 123 LYS A CB   9  
ATOM   8568  C CG   . LYS A 1 59 ? -1.100  1.781   -7.591  1.00 0.00 ? 123 LYS A CG   9  
ATOM   8569  C CD   . LYS A 1 59 ? -2.332  1.692   -8.458  1.00 0.00 ? 123 LYS A CD   9  
ATOM   8570  C CE   . LYS A 1 59 ? -2.618  0.283   -8.927  1.00 0.00 ? 123 LYS A CE   9  
ATOM   8571  N NZ   . LYS A 1 59 ? -3.827  0.225   -9.786  1.00 0.00 ? 123 LYS A NZ   9  
ATOM   8572  H H    . LYS A 1 59 ? -0.285  2.487   -4.572  1.00 0.00 ? 123 LYS A H    9  
ATOM   8573  H HA   . LYS A 1 59 ? 1.185   3.487   -6.943  1.00 0.00 ? 123 LYS A HA   9  
ATOM   8574  H HB2  . LYS A 1 59 ? -1.801  3.454   -6.533  1.00 0.00 ? 123 LYS A HB2  9  
ATOM   8575  H HB3  . LYS A 1 59 ? -0.955  3.842   -7.996  1.00 0.00 ? 123 LYS A HB3  9  
ATOM   8576  H HG2  . LYS A 1 59 ? -0.228  1.481   -8.154  1.00 0.00 ? 123 LYS A HG2  9  
ATOM   8577  H HG3  . LYS A 1 59 ? -1.230  1.145   -6.728  1.00 0.00 ? 123 LYS A HG3  9  
ATOM   8578  H HD2  . LYS A 1 59 ? -3.176  2.059   -7.893  1.00 0.00 ? 123 LYS A HD2  9  
ATOM   8579  H HD3  . LYS A 1 59 ? -2.168  2.335   -9.310  1.00 0.00 ? 123 LYS A HD3  9  
ATOM   8580  H HE2  . LYS A 1 59 ? -1.771  -0.084  -9.486  1.00 0.00 ? 123 LYS A HE2  9  
ATOM   8581  H HE3  . LYS A 1 59 ? -2.773  -0.340  -8.059  1.00 0.00 ? 123 LYS A HE3  9  
ATOM   8582  H HZ1  . LYS A 1 59 ? -3.689  0.758   -10.669 1.00 0.00 ? 123 LYS A HZ1  9  
ATOM   8583  H HZ2  . LYS A 1 59 ? -4.067  -0.760  -10.023 1.00 0.00 ? 123 LYS A HZ2  9  
ATOM   8584  H HZ3  . LYS A 1 59 ? -4.652  0.631   -9.300  1.00 0.00 ? 123 LYS A HZ3  9  
ATOM   8585  N N    . PRO A 1 60 ? 0.405   5.941   -6.582  1.00 0.00 ? 124 PRO A N    9  
ATOM   8586  C CA   . PRO A 1 60 ? 0.152   7.310   -6.184  1.00 0.00 ? 124 PRO A CA   9  
ATOM   8587  C C    . PRO A 1 60 ? -1.353  7.577   -6.179  1.00 0.00 ? 124 PRO A C    9  
ATOM   8588  O O    . PRO A 1 60 ? -2.118  6.906   -6.889  1.00 0.00 ? 124 PRO A O    9  
ATOM   8589  C CB   . PRO A 1 60 ? 0.858   8.141   -7.265  1.00 0.00 ? 124 PRO A CB   9  
ATOM   8590  C CG   . PRO A 1 60 ? 0.894   7.263   -8.467  1.00 0.00 ? 124 PRO A CG   9  
ATOM   8591  C CD   . PRO A 1 60 ? 0.951   5.849   -7.958  1.00 0.00 ? 124 PRO A CD   9  
ATOM   8592  H HA   . PRO A 1 60 ? 0.541   7.536   -5.204  1.00 0.00 ? 124 PRO A HA   9  
ATOM   8593  H HB2  . PRO A 1 60 ? 0.292   9.042   -7.453  1.00 0.00 ? 124 PRO A HB2  9  
ATOM   8594  H HB3  . PRO A 1 60 ? 1.855   8.396   -6.935  1.00 0.00 ? 124 PRO A HB3  9  
ATOM   8595  H HG2  . PRO A 1 60 ? 0.001   7.412   -9.056  1.00 0.00 ? 124 PRO A HG2  9  
ATOM   8596  H HG3  . PRO A 1 60 ? 1.769   7.486   -9.059  1.00 0.00 ? 124 PRO A HG3  9  
ATOM   8597  H HD2  . PRO A 1 60 ? 0.325   5.218   -8.571  1.00 0.00 ? 124 PRO A HD2  9  
ATOM   8598  H HD3  . PRO A 1 60 ? 1.956   5.455   -7.952  1.00 0.00 ? 124 PRO A HD3  9  
ATOM   8599  N N    . VAL A 1 61 ? -1.783  8.501   -5.371  1.00 0.00 ? 125 VAL A N    9  
ATOM   8600  C CA   . VAL A 1 61 ? -3.187  8.840   -5.298  1.00 0.00 ? 125 VAL A CA   9  
ATOM   8601  C C    . VAL A 1 61 ? -3.534  9.893   -6.326  1.00 0.00 ? 125 VAL A C    9  
ATOM   8602  O O    . VAL A 1 61 ? -2.669  10.322  -7.112  1.00 0.00 ? 125 VAL A O    9  
ATOM   8603  C CB   . VAL A 1 61 ? -3.609  9.343   -3.897  1.00 0.00 ? 125 VAL A CB   9  
ATOM   8604  C CG1  . VAL A 1 61 ? -3.513  8.240   -2.884  1.00 0.00 ? 125 VAL A CG1  9  
ATOM   8605  C CG2  . VAL A 1 61 ? -2.775  10.544  -3.458  1.00 0.00 ? 125 VAL A CG2  9  
ATOM   8606  H H    . VAL A 1 61 ? -1.125  8.988   -4.828  1.00 0.00 ? 125 VAL A H    9  
ATOM   8607  H HA   . VAL A 1 61 ? -3.739  7.939   -5.519  1.00 0.00 ? 125 VAL A HA   9  
ATOM   8608  H HB   . VAL A 1 61 ? -4.639  9.655   -3.958  1.00 0.00 ? 125 VAL A HB   9  
ATOM   8609  H HG11 . VAL A 1 61 ? -4.089  7.385   -3.207  1.00 0.00 ? 125 VAL A HG11 9  
ATOM   8610  H HG12 . VAL A 1 61 ? -2.478  7.959   -2.755  1.00 0.00 ? 125 VAL A HG12 9  
ATOM   8611  H HG13 . VAL A 1 61 ? -3.897  8.598   -1.941  1.00 0.00 ? 125 VAL A HG13 9  
ATOM   8612  H HG21 . VAL A 1 61 ? -2.899  11.341  -4.175  1.00 0.00 ? 125 VAL A HG21 9  
ATOM   8613  H HG22 . VAL A 1 61 ? -3.109  10.876  -2.486  1.00 0.00 ? 125 VAL A HG22 9  
ATOM   8614  H HG23 . VAL A 1 61 ? -1.734  10.260  -3.403  1.00 0.00 ? 125 VAL A HG23 9  
ATOM   8615  N N    . GLU A 1 62 ? -4.781  10.314  -6.335  1.00 0.00 ? 126 GLU A N    9  
ATOM   8616  C CA   . GLU A 1 62 ? -5.216  11.359  -7.221  1.00 0.00 ? 126 GLU A CA   9  
ATOM   8617  C C    . GLU A 1 62 ? -4.757  12.684  -6.695  1.00 0.00 ? 126 GLU A C    9  
ATOM   8618  O O    . GLU A 1 62 ? -5.474  13.387  -5.978  1.00 0.00 ? 126 GLU A O    9  
ATOM   8619  C CB   . GLU A 1 62 ? -6.706  11.310  -7.435  1.00 0.00 ? 126 GLU A CB   9  
ATOM   8620  C CG   . GLU A 1 62 ? -7.120  10.032  -8.088  1.00 0.00 ? 126 GLU A CG   9  
ATOM   8621  C CD   . GLU A 1 62 ? -8.596  9.951   -8.331  1.00 0.00 ? 126 GLU A CD   9  
ATOM   8622  O OE1  . GLU A 1 62 ? -9.354  9.566   -7.403  1.00 0.00 ? 126 GLU A OE1  9  
ATOM   8623  O OE2  . GLU A 1 62 ? -9.043  10.283  -9.442  1.00 0.00 ? 126 GLU A OE2  9  
ATOM   8624  H H    . GLU A 1 62 ? -5.432  9.914   -5.718  1.00 0.00 ? 126 GLU A H    9  
ATOM   8625  H HA   . GLU A 1 62 ? -4.714  11.190  -8.163  1.00 0.00 ? 126 GLU A HA   9  
ATOM   8626  H HB2  . GLU A 1 62 ? -7.200  11.385  -6.477  1.00 0.00 ? 126 GLU A HB2  9  
ATOM   8627  H HB3  . GLU A 1 62 ? -7.019  12.132  -8.061  1.00 0.00 ? 126 GLU A HB3  9  
ATOM   8628  H HG2  . GLU A 1 62 ? -6.572  9.988   -9.018  1.00 0.00 ? 126 GLU A HG2  9  
ATOM   8629  H HG3  . GLU A 1 62 ? -6.796  9.222   -7.452  1.00 0.00 ? 126 GLU A HG3  9  
ATOM   8630  N N    . GLU A 1 63 ? -3.539  12.958  -7.011  1.00 0.00 ? 127 GLU A N    9  
ATOM   8631  C CA   . GLU A 1 63 ? -2.787  14.114  -6.545  1.00 0.00 ? 127 GLU A CA   9  
ATOM   8632  C C    . GLU A 1 63 ? -1.441  14.036  -7.183  1.00 0.00 ? 127 GLU A C    9  
ATOM   8633  O O    . GLU A 1 63 ? -0.845  15.034  -7.583  1.00 0.00 ? 127 GLU A O    9  
ATOM   8634  C CB   . GLU A 1 63 ? -2.621  14.069  -5.018  1.00 0.00 ? 127 GLU A CB   9  
ATOM   8635  C CG   . GLU A 1 63 ? -1.995  15.306  -4.405  1.00 0.00 ? 127 GLU A CG   9  
ATOM   8636  C CD   . GLU A 1 63 ? -2.910  16.486  -4.428  1.00 0.00 ? 127 GLU A CD   9  
ATOM   8637  O OE1  . GLU A 1 63 ? -2.994  17.185  -5.447  1.00 0.00 ? 127 GLU A OE1  9  
ATOM   8638  O OE2  . GLU A 1 63 ? -3.588  16.734  -3.412  1.00 0.00 ? 127 GLU A OE2  9  
ATOM   8639  H H    . GLU A 1 63 ? -3.132  12.309  -7.629  1.00 0.00 ? 127 GLU A H    9  
ATOM   8640  H HA   . GLU A 1 63 ? -3.245  15.029  -6.857  1.00 0.00 ? 127 GLU A HA   9  
ATOM   8641  H HB2  . GLU A 1 63 ? -3.594  13.932  -4.570  1.00 0.00 ? 127 GLU A HB2  9  
ATOM   8642  H HB3  . GLU A 1 63 ? -2.005  13.218  -4.770  1.00 0.00 ? 127 GLU A HB3  9  
ATOM   8643  H HG2  . GLU A 1 63 ? -1.740  15.099  -3.377  1.00 0.00 ? 127 GLU A HG2  9  
ATOM   8644  H HG3  . GLU A 1 63 ? -1.100  15.553  -4.957  1.00 0.00 ? 127 GLU A HG3  9  
ATOM   8645  N N    . GLY A 1 64 ? -0.987  12.838  -7.282  1.00 0.00 ? 128 GLY A N    9  
ATOM   8646  C CA   . GLY A 1 64 ? 0.265   12.575  -7.877  1.00 0.00 ? 128 GLY A CA   9  
ATOM   8647  C C    . GLY A 1 64 ? 1.378   12.823  -6.907  1.00 0.00 ? 128 GLY A C    9  
ATOM   8648  O O    . GLY A 1 64 ? 2.497   13.132  -7.329  1.00 0.00 ? 128 GLY A O    9  
ATOM   8649  O OXT  . GLY A 1 64 ? 1.132   12.770  -5.682  1.00 0.00 ? 128 GLY A OXT  9  
ATOM   8650  H H    . GLY A 1 64 ? -1.533  12.122  -6.901  1.00 0.00 ? 128 GLY A H    9  
ATOM   8651  H HA2  . GLY A 1 64 ? 0.287   11.560  -8.244  1.00 0.00 ? 128 GLY A HA2  9  
ATOM   8652  H HA3  . GLY A 1 64 ? 0.348   13.276  -8.694  1.00 0.00 ? 128 GLY A HA3  9  
HETATM 8653  N N    . 2MR B 2 .  ? -16.857 -5.007  -0.932  1.00 0.00 ? 201 2MR A N    9  
HETATM 8654  C CA   . 2MR B 2 .  ? -16.920 -4.008  0.111   1.00 0.00 ? 201 2MR A CA   9  
HETATM 8655  C CB   . 2MR B 2 .  ? -15.575 -3.879  0.842   1.00 0.00 ? 201 2MR A CB   9  
HETATM 8656  C CG   . 2MR B 2 .  ? -15.619 -2.916  2.003   1.00 0.00 ? 201 2MR A CG   9  
HETATM 8657  C CD   . 2MR B 2 .  ? -14.278 -2.789  2.671   1.00 0.00 ? 201 2MR A CD   9  
HETATM 8658  N NE   . 2MR B 2 .  ? -13.255 -2.408  1.723   1.00 0.00 ? 201 2MR A NE   9  
HETATM 8659  C CZ   . 2MR B 2 .  ? -12.023 -2.146  2.039   1.00 0.00 ? 201 2MR A CZ   9  
HETATM 8660  N NH1  . 2MR B 2 .  ? -11.650 -2.230  3.359   1.00 0.00 ? 201 2MR A NH1  9  
HETATM 8661  C CQ1  . 2MR B 2 .  ? -10.356 -1.999  4.018   1.00 0.00 ? 201 2MR A CQ1  9  
HETATM 8662  N NH2  . 2MR B 2 .  ? -11.177 -1.815  1.033   1.00 0.00 ? 201 2MR A NH2  9  
HETATM 8663  C CQ2  . 2MR B 2 .  ? -9.760  -1.470  1.043   1.00 0.00 ? 201 2MR A CQ2  9  
HETATM 8664  C C    . 2MR B 2 .  ? -17.306 -2.703  -0.531  1.00 0.00 ? 201 2MR A C    9  
HETATM 8665  O O    . 2MR B 2 .  ? -18.339 -2.142  -0.165  1.00 0.00 ? 201 2MR A O    9  
HETATM 8666  O OXT  . 2MR B 2 .  ? -16.612 -2.266  -1.475  1.00 0.00 ? 201 2MR A OXT  9  
HETATM 8667  H H2   . 2MR B 2 .  ? -16.513 -5.930  -0.602  1.00 0.00 ? 201 2MR A H2   9  
HETATM 8668  H H    . 2MR B 2 .  ? -17.790 -5.112  -1.380  1.00 0.00 ? 201 2MR A H    9  
HETATM 8669  H H3   . 2MR B 2 .  ? -16.208 -4.650  -1.661  1.00 0.00 ? 201 2MR A H3   9  
HETATM 8670  H HA   . 2MR B 2 .  ? -17.697 -4.276  0.811   1.00 0.00 ? 201 2MR A HA   9  
HETATM 8671  H HB2  . 2MR B 2 .  ? -14.832 -3.510  0.150   1.00 0.00 ? 201 2MR A HB2  9  
HETATM 8672  H HB3  . 2MR B 2 .  ? -15.240 -4.835  1.218   1.00 0.00 ? 201 2MR A HB3  9  
HETATM 8673  H HG2  . 2MR B 2 .  ? -16.327 -3.305  2.717   1.00 0.00 ? 201 2MR A HG2  9  
HETATM 8674  H HG3  . 2MR B 2 .  ? -15.915 -1.946  1.635   1.00 0.00 ? 201 2MR A HG3  9  
HETATM 8675  H HD2  . 2MR B 2 .  ? -13.999 -3.722  3.134   1.00 0.00 ? 201 2MR A HD2  9  
HETATM 8676  H HD3  . 2MR B 2 .  ? -14.324 -2.004  3.415   1.00 0.00 ? 201 2MR A HD3  9  
HETATM 8677  H HE   . 2MR B 2 .  ? -13.544 -2.347  0.788   1.00 0.00 ? 201 2MR A HE   9  
HETATM 8678  H HQ11 . 2MR B 2 .  ? -9.659  -2.770  3.726   1.00 0.00 ? 201 2MR A HQ11 9  
HETATM 8679  H HQ12 . 2MR B 2 .  ? -9.972  -1.032  3.725   1.00 0.00 ? 201 2MR A HQ12 9  
HETATM 8680  H HQ13 . 2MR B 2 .  ? -10.489 -2.027  5.090   1.00 0.00 ? 201 2MR A HQ13 9  
HETATM 8681  H HH2  . 2MR B 2 .  ? -11.502 -1.798  0.089   1.00 0.00 ? 201 2MR A HH2  9  
HETATM 8682  H HQ21 . 2MR B 2 .  ? -9.198  -2.262  1.513   1.00 0.00 ? 201 2MR A HQ21 9  
HETATM 8683  H HQ22 . 2MR B 2 .  ? -9.416  -1.345  0.026   1.00 0.00 ? 201 2MR A HQ22 9  
HETATM 8684  H HQ23 . 2MR B 2 .  ? -9.611  -0.549  1.588   1.00 0.00 ? 201 2MR A HQ23 9  
HETATM 8685  H HH1  . 2MR B 2 .  ? -12.339 -2.477  4.050   1.00 0.00 ? 201 2MR A HH1  9  
ATOM   8686  N N    . ALA A 1 1  ? 16.424  -6.680  1.779   1.00 0.00 ? 65  ALA A N    10 
ATOM   8687  C CA   . ALA A 1 1  ? 16.511  -8.079  1.414   1.00 0.00 ? 65  ALA A CA   10 
ATOM   8688  C C    . ALA A 1 1  ? 15.777  -8.288  0.114   1.00 0.00 ? 65  ALA A C    10 
ATOM   8689  O O    . ALA A 1 1  ? 14.779  -7.597  -0.149  1.00 0.00 ? 65  ALA A O    10 
ATOM   8690  C CB   . ALA A 1 1  ? 15.908  -8.940  2.505   1.00 0.00 ? 65  ALA A CB   10 
ATOM   8691  H H1   . ALA A 1 1  ? 15.418  -6.411  1.823   1.00 0.00 ? 65  ALA A H1   10 
ATOM   8692  H H2   . ALA A 1 1  ? 16.850  -6.503  2.715   1.00 0.00 ? 65  ALA A H2   10 
ATOM   8693  H H3   . ALA A 1 1  ? 16.891  -6.089  1.064   1.00 0.00 ? 65  ALA A H3   10 
ATOM   8694  H HA   . ALA A 1 1  ? 17.549  -8.352  1.290   1.00 0.00 ? 65  ALA A HA   10 
ATOM   8695  H HB1  . ALA A 1 1  ? 14.876  -8.659  2.653   1.00 0.00 ? 65  ALA A HB1  10 
ATOM   8696  H HB2  . ALA A 1 1  ? 15.961  -9.979  2.218   1.00 0.00 ? 65  ALA A HB2  10 
ATOM   8697  H HB3  . ALA A 1 1  ? 16.455  -8.790  3.424   1.00 0.00 ? 65  ALA A HB3  10 
ATOM   8698  N N    . SER A 1 2  ? 16.266  -9.224  -0.699  1.00 0.00 ? 66  SER A N    10 
ATOM   8699  C CA   . SER A 1 2  ? 15.690  -9.570  -1.996  1.00 0.00 ? 66  SER A CA   10 
ATOM   8700  C C    . SER A 1 2  ? 15.878  -8.436  -3.025  1.00 0.00 ? 66  SER A C    10 
ATOM   8701  O O    . SER A 1 2  ? 16.772  -8.502  -3.871  1.00 0.00 ? 66  SER A O    10 
ATOM   8702  C CB   . SER A 1 2  ? 14.213  -9.996  -1.852  1.00 0.00 ? 66  SER A CB   10 
ATOM   8703  O OG   . SER A 1 2  ? 14.089  -11.042 -0.884  1.00 0.00 ? 66  SER A OG   10 
ATOM   8704  H H    . SER A 1 2  ? 17.066  -9.729  -0.437  1.00 0.00 ? 66  SER A H    10 
ATOM   8705  H HA   . SER A 1 2  ? 16.258  -10.413 -2.363  1.00 0.00 ? 66  SER A HA   10 
ATOM   8706  H HB2  . SER A 1 2  ? 13.627  -9.150  -1.528  1.00 0.00 ? 66  SER A HB2  10 
ATOM   8707  H HB3  . SER A 1 2  ? 13.842  -10.352 -2.802  1.00 0.00 ? 66  SER A HB3  10 
ATOM   8708  H HG   . SER A 1 2  ? 13.580  -10.701 -0.138  1.00 0.00 ? 66  SER A HG   10 
ATOM   8709  N N    . THR A 1 3  ? 15.074  -7.400  -2.916  1.00 0.00 ? 67  THR A N    10 
ATOM   8710  C CA   . THR A 1 3  ? 15.114  -6.266  -3.794  1.00 0.00 ? 67  THR A CA   10 
ATOM   8711  C C    . THR A 1 3  ? 14.101  -5.239  -3.287  1.00 0.00 ? 67  THR A C    10 
ATOM   8712  O O    . THR A 1 3  ? 12.989  -5.604  -2.846  1.00 0.00 ? 67  THR A O    10 
ATOM   8713  C CB   . THR A 1 3  ? 14.827  -6.670  -5.292  1.00 0.00 ? 67  THR A CB   10 
ATOM   8714  O OG1  . THR A 1 3  ? 14.899  -5.533  -6.173  1.00 0.00 ? 67  THR A OG1  10 
ATOM   8715  C CG2  . THR A 1 3  ? 13.474  -7.345  -5.446  1.00 0.00 ? 67  THR A CG2  10 
ATOM   8716  H H    . THR A 1 3  ? 14.417  -7.364  -2.186  1.00 0.00 ? 67  THR A H    10 
ATOM   8717  H HA   . THR A 1 3  ? 16.100  -5.834  -3.721  1.00 0.00 ? 67  THR A HA   10 
ATOM   8718  H HB   . THR A 1 3  ? 15.598  -7.367  -5.587  1.00 0.00 ? 67  THR A HB   10 
ATOM   8719  H HG1  . THR A 1 3  ? 15.753  -5.098  -6.025  1.00 0.00 ? 67  THR A HG1  10 
ATOM   8720  H HG21 . THR A 1 3  ? 12.701  -6.666  -5.117  1.00 0.00 ? 67  THR A HG21 10 
ATOM   8721  H HG22 . THR A 1 3  ? 13.319  -7.597  -6.484  1.00 0.00 ? 67  THR A HG22 10 
ATOM   8722  H HG23 . THR A 1 3  ? 13.444  -8.242  -4.845  1.00 0.00 ? 67  THR A HG23 10 
ATOM   8723  N N    . GLN A 1 4  ? 14.490  -3.991  -3.280  1.00 0.00 ? 68  GLN A N    10 
ATOM   8724  C CA   . GLN A 1 4  ? 13.618  -2.942  -2.834  1.00 0.00 ? 68  GLN A CA   10 
ATOM   8725  C C    . GLN A 1 4  ? 12.998  -2.271  -4.039  1.00 0.00 ? 68  GLN A C    10 
ATOM   8726  O O    . GLN A 1 4  ? 13.710  -1.966  -5.009  1.00 0.00 ? 68  GLN A O    10 
ATOM   8727  C CB   . GLN A 1 4  ? 14.377  -1.898  -2.015  1.00 0.00 ? 68  GLN A CB   10 
ATOM   8728  C CG   . GLN A 1 4  ? 15.081  -2.446  -0.790  1.00 0.00 ? 68  GLN A CG   10 
ATOM   8729  C CD   . GLN A 1 4  ? 15.729  -1.354  0.035   1.00 0.00 ? 68  GLN A CD   10 
ATOM   8730  O OE1  . GLN A 1 4  ? 15.251  -0.222  0.079   1.00 0.00 ? 68  GLN A OE1  10 
ATOM   8731  N NE2  . GLN A 1 4  ? 16.816  -1.673  0.679   1.00 0.00 ? 68  GLN A NE2  10 
ATOM   8732  H H    . GLN A 1 4  ? 15.385  -3.752  -3.606  1.00 0.00 ? 68  GLN A H    10 
ATOM   8733  H HA   . GLN A 1 4  ? 12.854  -3.388  -2.217  1.00 0.00 ? 68  GLN A HA   10 
ATOM   8734  H HB2  . GLN A 1 4  ? 15.121  -1.435  -2.645  1.00 0.00 ? 68  GLN A HB2  10 
ATOM   8735  H HB3  . GLN A 1 4  ? 13.679  -1.139  -1.692  1.00 0.00 ? 68  GLN A HB3  10 
ATOM   8736  H HG2  . GLN A 1 4  ? 14.358  -2.962  -0.175  1.00 0.00 ? 68  GLN A HG2  10 
ATOM   8737  H HG3  . GLN A 1 4  ? 15.844  -3.139  -1.111  1.00 0.00 ? 68  GLN A HG3  10 
ATOM   8738  H HE21 . GLN A 1 4  ? 17.157  -2.589  0.599   1.00 0.00 ? 68  GLN A HE21 10 
ATOM   8739  H HE22 . GLN A 1 4  ? 17.251  -0.980  1.221   1.00 0.00 ? 68  GLN A HE22 10 
ATOM   8740  N N    . PRO A 1 5  ? 11.676  -2.052  -4.026  1.00 0.00 ? 69  PRO A N    10 
ATOM   8741  C CA   . PRO A 1 5  ? 10.984  -1.352  -5.110  1.00 0.00 ? 69  PRO A CA   10 
ATOM   8742  C C    . PRO A 1 5  ? 11.553  0.059   -5.295  1.00 0.00 ? 69  PRO A C    10 
ATOM   8743  O O    . PRO A 1 5  ? 12.053  0.668   -4.337  1.00 0.00 ? 69  PRO A O    10 
ATOM   8744  C CB   . PRO A 1 5  ? 9.536   -1.280  -4.614  1.00 0.00 ? 69  PRO A CB   10 
ATOM   8745  C CG   . PRO A 1 5  ? 9.420   -2.405  -3.653  1.00 0.00 ? 69  PRO A CG   10 
ATOM   8746  C CD   . PRO A 1 5  ? 10.743  -2.478  -2.969  1.00 0.00 ? 69  PRO A CD   10 
ATOM   8747  H HA   . PRO A 1 5  ? 11.040  -1.897  -6.040  1.00 0.00 ? 69  PRO A HA   10 
ATOM   8748  H HB2  . PRO A 1 5  ? 9.366   -0.325  -4.141  1.00 0.00 ? 69  PRO A HB2  10 
ATOM   8749  H HB3  . PRO A 1 5  ? 8.857   -1.400  -5.444  1.00 0.00 ? 69  PRO A HB3  10 
ATOM   8750  H HG2  . PRO A 1 5  ? 8.629   -2.231  -2.940  1.00 0.00 ? 69  PRO A HG2  10 
ATOM   8751  H HG3  . PRO A 1 5  ? 9.232   -3.324  -4.187  1.00 0.00 ? 69  PRO A HG3  10 
ATOM   8752  H HD2  . PRO A 1 5  ? 10.774  -1.807  -2.123  1.00 0.00 ? 69  PRO A HD2  10 
ATOM   8753  H HD3  . PRO A 1 5  ? 10.941  -3.496  -2.666  1.00 0.00 ? 69  PRO A HD3  10 
ATOM   8754  N N    . THR A 1 6  ? 11.464  0.585   -6.494  1.00 0.00 ? 70  THR A N    10 
ATOM   8755  C CA   . THR A 1 6  ? 12.027  1.886   -6.778  1.00 0.00 ? 70  THR A CA   10 
ATOM   8756  C C    . THR A 1 6  ? 11.031  2.999   -6.406  1.00 0.00 ? 70  THR A C    10 
ATOM   8757  O O    . THR A 1 6  ? 11.283  4.190   -6.648  1.00 0.00 ? 70  THR A O    10 
ATOM   8758  C CB   . THR A 1 6  ? 12.507  2.013   -8.264  1.00 0.00 ? 70  THR A CB   10 
ATOM   8759  O OG1  . THR A 1 6  ? 13.231  3.244   -8.449  1.00 0.00 ? 70  THR A OG1  10 
ATOM   8760  C CG2  . THR A 1 6  ? 11.333  1.969   -9.240  1.00 0.00 ? 70  THR A CG2  10 
ATOM   8761  H H    . THR A 1 6  ? 11.001  0.089   -7.205  1.00 0.00 ? 70  THR A H    10 
ATOM   8762  H HA   . THR A 1 6  ? 12.883  1.991   -6.127  1.00 0.00 ? 70  THR A HA   10 
ATOM   8763  H HB   . THR A 1 6  ? 13.175  1.193   -8.476  1.00 0.00 ? 70  THR A HB   10 
ATOM   8764  H HG1  . THR A 1 6  ? 12.652  3.958   -8.159  1.00 0.00 ? 70  THR A HG1  10 
ATOM   8765  H HG21 . THR A 1 6  ? 10.654  2.781   -9.022  1.00 0.00 ? 70  THR A HG21 10 
ATOM   8766  H HG22 . THR A 1 6  ? 11.699  2.068   -10.251 1.00 0.00 ? 70  THR A HG22 10 
ATOM   8767  H HG23 . THR A 1 6  ? 10.814  1.029   -9.134  1.00 0.00 ? 70  THR A HG23 10 
ATOM   8768  N N    . HIS A 1 7  ? 9.906   2.602   -5.842  1.00 0.00 ? 71  HIS A N    10 
ATOM   8769  C CA   . HIS A 1 7  ? 8.942   3.542   -5.329  1.00 0.00 ? 71  HIS A CA   10 
ATOM   8770  C C    . HIS A 1 7  ? 9.411   4.050   -3.990  1.00 0.00 ? 71  HIS A C    10 
ATOM   8771  O O    . HIS A 1 7  ? 9.655   3.254   -3.075  1.00 0.00 ? 71  HIS A O    10 
ATOM   8772  C CB   . HIS A 1 7  ? 7.556   2.912   -5.158  1.00 0.00 ? 71  HIS A CB   10 
ATOM   8773  C CG   . HIS A 1 7  ? 6.848   2.566   -6.421  1.00 0.00 ? 71  HIS A CG   10 
ATOM   8774  N ND1  . HIS A 1 7  ? 5.971   1.517   -6.544  1.00 0.00 ? 71  HIS A ND1  10 
ATOM   8775  C CD2  . HIS A 1 7  ? 6.870   3.176   -7.615  1.00 0.00 ? 71  HIS A CD2  10 
ATOM   8776  C CE1  . HIS A 1 7  ? 5.501   1.513   -7.783  1.00 0.00 ? 71  HIS A CE1  10 
ATOM   8777  N NE2  . HIS A 1 7  ? 6.017   2.507   -8.485  1.00 0.00 ? 71  HIS A NE2  10 
ATOM   8778  H H    . HIS A 1 7  ? 9.733   1.640   -5.775  1.00 0.00 ? 71  HIS A H    10 
ATOM   8779  H HA   . HIS A 1 7  ? 8.876   4.363   -6.026  1.00 0.00 ? 71  HIS A HA   10 
ATOM   8780  H HB2  . HIS A 1 7  ? 7.656   2.000   -4.589  1.00 0.00 ? 71  HIS A HB2  10 
ATOM   8781  H HB3  . HIS A 1 7  ? 6.935   3.600   -4.604  1.00 0.00 ? 71  HIS A HB3  10 
ATOM   8782  H HD1  . HIS A 1 7  ? 5.691   0.904   -5.827  1.00 0.00 ? 71  HIS A HD1  10 
ATOM   8783  H HD2  . HIS A 1 7  ? 7.439   4.062   -7.842  1.00 0.00 ? 71  HIS A HD2  10 
ATOM   8784  H HE1  . HIS A 1 7  ? 4.789   0.796   -8.162  1.00 0.00 ? 71  HIS A HE1  10 
ATOM   8785  N N    . SER A 1 8  ? 9.554   5.328   -3.883  1.00 0.00 ? 72  SER A N    10 
ATOM   8786  C CA   . SER A 1 8  ? 9.976   5.946   -2.669  1.00 0.00 ? 72  SER A CA   10 
ATOM   8787  C C    . SER A 1 8  ? 8.756   6.493   -1.942  1.00 0.00 ? 72  SER A C    10 
ATOM   8788  O O    . SER A 1 8  ? 8.024   7.352   -2.473  1.00 0.00 ? 72  SER A O    10 
ATOM   8789  C CB   . SER A 1 8  ? 10.977  7.046   -2.982  1.00 0.00 ? 72  SER A CB   10 
ATOM   8790  O OG   . SER A 1 8  ? 12.068  6.517   -3.737  1.00 0.00 ? 72  SER A OG   10 
ATOM   8791  H H    . SER A 1 8  ? 9.345   5.907   -4.645  1.00 0.00 ? 72  SER A H    10 
ATOM   8792  H HA   . SER A 1 8  ? 10.451  5.194   -2.058  1.00 0.00 ? 72  SER A HA   10 
ATOM   8793  H HB2  . SER A 1 8  ? 10.495  7.823   -3.555  1.00 0.00 ? 72  SER A HB2  10 
ATOM   8794  H HB3  . SER A 1 8  ? 11.360  7.460   -2.062  1.00 0.00 ? 72  SER A HB3  10 
ATOM   8795  H HG   . SER A 1 8  ? 12.512  5.876   -3.165  1.00 0.00 ? 72  SER A HG   10 
ATOM   8796  N N    . TRP A 1 9  ? 8.505   5.955   -0.779  1.00 0.00 ? 73  TRP A N    10 
ATOM   8797  C CA   . TRP A 1 9  ? 7.375   6.329   0.023   1.00 0.00 ? 73  TRP A CA   10 
ATOM   8798  C C    . TRP A 1 9  ? 7.834   6.773   1.400   1.00 0.00 ? 73  TRP A C    10 
ATOM   8799  O O    . TRP A 1 9  ? 8.915   6.360   1.861   1.00 0.00 ? 73  TRP A O    10 
ATOM   8800  C CB   . TRP A 1 9  ? 6.417   5.142   0.135   1.00 0.00 ? 73  TRP A CB   10 
ATOM   8801  C CG   . TRP A 1 9  ? 5.778   4.767   -1.171  1.00 0.00 ? 73  TRP A CG   10 
ATOM   8802  C CD1  . TRP A 1 9  ? 6.117   3.732   -1.990  1.00 0.00 ? 73  TRP A CD1  10 
ATOM   8803  C CD2  . TRP A 1 9  ? 4.695   5.447   -1.812  1.00 0.00 ? 73  TRP A CD2  10 
ATOM   8804  N NE1  . TRP A 1 9  ? 5.301   3.722   -3.096  1.00 0.00 ? 73  TRP A NE1  10 
ATOM   8805  C CE2  . TRP A 1 9  ? 4.423   4.763   -3.008  1.00 0.00 ? 73  TRP A CE2  10 
ATOM   8806  C CE3  . TRP A 1 9  ? 3.928   6.565   -1.486  1.00 0.00 ? 73  TRP A CE3  10 
ATOM   8807  C CZ2  . TRP A 1 9  ? 3.417   5.159   -3.874  1.00 0.00 ? 73  TRP A CZ2  10 
ATOM   8808  C CZ3  . TRP A 1 9  ? 2.931   6.956   -2.349  1.00 0.00 ? 73  TRP A CZ3  10 
ATOM   8809  C CH2  . TRP A 1 9  ? 2.686   6.252   -3.528  1.00 0.00 ? 73  TRP A CH2  10 
ATOM   8810  H H    . TRP A 1 9  ? 9.113   5.267   -0.424  1.00 0.00 ? 73  TRP A H    10 
ATOM   8811  H HA   . TRP A 1 9  ? 6.857   7.139   -0.468  1.00 0.00 ? 73  TRP A HA   10 
ATOM   8812  H HB2  . TRP A 1 9  ? 6.972   4.284   0.487   1.00 0.00 ? 73  TRP A HB2  10 
ATOM   8813  H HB3  . TRP A 1 9  ? 5.632   5.362   0.841   1.00 0.00 ? 73  TRP A HB3  10 
ATOM   8814  H HD1  . TRP A 1 9  ? 6.912   3.029   -1.783  1.00 0.00 ? 73  TRP A HD1  10 
ATOM   8815  H HE1  . TRP A 1 9  ? 5.336   3.080   -3.840  1.00 0.00 ? 73  TRP A HE1  10 
ATOM   8816  H HE3  . TRP A 1 9  ? 4.107   7.118   -0.577  1.00 0.00 ? 73  TRP A HE3  10 
ATOM   8817  H HZ2  . TRP A 1 9  ? 3.206   4.629   -4.790  1.00 0.00 ? 73  TRP A HZ2  10 
ATOM   8818  H HZ3  . TRP A 1 9  ? 2.326   7.818   -2.113  1.00 0.00 ? 73  TRP A HZ3  10 
ATOM   8819  H HH2  . TRP A 1 9  ? 1.894   6.585   -4.181  1.00 0.00 ? 73  TRP A HH2  10 
ATOM   8820  N N    . LYS A 1 10 ? 7.082   7.657   2.023   1.00 0.00 ? 74  LYS A N    10 
ATOM   8821  C CA   . LYS A 1 10 ? 7.360   8.070   3.383   1.00 0.00 ? 74  LYS A CA   10 
ATOM   8822  C C    . LYS A 1 10 ? 6.129   7.857   4.243   1.00 0.00 ? 74  LYS A C    10 
ATOM   8823  O O    . LYS A 1 10 ? 5.004   7.747   3.730   1.00 0.00 ? 74  LYS A O    10 
ATOM   8824  C CB   . LYS A 1 10 ? 7.809   9.542   3.486   1.00 0.00 ? 74  LYS A CB   10 
ATOM   8825  C CG   . LYS A 1 10 ? 6.798   10.551  2.969   1.00 0.00 ? 74  LYS A CG   10 
ATOM   8826  C CD   . LYS A 1 10 ? 7.103   11.962  3.434   1.00 0.00 ? 74  LYS A CD   10 
ATOM   8827  C CE   . LYS A 1 10 ? 6.824   12.131  4.931   1.00 0.00 ? 74  LYS A CE   10 
ATOM   8828  N NZ   . LYS A 1 10 ? 7.054   13.518  5.392   1.00 0.00 ? 74  LYS A NZ   10 
ATOM   8829  H H    . LYS A 1 10 ? 6.298   8.061   1.573   1.00 0.00 ? 74  LYS A H    10 
ATOM   8830  H HA   . LYS A 1 10 ? 8.147   7.431   3.757   1.00 0.00 ? 74  LYS A HA   10 
ATOM   8831  H HB2  . LYS A 1 10 ? 8.014   9.768   4.520   1.00 0.00 ? 74  LYS A HB2  10 
ATOM   8832  H HB3  . LYS A 1 10 ? 8.720   9.659   2.920   1.00 0.00 ? 74  LYS A HB3  10 
ATOM   8833  H HG2  . LYS A 1 10 ? 6.807   10.534  1.889   1.00 0.00 ? 74  LYS A HG2  10 
ATOM   8834  H HG3  . LYS A 1 10 ? 5.817   10.267  3.323   1.00 0.00 ? 74  LYS A HG3  10 
ATOM   8835  H HD2  . LYS A 1 10 ? 8.149   12.157  3.251   1.00 0.00 ? 74  LYS A HD2  10 
ATOM   8836  H HD3  . LYS A 1 10 ? 6.500   12.658  2.870   1.00 0.00 ? 74  LYS A HD3  10 
ATOM   8837  H HE2  . LYS A 1 10 ? 5.793   11.873  5.122   1.00 0.00 ? 74  LYS A HE2  10 
ATOM   8838  H HE3  . LYS A 1 10 ? 7.454   11.461  5.495   1.00 0.00 ? 74  LYS A HE3  10 
ATOM   8839  H HZ1  . LYS A 1 10 ? 6.435   14.184  4.886   1.00 0.00 ? 74  LYS A HZ1  10 
ATOM   8840  H HZ2  . LYS A 1 10 ? 6.851   13.587  6.407   1.00 0.00 ? 74  LYS A HZ2  10 
ATOM   8841  H HZ3  . LYS A 1 10 ? 8.043   13.802  5.246   1.00 0.00 ? 74  LYS A HZ3  10 
ATOM   8842  N N    . VAL A 1 11 ? 6.334   7.753   5.531   1.00 0.00 ? 75  VAL A N    10 
ATOM   8843  C CA   . VAL A 1 11 ? 5.244   7.612   6.462   1.00 0.00 ? 75  VAL A CA   10 
ATOM   8844  C C    . VAL A 1 11 ? 4.389   8.872   6.420   1.00 0.00 ? 75  VAL A C    10 
ATOM   8845  O O    . VAL A 1 11 ? 4.907   9.989   6.549   1.00 0.00 ? 75  VAL A O    10 
ATOM   8846  C CB   . VAL A 1 11 ? 5.751   7.362   7.898   1.00 0.00 ? 75  VAL A CB   10 
ATOM   8847  C CG1  . VAL A 1 11 ? 4.593   7.238   8.877   1.00 0.00 ? 75  VAL A CG1  10 
ATOM   8848  C CG2  . VAL A 1 11 ? 6.618   6.114   7.947   1.00 0.00 ? 75  VAL A CG2  10 
ATOM   8849  H H    . VAL A 1 11 ? 7.259   7.795   5.867   1.00 0.00 ? 75  VAL A H    10 
ATOM   8850  H HA   . VAL A 1 11 ? 4.643   6.773   6.144   1.00 0.00 ? 75  VAL A HA   10 
ATOM   8851  H HB   . VAL A 1 11 ? 6.360   8.209   8.174   1.00 0.00 ? 75  VAL A HB   10 
ATOM   8852  H HG11 . VAL A 1 11 ? 3.968   6.405   8.593   1.00 0.00 ? 75  VAL A HG11 10 
ATOM   8853  H HG12 . VAL A 1 11 ? 4.978   7.075   9.873   1.00 0.00 ? 75  VAL A HG12 10 
ATOM   8854  H HG13 . VAL A 1 11 ? 4.010   8.146   8.856   1.00 0.00 ? 75  VAL A HG13 10 
ATOM   8855  H HG21 . VAL A 1 11 ? 7.486   6.250   7.319   1.00 0.00 ? 75  VAL A HG21 10 
ATOM   8856  H HG22 . VAL A 1 11 ? 6.930   5.932   8.965   1.00 0.00 ? 75  VAL A HG22 10 
ATOM   8857  H HG23 . VAL A 1 11 ? 6.047   5.269   7.592   1.00 0.00 ? 75  VAL A HG23 10 
ATOM   8858  N N    . GLY A 1 12 ? 3.114   8.694   6.235   1.00 0.00 ? 76  GLY A N    10 
ATOM   8859  C CA   . GLY A 1 12 ? 2.236   9.816   6.124   1.00 0.00 ? 76  GLY A CA   10 
ATOM   8860  C C    . GLY A 1 12 ? 1.780   10.019  4.703   1.00 0.00 ? 76  GLY A C    10 
ATOM   8861  O O    . GLY A 1 12 ? 0.923   10.850  4.438   1.00 0.00 ? 76  GLY A O    10 
ATOM   8862  H H    . GLY A 1 12 ? 2.749   7.783   6.193   1.00 0.00 ? 76  GLY A H    10 
ATOM   8863  H HA2  . GLY A 1 12 ? 1.374   9.655   6.757   1.00 0.00 ? 76  GLY A HA2  10 
ATOM   8864  H HA3  . GLY A 1 12 ? 2.759   10.701  6.452   1.00 0.00 ? 76  GLY A HA3  10 
ATOM   8865  N N    . ASP A 1 13 ? 2.359   9.270   3.779   1.00 0.00 ? 77  ASP A N    10 
ATOM   8866  C CA   . ASP A 1 13 ? 1.949   9.355   2.380   1.00 0.00 ? 77  ASP A CA   10 
ATOM   8867  C C    . ASP A 1 13 ? 0.635   8.712   2.150   1.00 0.00 ? 77  ASP A C    10 
ATOM   8868  O O    . ASP A 1 13 ? 0.288   7.704   2.791   1.00 0.00 ? 77  ASP A O    10 
ATOM   8869  C CB   . ASP A 1 13 ? 2.931   8.711   1.409   1.00 0.00 ? 77  ASP A CB   10 
ATOM   8870  C CG   . ASP A 1 13 ? 4.003   9.618   0.900   1.00 0.00 ? 77  ASP A CG   10 
ATOM   8871  O OD1  . ASP A 1 13 ? 3.689   10.768  0.510   1.00 0.00 ? 77  ASP A OD1  10 
ATOM   8872  O OD2  . ASP A 1 13 ? 5.154   9.191   0.793   1.00 0.00 ? 77  ASP A OD2  10 
ATOM   8873  H H    . ASP A 1 13 ? 3.078   8.651   4.035   1.00 0.00 ? 77  ASP A H    10 
ATOM   8874  H HA   . ASP A 1 13 ? 1.868   10.401  2.128   1.00 0.00 ? 77  ASP A HA   10 
ATOM   8875  H HB2  . ASP A 1 13 ? 3.405   7.905   1.940   1.00 0.00 ? 77  ASP A HB2  10 
ATOM   8876  H HB3  . ASP A 1 13 ? 2.384   8.303   0.571   1.00 0.00 ? 77  ASP A HB3  10 
ATOM   8877  N N    . LYS A 1 14 ? -0.088  9.275   1.241   1.00 0.00 ? 78  LYS A N    10 
ATOM   8878  C CA   . LYS A 1 14 ? -1.294  8.694   0.789   1.00 0.00 ? 78  LYS A CA   10 
ATOM   8879  C C    . LYS A 1 14 ? -0.943  7.906   -0.430  1.00 0.00 ? 78  LYS A C    10 
ATOM   8880  O O    . LYS A 1 14 ? -0.280  8.407   -1.344  1.00 0.00 ? 78  LYS A O    10 
ATOM   8881  C CB   . LYS A 1 14 ? -2.339  9.753   0.428   1.00 0.00 ? 78  LYS A CB   10 
ATOM   8882  C CG   . LYS A 1 14 ? -2.856  10.591  1.584   1.00 0.00 ? 78  LYS A CG   10 
ATOM   8883  C CD   . LYS A 1 14 ? -3.660  9.768   2.580   1.00 0.00 ? 78  LYS A CD   10 
ATOM   8884  C CE   . LYS A 1 14 ? -4.426  10.663  3.556   1.00 0.00 ? 78  LYS A CE   10 
ATOM   8885  N NZ   . LYS A 1 14 ? -3.547  11.559  4.335   1.00 0.00 ? 78  LYS A NZ   10 
ATOM   8886  H H    . LYS A 1 14 ? 0.241   10.100  0.827   1.00 0.00 ? 78  LYS A H    10 
ATOM   8887  H HA   . LYS A 1 14 ? -1.674  8.036   1.556   1.00 0.00 ? 78  LYS A HA   10 
ATOM   8888  H HB2  . LYS A 1 14 ? -1.908  10.423  -0.301  1.00 0.00 ? 78  LYS A HB2  10 
ATOM   8889  H HB3  . LYS A 1 14 ? -3.180  9.253   -0.028  1.00 0.00 ? 78  LYS A HB3  10 
ATOM   8890  H HG2  . LYS A 1 14 ? -1.982  10.959  2.098   1.00 0.00 ? 78  LYS A HG2  10 
ATOM   8891  H HG3  . LYS A 1 14 ? -3.454  11.410  1.214   1.00 0.00 ? 78  LYS A HG3  10 
ATOM   8892  H HD2  . LYS A 1 14 ? -4.364  9.150   2.041   1.00 0.00 ? 78  LYS A HD2  10 
ATOM   8893  H HD3  . LYS A 1 14 ? -2.980  9.141   3.136   1.00 0.00 ? 78  LYS A HD3  10 
ATOM   8894  H HE2  . LYS A 1 14 ? -5.120  11.267  2.992   1.00 0.00 ? 78  LYS A HE2  10 
ATOM   8895  H HE3  . LYS A 1 14 ? -4.979  10.031  4.235   1.00 0.00 ? 78  LYS A HE3  10 
ATOM   8896  H HZ1  . LYS A 1 14 ? -2.952  12.167  3.735   1.00 0.00 ? 78  LYS A HZ1  10 
ATOM   8897  H HZ2  . LYS A 1 14 ? -4.120  12.191  4.930   1.00 0.00 ? 78  LYS A HZ2  10 
ATOM   8898  H HZ3  . LYS A 1 14 ? -2.921  11.027  4.984   1.00 0.00 ? 78  LYS A HZ3  10 
ATOM   8899  N N    . CYS A 1 15 ? -1.367  6.725   -0.457  1.00 0.00 ? 79  CYS A N    10 
ATOM   8900  C CA   . CYS A 1 15 ? -1.071  5.847   -1.532  1.00 0.00 ? 79  CYS A CA   10 
ATOM   8901  C C    . CYS A 1 15 ? -2.290  5.046   -1.840  1.00 0.00 ? 79  CYS A C    10 
ATOM   8902  O O    . CYS A 1 15 ? -3.324  5.202   -1.192  1.00 0.00 ? 79  CYS A O    10 
ATOM   8903  C CB   . CYS A 1 15 ? 0.090   4.922   -1.141  1.00 0.00 ? 79  CYS A CB   10 
ATOM   8904  S SG   . CYS A 1 15 ? -0.214  3.933   0.352   1.00 0.00 ? 79  CYS A SG   10 
ATOM   8905  H H    . CYS A 1 15 ? -1.927  6.401   0.284   1.00 0.00 ? 79  CYS A H    10 
ATOM   8906  H HA   . CYS A 1 15 ? -0.781  6.427   -2.396  1.00 0.00 ? 79  CYS A HA   10 
ATOM   8907  H HB2  . CYS A 1 15 ? 0.287   4.243   -1.960  1.00 0.00 ? 79  CYS A HB2  10 
ATOM   8908  H HB3  . CYS A 1 15 ? 0.975   5.519   -0.977  1.00 0.00 ? 79  CYS A HB3  10 
ATOM   8909  H HG   . CYS A 1 15 ? -1.272  4.413   0.994   1.00 0.00 ? 79  CYS A HG   10 
ATOM   8910  N N    . MET A 1 16 ? -2.211  4.245   -2.829  1.00 0.00 ? 80  MET A N    10 
ATOM   8911  C CA   . MET A 1 16 ? -3.265  3.346   -3.116  1.00 0.00 ? 80  MET A CA   10 
ATOM   8912  C C    . MET A 1 16 ? -2.691  1.978   -3.037  1.00 0.00 ? 80  MET A C    10 
ATOM   8913  O O    . MET A 1 16 ? -1.645  1.709   -3.627  1.00 0.00 ? 80  MET A O    10 
ATOM   8914  C CB   . MET A 1 16 ? -3.887  3.597   -4.484  1.00 0.00 ? 80  MET A CB   10 
ATOM   8915  C CG   . MET A 1 16 ? -4.252  5.048   -4.726  1.00 0.00 ? 80  MET A CG   10 
ATOM   8916  S SD   . MET A 1 16 ? -5.233  5.298   -6.206  1.00 0.00 ? 80  MET A SD   10 
ATOM   8917  C CE   . MET A 1 16 ? -6.741  4.465   -5.723  1.00 0.00 ? 80  MET A CE   10 
ATOM   8918  H H    . MET A 1 16 ? -1.402  4.262   -3.389  1.00 0.00 ? 80  MET A H    10 
ATOM   8919  H HA   . MET A 1 16 ? -4.013  3.455   -2.345  1.00 0.00 ? 80  MET A HA   10 
ATOM   8920  H HB2  . MET A 1 16 ? -3.207  3.265   -5.250  1.00 0.00 ? 80  MET A HB2  10 
ATOM   8921  H HB3  . MET A 1 16 ? -4.788  3.006   -4.550  1.00 0.00 ? 80  MET A HB3  10 
ATOM   8922  H HG2  . MET A 1 16 ? -4.805  5.421   -3.878  1.00 0.00 ? 80  MET A HG2  10 
ATOM   8923  H HG3  . MET A 1 16 ? -3.329  5.600   -4.827  1.00 0.00 ? 80  MET A HG3  10 
ATOM   8924  H HE1  . MET A 1 16 ? -7.103  4.907   -4.805  1.00 0.00 ? 80  MET A HE1  10 
ATOM   8925  H HE2  . MET A 1 16 ? -7.484  4.580   -6.497  1.00 0.00 ? 80  MET A HE2  10 
ATOM   8926  H HE3  . MET A 1 16 ? -6.541  3.417   -5.557  1.00 0.00 ? 80  MET A HE3  10 
ATOM   8927  N N    . ALA A 1 17 ? -3.332  1.142   -2.308  1.00 0.00 ? 81  ALA A N    10 
ATOM   8928  C CA   . ALA A 1 17 ? -2.858  -0.181  -2.073  1.00 0.00 ? 81  ALA A CA   10 
ATOM   8929  C C    . ALA A 1 17 ? -3.848  -1.160  -2.605  1.00 0.00 ? 81  ALA A C    10 
ATOM   8930  O O    . ALA A 1 17 ? -5.038  -0.852  -2.704  1.00 0.00 ? 81  ALA A O    10 
ATOM   8931  C CB   . ALA A 1 17 ? -2.671  -0.393  -0.592  1.00 0.00 ? 81  ALA A CB   10 
ATOM   8932  H H    . ALA A 1 17 ? -4.193  1.416   -1.919  1.00 0.00 ? 81  ALA A H    10 
ATOM   8933  H HA   . ALA A 1 17 ? -1.905  -0.314  -2.559  1.00 0.00 ? 81  ALA A HA   10 
ATOM   8934  H HB1  . ALA A 1 17 ? -3.615  -0.216  -0.095  1.00 0.00 ? 81  ALA A HB1  10 
ATOM   8935  H HB2  . ALA A 1 17 ? -2.357  -1.409  -0.406  1.00 0.00 ? 81  ALA A HB2  10 
ATOM   8936  H HB3  . ALA A 1 17 ? -1.931  0.297   -0.215  1.00 0.00 ? 81  ALA A HB3  10 
ATOM   8937  N N    . VAL A 1 18 ? -3.378  -2.305  -2.969  1.00 0.00 ? 82  VAL A N    10 
ATOM   8938  C CA   . VAL A 1 18 ? -4.235  -3.342  -3.450  1.00 0.00 ? 82  VAL A CA   10 
ATOM   8939  C C    . VAL A 1 18 ? -4.713  -4.141  -2.261  1.00 0.00 ? 82  VAL A C    10 
ATOM   8940  O O    . VAL A 1 18 ? -3.915  -4.780  -1.585  1.00 0.00 ? 82  VAL A O    10 
ATOM   8941  C CB   . VAL A 1 18 ? -3.501  -4.266  -4.454  1.00 0.00 ? 82  VAL A CB   10 
ATOM   8942  C CG1  . VAL A 1 18 ? -4.428  -5.356  -4.977  1.00 0.00 ? 82  VAL A CG1  10 
ATOM   8943  C CG2  . VAL A 1 18 ? -2.932  -3.453  -5.611  1.00 0.00 ? 82  VAL A CG2  10 
ATOM   8944  H H    . VAL A 1 18 ? -2.417  -2.479  -2.894  1.00 0.00 ? 82  VAL A H    10 
ATOM   8945  H HA   . VAL A 1 18 ? -5.090  -2.894  -3.932  1.00 0.00 ? 82  VAL A HA   10 
ATOM   8946  H HB   . VAL A 1 18 ? -2.679  -4.737  -3.934  1.00 0.00 ? 82  VAL A HB   10 
ATOM   8947  H HG11 . VAL A 1 18 ? -5.269  -4.902  -5.481  1.00 0.00 ? 82  VAL A HG11 10 
ATOM   8948  H HG12 . VAL A 1 18 ? -3.889  -5.984  -5.669  1.00 0.00 ? 82  VAL A HG12 10 
ATOM   8949  H HG13 . VAL A 1 18 ? -4.784  -5.951  -4.149  1.00 0.00 ? 82  VAL A HG13 10 
ATOM   8950  H HG21 . VAL A 1 18 ? -2.240  -2.717  -5.230  1.00 0.00 ? 82  VAL A HG21 10 
ATOM   8951  H HG22 . VAL A 1 18 ? -2.420  -4.112  -6.297  1.00 0.00 ? 82  VAL A HG22 10 
ATOM   8952  H HG23 . VAL A 1 18 ? -3.743  -2.959  -6.124  1.00 0.00 ? 82  VAL A HG23 10 
ATOM   8953  N N    . TRP A 1 19 ? -5.998  -4.068  -2.001  1.00 0.00 ? 83  TRP A N    10 
ATOM   8954  C CA   . TRP A 1 19 ? -6.613  -4.753  -0.895  1.00 0.00 ? 83  TRP A CA   10 
ATOM   8955  C C    . TRP A 1 19 ? -6.562  -6.180  -1.157  1.00 0.00 ? 83  TRP A C    10 
ATOM   8956  O O    . TRP A 1 19 ? -7.198  -6.684  -2.085  1.00 0.00 ? 83  TRP A O    10 
ATOM   8957  C CB   . TRP A 1 19 ? -8.058  -4.291  -0.695  1.00 0.00 ? 83  TRP A CB   10 
ATOM   8958  C CG   . TRP A 1 19 ? -8.671  -4.702  0.622   1.00 0.00 ? 83  TRP A CG   10 
ATOM   8959  C CD1  . TRP A 1 19 ? -8.025  -4.819  1.803   1.00 0.00 ? 83  TRP A CD1  10 
ATOM   8960  C CD2  . TRP A 1 19 ? -10.048 -4.998  0.900   1.00 0.00 ? 83  TRP A CD2  10 
ATOM   8961  N NE1  . TRP A 1 19 ? -8.888  -5.166  2.796   1.00 0.00 ? 83  TRP A NE1  10 
ATOM   8962  C CE2  . TRP A 1 19 ? -10.138 -5.282  2.277   1.00 0.00 ? 83  TRP A CE2  10 
ATOM   8963  C CE3  . TRP A 1 19 ? -11.209 -5.053  0.131   1.00 0.00 ? 83  TRP A CE3  10 
ATOM   8964  C CZ2  . TRP A 1 19 ? -11.336 -5.613  2.898   1.00 0.00 ? 83  TRP A CZ2  10 
ATOM   8965  C CZ3  . TRP A 1 19 ? -12.398 -5.383  0.756   1.00 0.00 ? 83  TRP A CZ3  10 
ATOM   8966  C CH2  . TRP A 1 19 ? -12.447 -5.658  2.125   1.00 0.00 ? 83  TRP A CH2  10 
ATOM   8967  H H    . TRP A 1 19 ? -6.562  -3.534  -2.601  1.00 0.00 ? 83  TRP A H    10 
ATOM   8968  H HA   . TRP A 1 19 ? -6.067  -4.680  0.033   1.00 0.00 ? 83  TRP A HA   10 
ATOM   8969  H HB2  . TRP A 1 19 ? -8.098  -3.218  -0.794  1.00 0.00 ? 83  TRP A HB2  10 
ATOM   8970  H HB3  . TRP A 1 19 ? -8.655  -4.721  -1.486  1.00 0.00 ? 83  TRP A HB3  10 
ATOM   8971  H HD1  . TRP A 1 19 ? -6.965  -4.664  1.912   1.00 0.00 ? 83  TRP A HD1  10 
ATOM   8972  H HE1  . TRP A 1 19 ? -8.636  -5.305  3.738   1.00 0.00 ? 83  TRP A HE1  10 
ATOM   8973  H HE3  . TRP A 1 19 ? -11.191 -4.843  -0.927  1.00 0.00 ? 83  TRP A HE3  10 
ATOM   8974  H HZ2  . TRP A 1 19 ? -11.400 -5.827  3.955   1.00 0.00 ? 83  TRP A HZ2  10 
ATOM   8975  H HZ3  . TRP A 1 19 ? -13.317 -5.435  0.192   1.00 0.00 ? 83  TRP A HZ3  10 
ATOM   8976  H HH2  . TRP A 1 19 ? -13.396 -5.909  2.576   1.00 0.00 ? 83  TRP A HH2  10 
ATOM   8977  N N    . SER A 1 20 ? -5.844  -6.820  -0.320  1.00 0.00 ? 84  SER A N    10 
ATOM   8978  C CA   . SER A 1 20 ? -5.580  -8.201  -0.392  1.00 0.00 ? 84  SER A CA   10 
ATOM   8979  C C    . SER A 1 20 ? -6.834  -9.068  -0.320  1.00 0.00 ? 84  SER A C    10 
ATOM   8980  O O    . SER A 1 20 ? -6.817  -10.241 -0.688  1.00 0.00 ? 84  SER A O    10 
ATOM   8981  C CB   . SER A 1 20 ? -4.619  -8.530  0.702   1.00 0.00 ? 84  SER A CB   10 
ATOM   8982  O OG   . SER A 1 20 ? -3.362  -7.937  0.443   1.00 0.00 ? 84  SER A OG   10 
ATOM   8983  H H    . SER A 1 20 ? -5.429  -6.310  0.415   1.00 0.00 ? 84  SER A H    10 
ATOM   8984  H HA   . SER A 1 20 ? -5.077  -8.386  -1.325  1.00 0.00 ? 84  SER A HA   10 
ATOM   8985  H HB2  . SER A 1 20 ? -5.005  -8.161  1.642   1.00 0.00 ? 84  SER A HB2  10 
ATOM   8986  H HB3  . SER A 1 20 ? -4.518  -9.593  0.734   1.00 0.00 ? 84  SER A HB3  10 
ATOM   8987  H HG   . SER A 1 20 ? -3.333  -7.048  0.835   1.00 0.00 ? 84  SER A HG   10 
ATOM   8988  N N    . GLU A 1 21 ? -7.904  -8.499  0.136   1.00 0.00 ? 85  GLU A N    10 
ATOM   8989  C CA   . GLU A 1 21 ? -9.119  -9.225  0.270   1.00 0.00 ? 85  GLU A CA   10 
ATOM   8990  C C    . GLU A 1 21 ? -9.912  -9.255  -1.015  1.00 0.00 ? 85  GLU A C    10 
ATOM   8991  O O    . GLU A 1 21 ? -10.459 -10.295 -1.391  1.00 0.00 ? 85  GLU A O    10 
ATOM   8992  C CB   . GLU A 1 21 ? -9.938  -8.633  1.369   1.00 0.00 ? 85  GLU A CB   10 
ATOM   8993  C CG   . GLU A 1 21 ? -9.168  -8.494  2.663   1.00 0.00 ? 85  GLU A CG   10 
ATOM   8994  C CD   . GLU A 1 21 ? -8.516  -9.775  3.098   1.00 0.00 ? 85  GLU A CD   10 
ATOM   8995  O OE1  . GLU A 1 21 ? -9.224  -10.769 3.344   1.00 0.00 ? 85  GLU A OE1  10 
ATOM   8996  O OE2  . GLU A 1 21 ? -7.283  -9.820  3.173   1.00 0.00 ? 85  GLU A OE2  10 
ATOM   8997  H H    . GLU A 1 21 ? -7.853  -7.555  0.396   1.00 0.00 ? 85  GLU A H    10 
ATOM   8998  H HA   . GLU A 1 21 ? -8.882  -10.240 0.547   1.00 0.00 ? 85  GLU A HA   10 
ATOM   8999  H HB2  . GLU A 1 21 ? -10.268 -7.652  1.055   1.00 0.00 ? 85  GLU A HB2  10 
ATOM   9000  H HB3  . GLU A 1 21 ? -10.798 -9.259  1.532   1.00 0.00 ? 85  GLU A HB3  10 
ATOM   9001  H HG2  . GLU A 1 21 ? -8.400  -7.756  2.483   1.00 0.00 ? 85  GLU A HG2  10 
ATOM   9002  H HG3  . GLU A 1 21 ? -9.813  -8.107  3.434   1.00 0.00 ? 85  GLU A HG3  10 
ATOM   9003  N N    . ASP A 1 22 ? -9.967  -8.129  -1.693  1.00 0.00 ? 86  ASP A N    10 
ATOM   9004  C CA   . ASP A 1 22 ? -10.825 -8.027  -2.877  1.00 0.00 ? 86  ASP A CA   10 
ATOM   9005  C C    . ASP A 1 22 ? -10.019 -7.998  -4.165  1.00 0.00 ? 86  ASP A C    10 
ATOM   9006  O O    . ASP A 1 22 ? -10.535 -8.297  -5.229  1.00 0.00 ? 86  ASP A O    10 
ATOM   9007  C CB   . ASP A 1 22 ? -11.694 -6.777  -2.779  1.00 0.00 ? 86  ASP A CB   10 
ATOM   9008  C CG   . ASP A 1 22 ? -12.814 -6.737  -3.791  1.00 0.00 ? 86  ASP A CG   10 
ATOM   9009  O OD1  . ASP A 1 22 ? -13.880 -7.327  -3.523  1.00 0.00 ? 86  ASP A OD1  10 
ATOM   9010  O OD2  . ASP A 1 22 ? -12.698 -6.067  -4.812  1.00 0.00 ? 86  ASP A OD2  10 
ATOM   9011  H H    . ASP A 1 22 ? -9.420  -7.377  -1.384  1.00 0.00 ? 86  ASP A H    10 
ATOM   9012  H HA   . ASP A 1 22 ? -11.473 -8.890  -2.889  1.00 0.00 ? 86  ASP A HA   10 
ATOM   9013  H HB2  . ASP A 1 22 ? -12.133 -6.731  -1.794  1.00 0.00 ? 86  ASP A HB2  10 
ATOM   9014  H HB3  . ASP A 1 22 ? -11.069 -5.910  -2.927  1.00 0.00 ? 86  ASP A HB3  10 
ATOM   9015  N N    . GLY A 1 23 ? -8.750  -7.676  -4.060  1.00 0.00 ? 87  GLY A N    10 
ATOM   9016  C CA   . GLY A 1 23 ? -7.894  -7.632  -5.240  1.00 0.00 ? 87  GLY A CA   10 
ATOM   9017  C C    . GLY A 1 23 ? -7.964  -6.310  -6.001  1.00 0.00 ? 87  GLY A C    10 
ATOM   9018  O O    . GLY A 1 23 ? -7.468  -6.204  -7.130  1.00 0.00 ? 87  GLY A O    10 
ATOM   9019  H H    . GLY A 1 23 ? -8.364  -7.489  -3.174  1.00 0.00 ? 87  GLY A H    10 
ATOM   9020  H HA2  . GLY A 1 23 ? -6.871  -7.803  -4.942  1.00 0.00 ? 87  GLY A HA2  10 
ATOM   9021  H HA3  . GLY A 1 23 ? -8.202  -8.425  -5.905  1.00 0.00 ? 87  GLY A HA3  10 
ATOM   9022  N N    . GLN A 1 24 ? -8.562  -5.306  -5.399  1.00 0.00 ? 88  GLN A N    10 
ATOM   9023  C CA   . GLN A 1 24 ? -8.683  -3.996  -6.037  1.00 0.00 ? 88  GLN A CA   10 
ATOM   9024  C C    . GLN A 1 24 ? -7.831  -2.984  -5.319  1.00 0.00 ? 88  GLN A C    10 
ATOM   9025  O O    . GLN A 1 24 ? -7.361  -3.244  -4.216  1.00 0.00 ? 88  GLN A O    10 
ATOM   9026  C CB   . GLN A 1 24 ? -10.129 -3.515  -6.077  1.00 0.00 ? 88  GLN A CB   10 
ATOM   9027  C CG   . GLN A 1 24 ? -11.056 -4.295  -6.979  1.00 0.00 ? 88  GLN A CG   10 
ATOM   9028  C CD   . GLN A 1 24 ? -10.654 -4.257  -8.439  1.00 0.00 ? 88  GLN A CD   10 
ATOM   9029  O OE1  . GLN A 1 24 ? -11.041 -3.357  -9.177  1.00 0.00 ? 88  GLN A OE1  10 
ATOM   9030  N NE2  . GLN A 1 24 ? -9.937  -5.243  -8.880  1.00 0.00 ? 88  GLN A NE2  10 
ATOM   9031  H H    . GLN A 1 24 ? -8.903  -5.438  -4.491  1.00 0.00 ? 88  GLN A H    10 
ATOM   9032  H HA   . GLN A 1 24 ? -8.311  -4.088  -7.045  1.00 0.00 ? 88  GLN A HA   10 
ATOM   9033  H HB2  . GLN A 1 24 ? -10.532 -3.584  -5.078  1.00 0.00 ? 88  GLN A HB2  10 
ATOM   9034  H HB3  . GLN A 1 24 ? -10.140 -2.481  -6.386  1.00 0.00 ? 88  GLN A HB3  10 
ATOM   9035  H HG2  . GLN A 1 24 ? -11.049 -5.322  -6.649  1.00 0.00 ? 88  GLN A HG2  10 
ATOM   9036  H HG3  . GLN A 1 24 ? -12.044 -3.875  -6.878  1.00 0.00 ? 88  GLN A HG3  10 
ATOM   9037  H HE21 . GLN A 1 24 ? -9.688  -5.963  -8.258  1.00 0.00 ? 88  GLN A HE21 10 
ATOM   9038  H HE22 . GLN A 1 24 ? -9.686  -5.250  -9.829  1.00 0.00 ? 88  GLN A HE22 10 
ATOM   9039  N N    . CYS A 1 25 ? -7.658  -1.832  -5.908  1.00 0.00 ? 89  CYS A N    10 
ATOM   9040  C CA   . CYS A 1 25 ? -6.814  -0.814  -5.311  1.00 0.00 ? 89  CYS A CA   10 
ATOM   9041  C C    . CYS A 1 25 ? -7.647  0.254   -4.629  1.00 0.00 ? 89  CYS A C    10 
ATOM   9042  O O    . CYS A 1 25 ? -8.650  0.729   -5.185  1.00 0.00 ? 89  CYS A O    10 
ATOM   9043  C CB   . CYS A 1 25 ? -5.845  -0.211  -6.336  1.00 0.00 ? 89  CYS A CB   10 
ATOM   9044  S SG   . CYS A 1 25 ? -6.622  0.529   -7.790  1.00 0.00 ? 89  CYS A SG   10 
ATOM   9045  H H    . CYS A 1 25 ? -8.140  -1.664  -6.747  1.00 0.00 ? 89  CYS A H    10 
ATOM   9046  H HA   . CYS A 1 25 ? -6.239  -1.304  -4.538  1.00 0.00 ? 89  CYS A HA   10 
ATOM   9047  H HB2  . CYS A 1 25 ? -5.282  0.569   -5.846  1.00 0.00 ? 89  CYS A HB2  10 
ATOM   9048  H HB3  . CYS A 1 25 ? -5.164  -0.978  -6.673  1.00 0.00 ? 89  CYS A HB3  10 
ATOM   9049  H HG   . CYS A 1 25 ? -7.936  0.503   -7.609  1.00 0.00 ? 89  CYS A HG   10 
ATOM   9050  N N    . TYR A 1 26 ? -7.250  0.613   -3.429  1.00 0.00 ? 90  TYR A N    10 
ATOM   9051  C CA   . TYR A 1 26 ? -7.968  1.563   -2.600  1.00 0.00 ? 90  TYR A CA   10 
ATOM   9052  C C    . TYR A 1 26 ? -6.997  2.533   -1.963  1.00 0.00 ? 90  TYR A C    10 
ATOM   9053  O O    . TYR A 1 26 ? -5.813  2.222   -1.827  1.00 0.00 ? 90  TYR A O    10 
ATOM   9054  C CB   . TYR A 1 26 ? -8.738  0.833   -1.506  1.00 0.00 ? 90  TYR A CB   10 
ATOM   9055  C CG   . TYR A 1 26 ? -9.813  -0.114  -2.001  1.00 0.00 ? 90  TYR A CG   10 
ATOM   9056  C CD1  . TYR A 1 26 ? -9.491  -1.396  -2.408  1.00 0.00 ? 90  TYR A CD1  10 
ATOM   9057  C CD2  . TYR A 1 26 ? -11.142 0.267   -2.041  1.00 0.00 ? 90  TYR A CD2  10 
ATOM   9058  C CE1  . TYR A 1 26 ? -10.449 -2.269  -2.843  1.00 0.00 ? 90  TYR A CE1  10 
ATOM   9059  C CE2  . TYR A 1 26 ? -12.118 -0.607  -2.474  1.00 0.00 ? 90  TYR A CE2  10 
ATOM   9060  C CZ   . TYR A 1 26 ? -11.763 -1.873  -2.875  1.00 0.00 ? 90  TYR A CZ   10 
ATOM   9061  O OH   . TYR A 1 26 ? -12.727 -2.749  -3.309  1.00 0.00 ? 90  TYR A OH   10 
ATOM   9062  H H    . TYR A 1 26 ? -6.424  0.217   -3.064  1.00 0.00 ? 90  TYR A H    10 
ATOM   9063  H HA   . TYR A 1 26 ? -8.667  2.103   -3.220  1.00 0.00 ? 90  TYR A HA   10 
ATOM   9064  H HB2  . TYR A 1 26 ? -8.032  0.244   -0.941  1.00 0.00 ? 90  TYR A HB2  10 
ATOM   9065  H HB3  . TYR A 1 26 ? -9.190  1.551   -0.840  1.00 0.00 ? 90  TYR A HB3  10 
ATOM   9066  H HD1  . TYR A 1 26 ? -8.457  -1.707  -2.383  1.00 0.00 ? 90  TYR A HD1  10 
ATOM   9067  H HD2  . TYR A 1 26 ? -11.415 1.263   -1.727  1.00 0.00 ? 90  TYR A HD2  10 
ATOM   9068  H HE1  . TYR A 1 26 ? -10.151 -3.256  -3.159  1.00 0.00 ? 90  TYR A HE1  10 
ATOM   9069  H HE2  . TYR A 1 26 ? -13.151 -0.295  -2.495  1.00 0.00 ? 90  TYR A HE2  10 
ATOM   9070  H HH   . TYR A 1 26 ? -13.308 -2.261  -3.904  1.00 0.00 ? 90  TYR A HH   10 
ATOM   9071  N N    . GLU A 1 27 ? -7.494  3.680   -1.580  1.00 0.00 ? 91  GLU A N    10 
ATOM   9072  C CA   . GLU A 1 27 ? -6.695  4.725   -0.979  1.00 0.00 ? 91  GLU A CA   10 
ATOM   9073  C C    . GLU A 1 27 ? -6.331  4.360   0.460   1.00 0.00 ? 91  GLU A C    10 
ATOM   9074  O O    . GLU A 1 27 ? -7.198  4.044   1.288   1.00 0.00 ? 91  GLU A O    10 
ATOM   9075  C CB   . GLU A 1 27 ? -7.455  6.045   -1.027  1.00 0.00 ? 91  GLU A CB   10 
ATOM   9076  C CG   . GLU A 1 27 ? -6.687  7.228   -0.480  1.00 0.00 ? 91  GLU A CG   10 
ATOM   9077  C CD   . GLU A 1 27 ? -7.486  8.491   -0.541  1.00 0.00 ? 91  GLU A CD   10 
ATOM   9078  O OE1  . GLU A 1 27 ? -7.486  9.164   -1.586  1.00 0.00 ? 91  GLU A OE1  10 
ATOM   9079  O OE2  . GLU A 1 27 ? -8.126  8.853   0.455   1.00 0.00 ? 91  GLU A OE2  10 
ATOM   9080  H H    . GLU A 1 27 ? -8.455  3.841   -1.687  1.00 0.00 ? 91  GLU A H    10 
ATOM   9081  H HA   . GLU A 1 27 ? -5.788  4.821   -1.557  1.00 0.00 ? 91  GLU A HA   10 
ATOM   9082  H HB2  . GLU A 1 27 ? -7.716  6.257   -2.052  1.00 0.00 ? 91  GLU A HB2  10 
ATOM   9083  H HB3  . GLU A 1 27 ? -8.364  5.937   -0.454  1.00 0.00 ? 91  GLU A HB3  10 
ATOM   9084  H HG2  . GLU A 1 27 ? -6.432  7.032   0.551   1.00 0.00 ? 91  GLU A HG2  10 
ATOM   9085  H HG3  . GLU A 1 27 ? -5.784  7.357   -1.057  1.00 0.00 ? 91  GLU A HG3  10 
ATOM   9086  N N    . ALA A 1 28 ? -5.065  4.405   0.745   1.00 0.00 ? 92  ALA A N    10 
ATOM   9087  C CA   . ALA A 1 28 ? -4.548  4.037   2.033   1.00 0.00 ? 92  ALA A CA   10 
ATOM   9088  C C    . ALA A 1 28 ? -3.394  4.932   2.412   1.00 0.00 ? 92  ALA A C    10 
ATOM   9089  O O    . ALA A 1 28 ? -2.672  5.421   1.549   1.00 0.00 ? 92  ALA A O    10 
ATOM   9090  C CB   . ALA A 1 28 ? -4.086  2.602   1.988   1.00 0.00 ? 92  ALA A CB   10 
ATOM   9091  H H    . ALA A 1 28 ? -4.437  4.711   0.049   1.00 0.00 ? 92  ALA A H    10 
ATOM   9092  H HA   . ALA A 1 28 ? -5.322  4.119   2.782   1.00 0.00 ? 92  ALA A HA   10 
ATOM   9093  H HB1  . ALA A 1 28 ? -3.279  2.508   1.277   1.00 0.00 ? 92  ALA A HB1  10 
ATOM   9094  H HB2  . ALA A 1 28 ? -3.739  2.310   2.968   1.00 0.00 ? 92  ALA A HB2  10 
ATOM   9095  H HB3  . ALA A 1 28 ? -4.909  1.967   1.692   1.00 0.00 ? 92  ALA A HB3  10 
ATOM   9096  N N    . GLU A 1 29 ? -3.218  5.150   3.670   1.00 0.00 ? 93  GLU A N    10 
ATOM   9097  C CA   . GLU A 1 29 ? -2.133  5.957   4.139   1.00 0.00 ? 93  GLU A CA   10 
ATOM   9098  C C    . GLU A 1 29 ? -1.087  5.066   4.772   1.00 0.00 ? 93  GLU A C    10 
ATOM   9099  O O    . GLU A 1 29 ? -1.417  4.083   5.443   1.00 0.00 ? 93  GLU A O    10 
ATOM   9100  C CB   . GLU A 1 29 ? -2.623  7.019   5.116   1.00 0.00 ? 93  GLU A CB   10 
ATOM   9101  C CG   . GLU A 1 29 ? -1.524  7.933   5.642   1.00 0.00 ? 93  GLU A CG   10 
ATOM   9102  C CD   . GLU A 1 29 ? -2.063  9.026   6.506   1.00 0.00 ? 93  GLU A CD   10 
ATOM   9103  O OE1  . GLU A 1 29 ? -2.473  8.754   7.639   1.00 0.00 ? 93  GLU A OE1  10 
ATOM   9104  O OE2  . GLU A 1 29 ? -2.136  10.170  6.047   1.00 0.00 ? 93  GLU A OE2  10 
ATOM   9105  H H    . GLU A 1 29 ? -3.825  4.729   4.322   1.00 0.00 ? 93  GLU A H    10 
ATOM   9106  H HA   . GLU A 1 29 ? -1.693  6.439   3.278   1.00 0.00 ? 93  GLU A HA   10 
ATOM   9107  H HB2  . GLU A 1 29 ? -3.367  7.628   4.624   1.00 0.00 ? 93  GLU A HB2  10 
ATOM   9108  H HB3  . GLU A 1 29 ? -3.081  6.521   5.957   1.00 0.00 ? 93  GLU A HB3  10 
ATOM   9109  H HG2  . GLU A 1 29 ? -0.829  7.343   6.222   1.00 0.00 ? 93  GLU A HG2  10 
ATOM   9110  H HG3  . GLU A 1 29 ? -1.001  8.372   4.805   1.00 0.00 ? 93  GLU A HG3  10 
ATOM   9111  N N    . ILE A 1 30 ? 0.149   5.373   4.508   1.00 0.00 ? 94  ILE A N    10 
ATOM   9112  C CA   . ILE A 1 30 ? 1.262   4.621   5.033   1.00 0.00 ? 94  ILE A CA   10 
ATOM   9113  C C    . ILE A 1 30 ? 1.515   4.968   6.489   1.00 0.00 ? 94  ILE A C    10 
ATOM   9114  O O    . ILE A 1 30 ? 1.775   6.134   6.837   1.00 0.00 ? 94  ILE A O    10 
ATOM   9115  C CB   . ILE A 1 30 ? 2.528   4.869   4.205   1.00 0.00 ? 94  ILE A CB   10 
ATOM   9116  C CG1  . ILE A 1 30 ? 2.242   4.496   2.758   1.00 0.00 ? 94  ILE A CG1  10 
ATOM   9117  C CG2  . ILE A 1 30 ? 3.686   4.042   4.760   1.00 0.00 ? 94  ILE A CG2  10 
ATOM   9118  C CD1  . ILE A 1 30 ? 3.302   4.900   1.786   1.00 0.00 ? 94  ILE A CD1  10 
ATOM   9119  H H    . ILE A 1 30 ? 0.310   6.143   3.915   1.00 0.00 ? 94  ILE A H    10 
ATOM   9120  H HA   . ILE A 1 30 ? 1.013   3.572   4.974   1.00 0.00 ? 94  ILE A HA   10 
ATOM   9121  H HB   . ILE A 1 30 ? 2.785   5.916   4.253   1.00 0.00 ? 94  ILE A HB   10 
ATOM   9122  H HG12 . ILE A 1 30 ? 2.150   3.422   2.691   1.00 0.00 ? 94  ILE A HG12 10 
ATOM   9123  H HG13 . ILE A 1 30 ? 1.308   4.951   2.465   1.00 0.00 ? 94  ILE A HG13 10 
ATOM   9124  H HG21 . ILE A 1 30 ? 3.409   2.998   4.760   1.00 0.00 ? 94  ILE A HG21 10 
ATOM   9125  H HG22 . ILE A 1 30 ? 4.569   4.186   4.157   1.00 0.00 ? 94  ILE A HG22 10 
ATOM   9126  H HG23 . ILE A 1 30 ? 3.882   4.350   5.776   1.00 0.00 ? 94  ILE A HG23 10 
ATOM   9127  H HD11 . ILE A 1 30 ? 4.220   4.386   2.029   1.00 0.00 ? 94  ILE A HD11 10 
ATOM   9128  H HD12 . ILE A 1 30 ? 2.986   4.636   0.787   1.00 0.00 ? 94  ILE A HD12 10 
ATOM   9129  H HD13 . ILE A 1 30 ? 3.448   5.967   1.843   1.00 0.00 ? 94  ILE A HD13 10 
ATOM   9130  N N    . GLU A 1 31 ? 1.453   3.957   7.311   1.00 0.00 ? 95  GLU A N    10 
ATOM   9131  C CA   . GLU A 1 31 ? 1.642   4.072   8.737   1.00 0.00 ? 95  GLU A CA   10 
ATOM   9132  C C    . GLU A 1 31 ? 3.087   3.810   9.108   1.00 0.00 ? 95  GLU A C    10 
ATOM   9133  O O    . GLU A 1 31 ? 3.627   4.428   10.024  1.00 0.00 ? 95  GLU A O    10 
ATOM   9134  C CB   . GLU A 1 31 ? 0.757   3.064   9.447   1.00 0.00 ? 95  GLU A CB   10 
ATOM   9135  C CG   . GLU A 1 31 ? -0.722  3.261   9.208   1.00 0.00 ? 95  GLU A CG   10 
ATOM   9136  C CD   . GLU A 1 31 ? -1.272  4.517   9.847   1.00 0.00 ? 95  GLU A CD   10 
ATOM   9137  O OE1  . GLU A 1 31 ? -1.272  5.578   9.209   1.00 0.00 ? 95  GLU A OE1  10 
ATOM   9138  O OE2  . GLU A 1 31 ? -1.729  4.457   11.021  1.00 0.00 ? 95  GLU A OE2  10 
ATOM   9139  H H    . GLU A 1 31 ? 1.264   3.069   6.931   1.00 0.00 ? 95  GLU A H    10 
ATOM   9140  H HA   . GLU A 1 31 ? 1.353   5.062   9.045   1.00 0.00 ? 95  GLU A HA   10 
ATOM   9141  H HB2  . GLU A 1 31 ? 1.025   2.074   9.107   1.00 0.00 ? 95  GLU A HB2  10 
ATOM   9142  H HB3  . GLU A 1 31 ? 0.942   3.128   10.509  1.00 0.00 ? 95  GLU A HB3  10 
ATOM   9143  H HG2  . GLU A 1 31 ? -0.889  3.320   8.142   1.00 0.00 ? 95  GLU A HG2  10 
ATOM   9144  H HG3  . GLU A 1 31 ? -1.238  2.401   9.603   1.00 0.00 ? 95  GLU A HG3  10 
ATOM   9145  N N    . GLU A 1 32 ? 3.707   2.896   8.397   1.00 0.00 ? 96  GLU A N    10 
ATOM   9146  C CA   . GLU A 1 32 ? 5.071   2.511   8.669   1.00 0.00 ? 96  GLU A CA   10 
ATOM   9147  C C    . GLU A 1 32 ? 5.648   1.834   7.436   1.00 0.00 ? 96  GLU A C    10 
ATOM   9148  O O    . GLU A 1 32 ? 4.908   1.262   6.643   1.00 0.00 ? 96  GLU A O    10 
ATOM   9149  C CB   . GLU A 1 32 ? 5.123   1.573   9.896   1.00 0.00 ? 96  GLU A CB   10 
ATOM   9150  C CG   . GLU A 1 32 ? 6.524   1.184   10.325  1.00 0.00 ? 96  GLU A CG   10 
ATOM   9151  C CD   . GLU A 1 32 ? 7.371   2.378   10.683  1.00 0.00 ? 96  GLU A CD   10 
ATOM   9152  O OE1  . GLU A 1 32 ? 7.850   3.075   9.767   1.00 0.00 ? 96  GLU A OE1  10 
ATOM   9153  O OE2  . GLU A 1 32 ? 7.585   2.632   11.876  1.00 0.00 ? 96  GLU A OE2  10 
ATOM   9154  H H    . GLU A 1 32 ? 3.248   2.456   7.650   1.00 0.00 ? 96  GLU A H    10 
ATOM   9155  H HA   . GLU A 1 32 ? 5.649   3.401   8.872   1.00 0.00 ? 96  GLU A HA   10 
ATOM   9156  H HB2  . GLU A 1 32 ? 4.645   2.070   10.727  1.00 0.00 ? 96  GLU A HB2  10 
ATOM   9157  H HB3  . GLU A 1 32 ? 4.574   0.673   9.666   1.00 0.00 ? 96  GLU A HB3  10 
ATOM   9158  H HG2  . GLU A 1 32 ? 6.468   0.526   11.179  1.00 0.00 ? 96  GLU A HG2  10 
ATOM   9159  H HG3  . GLU A 1 32 ? 6.991   0.668   9.499   1.00 0.00 ? 96  GLU A HG3  10 
ATOM   9160  N N    . ILE A 1 33 ? 6.940   1.931   7.260   1.00 0.00 ? 97  ILE A N    10 
ATOM   9161  C CA   . ILE A 1 33 ? 7.619   1.363   6.105   1.00 0.00 ? 97  ILE A CA   10 
ATOM   9162  C C    . ILE A 1 33 ? 8.690   0.379   6.550   1.00 0.00 ? 97  ILE A C    10 
ATOM   9163  O O    . ILE A 1 33 ? 9.382   0.607   7.550   1.00 0.00 ? 97  ILE A O    10 
ATOM   9164  C CB   . ILE A 1 33 ? 8.280   2.495   5.282   1.00 0.00 ? 97  ILE A CB   10 
ATOM   9165  C CG1  . ILE A 1 33 ? 7.221   3.476   4.848   1.00 0.00 ? 97  ILE A CG1  10 
ATOM   9166  C CG2  . ILE A 1 33 ? 9.018   1.948   4.055   1.00 0.00 ? 97  ILE A CG2  10 
ATOM   9167  C CD1  . ILE A 1 33 ? 7.769   4.812   4.544   1.00 0.00 ? 97  ILE A CD1  10 
ATOM   9168  H H    . ILE A 1 33 ? 7.462   2.409   7.944   1.00 0.00 ? 97  ILE A H    10 
ATOM   9169  H HA   . ILE A 1 33 ? 6.893   0.863   5.482   1.00 0.00 ? 97  ILE A HA   10 
ATOM   9170  H HB   . ILE A 1 33 ? 8.992   3.016   5.903   1.00 0.00 ? 97  ILE A HB   10 
ATOM   9171  H HG12 . ILE A 1 33 ? 6.750   3.113   3.945   1.00 0.00 ? 97  ILE A HG12 10 
ATOM   9172  H HG13 . ILE A 1 33 ? 6.485   3.575   5.631   1.00 0.00 ? 97  ILE A HG13 10 
ATOM   9173  H HG21 . ILE A 1 33 ? 8.321   1.421   3.420   1.00 0.00 ? 97  ILE A HG21 10 
ATOM   9174  H HG22 . ILE A 1 33 ? 9.453   2.771   3.508   1.00 0.00 ? 97  ILE A HG22 10 
ATOM   9175  H HG23 . ILE A 1 33 ? 9.797   1.273   4.372   1.00 0.00 ? 97  ILE A HG23 10 
ATOM   9176  H HD11 . ILE A 1 33 ? 8.500   4.756   3.751   1.00 0.00 ? 97  ILE A HD11 10 
ATOM   9177  H HD12 . ILE A 1 33 ? 6.950   5.460   4.269   1.00 0.00 ? 97  ILE A HD12 10 
ATOM   9178  H HD13 . ILE A 1 33 ? 8.230   5.175   5.451   1.00 0.00 ? 97  ILE A HD13 10 
ATOM   9179  N N    . ASP A 1 34 ? 8.792   -0.708  5.842   1.00 0.00 ? 98  ASP A N    10 
ATOM   9180  C CA   . ASP A 1 34 ? 9.817   -1.699  6.046   1.00 0.00 ? 98  ASP A CA   10 
ATOM   9181  C C    . ASP A 1 34 ? 10.649  -1.774  4.789   1.00 0.00 ? 98  ASP A C    10 
ATOM   9182  O O    . ASP A 1 34 ? 10.293  -2.447  3.829   1.00 0.00 ? 98  ASP A O    10 
ATOM   9183  C CB   . ASP A 1 34 ? 9.238   -3.080  6.353   1.00 0.00 ? 98  ASP A CB   10 
ATOM   9184  C CG   . ASP A 1 34 ? 10.332  -4.096  6.577   1.00 0.00 ? 98  ASP A CG   10 
ATOM   9185  O OD1  . ASP A 1 34 ? 10.837  -4.215  7.706   1.00 0.00 ? 98  ASP A OD1  10 
ATOM   9186  O OD2  . ASP A 1 34 ? 10.711  -4.775  5.636   1.00 0.00 ? 98  ASP A OD2  10 
ATOM   9187  H H    . ASP A 1 34 ? 8.160   -0.866  5.102   1.00 0.00 ? 98  ASP A H    10 
ATOM   9188  H HA   . ASP A 1 34 ? 10.460  -1.385  6.855   1.00 0.00 ? 98  ASP A HA   10 
ATOM   9189  H HB2  . ASP A 1 34 ? 8.596   -3.040  7.220   1.00 0.00 ? 98  ASP A HB2  10 
ATOM   9190  H HB3  . ASP A 1 34 ? 8.661   -3.413  5.501   1.00 0.00 ? 98  ASP A HB3  10 
ATOM   9191  N N    . GLU A 1 35 ? 11.709  -1.028  4.771   1.00 0.00 ? 99  GLU A N    10 
ATOM   9192  C CA   . GLU A 1 35 ? 12.619  -0.964  3.630   1.00 0.00 ? 99  GLU A CA   10 
ATOM   9193  C C    . GLU A 1 35 ? 13.334  -2.292  3.396   1.00 0.00 ? 99  GLU A C    10 
ATOM   9194  O O    . GLU A 1 35 ? 13.885  -2.527  2.331   1.00 0.00 ? 99  GLU A O    10 
ATOM   9195  C CB   . GLU A 1 35 ? 13.633  0.145   3.827   1.00 0.00 ? 99  GLU A CB   10 
ATOM   9196  C CG   . GLU A 1 35 ? 13.016  1.525   3.958   1.00 0.00 ? 99  GLU A CG   10 
ATOM   9197  C CD   . GLU A 1 35 ? 14.028  2.571   4.329   1.00 0.00 ? 99  GLU A CD   10 
ATOM   9198  O OE1  . GLU A 1 35 ? 14.695  3.129   3.445   1.00 0.00 ? 99  GLU A OE1  10 
ATOM   9199  O OE2  . GLU A 1 35 ? 14.182  2.859   5.532   1.00 0.00 ? 99  GLU A OE2  10 
ATOM   9200  H H    . GLU A 1 35 ? 11.904  -0.479  5.560   1.00 0.00 ? 99  GLU A H    10 
ATOM   9201  H HA   . GLU A 1 35 ? 12.026  -0.735  2.756   1.00 0.00 ? 99  GLU A HA   10 
ATOM   9202  H HB2  . GLU A 1 35 ? 14.210  -0.064  4.714   1.00 0.00 ? 99  GLU A HB2  10 
ATOM   9203  H HB3  . GLU A 1 35 ? 14.291  0.145   2.971   1.00 0.00 ? 99  GLU A HB3  10 
ATOM   9204  H HG2  . GLU A 1 35 ? 12.565  1.799   3.015   1.00 0.00 ? 99  GLU A HG2  10 
ATOM   9205  H HG3  . GLU A 1 35 ? 12.255  1.490   4.724   1.00 0.00 ? 99  GLU A HG3  10 
ATOM   9206  N N    . GLU A 1 36 ? 13.334  -3.145  4.396   1.00 0.00 ? 100 GLU A N    10 
ATOM   9207  C CA   . GLU A 1 36 ? 14.039  -4.398  4.326   1.00 0.00 ? 100 GLU A CA   10 
ATOM   9208  C C    . GLU A 1 36 ? 13.340  -5.352  3.355   1.00 0.00 ? 100 GLU A C    10 
ATOM   9209  O O    . GLU A 1 36 ? 13.979  -5.999  2.537   1.00 0.00 ? 100 GLU A O    10 
ATOM   9210  C CB   . GLU A 1 36 ? 14.115  -5.005  5.718   1.00 0.00 ? 100 GLU A CB   10 
ATOM   9211  C CG   . GLU A 1 36 ? 15.074  -6.168  5.832   1.00 0.00 ? 100 GLU A CG   10 
ATOM   9212  C CD   . GLU A 1 36 ? 16.471  -5.793  5.406   1.00 0.00 ? 100 GLU A CD   10 
ATOM   9213  O OE1  . GLU A 1 36 ? 17.115  -4.982  6.079   1.00 0.00 ? 100 GLU A OE1  10 
ATOM   9214  O OE2  . GLU A 1 36 ? 16.951  -6.304  4.378   1.00 0.00 ? 100 GLU A OE2  10 
ATOM   9215  H H    . GLU A 1 36 ? 12.835  -2.919  5.208   1.00 0.00 ? 100 GLU A H    10 
ATOM   9216  H HA   . GLU A 1 36 ? 15.041  -4.207  3.974   1.00 0.00 ? 100 GLU A HA   10 
ATOM   9217  H HB2  . GLU A 1 36 ? 14.394  -4.231  6.418   1.00 0.00 ? 100 GLU A HB2  10 
ATOM   9218  H HB3  . GLU A 1 36 ? 13.127  -5.354  5.983   1.00 0.00 ? 100 GLU A HB3  10 
ATOM   9219  H HG2  . GLU A 1 36 ? 15.105  -6.503  6.859   1.00 0.00 ? 100 GLU A HG2  10 
ATOM   9220  H HG3  . GLU A 1 36 ? 14.723  -6.968  5.199   1.00 0.00 ? 100 GLU A HG3  10 
ATOM   9221  N N    . ASN A 1 37 ? 12.043  -5.402  3.424   1.00 0.00 ? 101 ASN A N    10 
ATOM   9222  C CA   . ASN A 1 37 ? 11.261  -6.234  2.516   1.00 0.00 ? 101 ASN A CA   10 
ATOM   9223  C C    . ASN A 1 37 ? 10.697  -5.401  1.413   1.00 0.00 ? 101 ASN A C    10 
ATOM   9224  O O    . ASN A 1 37 ? 10.123  -5.926  0.436   1.00 0.00 ? 101 ASN A O    10 
ATOM   9225  C CB   . ASN A 1 37 ? 10.110  -6.913  3.244   1.00 0.00 ? 101 ASN A CB   10 
ATOM   9226  C CG   . ASN A 1 37 ? 10.552  -7.901  4.285   1.00 0.00 ? 101 ASN A CG   10 
ATOM   9227  O OD1  . ASN A 1 37 ? 10.745  -9.087  4.000   1.00 0.00 ? 101 ASN A OD1  10 
ATOM   9228  N ND2  . ASN A 1 37 ? 10.721  -7.432  5.477   1.00 0.00 ? 101 ASN A ND2  10 
ATOM   9229  H H    . ASN A 1 37 ? 11.590  -4.902  4.147   1.00 0.00 ? 101 ASN A H    10 
ATOM   9230  H HA   . ASN A 1 37 ? 11.897  -6.997  2.095   1.00 0.00 ? 101 ASN A HA   10 
ATOM   9231  H HB2  . ASN A 1 37 ? 9.513   -6.156  3.733   1.00 0.00 ? 101 ASN A HB2  10 
ATOM   9232  H HB3  . ASN A 1 37 ? 9.503   -7.419  2.513   1.00 0.00 ? 101 ASN A HB3  10 
ATOM   9233  H HD21 . ASN A 1 37 ? 10.553  -6.457  5.582   1.00 0.00 ? 101 ASN A HD21 10 
ATOM   9234  H HD22 . ASN A 1 37 ? 10.989  -8.019  6.214   1.00 0.00 ? 101 ASN A HD22 10 
ATOM   9235  N N    . GLY A 1 38 ? 10.845  -4.107  1.559   1.00 0.00 ? 102 GLY A N    10 
ATOM   9236  C CA   . GLY A 1 38 ? 10.285  -3.188  0.625   1.00 0.00 ? 102 GLY A CA   10 
ATOM   9237  C C    . GLY A 1 38 ? 8.789   -3.127  0.785   1.00 0.00 ? 102 GLY A C    10 
ATOM   9238  O O    . GLY A 1 38 ? 8.055   -2.943  -0.186  1.00 0.00 ? 102 GLY A O    10 
ATOM   9239  H H    . GLY A 1 38 ? 11.349  -3.767  2.331   1.00 0.00 ? 102 GLY A H    10 
ATOM   9240  H HA2  . GLY A 1 38 ? 10.706  -2.206  0.790   1.00 0.00 ? 102 GLY A HA2  10 
ATOM   9241  H HA3  . GLY A 1 38 ? 10.514  -3.515  -0.379  1.00 0.00 ? 102 GLY A HA3  10 
ATOM   9242  N N    . THR A 1 39 ? 8.331   -3.300  2.001   1.00 0.00 ? 103 THR A N    10 
ATOM   9243  C CA   . THR A 1 39 ? 6.930   -3.285  2.285   1.00 0.00 ? 103 THR A CA   10 
ATOM   9244  C C    . THR A 1 39 ? 6.551   -2.104  3.141   1.00 0.00 ? 103 THR A C    10 
ATOM   9245  O O    . THR A 1 39 ? 7.407   -1.432  3.696   1.00 0.00 ? 103 THR A O    10 
ATOM   9246  C CB   . THR A 1 39 ? 6.481   -4.604  2.943   1.00 0.00 ? 103 THR A CB   10 
ATOM   9247  O OG1  . THR A 1 39 ? 7.381   -4.961  4.008   1.00 0.00 ? 103 THR A OG1  10 
ATOM   9248  C CG2  . THR A 1 39 ? 6.423   -5.731  1.932   1.00 0.00 ? 103 THR A CG2  10 
ATOM   9249  H H    . THR A 1 39 ? 8.943   -3.441  2.764   1.00 0.00 ? 103 THR A H    10 
ATOM   9250  H HA   . THR A 1 39 ? 6.400   -3.176  1.355   1.00 0.00 ? 103 THR A HA   10 
ATOM   9251  H HB   . THR A 1 39 ? 5.493   -4.442  3.348   1.00 0.00 ? 103 THR A HB   10 
ATOM   9252  H HG1  . THR A 1 39 ? 7.314   -5.915  4.131   1.00 0.00 ? 103 THR A HG1  10 
ATOM   9253  H HG21 . THR A 1 39 ? 7.397   -5.849  1.481   1.00 0.00 ? 103 THR A HG21 10 
ATOM   9254  H HG22 . THR A 1 39 ? 6.143   -6.648  2.428   1.00 0.00 ? 103 THR A HG22 10 
ATOM   9255  H HG23 . THR A 1 39 ? 5.694   -5.497  1.170   1.00 0.00 ? 103 THR A HG23 10 
ATOM   9256  N N    . ALA A 1 40 ? 5.295   -1.815  3.190   1.00 0.00 ? 104 ALA A N    10 
ATOM   9257  C CA   . ALA A 1 40 ? 4.791   -0.767  4.002   1.00 0.00 ? 104 ALA A CA   10 
ATOM   9258  C C    . ALA A 1 40 ? 3.504   -1.204  4.631   1.00 0.00 ? 104 ALA A C    10 
ATOM   9259  O O    . ALA A 1 40 ? 2.728   -1.966  4.037   1.00 0.00 ? 104 ALA A O    10 
ATOM   9260  C CB   . ALA A 1 40 ? 4.572   0.492   3.184   1.00 0.00 ? 104 ALA A CB   10 
ATOM   9261  H H    . ALA A 1 40 ? 4.647   -2.312  2.639   1.00 0.00 ? 104 ALA A H    10 
ATOM   9262  H HA   . ALA A 1 40 ? 5.513   -0.553  4.776   1.00 0.00 ? 104 ALA A HA   10 
ATOM   9263  H HB1  . ALA A 1 40 ? 3.849   0.290   2.409   1.00 0.00 ? 104 ALA A HB1  10 
ATOM   9264  H HB2  . ALA A 1 40 ? 4.199   1.275   3.827   1.00 0.00 ? 104 ALA A HB2  10 
ATOM   9265  H HB3  . ALA A 1 40 ? 5.505   0.804   2.739   1.00 0.00 ? 104 ALA A HB3  10 
ATOM   9266  N N    . ALA A 1 41 ? 3.297   -0.770  5.824   1.00 0.00 ? 105 ALA A N    10 
ATOM   9267  C CA   . ALA A 1 41 ? 2.092   -1.021  6.524   1.00 0.00 ? 105 ALA A CA   10 
ATOM   9268  C C    . ALA A 1 41 ? 1.191   0.146   6.264   1.00 0.00 ? 105 ALA A C    10 
ATOM   9269  O O    . ALA A 1 41 ? 1.552   1.302   6.540   1.00 0.00 ? 105 ALA A O    10 
ATOM   9270  C CB   . ALA A 1 41 ? 2.367   -1.183  7.993   1.00 0.00 ? 105 ALA A CB   10 
ATOM   9271  H H    . ALA A 1 41 ? 3.984   -0.207  6.250   1.00 0.00 ? 105 ALA A H    10 
ATOM   9272  H HA   . ALA A 1 41 ? 1.642   -1.922  6.134   1.00 0.00 ? 105 ALA A HA   10 
ATOM   9273  H HB1  . ALA A 1 41 ? 2.861   -0.292  8.352   1.00 0.00 ? 105 ALA A HB1  10 
ATOM   9274  H HB2  . ALA A 1 41 ? 1.435   -1.336  8.515   1.00 0.00 ? 105 ALA A HB2  10 
ATOM   9275  H HB3  . ALA A 1 41 ? 3.005   -2.044  8.119   1.00 0.00 ? 105 ALA A HB3  10 
ATOM   9276  N N    . ILE A 1 42 ? 0.060   -0.124  5.718   1.00 0.00 ? 106 ILE A N    10 
ATOM   9277  C CA   . ILE A 1 42 ? -0.824  0.912   5.279   1.00 0.00 ? 106 ILE A CA   10 
ATOM   9278  C C    . ILE A 1 42 ? -2.181  0.741   5.905   1.00 0.00 ? 106 ILE A C    10 
ATOM   9279  O O    . ILE A 1 42 ? -2.570  -0.370  6.242   1.00 0.00 ? 106 ILE A O    10 
ATOM   9280  C CB   . ILE A 1 42 ? -0.946  0.895   3.721   1.00 0.00 ? 106 ILE A CB   10 
ATOM   9281  C CG1  . ILE A 1 42 ? -1.456  -0.463  3.211   1.00 0.00 ? 106 ILE A CG1  10 
ATOM   9282  C CG2  . ILE A 1 42 ? 0.364   1.250   3.055   1.00 0.00 ? 106 ILE A CG2  10 
ATOM   9283  C CD1  . ILE A 1 42 ? -2.919  -0.485  2.927   1.00 0.00 ? 106 ILE A CD1  10 
ATOM   9284  H H    . ILE A 1 42 ? -0.208  -1.064  5.598   1.00 0.00 ? 106 ILE A H    10 
ATOM   9285  H HA   . ILE A 1 42 ? -0.409  1.864   5.571   1.00 0.00 ? 106 ILE A HA   10 
ATOM   9286  H HB   . ILE A 1 42 ? -1.665  1.654   3.447   1.00 0.00 ? 106 ILE A HB   10 
ATOM   9287  H HG12 . ILE A 1 42 ? -0.942  -0.798  2.324   1.00 0.00 ? 106 ILE A HG12 10 
ATOM   9288  H HG13 . ILE A 1 42 ? -1.280  -1.184  3.996   1.00 0.00 ? 106 ILE A HG13 10 
ATOM   9289  H HG21 . ILE A 1 42 ? 1.118   0.532   3.336   1.00 0.00 ? 106 ILE A HG21 10 
ATOM   9290  H HG22 . ILE A 1 42 ? 0.221   1.233   1.985   1.00 0.00 ? 106 ILE A HG22 10 
ATOM   9291  H HG23 . ILE A 1 42 ? 0.660   2.240   3.366   1.00 0.00 ? 106 ILE A HG23 10 
ATOM   9292  H HD11 . ILE A 1 42 ? -3.096  0.282   2.186   1.00 0.00 ? 106 ILE A HD11 10 
ATOM   9293  H HD12 . ILE A 1 42 ? -3.209  -1.445  2.526   1.00 0.00 ? 106 ILE A HD12 10 
ATOM   9294  H HD13 . ILE A 1 42 ? -3.471  -0.264  3.829   1.00 0.00 ? 106 ILE A HD13 10 
ATOM   9295  N N    . THR A 1 43 ? -2.869  1.824   6.087   1.00 0.00 ? 107 THR A N    10 
ATOM   9296  C CA   . THR A 1 43 ? -4.199  1.802   6.594   1.00 0.00 ? 107 THR A CA   10 
ATOM   9297  C C    . THR A 1 43 ? -5.133  2.404   5.570   1.00 0.00 ? 107 THR A C    10 
ATOM   9298  O O    . THR A 1 43 ? -4.931  3.533   5.124   1.00 0.00 ? 107 THR A O    10 
ATOM   9299  C CB   . THR A 1 43 ? -4.295  2.543   7.942   1.00 0.00 ? 107 THR A CB   10 
ATOM   9300  O OG1  . THR A 1 43 ? -3.457  1.868   8.882   1.00 0.00 ? 107 THR A OG1  10 
ATOM   9301  C CG2  . THR A 1 43 ? -5.729  2.573   8.472   1.00 0.00 ? 107 THR A CG2  10 
ATOM   9302  H H    . THR A 1 43 ? -2.475  2.699   5.859   1.00 0.00 ? 107 THR A H    10 
ATOM   9303  H HA   . THR A 1 43 ? -4.479  0.769   6.741   1.00 0.00 ? 107 THR A HA   10 
ATOM   9304  H HB   . THR A 1 43 ? -3.934  3.553   7.809   1.00 0.00 ? 107 THR A HB   10 
ATOM   9305  H HG1  . THR A 1 43 ? -2.736  1.473   8.381   1.00 0.00 ? 107 THR A HG1  10 
ATOM   9306  H HG21 . THR A 1 43 ? -6.083  1.562   8.608   1.00 0.00 ? 107 THR A HG21 10 
ATOM   9307  H HG22 . THR A 1 43 ? -5.755  3.098   9.416   1.00 0.00 ? 107 THR A HG22 10 
ATOM   9308  H HG23 . THR A 1 43 ? -6.366  3.084   7.765   1.00 0.00 ? 107 THR A HG23 10 
ATOM   9309  N N    . PHE A 1 44 ? -6.115  1.632   5.182   1.00 0.00 ? 108 PHE A N    10 
ATOM   9310  C CA   . PHE A 1 44 ? -7.092  2.037   4.213   1.00 0.00 ? 108 PHE A CA   10 
ATOM   9311  C C    . PHE A 1 44 ? -7.937  3.140   4.763   1.00 0.00 ? 108 PHE A C    10 
ATOM   9312  O O    . PHE A 1 44 ? -8.634  2.960   5.774   1.00 0.00 ? 108 PHE A O    10 
ATOM   9313  C CB   . PHE A 1 44 ? -7.948  0.859   3.781   1.00 0.00 ? 108 PHE A CB   10 
ATOM   9314  C CG   . PHE A 1 44 ? -7.190  -0.155  2.989   1.00 0.00 ? 108 PHE A CG   10 
ATOM   9315  C CD1  . PHE A 1 44 ? -6.864  0.119   1.673   1.00 0.00 ? 108 PHE A CD1  10 
ATOM   9316  C CD2  . PHE A 1 44 ? -6.789  -1.369  3.546   1.00 0.00 ? 108 PHE A CD2  10 
ATOM   9317  C CE1  . PHE A 1 44 ? -6.161  -0.784  0.915   1.00 0.00 ? 108 PHE A CE1  10 
ATOM   9318  C CE2  . PHE A 1 44 ? -6.076  -2.277  2.789   1.00 0.00 ? 108 PHE A CE2  10 
ATOM   9319  C CZ   . PHE A 1 44 ? -5.763  -1.986  1.468   1.00 0.00 ? 108 PHE A CZ   10 
ATOM   9320  H H    . PHE A 1 44 ? -6.191  0.747   5.606   1.00 0.00 ? 108 PHE A H    10 
ATOM   9321  H HA   . PHE A 1 44 ? -6.558  2.409   3.352   1.00 0.00 ? 108 PHE A HA   10 
ATOM   9322  H HB2  . PHE A 1 44 ? -8.351  0.371   4.656   1.00 0.00 ? 108 PHE A HB2  10 
ATOM   9323  H HB3  . PHE A 1 44 ? -8.760  1.220   3.168   1.00 0.00 ? 108 PHE A HB3  10 
ATOM   9324  H HD1  . PHE A 1 44 ? -7.185  1.058   1.246   1.00 0.00 ? 108 PHE A HD1  10 
ATOM   9325  H HD2  . PHE A 1 44 ? -7.043  -1.619  4.568   1.00 0.00 ? 108 PHE A HD2  10 
ATOM   9326  H HE1  . PHE A 1 44 ? -5.929  -0.542  -0.112  1.00 0.00 ? 108 PHE A HE1  10 
ATOM   9327  H HE2  . PHE A 1 44 ? -5.769  -3.216  3.225   1.00 0.00 ? 108 PHE A HE2  10 
ATOM   9328  H HZ   . PHE A 1 44 ? -5.206  -2.697  0.878   1.00 0.00 ? 108 PHE A HZ   10 
ATOM   9329  N N    . ALA A 1 45 ? -7.881  4.264   4.103   1.00 0.00 ? 109 ALA A N    10 
ATOM   9330  C CA   . ALA A 1 45 ? -8.553  5.445   4.544   1.00 0.00 ? 109 ALA A CA   10 
ATOM   9331  C C    . ALA A 1 45 ? -10.048 5.283   4.377   1.00 0.00 ? 109 ALA A C    10 
ATOM   9332  O O    . ALA A 1 45 ? -10.516 4.767   3.354   1.00 0.00 ? 109 ALA A O    10 
ATOM   9333  C CB   . ALA A 1 45 ? -8.035  6.653   3.784   1.00 0.00 ? 109 ALA A CB   10 
ATOM   9334  H H    . ALA A 1 45 ? -7.395  4.282   3.249   1.00 0.00 ? 109 ALA A H    10 
ATOM   9335  H HA   . ALA A 1 45 ? -8.321  5.575   5.590   1.00 0.00 ? 109 ALA A HA   10 
ATOM   9336  H HB1  . ALA A 1 45 ? -8.240  6.531   2.731   1.00 0.00 ? 109 ALA A HB1  10 
ATOM   9337  H HB2  . ALA A 1 45 ? -8.522  7.547   4.150   1.00 0.00 ? 109 ALA A HB2  10 
ATOM   9338  H HB3  . ALA A 1 45 ? -6.969  6.739   3.931   1.00 0.00 ? 109 ALA A HB3  10 
ATOM   9339  N N    . GLY A 1 46 ? -10.781 5.631   5.397   1.00 0.00 ? 110 GLY A N    10 
ATOM   9340  C CA   . GLY A 1 46 ? -12.215 5.539   5.341   1.00 0.00 ? 110 GLY A CA   10 
ATOM   9341  C C    . GLY A 1 46 ? -12.720 4.254   5.951   1.00 0.00 ? 110 GLY A C    10 
ATOM   9342  O O    . GLY A 1 46 ? -13.625 4.268   6.796   1.00 0.00 ? 110 GLY A O    10 
ATOM   9343  H H    . GLY A 1 46 ? -10.342 5.943   6.219   1.00 0.00 ? 110 GLY A H    10 
ATOM   9344  H HA2  . GLY A 1 46 ? -12.646 6.374   5.871   1.00 0.00 ? 110 GLY A HA2  10 
ATOM   9345  H HA3  . GLY A 1 46 ? -12.529 5.579   4.309   1.00 0.00 ? 110 GLY A HA3  10 
ATOM   9346  N N    . TYR A 1 47 ? -12.149 3.146   5.524   1.00 0.00 ? 111 TYR A N    10 
ATOM   9347  C CA   . TYR A 1 47 ? -12.535 1.849   6.016   1.00 0.00 ? 111 TYR A CA   10 
ATOM   9348  C C    . TYR A 1 47 ? -11.865 1.569   7.361   1.00 0.00 ? 111 TYR A C    10 
ATOM   9349  O O    . TYR A 1 47 ? -12.516 1.168   8.320   1.00 0.00 ? 111 TYR A O    10 
ATOM   9350  C CB   . TYR A 1 47 ? -12.121 0.792   5.028   1.00 0.00 ? 111 TYR A CB   10 
ATOM   9351  C CG   . TYR A 1 47 ? -12.572 1.031   3.603   1.00 0.00 ? 111 TYR A CG   10 
ATOM   9352  C CD1  . TYR A 1 47 ? -13.852 0.708   3.193   1.00 0.00 ? 111 TYR A CD1  10 
ATOM   9353  C CD2  . TYR A 1 47 ? -11.688 1.532   2.657   1.00 0.00 ? 111 TYR A CD2  10 
ATOM   9354  C CE1  . TYR A 1 47 ? -14.247 0.875   1.878   1.00 0.00 ? 111 TYR A CE1  10 
ATOM   9355  C CE2  . TYR A 1 47 ? -12.067 1.711   1.348   1.00 0.00 ? 111 TYR A CE2  10 
ATOM   9356  C CZ   . TYR A 1 47 ? -13.351 1.377   0.960   1.00 0.00 ? 111 TYR A CZ   10 
ATOM   9357  O OH   . TYR A 1 47 ? -13.739 1.547   -0.354  1.00 0.00 ? 111 TYR A OH   10 
ATOM   9358  H H    . TYR A 1 47 ? -11.462 3.197   4.825   1.00 0.00 ? 111 TYR A H    10 
ATOM   9359  H HA   . TYR A 1 47 ? -13.608 1.825   6.129   1.00 0.00 ? 111 TYR A HA   10 
ATOM   9360  H HB2  . TYR A 1 47 ? -11.044 0.727   5.022   1.00 0.00 ? 111 TYR A HB2  10 
ATOM   9361  H HB3  . TYR A 1 47 ? -12.524 -0.157  5.350   1.00 0.00 ? 111 TYR A HB3  10 
ATOM   9362  H HD1  . TYR A 1 47 ? -14.546 0.317   3.921   1.00 0.00 ? 111 TYR A HD1  10 
ATOM   9363  H HD2  . TYR A 1 47 ? -10.686 1.792   2.963   1.00 0.00 ? 111 TYR A HD2  10 
ATOM   9364  H HE1  . TYR A 1 47 ? -15.250 0.603   1.578   1.00 0.00 ? 111 TYR A HE1  10 
ATOM   9365  H HE2  . TYR A 1 47 ? -11.346 2.102   0.645   1.00 0.00 ? 111 TYR A HE2  10 
ATOM   9366  H HH   . TYR A 1 47 ? -14.618 1.949   -0.352  1.00 0.00 ? 111 TYR A HH   10 
ATOM   9367  N N    . GLY A 1 48 ? -10.558 1.778   7.421   1.00 0.00 ? 112 GLY A N    10 
ATOM   9368  C CA   . GLY A 1 48 ? -9.846  1.604   8.666   1.00 0.00 ? 112 GLY A CA   10 
ATOM   9369  C C    . GLY A 1 48 ? -9.129  0.265   8.831   1.00 0.00 ? 112 GLY A C    10 
ATOM   9370  O O    . GLY A 1 48 ? -8.915  -0.178  9.956   1.00 0.00 ? 112 GLY A O    10 
ATOM   9371  H H    . GLY A 1 48 ? -10.066 2.092   6.630   1.00 0.00 ? 112 GLY A H    10 
ATOM   9372  H HA2  . GLY A 1 48 ? -9.109  2.390   8.749   1.00 0.00 ? 112 GLY A HA2  10 
ATOM   9373  H HA3  . GLY A 1 48 ? -10.556 1.717   9.472   1.00 0.00 ? 112 GLY A HA3  10 
ATOM   9374  N N    . ASN A 1 49 ? -8.752  -0.397  7.750   1.00 0.00 ? 113 ASN A N    10 
ATOM   9375  C CA   . ASN A 1 49 ? -7.979  -1.643  7.908   1.00 0.00 ? 113 ASN A CA   10 
ATOM   9376  C C    . ASN A 1 49 ? -6.555  -1.392  7.591   1.00 0.00 ? 113 ASN A C    10 
ATOM   9377  O O    . ASN A 1 49 ? -6.231  -0.400  6.955   1.00 0.00 ? 113 ASN A O    10 
ATOM   9378  C CB   . ASN A 1 49 ? -8.457  -2.813  7.056   1.00 0.00 ? 113 ASN A CB   10 
ATOM   9379  C CG   . ASN A 1 49 ? -9.855  -3.247  7.337   1.00 0.00 ? 113 ASN A CG   10 
ATOM   9380  O OD1  . ASN A 1 49 ? -10.393 -3.020  8.421   1.00 0.00 ? 113 ASN A OD1  10 
ATOM   9381  N ND2  . ASN A 1 49 ? -10.412 -3.954  6.409   1.00 0.00 ? 113 ASN A ND2  10 
ATOM   9382  H H    . ASN A 1 49 ? -8.966  -0.059  6.857   1.00 0.00 ? 113 ASN A H    10 
ATOM   9383  H HA   . ASN A 1 49 ? -8.040  -1.914  8.952   1.00 0.00 ? 113 ASN A HA   10 
ATOM   9384  H HB2  . ASN A 1 49 ? -8.402  -2.534  6.015   1.00 0.00 ? 113 ASN A HB2  10 
ATOM   9385  H HB3  . ASN A 1 49 ? -7.797  -3.652  7.222   1.00 0.00 ? 113 ASN A HB3  10 
ATOM   9386  H HD21 . ASN A 1 49 ? -9.857  -4.156  5.624   1.00 0.00 ? 113 ASN A HD21 10 
ATOM   9387  H HD22 . ASN A 1 49 ? -11.352 -4.216  6.476   1.00 0.00 ? 113 ASN A HD22 10 
ATOM   9388  N N    . ALA A 1 50 ? -5.718  -2.294  7.970   1.00 0.00 ? 114 ALA A N    10 
ATOM   9389  C CA   . ALA A 1 50 ? -4.314  -2.150  7.786   1.00 0.00 ? 114 ALA A CA   10 
ATOM   9390  C C    . ALA A 1 50 ? -3.751  -3.426  7.245   1.00 0.00 ? 114 ALA A C    10 
ATOM   9391  O O    . ALA A 1 50 ? -4.192  -4.517  7.630   1.00 0.00 ? 114 ALA A O    10 
ATOM   9392  C CB   . ALA A 1 50 ? -3.639  -1.790  9.103   1.00 0.00 ? 114 ALA A CB   10 
ATOM   9393  H H    . ALA A 1 50 ? -6.039  -3.135  8.365   1.00 0.00 ? 114 ALA A H    10 
ATOM   9394  H HA   . ALA A 1 50 ? -4.133  -1.353  7.081   1.00 0.00 ? 114 ALA A HA   10 
ATOM   9395  H HB1  . ALA A 1 50 ? -3.841  -2.562  9.831   1.00 0.00 ? 114 ALA A HB1  10 
ATOM   9396  H HB2  . ALA A 1 50 ? -2.573  -1.705  8.955   1.00 0.00 ? 114 ALA A HB2  10 
ATOM   9397  H HB3  . ALA A 1 50 ? -4.030  -0.850  9.461   1.00 0.00 ? 114 ALA A HB3  10 
ATOM   9398  N N    . GLU A 1 51 ? -2.830  -3.309  6.335   1.00 0.00 ? 115 GLU A N    10 
ATOM   9399  C CA   . GLU A 1 51 ? -2.168  -4.454  5.801   1.00 0.00 ? 115 GLU A CA   10 
ATOM   9400  C C    . GLU A 1 51 ? -0.758  -4.080  5.414   1.00 0.00 ? 115 GLU A C    10 
ATOM   9401  O O    . GLU A 1 51 ? -0.448  -2.890  5.245   1.00 0.00 ? 115 GLU A O    10 
ATOM   9402  C CB   . GLU A 1 51 ? -2.929  -5.069  4.608   1.00 0.00 ? 115 GLU A CB   10 
ATOM   9403  C CG   . GLU A 1 51 ? -2.946  -4.272  3.319   1.00 0.00 ? 115 GLU A CG   10 
ATOM   9404  C CD   . GLU A 1 51 ? -3.419  -5.135  2.167   1.00 0.00 ? 115 GLU A CD   10 
ATOM   9405  O OE1  . GLU A 1 51 ? -4.635  -5.393  2.034   1.00 0.00 ? 115 GLU A OE1  10 
ATOM   9406  O OE2  . GLU A 1 51 ? -2.559  -5.644  1.423   1.00 0.00 ? 115 GLU A OE2  10 
ATOM   9407  H H    . GLU A 1 51 ? -2.565  -2.419  6.016   1.00 0.00 ? 115 GLU A H    10 
ATOM   9408  H HA   . GLU A 1 51 ? -2.111  -5.185  6.594   1.00 0.00 ? 115 GLU A HA   10 
ATOM   9409  H HB2  . GLU A 1 51 ? -2.523  -6.038  4.370   1.00 0.00 ? 115 GLU A HB2  10 
ATOM   9410  H HB3  . GLU A 1 51 ? -3.961  -5.169  4.918   1.00 0.00 ? 115 GLU A HB3  10 
ATOM   9411  H HG2  . GLU A 1 51 ? -3.596  -3.417  3.430   1.00 0.00 ? 115 GLU A HG2  10 
ATOM   9412  H HG3  . GLU A 1 51 ? -1.941  -3.936  3.107   1.00 0.00 ? 115 GLU A HG3  10 
ATOM   9413  N N    . VAL A 1 52 ? 0.094   -5.060  5.319   1.00 0.00 ? 116 VAL A N    10 
ATOM   9414  C CA   . VAL A 1 52 ? 1.453   -4.850  4.917   1.00 0.00 ? 116 VAL A CA   10 
ATOM   9415  C C    . VAL A 1 52 ? 1.566   -5.209  3.451   1.00 0.00 ? 116 VAL A C    10 
ATOM   9416  O O    . VAL A 1 52 ? 1.400   -6.369  3.063   1.00 0.00 ? 116 VAL A O    10 
ATOM   9417  C CB   . VAL A 1 52 ? 2.442   -5.699  5.751   1.00 0.00 ? 116 VAL A CB   10 
ATOM   9418  C CG1  . VAL A 1 52 ? 3.879   -5.415  5.339   1.00 0.00 ? 116 VAL A CG1  10 
ATOM   9419  C CG2  . VAL A 1 52 ? 2.252   -5.434  7.241   1.00 0.00 ? 116 VAL A CG2  10 
ATOM   9420  H H    . VAL A 1 52 ? -0.198  -5.976  5.512   1.00 0.00 ? 116 VAL A H    10 
ATOM   9421  H HA   . VAL A 1 52 ? 1.683   -3.802  5.040   1.00 0.00 ? 116 VAL A HA   10 
ATOM   9422  H HB   . VAL A 1 52 ? 2.236   -6.742  5.561   1.00 0.00 ? 116 VAL A HB   10 
ATOM   9423  H HG11 . VAL A 1 52 ? 4.099   -4.370  5.495   1.00 0.00 ? 116 VAL A HG11 10 
ATOM   9424  H HG12 . VAL A 1 52 ? 4.557   -6.020  5.924   1.00 0.00 ? 116 VAL A HG12 10 
ATOM   9425  H HG13 . VAL A 1 52 ? 4.000   -5.656  4.293   1.00 0.00 ? 116 VAL A HG13 10 
ATOM   9426  H HG21 . VAL A 1 52 ? 1.238   -5.677  7.521   1.00 0.00 ? 116 VAL A HG21 10 
ATOM   9427  H HG22 . VAL A 1 52 ? 2.935   -6.051  7.806   1.00 0.00 ? 116 VAL A HG22 10 
ATOM   9428  H HG23 . VAL A 1 52 ? 2.446   -4.393  7.453   1.00 0.00 ? 116 VAL A HG23 10 
ATOM   9429  N N    . THR A 1 53 ? 1.808   -4.233  2.655   1.00 0.00 ? 117 THR A N    10 
ATOM   9430  C CA   . THR A 1 53 ? 1.858   -4.402  1.226   1.00 0.00 ? 117 THR A CA   10 
ATOM   9431  C C    . THR A 1 53 ? 3.176   -3.826  0.683   1.00 0.00 ? 117 THR A C    10 
ATOM   9432  O O    . THR A 1 53 ? 3.689   -2.842  1.226   1.00 0.00 ? 117 THR A O    10 
ATOM   9433  C CB   . THR A 1 53 ? 0.608   -3.747  0.547   1.00 0.00 ? 117 THR A CB   10 
ATOM   9434  O OG1  . THR A 1 53 ? 0.584   -4.002  -0.868  1.00 0.00 ? 117 THR A OG1  10 
ATOM   9435  C CG2  . THR A 1 53 ? 0.572   -2.255  0.792   1.00 0.00 ? 117 THR A CG2  10 
ATOM   9436  H H    . THR A 1 53 ? 1.977   -3.343  3.051   1.00 0.00 ? 117 THR A H    10 
ATOM   9437  H HA   . THR A 1 53 ? 1.847   -5.464  1.032   1.00 0.00 ? 117 THR A HA   10 
ATOM   9438  H HB   . THR A 1 53 ? -0.273  -4.191  0.986   1.00 0.00 ? 117 THR A HB   10 
ATOM   9439  H HG1  . THR A 1 53 ? -0.188  -4.558  -1.029  1.00 0.00 ? 117 THR A HG1  10 
ATOM   9440  H HG21 . THR A 1 53 ? 1.442   -1.806  0.335   1.00 0.00 ? 117 THR A HG21 10 
ATOM   9441  H HG22 . THR A 1 53 ? -0.322  -1.832  0.358   1.00 0.00 ? 117 THR A HG22 10 
ATOM   9442  H HG23 . THR A 1 53 ? 0.591   -2.070  1.856   1.00 0.00 ? 117 THR A HG23 10 
ATOM   9443  N N    . PRO A 1 54 ? 3.805   -4.489  -0.308  1.00 0.00 ? 118 PRO A N    10 
ATOM   9444  C CA   . PRO A 1 54 ? 5.044   -4.016  -0.894  1.00 0.00 ? 118 PRO A CA   10 
ATOM   9445  C C    . PRO A 1 54 ? 4.875   -2.657  -1.552  1.00 0.00 ? 118 PRO A C    10 
ATOM   9446  O O    . PRO A 1 54 ? 3.821   -2.355  -2.115  1.00 0.00 ? 118 PRO A O    10 
ATOM   9447  C CB   . PRO A 1 54 ? 5.386   -5.072  -1.946  1.00 0.00 ? 118 PRO A CB   10 
ATOM   9448  C CG   . PRO A 1 54 ? 4.120   -5.772  -2.221  1.00 0.00 ? 118 PRO A CG   10 
ATOM   9449  C CD   . PRO A 1 54 ? 3.331   -5.718  -0.952  1.00 0.00 ? 118 PRO A CD   10 
ATOM   9450  H HA   . PRO A 1 54 ? 5.839   -3.960  -0.172  1.00 0.00 ? 118 PRO A HA   10 
ATOM   9451  H HB2  . PRO A 1 54 ? 5.780   -4.594  -2.829  1.00 0.00 ? 118 PRO A HB2  10 
ATOM   9452  H HB3  . PRO A 1 54 ? 6.121   -5.756  -1.549  1.00 0.00 ? 118 PRO A HB3  10 
ATOM   9453  H HG2  . PRO A 1 54 ? 3.591   -5.267  -3.017  1.00 0.00 ? 118 PRO A HG2  10 
ATOM   9454  H HG3  . PRO A 1 54 ? 4.322   -6.795  -2.501  1.00 0.00 ? 118 PRO A HG3  10 
ATOM   9455  H HD2  . PRO A 1 54 ? 2.278   -5.634  -1.180  1.00 0.00 ? 118 PRO A HD2  10 
ATOM   9456  H HD3  . PRO A 1 54 ? 3.520   -6.584  -0.338  1.00 0.00 ? 118 PRO A HD3  10 
ATOM   9457  N N    . LEU A 1 55 ? 5.921   -1.856  -1.496  1.00 0.00 ? 119 LEU A N    10 
ATOM   9458  C CA   . LEU A 1 55 ? 5.954   -0.514  -2.096  1.00 0.00 ? 119 LEU A CA   10 
ATOM   9459  C C    . LEU A 1 55 ? 5.650   -0.590  -3.587  1.00 0.00 ? 119 LEU A C    10 
ATOM   9460  O O    . LEU A 1 55 ? 5.160   0.360   -4.182  1.00 0.00 ? 119 LEU A O    10 
ATOM   9461  C CB   . LEU A 1 55 ? 7.325   0.135   -1.886  1.00 0.00 ? 119 LEU A CB   10 
ATOM   9462  C CG   . LEU A 1 55 ? 7.812   0.251   -0.442  1.00 0.00 ? 119 LEU A CG   10 
ATOM   9463  C CD1  . LEU A 1 55 ? 9.201   0.845   -0.395  1.00 0.00 ? 119 LEU A CD1  10 
ATOM   9464  C CD2  . LEU A 1 55 ? 6.854   1.068   0.401   1.00 0.00 ? 119 LEU A CD2  10 
ATOM   9465  H H    . LEU A 1 55 ? 6.709   -2.177  -0.998  1.00 0.00 ? 119 LEU A H    10 
ATOM   9466  H HA   . LEU A 1 55 ? 5.198   0.101   -1.630  1.00 0.00 ? 119 LEU A HA   10 
ATOM   9467  H HB2  . LEU A 1 55 ? 8.056   -0.431  -2.442  1.00 0.00 ? 119 LEU A HB2  10 
ATOM   9468  H HB3  . LEU A 1 55 ? 7.286   1.127   -2.308  1.00 0.00 ? 119 LEU A HB3  10 
ATOM   9469  H HG   . LEU A 1 55 ? 7.867   -0.743  -0.028  1.00 0.00 ? 119 LEU A HG   10 
ATOM   9470  H HD11 . LEU A 1 55 ? 9.187   1.819   -0.861  1.00 0.00 ? 119 LEU A HD11 10 
ATOM   9471  H HD12 . LEU A 1 55 ? 9.524   0.937   0.632   1.00 0.00 ? 119 LEU A HD12 10 
ATOM   9472  H HD13 . LEU A 1 55 ? 9.885   0.202   -0.932  1.00 0.00 ? 119 LEU A HD13 10 
ATOM   9473  H HD21 . LEU A 1 55 ? 5.886   0.589   0.406   1.00 0.00 ? 119 LEU A HD21 10 
ATOM   9474  H HD22 . LEU A 1 55 ? 7.234   1.127   1.410   1.00 0.00 ? 119 LEU A HD22 10 
ATOM   9475  H HD23 . LEU A 1 55 ? 6.760   2.063   -0.007  1.00 0.00 ? 119 LEU A HD23 10 
ATOM   9476  N N    . LEU A 1 56 ? 5.948   -1.743  -4.179  1.00 0.00 ? 120 LEU A N    10 
ATOM   9477  C CA   . LEU A 1 56 ? 5.702   -1.995  -5.590  1.00 0.00 ? 120 LEU A CA   10 
ATOM   9478  C C    . LEU A 1 56 ? 4.196   -1.976  -5.871  1.00 0.00 ? 120 LEU A C    10 
ATOM   9479  O O    . LEU A 1 56 ? 3.755   -1.573  -6.936  1.00 0.00 ? 120 LEU A O    10 
ATOM   9480  C CB   . LEU A 1 56 ? 6.354   -3.339  -6.003  1.00 0.00 ? 120 LEU A CB   10 
ATOM   9481  C CG   . LEU A 1 56 ? 5.622   -4.642  -5.662  1.00 0.00 ? 120 LEU A CG   10 
ATOM   9482  C CD1  . LEU A 1 56 ? 4.696   -5.025  -6.798  1.00 0.00 ? 120 LEU A CD1  10 
ATOM   9483  C CD2  . LEU A 1 56 ? 6.607   -5.759  -5.366  1.00 0.00 ? 120 LEU A CD2  10 
ATOM   9484  H H    . LEU A 1 56 ? 6.355   -2.444  -3.630  1.00 0.00 ? 120 LEU A H    10 
ATOM   9485  H HA   . LEU A 1 56 ? 6.142   -1.199  -6.165  1.00 0.00 ? 120 LEU A HA   10 
ATOM   9486  H HB2  . LEU A 1 56 ? 6.492   -3.325  -7.072  1.00 0.00 ? 120 LEU A HB2  10 
ATOM   9487  H HB3  . LEU A 1 56 ? 7.324   -3.375  -5.532  1.00 0.00 ? 120 LEU A HB3  10 
ATOM   9488  H HG   . LEU A 1 56 ? 4.996   -4.480  -4.795  1.00 0.00 ? 120 LEU A HG   10 
ATOM   9489  H HD11 . LEU A 1 56 ? 4.056   -4.176  -6.987  1.00 0.00 ? 120 LEU A HD11 10 
ATOM   9490  H HD12 . LEU A 1 56 ? 5.293   -5.228  -7.674  1.00 0.00 ? 120 LEU A HD12 10 
ATOM   9491  H HD13 . LEU A 1 56 ? 4.108   -5.893  -6.536  1.00 0.00 ? 120 LEU A HD13 10 
ATOM   9492  H HD21 . LEU A 1 56 ? 7.228   -5.481  -4.526  1.00 0.00 ? 120 LEU A HD21 10 
ATOM   9493  H HD22 . LEU A 1 56 ? 6.062   -6.660  -5.125  1.00 0.00 ? 120 LEU A HD22 10 
ATOM   9494  H HD23 . LEU A 1 56 ? 7.227   -5.934  -6.232  1.00 0.00 ? 120 LEU A HD23 10 
ATOM   9495  N N    . ASN A 1 57 ? 3.424   -2.362  -4.875  1.00 0.00 ? 121 ASN A N    10 
ATOM   9496  C CA   . ASN A 1 57 ? 1.979   -2.431  -4.992  1.00 0.00 ? 121 ASN A CA   10 
ATOM   9497  C C    . ASN A 1 57 ? 1.327   -1.129  -4.620  1.00 0.00 ? 121 ASN A C    10 
ATOM   9498  O O    . ASN A 1 57 ? 0.118   -0.956  -4.807  1.00 0.00 ? 121 ASN A O    10 
ATOM   9499  C CB   . ASN A 1 57 ? 1.388   -3.586  -4.167  1.00 0.00 ? 121 ASN A CB   10 
ATOM   9500  C CG   . ASN A 1 57 ? 1.512   -4.931  -4.845  1.00 0.00 ? 121 ASN A CG   10 
ATOM   9501  O OD1  . ASN A 1 57 ? 1.545   -5.026  -6.075  1.00 0.00 ? 121 ASN A OD1  10 
ATOM   9502  N ND2  . ASN A 1 57 ? 1.534   -5.974  -4.066  1.00 0.00 ? 121 ASN A ND2  10 
ATOM   9503  H H    . ASN A 1 57 ? 3.832   -2.588  -4.012  1.00 0.00 ? 121 ASN A H    10 
ATOM   9504  H HA   . ASN A 1 57 ? 1.769   -2.620  -6.033  1.00 0.00 ? 121 ASN A HA   10 
ATOM   9505  H HB2  . ASN A 1 57 ? 1.935   -3.643  -3.239  1.00 0.00 ? 121 ASN A HB2  10 
ATOM   9506  H HB3  . ASN A 1 57 ? 0.352   -3.408  -3.934  1.00 0.00 ? 121 ASN A HB3  10 
ATOM   9507  H HD21 . ASN A 1 57 ? 1.458   -5.835  -3.097  1.00 0.00 ? 121 ASN A HD21 10 
ATOM   9508  H HD22 . ASN A 1 57 ? 1.632   -6.866  -4.463  1.00 0.00 ? 121 ASN A HD22 10 
ATOM   9509  N N    . LEU A 1 58 ? 2.111   -0.205  -4.124  1.00 0.00 ? 122 LEU A N    10 
ATOM   9510  C CA   . LEU A 1 58 ? 1.601   1.086   -3.766  1.00 0.00 ? 122 LEU A CA   10 
ATOM   9511  C C    . LEU A 1 58 ? 1.592   1.988   -4.967  1.00 0.00 ? 122 LEU A C    10 
ATOM   9512  O O    . LEU A 1 58 ? 2.569   2.052   -5.724  1.00 0.00 ? 122 LEU A O    10 
ATOM   9513  C CB   . LEU A 1 58 ? 2.419   1.712   -2.642  1.00 0.00 ? 122 LEU A CB   10 
ATOM   9514  C CG   . LEU A 1 58 ? 2.385   0.991   -1.306  1.00 0.00 ? 122 LEU A CG   10 
ATOM   9515  C CD1  . LEU A 1 58 ? 3.193   1.756   -0.277  1.00 0.00 ? 122 LEU A CD1  10 
ATOM   9516  C CD2  . LEU A 1 58 ? 0.953   0.811   -0.839  1.00 0.00 ? 122 LEU A CD2  10 
ATOM   9517  H H    . LEU A 1 58 ? 3.068   -0.384  -4.011  1.00 0.00 ? 122 LEU A H    10 
ATOM   9518  H HA   . LEU A 1 58 ? 0.583   0.962   -3.429  1.00 0.00 ? 122 LEU A HA   10 
ATOM   9519  H HB2  . LEU A 1 58 ? 3.450   1.744   -2.964  1.00 0.00 ? 122 LEU A HB2  10 
ATOM   9520  H HB3  . LEU A 1 58 ? 2.076   2.725   -2.492  1.00 0.00 ? 122 LEU A HB3  10 
ATOM   9521  H HG   . LEU A 1 58 ? 2.830   0.013   -1.421  1.00 0.00 ? 122 LEU A HG   10 
ATOM   9522  H HD11 . LEU A 1 58 ? 2.762   2.737   -0.140  1.00 0.00 ? 122 LEU A HD11 10 
ATOM   9523  H HD12 . LEU A 1 58 ? 3.176   1.224   0.662   1.00 0.00 ? 122 LEU A HD12 10 
ATOM   9524  H HD13 . LEU A 1 58 ? 4.211   1.872   -0.620  1.00 0.00 ? 122 LEU A HD13 10 
ATOM   9525  H HD21 . LEU A 1 58 ? 0.420   0.188   -1.543  1.00 0.00 ? 122 LEU A HD21 10 
ATOM   9526  H HD22 . LEU A 1 58 ? 0.944   0.340   0.132   1.00 0.00 ? 122 LEU A HD22 10 
ATOM   9527  H HD23 . LEU A 1 58 ? 0.466   1.774   -0.776  1.00 0.00 ? 122 LEU A HD23 10 
ATOM   9528  N N    . LYS A 1 59 ? 0.491   2.634   -5.170  1.00 0.00 ? 123 LYS A N    10 
ATOM   9529  C CA   . LYS A 1 59 ? 0.332   3.554   -6.258  1.00 0.00 ? 123 LYS A CA   10 
ATOM   9530  C C    . LYS A 1 59 ? 0.160   4.932   -5.679  1.00 0.00 ? 123 LYS A C    10 
ATOM   9531  O O    . LYS A 1 59 ? -0.232  5.061   -4.514  1.00 0.00 ? 123 LYS A O    10 
ATOM   9532  C CB   . LYS A 1 59 ? -0.925  3.239   -7.075  1.00 0.00 ? 123 LYS A CB   10 
ATOM   9533  C CG   . LYS A 1 59 ? -1.053  1.832   -7.594  1.00 0.00 ? 123 LYS A CG   10 
ATOM   9534  C CD   . LYS A 1 59 ? -2.308  1.721   -8.434  1.00 0.00 ? 123 LYS A CD   10 
ATOM   9535  C CE   . LYS A 1 59 ? -2.559  0.306   -8.941  1.00 0.00 ? 123 LYS A CE   10 
ATOM   9536  N NZ   . LYS A 1 59 ? -1.495  -0.186  -9.851  1.00 0.00 ? 123 LYS A NZ   10 
ATOM   9537  H H    . LYS A 1 59 ? -0.249  2.497   -4.537  1.00 0.00 ? 123 LYS A H    10 
ATOM   9538  H HA   . LYS A 1 59 ? 1.200   3.522   -6.898  1.00 0.00 ? 123 LYS A HA   10 
ATOM   9539  H HB2  . LYS A 1 59 ? -1.787  3.446   -6.464  1.00 0.00 ? 123 LYS A HB2  10 
ATOM   9540  H HB3  . LYS A 1 59 ? -0.958  3.913   -7.918  1.00 0.00 ? 123 LYS A HB3  10 
ATOM   9541  H HG2  . LYS A 1 59 ? -0.189  1.588   -8.194  1.00 0.00 ? 123 LYS A HG2  10 
ATOM   9542  H HG3  . LYS A 1 59 ? -1.128  1.159   -6.753  1.00 0.00 ? 123 LYS A HG3  10 
ATOM   9543  H HD2  . LYS A 1 59 ? -3.148  2.045   -7.838  1.00 0.00 ? 123 LYS A HD2  10 
ATOM   9544  H HD3  . LYS A 1 59 ? -2.184  2.391   -9.274  1.00 0.00 ? 123 LYS A HD3  10 
ATOM   9545  H HE2  . LYS A 1 59 ? -2.615  -0.357  -8.090  1.00 0.00 ? 123 LYS A HE2  10 
ATOM   9546  H HE3  . LYS A 1 59 ? -3.507  0.289   -9.459  1.00 0.00 ? 123 LYS A HE3  10 
ATOM   9547  H HZ1  . LYS A 1 59 ? -1.329  0.479   -10.633 1.00 0.00 ? 123 LYS A HZ1  10 
ATOM   9548  H HZ2  . LYS A 1 59 ? -0.584  -0.300  -9.363  1.00 0.00 ? 123 LYS A HZ2  10 
ATOM   9549  H HZ3  . LYS A 1 59 ? -1.762  -1.107  -10.252 1.00 0.00 ? 123 LYS A HZ3  10 
ATOM   9550  N N    . PRO A 1 60 ? 0.441   5.970   -6.446  1.00 0.00 ? 124 PRO A N    10 
ATOM   9551  C CA   . PRO A 1 60 ? 0.164   7.315   -6.028  1.00 0.00 ? 124 PRO A CA   10 
ATOM   9552  C C    . PRO A 1 60 ? -1.323  7.580   -6.150  1.00 0.00 ? 124 PRO A C    10 
ATOM   9553  O O    . PRO A 1 60 ? -2.003  7.017   -7.036  1.00 0.00 ? 124 PRO A O    10 
ATOM   9554  C CB   . PRO A 1 60 ? 0.964   8.187   -6.992  1.00 0.00 ? 124 PRO A CB   10 
ATOM   9555  C CG   . PRO A 1 60 ? 1.192   7.347   -8.201  1.00 0.00 ? 124 PRO A CG   10 
ATOM   9556  C CD   . PRO A 1 60 ? 1.050   5.908   -7.781  1.00 0.00 ? 124 PRO A CD   10 
ATOM   9557  H HA   . PRO A 1 60 ? 0.453   7.503   -5.005  1.00 0.00 ? 124 PRO A HA   10 
ATOM   9558  H HB2  . PRO A 1 60 ? 0.396   9.075   -7.228  1.00 0.00 ? 124 PRO A HB2  10 
ATOM   9559  H HB3  . PRO A 1 60 ? 1.897   8.464   -6.526  1.00 0.00 ? 124 PRO A HB3  10 
ATOM   9560  H HG2  . PRO A 1 60 ? 0.454   7.586   -8.952  1.00 0.00 ? 124 PRO A HG2  10 
ATOM   9561  H HG3  . PRO A 1 60 ? 2.185   7.528   -8.583  1.00 0.00 ? 124 PRO A HG3  10 
ATOM   9562  H HD2  . PRO A 1 60 ? 0.382   5.381   -8.442  1.00 0.00 ? 124 PRO A HD2  10 
ATOM   9563  H HD3  . PRO A 1 60 ? 1.995   5.392   -7.742  1.00 0.00 ? 124 PRO A HD3  10 
ATOM   9564  N N    . VAL A 1 61 ? -1.838  8.372   -5.260  1.00 0.00 ? 125 VAL A N    10 
ATOM   9565  C CA   . VAL A 1 61 ? -3.249  8.684   -5.266  1.00 0.00 ? 125 VAL A CA   10 
ATOM   9566  C C    . VAL A 1 61 ? -3.586  9.636   -6.389  1.00 0.00 ? 125 VAL A C    10 
ATOM   9567  O O    . VAL A 1 61 ? -2.704  10.313  -6.940  1.00 0.00 ? 125 VAL A O    10 
ATOM   9568  C CB   . VAL A 1 61 ? -3.726  9.304   -3.928  1.00 0.00 ? 125 VAL A CB   10 
ATOM   9569  C CG1  . VAL A 1 61 ? -3.647  8.296   -2.806  1.00 0.00 ? 125 VAL A CG1  10 
ATOM   9570  C CG2  . VAL A 1 61 ? -2.902  10.535  -3.588  1.00 0.00 ? 125 VAL A CG2  10 
ATOM   9571  H H    . VAL A 1 61 ? -1.237  8.777   -4.599  1.00 0.00 ? 125 VAL A H    10 
ATOM   9572  H HA   . VAL A 1 61 ? -3.788  7.762   -5.422  1.00 0.00 ? 125 VAL A HA   10 
ATOM   9573  H HB   . VAL A 1 61 ? -4.756  9.611   -4.042  1.00 0.00 ? 125 VAL A HB   10 
ATOM   9574  H HG11 . VAL A 1 61 ? -2.620  7.996   -2.658  1.00 0.00 ? 125 VAL A HG11 10 
ATOM   9575  H HG12 . VAL A 1 61 ? -4.023  8.748   -1.900  1.00 0.00 ? 125 VAL A HG12 10 
ATOM   9576  H HG13 . VAL A 1 61 ? -4.247  7.433   -3.050  1.00 0.00 ? 125 VAL A HG13 10 
ATOM   9577  H HG21 . VAL A 1 61 ? -2.989  11.239  -4.404  1.00 0.00 ? 125 VAL A HG21 10 
ATOM   9578  H HG22 . VAL A 1 61 ? -3.268  10.983  -2.677  1.00 0.00 ? 125 VAL A HG22 10 
ATOM   9579  H HG23 . VAL A 1 61 ? -1.866  10.256  -3.468  1.00 0.00 ? 125 VAL A HG23 10 
ATOM   9580  N N    . GLU A 1 62 ? -4.837  9.673   -6.748  1.00 0.00 ? 126 GLU A N    10 
ATOM   9581  C CA   . GLU A 1 62 ? -5.293  10.622  -7.715  1.00 0.00 ? 126 GLU A CA   10 
ATOM   9582  C C    . GLU A 1 62 ? -5.351  11.974  -7.035  1.00 0.00 ? 126 GLU A C    10 
ATOM   9583  O O    . GLU A 1 62 ? -5.602  12.055  -5.827  1.00 0.00 ? 126 GLU A O    10 
ATOM   9584  C CB   . GLU A 1 62 ? -6.642  10.213  -8.294  1.00 0.00 ? 126 GLU A CB   10 
ATOM   9585  C CG   . GLU A 1 62 ? -7.691  9.916   -7.248  1.00 0.00 ? 126 GLU A CG   10 
ATOM   9586  C CD   . GLU A 1 62 ? -9.017  9.608   -7.843  1.00 0.00 ? 126 GLU A CD   10 
ATOM   9587  O OE1  . GLU A 1 62 ? -9.800  10.549  -8.061  1.00 0.00 ? 126 GLU A OE1  10 
ATOM   9588  O OE2  . GLU A 1 62 ? -9.313  8.417   -8.103  1.00 0.00 ? 126 GLU A OE2  10 
ATOM   9589  H H    . GLU A 1 62 ? -5.480  9.065   -6.328  1.00 0.00 ? 126 GLU A H    10 
ATOM   9590  H HA   . GLU A 1 62 ? -4.547  10.665  -8.494  1.00 0.00 ? 126 GLU A HA   10 
ATOM   9591  H HB2  . GLU A 1 62 ? -7.010  11.011  -8.922  1.00 0.00 ? 126 GLU A HB2  10 
ATOM   9592  H HB3  . GLU A 1 62 ? -6.507  9.328   -8.896  1.00 0.00 ? 126 GLU A HB3  10 
ATOM   9593  H HG2  . GLU A 1 62 ? -7.367  9.054   -6.684  1.00 0.00 ? 126 GLU A HG2  10 
ATOM   9594  H HG3  . GLU A 1 62 ? -7.783  10.767  -6.590  1.00 0.00 ? 126 GLU A HG3  10 
ATOM   9595  N N    . GLU A 1 63 ? -5.104  13.009  -7.758  1.00 0.00 ? 127 GLU A N    10 
ATOM   9596  C CA   . GLU A 1 63 ? -4.995  14.294  -7.151  1.00 0.00 ? 127 GLU A CA   10 
ATOM   9597  C C    . GLU A 1 63 ? -5.983  15.293  -7.699  1.00 0.00 ? 127 GLU A C    10 
ATOM   9598  O O    . GLU A 1 63 ? -5.904  15.714  -8.849  1.00 0.00 ? 127 GLU A O    10 
ATOM   9599  C CB   . GLU A 1 63 ? -3.554  14.797  -7.212  1.00 0.00 ? 127 GLU A CB   10 
ATOM   9600  C CG   . GLU A 1 63 ? -2.922  14.717  -8.587  1.00 0.00 ? 127 GLU A CG   10 
ATOM   9601  C CD   . GLU A 1 63 ? -1.536  15.259  -8.593  1.00 0.00 ? 127 GLU A CD   10 
ATOM   9602  O OE1  . GLU A 1 63 ? -0.594  14.535  -8.206  1.00 0.00 ? 127 GLU A OE1  10 
ATOM   9603  O OE2  . GLU A 1 63 ? -1.357  16.437  -8.972  1.00 0.00 ? 127 GLU A OE2  10 
ATOM   9604  H H    . GLU A 1 63 ? -5.032  12.933  -8.734  1.00 0.00 ? 127 GLU A H    10 
ATOM   9605  H HA   . GLU A 1 63 ? -5.240  14.151  -6.110  1.00 0.00 ? 127 GLU A HA   10 
ATOM   9606  H HB2  . GLU A 1 63 ? -3.528  15.828  -6.894  1.00 0.00 ? 127 GLU A HB2  10 
ATOM   9607  H HB3  . GLU A 1 63 ? -2.955  14.209  -6.534  1.00 0.00 ? 127 GLU A HB3  10 
ATOM   9608  H HG2  . GLU A 1 63 ? -2.893  13.682  -8.898  1.00 0.00 ? 127 GLU A HG2  10 
ATOM   9609  H HG3  . GLU A 1 63 ? -3.524  15.284  -9.280  1.00 0.00 ? 127 GLU A HG3  10 
ATOM   9610  N N    . GLY A 1 64 ? -6.932  15.619  -6.883  1.00 0.00 ? 128 GLY A N    10 
ATOM   9611  C CA   . GLY A 1 64 ? -7.895  16.613  -7.201  1.00 0.00 ? 128 GLY A CA   10 
ATOM   9612  C C    . GLY A 1 64 ? -8.025  17.547  -6.045  1.00 0.00 ? 128 GLY A C    10 
ATOM   9613  O O    . GLY A 1 64 ? -7.309  18.564  -5.999  1.00 0.00 ? 128 GLY A O    10 
ATOM   9614  O OXT  . GLY A 1 64 ? -8.777  17.228  -5.101  1.00 0.00 ? 128 GLY A OXT  10 
ATOM   9615  H H    . GLY A 1 64 ? -7.004  15.157  -6.020  1.00 0.00 ? 128 GLY A H    10 
ATOM   9616  H HA2  . GLY A 1 64 ? -7.568  17.156  -8.075  1.00 0.00 ? 128 GLY A HA2  10 
ATOM   9617  H HA3  . GLY A 1 64 ? -8.852  16.151  -7.389  1.00 0.00 ? 128 GLY A HA3  10 
HETATM 9618  N N    . 2MR B 2 .  ? -16.810 -5.005  -0.748  1.00 0.00 ? 201 2MR A N    10 
HETATM 9619  C CA   . 2MR B 2 .  ? -16.891 -3.947  0.220   1.00 0.00 ? 201 2MR A CA   10 
HETATM 9620  C CB   . 2MR B 2 .  ? -15.581 -3.816  0.978   1.00 0.00 ? 201 2MR A CB   10 
HETATM 9621  C CG   . 2MR B 2 .  ? -15.635 -2.837  2.121   1.00 0.00 ? 201 2MR A CG   10 
HETATM 9622  C CD   . 2MR B 2 .  ? -14.294 -2.702  2.772   1.00 0.00 ? 201 2MR A CD   10 
HETATM 9623  N NE   . 2MR B 2 .  ? -13.288 -2.307  1.804   1.00 0.00 ? 201 2MR A NE   10 
HETATM 9624  C CZ   . 2MR B 2 .  ? -12.047 -2.061  2.092   1.00 0.00 ? 201 2MR A CZ   10 
HETATM 9625  N NH1  . 2MR B 2 .  ? -11.645 -2.180  3.402   1.00 0.00 ? 201 2MR A NH1  10 
HETATM 9626  C CQ1  . 2MR B 2 .  ? -10.332 -1.971  4.041   1.00 0.00 ? 201 2MR A CQ1  10 
HETATM 9627  N NH2  . 2MR B 2 .  ? -11.227 -1.706  1.072   1.00 0.00 ? 201 2MR A NH2  10 
HETATM 9628  C CQ2  . 2MR B 2 .  ? -9.811  -1.371  1.059   1.00 0.00 ? 201 2MR A CQ2  10 
HETATM 9629  C C    . 2MR B 2 .  ? -17.180 -2.682  -0.522  1.00 0.00 ? 201 2MR A C    10 
HETATM 9630  O O    . 2MR B 2 .  ? -18.215 -2.060  -0.259  1.00 0.00 ? 201 2MR A O    10 
HETATM 9631  O OXT  . 2MR B 2 .  ? -16.389 -2.326  -1.409  1.00 0.00 ? 201 2MR A OXT  10 
HETATM 9632  H H2   . 2MR B 2 .  ? -16.511 -5.917  -0.350  1.00 0.00 ? 201 2MR A H2   10 
HETATM 9633  H H    . 2MR B 2 .  ? -17.724 -5.110  -1.230  1.00 0.00 ? 201 2MR A H    10 
HETATM 9634  H H3   . 2MR B 2 .  ? -16.129 -4.697  -1.470  1.00 0.00 ? 201 2MR A H3   10 
HETATM 9635  H HA   . 2MR B 2 .  ? -17.700 -4.134  0.911   1.00 0.00 ? 201 2MR A HA   10 
HETATM 9636  H HB2  . 2MR B 2 .  ? -14.829 -3.461  0.291   1.00 0.00 ? 201 2MR A HB2  10 
HETATM 9637  H HB3  . 2MR B 2 .  ? -15.275 -4.774  1.369   1.00 0.00 ? 201 2MR A HB3  10 
HETATM 9638  H HG2  . 2MR B 2 .  ? -16.339 -3.218  2.842   1.00 0.00 ? 201 2MR A HG2  10 
HETATM 9639  H HG3  . 2MR B 2 .  ? -15.935 -1.874  1.739   1.00 0.00 ? 201 2MR A HG3  10 
HETATM 9640  H HD2  . 2MR B 2 .  ? -14.003 -3.643  3.214   1.00 0.00 ? 201 2MR A HD2  10 
HETATM 9641  H HD3  . 2MR B 2 .  ? -14.339 -1.930  3.530   1.00 0.00 ? 201 2MR A HD3  10 
HETATM 9642  H HE   . 2MR B 2 .  ? -13.601 -2.234  0.877   1.00 0.00 ? 201 2MR A HE   10 
HETATM 9643  H HQ11 . 2MR B 2 .  ? -10.028 -0.945  3.893   1.00 0.00 ? 201 2MR A HQ11 10 
HETATM 9644  H HQ12 . 2MR B 2 .  ? -10.419 -2.168  5.099   1.00 0.00 ? 201 2MR A HQ12 10 
HETATM 9645  H HQ13 . 2MR B 2 .  ? -9.603  -2.638  3.602   1.00 0.00 ? 201 2MR A HQ13 10 
HETATM 9646  H HH2  . 2MR B 2 .  ? -11.577 -1.652  0.138   1.00 0.00 ? 201 2MR A HH2  10 
HETATM 9647  H HQ21 . 2MR B 2 .  ? -9.239  -2.210  1.429   1.00 0.00 ? 201 2MR A HQ21 10 
HETATM 9648  H HQ22 . 2MR B 2 .  ? -9.505  -1.154  0.046   1.00 0.00 ? 201 2MR A HQ22 10 
HETATM 9649  H HQ23 . 2MR B 2 .  ? -9.635  -0.509  1.684   1.00 0.00 ? 201 2MR A HQ23 10 
HETATM 9650  H HH1  . 2MR B 2 .  ? -12.309 -2.480  4.096   1.00 0.00 ? 201 2MR A HH1  10 
ATOM   9651  N N    . ALA A 1 1  ? 17.926  -5.439  2.349   1.00 0.00 ? 65  ALA A N    11 
ATOM   9652  C CA   . ALA A 1 1  ? 16.895  -5.252  1.353   1.00 0.00 ? 65  ALA A CA   11 
ATOM   9653  C C    . ALA A 1 1  ? 17.306  -5.947  0.074   1.00 0.00 ? 65  ALA A C    11 
ATOM   9654  O O    . ALA A 1 1  ? 18.140  -5.443  -0.687  1.00 0.00 ? 65  ALA A O    11 
ATOM   9655  C CB   . ALA A 1 1  ? 16.643  -3.771  1.110   1.00 0.00 ? 65  ALA A CB   11 
ATOM   9656  H H1   . ALA A 1 1  ? 18.108  -6.459  2.433   1.00 0.00 ? 65  ALA A H1   11 
ATOM   9657  H H2   . ALA A 1 1  ? 18.812  -4.972  2.074   1.00 0.00 ? 65  ALA A H2   11 
ATOM   9658  H H3   . ALA A 1 1  ? 17.604  -5.124  3.291   1.00 0.00 ? 65  ALA A H3   11 
ATOM   9659  H HA   . ALA A 1 1  ? 15.981  -5.699  1.716   1.00 0.00 ? 65  ALA A HA   11 
ATOM   9660  H HB1  . ALA A 1 1  ? 17.547  -3.310  0.741   1.00 0.00 ? 65  ALA A HB1  11 
ATOM   9661  H HB2  . ALA A 1 1  ? 15.852  -3.656  0.383   1.00 0.00 ? 65  ALA A HB2  11 
ATOM   9662  H HB3  . ALA A 1 1  ? 16.352  -3.299  2.037   1.00 0.00 ? 65  ALA A HB3  11 
ATOM   9663  N N    . SER A 1 2  ? 16.772  -7.135  -0.127  1.00 0.00 ? 66  SER A N    11 
ATOM   9664  C CA   . SER A 1 2  ? 17.040  -7.910  -1.303  1.00 0.00 ? 66  SER A CA   11 
ATOM   9665  C C    . SER A 1 2  ? 16.337  -7.250  -2.478  1.00 0.00 ? 66  SER A C    11 
ATOM   9666  O O    . SER A 1 2  ? 16.891  -7.138  -3.578  1.00 0.00 ? 66  SER A O    11 
ATOM   9667  C CB   . SER A 1 2  ? 16.556  -9.357  -1.106  1.00 0.00 ? 66  SER A CB   11 
ATOM   9668  O OG   . SER A 1 2  ? 16.934  -10.192 -2.194  1.00 0.00 ? 66  SER A OG   11 
ATOM   9669  H H    . SER A 1 2  ? 16.171  -7.507  0.556   1.00 0.00 ? 66  SER A H    11 
ATOM   9670  H HA   . SER A 1 2  ? 18.105  -7.904  -1.476  1.00 0.00 ? 66  SER A HA   11 
ATOM   9671  H HB2  . SER A 1 2  ? 16.975  -9.755  -0.194  1.00 0.00 ? 66  SER A HB2  11 
ATOM   9672  H HB3  . SER A 1 2  ? 15.479  -9.361  -1.027  1.00 0.00 ? 66  SER A HB3  11 
ATOM   9673  H HG   . SER A 1 2  ? 17.895  -10.139 -2.286  1.00 0.00 ? 66  SER A HG   11 
ATOM   9674  N N    . THR A 1 3  ? 15.139  -6.798  -2.241  1.00 0.00 ? 67  THR A N    11 
ATOM   9675  C CA   . THR A 1 3  ? 14.419  -6.087  -3.228  1.00 0.00 ? 67  THR A CA   11 
ATOM   9676  C C    . THR A 1 3  ? 14.372  -4.616  -2.794  1.00 0.00 ? 67  THR A C    11 
ATOM   9677  O O    . THR A 1 3  ? 14.174  -4.311  -1.608  1.00 0.00 ? 67  THR A O    11 
ATOM   9678  C CB   . THR A 1 3  ? 12.992  -6.702  -3.477  1.00 0.00 ? 67  THR A CB   11 
ATOM   9679  O OG1  . THR A 1 3  ? 12.350  -6.074  -4.598  1.00 0.00 ? 67  THR A OG1  11 
ATOM   9680  C CG2  . THR A 1 3  ? 12.089  -6.594  -2.249  1.00 0.00 ? 67  THR A CG2  11 
ATOM   9681  H H    . THR A 1 3  ? 14.729  -6.922  -1.357  1.00 0.00 ? 67  THR A H    11 
ATOM   9682  H HA   . THR A 1 3  ? 15.005  -6.150  -4.135  1.00 0.00 ? 67  THR A HA   11 
ATOM   9683  H HB   . THR A 1 3  ? 13.130  -7.746  -3.719  1.00 0.00 ? 67  THR A HB   11 
ATOM   9684  H HG1  . THR A 1 3  ? 12.894  -6.256  -5.376  1.00 0.00 ? 67  THR A HG1  11 
ATOM   9685  H HG21 . THR A 1 3  ? 11.983  -5.555  -1.972  1.00 0.00 ? 67  THR A HG21 11 
ATOM   9686  H HG22 . THR A 1 3  ? 11.118  -7.004  -2.478  1.00 0.00 ? 67  THR A HG22 11 
ATOM   9687  H HG23 . THR A 1 3  ? 12.530  -7.141  -1.430  1.00 0.00 ? 67  THR A HG23 11 
ATOM   9688  N N    . GLN A 1 4  ? 14.636  -3.731  -3.716  1.00 0.00 ? 68  GLN A N    11 
ATOM   9689  C CA   . GLN A 1 4  ? 14.675  -2.320  -3.415  1.00 0.00 ? 68  GLN A CA   11 
ATOM   9690  C C    . GLN A 1 4  ? 13.343  -1.668  -3.767  1.00 0.00 ? 68  GLN A C    11 
ATOM   9691  O O    . GLN A 1 4  ? 12.625  -2.173  -4.648  1.00 0.00 ? 68  GLN A O    11 
ATOM   9692  C CB   . GLN A 1 4  ? 15.841  -1.646  -4.149  1.00 0.00 ? 68  GLN A CB   11 
ATOM   9693  C CG   . GLN A 1 4  ? 15.810  -1.789  -5.659  1.00 0.00 ? 68  GLN A CG   11 
ATOM   9694  C CD   . GLN A 1 4  ? 16.988  -1.117  -6.308  1.00 0.00 ? 68  GLN A CD   11 
ATOM   9695  O OE1  . GLN A 1 4  ? 16.930  0.070   -6.654  1.00 0.00 ? 68  GLN A OE1  11 
ATOM   9696  N NE2  . GLN A 1 4  ? 18.062  -1.845  -6.472  1.00 0.00 ? 68  GLN A NE2  11 
ATOM   9697  H H    . GLN A 1 4  ? 14.791  -4.033  -4.636  1.00 0.00 ? 68  GLN A H    11 
ATOM   9698  H HA   . GLN A 1 4  ? 14.833  -2.230  -2.351  1.00 0.00 ? 68  GLN A HA   11 
ATOM   9699  H HB2  . GLN A 1 4  ? 15.831  -0.592  -3.917  1.00 0.00 ? 68  GLN A HB2  11 
ATOM   9700  H HB3  . GLN A 1 4  ? 16.767  -2.068  -3.789  1.00 0.00 ? 68  GLN A HB3  11 
ATOM   9701  H HG2  . GLN A 1 4  ? 15.824  -2.840  -5.912  1.00 0.00 ? 68  GLN A HG2  11 
ATOM   9702  H HG3  . GLN A 1 4  ? 14.901  -1.339  -6.032  1.00 0.00 ? 68  GLN A HG3  11 
ATOM   9703  H HE21 . GLN A 1 4  ? 18.047  -2.779  -6.171  1.00 0.00 ? 68  GLN A HE21 11 
ATOM   9704  H HE22 . GLN A 1 4  ? 18.850  -1.426  -6.879  1.00 0.00 ? 68  GLN A HE22 11 
ATOM   9705  N N    . PRO A 1 5  ? 12.969  -0.567  -3.066  1.00 0.00 ? 69  PRO A N    11 
ATOM   9706  C CA   . PRO A 1 5  ? 11.706  0.152   -3.298  1.00 0.00 ? 69  PRO A CA   11 
ATOM   9707  C C    . PRO A 1 5  ? 11.470  0.477   -4.768  1.00 0.00 ? 69  PRO A C    11 
ATOM   9708  O O    . PRO A 1 5  ? 12.378  0.947   -5.473  1.00 0.00 ? 69  PRO A O    11 
ATOM   9709  C CB   . PRO A 1 5  ? 11.907  1.448   -2.516  1.00 0.00 ? 69  PRO A CB   11 
ATOM   9710  C CG   . PRO A 1 5  ? 12.786  1.055   -1.391  1.00 0.00 ? 69  PRO A CG   11 
ATOM   9711  C CD   . PRO A 1 5  ? 13.743  0.052   -1.961  1.00 0.00 ? 69  PRO A CD   11 
ATOM   9712  H HA   . PRO A 1 5  ? 10.856  -0.381  -2.899  1.00 0.00 ? 69  PRO A HA   11 
ATOM   9713  H HB2  . PRO A 1 5  ? 12.374  2.183   -3.154  1.00 0.00 ? 69  PRO A HB2  11 
ATOM   9714  H HB3  . PRO A 1 5  ? 10.957  1.822   -2.164  1.00 0.00 ? 69  PRO A HB3  11 
ATOM   9715  H HG2  . PRO A 1 5  ? 13.314  1.917   -1.016  1.00 0.00 ? 69  PRO A HG2  11 
ATOM   9716  H HG3  . PRO A 1 5  ? 12.193  0.602   -0.610  1.00 0.00 ? 69  PRO A HG3  11 
ATOM   9717  H HD2  . PRO A 1 5  ? 14.627  0.546   -2.336  1.00 0.00 ? 69  PRO A HD2  11 
ATOM   9718  H HD3  . PRO A 1 5  ? 14.003  -0.683  -1.215  1.00 0.00 ? 69  PRO A HD3  11 
ATOM   9719  N N    . THR A 1 6  ? 10.264  0.215   -5.215  1.00 0.00 ? 70  THR A N    11 
ATOM   9720  C CA   . THR A 1 6  ? 9.866   0.479   -6.562  1.00 0.00 ? 70  THR A CA   11 
ATOM   9721  C C    . THR A 1 6  ? 9.516   1.970   -6.724  1.00 0.00 ? 70  THR A C    11 
ATOM   9722  O O    . THR A 1 6  ? 9.730   2.566   -7.775  1.00 0.00 ? 70  THR A O    11 
ATOM   9723  C CB   . THR A 1 6  ? 8.646   -0.390  -6.869  1.00 0.00 ? 70  THR A CB   11 
ATOM   9724  O OG1  . THR A 1 6  ? 8.893   -1.715  -6.353  1.00 0.00 ? 70  THR A OG1  11 
ATOM   9725  C CG2  . THR A 1 6  ? 8.412   -0.476  -8.357  1.00 0.00 ? 70  THR A CG2  11 
ATOM   9726  H H    . THR A 1 6  ? 9.600   -0.244  -4.662  1.00 0.00 ? 70  THR A H    11 
ATOM   9727  H HA   . THR A 1 6  ? 10.666  0.205   -7.232  1.00 0.00 ? 70  THR A HA   11 
ATOM   9728  H HB   . THR A 1 6  ? 7.779   0.033   -6.383  1.00 0.00 ? 70  THR A HB   11 
ATOM   9729  H HG1  . THR A 1 6  ? 8.779   -2.361  -7.061  1.00 0.00 ? 70  THR A HG1  11 
ATOM   9730  H HG21 . THR A 1 6  ? 9.287   -0.906  -8.820  1.00 0.00 ? 70  THR A HG21 11 
ATOM   9731  H HG22 . THR A 1 6  ? 7.553   -1.104  -8.543  1.00 0.00 ? 70  THR A HG22 11 
ATOM   9732  H HG23 . THR A 1 6  ? 8.241   0.516   -8.746  1.00 0.00 ? 70  THR A HG23 11 
ATOM   9733  N N    . HIS A 1 7  ? 9.008   2.552   -5.661  1.00 0.00 ? 71  HIS A N    11 
ATOM   9734  C CA   . HIS A 1 7  ? 8.645   3.955   -5.619  1.00 0.00 ? 71  HIS A CA   11 
ATOM   9735  C C    . HIS A 1 7  ? 9.130   4.506   -4.303  1.00 0.00 ? 71  HIS A C    11 
ATOM   9736  O O    . HIS A 1 7  ? 9.419   3.731   -3.380  1.00 0.00 ? 71  HIS A O    11 
ATOM   9737  C CB   . HIS A 1 7  ? 7.116   4.170   -5.729  1.00 0.00 ? 71  HIS A CB   11 
ATOM   9738  C CG   . HIS A 1 7  ? 6.486   3.791   -7.040  1.00 0.00 ? 71  HIS A CG   11 
ATOM   9739  N ND1  . HIS A 1 7  ? 6.144   4.698   -8.021  1.00 0.00 ? 71  HIS A ND1  11 
ATOM   9740  C CD2  . HIS A 1 7  ? 6.106   2.581   -7.509  1.00 0.00 ? 71  HIS A CD2  11 
ATOM   9741  C CE1  . HIS A 1 7  ? 5.586   4.031   -9.024  1.00 0.00 ? 71  HIS A CE1  11 
ATOM   9742  N NE2  . HIS A 1 7  ? 5.537   2.738   -8.766  1.00 0.00 ? 71  HIS A NE2  11 
ATOM   9743  H H    . HIS A 1 7  ? 8.902   2.037   -4.837  1.00 0.00 ? 71  HIS A H    11 
ATOM   9744  H HA   . HIS A 1 7  ? 9.148   4.458   -6.433  1.00 0.00 ? 71  HIS A HA   11 
ATOM   9745  H HB2  . HIS A 1 7  ? 6.635   3.578   -4.965  1.00 0.00 ? 71  HIS A HB2  11 
ATOM   9746  H HB3  . HIS A 1 7  ? 6.898   5.211   -5.537  1.00 0.00 ? 71  HIS A HB3  11 
ATOM   9747  H HD1  . HIS A 1 7  ? 6.268   5.673   -7.995  1.00 0.00 ? 71  HIS A HD1  11 
ATOM   9748  H HD2  . HIS A 1 7  ? 6.221   1.637   -6.996  1.00 0.00 ? 71  HIS A HD2  11 
ATOM   9749  H HE1  . HIS A 1 7  ? 5.224   4.487   -9.934  1.00 0.00 ? 71  HIS A HE1  11 
ATOM   9750  N N    . SER A 1 8  ? 9.225   5.799   -4.199  1.00 0.00 ? 72  SER A N    11 
ATOM   9751  C CA   . SER A 1 8  ? 9.680   6.414   -2.983  1.00 0.00 ? 72  SER A CA   11 
ATOM   9752  C C    . SER A 1 8  ? 8.477   6.820   -2.127  1.00 0.00 ? 72  SER A C    11 
ATOM   9753  O O    . SER A 1 8  ? 7.710   7.744   -2.490  1.00 0.00 ? 72  SER A O    11 
ATOM   9754  C CB   . SER A 1 8  ? 10.563  7.613   -3.317  1.00 0.00 ? 72  SER A CB   11 
ATOM   9755  O OG   . SER A 1 8  ? 11.611  7.225   -4.212  1.00 0.00 ? 72  SER A OG   11 
ATOM   9756  H H    . SER A 1 8  ? 8.979   6.365   -4.963  1.00 0.00 ? 72  SER A H    11 
ATOM   9757  H HA   . SER A 1 8  ? 10.262  5.684   -2.439  1.00 0.00 ? 72  SER A HA   11 
ATOM   9758  H HB2  . SER A 1 8  ? 9.968   8.381   -3.787  1.00 0.00 ? 72  SER A HB2  11 
ATOM   9759  H HB3  . SER A 1 8  ? 11.007  8.002   -2.414  1.00 0.00 ? 72  SER A HB3  11 
ATOM   9760  H HG   . SER A 1 8  ? 12.076  6.479   -3.810  1.00 0.00 ? 72  SER A HG   11 
ATOM   9761  N N    . TRP A 1 9  ? 8.288   6.118   -1.032  1.00 0.00 ? 73  TRP A N    11 
ATOM   9762  C CA   . TRP A 1 9  ? 7.182   6.351   -0.149  1.00 0.00 ? 73  TRP A CA   11 
ATOM   9763  C C    . TRP A 1 9  ? 7.693   6.694   1.231   1.00 0.00 ? 73  TRP A C    11 
ATOM   9764  O O    . TRP A 1 9  ? 8.737   6.171   1.648   1.00 0.00 ? 73  TRP A O    11 
ATOM   9765  C CB   . TRP A 1 9  ? 6.330   5.092   -0.059  1.00 0.00 ? 73  TRP A CB   11 
ATOM   9766  C CG   . TRP A 1 9  ? 5.688   4.682   -1.349  1.00 0.00 ? 73  TRP A CG   11 
ATOM   9767  C CD1  . TRP A 1 9  ? 6.022   3.618   -2.133  1.00 0.00 ? 73  TRP A CD1  11 
ATOM   9768  C CD2  . TRP A 1 9  ? 4.606   5.342   -2.008  1.00 0.00 ? 73  TRP A CD2  11 
ATOM   9769  N NE1  . TRP A 1 9  ? 5.188   3.557   -3.222  1.00 0.00 ? 73  TRP A NE1  11 
ATOM   9770  C CE2  . TRP A 1 9  ? 4.319   4.612   -3.173  1.00 0.00 ? 73  TRP A CE2  11 
ATOM   9771  C CE3  . TRP A 1 9  ? 3.846   6.476   -1.718  1.00 0.00 ? 73  TRP A CE3  11 
ATOM   9772  C CZ2  . TRP A 1 9  ? 3.306   4.981   -4.047  1.00 0.00 ? 73  TRP A CZ2  11 
ATOM   9773  C CZ3  . TRP A 1 9  ? 2.845   6.840   -2.587  1.00 0.00 ? 73  TRP A CZ3  11 
ATOM   9774  C CH2  . TRP A 1 9  ? 2.586   6.094   -3.736  1.00 0.00 ? 73  TRP A CH2  11 
ATOM   9775  H H    . TRP A 1 9  ? 8.916   5.413   -0.767  1.00 0.00 ? 73  TRP A H    11 
ATOM   9776  H HA   . TRP A 1 9  ? 6.572   7.150   -0.543  1.00 0.00 ? 73  TRP A HA   11 
ATOM   9777  H HB2  . TRP A 1 9  ? 6.954   4.274   0.269   1.00 0.00 ? 73  TRP A HB2  11 
ATOM   9778  H HB3  . TRP A 1 9  ? 5.553   5.255   0.671   1.00 0.00 ? 73  TRP A HB3  11 
ATOM   9779  H HD1  . TRP A 1 9  ? 6.817   2.924   -1.903  1.00 0.00 ? 73  TRP A HD1  11 
ATOM   9780  H HE1  . TRP A 1 9  ? 5.205   2.875   -3.928  1.00 0.00 ? 73  TRP A HE1  11 
ATOM   9781  H HE3  . TRP A 1 9  ? 4.034   7.064   -0.832  1.00 0.00 ? 73  TRP A HE3  11 
ATOM   9782  H HZ2  . TRP A 1 9  ? 3.083   4.418   -4.941  1.00 0.00 ? 73  TRP A HZ2  11 
ATOM   9783  H HZ3  . TRP A 1 9  ? 2.248   7.715   -2.383  1.00 0.00 ? 73  TRP A HZ3  11 
ATOM   9784  H HH2  . TRP A 1 9  ? 1.791   6.414   -4.390  1.00 0.00 ? 73  TRP A HH2  11 
ATOM   9785  N N    . LYS A 1 10 ? 7.001   7.571   1.922   1.00 0.00 ? 74  LYS A N    11 
ATOM   9786  C CA   . LYS A 1 10 ? 7.333   7.911   3.288   1.00 0.00 ? 74  LYS A CA   11 
ATOM   9787  C C    . LYS A 1 10 ? 6.099   7.781   4.175   1.00 0.00 ? 74  LYS A C    11 
ATOM   9788  O O    . LYS A 1 10 ? 4.969   7.669   3.679   1.00 0.00 ? 74  LYS A O    11 
ATOM   9789  C CB   . LYS A 1 10 ? 7.910   9.328   3.413   1.00 0.00 ? 74  LYS A CB   11 
ATOM   9790  C CG   . LYS A 1 10 ? 6.969   10.417  2.940   1.00 0.00 ? 74  LYS A CG   11 
ATOM   9791  C CD   . LYS A 1 10 ? 7.444   11.801  3.308   1.00 0.00 ? 74  LYS A CD   11 
ATOM   9792  C CE   . LYS A 1 10 ? 7.380   12.025  4.812   1.00 0.00 ? 74  LYS A CE   11 
ATOM   9793  N NZ   . LYS A 1 10 ? 7.656   13.423  5.174   1.00 0.00 ? 74  LYS A NZ   11 
ATOM   9794  H H    . LYS A 1 10 ? 6.228   8.033   1.514   1.00 0.00 ? 74  LYS A H    11 
ATOM   9795  H HA   . LYS A 1 10 ? 8.073   7.199   3.620   1.00 0.00 ? 74  LYS A HA   11 
ATOM   9796  H HB2  . LYS A 1 10 ? 8.153   9.510   4.449   1.00 0.00 ? 74  LYS A HB2  11 
ATOM   9797  H HB3  . LYS A 1 10 ? 8.814   9.379   2.825   1.00 0.00 ? 74  LYS A HB3  11 
ATOM   9798  H HG2  . LYS A 1 10 ? 6.874   10.358  1.866   1.00 0.00 ? 74  LYS A HG2  11 
ATOM   9799  H HG3  . LYS A 1 10 ? 6.001   10.247  3.388   1.00 0.00 ? 74  LYS A HG3  11 
ATOM   9800  H HD2  . LYS A 1 10 ? 8.469   11.901  2.983   1.00 0.00 ? 74  LYS A HD2  11 
ATOM   9801  H HD3  . LYS A 1 10 ? 6.827   12.530  2.808   1.00 0.00 ? 74  LYS A HD3  11 
ATOM   9802  H HE2  . LYS A 1 10 ? 6.396   11.760  5.166   1.00 0.00 ? 74  LYS A HE2  11 
ATOM   9803  H HE3  . LYS A 1 10 ? 8.111   11.388  5.288   1.00 0.00 ? 74  LYS A HE3  11 
ATOM   9804  H HZ1  . LYS A 1 10 ? 6.927   14.053  4.779   1.00 0.00 ? 74  LYS A HZ1  11 
ATOM   9805  H HZ2  . LYS A 1 10 ? 7.651   13.541  6.208   1.00 0.00 ? 74  LYS A HZ2  11 
ATOM   9806  H HZ3  . LYS A 1 10 ? 8.579   13.736  4.814   1.00 0.00 ? 74  LYS A HZ3  11 
ATOM   9807  N N    . VAL A 1 11 ? 6.317   7.767   5.474   1.00 0.00 ? 75  VAL A N    11 
ATOM   9808  C CA   . VAL A 1 11 ? 5.232   7.705   6.432   1.00 0.00 ? 75  VAL A CA   11 
ATOM   9809  C C    . VAL A 1 11 ? 4.370   8.956   6.306   1.00 0.00 ? 75  VAL A C    11 
ATOM   9810  O O    . VAL A 1 11 ? 4.883   10.084  6.334   1.00 0.00 ? 75  VAL A O    11 
ATOM   9811  C CB   . VAL A 1 11 ? 5.772   7.576   7.888   1.00 0.00 ? 75  VAL A CB   11 
ATOM   9812  C CG1  . VAL A 1 11 ? 4.641   7.612   8.913   1.00 0.00 ? 75  VAL A CG1  11 
ATOM   9813  C CG2  . VAL A 1 11 ? 6.566   6.291   8.038   1.00 0.00 ? 75  VAL A CG2  11 
ATOM   9814  H H    . VAL A 1 11 ? 7.243   7.808   5.798   1.00 0.00 ? 75  VAL A H    11 
ATOM   9815  H HA   . VAL A 1 11 ? 4.629   6.837   6.203   1.00 0.00 ? 75  VAL A HA   11 
ATOM   9816  H HB   . VAL A 1 11 ? 6.434   8.407   8.083   1.00 0.00 ? 75  VAL A HB   11 
ATOM   9817  H HG11 . VAL A 1 11 ? 3.959   6.796   8.725   1.00 0.00 ? 75  VAL A HG11 11 
ATOM   9818  H HG12 . VAL A 1 11 ? 5.051   7.518   9.906   1.00 0.00 ? 75  VAL A HG12 11 
ATOM   9819  H HG13 . VAL A 1 11 ? 4.110   8.548   8.830   1.00 0.00 ? 75  VAL A HG13 11 
ATOM   9820  H HG21 . VAL A 1 11 ? 7.397   6.296   7.350   1.00 0.00 ? 75  VAL A HG21 11 
ATOM   9821  H HG22 . VAL A 1 11 ? 6.934   6.213   9.050   1.00 0.00 ? 75  VAL A HG22 11 
ATOM   9822  H HG23 . VAL A 1 11 ? 5.928   5.446   7.823   1.00 0.00 ? 75  VAL A HG23 11 
ATOM   9823  N N    . GLY A 1 12 ? 3.087   8.760   6.152   1.00 0.00 ? 76  GLY A N    11 
ATOM   9824  C CA   . GLY A 1 12 ? 2.187   9.872   6.021   1.00 0.00 ? 76  GLY A CA   11 
ATOM   9825  C C    . GLY A 1 12 ? 1.756   10.092  4.593   1.00 0.00 ? 76  GLY A C    11 
ATOM   9826  O O    . GLY A 1 12 ? 0.936   10.978  4.312   1.00 0.00 ? 76  GLY A O    11 
ATOM   9827  H H    . GLY A 1 12 ? 2.734   7.842   6.135   1.00 0.00 ? 76  GLY A H    11 
ATOM   9828  H HA2  . GLY A 1 12 ? 1.312   9.693   6.627   1.00 0.00 ? 76  GLY A HA2  11 
ATOM   9829  H HA3  . GLY A 1 12 ? 2.685   10.762  6.372   1.00 0.00 ? 76  GLY A HA3  11 
ATOM   9830  N N    . ASP A 1 13 ? 2.313   9.319   3.682   1.00 0.00 ? 77  ASP A N    11 
ATOM   9831  C CA   . ASP A 1 13 ? 1.934   9.421   2.277   1.00 0.00 ? 77  ASP A CA   11 
ATOM   9832  C C    . ASP A 1 13 ? 0.625   8.749   2.011   1.00 0.00 ? 77  ASP A C    11 
ATOM   9833  O O    . ASP A 1 13 ? 0.256   7.763   2.682   1.00 0.00 ? 77  ASP A O    11 
ATOM   9834  C CB   . ASP A 1 13 ? 2.971   8.815   1.329   1.00 0.00 ? 77  ASP A CB   11 
ATOM   9835  C CG   . ASP A 1 13 ? 4.113   9.737   0.969   1.00 0.00 ? 77  ASP A CG   11 
ATOM   9836  O OD1  . ASP A 1 13 ? 3.892   10.978  0.873   1.00 0.00 ? 77  ASP A OD1  11 
ATOM   9837  O OD2  . ASP A 1 13 ? 5.231   9.242   0.702   1.00 0.00 ? 77  ASP A OD2  11 
ATOM   9838  H H    . ASP A 1 13 ? 2.998   8.666   3.942   1.00 0.00 ? 77  ASP A H    11 
ATOM   9839  H HA   . ASP A 1 13 ? 1.840   10.472  2.046   1.00 0.00 ? 77  ASP A HA   11 
ATOM   9840  H HB2  . ASP A 1 13 ? 3.373   7.961   1.848   1.00 0.00 ? 77  ASP A HB2  11 
ATOM   9841  H HB3  . ASP A 1 13 ? 2.476   8.482   0.429   1.00 0.00 ? 77  ASP A HB3  11 
ATOM   9842  N N    . LYS A 1 14 ? -0.075  9.271   1.046   1.00 0.00 ? 78  LYS A N    11 
ATOM   9843  C CA   . LYS A 1 14 ? -1.283  8.674   0.590   1.00 0.00 ? 78  LYS A CA   11 
ATOM   9844  C C    . LYS A 1 14 ? -0.927  7.844   -0.594  1.00 0.00 ? 78  LYS A C    11 
ATOM   9845  O O    . LYS A 1 14 ? -0.238  8.306   -1.511  1.00 0.00 ? 78  LYS A O    11 
ATOM   9846  C CB   . LYS A 1 14 ? -2.312  9.714   0.157   1.00 0.00 ? 78  LYS A CB   11 
ATOM   9847  C CG   . LYS A 1 14 ? -2.794  10.651  1.234   1.00 0.00 ? 78  LYS A CG   11 
ATOM   9848  C CD   . LYS A 1 14 ? -3.608  9.954   2.310   1.00 0.00 ? 78  LYS A CD   11 
ATOM   9849  C CE   . LYS A 1 14 ? -4.261  10.998  3.210   1.00 0.00 ? 78  LYS A CE   11 
ATOM   9850  N NZ   . LYS A 1 14 ? -4.953  10.405  4.371   1.00 0.00 ? 78  LYS A NZ   11 
ATOM   9851  H H    . LYS A 1 14 ? 0.261   10.068  0.583   1.00 0.00 ? 78  LYS A H    11 
ATOM   9852  H HA   . LYS A 1 14 ? -1.689  8.053   1.372   1.00 0.00 ? 78  LYS A HA   11 
ATOM   9853  H HB2  . LYS A 1 14 ? -1.882  10.312  -0.632  1.00 0.00 ? 78  LYS A HB2  11 
ATOM   9854  H HB3  . LYS A 1 14 ? -3.169  9.192   -0.241  1.00 0.00 ? 78  LYS A HB3  11 
ATOM   9855  H HG2  . LYS A 1 14 ? -1.902  11.036  1.703   1.00 0.00 ? 78  LYS A HG2  11 
ATOM   9856  H HG3  . LYS A 1 14 ? -3.367  11.454  0.794   1.00 0.00 ? 78  LYS A HG3  11 
ATOM   9857  H HD2  . LYS A 1 14 ? -4.364  9.338   1.845   1.00 0.00 ? 78  LYS A HD2  11 
ATOM   9858  H HD3  . LYS A 1 14 ? -2.955  9.334   2.903   1.00 0.00 ? 78  LYS A HD3  11 
ATOM   9859  H HE2  . LYS A 1 14 ? -3.502  11.677  3.565   1.00 0.00 ? 78  LYS A HE2  11 
ATOM   9860  H HE3  . LYS A 1 14 ? -4.975  11.554  2.621   1.00 0.00 ? 78  LYS A HE3  11 
ATOM   9861  H HZ1  . LYS A 1 14 ? -5.676  9.708   4.106   1.00 0.00 ? 78  LYS A HZ1  11 
ATOM   9862  H HZ2  . LYS A 1 14 ? -4.263  9.983   5.032   1.00 0.00 ? 78  LYS A HZ2  11 
ATOM   9863  H HZ3  . LYS A 1 14 ? -5.428  11.174  4.887   1.00 0.00 ? 78  LYS A HZ3  11 
ATOM   9864  N N    . CYS A 1 15 ? -1.372  6.670   -0.591  1.00 0.00 ? 79  CYS A N    11 
ATOM   9865  C CA   . CYS A 1 15 ? -1.100  5.774   -1.653  1.00 0.00 ? 79  CYS A CA   11 
ATOM   9866  C C    . CYS A 1 15 ? -2.325  4.977   -1.927  1.00 0.00 ? 79  CYS A C    11 
ATOM   9867  O O    . CYS A 1 15 ? -3.315  5.068   -1.197  1.00 0.00 ? 79  CYS A O    11 
ATOM   9868  C CB   . CYS A 1 15 ? 0.052   4.845   -1.271  1.00 0.00 ? 79  CYS A CB   11 
ATOM   9869  S SG   . CYS A 1 15 ? -0.235  3.900   0.249   1.00 0.00 ? 79  CYS A SG   11 
ATOM   9870  H H    . CYS A 1 15 ? -1.931  6.378   0.163   1.00 0.00 ? 79  CYS A H    11 
ATOM   9871  H HA   . CYS A 1 15 ? -0.818  6.335   -2.531  1.00 0.00 ? 79  CYS A HA   11 
ATOM   9872  H HB2  . CYS A 1 15 ? 0.207   4.143   -2.077  1.00 0.00 ? 79  CYS A HB2  11 
ATOM   9873  H HB3  . CYS A 1 15 ? 0.952   5.428   -1.145  1.00 0.00 ? 79  CYS A HB3  11 
ATOM   9874  H HG   . CYS A 1 15 ? -1.328  4.360   0.843   1.00 0.00 ? 79  CYS A HG   11 
ATOM   9875  N N    . MET A 1 16 ? -2.300  4.248   -2.966  1.00 0.00 ? 80  MET A N    11 
ATOM   9876  C CA   . MET A 1 16 ? -3.351  3.343   -3.226  1.00 0.00 ? 80  MET A CA   11 
ATOM   9877  C C    . MET A 1 16 ? -2.767  1.993   -3.107  1.00 0.00 ? 80  MET A C    11 
ATOM   9878  O O    . MET A 1 16 ? -1.724  1.716   -3.690  1.00 0.00 ? 80  MET A O    11 
ATOM   9879  C CB   . MET A 1 16 ? -3.999  3.533   -4.598  1.00 0.00 ? 80  MET A CB   11 
ATOM   9880  C CG   . MET A 1 16 ? -4.446  4.950   -4.877  1.00 0.00 ? 80  MET A CG   11 
ATOM   9881  S SD   . MET A 1 16 ? -5.569  5.082   -6.282  1.00 0.00 ? 80  MET A SD   11 
ATOM   9882  C CE   . MET A 1 16 ? -6.973  4.158   -5.654  1.00 0.00 ? 80  MET A CE   11 
ATOM   9883  H H    . MET A 1 16 ? -1.520  4.312   -3.564  1.00 0.00 ? 80  MET A H    11 
ATOM   9884  H HA   . MET A 1 16 ? -4.090  3.468   -2.447  1.00 0.00 ? 80  MET A HA   11 
ATOM   9885  H HB2  . MET A 1 16 ? -3.303  3.224   -5.359  1.00 0.00 ? 80  MET A HB2  11 
ATOM   9886  H HB3  . MET A 1 16 ? -4.862  2.887   -4.646  1.00 0.00 ? 80  MET A HB3  11 
ATOM   9887  H HG2  . MET A 1 16 ? -4.929  5.354   -4.000  1.00 0.00 ? 80  MET A HG2  11 
ATOM   9888  H HG3  . MET A 1 16 ? -3.551  5.515   -5.098  1.00 0.00 ? 80  MET A HG3  11 
ATOM   9889  H HE1  . MET A 1 16 ? -7.261  4.567   -4.696  1.00 0.00 ? 80  MET A HE1  11 
ATOM   9890  H HE2  . MET A 1 16 ? -7.792  4.219   -6.355  1.00 0.00 ? 80  MET A HE2  11 
ATOM   9891  H HE3  . MET A 1 16 ? -6.693  3.123   -5.517  1.00 0.00 ? 80  MET A HE3  11 
ATOM   9892  N N    . ALA A 1 17 ? -3.399  1.179   -2.361  1.00 0.00 ? 81  ALA A N    11 
ATOM   9893  C CA   . ALA A 1 17 ? -2.908  -0.121  -2.098  1.00 0.00 ? 81  ALA A CA   11 
ATOM   9894  C C    . ALA A 1 17 ? -3.879  -1.102  -2.623  1.00 0.00 ? 81  ALA A C    11 
ATOM   9895  O O    . ALA A 1 17 ? -5.073  -0.807  -2.712  1.00 0.00 ? 81  ALA A O    11 
ATOM   9896  C CB   . ALA A 1 17 ? -2.740  -0.311  -0.610  1.00 0.00 ? 81  ALA A CB   11 
ATOM   9897  H H    . ALA A 1 17 ? -4.263  1.452   -1.977  1.00 0.00 ? 81  ALA A H    11 
ATOM   9898  H HA   . ALA A 1 17 ? -1.947  -0.248  -2.571  1.00 0.00 ? 81  ALA A HA   11 
ATOM   9899  H HB1  . ALA A 1 17 ? -3.687  -0.119  -0.127  1.00 0.00 ? 81  ALA A HB1  11 
ATOM   9900  H HB2  . ALA A 1 17 ? -2.430  -1.323  -0.397  1.00 0.00 ? 81  ALA A HB2  11 
ATOM   9901  H HB3  . ALA A 1 17 ? -2.007  0.388   -0.233  1.00 0.00 ? 81  ALA A HB3  11 
ATOM   9902  N N    . VAL A 1 18 ? -3.393  -2.236  -2.989  1.00 0.00 ? 82  VAL A N    11 
ATOM   9903  C CA   . VAL A 1 18 ? -4.229  -3.278  -3.474  1.00 0.00 ? 82  VAL A CA   11 
ATOM   9904  C C    . VAL A 1 18 ? -4.704  -4.055  -2.282  1.00 0.00 ? 82  VAL A C    11 
ATOM   9905  O O    . VAL A 1 18 ? -3.903  -4.664  -1.583  1.00 0.00 ? 82  VAL A O    11 
ATOM   9906  C CB   . VAL A 1 18 ? -3.459  -4.213  -4.448  1.00 0.00 ? 82  VAL A CB   11 
ATOM   9907  C CG1  . VAL A 1 18 ? -4.359  -5.323  -4.980  1.00 0.00 ? 82  VAL A CG1  11 
ATOM   9908  C CG2  . VAL A 1 18 ? -2.866  -3.414  -5.599  1.00 0.00 ? 82  VAL A CG2  11 
ATOM   9909  H H    . VAL A 1 18 ? -2.427  -2.389  -2.918  1.00 0.00 ? 82  VAL A H    11 
ATOM   9910  H HA   . VAL A 1 18 ? -5.083  -2.854  -3.979  1.00 0.00 ? 82  VAL A HA   11 
ATOM   9911  H HB   . VAL A 1 18 ? -2.647  -4.670  -3.900  1.00 0.00 ? 82  VAL A HB   11 
ATOM   9912  H HG11 . VAL A 1 18 ? -5.190  -4.887  -5.514  1.00 0.00 ? 82  VAL A HG11 11 
ATOM   9913  H HG12 . VAL A 1 18 ? -3.794  -5.955  -5.650  1.00 0.00 ? 82  VAL A HG12 11 
ATOM   9914  H HG13 . VAL A 1 18 ? -4.731  -5.913  -4.156  1.00 0.00 ? 82  VAL A HG13 11 
ATOM   9915  H HG21 . VAL A 1 18 ? -2.195  -2.664  -5.207  1.00 0.00 ? 82  VAL A HG21 11 
ATOM   9916  H HG22 . VAL A 1 18 ? -2.324  -4.075  -6.258  1.00 0.00 ? 82  VAL A HG22 11 
ATOM   9917  H HG23 . VAL A 1 18 ? -3.661  -2.930  -6.148  1.00 0.00 ? 82  VAL A HG23 11 
ATOM   9918  N N    . TRP A 1 19 ? -5.992  -3.987  -2.032  1.00 0.00 ? 83  TRP A N    11 
ATOM   9919  C CA   . TRP A 1 19 ? -6.588  -4.662  -0.923  1.00 0.00 ? 83  TRP A CA   11 
ATOM   9920  C C    . TRP A 1 19 ? -6.498  -6.117  -1.200  1.00 0.00 ? 83  TRP A C    11 
ATOM   9921  O O    . TRP A 1 19 ? -7.112  -6.596  -2.156  1.00 0.00 ? 83  TRP A O    11 
ATOM   9922  C CB   . TRP A 1 19 ? -8.055  -4.259  -0.766  1.00 0.00 ? 83  TRP A CB   11 
ATOM   9923  C CG   . TRP A 1 19 ? -8.655  -4.671  0.552   1.00 0.00 ? 83  TRP A CG   11 
ATOM   9924  C CD1  . TRP A 1 19 ? -7.995  -4.792  1.729   1.00 0.00 ? 83  TRP A CD1  11 
ATOM   9925  C CD2  . TRP A 1 19 ? -10.028 -4.966  0.841   1.00 0.00 ? 83  TRP A CD2  11 
ATOM   9926  N NE1  . TRP A 1 19 ? -8.844  -5.163  2.723   1.00 0.00 ? 83  TRP A NE1  11 
ATOM   9927  C CE2  . TRP A 1 19 ? -10.103 -5.270  2.214   1.00 0.00 ? 83  TRP A CE2  11 
ATOM   9928  C CE3  . TRP A 1 19 ? -11.199 -5.009  0.084   1.00 0.00 ? 83  TRP A CE3  11 
ATOM   9929  C CZ2  . TRP A 1 19 ? -11.294 -5.613  2.840   1.00 0.00 ? 83  TRP A CZ2  11 
ATOM   9930  C CZ3  . TRP A 1 19 ? -12.384 -5.349  0.714   1.00 0.00 ? 83  TRP A CZ3  11 
ATOM   9931  C CH2  . TRP A 1 19 ? -12.415 -5.645  2.079   1.00 0.00 ? 83  TRP A CH2  11 
ATOM   9932  H H    . TRP A 1 19 ? -6.554  -3.467  -2.649  1.00 0.00 ? 83  TRP A H    11 
ATOM   9933  H HA   . TRP A 1 19 ? -6.044  -4.411  -0.026  1.00 0.00 ? 83  TRP A HA   11 
ATOM   9934  H HB2  . TRP A 1 19 ? -8.133  -3.192  -0.877  1.00 0.00 ? 83  TRP A HB2  11 
ATOM   9935  H HB3  . TRP A 1 19 ? -8.623  -4.732  -1.553  1.00 0.00 ? 83  TRP A HB3  11 
ATOM   9936  H HD1  . TRP A 1 19 ? -6.935  -4.636  1.832   1.00 0.00 ? 83  TRP A HD1  11 
ATOM   9937  H HE1  . TRP A 1 19 ? -8.585  -5.318  3.659   1.00 0.00 ? 83  TRP A HE1  11 
ATOM   9938  H HE3  . TRP A 1 19 ? -11.184 -4.778  -0.972  1.00 0.00 ? 83  TRP A HE3  11 
ATOM   9939  H HZ2  . TRP A 1 19 ? -11.346 -5.845  3.893   1.00 0.00 ? 83  TRP A HZ2  11 
ATOM   9940  H HZ3  . TRP A 1 19 ? -13.312 -5.383  0.162   1.00 0.00 ? 83  TRP A HZ3  11 
ATOM   9941  H HH2  . TRP A 1 19 ? -13.357 -5.905  2.535   1.00 0.00 ? 83  TRP A HH2  11 
ATOM   9942  N N    . SER A 1 20 ? -5.769  -6.815  -0.385  1.00 0.00 ? 84  SER A N    11 
ATOM   9943  C CA   . SER A 1 20 ? -5.515  -8.227  -0.595  1.00 0.00 ? 84  SER A CA   11 
ATOM   9944  C C    . SER A 1 20 ? -6.818  -9.054  -0.531  1.00 0.00 ? 84  SER A C    11 
ATOM   9945  O O    . SER A 1 20 ? -6.882  -10.182 -1.021  1.00 0.00 ? 84  SER A O    11 
ATOM   9946  C CB   . SER A 1 20 ? -4.461  -8.737  0.410   1.00 0.00 ? 84  SER A CB   11 
ATOM   9947  O OG   . SER A 1 20 ? -4.037  -10.063 0.103   1.00 0.00 ? 84  SER A OG   11 
ATOM   9948  H H    . SER A 1 20 ? -5.364  -6.345  0.385   1.00 0.00 ? 84  SER A H    11 
ATOM   9949  H HA   . SER A 1 20 ? -5.114  -8.325  -1.593  1.00 0.00 ? 84  SER A HA   11 
ATOM   9950  H HB2  . SER A 1 20 ? -3.599  -8.085  0.387   1.00 0.00 ? 84  SER A HB2  11 
ATOM   9951  H HB3  . SER A 1 20 ? -4.888  -8.730  1.402   1.00 0.00 ? 84  SER A HB3  11 
ATOM   9952  H HG   . SER A 1 20 ? -4.105  -10.565 0.927   1.00 0.00 ? 84  SER A HG   11 
ATOM   9953  N N    . GLU A 1 21 ? -7.863  -8.472  0.030   1.00 0.00 ? 85  GLU A N    11 
ATOM   9954  C CA   . GLU A 1 21 ? -9.129  -9.161  0.141   1.00 0.00 ? 85  GLU A CA   11 
ATOM   9955  C C    . GLU A 1 21 ? -9.912  -9.108  -1.172  1.00 0.00 ? 85  GLU A C    11 
ATOM   9956  O O    . GLU A 1 21 ? -10.537 -10.092 -1.564  1.00 0.00 ? 85  GLU A O    11 
ATOM   9957  C CB   . GLU A 1 21 ? -9.970  -8.544  1.230   1.00 0.00 ? 85  GLU A CB   11 
ATOM   9958  C CG   . GLU A 1 21 ? -9.335  -8.535  2.605   1.00 0.00 ? 85  GLU A CG   11 
ATOM   9959  C CD   . GLU A 1 21 ? -9.124  -9.907  3.187   1.00 0.00 ? 85  GLU A CD   11 
ATOM   9960  O OE1  . GLU A 1 21 ? -10.077 -10.463 3.774   1.00 0.00 ? 85  GLU A OE1  11 
ATOM   9961  O OE2  . GLU A 1 21 ? -8.005  -10.455 3.097   1.00 0.00 ? 85  GLU A OE2  11 
ATOM   9962  H H    . GLU A 1 21 ? -7.759  -7.557  0.373   1.00 0.00 ? 85  GLU A H    11 
ATOM   9963  H HA   . GLU A 1 21 ? -8.933  -10.191 0.400   1.00 0.00 ? 85  GLU A HA   11 
ATOM   9964  H HB2  . GLU A 1 21 ? -10.173 -7.520  0.955   1.00 0.00 ? 85  GLU A HB2  11 
ATOM   9965  H HB3  . GLU A 1 21 ? -10.906 -9.078  1.282   1.00 0.00 ? 85  GLU A HB3  11 
ATOM   9966  H HG2  . GLU A 1 21 ? -8.403  -8.001  2.521   1.00 0.00 ? 85  GLU A HG2  11 
ATOM   9967  H HG3  . GLU A 1 21 ? -9.964  -7.947  3.255   1.00 0.00 ? 85  GLU A HG3  11 
ATOM   9968  N N    . ASP A 1 22 ? -9.877  -7.967  -1.850  1.00 0.00 ? 86  ASP A N    11 
ATOM   9969  C CA   . ASP A 1 22 ? -10.708 -7.797  -3.057  1.00 0.00 ? 86  ASP A CA   11 
ATOM   9970  C C    . ASP A 1 22 ? -9.869  -7.798  -4.332  1.00 0.00 ? 86  ASP A C    11 
ATOM   9971  O O    . ASP A 1 22 ? -10.374 -8.036  -5.425  1.00 0.00 ? 86  ASP A O    11 
ATOM   9972  C CB   . ASP A 1 22 ? -11.520 -6.504  -2.949  1.00 0.00 ? 86  ASP A CB   11 
ATOM   9973  C CG   . ASP A 1 22 ? -12.588 -6.361  -4.012  1.00 0.00 ? 86  ASP A CG   11 
ATOM   9974  O OD1  . ASP A 1 22 ? -13.680 -6.953  -3.856  1.00 0.00 ? 86  ASP A OD1  11 
ATOM   9975  O OD2  . ASP A 1 22 ? -12.377 -5.629  -4.988  1.00 0.00 ? 86  ASP A OD2  11 
ATOM   9976  H H    . ASP A 1 22 ? -9.296  -7.243  -1.535  1.00 0.00 ? 86  ASP A H    11 
ATOM   9977  H HA   . ASP A 1 22 ? -11.392 -8.630  -3.095  1.00 0.00 ? 86  ASP A HA   11 
ATOM   9978  H HB2  . ASP A 1 22 ? -12.005 -6.470  -1.986  1.00 0.00 ? 86  ASP A HB2  11 
ATOM   9979  H HB3  . ASP A 1 22 ? -10.841 -5.668  -3.040  1.00 0.00 ? 86  ASP A HB3  11 
ATOM   9980  N N    . GLY A 1 23 ? -8.590  -7.553  -4.181  1.00 0.00 ? 87  GLY A N    11 
ATOM   9981  C CA   . GLY A 1 23 ? -7.679  -7.551  -5.314  1.00 0.00 ? 87  GLY A CA   11 
ATOM   9982  C C    . GLY A 1 23 ? -7.680  -6.241  -6.080  1.00 0.00 ? 87  GLY A C    11 
ATOM   9983  O O    . GLY A 1 23 ? -7.129  -6.158  -7.174  1.00 0.00 ? 87  GLY A O    11 
ATOM   9984  H H    . GLY A 1 23 ? -8.230  -7.381  -3.281  1.00 0.00 ? 87  GLY A H    11 
ATOM   9985  H HA2  . GLY A 1 23 ? -6.678  -7.728  -4.951  1.00 0.00 ? 87  GLY A HA2  11 
ATOM   9986  H HA3  . GLY A 1 23 ? -7.955  -8.349  -5.987  1.00 0.00 ? 87  GLY A HA3  11 
ATOM   9987  N N    . GLN A 1 24 ? -8.302  -5.227  -5.523  1.00 0.00 ? 88  GLN A N    11 
ATOM   9988  C CA   . GLN A 1 24 ? -8.375  -3.920  -6.172  1.00 0.00 ? 88  GLN A CA   11 
ATOM   9989  C C    . GLN A 1 24 ? -7.631  -2.873  -5.380  1.00 0.00 ? 88  GLN A C    11 
ATOM   9990  O O    . GLN A 1 24 ? -7.275  -3.113  -4.235  1.00 0.00 ? 88  GLN A O    11 
ATOM   9991  C CB   . GLN A 1 24 ? -9.815  -3.501  -6.415  1.00 0.00 ? 88  GLN A CB   11 
ATOM   9992  C CG   . GLN A 1 24 ? -10.533 -4.318  -7.467  1.00 0.00 ? 88  GLN A CG   11 
ATOM   9993  C CD   . GLN A 1 24 ? -9.923  -4.193  -8.859  1.00 0.00 ? 88  GLN A CD   11 
ATOM   9994  O OE1  . GLN A 1 24 ? -10.297 -3.316  -9.645  1.00 0.00 ? 88  GLN A OE1  11 
ATOM   9995  N NE2  . GLN A 1 24 ? -9.001  -5.048  -9.181  1.00 0.00 ? 88  GLN A NE2  11 
ATOM   9996  H H    . GLN A 1 24 ? -8.691  -5.346  -4.632  1.00 0.00 ? 88  GLN A H    11 
ATOM   9997  H HA   . GLN A 1 24 ? -7.879  -4.020  -7.125  1.00 0.00 ? 88  GLN A HA   11 
ATOM   9998  H HB2  . GLN A 1 24 ? -10.360 -3.603  -5.488  1.00 0.00 ? 88  GLN A HB2  11 
ATOM   9999  H HB3  . GLN A 1 24 ? -9.830  -2.464  -6.711  1.00 0.00 ? 88  GLN A HB3  11 
ATOM   10000 H HG2  . GLN A 1 24 ? -10.502 -5.356  -7.172  1.00 0.00 ? 88  GLN A HG2  11 
ATOM   10001 H HG3  . GLN A 1 24 ? -11.556 -3.976  -7.500  1.00 0.00 ? 88  GLN A HG3  11 
ATOM   10002 H HE21 . GLN A 1 24 ? -8.735  -5.725  -8.519  1.00 0.00 ? 88  GLN A HE21 11 
ATOM   10003 H HE22 . GLN A 1 24 ? -8.607  -5.029  -10.080 1.00 0.00 ? 88  GLN A HE22 11 
ATOM   10004 N N    . CYS A 1 25 ? -7.439  -1.713  -5.962  1.00 0.00 ? 89  CYS A N    11 
ATOM   10005 C CA   . CYS A 1 25 ? -6.681  -0.664  -5.312  1.00 0.00 ? 89  CYS A CA   11 
ATOM   10006 C C    . CYS A 1 25 ? -7.591  0.369   -4.665  1.00 0.00 ? 89  CYS A C    11 
ATOM   10007 O O    . CYS A 1 25 ? -8.568  0.817   -5.265  1.00 0.00 ? 89  CYS A O    11 
ATOM   10008 C CB   . CYS A 1 25 ? -5.697  -0.012  -6.287  1.00 0.00 ? 89  CYS A CB   11 
ATOM   10009 S SG   . CYS A 1 25 ? -6.442  0.629   -7.808  1.00 0.00 ? 89  CYS A SG   11 
ATOM   10010 H H    . CYS A 1 25 ? -7.849  -1.541  -6.837  1.00 0.00 ? 89  CYS A H    11 
ATOM   10011 H HA   . CYS A 1 25 ? -6.115  -1.133  -4.521  1.00 0.00 ? 89  CYS A HA   11 
ATOM   10012 H HB2  . CYS A 1 25 ? -5.222  0.817   -5.786  1.00 0.00 ? 89  CYS A HB2  11 
ATOM   10013 H HB3  . CYS A 1 25 ? -4.945  -0.737  -6.563  1.00 0.00 ? 89  CYS A HB3  11 
ATOM   10014 H HG   . CYS A 1 25 ? -7.696  0.974   -7.531  1.00 0.00 ? 89  CYS A HG   11 
ATOM   10015 N N    . TYR A 1 26 ? -7.262  0.726   -3.442  1.00 0.00 ? 90  TYR A N    11 
ATOM   10016 C CA   . TYR A 1 26 ? -8.026  1.663   -2.628  1.00 0.00 ? 90  TYR A CA   11 
ATOM   10017 C C    . TYR A 1 26 ? -7.067  2.625   -1.951  1.00 0.00 ? 90  TYR A C    11 
ATOM   10018 O O    . TYR A 1 26 ? -5.885  2.305   -1.804  1.00 0.00 ? 90  TYR A O    11 
ATOM   10019 C CB   . TYR A 1 26 ? -8.823  0.905   -1.563  1.00 0.00 ? 90  TYR A CB   11 
ATOM   10020 C CG   . TYR A 1 26 ? -9.885  -0.035  -2.108  1.00 0.00 ? 90  TYR A CG   11 
ATOM   10021 C CD1  . TYR A 1 26 ? -9.540  -1.290  -2.598  1.00 0.00 ? 90  TYR A CD1  11 
ATOM   10022 C CD2  . TYR A 1 26 ? -11.223 0.326   -2.122  1.00 0.00 ? 90  TYR A CD2  11 
ATOM   10023 C CE1  . TYR A 1 26 ? -10.486 -2.150  -3.092  1.00 0.00 ? 90  TYR A CE1  11 
ATOM   10024 C CE2  . TYR A 1 26 ? -12.182 -0.534  -2.615  1.00 0.00 ? 90  TYR A CE2  11 
ATOM   10025 C CZ   . TYR A 1 26 ? -11.805 -1.771  -3.101  1.00 0.00 ? 90  TYR A CZ   11 
ATOM   10026 O OH   . TYR A 1 26 ? -12.751 -2.627  -3.603  1.00 0.00 ? 90  TYR A OH   11 
ATOM   10027 H H    . TYR A 1 26 ? -6.450  0.333   -3.043  1.00 0.00 ? 90  TYR A H    11 
ATOM   10028 H HA   . TYR A 1 26 ? -8.704  2.207   -3.270  1.00 0.00 ? 90  TYR A HA   11 
ATOM   10029 H HB2  . TYR A 1 26 ? -8.125  0.302   -1.001  1.00 0.00 ? 90  TYR A HB2  11 
ATOM   10030 H HB3  . TYR A 1 26 ? -9.293  1.604   -0.888  1.00 0.00 ? 90  TYR A HB3  11 
ATOM   10031 H HD1  . TYR A 1 26 ? -8.502  -1.587  -2.588  1.00 0.00 ? 90  TYR A HD1  11 
ATOM   10032 H HD2  . TYR A 1 26 ? -11.509 1.297   -1.746  1.00 0.00 ? 90  TYR A HD2  11 
ATOM   10033 H HE1  . TYR A 1 26 ? -10.179 -3.113  -3.471  1.00 0.00 ? 90  TYR A HE1  11 
ATOM   10034 H HE2  . TYR A 1 26 ? -13.223 -0.243  -2.605  1.00 0.00 ? 90  TYR A HE2  11 
ATOM   10035 H HH   . TYR A 1 26 ? -12.559 -3.517  -3.283  1.00 0.00 ? 90  TYR A HH   11 
ATOM   10036 N N    . GLU A 1 27 ? -7.556  3.784   -1.550  1.00 0.00 ? 91  GLU A N    11 
ATOM   10037 C CA   . GLU A 1 27 ? -6.717  4.798   -0.921  1.00 0.00 ? 91  GLU A CA   11 
ATOM   10038 C C    . GLU A 1 27 ? -6.358  4.399   0.508   1.00 0.00 ? 91  GLU A C    11 
ATOM   10039 O O    . GLU A 1 27 ? -7.230  4.087   1.341   1.00 0.00 ? 91  GLU A O    11 
ATOM   10040 C CB   . GLU A 1 27 ? -7.395  6.174   -0.955  1.00 0.00 ? 91  GLU A CB   11 
ATOM   10041 C CG   . GLU A 1 27 ? -6.603  7.289   -0.271  1.00 0.00 ? 91  GLU A CG   11 
ATOM   10042 C CD   . GLU A 1 27 ? -7.285  8.628   -0.363  1.00 0.00 ? 91  GLU A CD   11 
ATOM   10043 O OE1  . GLU A 1 27 ? -8.120  8.939   0.507   1.00 0.00 ? 91  GLU A OE1  11 
ATOM   10044 O OE2  . GLU A 1 27 ? -7.005  9.392   -1.319  1.00 0.00 ? 91  GLU A OE2  11 
ATOM   10045 H H    . GLU A 1 27 ? -8.514  3.962   -1.658  1.00 0.00 ? 91  GLU A H    11 
ATOM   10046 H HA   . GLU A 1 27 ? -5.801  4.847   -1.491  1.00 0.00 ? 91  GLU A HA   11 
ATOM   10047 H HB2  . GLU A 1 27 ? -7.550  6.456   -1.986  1.00 0.00 ? 91  GLU A HB2  11 
ATOM   10048 H HB3  . GLU A 1 27 ? -8.355  6.094   -0.470  1.00 0.00 ? 91  GLU A HB3  11 
ATOM   10049 H HG2  . GLU A 1 27 ? -6.497  7.036   0.773   1.00 0.00 ? 91  GLU A HG2  11 
ATOM   10050 H HG3  . GLU A 1 27 ? -5.621  7.361   -0.713  1.00 0.00 ? 91  GLU A HG3  11 
ATOM   10051 N N    . ALA A 1 28 ? -5.089  4.420   0.780   1.00 0.00 ? 92  ALA A N    11 
ATOM   10052 C CA   . ALA A 1 28 ? -4.551  4.029   2.048   1.00 0.00 ? 92  ALA A CA   11 
ATOM   10053 C C    . ALA A 1 28 ? -3.398  4.927   2.408   1.00 0.00 ? 92  ALA A C    11 
ATOM   10054 O O    . ALA A 1 28 ? -2.701  5.435   1.531   1.00 0.00 ? 92  ALA A O    11 
ATOM   10055 C CB   . ALA A 1 28 ? -4.085  2.596   1.980   1.00 0.00 ? 92  ALA A CB   11 
ATOM   10056 H H    . ALA A 1 28 ? -4.467  4.736   0.081   1.00 0.00 ? 92  ALA A H    11 
ATOM   10057 H HA   . ALA A 1 28 ? -5.309  4.107   2.814   1.00 0.00 ? 92  ALA A HA   11 
ATOM   10058 H HB1  . ALA A 1 28 ? -3.298  2.511   1.245   1.00 0.00 ? 92  ALA A HB1  11 
ATOM   10059 H HB2  . ALA A 1 28 ? -3.713  2.298   2.948   1.00 0.00 ? 92  ALA A HB2  11 
ATOM   10060 H HB3  . ALA A 1 28 ? -4.911  1.959   1.698   1.00 0.00 ? 92  ALA A HB3  11 
ATOM   10061 N N    . GLU A 1 29 ? -3.197  5.131   3.665   1.00 0.00 ? 93  GLU A N    11 
ATOM   10062 C CA   . GLU A 1 29 ? -2.126  5.960   4.120   1.00 0.00 ? 93  GLU A CA   11 
ATOM   10063 C C    . GLU A 1 29 ? -1.045  5.096   4.724   1.00 0.00 ? 93  GLU A C    11 
ATOM   10064 O O    . GLU A 1 29 ? -1.335  4.142   5.454   1.00 0.00 ? 93  GLU A O    11 
ATOM   10065 C CB   . GLU A 1 29 ? -2.637  6.989   5.117   1.00 0.00 ? 93  GLU A CB   11 
ATOM   10066 C CG   . GLU A 1 29 ? -1.583  7.975   5.591   1.00 0.00 ? 93  GLU A CG   11 
ATOM   10067 C CD   . GLU A 1 29 ? -2.175  9.058   6.440   1.00 0.00 ? 93  GLU A CD   11 
ATOM   10068 O OE1  . GLU A 1 29 ? -2.730  10.013  5.880   1.00 0.00 ? 93  GLU A OE1  11 
ATOM   10069 O OE2  . GLU A 1 29 ? -2.105  8.978   7.670   1.00 0.00 ? 93  GLU A OE2  11 
ATOM   10070 H H    . GLU A 1 29 ? -3.778  4.689   4.326   1.00 0.00 ? 93  GLU A H    11 
ATOM   10071 H HA   . GLU A 1 29 ? -1.720  6.472   3.261   1.00 0.00 ? 93  GLU A HA   11 
ATOM   10072 H HB2  . GLU A 1 29 ? -3.439  7.547   4.657   1.00 0.00 ? 93  GLU A HB2  11 
ATOM   10073 H HB3  . GLU A 1 29 ? -3.030  6.468   5.978   1.00 0.00 ? 93  GLU A HB3  11 
ATOM   10074 H HG2  . GLU A 1 29 ? -0.851  7.434   6.172   1.00 0.00 ? 93  GLU A HG2  11 
ATOM   10075 H HG3  . GLU A 1 29 ? -1.091  8.415   4.735   1.00 0.00 ? 93  GLU A HG3  11 
ATOM   10076 N N    . ILE A 1 30 ? 0.175   5.391   4.372   1.00 0.00 ? 94  ILE A N    11 
ATOM   10077 C CA   . ILE A 1 30 ? 1.322   4.662   4.867   1.00 0.00 ? 94  ILE A CA   11 
ATOM   10078 C C    . ILE A 1 30 ? 1.633   5.044   6.299   1.00 0.00 ? 94  ILE A C    11 
ATOM   10079 O O    . ILE A 1 30 ? 1.902   6.218   6.616   1.00 0.00 ? 94  ILE A O    11 
ATOM   10080 C CB   . ILE A 1 30 ? 2.553   4.898   3.993   1.00 0.00 ? 94  ILE A CB   11 
ATOM   10081 C CG1  . ILE A 1 30 ? 2.210   4.532   2.560   1.00 0.00 ? 94  ILE A CG1  11 
ATOM   10082 C CG2  . ILE A 1 30 ? 3.723   4.052   4.502   1.00 0.00 ? 94  ILE A CG2  11 
ATOM   10083 C CD1  . ILE A 1 30 ? 3.248   4.908   1.558   1.00 0.00 ? 94  ILE A CD1  11 
ATOM   10084 H H    . ILE A 1 30 ? 0.301   6.127   3.730   1.00 0.00 ? 94  ILE A H    11 
ATOM   10085 H HA   . ILE A 1 30 ? 1.080   3.610   4.840   1.00 0.00 ? 94  ILE A HA   11 
ATOM   10086 H HB   . ILE A 1 30 ? 2.825   5.943   4.035   1.00 0.00 ? 94  ILE A HB   11 
ATOM   10087 H HG12 . ILE A 1 30 ? 2.093   3.461   2.500   1.00 0.00 ? 94  ILE A HG12 11 
ATOM   10088 H HG13 . ILE A 1 30 ? 1.279   5.008   2.296   1.00 0.00 ? 94  ILE A HG13 11 
ATOM   10089 H HG21 . ILE A 1 30 ? 3.436   3.010   4.503   1.00 0.00 ? 94  ILE A HG21 11 
ATOM   10090 H HG22 . ILE A 1 30 ? 4.581   4.191   3.863   1.00 0.00 ? 94  ILE A HG22 11 
ATOM   10091 H HG23 . ILE A 1 30 ? 3.966   4.346   5.512   1.00 0.00 ? 94  ILE A HG23 11 
ATOM   10092 H HD11 . ILE A 1 30 ? 4.152   4.360   1.778   1.00 0.00 ? 94  ILE A HD11 11 
ATOM   10093 H HD12 . ILE A 1 30 ? 2.896   4.650   0.569   1.00 0.00 ? 94  ILE A HD12 11 
ATOM   10094 H HD13 . ILE A 1 30 ? 3.435   5.969   1.611   1.00 0.00 ? 94  ILE A HD13 11 
ATOM   10095 N N    . GLU A 1 31 ? 1.603   4.060   7.134   1.00 0.00 ? 95  GLU A N    11 
ATOM   10096 C CA   . GLU A 1 31 ? 1.825   4.206   8.545   1.00 0.00 ? 95  GLU A CA   11 
ATOM   10097 C C    . GLU A 1 31 ? 3.255   3.881   8.921   1.00 0.00 ? 95  GLU A C    11 
ATOM   10098 O O    . GLU A 1 31 ? 3.845   4.541   9.760   1.00 0.00 ? 95  GLU A O    11 
ATOM   10099 C CB   . GLU A 1 31 ? 0.875   3.291   9.267   1.00 0.00 ? 95  GLU A CB   11 
ATOM   10100 C CG   . GLU A 1 31 ? -0.570  3.709   9.141   1.00 0.00 ? 95  GLU A CG   11 
ATOM   10101 C CD   . GLU A 1 31 ? -0.894  4.894   10.006  1.00 0.00 ? 95  GLU A CD   11 
ATOM   10102 O OE1  . GLU A 1 31 ? -1.147  4.697   11.218  1.00 0.00 ? 95  GLU A OE1  11 
ATOM   10103 O OE2  . GLU A 1 31 ? -0.894  6.040   9.517   1.00 0.00 ? 95  GLU A OE2  11 
ATOM   10104 H H    . GLU A 1 31 ? 1.411   3.162   6.776   1.00 0.00 ? 95  GLU A H    11 
ATOM   10105 H HA   . GLU A 1 31 ? 1.598   5.221   8.831   1.00 0.00 ? 95  GLU A HA   11 
ATOM   10106 H HB2  . GLU A 1 31 ? 0.983   2.297   8.860   1.00 0.00 ? 95  GLU A HB2  11 
ATOM   10107 H HB3  . GLU A 1 31 ? 1.134   3.270   10.315  1.00 0.00 ? 95  GLU A HB3  11 
ATOM   10108 H HG2  . GLU A 1 31 ? -0.759  3.971   8.110   1.00 0.00 ? 95  GLU A HG2  11 
ATOM   10109 H HG3  . GLU A 1 31 ? -1.200  2.878   9.419   1.00 0.00 ? 95  GLU A HG3  11 
ATOM   10110 N N    . GLU A 1 32 ? 3.812   2.881   8.298   1.00 0.00 ? 96  GLU A N    11 
ATOM   10111 C CA   . GLU A 1 32 ? 5.166   2.457   8.602   1.00 0.00 ? 96  GLU A CA   11 
ATOM   10112 C C    . GLU A 1 32 ? 5.742   1.772   7.383   1.00 0.00 ? 96  GLU A C    11 
ATOM   10113 O O    . GLU A 1 32 ? 5.007   1.157   6.622   1.00 0.00 ? 96  GLU A O    11 
ATOM   10114 C CB   . GLU A 1 32 ? 5.162   1.506   9.818   1.00 0.00 ? 96  GLU A CB   11 
ATOM   10115 C CG   . GLU A 1 32 ? 6.537   1.051   10.271  1.00 0.00 ? 96  GLU A CG   11 
ATOM   10116 C CD   . GLU A 1 32 ? 6.485   0.109   11.439  1.00 0.00 ? 96  GLU A CD   11 
ATOM   10117 O OE1  . GLU A 1 32 ? 6.367   -1.112  11.223  1.00 0.00 ? 96  GLU A OE1  11 
ATOM   10118 O OE2  . GLU A 1 32 ? 6.596   0.564   12.605  1.00 0.00 ? 96  GLU A OE2  11 
ATOM   10119 H H    . GLU A 1 32 ? 3.314   2.403   7.600   1.00 0.00 ? 96  GLU A H    11 
ATOM   10120 H HA   . GLU A 1 32 ? 5.764   3.329   8.823   1.00 0.00 ? 96  GLU A HA   11 
ATOM   10121 H HB2  . GLU A 1 32 ? 4.688   2.011   10.647  1.00 0.00 ? 96  GLU A HB2  11 
ATOM   10122 H HB3  . GLU A 1 32 ? 4.580   0.630   9.571   1.00 0.00 ? 96  GLU A HB3  11 
ATOM   10123 H HG2  . GLU A 1 32 ? 7.014   0.545   9.444   1.00 0.00 ? 96  GLU A HG2  11 
ATOM   10124 H HG3  . GLU A 1 32 ? 7.118   1.919   10.545  1.00 0.00 ? 96  GLU A HG3  11 
ATOM   10125 N N    . ILE A 1 33 ? 7.022   1.900   7.178   1.00 0.00 ? 97  ILE A N    11 
ATOM   10126 C CA   . ILE A 1 33 ? 7.670   1.304   6.035   1.00 0.00 ? 97  ILE A CA   11 
ATOM   10127 C C    . ILE A 1 33 ? 8.749   0.357   6.500   1.00 0.00 ? 97  ILE A C    11 
ATOM   10128 O O    . ILE A 1 33 ? 9.623   0.726   7.279   1.00 0.00 ? 97  ILE A O    11 
ATOM   10129 C CB   . ILE A 1 33 ? 8.299   2.389   5.132   1.00 0.00 ? 97  ILE A CB   11 
ATOM   10130 C CG1  . ILE A 1 33 ? 7.227   3.335   4.631   1.00 0.00 ? 97  ILE A CG1  11 
ATOM   10131 C CG2  . ILE A 1 33 ? 9.024   1.761   3.936   1.00 0.00 ? 97  ILE A CG2  11 
ATOM   10132 C CD1  . ILE A 1 33 ? 7.737   4.691   4.353   1.00 0.00 ? 97  ILE A CD1  11 
ATOM   10133 H H    . ILE A 1 33 ? 7.575   2.405   7.815   1.00 0.00 ? 97  ILE A H    11 
ATOM   10134 H HA   . ILE A 1 33 ? 6.932   0.762   5.463   1.00 0.00 ? 97  ILE A HA   11 
ATOM   10135 H HB   . ILE A 1 33 ? 9.012   2.947   5.718   1.00 0.00 ? 97  ILE A HB   11 
ATOM   10136 H HG12 . ILE A 1 33 ? 6.862   2.976   3.678   1.00 0.00 ? 97  ILE A HG12 11 
ATOM   10137 H HG13 . ILE A 1 33 ? 6.422   3.409   5.347   1.00 0.00 ? 97  ILE A HG13 11 
ATOM   10138 H HG21 . ILE A 1 33 ? 8.321   1.191   3.347   1.00 0.00 ? 97  ILE A HG21 11 
ATOM   10139 H HG22 . ILE A 1 33 ? 9.450   2.547   3.329   1.00 0.00 ? 97  ILE A HG22 11 
ATOM   10140 H HG23 . ILE A 1 33 ? 9.809   1.111   4.293   1.00 0.00 ? 97  ILE A HG23 11 
ATOM   10141 H HD11 . ILE A 1 33 ? 8.525   4.648   3.617   1.00 0.00 ? 97  ILE A HD11 11 
ATOM   10142 H HD12 . ILE A 1 33 ? 6.924   5.303   3.988   1.00 0.00 ? 97  ILE A HD12 11 
ATOM   10143 H HD13 . ILE A 1 33 ? 8.105   5.102   5.282   1.00 0.00 ? 97  ILE A HD13 11 
ATOM   10144 N N    . ASP A 1 34 ? 8.665   -0.843  6.049   1.00 0.00 ? 98  ASP A N    11 
ATOM   10145 C CA   . ASP A 1 34 ? 9.657   -1.852  6.308   1.00 0.00 ? 98  ASP A CA   11 
ATOM   10146 C C    . ASP A 1 34 ? 10.538  -1.897  5.091   1.00 0.00 ? 98  ASP A C    11 
ATOM   10147 O O    . ASP A 1 34 ? 10.223  -2.558  4.093   1.00 0.00 ? 98  ASP A O    11 
ATOM   10148 C CB   . ASP A 1 34 ? 9.012   -3.216  6.521   1.00 0.00 ? 98  ASP A CB   11 
ATOM   10149 C CG   . ASP A 1 34 ? 10.019  -4.291  6.859   1.00 0.00 ? 98  ASP A CG   11 
ATOM   10150 O OD1  . ASP A 1 34 ? 10.800  -4.688  5.979   1.00 0.00 ? 98  ASP A OD1  11 
ATOM   10151 O OD2  . ASP A 1 34 ? 10.030  -4.765  8.012   1.00 0.00 ? 98  ASP A OD2  11 
ATOM   10152 H H    . ASP A 1 34 ? 7.915   -1.074  5.456   1.00 0.00 ? 98  ASP A H    11 
ATOM   10153 H HA   . ASP A 1 34 ? 10.264  -1.584  7.161   1.00 0.00 ? 98  ASP A HA   11 
ATOM   10154 H HB2  . ASP A 1 34 ? 8.270   -3.153  7.303   1.00 0.00 ? 98  ASP A HB2  11 
ATOM   10155 H HB3  . ASP A 1 34 ? 8.518   -3.495  5.604   1.00 0.00 ? 98  ASP A HB3  11 
ATOM   10156 N N    . GLU A 1 35 ? 11.573  -1.125  5.135   1.00 0.00 ? 99  GLU A N    11 
ATOM   10157 C CA   . GLU A 1 35 ? 12.495  -0.979  4.034   1.00 0.00 ? 99  GLU A CA   11 
ATOM   10158 C C    . GLU A 1 35 ? 13.286  -2.254  3.734   1.00 0.00 ? 99  GLU A C    11 
ATOM   10159 O O    . GLU A 1 35 ? 13.840  -2.401  2.642   1.00 0.00 ? 99  GLU A O    11 
ATOM   10160 C CB   . GLU A 1 35 ? 13.416  0.194   4.282   1.00 0.00 ? 99  GLU A CB   11 
ATOM   10161 C CG   . GLU A 1 35 ? 12.678  1.511   4.452   1.00 0.00 ? 99  GLU A CG   11 
ATOM   10162 C CD   . GLU A 1 35 ? 13.601  2.676   4.650   1.00 0.00 ? 99  GLU A CD   11 
ATOM   10163 O OE1  . GLU A 1 35 ? 14.103  3.220   3.652   1.00 0.00 ? 99  GLU A OE1  11 
ATOM   10164 O OE2  . GLU A 1 35 ? 13.849  3.076   5.800   1.00 0.00 ? 99  GLU A OE2  11 
ATOM   10165 H H    . GLU A 1 35 ? 11.744  -0.624  5.961   1.00 0.00 ? 99  GLU A H    11 
ATOM   10166 H HA   . GLU A 1 35 ? 11.900  -0.751  3.161   1.00 0.00 ? 99  GLU A HA   11 
ATOM   10167 H HB2  . GLU A 1 35 ? 13.980  -0.010  5.180   1.00 0.00 ? 99  GLU A HB2  11 
ATOM   10168 H HB3  . GLU A 1 35 ? 14.091  0.278   3.444   1.00 0.00 ? 99  GLU A HB3  11 
ATOM   10169 H HG2  . GLU A 1 35 ? 12.085  1.695   3.568   1.00 0.00 ? 99  GLU A HG2  11 
ATOM   10170 H HG3  . GLU A 1 35 ? 12.024  1.433   5.308   1.00 0.00 ? 99  GLU A HG3  11 
ATOM   10171 N N    . GLU A 1 36 ? 13.325  -3.162  4.693   1.00 0.00 ? 100 GLU A N    11 
ATOM   10172 C CA   . GLU A 1 36 ? 14.095  -4.382  4.567   1.00 0.00 ? 100 GLU A CA   11 
ATOM   10173 C C    . GLU A 1 36 ? 13.424  -5.312  3.550   1.00 0.00 ? 100 GLU A C    11 
ATOM   10174 O O    . GLU A 1 36 ? 14.082  -5.911  2.691   1.00 0.00 ? 100 GLU A O    11 
ATOM   10175 C CB   . GLU A 1 36 ? 14.164  -5.077  5.930   1.00 0.00 ? 100 GLU A CB   11 
ATOM   10176 C CG   . GLU A 1 36 ? 15.283  -6.096  6.054   1.00 0.00 ? 100 GLU A CG   11 
ATOM   10177 C CD   . GLU A 1 36 ? 16.647  -5.446  5.996   1.00 0.00 ? 100 GLU A CD   11 
ATOM   10178 O OE1  . GLU A 1 36 ? 17.177  -5.051  7.054   1.00 0.00 ? 100 GLU A OE1  11 
ATOM   10179 O OE2  . GLU A 1 36 ? 17.224  -5.309  4.893   1.00 0.00 ? 100 GLU A OE2  11 
ATOM   10180 H H    . GLU A 1 36 ? 12.819  -3.001  5.517   1.00 0.00 ? 100 GLU A H    11 
ATOM   10181 H HA   . GLU A 1 36 ? 15.096  -4.137  4.243   1.00 0.00 ? 100 GLU A HA   11 
ATOM   10182 H HB2  . GLU A 1 36 ? 14.267  -4.331  6.703   1.00 0.00 ? 100 GLU A HB2  11 
ATOM   10183 H HB3  . GLU A 1 36 ? 13.226  -5.589  6.083   1.00 0.00 ? 100 GLU A HB3  11 
ATOM   10184 H HG2  . GLU A 1 36 ? 15.186  -6.614  6.997   1.00 0.00 ? 100 GLU A HG2  11 
ATOM   10185 H HG3  . GLU A 1 36 ? 15.203  -6.803  5.242   1.00 0.00 ? 100 GLU A HG3  11 
ATOM   10186 N N    . ASN A 1 37 ? 12.113  -5.398  3.641   1.00 0.00 ? 101 ASN A N    11 
ATOM   10187 C CA   . ASN A 1 37 ? 11.316  -6.229  2.740   1.00 0.00 ? 101 ASN A CA   11 
ATOM   10188 C C    . ASN A 1 37 ? 10.771  -5.404  1.610   1.00 0.00 ? 101 ASN A C    11 
ATOM   10189 O O    . ASN A 1 37 ? 10.240  -5.948  0.630   1.00 0.00 ? 101 ASN A O    11 
ATOM   10190 C CB   . ASN A 1 37 ? 10.130  -6.857  3.475   1.00 0.00 ? 101 ASN A CB   11 
ATOM   10191 C CG   . ASN A 1 37 ? 10.509  -7.824  4.570   1.00 0.00 ? 101 ASN A CG   11 
ATOM   10192 O OD1  . ASN A 1 37 ? 10.607  -9.038  4.357   1.00 0.00 ? 101 ASN A OD1  11 
ATOM   10193 N ND2  . ASN A 1 37 ? 10.720  -7.314  5.733   1.00 0.00 ? 101 ASN A ND2  11 
ATOM   10194 H H    . ASN A 1 37 ? 11.663  -4.914  4.375   1.00 0.00 ? 101 ASN A H    11 
ATOM   10195 H HA   . ASN A 1 37 ? 11.932  -7.022  2.346   1.00 0.00 ? 101 ASN A HA   11 
ATOM   10196 H HB2  . ASN A 1 37 ? 9.524   -6.076  3.912   1.00 0.00 ? 101 ASN A HB2  11 
ATOM   10197 H HB3  . ASN A 1 37 ? 9.543   -7.388  2.744   1.00 0.00 ? 101 ASN A HB3  11 
ATOM   10198 H HD21 . ASN A 1 37 ? 10.622  -6.329  5.816   1.00 0.00 ? 101 ASN A HD21 11 
ATOM   10199 H HD22 . ASN A 1 37 ? 10.973  -7.890  6.485   1.00 0.00 ? 101 ASN A HD22 11 
ATOM   10200 N N    . GLY A 1 38 ? 10.873  -4.090  1.750   1.00 0.00 ? 102 GLY A N    11 
ATOM   10201 C CA   . GLY A 1 38 ? 10.315  -3.198  0.768   1.00 0.00 ? 102 GLY A CA   11 
ATOM   10202 C C    . GLY A 1 38 ? 8.806   -3.145  0.896   1.00 0.00 ? 102 GLY A C    11 
ATOM   10203 O O    . GLY A 1 38 ? 8.088   -2.899  -0.072  1.00 0.00 ? 102 GLY A O    11 
ATOM   10204 H H    . GLY A 1 38 ? 11.336  -3.720  2.534   1.00 0.00 ? 102 GLY A H    11 
ATOM   10205 H HA2  . GLY A 1 38 ? 10.727  -2.210  0.912   1.00 0.00 ? 102 GLY A HA2  11 
ATOM   10206 H HA3  . GLY A 1 38 ? 10.571  -3.552  -0.220  1.00 0.00 ? 102 GLY A HA3  11 
ATOM   10207 N N    . THR A 1 39 ? 8.318   -3.377  2.089   1.00 0.00 ? 103 THR A N    11 
ATOM   10208 C CA   . THR A 1 39 ? 6.901   -3.391  2.313   1.00 0.00 ? 103 THR A CA   11 
ATOM   10209 C C    . THR A 1 39 ? 6.487   -2.251  3.208   1.00 0.00 ? 103 THR A C    11 
ATOM   10210 O O    . THR A 1 39 ? 7.286   -1.747  3.969   1.00 0.00 ? 103 THR A O    11 
ATOM   10211 C CB   . THR A 1 39 ? 6.455   -4.732  2.911   1.00 0.00 ? 103 THR A CB   11 
ATOM   10212 O OG1  . THR A 1 39 ? 7.248   -5.021  4.085   1.00 0.00 ? 103 THR A OG1  11 
ATOM   10213 C CG2  . THR A 1 39 ? 6.611   -5.853  1.897   1.00 0.00 ? 103 THR A CG2  11 
ATOM   10214 H H    . THR A 1 39 ? 8.937   -3.531  2.840   1.00 0.00 ? 103 THR A H    11 
ATOM   10215 H HA   . THR A 1 39 ? 6.408   -3.252  1.367   1.00 0.00 ? 103 THR A HA   11 
ATOM   10216 H HB   . THR A 1 39 ? 5.415   -4.634  3.180   1.00 0.00 ? 103 THR A HB   11 
ATOM   10217 H HG1  . THR A 1 39 ? 7.620   -4.180  4.371   1.00 0.00 ? 103 THR A HG1  11 
ATOM   10218 H HG21 . THR A 1 39 ? 7.643   -5.906  1.584   1.00 0.00 ? 103 THR A HG21 11 
ATOM   10219 H HG22 . THR A 1 39 ? 6.315   -6.791  2.342   1.00 0.00 ? 103 THR A HG22 11 
ATOM   10220 H HG23 . THR A 1 39 ? 5.989   -5.649  1.038   1.00 0.00 ? 103 THR A HG23 11 
ATOM   10221 N N    . ALA A 1 40 ? 5.266   -1.851  3.116   1.00 0.00 ? 104 ALA A N    11 
ATOM   10222 C CA   . ALA A 1 40 ? 4.767   -0.784  3.918   1.00 0.00 ? 104 ALA A CA   11 
ATOM   10223 C C    . ALA A 1 40 ? 3.477   -1.185  4.565   1.00 0.00 ? 104 ALA A C    11 
ATOM   10224 O O    . ALA A 1 40 ? 2.668   -1.904  3.977   1.00 0.00 ? 104 ALA A O    11 
ATOM   10225 C CB   . ALA A 1 40 ? 4.566   0.462   3.082   1.00 0.00 ? 104 ALA A CB   11 
ATOM   10226 H H    . ALA A 1 40 ? 4.640   -2.273  2.483   1.00 0.00 ? 104 ALA A H    11 
ATOM   10227 H HA   . ALA A 1 40 ? 5.497   -0.563  4.683   1.00 0.00 ? 104 ALA A HA   11 
ATOM   10228 H HB1  . ALA A 1 40 ? 3.856   0.248   2.297   1.00 0.00 ? 104 ALA A HB1  11 
ATOM   10229 H HB2  . ALA A 1 40 ? 4.191   1.260   3.704   1.00 0.00 ? 104 ALA A HB2  11 
ATOM   10230 H HB3  . ALA A 1 40 ? 5.508   0.753   2.641   1.00 0.00 ? 104 ALA A HB3  11 
ATOM   10231 N N    . ALA A 1 41 ? 3.308   -0.758  5.770   1.00 0.00 ? 105 ALA A N    11 
ATOM   10232 C CA   . ALA A 1 41 ? 2.105   -0.971  6.493   1.00 0.00 ? 105 ALA A CA   11 
ATOM   10233 C C    . ALA A 1 41 ? 1.213   0.193   6.196   1.00 0.00 ? 105 ALA A C    11 
ATOM   10234 O O    . ALA A 1 41 ? 1.591   1.361   6.426   1.00 0.00 ? 105 ALA A O    11 
ATOM   10235 C CB   . ALA A 1 41 ? 2.396   -1.065  7.961   1.00 0.00 ? 105 ALA A CB   11 
ATOM   10236 H H    . ALA A 1 41 ? 4.019   -0.227  6.196   1.00 0.00 ? 105 ALA A H    11 
ATOM   10237 H HA   . ALA A 1 41 ? 1.642   -1.886  6.152   1.00 0.00 ? 105 ALA A HA   11 
ATOM   10238 H HB1  . ALA A 1 41 ? 2.901   -0.157  8.260   1.00 0.00 ? 105 ALA A HB1  11 
ATOM   10239 H HB2  . ALA A 1 41 ? 1.472   -1.183  8.504   1.00 0.00 ? 105 ALA A HB2  11 
ATOM   10240 H HB3  . ALA A 1 41 ? 3.033   -1.922  8.116   1.00 0.00 ? 105 ALA A HB3  11 
ATOM   10241 N N    . ILE A 1 42 ? 0.084   -0.090  5.660   1.00 0.00 ? 106 ILE A N    11 
ATOM   10242 C CA   . ILE A 1 42 ? -0.803  0.929   5.200   1.00 0.00 ? 106 ILE A CA   11 
ATOM   10243 C C    . ILE A 1 42 ? -2.158  0.764   5.830   1.00 0.00 ? 106 ILE A C    11 
ATOM   10244 O O    . ILE A 1 42 ? -2.587  -0.352  6.101   1.00 0.00 ? 106 ILE A O    11 
ATOM   10245 C CB   . ILE A 1 42 ? -0.918  0.887   3.641   1.00 0.00 ? 106 ILE A CB   11 
ATOM   10246 C CG1  . ILE A 1 42 ? -1.411  -0.480  3.145   1.00 0.00 ? 106 ILE A CG1  11 
ATOM   10247 C CG2  . ILE A 1 42 ? 0.386   1.251   2.972   1.00 0.00 ? 106 ILE A CG2  11 
ATOM   10248 C CD1  . ILE A 1 42 ? -2.876  -0.529  2.898   1.00 0.00 ? 106 ILE A CD1  11 
ATOM   10249 H H    . ILE A 1 42 ? -0.187  -1.033  5.566   1.00 0.00 ? 106 ILE A H    11 
ATOM   10250 H HA   . ILE A 1 42 ? -0.392  1.886   5.480   1.00 0.00 ? 106 ILE A HA   11 
ATOM   10251 H HB   . ILE A 1 42 ? -1.645  1.633   3.356   1.00 0.00 ? 106 ILE A HB   11 
ATOM   10252 H HG12 . ILE A 1 42 ? -0.914  -0.803  2.245   1.00 0.00 ? 106 ILE A HG12 11 
ATOM   10253 H HG13 . ILE A 1 42 ? -1.203  -1.197  3.926   1.00 0.00 ? 106 ILE A HG13 11 
ATOM   10254 H HG21 . ILE A 1 42 ? 1.155   0.558   3.276   1.00 0.00 ? 106 ILE A HG21 11 
ATOM   10255 H HG22 . ILE A 1 42 ? 0.245   1.201   1.902   1.00 0.00 ? 106 ILE A HG22 11 
ATOM   10256 H HG23 . ILE A 1 42 ? 0.658   2.256   3.254   1.00 0.00 ? 106 ILE A HG23 11 
ATOM   10257 H HD11 . ILE A 1 42 ? -3.092  0.262   2.192   1.00 0.00 ? 106 ILE A HD11 11 
ATOM   10258 H HD12 . ILE A 1 42 ? -3.153  -1.484  2.477   1.00 0.00 ? 106 ILE A HD12 11 
ATOM   10259 H HD13 . ILE A 1 42 ? -3.412  -0.340  3.815   1.00 0.00 ? 106 ILE A HD13 11 
ATOM   10260 N N    . THR A 1 43 ? -2.811  1.849   6.075   1.00 0.00 ? 107 THR A N    11 
ATOM   10261 C CA   . THR A 1 43 ? -4.118  1.827   6.628   1.00 0.00 ? 107 THR A CA   11 
ATOM   10262 C C    . THR A 1 43 ? -5.099  2.453   5.642   1.00 0.00 ? 107 THR A C    11 
ATOM   10263 O O    . THR A 1 43 ? -4.912  3.588   5.191   1.00 0.00 ? 107 THR A O    11 
ATOM   10264 C CB   . THR A 1 43 ? -4.159  2.539   7.994   1.00 0.00 ? 107 THR A CB   11 
ATOM   10265 O OG1  . THR A 1 43 ? -3.233  1.894   8.887   1.00 0.00 ? 107 THR A OG1  11 
ATOM   10266 C CG2  . THR A 1 43 ? -5.551  2.479   8.600   1.00 0.00 ? 107 THR A CG2  11 
ATOM   10267 H H    . THR A 1 43 ? -2.399  2.717   5.855   1.00 0.00 ? 107 THR A H    11 
ATOM   10268 H HA   . THR A 1 43 ? -4.394  0.792   6.765   1.00 0.00 ? 107 THR A HA   11 
ATOM   10269 H HB   . THR A 1 43 ? -3.868  3.571   7.860   1.00 0.00 ? 107 THR A HB   11 
ATOM   10270 H HG1  . THR A 1 43 ? -2.597  1.376   8.375   1.00 0.00 ? 107 THR A HG1  11 
ATOM   10271 H HG21 . THR A 1 43 ? -5.858  1.448   8.699   1.00 0.00 ? 107 THR A HG21 11 
ATOM   10272 H HG22 . THR A 1 43 ? -5.542  2.951   9.571   1.00 0.00 ? 107 THR A HG22 11 
ATOM   10273 H HG23 . THR A 1 43 ? -6.238  2.998   7.948   1.00 0.00 ? 107 THR A HG23 11 
ATOM   10274 N N    . PHE A 1 44 ? -6.104  1.688   5.289   1.00 0.00 ? 108 PHE A N    11 
ATOM   10275 C CA   . PHE A 1 44 ? -7.118  2.089   4.350   1.00 0.00 ? 108 PHE A CA   11 
ATOM   10276 C C    . PHE A 1 44 ? -7.998  3.151   4.943   1.00 0.00 ? 108 PHE A C    11 
ATOM   10277 O O    . PHE A 1 44 ? -8.688  2.909   5.940   1.00 0.00 ? 108 PHE A O    11 
ATOM   10278 C CB   . PHE A 1 44 ? -7.950  0.888   3.901   1.00 0.00 ? 108 PHE A CB   11 
ATOM   10279 C CG   . PHE A 1 44 ? -7.180  -0.101  3.078   1.00 0.00 ? 108 PHE A CG   11 
ATOM   10280 C CD1  . PHE A 1 44 ? -6.929  0.173   1.747   1.00 0.00 ? 108 PHE A CD1  11 
ATOM   10281 C CD2  . PHE A 1 44 ? -6.707  -1.300  3.624   1.00 0.00 ? 108 PHE A CD2  11 
ATOM   10282 C CE1  . PHE A 1 44 ? -6.222  -0.710  0.960   1.00 0.00 ? 108 PHE A CE1  11 
ATOM   10283 C CE2  . PHE A 1 44 ? -5.998  -2.192  2.838   1.00 0.00 ? 108 PHE A CE2  11 
ATOM   10284 C CZ   . PHE A 1 44 ? -5.754  -1.896  1.504   1.00 0.00 ? 108 PHE A CZ   11 
ATOM   10285 H H    . PHE A 1 44 ? -6.171  0.808   5.724   1.00 0.00 ? 108 PHE A H    11 
ATOM   10286 H HA   . PHE A 1 44 ? -6.618  2.500   3.488   1.00 0.00 ? 108 PHE A HA   11 
ATOM   10287 H HB2  . PHE A 1 44 ? -8.336  0.373   4.767   1.00 0.00 ? 108 PHE A HB2  11 
ATOM   10288 H HB3  . PHE A 1 44 ? -8.777  1.242   3.303   1.00 0.00 ? 108 PHE A HB3  11 
ATOM   10289 H HD1  . PHE A 1 44 ? -7.305  1.097   1.330   1.00 0.00 ? 108 PHE A HD1  11 
ATOM   10290 H HD2  . PHE A 1 44 ? -6.909  -1.550  4.658   1.00 0.00 ? 108 PHE A HD2  11 
ATOM   10291 H HE1  . PHE A 1 44 ? -6.045  -0.468  -0.078  1.00 0.00 ? 108 PHE A HE1  11 
ATOM   10292 H HE2  . PHE A 1 44 ? -5.636  -3.116  3.265   1.00 0.00 ? 108 PHE A HE2  11 
ATOM   10293 H HZ   . PHE A 1 44 ? -5.199  -2.588  0.888   1.00 0.00 ? 108 PHE A HZ   11 
ATOM   10294 N N    . ALA A 1 45 ? -7.969  4.310   4.328   1.00 0.00 ? 109 ALA A N    11 
ATOM   10295 C CA   . ALA A 1 45 ? -8.709  5.463   4.790   1.00 0.00 ? 109 ALA A CA   11 
ATOM   10296 C C    . ALA A 1 45 ? -10.205 5.190   4.746   1.00 0.00 ? 109 ALA A C    11 
ATOM   10297 O O    . ALA A 1 45 ? -10.708 4.573   3.799   1.00 0.00 ? 109 ALA A O    11 
ATOM   10298 C CB   . ALA A 1 45 ? -8.348  6.683   3.951   1.00 0.00 ? 109 ALA A CB   11 
ATOM   10299 H H    . ALA A 1 45 ? -7.447  4.388   3.501   1.00 0.00 ? 109 ALA A H    11 
ATOM   10300 H HA   . ALA A 1 45 ? -8.418  5.655   5.813   1.00 0.00 ? 109 ALA A HA   11 
ATOM   10301 H HB1  . ALA A 1 45 ? -8.588  6.493   2.914   1.00 0.00 ? 109 ALA A HB1  11 
ATOM   10302 H HB2  . ALA A 1 45 ? -8.895  7.544   4.304   1.00 0.00 ? 109 ALA A HB2  11 
ATOM   10303 H HB3  . ALA A 1 45 ? -7.287  6.875   4.028   1.00 0.00 ? 109 ALA A HB3  11 
ATOM   10304 N N    . GLY A 1 46 ? -10.892 5.581   5.786   1.00 0.00 ? 110 GLY A N    11 
ATOM   10305 C CA   . GLY A 1 46 ? -12.314 5.386   5.855   1.00 0.00 ? 110 GLY A CA   11 
ATOM   10306 C C    . GLY A 1 46 ? -12.681 4.039   6.440   1.00 0.00 ? 110 GLY A C    11 
ATOM   10307 O O    . GLY A 1 46 ? -13.386 3.959   7.457   1.00 0.00 ? 110 GLY A O    11 
ATOM   10308 H H    . GLY A 1 46 ? -10.422 6.012   6.531   1.00 0.00 ? 110 GLY A H    11 
ATOM   10309 H HA2  . GLY A 1 46 ? -12.751 6.168   6.460   1.00 0.00 ? 110 GLY A HA2  11 
ATOM   10310 H HA3  . GLY A 1 46 ? -12.711 5.448   4.853   1.00 0.00 ? 110 GLY A HA3  11 
ATOM   10311 N N    . TYR A 1 47 ? -12.197 2.985   5.817   1.00 0.00 ? 111 TYR A N    11 
ATOM   10312 C CA   . TYR A 1 47 ? -12.502 1.632   6.240   1.00 0.00 ? 111 TYR A CA   11 
ATOM   10313 C C    . TYR A 1 47 ? -11.776 1.291   7.534   1.00 0.00 ? 111 TYR A C    11 
ATOM   10314 O O    . TYR A 1 47 ? -12.340 0.668   8.426   1.00 0.00 ? 111 TYR A O    11 
ATOM   10315 C CB   . TYR A 1 47 ? -12.085 0.654   5.184   1.00 0.00 ? 111 TYR A CB   11 
ATOM   10316 C CG   . TYR A 1 47 ? -12.615 0.921   3.799   1.00 0.00 ? 111 TYR A CG   11 
ATOM   10317 C CD1  . TYR A 1 47 ? -13.930 0.633   3.455   1.00 0.00 ? 111 TYR A CD1  11 
ATOM   10318 C CD2  . TYR A 1 47 ? -11.775 1.421   2.825   1.00 0.00 ? 111 TYR A CD2  11 
ATOM   10319 C CE1  . TYR A 1 47 ? -14.388 0.843   2.164   1.00 0.00 ? 111 TYR A CE1  11 
ATOM   10320 C CE2  . TYR A 1 47 ? -12.210 1.633   1.548   1.00 0.00 ? 111 TYR A CE2  11 
ATOM   10321 C CZ   . TYR A 1 47 ? -13.515 1.342   1.215   1.00 0.00 ? 111 TYR A CZ   11 
ATOM   10322 O OH   . TYR A 1 47 ? -13.953 1.559   -0.073  1.00 0.00 ? 111 TYR A OH   11 
ATOM   10323 H H    . TYR A 1 47 ? -11.624 3.124   5.030   1.00 0.00 ? 111 TYR A H    11 
ATOM   10324 H HA   . TYR A 1 47 ? -13.568 1.551   6.392   1.00 0.00 ? 111 TYR A HA   11 
ATOM   10325 H HB2  . TYR A 1 47 ? -11.008 0.663   5.123   1.00 0.00 ? 111 TYR A HB2  11 
ATOM   10326 H HB3  . TYR A 1 47 ? -12.404 -0.336  5.477   1.00 0.00 ? 111 TYR A HB3  11 
ATOM   10327 H HD1  . TYR A 1 47 ? -14.597 0.246   4.210   1.00 0.00 ? 111 TYR A HD1  11 
ATOM   10328 H HD2  . TYR A 1 47 ? -10.754 1.651   3.086   1.00 0.00 ? 111 TYR A HD2  11 
ATOM   10329 H HE1  . TYR A 1 47 ? -15.407 0.589   1.903   1.00 0.00 ? 111 TYR A HE1  11 
ATOM   10330 H HE2  . TYR A 1 47 ? -11.512 2.019   0.819   1.00 0.00 ? 111 TYR A HE2  11 
ATOM   10331 H HH   . TYR A 1 47 ? -13.253 1.290   -0.679  1.00 0.00 ? 111 TYR A HH   11 
ATOM   10332 N N    . GLY A 1 48 ? -10.520 1.673   7.613   1.00 0.00 ? 112 GLY A N    11 
ATOM   10333 C CA   . GLY A 1 48 ? -9.762  1.475   8.822   1.00 0.00 ? 112 GLY A CA   11 
ATOM   10334 C C    . GLY A 1 48 ? -9.008  0.158   8.900   1.00 0.00 ? 112 GLY A C    11 
ATOM   10335 O O    . GLY A 1 48 ? -8.672  -0.297  9.991   1.00 0.00 ? 112 GLY A O    11 
ATOM   10336 H H    . GLY A 1 48 ? -10.090 2.122   6.850   1.00 0.00 ? 112 GLY A H    11 
ATOM   10337 H HA2  . GLY A 1 48 ? -9.039  2.274   8.898   1.00 0.00 ? 112 GLY A HA2  11 
ATOM   10338 H HA3  . GLY A 1 48 ? -10.433 1.544   9.664   1.00 0.00 ? 112 GLY A HA3  11 
ATOM   10339 N N    . ASN A 1 49 ? -8.735  -0.478  7.781   1.00 0.00 ? 113 ASN A N    11 
ATOM   10340 C CA   . ASN A 1 49 ? -7.927  -1.706  7.844   1.00 0.00 ? 113 ASN A CA   11 
ATOM   10341 C C    . ASN A 1 49 ? -6.515  -1.392  7.581   1.00 0.00 ? 113 ASN A C    11 
ATOM   10342 O O    . ASN A 1 49 ? -6.210  -0.353  7.025   1.00 0.00 ? 113 ASN A O    11 
ATOM   10343 C CB   . ASN A 1 49 ? -8.342  -2.812  6.889   1.00 0.00 ? 113 ASN A CB   11 
ATOM   10344 C CG   . ASN A 1 49 ? -9.630  -3.477  7.235   1.00 0.00 ? 113 ASN A CG   11 
ATOM   10345 O OD1  . ASN A 1 49 ? -10.052 -3.504  8.399   1.00 0.00 ? 113 ASN A OD1  11 
ATOM   10346 N ND2  . ASN A 1 49 ? -10.217 -4.083  6.263   1.00 0.00 ? 113 ASN A ND2  11 
ATOM   10347 H H    . ASN A 1 49 ? -9.037  -0.112  6.924   1.00 0.00 ? 113 ASN A H    11 
ATOM   10348 H HA   . ASN A 1 49 ? -8.000  -2.070  8.858   1.00 0.00 ? 113 ASN A HA   11 
ATOM   10349 H HB2  . ASN A 1 49 ? -8.433  -2.400  5.897   1.00 0.00 ? 113 ASN A HB2  11 
ATOM   10350 H HB3  . ASN A 1 49 ? -7.562  -3.560  6.877   1.00 0.00 ? 113 ASN A HB3  11 
ATOM   10351 H HD21 . ASN A 1 49 ? -9.776  -4.068  5.386   1.00 0.00 ? 113 ASN A HD21 11 
ATOM   10352 H HD22 . ASN A 1 49 ? -11.078 -4.522  6.403   1.00 0.00 ? 113 ASN A HD22 11 
ATOM   10353 N N    . ALA A 1 50 ? -5.663  -2.292  7.917   1.00 0.00 ? 114 ALA A N    11 
ATOM   10354 C CA   . ALA A 1 50 ? -4.266  -2.095  7.740   1.00 0.00 ? 114 ALA A CA   11 
ATOM   10355 C C    . ALA A 1 50 ? -3.650  -3.364  7.252   1.00 0.00 ? 114 ALA A C    11 
ATOM   10356 O O    . ALA A 1 50 ? -3.952  -4.440  7.775   1.00 0.00 ? 114 ALA A O    11 
ATOM   10357 C CB   . ALA A 1 50 ? -3.627  -1.657  9.047   1.00 0.00 ? 114 ALA A CB   11 
ATOM   10358 H H    . ALA A 1 50 ? -5.971  -3.152  8.280   1.00 0.00 ? 114 ALA A H    11 
ATOM   10359 H HA   . ALA A 1 50 ? -4.116  -1.318  7.007   1.00 0.00 ? 114 ALA A HA   11 
ATOM   10360 H HB1  . ALA A 1 50 ? -3.782  -2.422  9.791   1.00 0.00 ? 114 ALA A HB1  11 
ATOM   10361 H HB2  . ALA A 1 50 ? -2.568  -1.516  8.893   1.00 0.00 ? 114 ALA A HB2  11 
ATOM   10362 H HB3  . ALA A 1 50 ? -4.073  -0.731  9.378   1.00 0.00 ? 114 ALA A HB3  11 
ATOM   10363 N N    . GLU A 1 51 ? -2.835  -3.269  6.251   1.00 0.00 ? 115 GLU A N    11 
ATOM   10364 C CA   . GLU A 1 51 ? -2.153  -4.418  5.751   1.00 0.00 ? 115 GLU A CA   11 
ATOM   10365 C C    . GLU A 1 51 ? -0.748  -4.034  5.392   1.00 0.00 ? 115 GLU A C    11 
ATOM   10366 O O    . GLU A 1 51 ? -0.460  -2.852  5.161   1.00 0.00 ? 115 GLU A O    11 
ATOM   10367 C CB   . GLU A 1 51 ? -2.872  -5.081  4.545   1.00 0.00 ? 115 GLU A CB   11 
ATOM   10368 C CG   . GLU A 1 51 ? -2.828  -4.344  3.218   1.00 0.00 ? 115 GLU A CG   11 
ATOM   10369 C CD   . GLU A 1 51 ? -3.233  -5.264  2.073   1.00 0.00 ? 115 GLU A CD   11 
ATOM   10370 O OE1  . GLU A 1 51 ? -4.452  -5.421  1.803   1.00 0.00 ? 115 GLU A OE1  11 
ATOM   10371 O OE2  . GLU A 1 51 ? -2.331  -5.883  1.458   1.00 0.00 ? 115 GLU A OE2  11 
ATOM   10372 H H    . GLU A 1 51 ? -2.651  -2.390  5.850   1.00 0.00 ? 115 GLU A H    11 
ATOM   10373 H HA   . GLU A 1 51 ? -2.109  -5.125  6.565   1.00 0.00 ? 115 GLU A HA   11 
ATOM   10374 H HB2  . GLU A 1 51 ? -2.451  -6.055  4.360   1.00 0.00 ? 115 GLU A HB2  11 
ATOM   10375 H HB3  . GLU A 1 51 ? -3.917  -5.175  4.809   1.00 0.00 ? 115 GLU A HB3  11 
ATOM   10376 H HG2  . GLU A 1 51 ? -3.506  -3.505  3.259   1.00 0.00 ? 115 GLU A HG2  11 
ATOM   10377 H HG3  . GLU A 1 51 ? -1.821  -3.994  3.044   1.00 0.00 ? 115 GLU A HG3  11 
ATOM   10378 N N    . VAL A 1 52 ? 0.126   -4.990  5.404   1.00 0.00 ? 116 VAL A N    11 
ATOM   10379 C CA   . VAL A 1 52 ? 1.479   -4.772  5.009   1.00 0.00 ? 116 VAL A CA   11 
ATOM   10380 C C    . VAL A 1 52 ? 1.596   -5.181  3.558   1.00 0.00 ? 116 VAL A C    11 
ATOM   10381 O O    . VAL A 1 52 ? 1.494   -6.360  3.225   1.00 0.00 ? 116 VAL A O    11 
ATOM   10382 C CB   . VAL A 1 52 ? 2.473   -5.576  5.891   1.00 0.00 ? 116 VAL A CB   11 
ATOM   10383 C CG1  . VAL A 1 52 ? 3.910   -5.323  5.464   1.00 0.00 ? 116 VAL A CG1  11 
ATOM   10384 C CG2  . VAL A 1 52 ? 2.288   -5.224  7.361   1.00 0.00 ? 116 VAL A CG2  11 
ATOM   10385 H H    . VAL A 1 52 ? -0.155  -5.889  5.678   1.00 0.00 ? 116 VAL A H    11 
ATOM   10386 H HA   . VAL A 1 52 ? 1.690   -3.717  5.091   1.00 0.00 ? 116 VAL A HA   11 
ATOM   10387 H HB   . VAL A 1 52 ? 2.260   -6.628  5.763   1.00 0.00 ? 116 VAL A HB   11 
ATOM   10388 H HG11 . VAL A 1 52 ? 4.130   -4.269  5.538   1.00 0.00 ? 116 VAL A HG11 11 
ATOM   10389 H HG12 . VAL A 1 52 ? 4.578   -5.878  6.106   1.00 0.00 ? 116 VAL A HG12 11 
ATOM   10390 H HG13 . VAL A 1 52 ? 4.035   -5.648  4.443   1.00 0.00 ? 116 VAL A HG13 11 
ATOM   10391 H HG21 . VAL A 1 52 ? 1.281   -5.469  7.666   1.00 0.00 ? 116 VAL A HG21 11 
ATOM   10392 H HG22 . VAL A 1 52 ? 2.990   -5.785  7.959   1.00 0.00 ? 116 VAL A HG22 11 
ATOM   10393 H HG23 . VAL A 1 52 ? 2.459   -4.167  7.504   1.00 0.00 ? 116 VAL A HG23 11 
ATOM   10394 N N    . THR A 1 53 ? 1.779   -4.225  2.717   1.00 0.00 ? 117 THR A N    11 
ATOM   10395 C CA   . THR A 1 53 ? 1.805   -4.453  1.297   1.00 0.00 ? 117 THR A CA   11 
ATOM   10396 C C    . THR A 1 53 ? 3.098   -3.858  0.713   1.00 0.00 ? 117 THR A C    11 
ATOM   10397 O O    . THR A 1 53 ? 3.596   -2.843  1.215   1.00 0.00 ? 117 THR A O    11 
ATOM   10398 C CB   . THR A 1 53 ? 0.520   -3.872  0.605   1.00 0.00 ? 117 THR A CB   11 
ATOM   10399 O OG1  . THR A 1 53 ? 0.408   -4.320  -0.761  1.00 0.00 ? 117 THR A OG1  11 
ATOM   10400 C CG2  . THR A 1 53 ? 0.517   -2.358  0.635   1.00 0.00 ? 117 THR A CG2  11 
ATOM   10401 H H    . THR A 1 53 ? 1.922   -3.315  3.075   1.00 0.00 ? 117 THR A H    11 
ATOM   10402 H HA   . THR A 1 53 ? 1.831   -5.523  1.154   1.00 0.00 ? 117 THR A HA   11 
ATOM   10403 H HB   . THR A 1 53 ? -0.343  -4.231  1.146   1.00 0.00 ? 117 THR A HB   11 
ATOM   10404 H HG1  . THR A 1 53 ? -0.434  -4.792  -0.797  1.00 0.00 ? 117 THR A HG1  11 
ATOM   10405 H HG21 . THR A 1 53 ? 1.367   -1.987  0.080   1.00 0.00 ? 117 THR A HG21 11 
ATOM   10406 H HG22 . THR A 1 53 ? -0.396  -1.987  0.190   1.00 0.00 ? 117 THR A HG22 11 
ATOM   10407 H HG23 . THR A 1 53 ? 0.585   -2.025  1.660   1.00 0.00 ? 117 THR A HG23 11 
ATOM   10408 N N    . PRO A 1 54 ? 3.725   -4.538  -0.259  1.00 0.00 ? 118 PRO A N    11 
ATOM   10409 C CA   . PRO A 1 54 ? 4.962   -4.074  -0.871  1.00 0.00 ? 118 PRO A CA   11 
ATOM   10410 C C    . PRO A 1 54 ? 4.794   -2.730  -1.562  1.00 0.00 ? 118 PRO A C    11 
ATOM   10411 O O    . PRO A 1 54 ? 3.718   -2.412  -2.075  1.00 0.00 ? 118 PRO A O    11 
ATOM   10412 C CB   . PRO A 1 54 ? 5.296   -5.159  -1.893  1.00 0.00 ? 118 PRO A CB   11 
ATOM   10413 C CG   . PRO A 1 54 ? 4.014   -5.836  -2.159  1.00 0.00 ? 118 PRO A CG   11 
ATOM   10414 C CD   . PRO A 1 54 ? 3.252   -5.780  -0.873  1.00 0.00 ? 118 PRO A CD   11 
ATOM   10415 H HA   . PRO A 1 54 ? 5.762   -3.999  -0.155  1.00 0.00 ? 118 PRO A HA   11 
ATOM   10416 H HB2  . PRO A 1 54 ? 5.704   -4.709  -2.785  1.00 0.00 ? 118 PRO A HB2  11 
ATOM   10417 H HB3  . PRO A 1 54 ? 6.012   -5.845  -1.469  1.00 0.00 ? 118 PRO A HB3  11 
ATOM   10418 H HG2  . PRO A 1 54 ? 3.479   -5.307  -2.934  1.00 0.00 ? 118 PRO A HG2  11 
ATOM   10419 H HG3  . PRO A 1 54 ? 4.185   -6.860  -2.454  1.00 0.00 ? 118 PRO A HG3  11 
ATOM   10420 H HD2  . PRO A 1 54 ? 2.191   -5.733  -1.069  1.00 0.00 ? 118 PRO A HD2  11 
ATOM   10421 H HD3  . PRO A 1 54 ? 3.483   -6.633  -0.258  1.00 0.00 ? 118 PRO A HD3  11 
ATOM   10422 N N    . LEU A 1 55 ? 5.858   -1.959  -1.579  1.00 0.00 ? 119 LEU A N    11 
ATOM   10423 C CA   . LEU A 1 55 ? 5.893   -0.632  -2.207  1.00 0.00 ? 119 LEU A CA   11 
ATOM   10424 C C    . LEU A 1 55 ? 5.552   -0.712  -3.691  1.00 0.00 ? 119 LEU A C    11 
ATOM   10425 O O    . LEU A 1 55 ? 5.083   0.257   -4.286  1.00 0.00 ? 119 LEU A O    11 
ATOM   10426 C CB   . LEU A 1 55 ? 7.265   0.019   -2.005  1.00 0.00 ? 119 LEU A CB   11 
ATOM   10427 C CG   . LEU A 1 55 ? 7.718   0.180   -0.548  1.00 0.00 ? 119 LEU A CG   11 
ATOM   10428 C CD1  . LEU A 1 55 ? 9.079   0.827   -0.468  1.00 0.00 ? 119 LEU A CD1  11 
ATOM   10429 C CD2  . LEU A 1 55 ? 6.713   0.964   0.271   1.00 0.00 ? 119 LEU A CD2  11 
ATOM   10430 H H    . LEU A 1 55 ? 6.668   -2.292  -1.130  1.00 0.00 ? 119 LEU A H    11 
ATOM   10431 H HA   . LEU A 1 55 ? 5.143   -0.016  -1.737  1.00 0.00 ? 119 LEU A HA   11 
ATOM   10432 H HB2  . LEU A 1 55 ? 7.997   -0.583  -2.523  1.00 0.00 ? 119 LEU A HB2  11 
ATOM   10433 H HB3  . LEU A 1 55 ? 7.247   0.996   -2.461  1.00 0.00 ? 119 LEU A HB3  11 
ATOM   10434 H HG   . LEU A 1 55 ? 7.794   -0.812  -0.128  1.00 0.00 ? 119 LEU A HG   11 
ATOM   10435 H HD11 . LEU A 1 55 ? 9.043   1.799   -0.936  1.00 0.00 ? 119 LEU A HD11 11 
ATOM   10436 H HD12 . LEU A 1 55 ? 9.364   0.936   0.569   1.00 0.00 ? 119 LEU A HD12 11 
ATOM   10437 H HD13 . LEU A 1 55 ? 9.803   0.209   -0.976  1.00 0.00 ? 119 LEU A HD13 11 
ATOM   10438 H HD21 . LEU A 1 55 ? 5.775   0.430   0.299   1.00 0.00 ? 119 LEU A HD21 11 
ATOM   10439 H HD22 . LEU A 1 55 ? 7.089   1.081   1.276   1.00 0.00 ? 119 LEU A HD22 11 
ATOM   10440 H HD23 . LEU A 1 55 ? 6.560   1.938   -0.170  1.00 0.00 ? 119 LEU A HD23 11 
ATOM   10441 N N    . LEU A 1 56 ? 5.812   -1.868  -4.272  1.00 0.00 ? 120 LEU A N    11 
ATOM   10442 C CA   . LEU A 1 56 ? 5.501   -2.148  -5.664  1.00 0.00 ? 120 LEU A CA   11 
ATOM   10443 C C    . LEU A 1 56 ? 3.990   -2.141  -5.888  1.00 0.00 ? 120 LEU A C    11 
ATOM   10444 O O    . LEU A 1 56 ? 3.520   -1.847  -6.981  1.00 0.00 ? 120 LEU A O    11 
ATOM   10445 C CB   . LEU A 1 56 ? 6.110   -3.508  -6.073  1.00 0.00 ? 120 LEU A CB   11 
ATOM   10446 C CG   . LEU A 1 56 ? 5.367   -4.787  -5.644  1.00 0.00 ? 120 LEU A CG   11 
ATOM   10447 C CD1  . LEU A 1 56 ? 4.387   -5.195  -6.721  1.00 0.00 ? 120 LEU A CD1  11 
ATOM   10448 C CD2  . LEU A 1 56 ? 6.340   -5.910  -5.345  1.00 0.00 ? 120 LEU A CD2  11 
ATOM   10449 H H    . LEU A 1 56 ? 6.279   -2.545  -3.734  1.00 0.00 ? 120 LEU A H    11 
ATOM   10450 H HA   . LEU A 1 56 ? 5.926   -1.379  -6.285  1.00 0.00 ? 120 LEU A HA   11 
ATOM   10451 H HB2  . LEU A 1 56 ? 6.179   -3.520  -7.148  1.00 0.00 ? 120 LEU A HB2  11 
ATOM   10452 H HB3  . LEU A 1 56 ? 7.109   -3.551  -5.668  1.00 0.00 ? 120 LEU A HB3  11 
ATOM   10453 H HG   . LEU A 1 56 ? 4.773   -4.582  -4.763  1.00 0.00 ? 120 LEU A HG   11 
ATOM   10454 H HD11 . LEU A 1 56 ? 4.923   -5.416  -7.631  1.00 0.00 ? 120 LEU A HD11 11 
ATOM   10455 H HD12 . LEU A 1 56 ? 3.806   -6.046  -6.399  1.00 0.00 ? 120 LEU A HD12 11 
ATOM   10456 H HD13 . LEU A 1 56 ? 3.745   -4.342  -6.887  1.00 0.00 ? 120 LEU A HD13 11 
ATOM   10457 H HD21 . LEU A 1 56 ? 7.006   -5.612  -4.550  1.00 0.00 ? 120 LEU A HD21 11 
ATOM   10458 H HD22 . LEU A 1 56 ? 5.791   -6.790  -5.041  1.00 0.00 ? 120 LEU A HD22 11 
ATOM   10459 H HD23 . LEU A 1 56 ? 6.916   -6.135  -6.232  1.00 0.00 ? 120 LEU A HD23 11 
ATOM   10460 N N    . ASN A 1 57 ? 3.248   -2.471  -4.847  1.00 0.00 ? 121 ASN A N    11 
ATOM   10461 C CA   . ASN A 1 57 ? 1.788   -2.536  -4.906  1.00 0.00 ? 121 ASN A CA   11 
ATOM   10462 C C    . ASN A 1 57 ? 1.175   -1.205  -4.614  1.00 0.00 ? 121 ASN A C    11 
ATOM   10463 O O    . ASN A 1 57 ? -0.039  -1.032  -4.728  1.00 0.00 ? 121 ASN A O    11 
ATOM   10464 C CB   . ASN A 1 57 ? 1.211   -3.552  -3.915  1.00 0.00 ? 121 ASN A CB   11 
ATOM   10465 C CG   . ASN A 1 57 ? 1.213   -4.976  -4.383  1.00 0.00 ? 121 ASN A CG   11 
ATOM   10466 O OD1  . ASN A 1 57 ? 1.213   -5.265  -5.584  1.00 0.00 ? 121 ASN A OD1  11 
ATOM   10467 N ND2  . ASN A 1 57 ? 1.102   -5.874  -3.449  1.00 0.00 ? 121 ASN A ND2  11 
ATOM   10468 H H    . ASN A 1 57 ? 3.696   -2.654  -3.992  1.00 0.00 ? 121 ASN A H    11 
ATOM   10469 H HA   . ASN A 1 57 ? 1.510   -2.840  -5.905  1.00 0.00 ? 121 ASN A HA   11 
ATOM   10470 H HB2  . ASN A 1 57 ? 1.830   -3.524  -3.031  1.00 0.00 ? 121 ASN A HB2  11 
ATOM   10471 H HB3  . ASN A 1 57 ? 0.214   -3.287  -3.619  1.00 0.00 ? 121 ASN A HB3  11 
ATOM   10472 H HD21 . ASN A 1 57 ? 1.016   -5.544  -2.526  1.00 0.00 ? 121 ASN A HD21 11 
ATOM   10473 H HD22 . ASN A 1 57 ? 1.123   -6.829  -3.675  1.00 0.00 ? 121 ASN A HD22 11 
ATOM   10474 N N    . LEU A 1 58 ? 1.990   -0.275  -4.219  1.00 0.00 ? 122 LEU A N    11 
ATOM   10475 C CA   . LEU A 1 58 ? 1.508   1.019   -3.896  1.00 0.00 ? 122 LEU A CA   11 
ATOM   10476 C C    . LEU A 1 58 ? 1.491   1.889   -5.121  1.00 0.00 ? 122 LEU A C    11 
ATOM   10477 O O    . LEU A 1 58 ? 2.462   1.937   -5.890  1.00 0.00 ? 122 LEU A O    11 
ATOM   10478 C CB   . LEU A 1 58 ? 2.337   1.642   -2.779  1.00 0.00 ? 122 LEU A CB   11 
ATOM   10479 C CG   . LEU A 1 58 ? 2.290   0.925   -1.435  1.00 0.00 ? 122 LEU A CG   11 
ATOM   10480 C CD1  . LEU A 1 58 ? 3.113   1.674   -0.411  1.00 0.00 ? 122 LEU A CD1  11 
ATOM   10481 C CD2  . LEU A 1 58 ? 0.856   0.772   -0.962  1.00 0.00 ? 122 LEU A CD2  11 
ATOM   10482 H H    . LEU A 1 58 ? 2.954   -0.450  -4.166  1.00 0.00 ? 122 LEU A H    11 
ATOM   10483 H HA   . LEU A 1 58 ? 0.490   0.913   -3.550  1.00 0.00 ? 122 LEU A HA   11 
ATOM   10484 H HB2  . LEU A 1 58 ? 3.371   1.633   -3.095  1.00 0.00 ? 122 LEU A HB2  11 
ATOM   10485 H HB3  . LEU A 1 58 ? 2.020   2.664   -2.632  1.00 0.00 ? 122 LEU A HB3  11 
ATOM   10486 H HG   . LEU A 1 58 ? 2.716   -0.061  -1.554  1.00 0.00 ? 122 LEU A HG   11 
ATOM   10487 H HD11 . LEU A 1 58 ? 2.709   2.668   -0.282  1.00 0.00 ? 122 LEU A HD11 11 
ATOM   10488 H HD12 . LEU A 1 58 ? 3.079   1.150   0.532   1.00 0.00 ? 122 LEU A HD12 11 
ATOM   10489 H HD13 . LEU A 1 58 ? 4.137   1.748   -0.745  1.00 0.00 ? 122 LEU A HD13 11 
ATOM   10490 H HD21 . LEU A 1 58 ? 0.306   0.163   -1.664  1.00 0.00 ? 122 LEU A HD21 11 
ATOM   10491 H HD22 . LEU A 1 58 ? 0.845   0.286   0.002   1.00 0.00 ? 122 LEU A HD22 11 
ATOM   10492 H HD23 . LEU A 1 58 ? 0.392   1.744   -0.884  1.00 0.00 ? 122 LEU A HD23 11 
ATOM   10493 N N    . LYS A 1 59 ? 0.387   2.533   -5.325  1.00 0.00 ? 123 LYS A N    11 
ATOM   10494 C CA   . LYS A 1 59 ? 0.206   3.419   -6.435  1.00 0.00 ? 123 LYS A CA   11 
ATOM   10495 C C    . LYS A 1 59 ? 0.043   4.817   -5.889  1.00 0.00 ? 123 LYS A C    11 
ATOM   10496 O O    . LYS A 1 59 ? -0.362  4.973   -4.733  1.00 0.00 ? 123 LYS A O    11 
ATOM   10497 C CB   . LYS A 1 59 ? -1.059  3.052   -7.226  1.00 0.00 ? 123 LYS A CB   11 
ATOM   10498 C CG   . LYS A 1 59 ? -1.164  1.608   -7.649  1.00 0.00 ? 123 LYS A CG   11 
ATOM   10499 C CD   . LYS A 1 59 ? -2.420  1.385   -8.467  1.00 0.00 ? 123 LYS A CD   11 
ATOM   10500 C CE   . LYS A 1 59 ? -2.562  -0.072  -8.885  1.00 0.00 ? 123 LYS A CE   11 
ATOM   10501 N NZ   . LYS A 1 59 ? -3.815  -0.335  -9.638  1.00 0.00 ? 123 LYS A NZ   11 
ATOM   10502 H H    . LYS A 1 59 ? -0.345  2.417   -4.679  1.00 0.00 ? 123 LYS A H    11 
ATOM   10503 H HA   . LYS A 1 59 ? 1.069   3.363   -7.081  1.00 0.00 ? 123 LYS A HA   11 
ATOM   10504 H HB2  . LYS A 1 59 ? -1.923  3.292   -6.629  1.00 0.00 ? 123 LYS A HB2  11 
ATOM   10505 H HB3  . LYS A 1 59 ? -1.090  3.665   -8.115  1.00 0.00 ? 123 LYS A HB3  11 
ATOM   10506 H HG2  . LYS A 1 59 ? -0.298  1.341   -8.234  1.00 0.00 ? 123 LYS A HG2  11 
ATOM   10507 H HG3  . LYS A 1 59 ? -1.217  1.009   -6.752  1.00 0.00 ? 123 LYS A HG3  11 
ATOM   10508 H HD2  . LYS A 1 59 ? -3.275  1.687   -7.881  1.00 0.00 ? 123 LYS A HD2  11 
ATOM   10509 H HD3  . LYS A 1 59 ? -2.336  2.008   -9.345  1.00 0.00 ? 123 LYS A HD3  11 
ATOM   10510 H HE2  . LYS A 1 59 ? -1.721  -0.337  -9.508  1.00 0.00 ? 123 LYS A HE2  11 
ATOM   10511 H HE3  . LYS A 1 59 ? -2.553  -0.682  -7.994  1.00 0.00 ? 123 LYS A HE3  11 
ATOM   10512 H HZ1  . LYS A 1 59 ? -3.877  0.211   -10.520 1.00 0.00 ? 123 LYS A HZ1  11 
ATOM   10513 H HZ2  . LYS A 1 59 ? -3.847  -1.343  -9.898  1.00 0.00 ? 123 LYS A HZ2  11 
ATOM   10514 H HZ3  . LYS A 1 59 ? -4.666  -0.146  -9.071  1.00 0.00 ? 123 LYS A HZ3  11 
ATOM   10515 N N    . PRO A 1 60 ? 0.337   5.840   -6.677  1.00 0.00 ? 124 PRO A N    11 
ATOM   10516 C CA   . PRO A 1 60 ? 0.122   7.208   -6.265  1.00 0.00 ? 124 PRO A CA   11 
ATOM   10517 C C    . PRO A 1 60 ? -1.361  7.539   -6.347  1.00 0.00 ? 124 PRO A C    11 
ATOM   10518 O O    . PRO A 1 60 ? -2.086  6.999   -7.205  1.00 0.00 ? 124 PRO A O    11 
ATOM   10519 C CB   . PRO A 1 60 ? 0.936   8.033   -7.264  1.00 0.00 ? 124 PRO A CB   11 
ATOM   10520 C CG   . PRO A 1 60 ? 1.066   7.172   -8.479  1.00 0.00 ? 124 PRO A CG   11 
ATOM   10521 C CD   . PRO A 1 60 ? 0.874   5.740   -8.039  1.00 0.00 ? 124 PRO A CD   11 
ATOM   10522 H HA   . PRO A 1 60 ? 0.449   7.389   -5.253  1.00 0.00 ? 124 PRO A HA   11 
ATOM   10523 H HB2  . PRO A 1 60 ? 0.414   8.952   -7.483  1.00 0.00 ? 124 PRO A HB2  11 
ATOM   10524 H HB3  . PRO A 1 60 ? 1.903   8.261   -6.841  1.00 0.00 ? 124 PRO A HB3  11 
ATOM   10525 H HG2  . PRO A 1 60 ? 0.307   7.441   -9.197  1.00 0.00 ? 124 PRO A HG2  11 
ATOM   10526 H HG3  . PRO A 1 60 ? 2.047   7.300   -8.911  1.00 0.00 ? 124 PRO A HG3  11 
ATOM   10527 H HD2  . PRO A 1 60 ? 0.141   5.246   -8.658  1.00 0.00 ? 124 PRO A HD2  11 
ATOM   10528 H HD3  . PRO A 1 60 ? 1.791   5.171   -8.050  1.00 0.00 ? 124 PRO A HD3  11 
ATOM   10529 N N    . VAL A 1 61 ? -1.827  8.367   -5.459  1.00 0.00 ? 125 VAL A N    11 
ATOM   10530 C CA   . VAL A 1 61 ? -3.223  8.703   -5.438  1.00 0.00 ? 125 VAL A CA   11 
ATOM   10531 C C    . VAL A 1 61 ? -3.573  9.688   -6.532  1.00 0.00 ? 125 VAL A C    11 
ATOM   10532 O O    . VAL A 1 61 ? -2.816  10.640  -6.816  1.00 0.00 ? 125 VAL A O    11 
ATOM   10533 C CB   . VAL A 1 61 ? -3.720  9.231   -4.060  1.00 0.00 ? 125 VAL A CB   11 
ATOM   10534 C CG1  . VAL A 1 61 ? -3.617  8.161   -3.000  1.00 0.00 ? 125 VAL A CG1  11 
ATOM   10535 C CG2  . VAL A 1 61 ? -2.976  10.487  -3.623  1.00 0.00 ? 125 VAL A CG2  11 
ATOM   10536 H H    . VAL A 1 61 ? -1.207  8.774   -4.815  1.00 0.00 ? 125 VAL A H    11 
ATOM   10537 H HA   . VAL A 1 61 ? -3.754  7.787   -5.655  1.00 0.00 ? 125 VAL A HA   11 
ATOM   10538 H HB   . VAL A 1 61 ? -4.764  9.478   -4.174  1.00 0.00 ? 125 VAL A HB   11 
ATOM   10539 H HG11 . VAL A 1 61 ? -2.579  7.889   -2.866  1.00 0.00 ? 125 VAL A HG11 11 
ATOM   10540 H HG12 . VAL A 1 61 ? -4.002  8.543   -2.067  1.00 0.00 ? 125 VAL A HG12 11 
ATOM   10541 H HG13 . VAL A 1 61 ? -4.186  7.294   -3.298  1.00 0.00 ? 125 VAL A HG13 11 
ATOM   10542 H HG21 . VAL A 1 61 ? -3.127  11.265  -4.354  1.00 0.00 ? 125 VAL A HG21 11 
ATOM   10543 H HG22 . VAL A 1 61 ? -3.353  10.813  -2.666  1.00 0.00 ? 125 VAL A HG22 11 
ATOM   10544 H HG23 . VAL A 1 61 ? -1.922  10.269  -3.538  1.00 0.00 ? 125 VAL A HG23 11 
ATOM   10545 N N    . GLU A 1 62 ? -4.672  9.445   -7.168  1.00 0.00 ? 126 GLU A N    11 
ATOM   10546 C CA   . GLU A 1 62 ? -5.168  10.337  -8.151  1.00 0.00 ? 126 GLU A CA   11 
ATOM   10547 C C    . GLU A 1 62 ? -6.200  11.197  -7.478  1.00 0.00 ? 126 GLU A C    11 
ATOM   10548 O O    . GLU A 1 62 ? -6.998  10.712  -6.661  1.00 0.00 ? 126 GLU A O    11 
ATOM   10549 C CB   . GLU A 1 62 ? -5.741  9.599   -9.365  1.00 0.00 ? 126 GLU A CB   11 
ATOM   10550 C CG   . GLU A 1 62 ? -6.815  8.591   -9.031  1.00 0.00 ? 126 GLU A CG   11 
ATOM   10551 C CD   . GLU A 1 62 ? -7.453  8.009   -10.255 1.00 0.00 ? 126 GLU A CD   11 
ATOM   10552 O OE1  . GLU A 1 62 ? -6.864  7.141   -10.904 1.00 0.00 ? 126 GLU A OE1  11 
ATOM   10553 O OE2  . GLU A 1 62 ? -8.573  8.415   -10.598 1.00 0.00 ? 126 GLU A OE2  11 
ATOM   10554 H H    . GLU A 1 62 ? -5.201  8.652   -6.933  1.00 0.00 ? 126 GLU A H    11 
ATOM   10555 H HA   . GLU A 1 62 ? -4.345  10.966  -8.455  1.00 0.00 ? 126 GLU A HA   11 
ATOM   10556 H HB2  . GLU A 1 62 ? -6.166  10.326  -10.043 1.00 0.00 ? 126 GLU A HB2  11 
ATOM   10557 H HB3  . GLU A 1 62 ? -4.935  9.087   -9.870  1.00 0.00 ? 126 GLU A HB3  11 
ATOM   10558 H HG2  . GLU A 1 62 ? -6.384  7.797   -8.439  1.00 0.00 ? 126 GLU A HG2  11 
ATOM   10559 H HG3  . GLU A 1 62 ? -7.563  9.115   -8.456  1.00 0.00 ? 126 GLU A HG3  11 
ATOM   10560 N N    . GLU A 1 63 ? -6.168  12.435  -7.762  1.00 0.00 ? 127 GLU A N    11 
ATOM   10561 C CA   . GLU A 1 63 ? -7.023  13.366  -7.108  1.00 0.00 ? 127 GLU A CA   11 
ATOM   10562 C C    . GLU A 1 63 ? -8.110  13.829  -8.043  1.00 0.00 ? 127 GLU A C    11 
ATOM   10563 O O    . GLU A 1 63 ? -7.896  14.675  -8.912  1.00 0.00 ? 127 GLU A O    11 
ATOM   10564 C CB   . GLU A 1 63 ? -6.192  14.516  -6.545  1.00 0.00 ? 127 GLU A CB   11 
ATOM   10565 C CG   . GLU A 1 63 ? -5.184  14.042  -5.500  1.00 0.00 ? 127 GLU A CG   11 
ATOM   10566 C CD   . GLU A 1 63 ? -4.185  15.088  -5.112  1.00 0.00 ? 127 GLU A CD   11 
ATOM   10567 O OE1  . GLU A 1 63 ? -4.465  15.903  -4.208  1.00 0.00 ? 127 GLU A OE1  11 
ATOM   10568 O OE2  . GLU A 1 63 ? -3.083  15.103  -5.689  1.00 0.00 ? 127 GLU A OE2  11 
ATOM   10569 H H    . GLU A 1 63 ? -5.562  12.754  -8.463  1.00 0.00 ? 127 GLU A H    11 
ATOM   10570 H HA   . GLU A 1 63 ? -7.485  12.844  -6.285  1.00 0.00 ? 127 GLU A HA   11 
ATOM   10571 H HB2  . GLU A 1 63 ? -5.659  14.995  -7.353  1.00 0.00 ? 127 GLU A HB2  11 
ATOM   10572 H HB3  . GLU A 1 63 ? -6.852  15.231  -6.076  1.00 0.00 ? 127 GLU A HB3  11 
ATOM   10573 H HG2  . GLU A 1 63 ? -5.718  13.747  -4.609  1.00 0.00 ? 127 GLU A HG2  11 
ATOM   10574 H HG3  . GLU A 1 63 ? -4.655  13.186  -5.896  1.00 0.00 ? 127 GLU A HG3  11 
ATOM   10575 N N    . GLY A 1 64 ? -9.243  13.218  -7.902  1.00 0.00 ? 128 GLY A N    11 
ATOM   10576 C CA   . GLY A 1 64 ? -10.368 13.520  -8.692  1.00 0.00 ? 128 GLY A CA   11 
ATOM   10577 C C    . GLY A 1 64 ? -11.433 12.543  -8.371  1.00 0.00 ? 128 GLY A C    11 
ATOM   10578 O O    . GLY A 1 64 ? -11.415 12.017  -7.240  1.00 0.00 ? 128 GLY A O    11 
ATOM   10579 O OXT  . GLY A 1 64 ? -12.312 12.291  -9.212  1.00 0.00 ? 128 GLY A OXT  11 
ATOM   10580 H H    . GLY A 1 64 ? -9.383  12.513  -7.233  1.00 0.00 ? 128 GLY A H    11 
ATOM   10581 H HA2  . GLY A 1 64 ? -10.701 14.525  -8.485  1.00 0.00 ? 128 GLY A HA2  11 
ATOM   10582 H HA3  . GLY A 1 64 ? -10.113 13.423  -9.737  1.00 0.00 ? 128 GLY A HA3  11 
HETATM 10583 N N    . 2MR B 2 .  ? -16.992 -4.950  -0.599  1.00 0.00 ? 201 2MR A N    11 
HETATM 10584 C CA   . 2MR B 2 .  ? -17.031 -3.976  0.468   1.00 0.00 ? 201 2MR A CA   11 
HETATM 10585 C CB   . 2MR B 2 .  ? -15.647 -3.816  1.088   1.00 0.00 ? 201 2MR A CB   11 
HETATM 10586 C CG   . 2MR B 2 .  ? -15.608 -2.848  2.228   1.00 0.00 ? 201 2MR A CG   11 
HETATM 10587 C CD   . 2MR B 2 .  ? -14.237 -2.755  2.818   1.00 0.00 ? 201 2MR A CD   11 
HETATM 10588 N NE   . 2MR B 2 .  ? -13.271 -2.323  1.824   1.00 0.00 ? 201 2MR A NE   11 
HETATM 10589 C CZ   . 2MR B 2 .  ? -12.027 -2.055  2.073   1.00 0.00 ? 201 2MR A CZ   11 
HETATM 10590 N NH1  . 2MR B 2 .  ? -11.582 -2.186  3.367   1.00 0.00 ? 201 2MR A NH1  11 
HETATM 10591 C CQ1  . 2MR B 2 .  ? -10.258 -1.962  3.969   1.00 0.00 ? 201 2MR A CQ1  11 
HETATM 10592 N NH2  . 2MR B 2 .  ? -11.245 -1.696  1.028   1.00 0.00 ? 201 2MR A NH2  11 
HETATM 10593 C CQ2  . 2MR B 2 .  ? -9.833  -1.337  0.966   1.00 0.00 ? 201 2MR A CQ2  11 
HETATM 10594 C C    . 2MR B 2 .  ? -17.503 -2.687  -0.110  1.00 0.00 ? 201 2MR A C    11 
HETATM 10595 O O    . 2MR B 2 .  ? -18.536 -2.183  0.334   1.00 0.00 ? 201 2MR A O    11 
HETATM 10596 O OXT  . 2MR B 2 .  ? -16.873 -2.198  -1.039  1.00 0.00 ? 201 2MR A OXT  11 
HETATM 10597 H H2   . 2MR B 2 .  ? -17.912 -4.973  -1.080  1.00 0.00 ? 201 2MR A H2   11 
HETATM 10598 H H    . 2MR B 2 .  ? -16.312 -4.611  -1.307  1.00 0.00 ? 201 2MR A H    11 
HETATM 10599 H H3   . 2MR B 2 .  ? -16.712 -5.900  -0.284  1.00 0.00 ? 201 2MR A H3   11 
HETATM 10600 H HA   . 2MR B 2 .  ? -17.740 -4.260  1.231   1.00 0.00 ? 201 2MR A HA   11 
HETATM 10601 H HB2  . 2MR B 2 .  ? -14.974 -3.437  0.335   1.00 0.00 ? 201 2MR A HB2  11 
HETATM 10602 H HB3  . 2MR B 2 .  ? -15.277 -4.765  1.445   1.00 0.00 ? 201 2MR A HB3  11 
HETATM 10603 H HG2  . 2MR B 2 .  ? -16.309 -3.175  2.979   1.00 0.00 ? 201 2MR A HG2  11 
HETATM 10604 H HG3  . 2MR B 2 .  ? -15.850 -1.881  1.813   1.00 0.00 ? 201 2MR A HG3  11 
HETATM 10605 H HD2  . 2MR B 2 .  ? -13.943 -3.723  3.192   1.00 0.00 ? 201 2MR A HD2  11 
HETATM 10606 H HD3  . 2MR B 2 .  ? -14.242 -2.038  3.626   1.00 0.00 ? 201 2MR A HD3  11 
HETATM 10607 H HE   . 2MR B 2 .  ? -13.625 -2.211  0.913   1.00 0.00 ? 201 2MR A HE   11 
HETATM 10608 H HQ11 . 2MR B 2 .  ? -10.291 -2.268  5.003   1.00 0.00 ? 201 2MR A HQ11 11 
HETATM 10609 H HQ12 . 2MR B 2 .  ? -9.511  -2.534  3.439   1.00 0.00 ? 201 2MR A HQ12 11 
HETATM 10610 H HQ13 . 2MR B 2 .  ? -10.023 -0.909  3.921   1.00 0.00 ? 201 2MR A HQ13 11 
HETATM 10611 H HH2  . 2MR B 2 .  ? -11.638 -1.668  0.111   1.00 0.00 ? 201 2MR A HH2  11 
HETATM 10612 H HQ21 . 2MR B 2 .  ? -9.232  -2.221  1.123   1.00 0.00 ? 201 2MR A HQ21 11 
HETATM 10613 H HQ22 . 2MR B 2 .  ? -9.617  -0.922  -0.007  1.00 0.00 ? 201 2MR A HQ22 11 
HETATM 10614 H HQ23 . 2MR B 2 .  ? -9.605  -0.608  1.730   1.00 0.00 ? 201 2MR A HQ23 11 
HETATM 10615 H HH1  . 2MR B 2 .  ? -12.229 -2.481  4.074   1.00 0.00 ? 201 2MR A HH1  11 
ATOM   10616 N N    . ALA A 1 1  ? 8.817   -9.485  -2.773  1.00 0.00 ? 65  ALA A N    12 
ATOM   10617 C CA   . ALA A 1 1  ? 8.199   -10.127 -3.926  1.00 0.00 ? 65  ALA A CA   12 
ATOM   10618 C C    . ALA A 1 1  ? 9.200   -10.162 -5.077  1.00 0.00 ? 65  ALA A C    12 
ATOM   10619 O O    . ALA A 1 1  ? 10.386  -9.872  -4.874  1.00 0.00 ? 65  ALA A O    12 
ATOM   10620 C CB   . ALA A 1 1  ? 6.933   -9.387  -4.320  1.00 0.00 ? 65  ALA A CB   12 
ATOM   10621 H H1   . ALA A 1 1  ? 9.713   -9.958  -2.543  1.00 0.00 ? 65  ALA A H1   12 
ATOM   10622 H H2   . ALA A 1 1  ? 9.072   -8.502  -2.991  1.00 0.00 ? 65  ALA A H2   12 
ATOM   10623 H H3   . ALA A 1 1  ? 8.213   -9.498  -1.928  1.00 0.00 ? 65  ALA A H3   12 
ATOM   10624 H HA   . ALA A 1 1  ? 7.942   -11.142 -3.659  1.00 0.00 ? 65  ALA A HA   12 
ATOM   10625 H HB1  . ALA A 1 1  ? 7.178   -8.390  -4.656  1.00 0.00 ? 65  ALA A HB1  12 
ATOM   10626 H HB2  . ALA A 1 1  ? 6.435   -9.926  -5.112  1.00 0.00 ? 65  ALA A HB2  12 
ATOM   10627 H HB3  . ALA A 1 1  ? 6.275   -9.330  -3.467  1.00 0.00 ? 65  ALA A HB3  12 
ATOM   10628 N N    . SER A 1 2  ? 8.744   -10.515 -6.267  1.00 0.00 ? 66  SER A N    12 
ATOM   10629 C CA   . SER A 1 2  ? 9.614   -10.617 -7.417  1.00 0.00 ? 66  SER A CA   12 
ATOM   10630 C C    . SER A 1 2  ? 10.002  -9.232  -7.927  1.00 0.00 ? 66  SER A C    12 
ATOM   10631 O O    . SER A 1 2  ? 11.190  -8.929  -8.104  1.00 0.00 ? 66  SER A O    12 
ATOM   10632 C CB   . SER A 1 2  ? 8.897   -11.385 -8.516  1.00 0.00 ? 66  SER A CB   12 
ATOM   10633 O OG   . SER A 1 2  ? 8.380   -12.615 -8.008  1.00 0.00 ? 66  SER A OG   12 
ATOM   10634 H H    . SER A 1 2  ? 7.791   -10.707 -6.407  1.00 0.00 ? 66  SER A H    12 
ATOM   10635 H HA   . SER A 1 2  ? 10.499  -11.166 -7.133  1.00 0.00 ? 66  SER A HA   12 
ATOM   10636 H HB2  . SER A 1 2  ? 8.097   -10.767 -8.902  1.00 0.00 ? 66  SER A HB2  12 
ATOM   10637 H HB3  . SER A 1 2  ? 9.591   -11.592 -9.318  1.00 0.00 ? 66  SER A HB3  12 
ATOM   10638 H HG   . SER A 1 2  ? 9.136   -13.139 -7.711  1.00 0.00 ? 66  SER A HG   12 
ATOM   10639 N N    . THR A 1 3  ? 9.006   -8.399  -8.134  1.00 0.00 ? 67  THR A N    12 
ATOM   10640 C CA   . THR A 1 3  ? 9.200   -7.082  -8.676  1.00 0.00 ? 67  THR A CA   12 
ATOM   10641 C C    . THR A 1 3  ? 9.944   -6.186  -7.671  1.00 0.00 ? 67  THR A C    12 
ATOM   10642 O O    . THR A 1 3  ? 9.572   -6.116  -6.489  1.00 0.00 ? 67  THR A O    12 
ATOM   10643 C CB   . THR A 1 3  ? 7.834   -6.466  -9.005  1.00 0.00 ? 67  THR A CB   12 
ATOM   10644 O OG1  . THR A 1 3  ? 7.025   -7.455  -9.664  1.00 0.00 ? 67  THR A OG1  12 
ATOM   10645 C CG2  . THR A 1 3  ? 7.992   -5.278  -9.926  1.00 0.00 ? 67  THR A CG2  12 
ATOM   10646 H H    . THR A 1 3  ? 8.087   -8.670  -7.911  1.00 0.00 ? 67  THR A H    12 
ATOM   10647 H HA   . THR A 1 3  ? 9.770   -7.163  -9.589  1.00 0.00 ? 67  THR A HA   12 
ATOM   10648 H HB   . THR A 1 3  ? 7.354   -6.152  -8.093  1.00 0.00 ? 67  THR A HB   12 
ATOM   10649 H HG1  . THR A 1 3  ? 7.605   -8.134  -10.033 1.00 0.00 ? 67  THR A HG1  12 
ATOM   10650 H HG21 . THR A 1 3  ? 8.466   -5.624  -10.832 1.00 0.00 ? 67  THR A HG21 12 
ATOM   10651 H HG22 . THR A 1 3  ? 7.019   -4.870  -10.154 1.00 0.00 ? 67  THR A HG22 12 
ATOM   10652 H HG23 . THR A 1 3  ? 8.614   -4.534  -9.451  1.00 0.00 ? 67  THR A HG23 12 
ATOM   10653 N N    . GLN A 1 4  ? 10.999  -5.552  -8.130  1.00 0.00 ? 68  GLN A N    12 
ATOM   10654 C CA   . GLN A 1 4  ? 11.755  -4.646  -7.305  1.00 0.00 ? 68  GLN A CA   12 
ATOM   10655 C C    . GLN A 1 4  ? 11.078  -3.296  -7.330  1.00 0.00 ? 68  GLN A C    12 
ATOM   10656 O O    . GLN A 1 4  ? 10.799  -2.767  -8.408  1.00 0.00 ? 68  GLN A O    12 
ATOM   10657 C CB   . GLN A 1 4  ? 13.207  -4.540  -7.792  1.00 0.00 ? 68  GLN A CB   12 
ATOM   10658 C CG   . GLN A 1 4  ? 13.971  -5.854  -7.712  1.00 0.00 ? 68  GLN A CG   12 
ATOM   10659 C CD   . GLN A 1 4  ? 14.023  -6.432  -6.303  1.00 0.00 ? 68  GLN A CD   12 
ATOM   10660 O OE1  . GLN A 1 4  ? 14.042  -7.657  -6.129  1.00 0.00 ? 68  GLN A OE1  12 
ATOM   10661 N NE2  . GLN A 1 4  ? 14.110  -5.584  -5.302  1.00 0.00 ? 68  GLN A NE2  12 
ATOM   10662 H H    . GLN A 1 4  ? 11.268  -5.669  -9.066  1.00 0.00 ? 68  GLN A H    12 
ATOM   10663 H HA   . GLN A 1 4  ? 11.740  -5.033  -6.297  1.00 0.00 ? 68  GLN A HA   12 
ATOM   10664 H HB2  . GLN A 1 4  ? 13.200  -4.217  -8.822  1.00 0.00 ? 68  GLN A HB2  12 
ATOM   10665 H HB3  . GLN A 1 4  ? 13.727  -3.803  -7.200  1.00 0.00 ? 68  GLN A HB3  12 
ATOM   10666 H HG2  . GLN A 1 4  ? 13.490  -6.576  -8.353  1.00 0.00 ? 68  GLN A HG2  12 
ATOM   10667 H HG3  . GLN A 1 4  ? 14.983  -5.691  -8.053  1.00 0.00 ? 68  GLN A HG3  12 
ATOM   10668 H HE21 . GLN A 1 4  ? 14.155  -4.619  -5.488  1.00 0.00 ? 68  GLN A HE21 12 
ATOM   10669 H HE22 . GLN A 1 4  ? 14.122  -5.929  -4.384  1.00 0.00 ? 68  GLN A HE22 12 
ATOM   10670 N N    . PRO A 1 5  ? 10.771  -2.728  -6.167  1.00 0.00 ? 69  PRO A N    12 
ATOM   10671 C CA   . PRO A 1 5  ? 10.059  -1.474  -6.098  1.00 0.00 ? 69  PRO A CA   12 
ATOM   10672 C C    . PRO A 1 5  ? 10.905  -0.298  -6.559  1.00 0.00 ? 69  PRO A C    12 
ATOM   10673 O O    . PRO A 1 5  ? 12.074  -0.160  -6.183  1.00 0.00 ? 69  PRO A O    12 
ATOM   10674 C CB   . PRO A 1 5  ? 9.715   -1.327  -4.616  1.00 0.00 ? 69  PRO A CB   12 
ATOM   10675 C CG   . PRO A 1 5  ? 10.753  -2.122  -3.906  1.00 0.00 ? 69  PRO A CG   12 
ATOM   10676 C CD   . PRO A 1 5  ? 11.103  -3.256  -4.827  1.00 0.00 ? 69  PRO A CD   12 
ATOM   10677 H HA   . PRO A 1 5  ? 9.146   -1.520  -6.670  1.00 0.00 ? 69  PRO A HA   12 
ATOM   10678 H HB2  . PRO A 1 5  ? 9.752   -0.283  -4.342  1.00 0.00 ? 69  PRO A HB2  12 
ATOM   10679 H HB3  . PRO A 1 5  ? 8.724   -1.718  -4.438  1.00 0.00 ? 69  PRO A HB3  12 
ATOM   10680 H HG2  . PRO A 1 5  ? 11.617  -1.499  -3.730  1.00 0.00 ? 69  PRO A HG2  12 
ATOM   10681 H HG3  . PRO A 1 5  ? 10.361  -2.497  -2.972  1.00 0.00 ? 69  PRO A HG3  12 
ATOM   10682 H HD2  . PRO A 1 5  ? 12.154  -3.493  -4.756  1.00 0.00 ? 69  PRO A HD2  12 
ATOM   10683 H HD3  . PRO A 1 5  ? 10.503  -4.125  -4.602  1.00 0.00 ? 69  PRO A HD3  12 
ATOM   10684 N N    . THR A 1 6  ? 10.324  0.531   -7.371  1.00 0.00 ? 70  THR A N    12 
ATOM   10685 C CA   . THR A 1 6  ? 10.992  1.723   -7.809  1.00 0.00 ? 70  THR A CA   12 
ATOM   10686 C C    . THR A 1 6  ? 10.339  2.927   -7.127  1.00 0.00 ? 70  THR A C    12 
ATOM   10687 O O    . THR A 1 6  ? 10.823  4.057   -7.200  1.00 0.00 ? 70  THR A O    12 
ATOM   10688 C CB   . THR A 1 6  ? 10.966  1.862   -9.371  1.00 0.00 ? 70  THR A CB   12 
ATOM   10689 O OG1  . THR A 1 6  ? 11.808  2.951   -9.802  1.00 0.00 ? 70  THR A OG1  12 
ATOM   10690 C CG2  . THR A 1 6  ? 9.544   2.077   -9.896  1.00 0.00 ? 70  THR A CG2  12 
ATOM   10691 H H    . THR A 1 6  ? 9.431   0.312   -7.718  1.00 0.00 ? 70  THR A H    12 
ATOM   10692 H HA   . THR A 1 6  ? 12.014  1.651   -7.471  1.00 0.00 ? 70  THR A HA   12 
ATOM   10693 H HB   . THR A 1 6  ? 11.362  0.949   -9.792  1.00 0.00 ? 70  THR A HB   12 
ATOM   10694 H HG1  . THR A 1 6  ? 12.698  2.747   -9.478  1.00 0.00 ? 70  THR A HG1  12 
ATOM   10695 H HG21 . THR A 1 6  ? 9.136   2.980   -9.465  1.00 0.00 ? 70  THR A HG21 12 
ATOM   10696 H HG22 . THR A 1 6  ? 9.564   2.169   -10.972 1.00 0.00 ? 70  THR A HG22 12 
ATOM   10697 H HG23 . THR A 1 6  ? 8.926   1.236   -9.619  1.00 0.00 ? 70  THR A HG23 12 
ATOM   10698 N N    . HIS A 1 7  ? 9.259   2.655   -6.429  1.00 0.00 ? 71  HIS A N    12 
ATOM   10699 C CA   . HIS A 1 7  ? 8.507   3.676   -5.747  1.00 0.00 ? 71  HIS A CA   12 
ATOM   10700 C C    . HIS A 1 7  ? 9.125   3.965   -4.398  1.00 0.00 ? 71  HIS A C    12 
ATOM   10701 O O    . HIS A 1 7  ? 9.395   3.042   -3.616  1.00 0.00 ? 71  HIS A O    12 
ATOM   10702 C CB   . HIS A 1 7  ? 7.047   3.254   -5.566  1.00 0.00 ? 71  HIS A CB   12 
ATOM   10703 C CG   . HIS A 1 7  ? 6.257   3.120   -6.832  1.00 0.00 ? 71  HIS A CG   12 
ATOM   10704 N ND1  . HIS A 1 7  ? 5.492   4.128   -7.361  1.00 0.00 ? 71  HIS A ND1  12 
ATOM   10705 C CD2  . HIS A 1 7  ? 6.110   2.064   -7.661  1.00 0.00 ? 71  HIS A CD2  12 
ATOM   10706 C CE1  . HIS A 1 7  ? 4.914   3.672   -8.472  1.00 0.00 ? 71  HIS A CE1  12 
ATOM   10707 N NE2  . HIS A 1 7  ? 5.259   2.416   -8.704  1.00 0.00 ? 71  HIS A NE2  12 
ATOM   10708 H H    . HIS A 1 7  ? 8.971   1.724   -6.352  1.00 0.00 ? 71  HIS A H    12 
ATOM   10709 H HA   . HIS A 1 7  ? 8.537   4.572   -6.349  1.00 0.00 ? 71  HIS A HA   12 
ATOM   10710 H HB2  . HIS A 1 7  ? 7.023   2.295   -5.069  1.00 0.00 ? 71  HIS A HB2  12 
ATOM   10711 H HB3  . HIS A 1 7  ? 6.552   3.979   -4.936  1.00 0.00 ? 71  HIS A HB3  12 
ATOM   10712 H HD1  . HIS A 1 7  ? 5.397   5.032   -6.984  1.00 0.00 ? 71  HIS A HD1  12 
ATOM   10713 H HD2  . HIS A 1 7  ? 6.572   1.098   -7.535  1.00 0.00 ? 71  HIS A HD2  12 
ATOM   10714 H HE1  . HIS A 1 7  ? 4.254   4.251   -9.101  1.00 0.00 ? 71  HIS A HE1  12 
ATOM   10715 N N    . SER A 1 8  ? 9.389   5.209   -4.150  1.00 0.00 ? 72  SER A N    12 
ATOM   10716 C CA   . SER A 1 8  ? 9.929   5.645   -2.897  1.00 0.00 ? 72  SER A CA   12 
ATOM   10717 C C    . SER A 1 8  ? 8.792   6.267   -2.083  1.00 0.00 ? 72  SER A C    12 
ATOM   10718 O O    . SER A 1 8  ? 8.215   7.277   -2.484  1.00 0.00 ? 72  SER A O    12 
ATOM   10719 C CB   . SER A 1 8  ? 11.046  6.651   -3.163  1.00 0.00 ? 72  SER A CB   12 
ATOM   10720 O OG   . SER A 1 8  ? 12.000  6.098   -4.087  1.00 0.00 ? 72  SER A OG   12 
ATOM   10721 H H    . SER A 1 8  ? 9.200   5.883   -4.839  1.00 0.00 ? 72  SER A H    12 
ATOM   10722 H HA   . SER A 1 8  ? 10.325  4.786   -2.378  1.00 0.00 ? 72  SER A HA   12 
ATOM   10723 H HB2  . SER A 1 8  ? 10.628  7.553   -3.583  1.00 0.00 ? 72  SER A HB2  12 
ATOM   10724 H HB3  . SER A 1 8  ? 11.553  6.881   -2.238  1.00 0.00 ? 72  SER A HB3  12 
ATOM   10725 H HG   . SER A 1 8  ? 12.013  5.144   -3.930  1.00 0.00 ? 72  SER A HG   12 
ATOM   10726 N N    . TRP A 1 9  ? 8.447   5.639   -0.988  1.00 0.00 ? 73  TRP A N    12 
ATOM   10727 C CA   . TRP A 1 9  ? 7.315   6.050   -0.178  1.00 0.00 ? 73  TRP A CA   12 
ATOM   10728 C C    . TRP A 1 9  ? 7.738   6.485   1.200   1.00 0.00 ? 73  TRP A C    12 
ATOM   10729 O O    . TRP A 1 9  ? 8.765   6.036   1.701   1.00 0.00 ? 73  TRP A O    12 
ATOM   10730 C CB   . TRP A 1 9  ? 6.316   4.918   -0.057  1.00 0.00 ? 73  TRP A CB   12 
ATOM   10731 C CG   . TRP A 1 9  ? 5.615   4.595   -1.327  1.00 0.00 ? 73  TRP A CG   12 
ATOM   10732 C CD1  . TRP A 1 9  ? 5.836   3.532   -2.140  1.00 0.00 ? 73  TRP A CD1  12 
ATOM   10733 C CD2  . TRP A 1 9  ? 4.578   5.360   -1.937  1.00 0.00 ? 73  TRP A CD2  12 
ATOM   10734 N NE1  . TRP A 1 9  ? 4.984   3.575   -3.206  1.00 0.00 ? 73  TRP A NE1  12 
ATOM   10735 C CE2  . TRP A 1 9  ? 4.210   4.693   -3.111  1.00 0.00 ? 73  TRP A CE2  12 
ATOM   10736 C CE3  . TRP A 1 9  ? 3.923   6.547   -1.599  1.00 0.00 ? 73  TRP A CE3  12 
ATOM   10737 C CZ2  . TRP A 1 9  ? 3.218   5.165   -3.948  1.00 0.00 ? 73  TRP A CZ2  12 
ATOM   10738 C CZ3  . TRP A 1 9  ? 2.939   7.013   -2.434  1.00 0.00 ? 73  TRP A CZ3  12 
ATOM   10739 C CH2  . TRP A 1 9  ? 2.599   6.326   -3.595  1.00 0.00 ? 73  TRP A CH2  12 
ATOM   10740 H H    . TRP A 1 9  ? 8.979   4.875   -0.674  1.00 0.00 ? 73  TRP A H    12 
ATOM   10741 H HA   . TRP A 1 9  ? 6.828   6.874   -0.677  1.00 0.00 ? 73  TRP A HA   12 
ATOM   10742 H HB2  . TRP A 1 9  ? 6.831   4.029   0.275   1.00 0.00 ? 73  TRP A HB2  12 
ATOM   10743 H HB3  . TRP A 1 9  ? 5.578   5.196   0.678   1.00 0.00 ? 73  TRP A HB3  12 
ATOM   10744 H HD1  . TRP A 1 9  ? 6.569   2.762   -1.953  1.00 0.00 ? 73  TRP A HD1  12 
ATOM   10745 H HE1  . TRP A 1 9  ? 4.939   2.913   -3.930  1.00 0.00 ? 73  TRP A HE1  12 
ATOM   10746 H HE3  . TRP A 1 9  ? 4.173   7.094   -0.702  1.00 0.00 ? 73  TRP A HE3  12 
ATOM   10747 H HZ2  . TRP A 1 9  ? 2.939   4.644   -4.853  1.00 0.00 ? 73  TRP A HZ2  12 
ATOM   10748 H HZ3  . TRP A 1 9  ? 2.418   7.928   -2.198  1.00 0.00 ? 73  TRP A HZ3  12 
ATOM   10749 H HH2  . TRP A 1 9  ? 1.818   6.725   -4.222  1.00 0.00 ? 73  TRP A HH2  12 
ATOM   10750 N N    . LYS A 1 10 ? 6.969   7.374   1.808   1.00 0.00 ? 74  LYS A N    12 
ATOM   10751 C CA   . LYS A 1 10 ? 7.248   7.810   3.152   1.00 0.00 ? 74  LYS A CA   12 
ATOM   10752 C C    . LYS A 1 10 ? 6.019   7.728   4.050   1.00 0.00 ? 74  LYS A C    12 
ATOM   10753 O O    . LYS A 1 10 ? 4.881   7.683   3.577   1.00 0.00 ? 74  LYS A O    12 
ATOM   10754 C CB   . LYS A 1 10 ? 7.830   9.213   3.195   1.00 0.00 ? 74  LYS A CB   12 
ATOM   10755 C CG   . LYS A 1 10 ? 6.961   10.289  2.574   1.00 0.00 ? 74  LYS A CG   12 
ATOM   10756 C CD   . LYS A 1 10 ? 7.483   11.669  2.943   1.00 0.00 ? 74  LYS A CD   12 
ATOM   10757 C CE   . LYS A 1 10 ? 7.017   12.069  4.347   1.00 0.00 ? 74  LYS A CE   12 
ATOM   10758 N NZ   . LYS A 1 10 ? 5.611   12.524  4.333   1.00 0.00 ? 74  LYS A NZ   12 
ATOM   10759 H H    . LYS A 1 10 ? 6.182   7.744   1.356   1.00 0.00 ? 74  LYS A H    12 
ATOM   10760 H HA   . LYS A 1 10 ? 7.986   7.126   3.543   1.00 0.00 ? 74  LYS A HA   12 
ATOM   10761 H HB2  . LYS A 1 10 ? 8.029   9.483   4.221   1.00 0.00 ? 74  LYS A HB2  12 
ATOM   10762 H HB3  . LYS A 1 10 ? 8.762   9.183   2.649   1.00 0.00 ? 74  LYS A HB3  12 
ATOM   10763 H HG2  . LYS A 1 10 ? 6.921   10.167  1.503   1.00 0.00 ? 74  LYS A HG2  12 
ATOM   10764 H HG3  . LYS A 1 10 ? 5.965   10.179  2.977   1.00 0.00 ? 74  LYS A HG3  12 
ATOM   10765 H HD2  . LYS A 1 10 ? 8.562   11.659  2.917   1.00 0.00 ? 74  LYS A HD2  12 
ATOM   10766 H HD3  . LYS A 1 10 ? 7.109   12.390  2.231   1.00 0.00 ? 74  LYS A HD3  12 
ATOM   10767 H HE2  . LYS A 1 10 ? 7.076   11.212  5.006   1.00 0.00 ? 74  LYS A HE2  12 
ATOM   10768 H HE3  . LYS A 1 10 ? 7.641   12.863  4.729   1.00 0.00 ? 74  LYS A HE3  12 
ATOM   10769 H HZ1  . LYS A 1 10 ? 5.029   11.905  3.720   1.00 0.00 ? 74  LYS A HZ1  12 
ATOM   10770 H HZ2  . LYS A 1 10 ? 5.181   12.560  5.275   1.00 0.00 ? 74  LYS A HZ2  12 
ATOM   10771 H HZ3  . LYS A 1 10 ? 5.563   13.473  3.907   1.00 0.00 ? 74  LYS A HZ3  12 
ATOM   10772 N N    . VAL A 1 11 ? 6.277   7.690   5.338   1.00 0.00 ? 75  VAL A N    12 
ATOM   10773 C CA   . VAL A 1 11 ? 5.254   7.649   6.368   1.00 0.00 ? 75  VAL A CA   12 
ATOM   10774 C C    . VAL A 1 11 ? 4.407   8.928   6.344   1.00 0.00 ? 75  VAL A C    12 
ATOM   10775 O O    . VAL A 1 11 ? 4.946   10.039  6.192   1.00 0.00 ? 75  VAL A O    12 
ATOM   10776 C CB   . VAL A 1 11 ? 5.916   7.482   7.765   1.00 0.00 ? 75  VAL A CB   12 
ATOM   10777 C CG1  . VAL A 1 11 ? 4.902   7.616   8.893   1.00 0.00 ? 75  VAL A CG1  12 
ATOM   10778 C CG2  . VAL A 1 11 ? 6.617   6.138   7.853   1.00 0.00 ? 75  VAL A CG2  12 
ATOM   10779 H H    . VAL A 1 11 ? 7.219   7.700   5.616   1.00 0.00 ? 75  VAL A H    12 
ATOM   10780 H HA   . VAL A 1 11 ? 4.629   6.788   6.182   1.00 0.00 ? 75  VAL A HA   12 
ATOM   10781 H HB   . VAL A 1 11 ? 6.662   8.257   7.869   1.00 0.00 ? 75  VAL A HB   12 
ATOM   10782 H HG11 . VAL A 1 11 ? 4.140   6.858   8.790   1.00 0.00 ? 75  VAL A HG11 12 
ATOM   10783 H HG12 . VAL A 1 11 ? 5.403   7.513   9.844   1.00 0.00 ? 75  VAL A HG12 12 
ATOM   10784 H HG13 . VAL A 1 11 ? 4.455   8.598   8.825   1.00 0.00 ? 75  VAL A HG13 12 
ATOM   10785 H HG21 . VAL A 1 11 ? 7.413   6.093   7.126   1.00 0.00 ? 75  VAL A HG21 12 
ATOM   10786 H HG22 . VAL A 1 11 ? 7.023   6.018   8.845   1.00 0.00 ? 75  VAL A HG22 12 
ATOM   10787 H HG23 . VAL A 1 11 ? 5.905   5.348   7.664   1.00 0.00 ? 75  VAL A HG23 12 
ATOM   10788 N N    . GLY A 1 12 ? 3.106   8.772   6.470   1.00 0.00 ? 76  GLY A N    12 
ATOM   10789 C CA   . GLY A 1 12 ? 2.222   9.913   6.511   1.00 0.00 ? 76  GLY A CA   12 
ATOM   10790 C C    . GLY A 1 12 ? 1.755   10.317  5.144   1.00 0.00 ? 76  GLY A C    12 
ATOM   10791 O O    . GLY A 1 12 ? 1.164   11.386  4.965   1.00 0.00 ? 76  GLY A O    12 
ATOM   10792 H H    . GLY A 1 12 ? 2.722   7.868   6.550   1.00 0.00 ? 76  GLY A H    12 
ATOM   10793 H HA2  . GLY A 1 12 ? 1.362   9.671   7.117   1.00 0.00 ? 76  GLY A HA2  12 
ATOM   10794 H HA3  . GLY A 1 12 ? 2.749   10.741  6.962   1.00 0.00 ? 76  GLY A HA3  12 
ATOM   10795 N N    . ASP A 1 13 ? 2.034   9.489   4.174   1.00 0.00 ? 77  ASP A N    12 
ATOM   10796 C CA   . ASP A 1 13 ? 1.626   9.764   2.827   1.00 0.00 ? 77  ASP A CA   12 
ATOM   10797 C C    . ASP A 1 13 ? 0.523   8.899   2.370   1.00 0.00 ? 77  ASP A C    12 
ATOM   10798 O O    . ASP A 1 13 ? 0.352   7.770   2.847   1.00 0.00 ? 77  ASP A O    12 
ATOM   10799 C CB   . ASP A 1 13 ? 2.777   9.700   1.858   1.00 0.00 ? 77  ASP A CB   12 
ATOM   10800 C CG   . ASP A 1 13 ? 3.326   11.060  1.607   1.00 0.00 ? 77  ASP A CG   12 
ATOM   10801 O OD1  . ASP A 1 13 ? 4.157   11.545  2.384   1.00 0.00 ? 77  ASP A OD1  12 
ATOM   10802 O OD2  . ASP A 1 13 ? 2.889   11.697  0.633   1.00 0.00 ? 77  ASP A OD2  12 
ATOM   10803 H H    . ASP A 1 13 ? 2.544   8.672   4.358   1.00 0.00 ? 77  ASP A H    12 
ATOM   10804 H HA   . ASP A 1 13 ? 1.261   10.780  2.824   1.00 0.00 ? 77  ASP A HA   12 
ATOM   10805 H HB2  . ASP A 1 13 ? 3.537   9.056   2.273   1.00 0.00 ? 77  ASP A HB2  12 
ATOM   10806 H HB3  . ASP A 1 13 ? 2.451   9.270   0.923   1.00 0.00 ? 77  ASP A HB3  12 
ATOM   10807 N N    . LYS A 1 14 ? -0.212  9.417   1.431   1.00 0.00 ? 78  LYS A N    12 
ATOM   10808 C CA   . LYS A 1 14 ? -1.313  8.735   0.862   1.00 0.00 ? 78  LYS A CA   12 
ATOM   10809 C C    . LYS A 1 14 ? -0.818  7.979   -0.331  1.00 0.00 ? 78  LYS A C    12 
ATOM   10810 O O    . LYS A 1 14 ? 0.019   8.471   -1.106  1.00 0.00 ? 78  LYS A O    12 
ATOM   10811 C CB   . LYS A 1 14 ? -2.396  9.707   0.394   1.00 0.00 ? 78  LYS A CB   12 
ATOM   10812 C CG   . LYS A 1 14 ? -2.927  10.660  1.440   1.00 0.00 ? 78  LYS A CG   12 
ATOM   10813 C CD   . LYS A 1 14 ? -3.683  9.972   2.565   1.00 0.00 ? 78  LYS A CD   12 
ATOM   10814 C CE   . LYS A 1 14 ? -4.323  11.031  3.461   1.00 0.00 ? 78  LYS A CE   12 
ATOM   10815 N NZ   . LYS A 1 14 ? -4.966  10.474  4.667   1.00 0.00 ? 78  LYS A NZ   12 
ATOM   10816 H H    . LYS A 1 14 ? 0.022   10.301  1.077   1.00 0.00 ? 78  LYS A H    12 
ATOM   10817 H HA   . LYS A 1 14 ? -1.732  8.058   1.591   1.00 0.00 ? 78  LYS A HA   12 
ATOM   10818 H HB2  . LYS A 1 14 ? -2.000  10.298  -0.418  1.00 0.00 ? 78  LYS A HB2  12 
ATOM   10819 H HB3  . LYS A 1 14 ? -3.224  9.124   0.020   1.00 0.00 ? 78  LYS A HB3  12 
ATOM   10820 H HG2  . LYS A 1 14 ? -2.062  11.133  1.876   1.00 0.00 ? 78  LYS A HG2  12 
ATOM   10821 H HG3  . LYS A 1 14 ? -3.558  11.402  0.974   1.00 0.00 ? 78  LYS A HG3  12 
ATOM   10822 H HD2  . LYS A 1 14 ? -4.438  9.325   2.140   1.00 0.00 ? 78  LYS A HD2  12 
ATOM   10823 H HD3  . LYS A 1 14 ? -2.994  9.378   3.148   1.00 0.00 ? 78  LYS A HD3  12 
ATOM   10824 H HE2  . LYS A 1 14 ? -3.553  11.722  3.769   1.00 0.00 ? 78  LYS A HE2  12 
ATOM   10825 H HE3  . LYS A 1 14 ? -5.059  11.568  2.882   1.00 0.00 ? 78  LYS A HE3  12 
ATOM   10826 H HZ1  . LYS A 1 14 ? -5.654  9.724   4.461   1.00 0.00 ? 78  LYS A HZ1  12 
ATOM   10827 H HZ2  . LYS A 1 14 ? -4.240  10.108  5.324   1.00 0.00 ? 78  LYS A HZ2  12 
ATOM   10828 H HZ3  . LYS A 1 14 ? -5.459  11.230  5.187   1.00 0.00 ? 78  LYS A HZ3  12 
ATOM   10829 N N    . CYS A 1 15 ? -1.297  6.821   -0.448  1.00 0.00 ? 79  CYS A N    12 
ATOM   10830 C CA   . CYS A 1 15 ? -1.003  5.955   -1.533  1.00 0.00 ? 79  CYS A CA   12 
ATOM   10831 C C    . CYS A 1 15 ? -2.235  5.156   -1.840  1.00 0.00 ? 79  CYS A C    12 
ATOM   10832 O O    . CYS A 1 15 ? -3.268  5.318   -1.192  1.00 0.00 ? 79  CYS A O    12 
ATOM   10833 C CB   . CYS A 1 15 ? 0.136   5.018   -1.158  1.00 0.00 ? 79  CYS A CB   12 
ATOM   10834 S SG   . CYS A 1 15 ? -0.157  4.057   0.355   1.00 0.00 ? 79  CYS A SG   12 
ATOM   10835 H H    . CYS A 1 15 ? -1.906  6.514   0.259   1.00 0.00 ? 79  CYS A H    12 
ATOM   10836 H HA   . CYS A 1 15 ? -0.715  6.541   -2.393  1.00 0.00 ? 79  CYS A HA   12 
ATOM   10837 H HB2  . CYS A 1 15 ? 0.282   4.329   -1.977  1.00 0.00 ? 79  CYS A HB2  12 
ATOM   10838 H HB3  . CYS A 1 15 ? 1.034   5.601   -1.037  1.00 0.00 ? 79  CYS A HB3  12 
ATOM   10839 H HG   . CYS A 1 15 ? -1.267  4.468   0.953   1.00 0.00 ? 79  CYS A HG   12 
ATOM   10840 N N    . MET A 1 16 ? -2.161  4.346   -2.824  1.00 0.00 ? 80  MET A N    12 
ATOM   10841 C CA   . MET A 1 16 ? -3.215  3.451   -3.117  1.00 0.00 ? 80  MET A CA   12 
ATOM   10842 C C    . MET A 1 16 ? -2.649  2.089   -3.012  1.00 0.00 ? 80  MET A C    12 
ATOM   10843 O O    . MET A 1 16 ? -1.604  1.820   -3.583  1.00 0.00 ? 80  MET A O    12 
ATOM   10844 C CB   . MET A 1 16 ? -3.771  3.675   -4.505  1.00 0.00 ? 80  MET A CB   12 
ATOM   10845 C CG   . MET A 1 16 ? -4.146  5.108   -4.781  1.00 0.00 ? 80  MET A CG   12 
ATOM   10846 S SD   . MET A 1 16 ? -5.028  5.295   -6.318  1.00 0.00 ? 80  MET A SD   12 
ATOM   10847 C CE   . MET A 1 16 ? -6.555  4.476   -5.871  1.00 0.00 ? 80  MET A CE   12 
ATOM   10848 H H    . MET A 1 16 ? -1.355  4.349   -3.390  1.00 0.00 ? 80  MET A H    12 
ATOM   10849 H HA   . MET A 1 16 ? -3.996  3.579   -2.382  1.00 0.00 ? 80  MET A HA   12 
ATOM   10850 H HB2  . MET A 1 16 ? -3.029  3.365   -5.225  1.00 0.00 ? 80  MET A HB2  12 
ATOM   10851 H HB3  . MET A 1 16 ? -4.650  3.061   -4.624  1.00 0.00 ? 80  MET A HB3  12 
ATOM   10852 H HG2  . MET A 1 16 ? -4.767  5.469   -3.975  1.00 0.00 ? 80  MET A HG2  12 
ATOM   10853 H HG3  . MET A 1 16 ? -3.238  5.691   -4.825  1.00 0.00 ? 80  MET A HG3  12 
ATOM   10854 H HE1  . MET A 1 16 ? -6.925  4.942   -4.968  1.00 0.00 ? 80  MET A HE1  12 
ATOM   10855 H HE2  . MET A 1 16 ? -7.277  4.580   -6.666  1.00 0.00 ? 80  MET A HE2  12 
ATOM   10856 H HE3  . MET A 1 16 ? -6.365  3.432   -5.672  1.00 0.00 ? 80  MET A HE3  12 
ATOM   10857 N N    . ALA A 1 17 ? -3.300  1.253   -2.296  1.00 0.00 ? 81  ALA A N    12 
ATOM   10858 C CA   . ALA A 1 17 ? -2.819  -0.064  -2.057  1.00 0.00 ? 81  ALA A CA   12 
ATOM   10859 C C    . ALA A 1 17 ? -3.783  -1.046  -2.613  1.00 0.00 ? 81  ALA A C    12 
ATOM   10860 O O    . ALA A 1 17 ? -4.976  -0.760  -2.714  1.00 0.00 ? 81  ALA A O    12 
ATOM   10861 C CB   . ALA A 1 17 ? -2.666  -0.294  -0.572  1.00 0.00 ? 81  ALA A CB   12 
ATOM   10862 H H    . ALA A 1 17 ? -4.175  1.518   -1.927  1.00 0.00 ? 81  ALA A H    12 
ATOM   10863 H HA   . ALA A 1 17 ? -1.851  -0.182  -2.520  1.00 0.00 ? 81  ALA A HA   12 
ATOM   10864 H HB1  . ALA A 1 17 ? -3.615  -0.115  -0.089  1.00 0.00 ? 81  ALA A HB1  12 
ATOM   10865 H HB2  . ALA A 1 17 ? -2.370  -1.317  -0.393  1.00 0.00 ? 81  ALA A HB2  12 
ATOM   10866 H HB3  . ALA A 1 17 ? -1.922  0.378   -0.169  1.00 0.00 ? 81  ALA A HB3  12 
ATOM   10867 N N    . VAL A 1 18 ? -3.286  -2.173  -2.992  1.00 0.00 ? 82  VAL A N    12 
ATOM   10868 C CA   . VAL A 1 18 ? -4.116  -3.229  -3.480  1.00 0.00 ? 82  VAL A CA   12 
ATOM   10869 C C    . VAL A 1 18 ? -4.564  -4.028  -2.283  1.00 0.00 ? 82  VAL A C    12 
ATOM   10870 O O    . VAL A 1 18 ? -3.743  -4.616  -1.597  1.00 0.00 ? 82  VAL A O    12 
ATOM   10871 C CB   . VAL A 1 18 ? -3.347  -4.145  -4.477  1.00 0.00 ? 82  VAL A CB   12 
ATOM   10872 C CG1  . VAL A 1 18 ? -4.244  -5.256  -5.008  1.00 0.00 ? 82  VAL A CG1  12 
ATOM   10873 C CG2  . VAL A 1 18 ? -2.779  -3.330  -5.633  1.00 0.00 ? 82  VAL A CG2  12 
ATOM   10874 H H    . VAL A 1 18 ? -2.316  -2.303  -2.943  1.00 0.00 ? 82  VAL A H    12 
ATOM   10875 H HA   . VAL A 1 18 ? -4.984  -2.811  -3.965  1.00 0.00 ? 82  VAL A HA   12 
ATOM   10876 H HB   . VAL A 1 18 ? -2.524  -4.600  -3.946  1.00 0.00 ? 82  VAL A HB   12 
ATOM   10877 H HG11 . VAL A 1 18 ? -5.092  -4.825  -5.519  1.00 0.00 ? 82  VAL A HG11 12 
ATOM   10878 H HG12 . VAL A 1 18 ? -3.685  -5.874  -5.695  1.00 0.00 ? 82  VAL A HG12 12 
ATOM   10879 H HG13 . VAL A 1 18 ? -4.592  -5.861  -4.183  1.00 0.00 ? 82  VAL A HG13 12 
ATOM   10880 H HG21 . VAL A 1 18 ? -2.110  -2.575  -5.246  1.00 0.00 ? 82  VAL A HG21 12 
ATOM   10881 H HG22 . VAL A 1 18 ? -2.237  -3.983  -6.301  1.00 0.00 ? 82  VAL A HG22 12 
ATOM   10882 H HG23 . VAL A 1 18 ? -3.586  -2.856  -6.171  1.00 0.00 ? 82  VAL A HG23 12 
ATOM   10883 N N    . TRP A 1 19 ? -5.850  -3.993  -2.014  1.00 0.00 ? 83  TRP A N    12 
ATOM   10884 C CA   . TRP A 1 19 ? -6.425  -4.665  -0.883  1.00 0.00 ? 83  TRP A CA   12 
ATOM   10885 C C    . TRP A 1 19 ? -6.276  -6.143  -1.076  1.00 0.00 ? 83  TRP A C    12 
ATOM   10886 O O    . TRP A 1 19 ? -6.846  -6.711  -2.001  1.00 0.00 ? 83  TRP A O    12 
ATOM   10887 C CB   . TRP A 1 19 ? -7.908  -4.292  -0.733  1.00 0.00 ? 83  TRP A CB   12 
ATOM   10888 C CG   . TRP A 1 19 ? -8.508  -4.684  0.593   1.00 0.00 ? 83  TRP A CG   12 
ATOM   10889 C CD1  . TRP A 1 19 ? -7.859  -4.752  1.779   1.00 0.00 ? 83  TRP A CD1  12 
ATOM   10890 C CD2  . TRP A 1 19 ? -9.873  -5.009  0.878   1.00 0.00 ? 83  TRP A CD2  12 
ATOM   10891 N NE1  . TRP A 1 19 ? -8.703  -5.113  2.772   1.00 0.00 ? 83  TRP A NE1  12 
ATOM   10892 C CE2  . TRP A 1 19 ? -9.950  -5.276  2.257   1.00 0.00 ? 83  TRP A CE2  12 
ATOM   10893 C CE3  . TRP A 1 19 ? -11.032 -5.109  0.116   1.00 0.00 ? 83  TRP A CE3  12 
ATOM   10894 C CZ2  . TRP A 1 19 ? -11.130 -5.636  2.882   1.00 0.00 ? 83  TRP A CZ2  12 
ATOM   10895 C CZ3  . TRP A 1 19 ? -12.209 -5.469  0.746   1.00 0.00 ? 83  TRP A CZ3  12 
ATOM   10896 C CH2  . TRP A 1 19 ? -12.240 -5.727  2.118   1.00 0.00 ? 83  TRP A CH2  12 
ATOM   10897 H H    . TRP A 1 19 ? -6.439  -3.496  -2.624  1.00 0.00 ? 83  TRP A H    12 
ATOM   10898 H HA   . TRP A 1 19 ? -5.893  -4.363  0.005   1.00 0.00 ? 83  TRP A HA   12 
ATOM   10899 H HB2  . TRP A 1 19 ? -8.003  -3.225  -0.847  1.00 0.00 ? 83  TRP A HB2  12 
ATOM   10900 H HB3  . TRP A 1 19 ? -8.471  -4.779  -1.515  1.00 0.00 ? 83  TRP A HB3  12 
ATOM   10901 H HD1  . TRP A 1 19 ? -6.807  -4.558  1.896   1.00 0.00 ? 83  TRP A HD1  12 
ATOM   10902 H HE1  . TRP A 1 19 ? -8.434  -5.225  3.712   1.00 0.00 ? 83  TRP A HE1  12 
ATOM   10903 H HE3  . TRP A 1 19 ? -11.018 -4.908  -0.944  1.00 0.00 ? 83  TRP A HE3  12 
ATOM   10904 H HZ2  . TRP A 1 19 ? -11.186 -5.841  3.940   1.00 0.00 ? 83  TRP A HZ2  12 
ATOM   10905 H HZ3  . TRP A 1 19 ? -13.131 -5.551  0.189   1.00 0.00 ? 83  TRP A HZ3  12 
ATOM   10906 H HH2  . TRP A 1 19 ? -13.170 -6.011  2.581   1.00 0.00 ? 83  TRP A HH2  12 
ATOM   10907 N N    . SER A 1 20 ? -5.534  -6.749  -0.202  1.00 0.00 ? 84  SER A N    12 
ATOM   10908 C CA   . SER A 1 20 ? -5.208  -8.161  -0.249  1.00 0.00 ? 84  SER A CA   12 
ATOM   10909 C C    . SER A 1 20 ? -6.474  -9.047  -0.143  1.00 0.00 ? 84  SER A C    12 
ATOM   10910 O O    . SER A 1 20 ? -6.447  -10.240 -0.454  1.00 0.00 ? 84  SER A O    12 
ATOM   10911 C CB   . SER A 1 20 ? -4.159  -8.474  0.845   1.00 0.00 ? 84  SER A CB   12 
ATOM   10912 O OG   . SER A 1 20 ? -3.764  -9.839  0.863   1.00 0.00 ? 84  SER A OG   12 
ATOM   10913 H H    . SER A 1 20 ? -5.162  -6.206  0.535   1.00 0.00 ? 84  SER A H    12 
ATOM   10914 H HA   . SER A 1 20 ? -4.758  -8.343  -1.214  1.00 0.00 ? 84  SER A HA   12 
ATOM   10915 H HB2  . SER A 1 20 ? -3.280  -7.874  0.662   1.00 0.00 ? 84  SER A HB2  12 
ATOM   10916 H HB3  . SER A 1 20 ? -4.561  -8.204  1.808   1.00 0.00 ? 84  SER A HB3  12 
ATOM   10917 H HG   . SER A 1 20 ? -4.185  -10.223 1.644   1.00 0.00 ? 84  SER A HG   12 
ATOM   10918 N N    . GLU A 1 21 ? -7.573  -8.460  0.296   1.00 0.00 ? 85  GLU A N    12 
ATOM   10919 C CA   . GLU A 1 21 ? -8.819  -9.183  0.399   1.00 0.00 ? 85  GLU A CA   12 
ATOM   10920 C C    . GLU A 1 21 ? -9.557  -9.214  -0.939  1.00 0.00 ? 85  GLU A C    12 
ATOM   10921 O O    . GLU A 1 21 ? -10.100 -10.242 -1.326  1.00 0.00 ? 85  GLU A O    12 
ATOM   10922 C CB   . GLU A 1 21 ? -9.723  -8.538  1.423   1.00 0.00 ? 85  GLU A CB   12 
ATOM   10923 C CG   . GLU A 1 21 ? -9.205  -8.535  2.846   1.00 0.00 ? 85  GLU A CG   12 
ATOM   10924 C CD   . GLU A 1 21 ? -9.209  -9.899  3.476   1.00 0.00 ? 85  GLU A CD   12 
ATOM   10925 O OE1  . GLU A 1 21 ? -10.258 -10.319 3.977   1.00 0.00 ? 85  GLU A OE1  12 
ATOM   10926 O OE2  . GLU A 1 21 ? -8.167  -10.589 3.472   1.00 0.00 ? 85  GLU A OE2  12 
ATOM   10927 H H    . GLU A 1 21 ? -7.529  -7.512  0.547   1.00 0.00 ? 85  GLU A H    12 
ATOM   10928 H HA   . GLU A 1 21 ? -8.603  -10.191 0.717   1.00 0.00 ? 85  GLU A HA   12 
ATOM   10929 H HB2  . GLU A 1 21 ? -9.889  -7.512  1.132   1.00 0.00 ? 85  GLU A HB2  12 
ATOM   10930 H HB3  . GLU A 1 21 ? -10.668 -9.057  1.404   1.00 0.00 ? 85  GLU A HB3  12 
ATOM   10931 H HG2  . GLU A 1 21 ? -8.215  -8.114  2.834   1.00 0.00 ? 85  GLU A HG2  12 
ATOM   10932 H HG3  . GLU A 1 21 ? -9.820  -7.857  3.418   1.00 0.00 ? 85  GLU A HG3  12 
ATOM   10933 N N    . ASP A 1 22 ? -9.570  -8.095  -1.654  1.00 0.00 ? 86  ASP A N    12 
ATOM   10934 C CA   . ASP A 1 22 ? -10.399 -8.013  -2.871  1.00 0.00 ? 86  ASP A CA   12 
ATOM   10935 C C    . ASP A 1 22 ? -9.560  -8.037  -4.148  1.00 0.00 ? 86  ASP A C    12 
ATOM   10936 O O    . ASP A 1 22 ? -10.043 -8.424  -5.214  1.00 0.00 ? 86  ASP A O    12 
ATOM   10937 C CB   . ASP A 1 22 ? -11.216 -6.714  -2.828  1.00 0.00 ? 86  ASP A CB   12 
ATOM   10938 C CG   . ASP A 1 22 ? -12.254 -6.600  -3.917  1.00 0.00 ? 86  ASP A CG   12 
ATOM   10939 O OD1  . ASP A 1 22 ? -11.921 -6.209  -5.038  1.00 0.00 ? 86  ASP A OD1  12 
ATOM   10940 O OD2  . ASP A 1 22 ? -13.440 -6.888  -3.650  1.00 0.00 ? 86  ASP A OD2  12 
ATOM   10941 H H    . ASP A 1 22 ? -9.027  -7.331  -1.368  1.00 0.00 ? 86  ASP A H    12 
ATOM   10942 H HA   . ASP A 1 22 ? -11.089 -8.844  -2.873  1.00 0.00 ? 86  ASP A HA   12 
ATOM   10943 H HB2  . ASP A 1 22 ? -11.729 -6.652  -1.880  1.00 0.00 ? 86  ASP A HB2  12 
ATOM   10944 H HB3  . ASP A 1 22 ? -10.535 -5.881  -2.919  1.00 0.00 ? 86  ASP A HB3  12 
ATOM   10945 N N    . GLY A 1 23 ? -8.299  -7.703  -4.027  1.00 0.00 ? 87  GLY A N    12 
ATOM   10946 C CA   . GLY A 1 23 ? -7.420  -7.668  -5.180  1.00 0.00 ? 87  GLY A CA   12 
ATOM   10947 C C    . GLY A 1 23 ? -7.532  -6.370  -5.984  1.00 0.00 ? 87  GLY A C    12 
ATOM   10948 O O    . GLY A 1 23 ? -7.061  -6.293  -7.115  1.00 0.00 ? 87  GLY A O    12 
ATOM   10949 H H    . GLY A 1 23 ? -7.927  -7.493  -3.141  1.00 0.00 ? 87  GLY A H    12 
ATOM   10950 H HA2  . GLY A 1 23 ? -6.401  -7.779  -4.842  1.00 0.00 ? 87  GLY A HA2  12 
ATOM   10951 H HA3  . GLY A 1 23 ? -7.665  -8.499  -5.824  1.00 0.00 ? 87  GLY A HA3  12 
ATOM   10952 N N    . GLN A 1 24 ? -8.170  -5.365  -5.422  1.00 0.00 ? 88  GLN A N    12 
ATOM   10953 C CA   . GLN A 1 24 ? -8.308  -4.066  -6.097  1.00 0.00 ? 88  GLN A CA   12 
ATOM   10954 C C    . GLN A 1 24 ? -7.565  -2.992  -5.342  1.00 0.00 ? 88  GLN A C    12 
ATOM   10955 O O    . GLN A 1 24 ? -7.197  -3.199  -4.196  1.00 0.00 ? 88  GLN A O    12 
ATOM   10956 C CB   . GLN A 1 24 ? -9.767  -3.675  -6.289  1.00 0.00 ? 88  GLN A CB   12 
ATOM   10957 C CG   . GLN A 1 24 ? -10.507 -4.488  -7.330  1.00 0.00 ? 88  GLN A CG   12 
ATOM   10958 C CD   . GLN A 1 24 ? -9.956  -4.318  -8.736  1.00 0.00 ? 88  GLN A CD   12 
ATOM   10959 O OE1  . GLN A 1 24 ? -10.376 -3.431  -9.472  1.00 0.00 ? 88  GLN A OE1  12 
ATOM   10960 N NE2  . GLN A 1 24 ? -9.040  -5.167  -9.126  1.00 0.00 ? 88  GLN A NE2  12 
ATOM   10961 H H    . GLN A 1 24 ? -8.530  -5.471  -4.515  1.00 0.00 ? 88  GLN A H    12 
ATOM   10962 H HA   . GLN A 1 24 ? -7.841  -4.170  -7.065  1.00 0.00 ? 88  GLN A HA   12 
ATOM   10963 H HB2  . GLN A 1 24 ? -10.280 -3.804  -5.348  1.00 0.00 ? 88  GLN A HB2  12 
ATOM   10964 H HB3  . GLN A 1 24 ? -9.814  -2.634  -6.569  1.00 0.00 ? 88  GLN A HB3  12 
ATOM   10965 H HG2  . GLN A 1 24 ? -10.442 -5.530  -7.059  1.00 0.00 ? 88  GLN A HG2  12 
ATOM   10966 H HG3  . GLN A 1 24 ? -11.535 -4.163  -7.318  1.00 0.00 ? 88  GLN A HG3  12 
ATOM   10967 H HE21 . GLN A 1 24 ? -8.749  -5.867  -8.502  1.00 0.00 ? 88  GLN A HE21 12 
ATOM   10968 H HE22 . GLN A 1 24 ? -8.682  -5.080  -10.036 1.00 0.00 ? 88  GLN A HE22 12 
ATOM   10969 N N    . CYS A 1 25 ? -7.385  -1.847  -5.948  1.00 0.00 ? 89  CYS A N    12 
ATOM   10970 C CA   . CYS A 1 25 ? -6.633  -0.782  -5.312  1.00 0.00 ? 89  CYS A CA   12 
ATOM   10971 C C    . CYS A 1 25 ? -7.550  0.253   -4.688  1.00 0.00 ? 89  CYS A C    12 
ATOM   10972 O O    . CYS A 1 25 ? -8.557  0.662   -5.289  1.00 0.00 ? 89  CYS A O    12 
ATOM   10973 C CB   . CYS A 1 25 ? -5.611  -0.138  -6.264  1.00 0.00 ? 89  CYS A CB   12 
ATOM   10974 S SG   . CYS A 1 25 ? -6.301  0.644   -7.737  1.00 0.00 ? 89  CYS A SG   12 
ATOM   10975 H H    . CYS A 1 25 ? -7.802  -1.699  -6.823  1.00 0.00 ? 89  CYS A H    12 
ATOM   10976 H HA   . CYS A 1 25 ? -6.095  -1.239  -4.495  1.00 0.00 ? 89  CYS A HA   12 
ATOM   10977 H HB2  . CYS A 1 25 ? -5.085  0.628   -5.716  1.00 0.00 ? 89  CYS A HB2  12 
ATOM   10978 H HB3  . CYS A 1 25 ? -4.905  -0.891  -6.582  1.00 0.00 ? 89  CYS A HB3  12 
ATOM   10979 H HG   . CYS A 1 25 ? -7.520  1.063   -7.420  1.00 0.00 ? 89  CYS A HG   12 
ATOM   10980 N N    . TYR A 1 26 ? -7.214  0.633   -3.477  1.00 0.00 ? 90  TYR A N    12 
ATOM   10981 C CA   . TYR A 1 26 ? -7.972  1.565   -2.672  1.00 0.00 ? 90  TYR A CA   12 
ATOM   10982 C C    . TYR A 1 26 ? -7.011  2.546   -2.022  1.00 0.00 ? 90  TYR A C    12 
ATOM   10983 O O    . TYR A 1 26 ? -5.819  2.251   -1.887  1.00 0.00 ? 90  TYR A O    12 
ATOM   10984 C CB   . TYR A 1 26 ? -8.747  0.817   -1.586  1.00 0.00 ? 90  TYR A CB   12 
ATOM   10985 C CG   . TYR A 1 26 ? -9.796  -0.155  -2.101  1.00 0.00 ? 90  TYR A CG   12 
ATOM   10986 C CD1  . TYR A 1 26 ? -9.436  -1.415  -2.557  1.00 0.00 ? 90  TYR A CD1  12 
ATOM   10987 C CD2  . TYR A 1 26 ? -11.139 0.180   -2.112  1.00 0.00 ? 90  TYR A CD2  12 
ATOM   10988 C CE1  . TYR A 1 26 ? -10.370 -2.304  -3.014  1.00 0.00 ? 90  TYR A CE1  12 
ATOM   10989 C CE2  . TYR A 1 26 ? -12.088 -0.711  -2.567  1.00 0.00 ? 90  TYR A CE2  12 
ATOM   10990 C CZ   . TYR A 1 26 ? -11.698 -1.950  -3.019  1.00 0.00 ? 90  TYR A CZ   12 
ATOM   10991 O OH   . TYR A 1 26 ? -12.637 -2.837  -3.473  1.00 0.00 ? 90  TYR A OH   12 
ATOM   10992 H H    . TYR A 1 26 ? -6.392  0.263   -3.080  1.00 0.00 ? 90  TYR A H    12 
ATOM   10993 H HA   . TYR A 1 26 ? -8.666  2.095   -3.308  1.00 0.00 ? 90  TYR A HA   12 
ATOM   10994 H HB2  . TYR A 1 26 ? -8.035  0.241   -1.013  1.00 0.00 ? 90  TYR A HB2  12 
ATOM   10995 H HB3  . TYR A 1 26 ? -9.224  1.525   -0.926  1.00 0.00 ? 90  TYR A HB3  12 
ATOM   10996 H HD1  . TYR A 1 26 ? -8.392  -1.692  -2.552  1.00 0.00 ? 90  TYR A HD1  12 
ATOM   10997 H HD2  . TYR A 1 26 ? -11.442 1.154   -1.758  1.00 0.00 ? 90  TYR A HD2  12 
ATOM   10998 H HE1  . TYR A 1 26 ? -10.044 -3.271  -3.368  1.00 0.00 ? 90  TYR A HE1  12 
ATOM   10999 H HE2  . TYR A 1 26 ? -13.132 -0.434  -2.563  1.00 0.00 ? 90  TYR A HE2  12 
ATOM   11000 H HH   . TYR A 1 26 ? -13.247 -2.371  -4.051  1.00 0.00 ? 90  TYR A HH   12 
ATOM   11001 N N    . GLU A 1 27 ? -7.515  3.682   -1.643  1.00 0.00 ? 91  GLU A N    12 
ATOM   11002 C CA   . GLU A 1 27 ? -6.725  4.744   -1.055  1.00 0.00 ? 91  GLU A CA   12 
ATOM   11003 C C    . GLU A 1 27 ? -6.343  4.394   0.393   1.00 0.00 ? 91  GLU A C    12 
ATOM   11004 O O    . GLU A 1 27 ? -7.191  4.018   1.213   1.00 0.00 ? 91  GLU A O    12 
ATOM   11005 C CB   . GLU A 1 27 ? -7.523  6.038   -1.122  1.00 0.00 ? 91  GLU A CB   12 
ATOM   11006 C CG   . GLU A 1 27 ? -6.778  7.281   -0.699  1.00 0.00 ? 91  GLU A CG   12 
ATOM   11007 C CD   . GLU A 1 27 ? -7.633  8.497   -0.863  1.00 0.00 ? 91  GLU A CD   12 
ATOM   11008 O OE1  . GLU A 1 27 ? -7.647  9.088   -1.965  1.00 0.00 ? 91  GLU A OE1  12 
ATOM   11009 O OE2  . GLU A 1 27 ? -8.340  8.867   0.096   1.00 0.00 ? 91  GLU A OE2  12 
ATOM   11010 H H    . GLU A 1 27 ? -8.480  3.828   -1.746  1.00 0.00 ? 91  GLU A H    12 
ATOM   11011 H HA   . GLU A 1 27 ? -5.824  4.857   -1.640  1.00 0.00 ? 91  GLU A HA   12 
ATOM   11012 H HB2  . GLU A 1 27 ? -7.860  6.186   -2.138  1.00 0.00 ? 91  GLU A HB2  12 
ATOM   11013 H HB3  . GLU A 1 27 ? -8.390  5.932   -0.487  1.00 0.00 ? 91  GLU A HB3  12 
ATOM   11014 H HG2  . GLU A 1 27 ? -6.494  7.187   0.339   1.00 0.00 ? 91  GLU A HG2  12 
ATOM   11015 H HG3  . GLU A 1 27 ? -5.895  7.390   -1.311  1.00 0.00 ? 91  GLU A HG3  12 
ATOM   11016 N N    . ALA A 1 28 ? -5.078  4.508   0.692   1.00 0.00 ? 92  ALA A N    12 
ATOM   11017 C CA   . ALA A 1 28 ? -4.543  4.143   1.984   1.00 0.00 ? 92  ALA A CA   12 
ATOM   11018 C C    . ALA A 1 28 ? -3.431  5.082   2.383   1.00 0.00 ? 92  ALA A C    12 
ATOM   11019 O O    . ALA A 1 28 ? -2.808  5.707   1.535   1.00 0.00 ? 92  ALA A O    12 
ATOM   11020 C CB   . ALA A 1 28 ? -4.022  2.729   1.924   1.00 0.00 ? 92  ALA A CB   12 
ATOM   11021 H H    . ALA A 1 28 ? -4.466  4.887   0.017   1.00 0.00 ? 92  ALA A H    12 
ATOM   11022 H HA   . ALA A 1 28 ? -5.308  4.187   2.746   1.00 0.00 ? 92  ALA A HA   12 
ATOM   11023 H HB1  . ALA A 1 28 ? -3.186  2.685   1.241   1.00 0.00 ? 92  ALA A HB1  12 
ATOM   11024 H HB2  . ALA A 1 28 ? -3.697  2.431   2.910   1.00 0.00 ? 92  ALA A HB2  12 
ATOM   11025 H HB3  . ALA A 1 28 ? -4.806  2.069   1.586   1.00 0.00 ? 92  ALA A HB3  12 
ATOM   11026 N N    . GLU A 1 29 ? -3.178  5.189   3.648   1.00 0.00 ? 93  GLU A N    12 
ATOM   11027 C CA   . GLU A 1 29 ? -2.099  6.013   4.114   1.00 0.00 ? 93  GLU A CA   12 
ATOM   11028 C C    . GLU A 1 29 ? -1.031  5.136   4.741   1.00 0.00 ? 93  GLU A C    12 
ATOM   11029 O O    . GLU A 1 29 ? -1.349  4.174   5.443   1.00 0.00 ? 93  GLU A O    12 
ATOM   11030 C CB   . GLU A 1 29 ? -2.581  7.060   5.109   1.00 0.00 ? 93  GLU A CB   12 
ATOM   11031 C CG   . GLU A 1 29 ? -1.497  8.056   5.475   1.00 0.00 ? 93  GLU A CG   12 
ATOM   11032 C CD   . GLU A 1 29 ? -1.934  9.075   6.460   1.00 0.00 ? 93  GLU A CD   12 
ATOM   11033 O OE1  . GLU A 1 29 ? -2.868  9.842   6.164   1.00 0.00 ? 93  GLU A OE1  12 
ATOM   11034 O OE2  . GLU A 1 29 ? -1.332  9.161   7.540   1.00 0.00 ? 93  GLU A OE2  12 
ATOM   11035 H H    . GLU A 1 29 ? -3.723  4.688   4.295   1.00 0.00 ? 93  GLU A H    12 
ATOM   11036 H HA   . GLU A 1 29 ? -1.674  6.509   3.254   1.00 0.00 ? 93  GLU A HA   12 
ATOM   11037 H HB2  . GLU A 1 29 ? -3.418  7.591   4.680   1.00 0.00 ? 93  GLU A HB2  12 
ATOM   11038 H HB3  . GLU A 1 29 ? -2.904  6.561   6.010   1.00 0.00 ? 93  GLU A HB3  12 
ATOM   11039 H HG2  . GLU A 1 29 ? -0.674  7.507   5.909   1.00 0.00 ? 93  GLU A HG2  12 
ATOM   11040 H HG3  . GLU A 1 29 ? -1.164  8.551   4.575   1.00 0.00 ? 93  GLU A HG3  12 
ATOM   11041 N N    . ILE A 1 30 ? 0.201   5.444   4.451   1.00 0.00 ? 94  ILE A N    12 
ATOM   11042 C CA   . ILE A 1 30 ? 1.339   4.706   4.960   1.00 0.00 ? 94  ILE A CA   12 
ATOM   11043 C C    . ILE A 1 30 ? 1.621   5.063   6.407   1.00 0.00 ? 94  ILE A C    12 
ATOM   11044 O O    . ILE A 1 30 ? 1.906   6.221   6.737   1.00 0.00 ? 94  ILE A O    12 
ATOM   11045 C CB   . ILE A 1 30 ? 2.584   4.985   4.124   1.00 0.00 ? 94  ILE A CB   12 
ATOM   11046 C CG1  . ILE A 1 30 ? 2.283   4.663   2.675   1.00 0.00 ? 94  ILE A CG1  12 
ATOM   11047 C CG2  . ILE A 1 30 ? 3.747   4.133   4.632   1.00 0.00 ? 94  ILE A CG2  12 
ATOM   11048 C CD1  . ILE A 1 30 ? 3.323   5.138   1.717   1.00 0.00 ? 94  ILE A CD1  12 
ATOM   11049 H H    . ILE A 1 30 ? 0.350   6.210   3.851   1.00 0.00 ? 94  ILE A H    12 
ATOM   11050 H HA   . ILE A 1 30 ? 1.117   3.651   4.899   1.00 0.00 ? 94  ILE A HA   12 
ATOM   11051 H HB   . ILE A 1 30 ? 2.841   6.031   4.207   1.00 0.00 ? 94  ILE A HB   12 
ATOM   11052 H HG12 . ILE A 1 30 ? 2.206   3.591   2.565   1.00 0.00 ? 94  ILE A HG12 12 
ATOM   11053 H HG13 . ILE A 1 30 ? 1.338   5.117   2.418   1.00 0.00 ? 94  ILE A HG13 12 
ATOM   11054 H HG21 . ILE A 1 30 ? 3.471   3.089   4.588   1.00 0.00 ? 94  ILE A HG21 12 
ATOM   11055 H HG22 . ILE A 1 30 ? 4.626   4.306   4.030   1.00 0.00 ? 94  ILE A HG22 12 
ATOM   11056 H HG23 . ILE A 1 30 ? 3.951   4.396   5.661   1.00 0.00 ? 94  ILE A HG23 12 
ATOM   11057 H HD11 . ILE A 1 30 ? 4.264   4.694   2.005   1.00 0.00 ? 94  ILE A HD11 12 
ATOM   11058 H HD12 . ILE A 1 30 ? 3.057   4.841   0.713   1.00 0.00 ? 94  ILE A HD12 12 
ATOM   11059 H HD13 . ILE A 1 30 ? 3.400   6.214   1.771   1.00 0.00 ? 94  ILE A HD13 12 
ATOM   11060 N N    . GLU A 1 31 ? 1.579   4.062   7.231   1.00 0.00 ? 95  GLU A N    12 
ATOM   11061 C CA   . GLU A 1 31 ? 1.768   4.191   8.657   1.00 0.00 ? 95  GLU A CA   12 
ATOM   11062 C C    . GLU A 1 31 ? 3.210   3.847   9.035   1.00 0.00 ? 95  GLU A C    12 
ATOM   11063 O O    . GLU A 1 31 ? 3.807   4.468   9.914   1.00 0.00 ? 95  GLU A O    12 
ATOM   11064 C CB   . GLU A 1 31 ? 0.819   3.225   9.335   1.00 0.00 ? 95  GLU A CB   12 
ATOM   11065 C CG   . GLU A 1 31 ? -0.632  3.441   8.957   1.00 0.00 ? 95  GLU A CG   12 
ATOM   11066 C CD   . GLU A 1 31 ? -1.288  4.592   9.671   1.00 0.00 ? 95  GLU A CD   12 
ATOM   11067 O OE1  . GLU A 1 31 ? -0.794  5.733   9.615   1.00 0.00 ? 95  GLU A OE1  12 
ATOM   11068 O OE2  . GLU A 1 31 ? -2.342  4.361   10.300  1.00 0.00 ? 95  GLU A OE2  12 
ATOM   11069 H H    . GLU A 1 31 ? 1.405   3.170   6.855   1.00 0.00 ? 95  GLU A H    12 
ATOM   11070 H HA   . GLU A 1 31 ? 1.513   5.194   8.959   1.00 0.00 ? 95  GLU A HA   12 
ATOM   11071 H HB2  . GLU A 1 31 ? 1.098   2.218   9.060   1.00 0.00 ? 95  GLU A HB2  12 
ATOM   11072 H HB3  . GLU A 1 31 ? 0.909   3.340   10.405  1.00 0.00 ? 95  GLU A HB3  12 
ATOM   11073 H HG2  . GLU A 1 31 ? -0.691  3.633   7.896   1.00 0.00 ? 95  GLU A HG2  12 
ATOM   11074 H HG3  . GLU A 1 31 ? -1.184  2.541   9.178   1.00 0.00 ? 95  GLU A HG3  12 
ATOM   11075 N N    . GLU A 1 32 ? 3.764   2.867   8.348   1.00 0.00 ? 96  GLU A N    12 
ATOM   11076 C CA   . GLU A 1 32 ? 5.107   2.378   8.614   1.00 0.00 ? 96  GLU A CA   12 
ATOM   11077 C C    . GLU A 1 32 ? 5.631   1.732   7.351   1.00 0.00 ? 96  GLU A C    12 
ATOM   11078 O O    . GLU A 1 32 ? 4.852   1.224   6.554   1.00 0.00 ? 96  GLU A O    12 
ATOM   11079 C CB   . GLU A 1 32 ? 5.074   1.356   9.775   1.00 0.00 ? 96  GLU A CB   12 
ATOM   11080 C CG   . GLU A 1 32 ? 6.423   0.752   10.151  1.00 0.00 ? 96  GLU A CG   12 
ATOM   11081 C CD   . GLU A 1 32 ? 6.329   -0.206  11.309  1.00 0.00 ? 96  GLU A CD   12 
ATOM   11082 O OE1  . GLU A 1 32 ? 5.979   -1.393  11.100  1.00 0.00 ? 96  GLU A OE1  12 
ATOM   11083 O OE2  . GLU A 1 32 ? 6.606   0.209   12.457  1.00 0.00 ? 96  GLU A OE2  12 
ATOM   11084 H H    . GLU A 1 32 ? 3.267   2.444   7.614   1.00 0.00 ? 96  GLU A H    12 
ATOM   11085 H HA   . GLU A 1 32 ? 5.750   3.207   8.869   1.00 0.00 ? 96  GLU A HA   12 
ATOM   11086 H HB2  . GLU A 1 32 ? 4.668   1.839   10.652  1.00 0.00 ? 96  GLU A HB2  12 
ATOM   11087 H HB3  . GLU A 1 32 ? 4.414   0.551   9.488   1.00 0.00 ? 96  GLU A HB3  12 
ATOM   11088 H HG2  . GLU A 1 32 ? 6.818   0.222   9.298   1.00 0.00 ? 96  GLU A HG2  12 
ATOM   11089 H HG3  . GLU A 1 32 ? 7.096   1.553   10.419  1.00 0.00 ? 96  GLU A HG3  12 
ATOM   11090 N N    . ILE A 1 33 ? 6.916   1.782   7.148   1.00 0.00 ? 97  ILE A N    12 
ATOM   11091 C CA   . ILE A 1 33 ? 7.524   1.204   5.973   1.00 0.00 ? 97  ILE A CA   12 
ATOM   11092 C C    . ILE A 1 33 ? 8.569   0.207   6.386   1.00 0.00 ? 97  ILE A C    12 
ATOM   11093 O O    . ILE A 1 33 ? 9.480   0.531   7.152   1.00 0.00 ? 97  ILE A O    12 
ATOM   11094 C CB   . ILE A 1 33 ? 8.197   2.297   5.125   1.00 0.00 ? 97  ILE A CB   12 
ATOM   11095 C CG1  . ILE A 1 33 ? 7.178   3.338   4.752   1.00 0.00 ? 97  ILE A CG1  12 
ATOM   11096 C CG2  . ILE A 1 33 ? 8.825   1.703   3.858   1.00 0.00 ? 97  ILE A CG2  12 
ATOM   11097 C CD1  . ILE A 1 33 ? 7.777   4.659   4.472   1.00 0.00 ? 97  ILE A CD1  12 
ATOM   11098 H H    . ILE A 1 33 ? 7.505   2.219   7.804   1.00 0.00 ? 97  ILE A H    12 
ATOM   11099 H HA   . ILE A 1 33 ? 6.762   0.724   5.378   1.00 0.00 ? 97  ILE A HA   12 
ATOM   11100 H HB   . ILE A 1 33 ? 8.974   2.764   5.711   1.00 0.00 ? 97  ILE A HB   12 
ATOM   11101 H HG12 . ILE A 1 33 ? 6.664   3.024   3.854   1.00 0.00 ? 97  ILE A HG12 12 
ATOM   11102 H HG13 . ILE A 1 33 ? 6.471   3.439   5.562   1.00 0.00 ? 97  ILE A HG13 12 
ATOM   11103 H HG21 . ILE A 1 33 ? 8.060   1.208   3.279   1.00 0.00 ? 97  ILE A HG21 12 
ATOM   11104 H HG22 . ILE A 1 33 ? 9.266   2.493   3.269   1.00 0.00 ? 97  ILE A HG22 12 
ATOM   11105 H HG23 . ILE A 1 33 ? 9.588   0.988   4.130   1.00 0.00 ? 97  ILE A HG23 12 
ATOM   11106 H HD11 . ILE A 1 33 ? 8.484   4.587   3.660   1.00 0.00 ? 97  ILE A HD11 12 
ATOM   11107 H HD12 . ILE A 1 33 ? 6.987   5.351   4.222   1.00 0.00 ? 97  ILE A HD12 12 
ATOM   11108 H HD13 . ILE A 1 33 ? 8.269   4.989   5.376   1.00 0.00 ? 97  ILE A HD13 12 
ATOM   11109 N N    . ASP A 1 34 ? 8.449   -0.980  5.900   1.00 0.00 ? 98  ASP A N    12 
ATOM   11110 C CA   . ASP A 1 34 ? 9.436   -1.987  6.142   1.00 0.00 ? 98  ASP A CA   12 
ATOM   11111 C C    . ASP A 1 34 ? 10.333  -2.011  4.934   1.00 0.00 ? 98  ASP A C    12 
ATOM   11112 O O    . ASP A 1 34 ? 10.050  -2.665  3.924   1.00 0.00 ? 98  ASP A O    12 
ATOM   11113 C CB   . ASP A 1 34 ? 8.815   -3.368  6.377   1.00 0.00 ? 98  ASP A CB   12 
ATOM   11114 C CG   . ASP A 1 34 ? 9.854   -4.426  6.695   1.00 0.00 ? 98  ASP A CG   12 
ATOM   11115 O OD1  . ASP A 1 34 ? 10.600  -4.830  5.798   1.00 0.00 ? 98  ASP A OD1  12 
ATOM   11116 O OD2  . ASP A 1 34 ? 9.932   -4.882  7.859   1.00 0.00 ? 98  ASP A OD2  12 
ATOM   11117 H H    . ASP A 1 34 ? 7.703   -1.180  5.291   1.00 0.00 ? 98  ASP A H    12 
ATOM   11118 H HA   . ASP A 1 34 ? 10.021  -1.689  6.999   1.00 0.00 ? 98  ASP A HA   12 
ATOM   11119 H HB2  . ASP A 1 34 ? 8.120   -3.313  7.202   1.00 0.00 ? 98  ASP A HB2  12 
ATOM   11120 H HB3  . ASP A 1 34 ? 8.287   -3.672  5.484   1.00 0.00 ? 98  ASP A HB3  12 
ATOM   11121 N N    . GLU A 1 35 ? 11.369  -1.229  5.004   1.00 0.00 ? 99  GLU A N    12 
ATOM   11122 C CA   . GLU A 1 35 ? 12.322  -1.079  3.914   1.00 0.00 ? 99  GLU A CA   12 
ATOM   11123 C C    . GLU A 1 35 ? 13.094  -2.361  3.654   1.00 0.00 ? 99  GLU A C    12 
ATOM   11124 O O    . GLU A 1 35 ? 13.673  -2.546  2.575   1.00 0.00 ? 99  GLU A O    12 
ATOM   11125 C CB   . GLU A 1 35 ? 13.272  0.053   4.222   1.00 0.00 ? 99  GLU A CB   12 
ATOM   11126 C CG   . GLU A 1 35 ? 12.577  1.385   4.416   1.00 0.00 ? 99  GLU A CG   12 
ATOM   11127 C CD   . GLU A 1 35 ? 13.501  2.428   4.944   1.00 0.00 ? 99  GLU A CD   12 
ATOM   11128 O OE1  . GLU A 1 35 ? 13.640  2.529   6.178   1.00 0.00 ? 99  GLU A OE1  12 
ATOM   11129 O OE2  . GLU A 1 35 ? 14.125  3.159   4.141   1.00 0.00 ? 99  GLU A OE2  12 
ATOM   11130 H H    . GLU A 1 35 ? 11.501  -0.717  5.831   1.00 0.00 ? 99  GLU A H    12 
ATOM   11131 H HA   . GLU A 1 35 ? 11.766  -0.824  3.023   1.00 0.00 ? 99  GLU A HA   12 
ATOM   11132 H HB2  . GLU A 1 35 ? 13.821  -0.186  5.120   1.00 0.00 ? 99  GLU A HB2  12 
ATOM   11133 H HB3  . GLU A 1 35 ? 13.959  0.142   3.395   1.00 0.00 ? 99  GLU A HB3  12 
ATOM   11134 H HG2  . GLU A 1 35 ? 12.184  1.719   3.467   1.00 0.00 ? 99  GLU A HG2  12 
ATOM   11135 H HG3  . GLU A 1 35 ? 11.764  1.253   5.115   1.00 0.00 ? 99  GLU A HG3  12 
ATOM   11136 N N    . GLU A 1 36 ? 13.095  -3.238  4.638   1.00 0.00 ? 100 GLU A N    12 
ATOM   11137 C CA   . GLU A 1 36 ? 13.819  -4.483  4.587   1.00 0.00 ? 100 GLU A CA   12 
ATOM   11138 C C    . GLU A 1 36 ? 13.205  -5.402  3.532   1.00 0.00 ? 100 GLU A C    12 
ATOM   11139 O O    . GLU A 1 36 ? 13.912  -6.029  2.746   1.00 0.00 ? 100 GLU A O    12 
ATOM   11140 C CB   . GLU A 1 36 ? 13.753  -5.137  5.963   1.00 0.00 ? 100 GLU A CB   12 
ATOM   11141 C CG   . GLU A 1 36 ? 14.732  -6.262  6.176   1.00 0.00 ? 100 GLU A CG   12 
ATOM   11142 C CD   . GLU A 1 36 ? 16.146  -5.802  6.022   1.00 0.00 ? 100 GLU A CD   12 
ATOM   11143 O OE1  . GLU A 1 36 ? 16.626  -5.024  6.875   1.00 0.00 ? 100 GLU A OE1  12 
ATOM   11144 O OE2  . GLU A 1 36 ? 16.810  -6.215  5.058   1.00 0.00 ? 100 GLU A OE2  12 
ATOM   11145 H H    . GLU A 1 36 ? 12.576  -3.031  5.445   1.00 0.00 ? 100 GLU A H    12 
ATOM   11146 H HA   . GLU A 1 36 ? 14.852  -4.288  4.343   1.00 0.00 ? 100 GLU A HA   12 
ATOM   11147 H HB2  . GLU A 1 36 ? 13.938  -4.379  6.708   1.00 0.00 ? 100 GLU A HB2  12 
ATOM   11148 H HB3  . GLU A 1 36 ? 12.753  -5.520  6.107   1.00 0.00 ? 100 GLU A HB3  12 
ATOM   11149 H HG2  . GLU A 1 36 ? 14.607  -6.659  7.172   1.00 0.00 ? 100 GLU A HG2  12 
ATOM   11150 H HG3  . GLU A 1 36 ? 14.539  -7.035  5.448   1.00 0.00 ? 100 GLU A HG3  12 
ATOM   11151 N N    . ASN A 1 37 ? 11.900  -5.455  3.502   1.00 0.00 ? 101 ASN A N    12 
ATOM   11152 C CA   . ASN A 1 37 ? 11.185  -6.268  2.514   1.00 0.00 ? 101 ASN A CA   12 
ATOM   11153 C C    . ASN A 1 37 ? 10.712  -5.414  1.376   1.00 0.00 ? 101 ASN A C    12 
ATOM   11154 O O    . ASN A 1 37 ? 10.320  -5.926  0.316   1.00 0.00 ? 101 ASN A O    12 
ATOM   11155 C CB   . ASN A 1 37 ? 9.963   -6.937  3.134   1.00 0.00 ? 101 ASN A CB   12 
ATOM   11156 C CG   . ASN A 1 37 ? 10.287  -7.928  4.216   1.00 0.00 ? 101 ASN A CG   12 
ATOM   11157 O OD1  . ASN A 1 37 ? 10.445  -9.122  3.969   1.00 0.00 ? 101 ASN A OD1  12 
ATOM   11158 N ND2  . ASN A 1 37 ? 10.407  -7.449  5.409   1.00 0.00 ? 101 ASN A ND2  12 
ATOM   11159 H H    . ASN A 1 37 ? 11.393  -4.972  4.201   1.00 0.00 ? 101 ASN A H    12 
ATOM   11160 H HA   . ASN A 1 37 ? 11.843  -7.037  2.138   1.00 0.00 ? 101 ASN A HA   12 
ATOM   11161 H HB2  . ASN A 1 37 ? 9.322   -6.177  3.554   1.00 0.00 ? 101 ASN A HB2  12 
ATOM   11162 H HB3  . ASN A 1 37 ? 9.432   -7.446  2.346   1.00 0.00 ? 101 ASN A HB3  12 
ATOM   11163 H HD21 . ASN A 1 37 ? 10.292  -6.468  5.517   1.00 0.00 ? 101 ASN A HD21 12 
ATOM   11164 H HD22 . ASN A 1 37 ? 10.575  -8.048  6.165   1.00 0.00 ? 101 ASN A HD22 12 
ATOM   11165 N N    . GLY A 1 38 ? 10.746  -4.116  1.580   1.00 0.00 ? 102 GLY A N    12 
ATOM   11166 C CA   . GLY A 1 38 ? 10.229  -3.210  0.597   1.00 0.00 ? 102 GLY A CA   12 
ATOM   11167 C C    . GLY A 1 38 ? 8.720   -3.192  0.665   1.00 0.00 ? 102 GLY A C    12 
ATOM   11168 O O    . GLY A 1 38 ? 8.034   -3.058  -0.358  1.00 0.00 ? 102 GLY A O    12 
ATOM   11169 H H    . GLY A 1 38 ? 11.110  -3.770  2.424   1.00 0.00 ? 102 GLY A H    12 
ATOM   11170 H HA2  . GLY A 1 38 ? 10.613  -2.219  0.788   1.00 0.00 ? 102 GLY A HA2  12 
ATOM   11171 H HA3  . GLY A 1 38 ? 10.531  -3.530  -0.389  1.00 0.00 ? 102 GLY A HA3  12 
ATOM   11172 N N    . THR A 1 39 ? 8.206   -3.367  1.862   1.00 0.00 ? 103 THR A N    12 
ATOM   11173 C CA   . THR A 1 39 ? 6.803   -3.371  2.105   1.00 0.00 ? 103 THR A CA   12 
ATOM   11174 C C    . THR A 1 39 ? 6.416   -2.182  2.964   1.00 0.00 ? 103 THR A C    12 
ATOM   11175 O O    . THR A 1 39 ? 7.269   -1.533  3.551   1.00 0.00 ? 103 THR A O    12 
ATOM   11176 C CB   . THR A 1 39 ? 6.374   -4.695  2.773   1.00 0.00 ? 103 THR A CB   12 
ATOM   11177 O OG1  . THR A 1 39 ? 7.242   -4.986  3.878   1.00 0.00 ? 103 THR A OG1  12 
ATOM   11178 C CG2  . THR A 1 39 ? 6.416   -5.848  1.788   1.00 0.00 ? 103 THR A CG2  12 
ATOM   11179 H H    . THR A 1 39 ? 8.782   -3.499  2.652   1.00 0.00 ? 103 THR A H    12 
ATOM   11180 H HA   . THR A 1 39 ? 6.287   -3.272  1.166   1.00 0.00 ? 103 THR A HA   12 
ATOM   11181 H HB   . THR A 1 39 ? 5.364   -4.567  3.130   1.00 0.00 ? 103 THR A HB   12 
ATOM   11182 H HG1  . THR A 1 39 ? 6.909   -5.753  4.361   1.00 0.00 ? 103 THR A HG1  12 
ATOM   11183 H HG21 . THR A 1 39 ? 7.414   -5.933  1.384   1.00 0.00 ? 103 THR A HG21 12 
ATOM   11184 H HG22 . THR A 1 39 ? 6.152   -6.765  2.293   1.00 0.00 ? 103 THR A HG22 12 
ATOM   11185 H HG23 . THR A 1 39 ? 5.720   -5.663  0.984   1.00 0.00 ? 103 THR A HG23 12 
ATOM   11186 N N    . ALA A 1 40 ? 5.165   -1.859  2.987   1.00 0.00 ? 104 ALA A N    12 
ATOM   11187 C CA   . ALA A 1 40 ? 4.686   -0.788  3.798   1.00 0.00 ? 104 ALA A CA   12 
ATOM   11188 C C    . ALA A 1 40 ? 3.395   -1.177  4.455   1.00 0.00 ? 104 ALA A C    12 
ATOM   11189 O O    . ALA A 1 40 ? 2.579   -1.898  3.875   1.00 0.00 ? 104 ALA A O    12 
ATOM   11190 C CB   . ALA A 1 40 ? 4.503   0.469   2.974   1.00 0.00 ? 104 ALA A CB   12 
ATOM   11191 H H    . ALA A 1 40 ? 4.514   -2.335  2.419   1.00 0.00 ? 104 ALA A H    12 
ATOM   11192 H HA   . ALA A 1 40 ? 5.418   -0.587  4.566   1.00 0.00 ? 104 ALA A HA   12 
ATOM   11193 H HB1  . ALA A 1 40 ? 3.745   0.280   2.230   1.00 0.00 ? 104 ALA A HB1  12 
ATOM   11194 H HB2  . ALA A 1 40 ? 4.195   1.286   3.610   1.00 0.00 ? 104 ALA A HB2  12 
ATOM   11195 H HB3  . ALA A 1 40 ? 5.434   0.714   2.486   1.00 0.00 ? 104 ALA A HB3  12 
ATOM   11196 N N    . ALA A 1 41 ? 3.237   -0.738  5.661   1.00 0.00 ? 105 ALA A N    12 
ATOM   11197 C CA   . ALA A 1 41 ? 2.053   -0.953  6.416   1.00 0.00 ? 105 ALA A CA   12 
ATOM   11198 C C    . ALA A 1 41 ? 1.171   0.235   6.187   1.00 0.00 ? 105 ALA A C    12 
ATOM   11199 O O    . ALA A 1 41 ? 1.560   1.385   6.465   1.00 0.00 ? 105 ALA A O    12 
ATOM   11200 C CB   . ALA A 1 41 ? 2.388   -1.101  7.875   1.00 0.00 ? 105 ALA A CB   12 
ATOM   11201 H H    . ALA A 1 41 ? 3.947   -0.188  6.063   1.00 0.00 ? 105 ALA A H    12 
ATOM   11202 H HA   . ALA A 1 41 ? 1.565   -1.848  6.061   1.00 0.00 ? 105 ALA A HA   12 
ATOM   11203 H HB1  . ALA A 1 41 ? 2.907   -0.209  8.195   1.00 0.00 ? 105 ALA A HB1  12 
ATOM   11204 H HB2  . ALA A 1 41 ? 1.477   -1.232  8.440   1.00 0.00 ? 105 ALA A HB2  12 
ATOM   11205 H HB3  . ALA A 1 41 ? 3.030   -1.961  7.994   1.00 0.00 ? 105 ALA A HB3  12 
ATOM   11206 N N    . ILE A 1 42 ? 0.029   -0.013  5.664   1.00 0.00 ? 106 ILE A N    12 
ATOM   11207 C CA   . ILE A 1 42 ? -0.850  1.032   5.247   1.00 0.00 ? 106 ILE A CA   12 
ATOM   11208 C C    . ILE A 1 42 ? -2.210  0.874   5.891   1.00 0.00 ? 106 ILE A C    12 
ATOM   11209 O O    . ILE A 1 42 ? -2.638  -0.242  6.158   1.00 0.00 ? 106 ILE A O    12 
ATOM   11210 C CB   . ILE A 1 42 ? -0.983  1.012   3.689   1.00 0.00 ? 106 ILE A CB   12 
ATOM   11211 C CG1  . ILE A 1 42 ? -1.485  -0.354  3.189   1.00 0.00 ? 106 ILE A CG1  12 
ATOM   11212 C CG2  . ILE A 1 42 ? 0.316   1.383   3.005   1.00 0.00 ? 106 ILE A CG2  12 
ATOM   11213 C CD1  . ILE A 1 42 ? -2.949  -0.387  2.932   1.00 0.00 ? 106 ILE A CD1  12 
ATOM   11214 H H    . ILE A 1 42 ? -0.253  -0.949  5.550   1.00 0.00 ? 106 ILE A H    12 
ATOM   11215 H HA   . ILE A 1 42 ? -0.414  1.978   5.529   1.00 0.00 ? 106 ILE A HA   12 
ATOM   11216 H HB   . ILE A 1 42 ? -1.713  1.760   3.418   1.00 0.00 ? 106 ILE A HB   12 
ATOM   11217 H HG12 . ILE A 1 42 ? -0.981  -0.690  2.297   1.00 0.00 ? 106 ILE A HG12 12 
ATOM   11218 H HG13 . ILE A 1 42 ? -1.292  -1.075  3.971   1.00 0.00 ? 106 ILE A HG13 12 
ATOM   11219 H HG21 . ILE A 1 42 ? 1.087   0.684   3.293   1.00 0.00 ? 106 ILE A HG21 12 
ATOM   11220 H HG22 . ILE A 1 42 ? 0.161   1.341   1.937   1.00 0.00 ? 106 ILE A HG22 12 
ATOM   11221 H HG23 . ILE A 1 42 ? 0.603   2.384   3.289   1.00 0.00 ? 106 ILE A HG23 12 
ATOM   11222 H HD11 . ILE A 1 42 ? -3.151  0.377   2.191   1.00 0.00 ? 106 ILE A HD11 12 
ATOM   11223 H HD12 . ILE A 1 42 ? -3.238  -1.351  2.541   1.00 0.00 ? 106 ILE A HD12 12 
ATOM   11224 H HD13 . ILE A 1 42 ? -3.484  -0.164  3.843   1.00 0.00 ? 106 ILE A HD13 12 
ATOM   11225 N N    . THR A 1 43 ? -2.871  1.969   6.128   1.00 0.00 ? 107 THR A N    12 
ATOM   11226 C CA   . THR A 1 43 ? -4.196  1.956   6.671   1.00 0.00 ? 107 THR A CA   12 
ATOM   11227 C C    . THR A 1 43 ? -5.152  2.492   5.619   1.00 0.00 ? 107 THR A C    12 
ATOM   11228 O O    . THR A 1 43 ? -4.975  3.617   5.123   1.00 0.00 ? 107 THR A O    12 
ATOM   11229 C CB   . THR A 1 43 ? -4.304  2.799   7.976   1.00 0.00 ? 107 THR A CB   12 
ATOM   11230 O OG1  . THR A 1 43 ? -3.472  2.237   9.014   1.00 0.00 ? 107 THR A OG1  12 
ATOM   11231 C CG2  . THR A 1 43 ? -5.739  2.864   8.473   1.00 0.00 ? 107 THR A CG2  12 
ATOM   11232 H H    . THR A 1 43 ? -2.459  2.834   5.903   1.00 0.00 ? 107 THR A H    12 
ATOM   11233 H HA   . THR A 1 43 ? -4.456  0.930   6.887   1.00 0.00 ? 107 THR A HA   12 
ATOM   11234 H HB   . THR A 1 43 ? -3.960  3.801   7.759   1.00 0.00 ? 107 THR A HB   12 
ATOM   11235 H HG1  . THR A 1 43 ? -3.041  2.991   9.454   1.00 0.00 ? 107 THR A HG1  12 
ATOM   11236 H HG21 . THR A 1 43 ? -6.094  1.861   8.652   1.00 0.00 ? 107 THR A HG21 12 
ATOM   11237 H HG22 . THR A 1 43 ? -5.766  3.434   9.390   1.00 0.00 ? 107 THR A HG22 12 
ATOM   11238 H HG23 . THR A 1 43 ? -6.350  3.340   7.720   1.00 0.00 ? 107 THR A HG23 12 
ATOM   11239 N N    . PHE A 1 44 ? -6.135  1.695   5.276   1.00 0.00 ? 108 PHE A N    12 
ATOM   11240 C CA   . PHE A 1 44 ? -7.113  2.048   4.278   1.00 0.00 ? 108 PHE A CA   12 
ATOM   11241 C C    . PHE A 1 44 ? -7.982  3.177   4.738   1.00 0.00 ? 108 PHE A C    12 
ATOM   11242 O O    . PHE A 1 44 ? -8.656  3.072   5.776   1.00 0.00 ? 108 PHE A O    12 
ATOM   11243 C CB   . PHE A 1 44 ? -7.944  0.845   3.870   1.00 0.00 ? 108 PHE A CB   12 
ATOM   11244 C CG   . PHE A 1 44 ? -7.164  -0.146  3.074   1.00 0.00 ? 108 PHE A CG   12 
ATOM   11245 C CD1  . PHE A 1 44 ? -6.903  0.111   1.742   1.00 0.00 ? 108 PHE A CD1  12 
ATOM   11246 C CD2  . PHE A 1 44 ? -6.685  -1.322  3.644   1.00 0.00 ? 108 PHE A CD2  12 
ATOM   11247 C CE1  . PHE A 1 44 ? -6.180  -0.774  0.978   1.00 0.00 ? 108 PHE A CE1  12 
ATOM   11248 C CE2  . PHE A 1 44 ? -5.960  -2.217  2.882   1.00 0.00 ? 108 PHE A CE2  12 
ATOM   11249 C CZ   . PHE A 1 44 ? -5.704  -1.941  1.546   1.00 0.00 ? 108 PHE A CZ   12 
ATOM   11250 H H    . PHE A 1 44 ? -6.205  0.832   5.746   1.00 0.00 ? 108 PHE A H    12 
ATOM   11251 H HA   . PHE A 1 44 ? -6.562  2.384   3.415   1.00 0.00 ? 108 PHE A HA   12 
ATOM   11252 H HB2  . PHE A 1 44 ? -8.322  0.355   4.753   1.00 0.00 ? 108 PHE A HB2  12 
ATOM   11253 H HB3  . PHE A 1 44 ? -8.772  1.181   3.264   1.00 0.00 ? 108 PHE A HB3  12 
ATOM   11254 H HD1  . PHE A 1 44 ? -7.290  1.024   1.308   1.00 0.00 ? 108 PHE A HD1  12 
ATOM   11255 H HD2  . PHE A 1 44 ? -6.891  -1.551  4.681   1.00 0.00 ? 108 PHE A HD2  12 
ATOM   11256 H HE1  . PHE A 1 44 ? -5.993  -0.550  -0.062  1.00 0.00 ? 108 PHE A HE1  12 
ATOM   11257 H HE2  . PHE A 1 44 ? -5.592  -3.129  3.328   1.00 0.00 ? 108 PHE A HE2  12 
ATOM   11258 H HZ   . PHE A 1 44 ? -5.134  -2.637  0.949   1.00 0.00 ? 108 PHE A HZ   12 
ATOM   11259 N N    . ALA A 1 45 ? -7.971  4.239   3.960   1.00 0.00 ? 109 ALA A N    12 
ATOM   11260 C CA   . ALA A 1 45 ? -8.671  5.457   4.276   1.00 0.00 ? 109 ALA A CA   12 
ATOM   11261 C C    . ALA A 1 45 ? -10.162 5.231   4.310   1.00 0.00 ? 109 ALA A C    12 
ATOM   11262 O O    . ALA A 1 45 ? -10.748 4.675   3.369   1.00 0.00 ? 109 ALA A O    12 
ATOM   11263 C CB   . ALA A 1 45 ? -8.314  6.547   3.274   1.00 0.00 ? 109 ALA A CB   12 
ATOM   11264 H H    . ALA A 1 45 ? -7.497  4.194   3.098   1.00 0.00 ? 109 ALA A H    12 
ATOM   11265 H HA   . ALA A 1 45 ? -8.346  5.781   5.253   1.00 0.00 ? 109 ALA A HA   12 
ATOM   11266 H HB1  . ALA A 1 45 ? -8.642  6.250   2.289   1.00 0.00 ? 109 ALA A HB1  12 
ATOM   11267 H HB2  . ALA A 1 45 ? -8.802  7.470   3.551   1.00 0.00 ? 109 ALA A HB2  12 
ATOM   11268 H HB3  . ALA A 1 45 ? -7.244  6.695   3.269   1.00 0.00 ? 109 ALA A HB3  12 
ATOM   11269 N N    . GLY A 1 46 ? -10.762 5.588   5.408   1.00 0.00 ? 110 GLY A N    12 
ATOM   11270 C CA   . GLY A 1 46 ? -12.180 5.478   5.546   1.00 0.00 ? 110 GLY A CA   12 
ATOM   11271 C C    . GLY A 1 46 ? -12.603 4.172   6.164   1.00 0.00 ? 110 GLY A C    12 
ATOM   11272 O O    . GLY A 1 46 ? -13.382 4.162   7.119   1.00 0.00 ? 110 GLY A O    12 
ATOM   11273 H H    . GLY A 1 46 ? -10.221 5.928   6.155   1.00 0.00 ? 110 GLY A H    12 
ATOM   11274 H HA2  . GLY A 1 46 ? -12.536 6.288   6.164   1.00 0.00 ? 110 GLY A HA2  12 
ATOM   11275 H HA3  . GLY A 1 46 ? -12.628 5.558   4.567   1.00 0.00 ? 110 GLY A HA3  12 
ATOM   11276 N N    . TYR A 1 47 ? -12.110 3.073   5.623   1.00 0.00 ? 111 TYR A N    12 
ATOM   11277 C CA   . TYR A 1 47 ? -12.457 1.758   6.110   1.00 0.00 ? 111 TYR A CA   12 
ATOM   11278 C C    . TYR A 1 47 ? -11.772 1.478   7.447   1.00 0.00 ? 111 TYR A C    12 
ATOM   11279 O O    . TYR A 1 47 ? -12.415 1.059   8.409   1.00 0.00 ? 111 TYR A O    12 
ATOM   11280 C CB   . TYR A 1 47 ? -12.052 0.709   5.106   1.00 0.00 ? 111 TYR A CB   12 
ATOM   11281 C CG   . TYR A 1 47 ? -12.556 0.939   3.704   1.00 0.00 ? 111 TYR A CG   12 
ATOM   11282 C CD1  . TYR A 1 47 ? -13.837 0.578   3.340   1.00 0.00 ? 111 TYR A CD1  12 
ATOM   11283 C CD2  . TYR A 1 47 ? -11.720 1.477   2.732   1.00 0.00 ? 111 TYR A CD2  12 
ATOM   11284 C CE1  . TYR A 1 47 ? -14.281 0.745   2.049   1.00 0.00 ? 111 TYR A CE1  12 
ATOM   11285 C CE2  . TYR A 1 47 ? -12.150 1.656   1.439   1.00 0.00 ? 111 TYR A CE2  12 
ATOM   11286 C CZ   . TYR A 1 47 ? -13.439 1.283   1.098   1.00 0.00 ? 111 TYR A CZ   12 
ATOM   11287 O OH   . TYR A 1 47 ? -13.894 1.446   -0.198  1.00 0.00 ? 111 TYR A OH   12 
ATOM   11288 H H    . TYR A 1 47 ? -11.515 3.142   4.846   1.00 0.00 ? 111 TYR A H    12 
ATOM   11289 H HA   . TYR A 1 47 ? -13.528 1.718   6.245   1.00 0.00 ? 111 TYR A HA   12 
ATOM   11290 H HB2  . TYR A 1 47 ? -10.977 0.646   5.055   1.00 0.00 ? 111 TYR A HB2  12 
ATOM   11291 H HB3  . TYR A 1 47 ? -12.433 -0.246  5.434   1.00 0.00 ? 111 TYR A HB3  12 
ATOM   11292 H HD1  . TYR A 1 47 ? -14.498 0.160   4.085   1.00 0.00 ? 111 TYR A HD1  12 
ATOM   11293 H HD2  . TYR A 1 47 ? -10.717 1.767   3.007   1.00 0.00 ? 111 TYR A HD2  12 
ATOM   11294 H HE1  . TYR A 1 47 ? -15.283 0.442   1.786   1.00 0.00 ? 111 TYR A HE1  12 
ATOM   11295 H HE2  . TYR A 1 47 ? -11.462 2.073   0.717   1.00 0.00 ? 111 TYR A HE2  12 
ATOM   11296 H HH   . TYR A 1 47 ? -14.809 1.755   -0.140  1.00 0.00 ? 111 TYR A HH   12 
ATOM   11297 N N    . GLY A 1 48 ? -10.477 1.713   7.511   1.00 0.00 ? 112 GLY A N    12 
ATOM   11298 C CA   . GLY A 1 48 ? -9.766  1.534   8.760   1.00 0.00 ? 112 GLY A CA   12 
ATOM   11299 C C    . GLY A 1 48 ? -9.033  0.208   8.906   1.00 0.00 ? 112 GLY A C    12 
ATOM   11300 O O    . GLY A 1 48 ? -8.743  -0.213  10.033  1.00 0.00 ? 112 GLY A O    12 
ATOM   11301 H H    . GLY A 1 48 ? -9.998  2.051   6.723   1.00 0.00 ? 112 GLY A H    12 
ATOM   11302 H HA2  . GLY A 1 48 ? -9.039  2.327   8.852   1.00 0.00 ? 112 GLY A HA2  12 
ATOM   11303 H HA3  . GLY A 1 48 ? -10.474 1.629   9.570   1.00 0.00 ? 112 GLY A HA3  12 
ATOM   11304 N N    . ASN A 1 49 ? -8.730  -0.465  7.811   1.00 0.00 ? 113 ASN A N    12 
ATOM   11305 C CA   . ASN A 1 49 ? -7.937  -1.698  7.920   1.00 0.00 ? 113 ASN A CA   12 
ATOM   11306 C C    . ASN A 1 49 ? -6.518  -1.378  7.655   1.00 0.00 ? 113 ASN A C    12 
ATOM   11307 O O    . ASN A 1 49 ? -6.220  -0.324  7.099   1.00 0.00 ? 113 ASN A O    12 
ATOM   11308 C CB   . ASN A 1 49 ? -8.350  -2.820  6.967   1.00 0.00 ? 113 ASN A CB   12 
ATOM   11309 C CG   . ASN A 1 49 ? -9.691  -3.433  7.243   1.00 0.00 ? 113 ASN A CG   12 
ATOM   11310 O OD1  . ASN A 1 49 ? -10.191 -3.406  8.358   1.00 0.00 ? 113 ASN A OD1  12 
ATOM   11311 N ND2  . ASN A 1 49 ? -10.235 -4.056  6.249   1.00 0.00 ? 113 ASN A ND2  12 
ATOM   11312 H H    . ASN A 1 49 ? -8.997  -0.133  6.929   1.00 0.00 ? 113 ASN A H    12 
ATOM   11313 H HA   . ASN A 1 49 ? -8.022  -2.041  8.941   1.00 0.00 ? 113 ASN A HA   12 
ATOM   11314 H HB2  . ASN A 1 49 ? -8.367  -2.436  5.959   1.00 0.00 ? 113 ASN A HB2  12 
ATOM   11315 H HB3  . ASN A 1 49 ? -7.600  -3.596  7.024   1.00 0.00 ? 113 ASN A HB3  12 
ATOM   11316 H HD21 . ASN A 1 49 ? -9.725  -4.084  5.411   1.00 0.00 ? 113 ASN A HD21 12 
ATOM   11317 H HD22 . ASN A 1 49 ? -11.122 -4.454  6.344   1.00 0.00 ? 113 ASN A HD22 12 
ATOM   11318 N N    . ALA A 1 50 ? -5.647  -2.267  8.004   1.00 0.00 ? 114 ALA A N    12 
ATOM   11319 C CA   . ALA A 1 50 ? -4.248  -2.058  7.801   1.00 0.00 ? 114 ALA A CA   12 
ATOM   11320 C C    . ALA A 1 50 ? -3.610  -3.329  7.331   1.00 0.00 ? 114 ALA A C    12 
ATOM   11321 O O    . ALA A 1 50 ? -3.876  -4.403  7.889   1.00 0.00 ? 114 ALA A O    12 
ATOM   11322 C CB   . ALA A 1 50 ? -3.579  -1.571  9.078   1.00 0.00 ? 114 ALA A CB   12 
ATOM   11323 H H    . ALA A 1 50 ? -5.941  -3.123  8.387   1.00 0.00 ? 114 ALA A H    12 
ATOM   11324 H HA   . ALA A 1 50 ? -4.129  -1.298  7.043   1.00 0.00 ? 114 ALA A HA   12 
ATOM   11325 H HB1  . ALA A 1 50 ? -3.672  -2.326  9.843   1.00 0.00 ? 114 ALA A HB1  12 
ATOM   11326 H HB2  . ALA A 1 50 ? -2.533  -1.381  8.884   1.00 0.00 ? 114 ALA A HB2  12 
ATOM   11327 H HB3  . ALA A 1 50 ? -4.056  -0.660  9.408   1.00 0.00 ? 114 ALA A HB3  12 
ATOM   11328 N N    . GLU A 1 51 ? -2.799  -3.232  6.317   1.00 0.00 ? 115 GLU A N    12 
ATOM   11329 C CA   . GLU A 1 51 ? -2.104  -4.377  5.819   1.00 0.00 ? 115 GLU A CA   12 
ATOM   11330 C C    . GLU A 1 51 ? -0.699  -3.987  5.449   1.00 0.00 ? 115 GLU A C    12 
ATOM   11331 O O    . GLU A 1 51 ? -0.404  -2.797  5.275   1.00 0.00 ? 115 GLU A O    12 
ATOM   11332 C CB   . GLU A 1 51 ? -2.816  -5.030  4.618   1.00 0.00 ? 115 GLU A CB   12 
ATOM   11333 C CG   . GLU A 1 51 ? -2.803  -4.265  3.308   1.00 0.00 ? 115 GLU A CG   12 
ATOM   11334 C CD   . GLU A 1 51 ? -3.206  -5.170  2.160   1.00 0.00 ? 115 GLU A CD   12 
ATOM   11335 O OE1  . GLU A 1 51 ? -4.417  -5.451  1.981   1.00 0.00 ? 115 GLU A OE1  12 
ATOM   11336 O OE2  . GLU A 1 51 ? -2.300  -5.677  1.459   1.00 0.00 ? 115 GLU A OE2  12 
ATOM   11337 H H    . GLU A 1 51 ? -2.642  -2.356  5.899   1.00 0.00 ? 115 GLU A H    12 
ATOM   11338 H HA   . GLU A 1 51 ? -2.054  -5.092  6.628   1.00 0.00 ? 115 GLU A HA   12 
ATOM   11339 H HB2  . GLU A 1 51 ? -2.379  -5.990  4.406   1.00 0.00 ? 115 GLU A HB2  12 
ATOM   11340 H HB3  . GLU A 1 51 ? -3.854  -5.144  4.895   1.00 0.00 ? 115 GLU A HB3  12 
ATOM   11341 H HG2  . GLU A 1 51 ? -3.493  -3.436  3.370   1.00 0.00 ? 115 GLU A HG2  12 
ATOM   11342 H HG3  . GLU A 1 51 ? -1.805  -3.897  3.125   1.00 0.00 ? 115 GLU A HG3  12 
ATOM   11343 N N    . VAL A 1 52 ? 0.164   -4.956  5.370   1.00 0.00 ? 116 VAL A N    12 
ATOM   11344 C CA   . VAL A 1 52 ? 1.507   -4.729  4.951   1.00 0.00 ? 116 VAL A CA   12 
ATOM   11345 C C    . VAL A 1 52 ? 1.606   -5.181  3.508   1.00 0.00 ? 116 VAL A C    12 
ATOM   11346 O O    . VAL A 1 52 ? 1.499   -6.378  3.200   1.00 0.00 ? 116 VAL A O    12 
ATOM   11347 C CB   . VAL A 1 52 ? 2.535   -5.478  5.839   1.00 0.00 ? 116 VAL A CB   12 
ATOM   11348 C CG1  . VAL A 1 52 ? 3.951   -5.150  5.408   1.00 0.00 ? 116 VAL A CG1  12 
ATOM   11349 C CG2  . VAL A 1 52 ? 2.338   -5.125  7.305   1.00 0.00 ? 116 VAL A CG2  12 
ATOM   11350 H H    . VAL A 1 52 ? -0.112  -5.874  5.581   1.00 0.00 ? 116 VAL A H    12 
ATOM   11351 H HA   . VAL A 1 52 ? 1.692   -3.666  4.990   1.00 0.00 ? 116 VAL A HA   12 
ATOM   11352 H HB   . VAL A 1 52 ? 2.378   -6.540  5.718   1.00 0.00 ? 116 VAL A HB   12 
ATOM   11353 H HG11 . VAL A 1 52 ? 4.095   -4.080  5.428   1.00 0.00 ? 116 VAL A HG11 12 
ATOM   11354 H HG12 . VAL A 1 52 ? 4.651   -5.617  6.084   1.00 0.00 ? 116 VAL A HG12 12 
ATOM   11355 H HG13 . VAL A 1 52 ? 4.107   -5.514  4.403   1.00 0.00 ? 116 VAL A HG13 12 
ATOM   11356 H HG21 . VAL A 1 52 ? 1.336   -5.395  7.604   1.00 0.00 ? 116 VAL A HG21 12 
ATOM   11357 H HG22 . VAL A 1 52 ? 3.054   -5.662  7.909   1.00 0.00 ? 116 VAL A HG22 12 
ATOM   11358 H HG23 . VAL A 1 52 ? 2.476   -4.062  7.441   1.00 0.00 ? 116 VAL A HG23 12 
ATOM   11359 N N    . THR A 1 53 ? 1.762   -4.238  2.645   1.00 0.00 ? 117 THR A N    12 
ATOM   11360 C CA   . THR A 1 53 ? 1.749   -4.468  1.224   1.00 0.00 ? 117 THR A CA   12 
ATOM   11361 C C    . THR A 1 53 ? 3.037   -3.902  0.609   1.00 0.00 ? 117 THR A C    12 
ATOM   11362 O O    . THR A 1 53 ? 3.556   -2.895  1.090   1.00 0.00 ? 117 THR A O    12 
ATOM   11363 C CB   . THR A 1 53 ? 0.468   -3.839  0.573   1.00 0.00 ? 117 THR A CB   12 
ATOM   11364 O OG1  . THR A 1 53 ? 0.355   -4.195  -0.814  1.00 0.00 ? 117 THR A OG1  12 
ATOM   11365 C CG2  . THR A 1 53 ? 0.462   -2.327  0.711   1.00 0.00 ? 117 THR A CG2  12 
ATOM   11366 H H    . THR A 1 53 ? 1.917   -3.324  2.984   1.00 0.00 ? 117 THR A H    12 
ATOM   11367 H HA   . THR A 1 53 ? 1.734   -5.537  1.072   1.00 0.00 ? 117 THR A HA   12 
ATOM   11368 H HB   . THR A 1 53 ? -0.394  -4.234  1.090   1.00 0.00 ? 117 THR A HB   12 
ATOM   11369 H HG1  . THR A 1 53 ? -0.499  -4.631  -0.902  1.00 0.00 ? 117 THR A HG1  12 
ATOM   11370 H HG21 . THR A 1 53 ? 1.320   -1.920  0.195   1.00 0.00 ? 117 THR A HG21 12 
ATOM   11371 H HG22 . THR A 1 53 ? -0.442  -1.924  0.279   1.00 0.00 ? 117 THR A HG22 12 
ATOM   11372 H HG23 . THR A 1 53 ? 0.517   -2.064  1.757   1.00 0.00 ? 117 THR A HG23 12 
ATOM   11373 N N    . PRO A 1 54 ? 3.629   -4.591  -0.376  1.00 0.00 ? 118 PRO A N    12 
ATOM   11374 C CA   . PRO A 1 54 ? 4.860   -4.143  -1.016  1.00 0.00 ? 118 PRO A CA   12 
ATOM   11375 C C    . PRO A 1 54 ? 4.703   -2.774  -1.682  1.00 0.00 ? 118 PRO A C    12 
ATOM   11376 O O    . PRO A 1 54 ? 3.629   -2.439  -2.188  1.00 0.00 ? 118 PRO A O    12 
ATOM   11377 C CB   . PRO A 1 54 ? 5.137   -5.216  -2.068  1.00 0.00 ? 118 PRO A CB   12 
ATOM   11378 C CG   . PRO A 1 54 ? 3.845   -5.888  -2.284  1.00 0.00 ? 118 PRO A CG   12 
ATOM   11379 C CD   . PRO A 1 54 ? 3.120   -5.827  -0.980  1.00 0.00 ? 118 PRO A CD   12 
ATOM   11380 H HA   . PRO A 1 54 ? 5.683   -4.100  -0.323  1.00 0.00 ? 118 PRO A HA   12 
ATOM   11381 H HB2  . PRO A 1 54 ? 5.485   -4.748  -2.975  1.00 0.00 ? 118 PRO A HB2  12 
ATOM   11382 H HB3  . PRO A 1 54 ? 5.881   -5.909  -1.706  1.00 0.00 ? 118 PRO A HB3  12 
ATOM   11383 H HG2  . PRO A 1 54 ? 3.290   -5.366  -3.049  1.00 0.00 ? 118 PRO A HG2  12 
ATOM   11384 H HG3  . PRO A 1 54 ? 4.017   -6.910  -2.582  1.00 0.00 ? 118 PRO A HG3  12 
ATOM   11385 H HD2  . PRO A 1 54 ? 2.057   -5.751  -1.157  1.00 0.00 ? 118 PRO A HD2  12 
ATOM   11386 H HD3  . PRO A 1 54 ? 3.336   -6.686  -0.367  1.00 0.00 ? 118 PRO A HD3  12 
ATOM   11387 N N    . LEU A 1 55 ? 5.780   -2.000  -1.682  1.00 0.00 ? 119 LEU A N    12 
ATOM   11388 C CA   . LEU A 1 55 ? 5.829   -0.660  -2.294  1.00 0.00 ? 119 LEU A CA   12 
ATOM   11389 C C    . LEU A 1 55 ? 5.446   -0.712  -3.767  1.00 0.00 ? 119 LEU A C    12 
ATOM   11390 O O    . LEU A 1 55 ? 4.971   0.270   -4.325  1.00 0.00 ? 119 LEU A O    12 
ATOM   11391 C CB   . LEU A 1 55 ? 7.231   -0.052  -2.153  1.00 0.00 ? 119 LEU A CB   12 
ATOM   11392 C CG   . LEU A 1 55 ? 7.790   0.063   -0.732  1.00 0.00 ? 119 LEU A CG   12 
ATOM   11393 C CD1  . LEU A 1 55 ? 9.175   0.691   -0.748  1.00 0.00 ? 119 LEU A CD1  12 
ATOM   11394 C CD2  . LEU A 1 55 ? 6.855   0.846   0.173   1.00 0.00 ? 119 LEU A CD2  12 
ATOM   11395 H H    . LEU A 1 55 ? 6.582   -2.340  -1.227  1.00 0.00 ? 119 LEU A H    12 
ATOM   11396 H HA   . LEU A 1 55 ? 5.120   -0.024  -1.789  1.00 0.00 ? 119 LEU A HA   12 
ATOM   11397 H HB2  . LEU A 1 55 ? 7.910   -0.663  -2.728  1.00 0.00 ? 119 LEU A HB2  12 
ATOM   11398 H HB3  . LEU A 1 55 ? 7.217   0.933   -2.592  1.00 0.00 ? 119 LEU A HB3  12 
ATOM   11399 H HG   . LEU A 1 55 ? 7.885   -0.939  -0.341  1.00 0.00 ? 119 LEU A HG   12 
ATOM   11400 H HD11 . LEU A 1 55 ? 9.119   1.686   -1.164  1.00 0.00 ? 119 LEU A HD11 12 
ATOM   11401 H HD12 . LEU A 1 55 ? 9.557   0.741   0.261   1.00 0.00 ? 119 LEU A HD12 12 
ATOM   11402 H HD13 . LEU A 1 55 ? 9.836   0.084   -1.349  1.00 0.00 ? 119 LEU A HD13 12 
ATOM   11403 H HD21 . LEU A 1 55 ? 5.895   0.351   0.206   1.00 0.00 ? 119 LEU A HD21 12 
ATOM   11404 H HD22 . LEU A 1 55 ? 7.273   0.887   1.168   1.00 0.00 ? 119 LEU A HD22 12 
ATOM   11405 H HD23 . LEU A 1 55 ? 6.728   1.849   -0.202  1.00 0.00 ? 119 LEU A HD23 12 
ATOM   11406 N N    . LEU A 1 56 ? 5.671   -1.866  -4.379  1.00 0.00 ? 120 LEU A N    12 
ATOM   11407 C CA   . LEU A 1 56 ? 5.334   -2.102  -5.775  1.00 0.00 ? 120 LEU A CA   12 
ATOM   11408 C C    . LEU A 1 56 ? 3.800   -2.036  -5.972  1.00 0.00 ? 120 LEU A C    12 
ATOM   11409 O O    . LEU A 1 56 ? 3.304   -1.665  -7.032  1.00 0.00 ? 120 LEU A O    12 
ATOM   11410 C CB   . LEU A 1 56 ? 5.909   -3.478  -6.205  1.00 0.00 ? 120 LEU A CB   12 
ATOM   11411 C CG   . LEU A 1 56 ? 5.125   -4.732  -5.795  1.00 0.00 ? 120 LEU A CG   12 
ATOM   11412 C CD1  . LEU A 1 56 ? 4.120   -5.088  -6.867  1.00 0.00 ? 120 LEU A CD1  12 
ATOM   11413 C CD2  . LEU A 1 56 ? 6.048   -5.897  -5.500  1.00 0.00 ? 120 LEU A CD2  12 
ATOM   11414 H H    . LEU A 1 56 ? 6.108   -2.579  -3.863  1.00 0.00 ? 120 LEU A H    12 
ATOM   11415 H HA   . LEU A 1 56 ? 5.783   -1.329  -6.373  1.00 0.00 ? 120 LEU A HA   12 
ATOM   11416 H HB2  . LEU A 1 56 ? 6.002   -3.487  -7.279  1.00 0.00 ? 120 LEU A HB2  12 
ATOM   11417 H HB3  . LEU A 1 56 ? 6.897   -3.555  -5.779  1.00 0.00 ? 120 LEU A HB3  12 
ATOM   11418 H HG   . LEU A 1 56 ? 4.553   -4.504  -4.907  1.00 0.00 ? 120 LEU A HG   12 
ATOM   11419 H HD11 . LEU A 1 56 ? 3.529   -4.201  -7.044  1.00 0.00 ? 120 LEU A HD11 12 
ATOM   11420 H HD12 . LEU A 1 56 ? 4.639   -5.364  -7.772  1.00 0.00 ? 120 LEU A HD12 12 
ATOM   11421 H HD13 . LEU A 1 56 ? 3.484   -5.892  -6.525  1.00 0.00 ? 120 LEU A HD13 12 
ATOM   11422 H HD21 . LEU A 1 56 ? 6.697   -5.639  -4.677  1.00 0.00 ? 120 LEU A HD21 12 
ATOM   11423 H HD22 . LEU A 1 56 ? 5.456   -6.758  -5.227  1.00 0.00 ? 120 LEU A HD22 12 
ATOM   11424 H HD23 . LEU A 1 56 ? 6.645   -6.133  -6.365  1.00 0.00 ? 120 LEU A HD23 12 
ATOM   11425 N N    . ASN A 1 57 ? 3.075   -2.384  -4.923  1.00 0.00 ? 121 ASN A N    12 
ATOM   11426 C CA   . ASN A 1 57 ? 1.615   -2.412  -4.944  1.00 0.00 ? 121 ASN A CA   12 
ATOM   11427 C C    . ASN A 1 57 ? 1.034   -1.091  -4.534  1.00 0.00 ? 121 ASN A C    12 
ATOM   11428 O O    . ASN A 1 57 ? -0.186  -0.910  -4.545  1.00 0.00 ? 121 ASN A O    12 
ATOM   11429 C CB   . ASN A 1 57 ? 1.050   -3.535  -4.049  1.00 0.00 ? 121 ASN A CB   12 
ATOM   11430 C CG   . ASN A 1 57 ? 1.056   -4.899  -4.698  1.00 0.00 ? 121 ASN A CG   12 
ATOM   11431 O OD1  . ASN A 1 57 ? 0.968   -5.032  -5.919  1.00 0.0