data_4A9J
# 
_entry.id   4A9J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4A9J         
PDBE  EBI-50485    
WWPDB D_1290050485 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2YEK unspecified 'CRYSTAL STRUCTURE OF THE FIRST BROMODOMAIN OF HUMAN BRD2 WITH THE INHIBITOR GSK525762 (IBET)' 
PDB 4A9E unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3-METHYL-1 ,2,3,4-TETRAHYDROQUINAZOLIN-2-ONE' 
PDB 1X0J unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE N-TERMINAL BROMODOMAIN OFHUMAN BRD2' 
PDB 4A9F unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1- METHYLPYRROLIDIN-2-ONE' 
PDB 2YDW unspecified 'CRYSTAL STRUCTURE OF THE FIRST BROMODOMAIN OF HUMAN BRD2 WITH THE INHIBITOR GW841819X' 
PDB 4A9K unspecified 'BROMODOMAIN OF HUMAN CREBBP WITH N-(4-HYDROXYPHENYL) ACETAMIDE' 
PDB 4A9M unspecified 
'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N- CYCLOPENTYL-5-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-2- METHYLBENZENE-1-SULFONAMIDE' 
PDB 4A9H unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1-(2- METHYL-1,2,3,4-TETRAHYDROQUINOLIN-1-YL)ETHAN-1-ONE' 
PDB 4A9L unspecified 
'N-TERMINAL BROMODOMAIN OF HUMAN BRD4 WITH 1,3- DIMETHYL-6-(MORPHOLINE-4-SULFONYL)-1,2,3,4- TETRAHYDROQUINAZOLIN-2-ONE'    
PDB 4A9I unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3-METHYL-1 ,2,3,4-TETRAHYDROQUINAZOLIN-2-ONE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A9J 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chung, C.W.'    1 
'Bamborough, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                576 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22136404 
_citation.pdbx_database_id_DOI      10.1021/JM201320W 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chung, C.W.'    1 ? 
primary 'Dean, A.W.'     2 ? 
primary 'Woolven, J.M.'  3 ? 
primary 'Bamborough, P.' 4 ? 
# 
_cell.entry_id           4A9J 
_cell.length_a           114.051 
_cell.length_b           55.542 
_cell.length_c           68.072 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.88 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A9J 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BROMODOMAIN CONTAINING 2'               17908.727 3   ? ? 'N-TERMINAL BROMODOMAIN (BD1), RESIDUES 67-200' ? 
2 non-polymer syn 1,2-ETHANEDIOL                           62.068    3   ? ? ?                                               ? 
3 non-polymer syn 'N-(4-HYDROXYPHENYL)ACETAMIDE (TYLENOL)' 151.163   3   ? ? ?                                               ? 
4 non-polymer syn 'SULFATE ION'                            96.063    3   ? ? ?                                               ? 
5 water       nat water                                    18.015    303 ? ? ?                                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN BRD2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTI
KRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTI
KRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  HIS n 
1 20  MET n 
1 21  SER n 
1 22  ASN n 
1 23  PRO n 
1 24  LYS n 
1 25  LYS n 
1 26  PRO n 
1 27  GLY n 
1 28  ARG n 
1 29  VAL n 
1 30  THR n 
1 31  ASN n 
1 32  GLN n 
1 33  LEU n 
1 34  GLN n 
1 35  TYR n 
1 36  LEU n 
1 37  HIS n 
1 38  LYS n 
1 39  VAL n 
1 40  VAL n 
1 41  MET n 
1 42  LYS n 
1 43  ALA n 
1 44  LEU n 
1 45  TRP n 
1 46  LYS n 
1 47  HIS n 
1 48  GLN n 
1 49  PHE n 
1 50  ALA n 
1 51  TRP n 
1 52  PRO n 
1 53  PHE n 
1 54  ARG n 
1 55  GLN n 
1 56  PRO n 
1 57  VAL n 
1 58  ASP n 
1 59  ALA n 
1 60  VAL n 
1 61  LYS n 
1 62  LEU n 
1 63  GLY n 
1 64  LEU n 
1 65  PRO n 
1 66  ASP n 
1 67  TYR n 
1 68  HIS n 
1 69  LYS n 
1 70  ILE n 
1 71  ILE n 
1 72  LYS n 
1 73  GLN n 
1 74  PRO n 
1 75  MET n 
1 76  ASP n 
1 77  MET n 
1 78  GLY n 
1 79  THR n 
1 80  ILE n 
1 81  LYS n 
1 82  ARG n 
1 83  ARG n 
1 84  LEU n 
1 85  GLU n 
1 86  ASN n 
1 87  ASN n 
1 88  TYR n 
1 89  TYR n 
1 90  TRP n 
1 91  ALA n 
1 92  ALA n 
1 93  SER n 
1 94  GLU n 
1 95  CYS n 
1 96  MET n 
1 97  GLN n 
1 98  ASP n 
1 99  PHE n 
1 100 ASN n 
1 101 THR n 
1 102 MET n 
1 103 PHE n 
1 104 THR n 
1 105 ASN n 
1 106 CYS n 
1 107 TYR n 
1 108 ILE n 
1 109 TYR n 
1 110 ASN n 
1 111 LYS n 
1 112 PRO n 
1 113 THR n 
1 114 ASP n 
1 115 ASP n 
1 116 ILE n 
1 117 VAL n 
1 118 LEU n 
1 119 MET n 
1 120 ALA n 
1 121 GLN n 
1 122 THR n 
1 123 LEU n 
1 124 GLU n 
1 125 LYS n 
1 126 ILE n 
1 127 PHE n 
1 128 LEU n 
1 129 GLN n 
1 130 LYS n 
1 131 VAL n 
1 132 ALA n 
1 133 SER n 
1 134 MET n 
1 135 PRO n 
1 136 GLN n 
1 137 GLU n 
1 138 GLU n 
1 139 GLN n 
1 140 GLU n 
1 141 LEU n 
1 142 VAL n 
1 143 VAL n 
1 144 THR n 
1 145 ILE n 
1 146 PRO n 
1 147 LYS n 
1 148 ASN n 
1 149 SER n 
1 150 HIS n 
1 151 LYS n 
1 152 LYS n 
1 153 GLY n 
1 154 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRD2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P25440 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4A9J A 21 ? 154 ? P25440 67 ? 200 ? 67 200 
2 1 4A9J B 21 ? 154 ? P25440 67 ? 200 ? 67 200 
3 1 4A9J C 21 ? 154 ? P25440 67 ? 200 ? 67 200 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4A9J GLY A 1  ? UNP P25440 ? ? 'expression tag' 47 1  
1 4A9J SER A 2  ? UNP P25440 ? ? 'expression tag' 48 2  
1 4A9J SER A 3  ? UNP P25440 ? ? 'expression tag' 49 3  
1 4A9J HIS A 4  ? UNP P25440 ? ? 'expression tag' 50 4  
1 4A9J HIS A 5  ? UNP P25440 ? ? 'expression tag' 51 5  
1 4A9J HIS A 6  ? UNP P25440 ? ? 'expression tag' 52 6  
1 4A9J HIS A 7  ? UNP P25440 ? ? 'expression tag' 53 7  
1 4A9J HIS A 8  ? UNP P25440 ? ? 'expression tag' 54 8  
1 4A9J HIS A 9  ? UNP P25440 ? ? 'expression tag' 55 9  
1 4A9J SER A 10 ? UNP P25440 ? ? 'expression tag' 56 10 
1 4A9J SER A 11 ? UNP P25440 ? ? 'expression tag' 57 11 
1 4A9J GLY A 12 ? UNP P25440 ? ? 'expression tag' 58 12 
1 4A9J LEU A 13 ? UNP P25440 ? ? 'expression tag' 59 13 
1 4A9J VAL A 14 ? UNP P25440 ? ? 'expression tag' 60 14 
1 4A9J PRO A 15 ? UNP P25440 ? ? 'expression tag' 61 15 
1 4A9J ARG A 16 ? UNP P25440 ? ? 'expression tag' 62 16 
1 4A9J GLY A 17 ? UNP P25440 ? ? 'expression tag' 63 17 
1 4A9J SER A 18 ? UNP P25440 ? ? 'expression tag' 64 18 
1 4A9J HIS A 19 ? UNP P25440 ? ? 'expression tag' 65 19 
1 4A9J MET A 20 ? UNP P25440 ? ? 'expression tag' 66 20 
2 4A9J GLY B 1  ? UNP P25440 ? ? 'expression tag' 47 21 
2 4A9J SER B 2  ? UNP P25440 ? ? 'expression tag' 48 22 
2 4A9J SER B 3  ? UNP P25440 ? ? 'expression tag' 49 23 
2 4A9J HIS B 4  ? UNP P25440 ? ? 'expression tag' 50 24 
2 4A9J HIS B 5  ? UNP P25440 ? ? 'expression tag' 51 25 
2 4A9J HIS B 6  ? UNP P25440 ? ? 'expression tag' 52 26 
2 4A9J HIS B 7  ? UNP P25440 ? ? 'expression tag' 53 27 
2 4A9J HIS B 8  ? UNP P25440 ? ? 'expression tag' 54 28 
2 4A9J HIS B 9  ? UNP P25440 ? ? 'expression tag' 55 29 
2 4A9J SER B 10 ? UNP P25440 ? ? 'expression tag' 56 30 
2 4A9J SER B 11 ? UNP P25440 ? ? 'expression tag' 57 31 
2 4A9J GLY B 12 ? UNP P25440 ? ? 'expression tag' 58 32 
2 4A9J LEU B 13 ? UNP P25440 ? ? 'expression tag' 59 33 
2 4A9J VAL B 14 ? UNP P25440 ? ? 'expression tag' 60 34 
2 4A9J PRO B 15 ? UNP P25440 ? ? 'expression tag' 61 35 
2 4A9J ARG B 16 ? UNP P25440 ? ? 'expression tag' 62 36 
2 4A9J GLY B 17 ? UNP P25440 ? ? 'expression tag' 63 37 
2 4A9J SER B 18 ? UNP P25440 ? ? 'expression tag' 64 38 
2 4A9J HIS B 19 ? UNP P25440 ? ? 'expression tag' 65 39 
2 4A9J MET B 20 ? UNP P25440 ? ? 'expression tag' 66 40 
3 4A9J GLY C 1  ? UNP P25440 ? ? 'expression tag' 47 41 
3 4A9J SER C 2  ? UNP P25440 ? ? 'expression tag' 48 42 
3 4A9J SER C 3  ? UNP P25440 ? ? 'expression tag' 49 43 
3 4A9J HIS C 4  ? UNP P25440 ? ? 'expression tag' 50 44 
3 4A9J HIS C 5  ? UNP P25440 ? ? 'expression tag' 51 45 
3 4A9J HIS C 6  ? UNP P25440 ? ? 'expression tag' 52 46 
3 4A9J HIS C 7  ? UNP P25440 ? ? 'expression tag' 53 47 
3 4A9J HIS C 8  ? UNP P25440 ? ? 'expression tag' 54 48 
3 4A9J HIS C 9  ? UNP P25440 ? ? 'expression tag' 55 49 
3 4A9J SER C 10 ? UNP P25440 ? ? 'expression tag' 56 50 
3 4A9J SER C 11 ? UNP P25440 ? ? 'expression tag' 57 51 
3 4A9J GLY C 12 ? UNP P25440 ? ? 'expression tag' 58 52 
3 4A9J LEU C 13 ? UNP P25440 ? ? 'expression tag' 59 53 
3 4A9J VAL C 14 ? UNP P25440 ? ? 'expression tag' 60 54 
3 4A9J PRO C 15 ? UNP P25440 ? ? 'expression tag' 61 55 
3 4A9J ARG C 16 ? UNP P25440 ? ? 'expression tag' 62 56 
3 4A9J GLY C 17 ? UNP P25440 ? ? 'expression tag' 63 57 
3 4A9J SER C 18 ? UNP P25440 ? ? 'expression tag' 64 58 
3 4A9J HIS C 19 ? UNP P25440 ? ? 'expression tag' 65 59 
3 4A9J MET C 20 ? UNP P25440 ? ? 'expression tag' 66 60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                               ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                   ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                            ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                                ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'  204.225 
TYL non-polymer         . 'N-(4-HYDROXYPHENYL)ACETAMIDE (TYLENOL)' ?                 'C8 H9 N O2'     151.163 
TYR 'L-peptide linking' y TYROSINE                                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                   ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4A9J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.48 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES PH 7.0, 24-28% PEG 3350, 0.2 M (NH4)2SO4, 20 DEGREES CELSIUS.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   'RIGAKU A200' 
_diffrn_detector.pdbx_collection_date   2010-06-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.54178 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4A9J 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             67.83 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   33482 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.80 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.40 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        3.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4A9J 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     31776 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             67.83 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.18548 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18372 
_refine.ls_R_factor_R_free                       0.21828 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1693 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               59.570 
_refine.aniso_B[1][1]                            1.24 
_refine.aniso_B[2][2]                            -0.60 
_refine.aniso_B[3][3]                            -0.75 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.65 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.146 
_refine.pdbx_overall_ESU_R_Free                  0.134 
_refine.overall_SU_ML                            0.100 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.628 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2754 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             303 
_refine_hist.number_atoms_total               3117 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        67.83 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 2965 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2020 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.930  1.953  ? 4013 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.804  3.000  ? 4935 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.298  5.000  ? 342  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.031 24.857 ? 140  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.966 15.000 ? 536  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       24.398 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.053  0.200  ? 415  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 3222 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 600  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.630  2.000  ? 1715 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.092  2.000  ? 667  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.207  4.000  ? 2797 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.495  4.000  ? 1250 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.453  6.000  ? 1216 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             2372 
_refine_ls_shell.R_factor_R_work                  0.257 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.304 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4A9J 
_struct.title                     'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N-(4-hydroxyphenyl) acetamide' 
_struct.pdbx_descriptor           'BROMODOMAIN CONTAINING 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A9J 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'INHIBITOR, HISTONE, EPIGENETIC READER, SIGNALING PROTEIN, PARACETAMOL' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 30  ? VAL A 39  ? THR A 76  VAL A 85  1 ? 10 
HELX_P HELX_P2  2  VAL A 39  ? LYS A 46  ? VAL A 85  LYS A 92  1 ? 8  
HELX_P HELX_P3  3  ALA A 50  ? ARG A 54  ? ALA A 96  ARG A 100 5 ? 5  
HELX_P HELX_P4  4  ASP A 58  ? GLY A 63  ? ASP A 104 GLY A 109 1 ? 6  
HELX_P HELX_P5  5  ASP A 66  ? ILE A 71  ? ASP A 112 ILE A 117 1 ? 6  
HELX_P HELX_P6  6  ASP A 76  ? ASN A 86  ? ASP A 122 ASN A 132 1 ? 11 
HELX_P HELX_P7  7  ALA A 91  ? ASN A 110 ? ALA A 137 ASN A 156 1 ? 20 
HELX_P HELX_P8  8  ASP A 114 ? ALA A 132 ? ASP A 160 ALA A 178 1 ? 19 
HELX_P HELX_P9  9  THR B 30  ? VAL B 39  ? THR B 76  VAL B 85  1 ? 10 
HELX_P HELX_P10 10 VAL B 39  ? HIS B 47  ? VAL B 85  HIS B 93  1 ? 9  
HELX_P HELX_P11 11 ALA B 50  ? ARG B 54  ? ALA B 96  ARG B 100 5 ? 5  
HELX_P HELX_P12 12 ASP B 66  ? ILE B 71  ? ASP B 112 ILE B 117 1 ? 6  
HELX_P HELX_P13 13 ASP B 76  ? ASN B 86  ? ASP B 122 ASN B 132 1 ? 11 
HELX_P HELX_P14 14 ALA B 91  ? ASN B 110 ? ALA B 137 ASN B 156 1 ? 20 
HELX_P HELX_P15 15 ASP B 114 ? ALA B 132 ? ASP B 160 ALA B 178 1 ? 19 
HELX_P HELX_P16 16 ASN C 31  ? VAL C 39  ? ASN C 77  VAL C 85  1 ? 9  
HELX_P HELX_P17 17 VAL C 39  ? LYS C 46  ? VAL C 85  LYS C 92  1 ? 8  
HELX_P HELX_P18 18 HIS C 47  ? ARG C 54  ? HIS C 93  ARG C 100 5 ? 8  
HELX_P HELX_P19 19 ASP C 66  ? ILE C 71  ? ASP C 112 ILE C 117 1 ? 6  
HELX_P HELX_P20 20 ASP C 76  ? ASN C 86  ? ASP C 122 ASN C 132 1 ? 11 
HELX_P HELX_P21 21 ALA C 91  ? ASN C 110 ? ALA C 137 ASN C 156 1 ? 20 
HELX_P HELX_P22 22 ASP C 114 ? SER C 133 ? ASP C 160 SER C 179 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE EDO A 1187' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE TYL A 1188' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 1189' 
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE EDO B 1186' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE TYL B 1187' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO C 1183' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE TYL C 1184' 
AC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 C 1185' 
AC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 C 1186' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 TRP A 51  ? TRP A 97   . ? 1_555 ? 
2  AC1 7 ASP A 115 ? ASP A 161  . ? 1_555 ? 
3  AC1 7 MET A 119 ? MET A 165  . ? 1_555 ? 
4  AC1 7 HOH M .   ? HOH A 2111 . ? 1_555 ? 
5  AC1 7 HOH M .   ? HOH A 2125 . ? 1_555 ? 
6  AC1 7 HOH M .   ? HOH A 2126 . ? 1_555 ? 
7  AC1 7 GLN B 48  ? GLN B 94   . ? 4_555 ? 
8  AC2 9 VAL A 57  ? VAL A 103  . ? 1_555 ? 
9  AC2 9 LEU A 62  ? LEU A 108  . ? 1_555 ? 
10 AC2 9 LEU A 64  ? LEU A 110  . ? 1_555 ? 
11 AC2 9 ASN A 110 ? ASN A 156  . ? 1_555 ? 
12 AC2 9 ILE A 116 ? ILE A 162  . ? 1_555 ? 
13 AC2 9 HOH M .   ? HOH A 2026 . ? 1_555 ? 
14 AC2 9 HOH M .   ? HOH A 2043 . ? 1_555 ? 
15 AC2 9 HOH M .   ? HOH A 2052 . ? 1_555 ? 
16 AC2 9 HOH M .   ? HOH A 2127 . ? 1_555 ? 
17 AC3 5 TRP A 51  ? TRP A 97   . ? 1_555 ? 
18 AC3 5 ARG A 54  ? ARG A 100  . ? 1_555 ? 
19 AC3 5 HOH M .   ? HOH A 2016 . ? 1_555 ? 
20 AC3 5 HOH M .   ? HOH A 2019 . ? 1_555 ? 
21 AC3 5 HOH M .   ? HOH A 2021 . ? 1_555 ? 
22 AC4 3 GLN A 48  ? GLN A 94   . ? 4_545 ? 
23 AC4 3 HOH N .   ? HOH B 2091 . ? 1_555 ? 
24 AC4 3 HOH N .   ? HOH B 2101 . ? 1_555 ? 
25 AC5 7 VAL B 57  ? VAL B 103  . ? 1_555 ? 
26 AC5 7 ASN B 110 ? ASN B 156  . ? 1_555 ? 
27 AC5 7 ILE B 116 ? ILE B 162  . ? 1_555 ? 
28 AC5 7 HOH N .   ? HOH B 2017 . ? 1_555 ? 
29 AC5 7 HOH N .   ? HOH B 2035 . ? 1_555 ? 
30 AC5 7 HOH N .   ? HOH B 2041 . ? 1_555 ? 
31 AC5 7 HOH N .   ? HOH B 2102 . ? 1_555 ? 
32 AC6 4 TRP B 51  ? TRP B 97   . ? 3_455 ? 
33 AC6 4 ARG C 82  ? ARG C 128  . ? 1_555 ? 
34 AC6 4 ASN C 86  ? ASN C 132  . ? 1_555 ? 
35 AC6 4 SO4 K .   ? SO4 C 1185 . ? 1_555 ? 
36 AC7 5 VAL C 57  ? VAL C 103  . ? 1_555 ? 
37 AC7 5 LEU C 62  ? LEU C 108  . ? 1_555 ? 
38 AC7 5 ASN C 110 ? ASN C 156  . ? 1_555 ? 
39 AC7 5 ILE C 116 ? ILE C 162  . ? 1_555 ? 
40 AC7 5 HOH O .   ? HOH C 2026 . ? 1_555 ? 
41 AC8 8 ARG B 54  ? ARG B 100  . ? 3_455 ? 
42 AC8 8 ARG C 82  ? ARG C 128  . ? 1_555 ? 
43 AC8 8 ASN C 86  ? ASN C 132  . ? 1_555 ? 
44 AC8 8 TYR C 88  ? TYR C 134  . ? 1_555 ? 
45 AC8 8 EDO I .   ? EDO C 1183 . ? 1_555 ? 
46 AC8 8 HOH O .   ? HOH C 2040 . ? 1_555 ? 
47 AC8 8 HOH O .   ? HOH C 2070 . ? 1_555 ? 
48 AC8 8 HOH O .   ? HOH C 2071 . ? 1_555 ? 
49 AC9 7 GLN C 32  ? GLN C 78   . ? 1_555 ? 
50 AC9 7 VAL C 131 ? VAL C 177  . ? 2_556 ? 
51 AC9 7 ALA C 132 ? ALA C 178  . ? 2_556 ? 
52 AC9 7 MET C 134 ? MET C 180  . ? 2_556 ? 
53 AC9 7 MET C 134 ? MET C 180  . ? 1_555 ? 
54 AC9 7 PRO C 135 ? PRO C 181  . ? 1_555 ? 
55 AC9 7 GLN C 136 ? GLN C 182  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4A9J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4A9J 
_atom_sites.fract_transf_matrix[1][1]   0.008768 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000749 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018004 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 29  ? 5.320   -2.788  15.433  1.00 84.22  ? 75   VAL A N   1 
ATOM   2    C CA  . VAL A 1 29  ? 5.201   -1.302  15.362  1.00 83.05  ? 75   VAL A CA  1 
ATOM   3    C C   . VAL A 1 29  ? 5.857   -0.684  16.597  1.00 82.48  ? 75   VAL A C   1 
ATOM   4    O O   . VAL A 1 29  ? 5.173   -0.292  17.549  1.00 84.92  ? 75   VAL A O   1 
ATOM   5    C CB  . VAL A 1 29  ? 3.713   -0.859  15.265  1.00 85.19  ? 75   VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 29  ? 3.602   0.656   15.109  1.00 84.07  ? 75   VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 29  ? 3.023   -1.563  14.108  1.00 86.21  ? 75   VAL A CG2 1 
ATOM   8    N N   . THR A 1 30  ? 7.187   -0.607  16.577  1.00 79.22  ? 76   THR A N   1 
ATOM   9    C CA  . THR A 1 30  ? 7.944   -0.074  17.712  1.00 78.22  ? 76   THR A CA  1 
ATOM   10   C C   . THR A 1 30  ? 7.846   1.449   17.775  1.00 76.40  ? 76   THR A C   1 
ATOM   11   O O   . THR A 1 30  ? 7.468   2.100   16.798  1.00 75.47  ? 76   THR A O   1 
ATOM   12   C CB  . THR A 1 30  ? 9.441   -0.465  17.656  1.00 76.49  ? 76   THR A CB  1 
ATOM   13   O OG1 . THR A 1 30  ? 10.078  0.210   16.562  1.00 72.98  ? 76   THR A OG1 1 
ATOM   14   C CG2 . THR A 1 30  ? 9.616   -1.978  17.507  1.00 76.89  ? 76   THR A CG2 1 
ATOM   15   N N   . ASN A 1 31  ? 8.193   2.008   18.931  1.00 76.09  ? 77   ASN A N   1 
ATOM   16   C CA  . ASN A 1 31  ? 8.225   3.463   19.113  1.00 74.59  ? 77   ASN A CA  1 
ATOM   17   C C   . ASN A 1 31  ? 9.261   4.143   18.207  1.00 70.55  ? 77   ASN A C   1 
ATOM   18   O O   . ASN A 1 31  ? 9.039   5.259   17.729  1.00 69.01  ? 77   ASN A O   1 
ATOM   19   C CB  . ASN A 1 31  ? 8.482   3.826   20.583  1.00 76.54  ? 77   ASN A CB  1 
ATOM   20   C CG  . ASN A 1 31  ? 9.817   3.291   21.110  1.00 77.18  ? 77   ASN A CG  1 
ATOM   21   O OD1 . ASN A 1 31  ? 10.345  2.289   20.622  1.00 76.32  ? 77   ASN A OD1 1 
ATOM   22   N ND2 . ASN A 1 31  ? 10.357  3.959   22.122  1.00 80.85  ? 77   ASN A ND2 1 
ATOM   23   N N   . GLN A 1 32  ? 10.385  3.465   17.979  1.00 68.32  ? 78   GLN A N   1 
ATOM   24   C CA  . GLN A 1 32  ? 11.437  3.975   17.095  1.00 65.79  ? 78   GLN A CA  1 
ATOM   25   C C   . GLN A 1 32  ? 10.984  3.999   15.634  1.00 63.31  ? 78   GLN A C   1 
ATOM   26   O O   . GLN A 1 32  ? 11.294  4.936   14.909  1.00 61.98  ? 78   GLN A O   1 
ATOM   27   C CB  . GLN A 1 32  ? 12.719  3.133   17.221  1.00 65.50  ? 78   GLN A CB  1 
ATOM   28   C CG  . GLN A 1 32  ? 13.384  3.169   18.599  1.00 68.73  ? 78   GLN A CG  1 
ATOM   29   C CD  . GLN A 1 32  ? 14.710  2.404   18.639  1.00 70.43  ? 78   GLN A CD  1 
ATOM   30   O OE1 . GLN A 1 32  ? 14.822  1.302   18.100  1.00 70.75  ? 78   GLN A OE1 1 
ATOM   31   N NE2 . GLN A 1 32  ? 15.715  2.988   19.286  1.00 71.02  ? 78   GLN A NE2 1 
ATOM   32   N N   . LEU A 1 33  ? 10.270  2.961   15.204  1.00 63.35  ? 79   LEU A N   1 
ATOM   33   C CA  . LEU A 1 33  ? 9.748   2.895   13.834  1.00 61.70  ? 79   LEU A CA  1 
ATOM   34   C C   . LEU A 1 33  ? 8.664   3.946   13.605  1.00 61.70  ? 79   LEU A C   1 
ATOM   35   O O   . LEU A 1 33  ? 8.523   4.471   12.505  1.00 59.41  ? 79   LEU A O   1 
ATOM   36   C CB  . LEU A 1 33  ? 9.205   1.497   13.512  1.00 62.79  ? 79   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 33  ? 10.272  0.462   13.138  1.00 62.39  ? 79   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 33  ? 9.729   -0.946  13.245  1.00 65.35  ? 79   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 33  ? 10.800  0.722   11.733  1.00 59.04  ? 79   LEU A CD2 1 
ATOM   40   N N   . GLN A 1 34  ? 7.896   4.235   14.649  1.00 63.68  ? 80   GLN A N   1 
ATOM   41   C CA  . GLN A 1 34  ? 6.894   5.291   14.594  1.00 64.80  ? 80   GLN A CA  1 
ATOM   42   C C   . GLN A 1 34  ? 7.570   6.639   14.458  1.00 62.18  ? 80   GLN A C   1 
ATOM   43   O O   . GLN A 1 34  ? 7.101   7.501   13.720  1.00 61.89  ? 80   GLN A O   1 
ATOM   44   C CB  . GLN A 1 34  ? 6.015   5.265   15.844  1.00 68.57  ? 80   GLN A CB  1 
ATOM   45   C CG  . GLN A 1 34  ? 5.042   4.117   15.848  1.00 73.41  ? 80   GLN A CG  1 
ATOM   46   C CD  . GLN A 1 34  ? 3.885   4.356   14.907  1.00 77.11  ? 80   GLN A CD  1 
ATOM   47   O OE1 . GLN A 1 34  ? 3.021   5.193   15.171  1.00 80.89  ? 80   GLN A OE1 1 
ATOM   48   N NE2 . GLN A 1 34  ? 3.860   3.625   13.799  1.00 78.48  ? 80   GLN A NE2 1 
ATOM   49   N N   . TYR A 1 35  ? 8.671   6.816   15.175  1.00 60.95  ? 81   TYR A N   1 
ATOM   50   C CA  . TYR A 1 35  ? 9.460   8.021   15.052  1.00 59.80  ? 81   TYR A CA  1 
ATOM   51   C C   . TYR A 1 35  ? 10.008  8.141   13.623  1.00 57.98  ? 81   TYR A C   1 
ATOM   52   O O   . TYR A 1 35  ? 9.878   9.193   12.997  1.00 56.98  ? 81   TYR A O   1 
ATOM   53   C CB  . TYR A 1 35  ? 10.586  8.038   16.083  1.00 59.48  ? 81   TYR A CB  1 
ATOM   54   C CG  . TYR A 1 35  ? 11.425  9.287   16.027  1.00 58.07  ? 81   TYR A CG  1 
ATOM   55   C CD1 . TYR A 1 35  ? 11.057  10.426  16.732  1.00 59.39  ? 81   TYR A CD1 1 
ATOM   56   C CD2 . TYR A 1 35  ? 12.583  9.334   15.262  1.00 55.15  ? 81   TYR A CD2 1 
ATOM   57   C CE1 . TYR A 1 35  ? 11.821  11.581  16.681  1.00 58.86  ? 81   TYR A CE1 1 
ATOM   58   C CE2 . TYR A 1 35  ? 13.358  10.484  15.203  1.00 54.43  ? 81   TYR A CE2 1 
ATOM   59   C CZ  . TYR A 1 35  ? 12.972  11.604  15.911  1.00 56.66  ? 81   TYR A CZ  1 
ATOM   60   O OH  . TYR A 1 35  ? 13.729  12.753  15.863  1.00 56.53  ? 81   TYR A OH  1 
ATOM   61   N N   . LEU A 1 36  ? 10.589  7.057   13.107  1.00 58.28  ? 82   LEU A N   1 
ATOM   62   C CA  . LEU A 1 36  ? 11.138  7.050   11.748  1.00 56.70  ? 82   LEU A CA  1 
ATOM   63   C C   . LEU A 1 36  ? 10.081  7.343   10.678  1.00 56.98  ? 82   LEU A C   1 
ATOM   64   O O   . LEU A 1 36  ? 10.375  7.998   9.683   1.00 54.40  ? 82   LEU A O   1 
ATOM   65   C CB  . LEU A 1 36  ? 11.849  5.726   11.451  1.00 56.83  ? 82   LEU A CB  1 
ATOM   66   C CG  . LEU A 1 36  ? 13.169  5.526   12.206  1.00 57.69  ? 82   LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 36  ? 13.702  4.117   12.017  1.00 56.60  ? 82   LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 36  ? 14.206  6.559   11.775  1.00 57.14  ? 82   LEU A CD2 1 
ATOM   69   N N   . HIS A 1 37  ? 8.856   6.870   10.885  1.00 59.00  ? 83   HIS A N   1 
ATOM   70   C CA  . HIS A 1 37  ? 7.761   7.150   9.953   1.00 60.57  ? 83   HIS A CA  1 
ATOM   71   C C   . HIS A 1 37  ? 7.229   8.585   10.111  1.00 60.87  ? 83   HIS A C   1 
ATOM   72   O O   . HIS A 1 37  ? 7.154   9.339   9.136   1.00 60.30  ? 83   HIS A O   1 
ATOM   73   C CB  . HIS A 1 37  ? 6.619   6.150   10.165  1.00 63.55  ? 83   HIS A CB  1 
ATOM   74   C CG  . HIS A 1 37  ? 5.645   6.082   9.028   1.00 66.97  ? 83   HIS A CG  1 
ATOM   75   N ND1 . HIS A 1 37  ? 4.659   5.120   8.956   1.00 71.23  ? 83   HIS A ND1 1 
ATOM   76   C CD2 . HIS A 1 37  ? 5.513   6.840   7.912   1.00 67.87  ? 83   HIS A CD2 1 
ATOM   77   C CE1 . HIS A 1 37  ? 3.953   5.299   7.854   1.00 72.37  ? 83   HIS A CE1 1 
ATOM   78   N NE2 . HIS A 1 37  ? 4.452   6.334   7.202   1.00 70.01  ? 83   HIS A NE2 1 
ATOM   79   N N   . LYS A 1 38  ? 6.858   8.952   11.338  1.00 61.97  ? 84   LYS A N   1 
ATOM   80   C CA  . LYS A 1 38  ? 6.170   10.221  11.602  1.00 62.13  ? 84   LYS A CA  1 
ATOM   81   C C   . LYS A 1 38  ? 7.073   11.455  11.578  1.00 59.99  ? 84   LYS A C   1 
ATOM   82   O O   . LYS A 1 38  ? 6.595   12.551  11.302  1.00 60.08  ? 84   LYS A O   1 
ATOM   83   C CB  . LYS A 1 38  ? 5.465   10.183  12.964  1.00 65.66  ? 84   LYS A CB  1 
ATOM   84   C CG  . LYS A 1 38  ? 4.280   9.239   13.068  1.00 69.52  ? 84   LYS A CG  1 
ATOM   85   C CD  . LYS A 1 38  ? 3.430   9.613   14.281  1.00 75.12  ? 84   LYS A CD  1 
ATOM   86   C CE  . LYS A 1 38  ? 2.479   8.501   14.703  1.00 79.40  ? 84   LYS A CE  1 
ATOM   87   N NZ  . LYS A 1 38  ? 1.471   8.168   13.657  1.00 81.82  ? 84   LYS A NZ  1 
ATOM   88   N N   . VAL A 1 39  ? 8.356   11.294  11.899  1.00 57.99  ? 85   VAL A N   1 
ATOM   89   C CA  . VAL A 1 39  ? 9.266   12.437  11.986  1.00 57.04  ? 85   VAL A CA  1 
ATOM   90   C C   . VAL A 1 39  ? 10.294  12.437  10.866  1.00 55.22  ? 85   VAL A C   1 
ATOM   91   O O   . VAL A 1 39  ? 10.424  13.436  10.166  1.00 55.14  ? 85   VAL A O   1 
ATOM   92   C CB  . VAL A 1 39  ? 9.986   12.508  13.350  1.00 57.29  ? 85   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 39  ? 10.976  13.671  13.379  1.00 57.49  ? 85   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 39  ? 8.967   12.664  14.476  1.00 59.52  ? 85   VAL A CG2 1 
ATOM   95   N N   . VAL A 1 40  ? 11.015  11.328  10.697  1.00 53.96  ? 86   VAL A N   1 
ATOM   96   C CA  . VAL A 1 40  ? 12.104  11.272  9.719   1.00 52.33  ? 86   VAL A CA  1 
ATOM   97   C C   . VAL A 1 40  ? 11.574  11.197  8.288   1.00 52.11  ? 86   VAL A C   1 
ATOM   98   O O   . VAL A 1 40  ? 11.919  12.039  7.454   1.00 51.44  ? 86   VAL A O   1 
ATOM   99   C CB  . VAL A 1 40  ? 13.080  10.110  9.999   1.00 51.59  ? 86   VAL A CB  1 
ATOM   100  C CG1 . VAL A 1 40  ? 14.166  10.029  8.907   1.00 49.71  ? 86   VAL A CG1 1 
ATOM   101  C CG2 . VAL A 1 40  ? 13.720  10.280  11.371  1.00 51.45  ? 86   VAL A CG2 1 
ATOM   102  N N   . MET A 1 41  ? 10.740  10.201  8.000   1.00 53.10  ? 87   MET A N   1 
ATOM   103  C CA  . MET A 1 41  ? 10.210  10.036  6.644   1.00 53.47  ? 87   MET A CA  1 
ATOM   104  C C   . MET A 1 41  ? 9.297   11.204  6.260   1.00 54.72  ? 87   MET A C   1 
ATOM   105  O O   . MET A 1 41  ? 9.322   11.664  5.119   1.00 54.31  ? 87   MET A O   1 
ATOM   106  C CB  . MET A 1 41  ? 9.471   8.704   6.477   1.00 54.42  ? 87   MET A CB  1 
ATOM   107  C CG  . MET A 1 41  ? 8.904   8.495   5.071   1.00 55.05  ? 87   MET A CG  1 
ATOM   108  S SD  . MET A 1 41  ? 10.196  8.556   3.807   1.00 56.81  ? 87   MET A SD  1 
ATOM   109  C CE  . MET A 1 41  ? 10.890  6.928   4.055   1.00 56.83  ? 87   MET A CE  1 
ATOM   110  N N   . LYS A 1 42  ? 8.507   11.688  7.212   1.00 56.28  ? 88   LYS A N   1 
ATOM   111  C CA  . LYS A 1 42  ? 7.664   12.851  6.968   1.00 57.88  ? 88   LYS A CA  1 
ATOM   112  C C   . LYS A 1 42  ? 8.503   14.034  6.518   1.00 56.47  ? 88   LYS A C   1 
ATOM   113  O O   . LYS A 1 42  ? 8.162   14.690  5.540   1.00 57.49  ? 88   LYS A O   1 
ATOM   114  C CB  . LYS A 1 42  ? 6.844   13.227  8.211   1.00 60.61  ? 88   LYS A CB  1 
ATOM   115  C CG  . LYS A 1 42  ? 5.631   14.096  7.900   1.00 64.33  ? 88   LYS A CG  1 
ATOM   116  C CD  . LYS A 1 42  ? 4.595   14.078  9.026   1.00 68.86  ? 88   LYS A CD  1 
ATOM   117  C CE  . LYS A 1 42  ? 3.810   12.760  9.074   1.00 71.18  ? 88   LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 42  ? 3.011   12.633  10.327  1.00 73.89  ? 88   LYS A NZ  1 
ATOM   119  N N   . ALA A 1 43  ? 9.605   14.293  7.219   1.00 55.09  ? 89   ALA A N   1 
ATOM   120  C CA  . ALA A 1 43  ? 10.500  15.402  6.875   1.00 54.41  ? 89   ALA A CA  1 
ATOM   121  C C   . ALA A 1 43  ? 11.156  15.231  5.497   1.00 53.29  ? 89   ALA A C   1 
ATOM   122  O O   . ALA A 1 43  ? 11.155  16.158  4.680   1.00 53.83  ? 89   ALA A O   1 
ATOM   123  C CB  . ALA A 1 43  ? 11.570  15.568  7.941   1.00 54.27  ? 89   ALA A CB  1 
ATOM   124  N N   . LEU A 1 44  ? 11.705  14.051  5.237   1.00 51.32  ? 90   LEU A N   1 
ATOM   125  C CA  . LEU A 1 44  ? 12.451  13.822  3.994   1.00 50.83  ? 90   LEU A CA  1 
ATOM   126  C C   . LEU A 1 44  ? 11.557  13.716  2.749   1.00 50.91  ? 90   LEU A C   1 
ATOM   127  O O   . LEU A 1 44  ? 11.905  14.235  1.683   1.00 49.98  ? 90   LEU A O   1 
ATOM   128  C CB  . LEU A 1 44  ? 13.336  12.581  4.130   1.00 50.67  ? 90   LEU A CB  1 
ATOM   129  C CG  . LEU A 1 44  ? 14.393  12.622  5.237   1.00 52.42  ? 90   LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 44  ? 15.218  11.335  5.244   1.00 53.39  ? 90   LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 44  ? 15.292  13.824  5.085   1.00 53.55  ? 90   LEU A CD2 1 
ATOM   132  N N   . TRP A 1 45  ? 10.402  13.067  2.891   1.00 50.90  ? 91   TRP A N   1 
ATOM   133  C CA  . TRP A 1 45  ? 9.493   12.842  1.768   1.00 51.31  ? 91   TRP A CA  1 
ATOM   134  C C   . TRP A 1 45  ? 9.026   14.137  1.119   1.00 52.21  ? 91   TRP A C   1 
ATOM   135  O O   . TRP A 1 45  ? 8.966   14.229  -0.103  1.00 52.67  ? 91   TRP A O   1 
ATOM   136  C CB  . TRP A 1 45  ? 8.273   12.028  2.211   1.00 52.58  ? 91   TRP A CB  1 
ATOM   137  C CG  . TRP A 1 45  ? 7.352   11.628  1.086   1.00 52.67  ? 91   TRP A CG  1 
ATOM   138  C CD1 . TRP A 1 45  ? 6.136   12.168  0.792   1.00 55.87  ? 91   TRP A CD1 1 
ATOM   139  C CD2 . TRP A 1 45  ? 7.569   10.582  0.132   1.00 53.16  ? 91   TRP A CD2 1 
ATOM   140  N NE1 . TRP A 1 45  ? 5.584   11.532  -0.296  1.00 56.62  ? 91   TRP A NE1 1 
ATOM   141  C CE2 . TRP A 1 45  ? 6.450   10.558  -0.724  1.00 54.55  ? 91   TRP A CE2 1 
ATOM   142  C CE3 . TRP A 1 45  ? 8.612   9.667   -0.089  1.00 52.56  ? 91   TRP A CE3 1 
ATOM   143  C CZ2 . TRP A 1 45  ? 6.336   9.655   -1.785  1.00 54.55  ? 91   TRP A CZ2 1 
ATOM   144  C CZ3 . TRP A 1 45  ? 8.499   8.768   -1.145  1.00 52.85  ? 91   TRP A CZ3 1 
ATOM   145  C CH2 . TRP A 1 45  ? 7.366   8.770   -1.979  1.00 53.75  ? 91   TRP A CH2 1 
ATOM   146  N N   . LYS A 1 46  ? 8.706   15.138  1.932   1.00 52.69  ? 92   LYS A N   1 
ATOM   147  C CA  . LYS A 1 46  ? 8.196   16.407  1.408   1.00 53.38  ? 92   LYS A CA  1 
ATOM   148  C C   . LYS A 1 46  ? 9.291   17.435  1.096   1.00 51.38  ? 92   LYS A C   1 
ATOM   149  O O   . LYS A 1 46  ? 8.979   18.565  0.729   1.00 51.66  ? 92   LYS A O   1 
ATOM   150  C CB  . LYS A 1 46  ? 7.186   17.017  2.386   1.00 55.81  ? 92   LYS A CB  1 
ATOM   151  C CG  . LYS A 1 46  ? 7.790   17.547  3.668   1.00 57.47  ? 92   LYS A CG  1 
ATOM   152  C CD  . LYS A 1 46  ? 6.717   18.056  4.613   1.00 62.32  ? 92   LYS A CD  1 
ATOM   153  C CE  . LYS A 1 46  ? 7.330   18.788  5.800   1.00 63.68  ? 92   LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 46  ? 6.350   19.727  6.439   1.00 68.13  ? 92   LYS A NZ  1 
ATOM   155  N N   . HIS A 1 47  ? 10.559  17.061  1.250   1.00 48.93  ? 93   HIS A N   1 
ATOM   156  C CA  . HIS A 1 47  ? 11.670  17.994  1.028   1.00 48.10  ? 93   HIS A CA  1 
ATOM   157  C C   . HIS A 1 47  ? 11.799  18.304  -0.470  1.00 47.26  ? 93   HIS A C   1 
ATOM   158  O O   . HIS A 1 47  ? 11.558  17.447  -1.307  1.00 47.21  ? 93   HIS A O   1 
ATOM   159  C CB  . HIS A 1 47  ? 12.983  17.405  1.577   1.00 47.45  ? 93   HIS A CB  1 
ATOM   160  C CG  . HIS A 1 47  ? 14.081  18.411  1.724   1.00 48.08  ? 93   HIS A CG  1 
ATOM   161  N ND1 . HIS A 1 47  ? 14.822  18.864  0.655   1.00 47.41  ? 93   HIS A ND1 1 
ATOM   162  C CD2 . HIS A 1 47  ? 14.561  19.055  2.815   1.00 49.80  ? 93   HIS A CD2 1 
ATOM   163  C CE1 . HIS A 1 47  ? 15.698  19.759  1.078   1.00 49.84  ? 93   HIS A CE1 1 
ATOM   164  N NE2 . HIS A 1 47  ? 15.564  19.889  2.387   1.00 48.80  ? 93   HIS A NE2 1 
ATOM   165  N N   . GLN A 1 48  ? 12.176  19.532  -0.803  1.00 48.00  ? 94   GLN A N   1 
ATOM   166  C CA  . GLN A 1 48  ? 12.317  19.952  -2.208  1.00 48.88  ? 94   GLN A CA  1 
ATOM   167  C C   . GLN A 1 48  ? 13.401  19.198  -2.996  1.00 47.26  ? 94   GLN A C   1 
ATOM   168  O O   . GLN A 1 48  ? 13.394  19.200  -4.218  1.00 48.04  ? 94   GLN A O   1 
ATOM   169  C CB  . GLN A 1 48  ? 12.575  21.460  -2.292  1.00 51.65  ? 94   GLN A CB  1 
ATOM   170  C CG  . GLN A 1 48  ? 13.870  21.943  -1.613  1.00 52.43  ? 94   GLN A CG  1 
ATOM   171  C CD  . GLN A 1 48  ? 14.173  23.402  -1.916  1.00 58.93  ? 94   GLN A CD  1 
ATOM   172  O OE1 . GLN A 1 48  ? 13.759  23.933  -2.951  1.00 62.92  ? 94   GLN A OE1 1 
ATOM   173  N NE2 . GLN A 1 48  ? 14.889  24.066  -1.003  1.00 58.27  ? 94   GLN A NE2 1 
ATOM   174  N N   . PHE A 1 49  ? 14.326  18.551  -2.297  1.00 45.62  ? 95   PHE A N   1 
ATOM   175  C CA  . PHE A 1 49  ? 15.369  17.757  -2.942  1.00 45.01  ? 95   PHE A CA  1 
ATOM   176  C C   . PHE A 1 49  ? 15.040  16.268  -2.976  1.00 44.41  ? 95   PHE A C   1 
ATOM   177  O O   . PHE A 1 49  ? 15.853  15.479  -3.436  1.00 43.70  ? 95   PHE A O   1 
ATOM   178  C CB  . PHE A 1 49  ? 16.705  17.948  -2.226  1.00 43.98  ? 95   PHE A CB  1 
ATOM   179  C CG  . PHE A 1 49  ? 17.307  19.323  -2.371  1.00 46.22  ? 95   PHE A CG  1 
ATOM   180  C CD1 . PHE A 1 49  ? 16.869  20.228  -3.342  1.00 48.54  ? 95   PHE A CD1 1 
ATOM   181  C CD2 . PHE A 1 49  ? 18.358  19.693  -1.549  1.00 47.18  ? 95   PHE A CD2 1 
ATOM   182  C CE1 . PHE A 1 49  ? 17.452  21.482  -3.460  1.00 50.58  ? 95   PHE A CE1 1 
ATOM   183  C CE2 . PHE A 1 49  ? 18.947  20.943  -1.664  1.00 49.18  ? 95   PHE A CE2 1 
ATOM   184  C CZ  . PHE A 1 49  ? 18.495  21.839  -2.620  1.00 50.99  ? 95   PHE A CZ  1 
ATOM   185  N N   . ALA A 1 50  ? 13.854  15.892  -2.503  1.00 45.19  ? 96   ALA A N   1 
ATOM   186  C CA  . ALA A 1 50  ? 13.501  14.480  -2.331  1.00 45.31  ? 96   ALA A CA  1 
ATOM   187  C C   . ALA A 1 50  ? 13.124  13.773  -3.622  1.00 45.79  ? 96   ALA A C   1 
ATOM   188  O O   . ALA A 1 50  ? 13.251  12.550  -3.702  1.00 45.77  ? 96   ALA A O   1 
ATOM   189  C CB  . ALA A 1 50  ? 12.367  14.339  -1.327  1.00 46.27  ? 96   ALA A CB  1 
ATOM   190  N N   . TRP A 1 51  ? 12.683  14.523  -4.630  1.00 47.47  ? 97   TRP A N   1 
ATOM   191  C CA  . TRP A 1 51  ? 12.081  13.927  -5.839  1.00 48.70  ? 97   TRP A CA  1 
ATOM   192  C C   . TRP A 1 51  ? 12.942  12.863  -6.550  1.00 48.12  ? 97   TRP A C   1 
ATOM   193  O O   . TRP A 1 51  ? 12.401  11.871  -7.039  1.00 49.88  ? 97   TRP A O   1 
ATOM   194  C CB  . TRP A 1 51  ? 11.577  15.008  -6.824  1.00 50.79  ? 97   TRP A CB  1 
ATOM   195  C CG  . TRP A 1 51  ? 12.647  15.879  -7.393  1.00 50.89  ? 97   TRP A CG  1 
ATOM   196  C CD1 . TRP A 1 51  ? 13.090  17.074  -6.893  1.00 51.82  ? 97   TRP A CD1 1 
ATOM   197  C CD2 . TRP A 1 51  ? 13.431  15.615  -8.558  1.00 52.58  ? 97   TRP A CD2 1 
ATOM   198  N NE1 . TRP A 1 51  ? 14.097  17.575  -7.686  1.00 52.36  ? 97   TRP A NE1 1 
ATOM   199  C CE2 . TRP A 1 51  ? 14.328  16.697  -8.712  1.00 52.72  ? 97   TRP A CE2 1 
ATOM   200  C CE3 . TRP A 1 51  ? 13.465  14.567  -9.488  1.00 53.06  ? 97   TRP A CE3 1 
ATOM   201  C CZ2 . TRP A 1 51  ? 15.247  16.760  -9.759  1.00 55.36  ? 97   TRP A CZ2 1 
ATOM   202  C CZ3 . TRP A 1 51  ? 14.380  14.630  -10.528 1.00 54.24  ? 97   TRP A CZ3 1 
ATOM   203  C CH2 . TRP A 1 51  ? 15.257  15.720  -10.657 1.00 56.22  ? 97   TRP A CH2 1 
ATOM   204  N N   . PRO A 1 52  ? 14.276  13.040  -6.603  1.00 47.66  ? 98   PRO A N   1 
ATOM   205  C CA  . PRO A 1 52  ? 15.044  11.965  -7.260  1.00 47.40  ? 98   PRO A CA  1 
ATOM   206  C C   . PRO A 1 52  ? 15.094  10.648  -6.467  1.00 46.77  ? 98   PRO A C   1 
ATOM   207  O O   . PRO A 1 52  ? 15.529  9.633   -7.013  1.00 47.35  ? 98   PRO A O   1 
ATOM   208  C CB  . PRO A 1 52  ? 16.457  12.562  -7.391  1.00 46.92  ? 98   PRO A CB  1 
ATOM   209  C CG  . PRO A 1 52  ? 16.298  14.049  -7.122  1.00 46.33  ? 98   PRO A CG  1 
ATOM   210  C CD  . PRO A 1 52  ? 15.165  14.122  -6.146  1.00 46.92  ? 98   PRO A CD  1 
ATOM   211  N N   . PHE A 1 53  ? 14.647  10.673  -5.207  1.00 46.02  ? 99   PHE A N   1 
ATOM   212  C CA  . PHE A 1 53  ? 14.758  9.543   -4.291  1.00 45.65  ? 99   PHE A CA  1 
ATOM   213  C C   . PHE A 1 53  ? 13.407  8.944   -3.912  1.00 46.63  ? 99   PHE A C   1 
ATOM   214  O O   . PHE A 1 53  ? 13.362  8.014   -3.124  1.00 46.40  ? 99   PHE A O   1 
ATOM   215  C CB  . PHE A 1 53  ? 15.468  9.986   -3.011  1.00 44.30  ? 99   PHE A CB  1 
ATOM   216  C CG  . PHE A 1 53  ? 16.814  10.587  -3.251  1.00 44.98  ? 99   PHE A CG  1 
ATOM   217  C CD1 . PHE A 1 53  ? 17.929  9.775   -3.410  1.00 44.11  ? 99   PHE A CD1 1 
ATOM   218  C CD2 . PHE A 1 53  ? 16.967  11.966  -3.359  1.00 45.90  ? 99   PHE A CD2 1 
ATOM   219  C CE1 . PHE A 1 53  ? 19.183  10.336  -3.655  1.00 44.57  ? 99   PHE A CE1 1 
ATOM   220  C CE2 . PHE A 1 53  ? 18.222  12.526  -3.596  1.00 46.72  ? 99   PHE A CE2 1 
ATOM   221  C CZ  . PHE A 1 53  ? 19.326  11.704  -3.738  1.00 45.18  ? 99   PHE A CZ  1 
ATOM   222  N N   . ARG A 1 54  ? 12.317  9.477   -4.459  1.00 48.60  ? 100  ARG A N   1 
ATOM   223  C CA  . ARG A 1 54  ? 10.967  9.021   -4.092  1.00 49.90  ? 100  ARG A CA  1 
ATOM   224  C C   . ARG A 1 54  ? 10.564  7.697   -4.741  1.00 50.41  ? 100  ARG A C   1 
ATOM   225  O O   . ARG A 1 54  ? 9.568   7.095   -4.349  1.00 51.08  ? 100  ARG A O   1 
ATOM   226  C CB  . ARG A 1 54  ? 9.923   10.083  -4.432  1.00 51.40  ? 100  ARG A CB  1 
ATOM   227  C CG  . ARG A 1 54  ? 9.996   11.309  -3.552  1.00 53.02  ? 100  ARG A CG  1 
ATOM   228  C CD  . ARG A 1 54  ? 8.698   12.078  -3.570  1.00 54.72  ? 100  ARG A CD  1 
ATOM   229  N NE  . ARG A 1 54  ? 8.827   13.351  -2.864  1.00 57.13  ? 100  ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 54  ? 8.715   14.560  -3.414  1.00 59.23  ? 100  ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 54  ? 8.441   14.719  -4.709  1.00 61.14  ? 100  ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 54  ? 8.854   15.630  -2.647  1.00 60.77  ? 100  ARG A NH2 1 
ATOM   233  N N   . GLN A 1 55  ? 11.322  7.265   -5.742  1.00 49.75  ? 101  GLN A N   1 
ATOM   234  C CA  . GLN A 1 55  ? 11.036  6.025   -6.458  1.00 51.17  ? 101  GLN A CA  1 
ATOM   235  C C   . GLN A 1 55  ? 12.369  5.381   -6.826  1.00 48.87  ? 101  GLN A C   1 
ATOM   236  O O   . GLN A 1 55  ? 13.383  6.076   -6.871  1.00 46.57  ? 101  GLN A O   1 
ATOM   237  C CB  . GLN A 1 55  ? 10.207  6.304   -7.722  1.00 53.07  ? 101  GLN A CB  1 
ATOM   238  C CG  . GLN A 1 55  ? 10.871  7.228   -8.750  1.00 54.65  ? 101  GLN A CG  1 
ATOM   239  C CD  . GLN A 1 55  ? 11.053  8.662   -8.241  1.00 56.10  ? 101  GLN A CD  1 
ATOM   240  O OE1 . GLN A 1 55  ? 12.177  9.194   -8.211  1.00 53.71  ? 101  GLN A OE1 1 
ATOM   241  N NE2 . GLN A 1 55  ? 9.954   9.282   -7.825  1.00 55.89  ? 101  GLN A NE2 1 
ATOM   242  N N   . PRO A 1 56  ? 12.369  4.062   -7.090  1.00 48.88  ? 102  PRO A N   1 
ATOM   243  C CA  . PRO A 1 56  ? 13.585  3.382   -7.522  1.00 48.61  ? 102  PRO A CA  1 
ATOM   244  C C   . PRO A 1 56  ? 14.225  4.060   -8.725  1.00 49.07  ? 102  PRO A C   1 
ATOM   245  O O   . PRO A 1 56  ? 13.519  4.586   -9.587  1.00 50.34  ? 102  PRO A O   1 
ATOM   246  C CB  . PRO A 1 56  ? 13.085  1.987   -7.929  1.00 49.96  ? 102  PRO A CB  1 
ATOM   247  C CG  . PRO A 1 56  ? 11.853  1.783   -7.138  1.00 50.92  ? 102  PRO A CG  1 
ATOM   248  C CD  . PRO A 1 56  ? 11.221  3.136   -7.018  1.00 50.54  ? 102  PRO A CD  1 
ATOM   249  N N   . VAL A 1 57  ? 15.551  4.047   -8.786  1.00 48.37  ? 103  VAL A N   1 
ATOM   250  C CA  . VAL A 1 57  ? 16.249  4.521   -9.978  1.00 49.05  ? 103  VAL A CA  1 
ATOM   251  C C   . VAL A 1 57  ? 15.789  3.708   -11.200 1.00 50.59  ? 103  VAL A C   1 
ATOM   252  O O   . VAL A 1 57  ? 15.850  2.473   -11.206 1.00 51.47  ? 103  VAL A O   1 
ATOM   253  C CB  . VAL A 1 57  ? 17.783  4.415   -9.828  1.00 48.41  ? 103  VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 57  ? 18.482  4.768   -11.143 1.00 47.74  ? 103  VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 57  ? 18.273  5.321   -8.695  1.00 48.04  ? 103  VAL A CG2 1 
ATOM   256  N N   . ASP A 1 58  ? 15.305  4.416   -12.214 1.00 51.68  ? 104  ASP A N   1 
ATOM   257  C CA  . ASP A 1 58  ? 14.941  3.817   -13.492 1.00 53.80  ? 104  ASP A CA  1 
ATOM   258  C C   . ASP A 1 58  ? 16.107  4.029   -14.457 1.00 53.74  ? 104  ASP A C   1 
ATOM   259  O O   . ASP A 1 58  ? 16.241  5.096   -15.050 1.00 53.70  ? 104  ASP A O   1 
ATOM   260  C CB  . ASP A 1 58  ? 13.661  4.471   -14.021 1.00 55.59  ? 104  ASP A CB  1 
ATOM   261  C CG  . ASP A 1 58  ? 13.130  3.808   -15.281 1.00 58.60  ? 104  ASP A CG  1 
ATOM   262  O OD1 . ASP A 1 58  ? 13.899  3.105   -15.972 1.00 58.14  ? 104  ASP A OD1 1 
ATOM   263  O OD2 . ASP A 1 58  ? 11.932  4.004   -15.590 1.00 60.12  ? 104  ASP A OD2 1 
ATOM   264  N N   . ALA A 1 59  ? 16.947  3.003   -14.600 1.00 53.72  ? 105  ALA A N   1 
ATOM   265  C CA  . ALA A 1 59  ? 18.177  3.098   -15.396 1.00 53.85  ? 105  ALA A CA  1 
ATOM   266  C C   . ALA A 1 59  ? 17.907  3.365   -16.875 1.00 55.90  ? 105  ALA A C   1 
ATOM   267  O O   . ALA A 1 59  ? 18.692  4.042   -17.534 1.00 56.75  ? 105  ALA A O   1 
ATOM   268  C CB  . ALA A 1 59  ? 19.005  1.829   -15.242 1.00 53.83  ? 105  ALA A CB  1 
ATOM   269  N N   . VAL A 1 60  ? 16.806  2.821   -17.392 1.00 57.62  ? 106  VAL A N   1 
ATOM   270  C CA  . VAL A 1 60  ? 16.412  3.037   -18.787 1.00 59.58  ? 106  VAL A CA  1 
ATOM   271  C C   . VAL A 1 60  ? 16.047  4.510   -19.008 1.00 60.17  ? 106  VAL A C   1 
ATOM   272  O O   . VAL A 1 60  ? 16.591  5.175   -19.893 1.00 60.95  ? 106  VAL A O   1 
ATOM   273  C CB  . VAL A 1 60  ? 15.215  2.149   -19.175 1.00 61.03  ? 106  VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 60  ? 14.843  2.351   -20.633 1.00 62.96  ? 106  VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 60  ? 15.530  0.682   -18.911 1.00 62.17  ? 106  VAL A CG2 1 
ATOM   276  N N   . LYS A 1 61  ? 15.130  5.010   -18.184 1.00 59.89  ? 107  LYS A N   1 
ATOM   277  C CA  . LYS A 1 61  ? 14.688  6.404   -18.239 1.00 60.56  ? 107  LYS A CA  1 
ATOM   278  C C   . LYS A 1 61  ? 15.837  7.398   -18.073 1.00 59.64  ? 107  LYS A C   1 
ATOM   279  O O   . LYS A 1 61  ? 15.889  8.416   -18.768 1.00 59.56  ? 107  LYS A O   1 
ATOM   280  C CB  . LYS A 1 61  ? 13.639  6.651   -17.147 1.00 60.53  ? 107  LYS A CB  1 
ATOM   281  C CG  . LYS A 1 61  ? 13.163  8.089   -17.019 1.00 61.87  ? 107  LYS A CG  1 
ATOM   282  C CD  . LYS A 1 61  ? 12.250  8.249   -15.820 1.00 62.91  ? 107  LYS A CD  1 
ATOM   283  C CE  . LYS A 1 61  ? 12.022  9.711   -15.502 1.00 64.86  ? 107  LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 61  ? 11.342  9.894   -14.189 1.00 66.08  ? 107  LYS A NZ  1 
ATOM   285  N N   . LEU A 1 62  ? 16.746  7.105   -17.146 1.00 58.46  ? 108  LEU A N   1 
ATOM   286  C CA  . LEU A 1 62  ? 17.829  8.030   -16.801 1.00 58.07  ? 108  LEU A CA  1 
ATOM   287  C C   . LEU A 1 62  ? 19.074  7.831   -17.674 1.00 59.71  ? 108  LEU A C   1 
ATOM   288  O O   . LEU A 1 62  ? 20.028  8.613   -17.594 1.00 60.71  ? 108  LEU A O   1 
ATOM   289  C CB  . LEU A 1 62  ? 18.178  7.896   -15.310 1.00 56.33  ? 108  LEU A CB  1 
ATOM   290  C CG  . LEU A 1 62  ? 17.030  8.214   -14.336 1.00 56.62  ? 108  LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 62  ? 17.405  7.902   -12.882 1.00 55.69  ? 108  LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 62  ? 16.569  9.668   -14.468 1.00 57.28  ? 108  LEU A CD2 1 
ATOM   293  N N   . GLY A 1 63  ? 19.059  6.802   -18.517 1.00 60.45  ? 109  GLY A N   1 
ATOM   294  C CA  . GLY A 1 63  ? 20.175  6.518   -19.413 1.00 61.81  ? 109  GLY A CA  1 
ATOM   295  C C   . GLY A 1 63  ? 21.421  6.054   -18.683 1.00 60.72  ? 109  GLY A C   1 
ATOM   296  O O   . GLY A 1 63  ? 22.520  6.531   -18.970 1.00 61.22  ? 109  GLY A O   1 
ATOM   297  N N   . LEU A 1 64  ? 21.241  5.116   -17.750 1.00 59.18  ? 110  LEU A N   1 
ATOM   298  C CA  . LEU A 1 64  ? 22.317  4.616   -16.894 1.00 57.68  ? 110  LEU A CA  1 
ATOM   299  C C   . LEU A 1 64  ? 22.482  3.098   -17.066 1.00 58.04  ? 110  LEU A C   1 
ATOM   300  O O   . LEU A 1 64  ? 22.129  2.335   -16.171 1.00 57.36  ? 110  LEU A O   1 
ATOM   301  C CB  . LEU A 1 64  ? 22.000  4.944   -15.426 1.00 56.16  ? 110  LEU A CB  1 
ATOM   302  C CG  . LEU A 1 64  ? 21.622  6.392   -15.098 1.00 55.22  ? 110  LEU A CG  1 
ATOM   303  C CD1 . LEU A 1 64  ? 21.205  6.519   -13.627 1.00 53.96  ? 110  LEU A CD1 1 
ATOM   304  C CD2 . LEU A 1 64  ? 22.760  7.346   -15.439 1.00 53.44  ? 110  LEU A CD2 1 
ATOM   305  N N   . PRO A 1 65  ? 23.025  2.648   -18.218 1.00 59.72  ? 111  PRO A N   1 
ATOM   306  C CA  . PRO A 1 65  ? 23.105  1.201   -18.507 1.00 60.54  ? 111  PRO A CA  1 
ATOM   307  C C   . PRO A 1 65  ? 24.008  0.388   -17.563 1.00 59.08  ? 111  PRO A C   1 
ATOM   308  O O   . PRO A 1 65  ? 23.875  -0.838  -17.489 1.00 60.09  ? 111  PRO A O   1 
ATOM   309  C CB  . PRO A 1 65  ? 23.661  1.158   -19.937 1.00 62.49  ? 111  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 65  ? 24.423  2.430   -20.079 1.00 62.91  ? 111  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 65  ? 23.659  3.451   -19.281 1.00 60.91  ? 111  PRO A CD  1 
ATOM   312  N N   . ASP A 1 66  ? 24.921  1.055   -16.863 1.00 56.95  ? 112  ASP A N   1 
ATOM   313  C CA  . ASP A 1 66  ? 25.783  0.384   -15.884 1.00 55.84  ? 112  ASP A CA  1 
ATOM   314  C C   . ASP A 1 66  ? 25.239  0.447   -14.451 1.00 52.78  ? 112  ASP A C   1 
ATOM   315  O O   . ASP A 1 66  ? 25.853  -0.103  -13.540 1.00 51.31  ? 112  ASP A O   1 
ATOM   316  C CB  . ASP A 1 66  ? 27.198  0.982   -15.921 1.00 56.39  ? 112  ASP A CB  1 
ATOM   317  C CG  . ASP A 1 66  ? 27.227  2.460   -15.547 1.00 57.16  ? 112  ASP A CG  1 
ATOM   318  O OD1 . ASP A 1 66  ? 26.168  3.126   -15.600 1.00 57.99  ? 112  ASP A OD1 1 
ATOM   319  O OD2 . ASP A 1 66  ? 28.318  2.960   -15.202 1.00 59.85  ? 112  ASP A OD2 1 
ATOM   320  N N   . TYR A 1 67  ? 24.101  1.112   -14.240 1.00 51.23  ? 113  TYR A N   1 
ATOM   321  C CA  . TYR A 1 67  ? 23.649  1.380   -12.872 1.00 49.03  ? 113  TYR A CA  1 
ATOM   322  C C   . TYR A 1 67  ? 23.536  0.108   -12.032 1.00 48.69  ? 113  TYR A C   1 
ATOM   323  O O   . TYR A 1 67  ? 24.065  0.046   -10.925 1.00 47.38  ? 113  TYR A O   1 
ATOM   324  C CB  . TYR A 1 67  ? 22.322  2.151   -12.827 1.00 48.37  ? 113  TYR A CB  1 
ATOM   325  C CG  . TYR A 1 67  ? 21.976  2.562   -11.411 1.00 46.95  ? 113  TYR A CG  1 
ATOM   326  C CD1 . TYR A 1 67  ? 22.536  3.710   -10.839 1.00 46.59  ? 113  TYR A CD1 1 
ATOM   327  C CD2 . TYR A 1 67  ? 21.142  1.773   -10.618 1.00 46.99  ? 113  TYR A CD2 1 
ATOM   328  C CE1 . TYR A 1 67  ? 22.244  4.075   -9.517  1.00 46.29  ? 113  TYR A CE1 1 
ATOM   329  C CE2 . TYR A 1 67  ? 20.850  2.127   -9.299  1.00 47.07  ? 113  TYR A CE2 1 
ATOM   330  C CZ  . TYR A 1 67  ? 21.395  3.281   -8.757  1.00 45.74  ? 113  TYR A CZ  1 
ATOM   331  O OH  . TYR A 1 67  ? 21.106  3.624   -7.454  1.00 45.28  ? 113  TYR A OH  1 
ATOM   332  N N   . HIS A 1 68  ? 22.864  -0.910  -12.560 1.00 49.78  ? 114  HIS A N   1 
ATOM   333  C CA  . HIS A 1 68  ? 22.658  -2.155  -11.805 1.00 50.39  ? 114  HIS A CA  1 
ATOM   334  C C   . HIS A 1 68  ? 23.878  -3.077  -11.768 1.00 50.82  ? 114  HIS A C   1 
ATOM   335  O O   . HIS A 1 68  ? 23.900  -4.046  -11.011 1.00 51.80  ? 114  HIS A O   1 
ATOM   336  C CB  . HIS A 1 68  ? 21.428  -2.887  -12.329 1.00 52.03  ? 114  HIS A CB  1 
ATOM   337  C CG  . HIS A 1 68  ? 20.160  -2.127  -12.114 1.00 52.44  ? 114  HIS A CG  1 
ATOM   338  N ND1 . HIS A 1 68  ? 19.523  -2.084  -10.895 1.00 54.36  ? 114  HIS A ND1 1 
ATOM   339  C CD2 . HIS A 1 68  ? 19.419  -1.367  -12.955 1.00 55.67  ? 114  HIS A CD2 1 
ATOM   340  C CE1 . HIS A 1 68  ? 18.440  -1.332  -10.993 1.00 55.85  ? 114  HIS A CE1 1 
ATOM   341  N NE2 . HIS A 1 68  ? 18.352  -0.887  -12.232 1.00 55.59  ? 114  HIS A NE2 1 
ATOM   342  N N   . LYS A 1 69  ? 24.896  -2.769  -12.565 1.00 51.50  ? 115  LYS A N   1 
ATOM   343  C CA  . LYS A 1 69  ? 26.180  -3.452  -12.463 1.00 52.21  ? 115  LYS A CA  1 
ATOM   344  C C   . LYS A 1 69  ? 26.998  -2.897  -11.288 1.00 50.84  ? 115  LYS A C   1 
ATOM   345  O O   . LYS A 1 69  ? 27.734  -3.635  -10.629 1.00 51.00  ? 115  LYS A O   1 
ATOM   346  C CB  . LYS A 1 69  ? 26.953  -3.322  -13.772 1.00 54.17  ? 115  LYS A CB  1 
ATOM   347  C CG  . LYS A 1 69  ? 26.287  -4.064  -14.915 1.00 58.34  ? 115  LYS A CG  1 
ATOM   348  C CD  . LYS A 1 69  ? 27.012  -3.856  -16.217 1.00 61.51  ? 115  LYS A CD  1 
ATOM   349  C CE  . LYS A 1 69  ? 26.353  -4.645  -17.332 1.00 65.05  ? 115  LYS A CE  1 
ATOM   350  N NZ  . LYS A 1 69  ? 24.911  -4.326  -17.460 1.00 65.91  ? 115  LYS A NZ  1 
ATOM   351  N N   . ILE A 1 70  ? 26.860  -1.600  -11.035 1.00 48.14  ? 116  ILE A N   1 
ATOM   352  C CA  . ILE A 1 70  ? 27.580  -0.936  -9.951  1.00 46.88  ? 116  ILE A CA  1 
ATOM   353  C C   . ILE A 1 70  ? 26.815  -1.007  -8.627  1.00 45.03  ? 116  ILE A C   1 
ATOM   354  O O   . ILE A 1 70  ? 27.410  -1.288  -7.585  1.00 44.50  ? 116  ILE A O   1 
ATOM   355  C CB  . ILE A 1 70  ? 27.890  0.527   -10.318 1.00 46.77  ? 116  ILE A CB  1 
ATOM   356  C CG1 . ILE A 1 70  ? 28.858  0.553   -11.506 1.00 49.92  ? 116  ILE A CG1 1 
ATOM   357  C CG2 . ILE A 1 70  ? 28.498  1.275   -9.128  1.00 46.04  ? 116  ILE A CG2 1 
ATOM   358  C CD1 . ILE A 1 70  ? 29.183  1.936   -12.004 1.00 52.21  ? 116  ILE A CD1 1 
ATOM   359  N N   . ILE A 1 71  ? 25.507  -0.763  -8.673  1.00 44.61  ? 117  ILE A N   1 
ATOM   360  C CA  . ILE A 1 71  ? 24.668  -0.725  -7.467  1.00 43.67  ? 117  ILE A CA  1 
ATOM   361  C C   . ILE A 1 71  ? 23.881  -2.053  -7.373  1.00 46.35  ? 117  ILE A C   1 
ATOM   362  O O   . ILE A 1 71  ? 22.979  -2.321  -8.173  1.00 47.75  ? 117  ILE A O   1 
ATOM   363  C CB  . ILE A 1 71  ? 23.735  0.516   -7.495  1.00 43.60  ? 117  ILE A CB  1 
ATOM   364  C CG1 . ILE A 1 71  ? 24.566  1.813   -7.517  1.00 41.73  ? 117  ILE A CG1 1 
ATOM   365  C CG2 . ILE A 1 71  ? 22.764  0.528   -6.319  1.00 42.90  ? 117  ILE A CG2 1 
ATOM   366  C CD1 . ILE A 1 71  ? 25.531  1.979   -6.342  1.00 39.84  ? 117  ILE A CD1 1 
ATOM   367  N N   . LYS A 1 72  ? 24.245  -2.885  -6.405  1.00 47.07  ? 118  LYS A N   1 
ATOM   368  C CA  . LYS A 1 72  ? 23.691  -4.240  -6.313  1.00 50.14  ? 118  LYS A CA  1 
ATOM   369  C C   . LYS A 1 72  ? 22.456  -4.315  -5.424  1.00 49.31  ? 118  LYS A C   1 
ATOM   370  O O   . LYS A 1 72  ? 21.677  -5.256  -5.544  1.00 49.71  ? 118  LYS A O   1 
ATOM   371  C CB  . LYS A 1 72  ? 24.761  -5.215  -5.817  1.00 52.14  ? 118  LYS A CB  1 
ATOM   372  C CG  . LYS A 1 72  ? 25.953  -5.356  -6.762  1.00 55.41  ? 118  LYS A CG  1 
ATOM   373  C CD  . LYS A 1 72  ? 25.484  -5.619  -8.186  1.00 59.21  ? 118  LYS A CD  1 
ATOM   374  C CE  . LYS A 1 72  ? 26.540  -6.272  -9.044  1.00 62.56  ? 118  LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 72  ? 26.036  -6.386  -10.445 1.00 65.31  ? 118  LYS A NZ  1 
ATOM   376  N N   . GLN A 1 73  ? 22.277  -3.321  -4.554  1.00 47.75  ? 119  GLN A N   1 
ATOM   377  C CA  . GLN A 1 73  ? 21.089  -3.227  -3.703  1.00 48.02  ? 119  GLN A CA  1 
ATOM   378  C C   . GLN A 1 73  ? 20.472  -1.844  -3.839  1.00 45.54  ? 119  GLN A C   1 
ATOM   379  O O   . GLN A 1 73  ? 20.716  -0.972  -3.003  1.00 42.99  ? 119  GLN A O   1 
ATOM   380  C CB  . GLN A 1 73  ? 21.424  -3.483  -2.233  1.00 49.17  ? 119  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 73  ? 20.183  -3.558  -1.343  1.00 54.04  ? 119  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 73  ? 20.515  -3.541  0.130   1.00 56.92  ? 119  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 73  ? 21.672  -3.731  0.525   1.00 62.16  ? 119  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 73  ? 19.503  -3.322  0.952   1.00 57.15  ? 119  GLN A NE2 1 
ATOM   385  N N   . PRO A 1 74  ? 19.659  -1.643  -4.889  1.00 45.94  ? 120  PRO A N   1 
ATOM   386  C CA  . PRO A 1 74  ? 18.970  -0.361  -5.034  1.00 45.75  ? 120  PRO A CA  1 
ATOM   387  C C   . PRO A 1 74  ? 18.032  -0.101  -3.851  1.00 45.33  ? 120  PRO A C   1 
ATOM   388  O O   . PRO A 1 74  ? 17.464  -1.040  -3.282  1.00 45.33  ? 120  PRO A O   1 
ATOM   389  C CB  . PRO A 1 74  ? 18.178  -0.523  -6.342  1.00 46.88  ? 120  PRO A CB  1 
ATOM   390  C CG  . PRO A 1 74  ? 18.794  -1.713  -7.043  1.00 49.00  ? 120  PRO A CG  1 
ATOM   391  C CD  . PRO A 1 74  ? 19.258  -2.605  -5.931  1.00 48.21  ? 120  PRO A CD  1 
ATOM   392  N N   . MET A 1 75  ? 17.885  1.158   -3.474  1.00 43.47  ? 121  MET A N   1 
ATOM   393  C CA  . MET A 1 75  ? 16.950  1.529   -2.412  1.00 43.26  ? 121  MET A CA  1 
ATOM   394  C C   . MET A 1 75  ? 16.489  2.960   -2.635  1.00 43.63  ? 121  MET A C   1 
ATOM   395  O O   . MET A 1 75  ? 17.205  3.763   -3.240  1.00 42.52  ? 121  MET A O   1 
ATOM   396  C CB  . MET A 1 75  ? 17.606  1.357   -1.036  1.00 43.25  ? 121  MET A CB  1 
ATOM   397  C CG  . MET A 1 75  ? 16.678  1.520   0.183   1.00 43.76  ? 121  MET A CG  1 
ATOM   398  S SD  . MET A 1 75  ? 15.167  0.546   0.136   1.00 47.73  ? 121  MET A SD  1 
ATOM   399  C CE  . MET A 1 75  ? 15.810  -1.128  0.064   1.00 45.95  ? 121  MET A CE  1 
ATOM   400  N N   . ASP A 1 76  ? 15.285  3.267   -2.156  1.00 44.07  ? 122  ASP A N   1 
ATOM   401  C CA  . ASP A 1 76  ? 14.655  4.560   -2.399  1.00 44.48  ? 122  ASP A CA  1 
ATOM   402  C C   . ASP A 1 76  ? 13.601  4.802   -1.313  1.00 45.14  ? 122  ASP A C   1 
ATOM   403  O O   . ASP A 1 76  ? 13.145  3.849   -0.682  1.00 45.98  ? 122  ASP A O   1 
ATOM   404  C CB  . ASP A 1 76  ? 14.008  4.574   -3.784  1.00 45.03  ? 122  ASP A CB  1 
ATOM   405  C CG  . ASP A 1 76  ? 12.821  3.637   -3.880  1.00 47.85  ? 122  ASP A CG  1 
ATOM   406  O OD1 . ASP A 1 76  ? 13.025  2.413   -4.057  1.00 49.80  ? 122  ASP A OD1 1 
ATOM   407  O OD2 . ASP A 1 76  ? 11.675  4.125   -3.756  1.00 48.54  ? 122  ASP A OD2 1 
ATOM   408  N N   A MET A 1 77  ? 13.207  6.055   -1.106  0.50 45.52  ? 123  MET A N   1 
ATOM   409  N N   B MET A 1 77  ? 13.238  6.074   -1.117  0.50 45.57  ? 123  MET A N   1 
ATOM   410  C CA  A MET A 1 77  ? 12.274  6.394   -0.027  0.50 46.33  ? 123  MET A CA  1 
ATOM   411  C CA  B MET A 1 77  ? 12.257  6.495   -0.105  0.50 46.47  ? 123  MET A CA  1 
ATOM   412  C C   A MET A 1 77  ? 10.839  5.926   -0.256  0.50 47.83  ? 123  MET A C   1 
ATOM   413  C C   B MET A 1 77  ? 10.912  5.808   -0.261  0.50 47.82  ? 123  MET A C   1 
ATOM   414  O O   A MET A 1 77  ? 10.076  5.825   0.699   0.50 48.98  ? 123  MET A O   1 
ATOM   415  O O   B MET A 1 77  ? 10.290  5.427   0.732   0.50 48.74  ? 123  MET A O   1 
ATOM   416  C CB  A MET A 1 77  ? 12.280  7.901   0.239   0.50 46.47  ? 123  MET A CB  1 
ATOM   417  C CB  B MET A 1 77  ? 12.002  8.007   -0.179  0.50 46.95  ? 123  MET A CB  1 
ATOM   418  C CG  A MET A 1 77  ? 13.522  8.374   0.968   0.50 45.79  ? 123  MET A CG  1 
ATOM   419  C CG  B MET A 1 77  ? 13.189  8.910   0.134   0.50 46.40  ? 123  MET A CG  1 
ATOM   420  S SD  A MET A 1 77  ? 13.407  10.072  1.521   0.50 45.29  ? 123  MET A SD  1 
ATOM   421  S SD  B MET A 1 77  ? 12.656  10.630  0.298   0.50 47.34  ? 123  MET A SD  1 
ATOM   422  C CE  A MET A 1 77  ? 13.820  10.966  0.023   0.50 46.17  ? 123  MET A CE  1 
ATOM   423  C CE  B MET A 1 77  ? 11.966  10.580  1.940   0.50 50.55  ? 123  MET A CE  1 
ATOM   424  N N   . GLY A 1 78  ? 10.461  5.662   -1.505  1.00 48.24  ? 124  GLY A N   1 
ATOM   425  C CA  . GLY A 1 78  ? 9.152   5.060   -1.794  1.00 50.18  ? 124  GLY A CA  1 
ATOM   426  C C   . GLY A 1 78  ? 9.056   3.661   -1.221  1.00 50.89  ? 124  GLY A C   1 
ATOM   427  O O   . GLY A 1 78  ? 8.075   3.316   -0.549  1.00 52.56  ? 124  GLY A O   1 
ATOM   428  N N   . THR A 1 79  ? 10.099  2.867   -1.470  1.00 49.36  ? 125  THR A N   1 
ATOM   429  C CA  . THR A 1 79  ? 10.237  1.522   -0.905  1.00 50.03  ? 125  THR A CA  1 
ATOM   430  C C   . THR A 1 79  ? 10.280  1.550   0.631   1.00 50.81  ? 125  THR A C   1 
ATOM   431  O O   . THR A 1 79  ? 9.605   0.756   1.284   1.00 51.71  ? 125  THR A O   1 
ATOM   432  C CB  . THR A 1 79  ? 11.520  0.837   -1.454  1.00 49.10  ? 125  THR A CB  1 
ATOM   433  O OG1 . THR A 1 79  ? 11.408  0.703   -2.873  1.00 49.27  ? 125  THR A OG1 1 
ATOM   434  C CG2 . THR A 1 79  ? 11.744  -0.540  -0.845  1.00 49.73  ? 125  THR A CG2 1 
ATOM   435  N N   . ILE A 1 80  ? 11.066  2.461   1.203   1.00 49.97  ? 126  ILE A N   1 
ATOM   436  C CA  . ILE A 1 80  ? 11.177  2.570   2.661   1.00 50.92  ? 126  ILE A CA  1 
ATOM   437  C C   . ILE A 1 80  ? 9.836   2.985   3.286   1.00 53.13  ? 126  ILE A C   1 
ATOM   438  O O   . ILE A 1 80  ? 9.410   2.408   4.287   1.00 53.99  ? 126  ILE A O   1 
ATOM   439  C CB  . ILE A 1 80  ? 12.284  3.554   3.088   1.00 49.20  ? 126  ILE A CB  1 
ATOM   440  C CG1 . ILE A 1 80  ? 13.655  3.057   2.620   1.00 48.26  ? 126  ILE A CG1 1 
ATOM   441  C CG2 . ILE A 1 80  ? 12.293  3.727   4.616   1.00 49.69  ? 126  ILE A CG2 1 
ATOM   442  C CD1 . ILE A 1 80  ? 14.771  4.085   2.810   1.00 46.84  ? 126  ILE A CD1 1 
ATOM   443  N N   . LYS A 1 81  ? 9.183   3.977   2.680   1.00 54.23  ? 127  LYS A N   1 
ATOM   444  C CA  . LYS A 1 81  ? 7.861   4.439   3.099   1.00 56.65  ? 127  LYS A CA  1 
ATOM   445  C C   . LYS A 1 81  ? 6.835   3.308   3.054   1.00 59.50  ? 127  LYS A C   1 
ATOM   446  O O   . LYS A 1 81  ? 6.065   3.121   4.001   1.00 60.95  ? 127  LYS A O   1 
ATOM   447  C CB  . LYS A 1 81  ? 7.408   5.591   2.199   1.00 56.78  ? 127  LYS A CB  1 
ATOM   448  C CG  . LYS A 1 81  ? 6.055   6.200   2.537   1.00 60.75  ? 127  LYS A CG  1 
ATOM   449  C CD  . LYS A 1 81  ? 5.849   7.493   1.757   1.00 61.33  ? 127  LYS A CD  1 
ATOM   450  C CE  . LYS A 1 81  ? 4.505   8.133   2.043   1.00 65.20  ? 127  LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 81  ? 3.380   7.323   1.508   1.00 67.83  ? 127  LYS A NZ  1 
ATOM   452  N N   . ARG A 1 82  ? 6.826   2.565   1.950   1.00 60.53  ? 128  ARG A N   1 
ATOM   453  C CA  . ARG A 1 82  ? 5.925   1.420   1.795   1.00 63.87  ? 128  ARG A CA  1 
ATOM   454  C C   . ARG A 1 82  ? 6.209   0.346   2.852   1.00 63.99  ? 128  ARG A C   1 
ATOM   455  O O   . ARG A 1 82  ? 5.280   -0.278  3.379   1.00 65.58  ? 128  ARG A O   1 
ATOM   456  C CB  . ARG A 1 82  ? 6.040   0.831   0.385   1.00 64.94  ? 128  ARG A CB  1 
ATOM   457  C CG  . ARG A 1 82  ? 4.931   -0.132  0.013   1.00 71.23  ? 128  ARG A CG  1 
ATOM   458  C CD  . ARG A 1 82  ? 4.996   -0.525  -1.465  1.00 75.27  ? 128  ARG A CD  1 
ATOM   459  N NE  . ARG A 1 82  ? 6.250   -1.213  -1.789  1.00 76.95  ? 128  ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 82  ? 7.167   -0.801  -2.669  1.00 77.54  ? 128  ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 82  ? 7.008   0.317   -3.380  1.00 78.36  ? 128  ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 82  ? 8.265   -1.531  -2.846  1.00 77.21  ? 128  ARG A NH2 1 
ATOM   463  N N   . ARG A 1 83  ? 7.488   0.146   3.168   1.00 61.87  ? 129  ARG A N   1 
ATOM   464  C CA  . ARG A 1 83  ? 7.896   -0.814  4.197   1.00 62.12  ? 129  ARG A CA  1 
ATOM   465  C C   . ARG A 1 83  ? 7.492   -0.388  5.613   1.00 62.80  ? 129  ARG A C   1 
ATOM   466  O O   . ARG A 1 83  ? 7.116   -1.227  6.435   1.00 64.42  ? 129  ARG A O   1 
ATOM   467  C CB  . ARG A 1 83  ? 9.401   -1.059  4.125   1.00 60.25  ? 129  ARG A CB  1 
ATOM   468  C CG  . ARG A 1 83  ? 9.803   -1.931  2.954   1.00 60.62  ? 129  ARG A CG  1 
ATOM   469  C CD  . ARG A 1 83  ? 11.309  -2.065  2.854   1.00 59.33  ? 129  ARG A CD  1 
ATOM   470  N NE  . ARG A 1 83  ? 11.682  -2.977  1.780   1.00 59.82  ? 129  ARG A NE  1 
ATOM   471  C CZ  . ARG A 1 83  ? 12.910  -3.435  1.562   1.00 59.96  ? 129  ARG A CZ  1 
ATOM   472  N NH1 . ARG A 1 83  ? 13.925  -3.083  2.344   1.00 59.15  ? 129  ARG A NH1 1 
ATOM   473  N NH2 . ARG A 1 83  ? 13.123  -4.264  0.552   1.00 61.89  ? 129  ARG A NH2 1 
ATOM   474  N N   . LEU A 1 84  ? 7.568   0.912   5.889   1.00 62.07  ? 130  LEU A N   1 
ATOM   475  C CA  . LEU A 1 84  ? 7.095   1.465   7.164   1.00 62.95  ? 130  LEU A CA  1 
ATOM   476  C C   . LEU A 1 84  ? 5.582   1.326   7.303   1.00 65.70  ? 130  LEU A C   1 
ATOM   477  O O   . LEU A 1 84  ? 5.089   0.882   8.339   1.00 67.59  ? 130  LEU A O   1 
ATOM   478  C CB  . LEU A 1 84  ? 7.492   2.937   7.295   1.00 61.48  ? 130  LEU A CB  1 
ATOM   479  C CG  . LEU A 1 84  ? 8.983   3.186   7.535   1.00 58.48  ? 130  LEU A CG  1 
ATOM   480  C CD1 . LEU A 1 84  ? 9.326   4.656   7.315   1.00 57.86  ? 130  LEU A CD1 1 
ATOM   481  C CD2 . LEU A 1 84  ? 9.380   2.721   8.939   1.00 57.88  ? 130  LEU A CD2 1 
ATOM   482  N N   . GLU A 1 85  ? 4.857   1.711   6.254   1.00 66.23  ? 131  GLU A N   1 
ATOM   483  C CA  . GLU A 1 85  ? 3.396   1.594   6.218   1.00 68.64  ? 131  GLU A CA  1 
ATOM   484  C C   . GLU A 1 85  ? 2.903   0.157   6.411   1.00 71.11  ? 131  GLU A C   1 
ATOM   485  O O   . GLU A 1 85  ? 1.855   -0.062  7.024   1.00 73.42  ? 131  GLU A O   1 
ATOM   486  C CB  . GLU A 1 85  ? 2.848   2.148   4.899   1.00 68.25  ? 131  GLU A CB  1 
ATOM   487  C CG  . GLU A 1 85  ? 2.927   3.671   4.781   1.00 67.96  ? 131  GLU A CG  1 
ATOM   488  C CD  . GLU A 1 85  ? 2.801   4.181   3.347   1.00 67.30  ? 131  GLU A CD  1 
ATOM   489  O OE1 . GLU A 1 85  ? 2.673   3.362   2.414   1.00 68.83  ? 131  GLU A OE1 1 
ATOM   490  O OE2 . GLU A 1 85  ? 2.838   5.412   3.150   1.00 66.23  ? 131  GLU A OE2 1 
ATOM   491  N N   . ASN A 1 86  ? 3.652   -0.819  5.895   1.00 70.69  ? 132  ASN A N   1 
ATOM   492  C CA  . ASN A 1 86  ? 3.244   -2.228  5.966   1.00 73.65  ? 132  ASN A CA  1 
ATOM   493  C C   . ASN A 1 86  ? 3.901   -3.025  7.100   1.00 73.57  ? 132  ASN A C   1 
ATOM   494  O O   . ASN A 1 86  ? 3.865   -4.252  7.087   1.00 74.94  ? 132  ASN A O   1 
ATOM   495  C CB  . ASN A 1 86  ? 3.517   -2.925  4.626   1.00 74.09  ? 132  ASN A CB  1 
ATOM   496  C CG  . ASN A 1 86  ? 2.807   -2.259  3.459   1.00 76.33  ? 132  ASN A CG  1 
ATOM   497  O OD1 . ASN A 1 86  ? 3.226   -2.394  2.311   1.00 78.22  ? 132  ASN A OD1 1 
ATOM   498  N ND2 . ASN A 1 86  ? 1.727   -1.538  3.745   1.00 80.17  ? 132  ASN A ND2 1 
ATOM   499  N N   . ASN A 1 87  ? 4.484   -2.331  8.079   1.00 72.68  ? 133  ASN A N   1 
ATOM   500  C CA  . ASN A 1 87  ? 5.147   -2.976  9.221   1.00 73.24  ? 133  ASN A CA  1 
ATOM   501  C C   . ASN A 1 87  ? 6.114   -4.088  8.793   1.00 72.29  ? 133  ASN A C   1 
ATOM   502  O O   . ASN A 1 87  ? 6.118   -5.184  9.361   1.00 73.98  ? 133  ASN A O   1 
ATOM   503  C CB  . ASN A 1 87  ? 4.108   -3.515  10.218  1.00 76.93  ? 133  ASN A CB  1 
ATOM   504  C CG  . ASN A 1 87  ? 3.230   -2.419  10.807  1.00 78.66  ? 133  ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 87  ? 3.607   -1.246  10.840  1.00 78.67  ? 133  ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 87  ? 2.053   -2.805  11.288  1.00 82.55  ? 133  ASN A ND2 1 
ATOM   507  N N   . TYR A 1 88  ? 6.924   -3.787  7.779   1.00 70.11  ? 134  TYR A N   1 
ATOM   508  C CA  . TYR A 1 88  ? 7.915   -4.720  7.241   1.00 68.87  ? 134  TYR A CA  1 
ATOM   509  C C   . TYR A 1 88  ? 9.106   -4.851  8.188   1.00 67.26  ? 134  TYR A C   1 
ATOM   510  O O   . TYR A 1 88  ? 9.646   -5.943  8.371   1.00 67.12  ? 134  TYR A O   1 
ATOM   511  C CB  . TYR A 1 88  ? 8.382   -4.232  5.859   1.00 67.63  ? 134  TYR A CB  1 
ATOM   512  C CG  . TYR A 1 88  ? 9.532   -5.007  5.243   1.00 68.38  ? 134  TYR A CG  1 
ATOM   513  C CD1 . TYR A 1 88  ? 9.304   -6.178  4.524   1.00 71.92  ? 134  TYR A CD1 1 
ATOM   514  C CD2 . TYR A 1 88  ? 10.842  -4.561  5.370   1.00 67.30  ? 134  TYR A CD2 1 
ATOM   515  C CE1 . TYR A 1 88  ? 10.357  -6.887  3.951   1.00 71.98  ? 134  TYR A CE1 1 
ATOM   516  C CE2 . TYR A 1 88  ? 11.903  -5.257  4.797   1.00 67.18  ? 134  TYR A CE2 1 
ATOM   517  C CZ  . TYR A 1 88  ? 11.652  -6.418  4.093   1.00 70.13  ? 134  TYR A CZ  1 
ATOM   518  O OH  . TYR A 1 88  ? 12.691  -7.115  3.529   1.00 69.58  ? 134  TYR A OH  1 
ATOM   519  N N   . TYR A 1 89  ? 9.513   -3.734  8.785   1.00 65.83  ? 135  TYR A N   1 
ATOM   520  C CA  . TYR A 1 89  ? 10.695  -3.711  9.645   1.00 65.41  ? 135  TYR A CA  1 
ATOM   521  C C   . TYR A 1 89  ? 10.414  -4.296  11.025  1.00 68.79  ? 135  TYR A C   1 
ATOM   522  O O   . TYR A 1 89  ? 9.376   -4.020  11.628  1.00 70.04  ? 135  TYR A O   1 
ATOM   523  C CB  . TYR A 1 89  ? 11.221  -2.287  9.806   1.00 62.76  ? 135  TYR A CB  1 
ATOM   524  C CG  . TYR A 1 89  ? 11.650  -1.640  8.511   1.00 59.96  ? 135  TYR A CG  1 
ATOM   525  C CD1 . TYR A 1 89  ? 12.726  -2.144  7.780   1.00 58.25  ? 135  TYR A CD1 1 
ATOM   526  C CD2 . TYR A 1 89  ? 10.993  -0.518  8.023   1.00 58.58  ? 135  TYR A CD2 1 
ATOM   527  C CE1 . TYR A 1 89  ? 13.124  -1.547  6.597   1.00 55.97  ? 135  TYR A CE1 1 
ATOM   528  C CE2 . TYR A 1 89  ? 11.382  0.087   6.848   1.00 57.51  ? 135  TYR A CE2 1 
ATOM   529  C CZ  . TYR A 1 89  ? 12.448  -0.427  6.135   1.00 55.71  ? 135  TYR A CZ  1 
ATOM   530  O OH  . TYR A 1 89  ? 12.825  0.187   4.964   1.00 53.76  ? 135  TYR A OH  1 
ATOM   531  N N   . TRP A 1 90  ? 11.358  -5.098  11.510  1.00 70.50  ? 136  TRP A N   1 
ATOM   532  C CA  . TRP A 1 90  ? 11.304  -5.662  12.855  1.00 73.93  ? 136  TRP A CA  1 
ATOM   533  C C   . TRP A 1 90  ? 11.976  -4.727  13.863  1.00 72.28  ? 136  TRP A C   1 
ATOM   534  O O   . TRP A 1 90  ? 11.618  -4.717  15.040  1.00 73.58  ? 136  TRP A O   1 
ATOM   535  C CB  . TRP A 1 90  ? 11.970  -7.045  12.878  1.00 76.28  ? 136  TRP A CB  1 
ATOM   536  C CG  . TRP A 1 90  ? 11.257  -8.088  12.030  1.00 82.33  ? 136  TRP A CG  1 
ATOM   537  C CD1 . TRP A 1 90  ? 10.055  -7.948  11.380  1.00 84.90  ? 136  TRP A CD1 1 
ATOM   538  C CD2 . TRP A 1 90  ? 11.687  -9.436  11.780  1.00 86.88  ? 136  TRP A CD2 1 
ATOM   539  N NE1 . TRP A 1 90  ? 9.726   -9.116  10.732  1.00 87.82  ? 136  TRP A NE1 1 
ATOM   540  C CE2 . TRP A 1 90  ? 10.708  -10.045 10.960  1.00 88.89  ? 136  TRP A CE2 1 
ATOM   541  C CE3 . TRP A 1 90  ? 12.807  -10.187 12.164  1.00 88.34  ? 136  TRP A CE3 1 
ATOM   542  C CZ2 . TRP A 1 90  ? 10.815  -11.370 10.522  1.00 91.21  ? 136  TRP A CZ2 1 
ATOM   543  C CZ3 . TRP A 1 90  ? 12.913  -11.503 11.725  1.00 90.69  ? 136  TRP A CZ3 1 
ATOM   544  C CH2 . TRP A 1 90  ? 11.921  -12.079 10.911  1.00 91.87  ? 136  TRP A CH2 1 
ATOM   545  N N   . ALA A 1 91  ? 12.942  -3.942  13.390  1.00 68.62  ? 137  ALA A N   1 
ATOM   546  C CA  . ALA A 1 91  ? 13.673  -2.999  14.230  1.00 67.42  ? 137  ALA A CA  1 
ATOM   547  C C   . ALA A 1 91  ? 13.943  -1.699  13.472  1.00 64.43  ? 137  ALA A C   1 
ATOM   548  O O   . ALA A 1 91  ? 14.013  -1.693  12.238  1.00 62.57  ? 137  ALA A O   1 
ATOM   549  C CB  . ALA A 1 91  ? 14.988  -3.620  14.690  1.00 67.56  ? 137  ALA A CB  1 
ATOM   550  N N   . ALA A 1 92  ? 14.115  -0.610  14.217  1.00 63.40  ? 138  ALA A N   1 
ATOM   551  C CA  . ALA A 1 92  ? 14.398  0.702   13.630  1.00 61.52  ? 138  ALA A CA  1 
ATOM   552  C C   . ALA A 1 92  ? 15.724  0.722   12.867  1.00 59.27  ? 138  ALA A C   1 
ATOM   553  O O   . ALA A 1 92  ? 15.832  1.371   11.833  1.00 56.71  ? 138  ALA A O   1 
ATOM   554  C CB  . ALA A 1 92  ? 14.403  1.769   14.707  1.00 62.16  ? 138  ALA A CB  1 
ATOM   555  N N   . SER A 1 93  ? 16.728  0.011   13.376  1.00 59.63  ? 139  SER A N   1 
ATOM   556  C CA  . SER A 1 93  ? 18.027  -0.061  12.705  1.00 58.11  ? 139  SER A CA  1 
ATOM   557  C C   . SER A 1 93  ? 17.919  -0.586  11.268  1.00 56.80  ? 139  SER A C   1 
ATOM   558  O O   . SER A 1 93  ? 18.663  -0.147  10.395  1.00 55.45  ? 139  SER A O   1 
ATOM   559  C CB  . SER A 1 93  ? 19.012  -0.916  13.507  1.00 59.33  ? 139  SER A CB  1 
ATOM   560  O OG  . SER A 1 93  ? 18.530  -2.237  13.672  1.00 61.59  ? 139  SER A OG  1 
ATOM   561  N N   . GLU A 1 94  ? 16.997  -1.517  11.023  1.00 57.79  ? 140  GLU A N   1 
ATOM   562  C CA  . GLU A 1 94  ? 16.798  -2.080  9.680   1.00 56.75  ? 140  GLU A CA  1 
ATOM   563  C C   . GLU A 1 94  ? 16.354  -1.004  8.689   1.00 54.71  ? 140  GLU A C   1 
ATOM   564  O O   . GLU A 1 94  ? 16.843  -0.945  7.553   1.00 53.33  ? 140  GLU A O   1 
ATOM   565  C CB  . GLU A 1 94  ? 15.760  -3.202  9.710   1.00 59.46  ? 140  GLU A CB  1 
ATOM   566  C CG  . GLU A 1 94  ? 16.169  -4.429  10.522  1.00 62.69  ? 140  GLU A CG  1 
ATOM   567  C CD  . GLU A 1 94  ? 15.059  -5.461  10.647  1.00 66.08  ? 140  GLU A CD  1 
ATOM   568  O OE1 . GLU A 1 94  ? 13.924  -5.193  10.197  1.00 65.76  ? 140  GLU A OE1 1 
ATOM   569  O OE2 . GLU A 1 94  ? 15.325  -6.546  11.206  1.00 69.31  ? 140  GLU A OE2 1 
ATOM   570  N N   . CYS A 1 95  ? 15.419  -0.168  9.129   1.00 53.92  ? 141  CYS A N   1 
ATOM   571  C CA  . CYS A 1 95  ? 14.967  0.988   8.360   1.00 52.80  ? 141  CYS A CA  1 
ATOM   572  C C   . CYS A 1 95  ? 16.092  1.990   8.164   1.00 50.89  ? 141  CYS A C   1 
ATOM   573  O O   . CYS A 1 95  ? 16.261  2.527   7.070   1.00 49.21  ? 141  CYS A O   1 
ATOM   574  C CB  . CYS A 1 95  ? 13.788  1.664   9.072   1.00 53.70  ? 141  CYS A CB  1 
ATOM   575  S SG  . CYS A 1 95  ? 13.251  3.247   8.386   1.00 53.42  ? 141  CYS A SG  1 
ATOM   576  N N   . MET A 1 96  ? 16.867  2.226   9.222   1.00 51.08  ? 142  MET A N   1 
ATOM   577  C CA  . MET A 1 96  ? 18.007  3.138   9.150   1.00 49.85  ? 142  MET A CA  1 
ATOM   578  C C   . MET A 1 96  ? 19.037  2.651   8.129   1.00 48.42  ? 142  MET A C   1 
ATOM   579  O O   . MET A 1 96  ? 19.598  3.460   7.379   1.00 45.86  ? 142  MET A O   1 
ATOM   580  C CB  . MET A 1 96  ? 18.658  3.306   10.526  1.00 50.99  ? 142  MET A CB  1 
ATOM   581  C CG  . MET A 1 96  ? 17.816  4.099   11.507  1.00 52.82  ? 142  MET A CG  1 
ATOM   582  S SD  . MET A 1 96  ? 18.372  3.963   13.216  1.00 56.58  ? 142  MET A SD  1 
ATOM   583  C CE  . MET A 1 96  ? 20.020  4.654   13.125  1.00 54.66  ? 142  MET A CE  1 
ATOM   584  N N   . GLN A 1 97  ? 19.263  1.336   8.083   1.00 48.23  ? 143  GLN A N   1 
ATOM   585  C CA  . GLN A 1 97  ? 20.185  0.771   7.101   1.00 48.06  ? 143  GLN A CA  1 
ATOM   586  C C   . GLN A 1 97  ? 19.698  1.003   5.678   1.00 46.07  ? 143  GLN A C   1 
ATOM   587  O O   . GLN A 1 97  ? 20.518  1.179   4.782   1.00 44.89  ? 143  GLN A O   1 
ATOM   588  C CB  . GLN A 1 97  ? 20.431  -0.736  7.316   1.00 49.09  ? 143  GLN A CB  1 
ATOM   589  C CG  . GLN A 1 97  ? 21.068  -1.124  8.656   1.00 53.84  ? 143  GLN A CG  1 
ATOM   590  C CD  . GLN A 1 97  ? 22.415  -0.478  8.907   1.00 54.70  ? 143  GLN A CD  1 
ATOM   591  O OE1 . GLN A 1 97  ? 23.010  0.115   8.007   1.00 55.34  ? 143  GLN A OE1 1 
ATOM   592  N NE2 . GLN A 1 97  ? 22.910  -0.595  10.146  1.00 55.41  ? 143  GLN A NE2 1 
ATOM   593  N N   . ASP A 1 98  ? 18.381  0.978   5.461   1.00 45.87  ? 144  ASP A N   1 
ATOM   594  C CA  . ASP A 1 98  ? 17.827  1.228   4.123   1.00 45.69  ? 144  ASP A CA  1 
ATOM   595  C C   . ASP A 1 98  ? 18.040  2.676   3.681   1.00 44.41  ? 144  ASP A C   1 
ATOM   596  O O   . ASP A 1 98  ? 18.441  2.924   2.535   1.00 42.72  ? 144  ASP A O   1 
ATOM   597  C CB  . ASP A 1 98  ? 16.340  0.859   4.044   1.00 46.68  ? 144  ASP A CB  1 
ATOM   598  C CG  . ASP A 1 98  ? 16.103  -0.640  3.875   1.00 49.56  ? 144  ASP A CG  1 
ATOM   599  O OD1 . ASP A 1 98  ? 17.060  -1.403  3.602   1.00 49.43  ? 144  ASP A OD1 1 
ATOM   600  O OD2 . ASP A 1 98  ? 14.938  -1.061  4.024   1.00 53.05  ? 144  ASP A OD2 1 
ATOM   601  N N   . PHE A 1 99  ? 17.777  3.633   4.571   1.00 44.79  ? 145  PHE A N   1 
ATOM   602  C CA  . PHE A 1 99  ? 18.099  5.036   4.280   1.00 44.43  ? 145  PHE A CA  1 
ATOM   603  C C   . PHE A 1 99  ? 19.575  5.151   3.920   1.00 44.25  ? 145  PHE A C   1 
ATOM   604  O O   . PHE A 1 99  ? 19.928  5.773   2.929   1.00 43.95  ? 145  PHE A O   1 
ATOM   605  C CB  . PHE A 1 99  ? 17.818  5.955   5.471   1.00 45.16  ? 145  PHE A CB  1 
ATOM   606  C CG  . PHE A 1 99  ? 16.394  6.427   5.567   1.00 44.96  ? 145  PHE A CG  1 
ATOM   607  C CD1 . PHE A 1 99  ? 15.931  7.454   4.745   1.00 47.72  ? 145  PHE A CD1 1 
ATOM   608  C CD2 . PHE A 1 99  ? 15.525  5.880   6.510   1.00 48.94  ? 145  PHE A CD2 1 
ATOM   609  C CE1 . PHE A 1 99  ? 14.614  7.915   4.849   1.00 47.74  ? 145  PHE A CE1 1 
ATOM   610  C CE2 . PHE A 1 99  ? 14.210  6.334   6.619   1.00 48.99  ? 145  PHE A CE2 1 
ATOM   611  C CZ  . PHE A 1 99  ? 13.757  7.347   5.788   1.00 49.36  ? 145  PHE A CZ  1 
ATOM   612  N N   . ASN A 1 100 ? 20.432  4.548   4.738   1.00 44.95  ? 146  ASN A N   1 
ATOM   613  C CA  . ASN A 1 100 ? 21.866  4.602   4.504   1.00 44.99  ? 146  ASN A CA  1 
ATOM   614  C C   . ASN A 1 100 ? 22.259  4.036   3.143   1.00 43.92  ? 146  ASN A C   1 
ATOM   615  O O   . ASN A 1 100 ? 23.065  4.630   2.422   1.00 42.76  ? 146  ASN A O   1 
ATOM   616  C CB  . ASN A 1 100 ? 22.617  3.854   5.600   1.00 46.36  ? 146  ASN A CB  1 
ATOM   617  C CG  . ASN A 1 100 ? 24.115  3.966   5.443   1.00 47.13  ? 146  ASN A CG  1 
ATOM   618  O OD1 . ASN A 1 100 ? 24.683  5.043   5.624   1.00 49.54  ? 146  ASN A OD1 1 
ATOM   619  N ND2 . ASN A 1 100 ? 24.761  2.863   5.108   1.00 45.14  ? 146  ASN A ND2 1 
ATOM   620  N N   . THR A 1 101 ? 21.702  2.880   2.806   1.00 43.22  ? 147  THR A N   1 
ATOM   621  C CA  . THR A 1 101 ? 21.947  2.254   1.506   1.00 43.49  ? 147  THR A CA  1 
ATOM   622  C C   . THR A 1 101 ? 21.549  3.174   0.358   1.00 42.63  ? 147  THR A C   1 
ATOM   623  O O   . THR A 1 101 ? 22.280  3.323   -0.613  1.00 42.21  ? 147  THR A O   1 
ATOM   624  C CB  . THR A 1 101 ? 21.167  0.933   1.385   1.00 44.17  ? 147  THR A CB  1 
ATOM   625  O OG1 . THR A 1 101 ? 21.718  -0.012  2.309   1.00 43.04  ? 147  THR A OG1 1 
ATOM   626  C CG2 . THR A 1 101 ? 21.256  0.375   -0.048  1.00 43.99  ? 147  THR A CG2 1 
ATOM   627  N N   . MET A 1 102 ? 20.384  3.800   0.476   1.00 42.45  ? 148  MET A N   1 
ATOM   628  C CA  . MET A 1 102 ? 19.938  4.748   -0.536  1.00 42.26  ? 148  MET A CA  1 
ATOM   629  C C   . MET A 1 102 ? 20.938  5.880   -0.746  1.00 41.50  ? 148  MET A C   1 
ATOM   630  O O   . MET A 1 102 ? 21.250  6.241   -1.880  1.00 41.96  ? 148  MET A O   1 
ATOM   631  C CB  . MET A 1 102 ? 18.582  5.337   -0.155  1.00 42.78  ? 148  MET A CB  1 
ATOM   632  C CG  . MET A 1 102 ? 18.106  6.461   -1.066  1.00 43.21  ? 148  MET A CG  1 
ATOM   633  S SD  . MET A 1 102 ? 16.544  7.114   -0.480  1.00 44.82  ? 148  MET A SD  1 
ATOM   634  C CE  . MET A 1 102 ? 17.129  8.191   0.842   1.00 46.03  ? 148  MET A CE  1 
ATOM   635  N N   . PHE A 1 103 ? 21.437  6.450   0.345   1.00 41.06  ? 149  PHE A N   1 
ATOM   636  C CA  . PHE A 1 103 ? 22.355  7.584   0.232   1.00 41.55  ? 149  PHE A CA  1 
ATOM   637  C C   . PHE A 1 103 ? 23.702  7.105   -0.307  1.00 40.93  ? 149  PHE A C   1 
ATOM   638  O O   . PHE A 1 103 ? 24.299  7.734   -1.168  1.00 40.54  ? 149  PHE A O   1 
ATOM   639  C CB  . PHE A 1 103 ? 22.522  8.275   1.588   1.00 42.29  ? 149  PHE A CB  1 
ATOM   640  C CG  . PHE A 1 103 ? 21.276  8.991   2.062   1.00 43.85  ? 149  PHE A CG  1 
ATOM   641  C CD1 . PHE A 1 103 ? 20.641  9.924   1.242   1.00 45.12  ? 149  PHE A CD1 1 
ATOM   642  C CD2 . PHE A 1 103 ? 20.745  8.738   3.314   1.00 46.79  ? 149  PHE A CD2 1 
ATOM   643  C CE1 . PHE A 1 103 ? 19.492  10.582  1.662   1.00 47.89  ? 149  PHE A CE1 1 
ATOM   644  C CE2 . PHE A 1 103 ? 19.595  9.402   3.748   1.00 47.74  ? 149  PHE A CE2 1 
ATOM   645  C CZ  . PHE A 1 103 ? 18.971  10.322  2.919   1.00 48.08  ? 149  PHE A CZ  1 
ATOM   646  N N   . THR A 1 104 ? 24.158  5.975   0.208   1.00 41.00  ? 150  THR A N   1 
ATOM   647  C CA  . THR A 1 104 ? 25.449  5.420   -0.170  1.00 41.58  ? 150  THR A CA  1 
ATOM   648  C C   . THR A 1 104 ? 25.509  5.023   -1.654  1.00 40.36  ? 150  THR A C   1 
ATOM   649  O O   . THR A 1 104 ? 26.500  5.296   -2.324  1.00 40.96  ? 150  THR A O   1 
ATOM   650  C CB  . THR A 1 104 ? 25.808  4.251   0.764   1.00 42.16  ? 150  THR A CB  1 
ATOM   651  O OG1 . THR A 1 104 ? 25.998  4.773   2.083   1.00 43.39  ? 150  THR A OG1 1 
ATOM   652  C CG2 . THR A 1 104 ? 27.077  3.569   0.319   1.00 43.41  ? 150  THR A CG2 1 
ATOM   653  N N   . ASN A 1 105 ? 24.441  4.409   -2.159  1.00 41.38  ? 151  ASN A N   1 
ATOM   654  C CA  . ASN A 1 105 ? 24.320  4.090   -3.584  1.00 41.10  ? 151  ASN A CA  1 
ATOM   655  C C   . ASN A 1 105 ? 24.555  5.338   -4.414  1.00 40.97  ? 151  ASN A C   1 
ATOM   656  O O   . ASN A 1 105 ? 25.262  5.315   -5.423  1.00 40.80  ? 151  ASN A O   1 
ATOM   657  C CB  . ASN A 1 105 ? 22.924  3.531   -3.922  1.00 41.27  ? 151  ASN A CB  1 
ATOM   658  C CG  . ASN A 1 105 ? 22.691  2.115   -3.397  1.00 43.20  ? 151  ASN A CG  1 
ATOM   659  O OD1 . ASN A 1 105 ? 23.611  1.446   -2.918  1.00 43.62  ? 151  ASN A OD1 1 
ATOM   660  N ND2 . ASN A 1 105 ? 21.440  1.647   -3.503  1.00 41.77  ? 151  ASN A ND2 1 
ATOM   661  N N   . CYS A 1 106 ? 23.963  6.439   -3.973  1.00 40.91  ? 152  CYS A N   1 
ATOM   662  C CA  . CYS A 1 106 ? 24.045  7.681   -4.705  1.00 40.84  ? 152  CYS A CA  1 
ATOM   663  C C   . CYS A 1 106 ? 25.488  8.198   -4.758  1.00 40.80  ? 152  CYS A C   1 
ATOM   664  O O   . CYS A 1 106 ? 25.972  8.568   -5.829  1.00 41.38  ? 152  CYS A O   1 
ATOM   665  C CB  . CYS A 1 106 ? 23.090  8.707   -4.091  1.00 41.86  ? 152  CYS A CB  1 
ATOM   666  S SG  . CYS A 1 106 ? 23.059  10.277  -4.932  1.00 44.64  ? 152  CYS A SG  1 
ATOM   667  N N   . TYR A 1 107 ? 26.180  8.179   -3.617  1.00 40.25  ? 153  TYR A N   1 
ATOM   668  C CA  . TYR A 1 107 ? 27.576  8.636   -3.542  1.00 39.93  ? 153  TYR A CA  1 
ATOM   669  C C   . TYR A 1 107 ? 28.523  7.738   -4.351  1.00 41.06  ? 153  TYR A C   1 
ATOM   670  O O   . TYR A 1 107 ? 29.463  8.222   -4.985  1.00 42.10  ? 153  TYR A O   1 
ATOM   671  C CB  . TYR A 1 107 ? 28.051  8.703   -2.081  1.00 39.49  ? 153  TYR A CB  1 
ATOM   672  C CG  . TYR A 1 107 ? 27.162  9.523   -1.164  1.00 40.95  ? 153  TYR A CG  1 
ATOM   673  C CD1 . TYR A 1 107 ? 26.651  10.750  -1.573  1.00 43.26  ? 153  TYR A CD1 1 
ATOM   674  C CD2 . TYR A 1 107 ? 26.856  9.083   0.121   1.00 41.05  ? 153  TYR A CD2 1 
ATOM   675  C CE1 . TYR A 1 107 ? 25.832  11.498  -0.742  1.00 43.22  ? 153  TYR A CE1 1 
ATOM   676  C CE2 . TYR A 1 107 ? 26.043  9.821   0.959   1.00 42.77  ? 153  TYR A CE2 1 
ATOM   677  C CZ  . TYR A 1 107 ? 25.533  11.037  0.517   1.00 42.79  ? 153  TYR A CZ  1 
ATOM   678  O OH  . TYR A 1 107 ? 24.727  11.805  1.332   1.00 44.78  ? 153  TYR A OH  1 
ATOM   679  N N   . ILE A 1 108 ? 28.260  6.433   -4.347  1.00 41.45  ? 154  ILE A N   1 
ATOM   680  C CA  . ILE A 1 108 ? 29.133  5.478   -5.023  1.00 42.28  ? 154  ILE A CA  1 
ATOM   681  C C   . ILE A 1 108 ? 28.978  5.570   -6.536  1.00 42.60  ? 154  ILE A C   1 
ATOM   682  O O   . ILE A 1 108 ? 29.965  5.596   -7.257  1.00 43.45  ? 154  ILE A O   1 
ATOM   683  C CB  . ILE A 1 108 ? 28.874  4.037   -4.515  1.00 42.13  ? 154  ILE A CB  1 
ATOM   684  C CG1 . ILE A 1 108 ? 29.395  3.900   -3.082  1.00 41.92  ? 154  ILE A CG1 1 
ATOM   685  C CG2 . ILE A 1 108 ? 29.554  2.990   -5.396  1.00 42.32  ? 154  ILE A CG2 1 
ATOM   686  C CD1 . ILE A 1 108 ? 29.082  2.562   -2.445  1.00 42.60  ? 154  ILE A CD1 1 
ATOM   687  N N   . TYR A 1 109 ? 27.739  5.641   -7.015  1.00 42.68  ? 155  TYR A N   1 
ATOM   688  C CA  . TYR A 1 109 ? 27.489  5.609   -8.450  1.00 43.46  ? 155  TYR A CA  1 
ATOM   689  C C   . TYR A 1 109 ? 27.849  6.916   -9.154  1.00 44.10  ? 155  TYR A C   1 
ATOM   690  O O   . TYR A 1 109 ? 28.487  6.912   -10.208 1.00 43.77  ? 155  TYR A O   1 
ATOM   691  C CB  . TYR A 1 109 ? 26.030  5.249   -8.764  1.00 43.89  ? 155  TYR A CB  1 
ATOM   692  C CG  . TYR A 1 109 ? 25.800  5.247   -10.255 1.00 44.68  ? 155  TYR A CG  1 
ATOM   693  C CD1 . TYR A 1 109 ? 26.284  4.212   -11.044 1.00 45.05  ? 155  TYR A CD1 1 
ATOM   694  C CD2 . TYR A 1 109 ? 25.175  6.318   -10.884 1.00 44.48  ? 155  TYR A CD2 1 
ATOM   695  C CE1 . TYR A 1 109 ? 26.124  4.225   -12.420 1.00 46.86  ? 155  TYR A CE1 1 
ATOM   696  C CE2 . TYR A 1 109 ? 25.009  6.339   -12.261 1.00 47.00  ? 155  TYR A CE2 1 
ATOM   697  C CZ  . TYR A 1 109 ? 25.492  5.291   -13.022 1.00 47.65  ? 155  TYR A CZ  1 
ATOM   698  O OH  . TYR A 1 109 ? 25.325  5.305   -14.384 1.00 49.71  ? 155  TYR A OH  1 
ATOM   699  N N   . ASN A 1 110 ? 27.430  8.031   -8.572  1.00 44.24  ? 156  ASN A N   1 
ATOM   700  C CA  . ASN A 1 110 ? 27.525  9.329   -9.237  1.00 45.76  ? 156  ASN A CA  1 
ATOM   701  C C   . ASN A 1 110 ? 28.894  9.997   -9.115  1.00 47.93  ? 156  ASN A C   1 
ATOM   702  O O   . ASN A 1 110 ? 29.717  9.610   -8.289  1.00 46.88  ? 156  ASN A O   1 
ATOM   703  C CB  . ASN A 1 110 ? 26.405  10.235  -8.724  1.00 44.73  ? 156  ASN A CB  1 
ATOM   704  C CG  . ASN A 1 110 ? 25.039  9.702   -9.094  1.00 44.64  ? 156  ASN A CG  1 
ATOM   705  O OD1 . ASN A 1 110 ? 24.659  9.708   -10.273 1.00 46.60  ? 156  ASN A OD1 1 
ATOM   706  N ND2 . ASN A 1 110 ? 24.307  9.200   -8.108  1.00 42.31  ? 156  ASN A ND2 1 
ATOM   707  N N   . LYS A 1 111 ? 29.131  10.990  -9.966  1.00 50.66  ? 157  LYS A N   1 
ATOM   708  C CA  . LYS A 1 111 ? 30.375  11.757  -9.937  1.00 53.24  ? 157  LYS A CA  1 
ATOM   709  C C   . LYS A 1 111 ? 30.377  12.713  -8.746  1.00 52.48  ? 157  LYS A C   1 
ATOM   710  O O   . LYS A 1 111 ? 29.317  13.157  -8.310  1.00 51.61  ? 157  LYS A O   1 
ATOM   711  C CB  . LYS A 1 111 ? 30.557  12.550  -11.232 1.00 55.73  ? 157  LYS A CB  1 
ATOM   712  C CG  . LYS A 1 111 ? 30.724  11.692  -12.471 1.00 59.59  ? 157  LYS A CG  1 
ATOM   713  C CD  . LYS A 1 111 ? 30.691  12.535  -13.733 1.00 63.65  ? 157  LYS A CD  1 
ATOM   714  C CE  . LYS A 1 111 ? 30.619  11.660  -14.982 1.00 65.92  ? 157  LYS A CE  1 
ATOM   715  N NZ  . LYS A 1 111 ? 30.148  12.421  -16.166 1.00 70.26  ? 157  LYS A NZ  1 
ATOM   716  N N   . PRO A 1 112 ? 31.569  13.035  -8.214  1.00 53.60  ? 158  PRO A N   1 
ATOM   717  C CA  . PRO A 1 112 ? 31.680  13.974  -7.093  1.00 54.15  ? 158  PRO A CA  1 
ATOM   718  C C   . PRO A 1 112 ? 30.934  15.300  -7.302  1.00 54.19  ? 158  PRO A C   1 
ATOM   719  O O   . PRO A 1 112 ? 30.396  15.863  -6.349  1.00 54.54  ? 158  PRO A O   1 
ATOM   720  C CB  . PRO A 1 112 ? 33.186  14.241  -7.018  1.00 55.13  ? 158  PRO A CB  1 
ATOM   721  C CG  . PRO A 1 112 ? 33.807  13.025  -7.548  1.00 55.51  ? 158  PRO A CG  1 
ATOM   722  C CD  . PRO A 1 112 ? 32.876  12.457  -8.570  1.00 54.46  ? 158  PRO A CD  1 
ATOM   723  N N   . THR A 1 113 ? 30.900  15.768  -8.544  1.00 54.87  ? 159  THR A N   1 
ATOM   724  C CA  . THR A 1 113 ? 30.394  17.105  -8.878  1.00 56.29  ? 159  THR A CA  1 
ATOM   725  C C   . THR A 1 113 ? 28.913  17.126  -9.291  1.00 54.83  ? 159  THR A C   1 
ATOM   726  O O   . THR A 1 113 ? 28.374  18.191  -9.620  1.00 55.53  ? 159  THR A O   1 
ATOM   727  C CB  . THR A 1 113 ? 31.234  17.706  -10.024 1.00 58.46  ? 159  THR A CB  1 
ATOM   728  O OG1 . THR A 1 113 ? 31.311  16.760  -11.099 1.00 59.34  ? 159  THR A OG1 1 
ATOM   729  C CG2 . THR A 1 113 ? 32.647  18.024  -9.544  1.00 59.85  ? 159  THR A CG2 1 
ATOM   730  N N   . ASP A 1 114 ? 28.260  15.966  -9.274  1.00 51.74  ? 160  ASP A N   1 
ATOM   731  C CA  . ASP A 1 114 ? 26.848  15.877  -9.660  1.00 50.72  ? 160  ASP A CA  1 
ATOM   732  C C   . ASP A 1 114 ? 25.934  16.533  -8.620  1.00 48.89  ? 160  ASP A C   1 
ATOM   733  O O   . ASP A 1 114 ? 26.142  16.377  -7.423  1.00 47.74  ? 160  ASP A O   1 
ATOM   734  C CB  . ASP A 1 114 ? 26.431  14.418  -9.855  1.00 49.46  ? 160  ASP A CB  1 
ATOM   735  C CG  . ASP A 1 114 ? 27.040  13.785  -11.097 1.00 52.11  ? 160  ASP A CG  1 
ATOM   736  O OD1 . ASP A 1 114 ? 27.527  14.519  -11.978 1.00 54.03  ? 160  ASP A OD1 1 
ATOM   737  O OD2 . ASP A 1 114 ? 27.023  12.541  -11.201 1.00 51.67  ? 160  ASP A OD2 1 
ATOM   738  N N   . ASP A 1 115 ? 24.920  17.259  -9.090  1.00 48.34  ? 161  ASP A N   1 
ATOM   739  C CA  . ASP A 1 115 ? 23.915  17.859  -8.208  1.00 48.60  ? 161  ASP A CA  1 
ATOM   740  C C   . ASP A 1 115 ? 23.259  16.844  -7.272  1.00 46.64  ? 161  ASP A C   1 
ATOM   741  O O   . ASP A 1 115 ? 22.963  17.166  -6.114  1.00 45.69  ? 161  ASP A O   1 
ATOM   742  C CB  . ASP A 1 115 ? 22.808  18.557  -9.015  1.00 49.84  ? 161  ASP A CB  1 
ATOM   743  C CG  . ASP A 1 115 ? 23.278  19.832  -9.700  1.00 53.33  ? 161  ASP A CG  1 
ATOM   744  O OD1 . ASP A 1 115 ? 24.432  20.272  -9.505  1.00 56.32  ? 161  ASP A OD1 1 
ATOM   745  O OD2 . ASP A 1 115 ? 22.466  20.408  -10.452 1.00 57.31  ? 161  ASP A OD2 1 
ATOM   746  N N   . ILE A 1 116 ? 23.025  15.626  -7.764  1.00 45.68  ? 162  ILE A N   1 
ATOM   747  C CA  . ILE A 1 116 ? 22.316  14.623  -6.978  1.00 44.99  ? 162  ILE A CA  1 
ATOM   748  C C   . ILE A 1 116 ? 23.058  14.267  -5.690  1.00 43.51  ? 162  ILE A C   1 
ATOM   749  O O   . ILE A 1 116 ? 22.440  13.979  -4.671  1.00 41.68  ? 162  ILE A O   1 
ATOM   750  C CB  . ILE A 1 116 ? 22.014  13.341  -7.786  1.00 45.27  ? 162  ILE A CB  1 
ATOM   751  C CG1 . ILE A 1 116 ? 20.951  12.526  -7.043  1.00 47.21  ? 162  ILE A CG1 1 
ATOM   752  C CG2 . ILE A 1 116 ? 23.298  12.545  -8.076  1.00 43.41  ? 162  ILE A CG2 1 
ATOM   753  C CD1 . ILE A 1 116 ? 20.243  11.543  -7.886  1.00 50.58  ? 162  ILE A CD1 1 
ATOM   754  N N   . VAL A 1 117 ? 24.383  14.320  -5.741  1.00 43.74  ? 163  VAL A N   1 
ATOM   755  C CA  . VAL A 1 117 ? 25.214  14.105  -4.556  1.00 43.92  ? 163  VAL A CA  1 
ATOM   756  C C   . VAL A 1 117 ? 24.927  15.171  -3.496  1.00 43.85  ? 163  VAL A C   1 
ATOM   757  O O   . VAL A 1 117 ? 24.748  14.852  -2.313  1.00 43.91  ? 163  VAL A O   1 
ATOM   758  C CB  . VAL A 1 117 ? 26.715  14.065  -4.936  1.00 44.29  ? 163  VAL A CB  1 
ATOM   759  C CG1 . VAL A 1 117 ? 27.609  14.074  -3.691  1.00 44.02  ? 163  VAL A CG1 1 
ATOM   760  C CG2 . VAL A 1 117 ? 26.989  12.823  -5.787  1.00 44.15  ? 163  VAL A CG2 1 
ATOM   761  N N   . LEU A 1 118 ? 24.854  16.425  -3.925  1.00 44.72  ? 164  LEU A N   1 
ATOM   762  C CA  . LEU A 1 118 ? 24.531  17.539  -3.025  1.00 45.68  ? 164  LEU A CA  1 
ATOM   763  C C   . LEU A 1 118 ? 23.133  17.371  -2.422  1.00 44.06  ? 164  LEU A C   1 
ATOM   764  O O   . LEU A 1 118 ? 22.917  17.616  -1.237  1.00 43.59  ? 164  LEU A O   1 
ATOM   765  C CB  . LEU A 1 118 ? 24.610  18.858  -3.790  1.00 48.63  ? 164  LEU A CB  1 
ATOM   766  C CG  . LEU A 1 118 ? 24.304  20.145  -3.037  1.00 53.68  ? 164  LEU A CG  1 
ATOM   767  C CD1 . LEU A 1 118 ? 25.156  20.223  -1.771  1.00 57.52  ? 164  LEU A CD1 1 
ATOM   768  C CD2 . LEU A 1 118 ? 24.568  21.341  -3.940  1.00 58.57  ? 164  LEU A CD2 1 
ATOM   769  N N   . MET A 1 119 ? 22.194  16.942  -3.256  1.00 43.33  ? 165  MET A N   1 
ATOM   770  C CA  . MET A 1 119 ? 20.828  16.700  -2.820  1.00 43.10  ? 165  MET A CA  1 
ATOM   771  C C   . MET A 1 119 ? 20.771  15.588  -1.778  1.00 43.16  ? 165  MET A C   1 
ATOM   772  O O   . MET A 1 119 ? 20.134  15.742  -0.733  1.00 43.82  ? 165  MET A O   1 
ATOM   773  C CB  . MET A 1 119 ? 19.950  16.402  -4.034  1.00 43.51  ? 165  MET A CB  1 
ATOM   774  C CG  . MET A 1 119 ? 19.847  17.596  -4.982  1.00 45.65  ? 165  MET A CG  1 
ATOM   775  S SD  . MET A 1 119 ? 19.137  17.233  -6.598  1.00 46.09  ? 165  MET A SD  1 
ATOM   776  C CE  . MET A 1 119 ? 17.392  17.320  -6.194  1.00 49.00  ? 165  MET A CE  1 
ATOM   777  N N   . ALA A 1 120 ? 21.461  14.481  -2.045  1.00 41.45  ? 166  ALA A N   1 
ATOM   778  C CA  . ALA A 1 120 ? 21.562  13.383  -1.086  1.00 41.89  ? 166  ALA A CA  1 
ATOM   779  C C   . ALA A 1 120 ? 22.172  13.848  0.239   1.00 42.20  ? 166  ALA A C   1 
ATOM   780  O O   . ALA A 1 120 ? 21.652  13.525  1.305   1.00 42.61  ? 166  ALA A O   1 
ATOM   781  C CB  . ALA A 1 120 ? 22.388  12.209  -1.683  1.00 40.90  ? 166  ALA A CB  1 
ATOM   782  N N   . GLN A 1 121 ? 23.262  14.612  0.174   1.00 43.05  ? 167  GLN A N   1 
ATOM   783  C CA  . GLN A 1 121 ? 23.922  15.111  1.394   1.00 44.36  ? 167  GLN A CA  1 
ATOM   784  C C   . GLN A 1 121 ? 22.984  15.962  2.246   1.00 44.72  ? 167  GLN A C   1 
ATOM   785  O O   . GLN A 1 121 ? 22.966  15.844  3.474   1.00 44.78  ? 167  GLN A O   1 
ATOM   786  C CB  . GLN A 1 121 ? 25.183  15.923  1.046   1.00 46.13  ? 167  GLN A CB  1 
ATOM   787  C CG  . GLN A 1 121 ? 26.335  15.076  0.502   1.00 47.75  ? 167  GLN A CG  1 
ATOM   788  C CD  . GLN A 1 121 ? 27.501  15.899  -0.030  1.00 54.86  ? 167  GLN A CD  1 
ATOM   789  O OE1 . GLN A 1 121 ? 27.325  16.776  -0.880  1.00 58.82  ? 167  GLN A OE1 1 
ATOM   790  N NE2 . GLN A 1 121 ? 28.708  15.595  0.445   1.00 59.01  ? 167  GLN A NE2 1 
ATOM   791  N N   . THR A 1 122 ? 22.208  16.822  1.592   1.00 44.21  ? 168  THR A N   1 
ATOM   792  C CA  . THR A 1 122 ? 21.267  17.681  2.291   1.00 45.12  ? 168  THR A CA  1 
ATOM   793  C C   . THR A 1 122 ? 20.228  16.838  3.023   1.00 45.20  ? 168  THR A C   1 
ATOM   794  O O   . THR A 1 122 ? 19.931  17.074  4.200   1.00 46.76  ? 168  THR A O   1 
ATOM   795  C CB  . THR A 1 122 ? 20.603  18.672  1.303   1.00 45.97  ? 168  THR A CB  1 
ATOM   796  O OG1 . THR A 1 122 ? 21.625  19.451  0.674   1.00 45.32  ? 168  THR A OG1 1 
ATOM   797  C CG2 . THR A 1 122 ? 19.626  19.611  2.004   1.00 45.34  ? 168  THR A CG2 1 
ATOM   798  N N   . LEU A 1 123 ? 19.677  15.854  2.326   1.00 43.71  ? 169  LEU A N   1 
ATOM   799  C CA  . LEU A 1 123 ? 18.684  14.967  2.919   1.00 43.83  ? 169  LEU A CA  1 
ATOM   800  C C   . LEU A 1 123 ? 19.277  14.118  4.043   1.00 43.50  ? 169  LEU A C   1 
ATOM   801  O O   . LEU A 1 123 ? 18.637  13.920  5.082   1.00 43.37  ? 169  LEU A O   1 
ATOM   802  C CB  . LEU A 1 123 ? 18.073  14.060  1.856   1.00 43.09  ? 169  LEU A CB  1 
ATOM   803  C CG  . LEU A 1 123 ? 17.294  14.762  0.740   1.00 44.24  ? 169  LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 123 ? 16.948  13.749  -0.347  1.00 44.62  ? 169  LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 123 ? 16.035  15.436  1.264   1.00 45.41  ? 169  LEU A CD2 1 
ATOM   806  N N   . GLU A 1 124 ? 20.500  13.636  3.849   1.00 43.76  ? 170  GLU A N   1 
ATOM   807  C CA  . GLU A 1 124 ? 21.128  12.779  4.851   1.00 44.84  ? 170  GLU A CA  1 
ATOM   808  C C   . GLU A 1 124 ? 21.454  13.524  6.142   1.00 45.49  ? 170  GLU A C   1 
ATOM   809  O O   . GLU A 1 124 ? 21.397  12.942  7.234   1.00 45.69  ? 170  GLU A O   1 
ATOM   810  C CB  . GLU A 1 124 ? 22.367  12.078  4.298   1.00 44.35  ? 170  GLU A CB  1 
ATOM   811  C CG  . GLU A 1 124 ? 22.793  10.928  5.159   1.00 47.10  ? 170  GLU A CG  1 
ATOM   812  C CD  . GLU A 1 124 ? 23.800  10.009  4.502   1.00 49.20  ? 170  GLU A CD  1 
ATOM   813  O OE1 . GLU A 1 124 ? 24.575  10.478  3.651   1.00 49.88  ? 170  GLU A OE1 1 
ATOM   814  O OE2 . GLU A 1 124 ? 23.834  8.818   4.881   1.00 53.52  ? 170  GLU A OE2 1 
ATOM   815  N N   A LYS A 1 125 ? 21.800  14.803  6.027   0.50 45.97  ? 171  LYS A N   1 
ATOM   816  N N   B LYS A 1 125 ? 21.784  14.809  6.018   0.50 46.09  ? 171  LYS A N   1 
ATOM   817  C CA  A LYS A 1 125 ? 22.070  15.613  7.203   0.50 47.07  ? 171  LYS A CA  1 
ATOM   818  C CA  B LYS A 1 125 ? 21.975  15.668  7.177   0.50 47.32  ? 171  LYS A CA  1 
ATOM   819  C C   A LYS A 1 125 ? 20.795  15.796  8.035   0.50 47.58  ? 171  LYS A C   1 
ATOM   820  C C   B LYS A 1 125 ? 20.695  15.719  8.015   0.50 47.63  ? 171  LYS A C   1 
ATOM   821  O O   A LYS A 1 125 ? 20.854  15.852  9.257   0.50 48.22  ? 171  LYS A O   1 
ATOM   822  O O   B LYS A 1 125 ? 20.740  15.559  9.230   0.50 47.86  ? 171  LYS A O   1 
ATOM   823  C CB  A LYS A 1 125 ? 22.676  16.958  6.796   0.50 48.11  ? 171  LYS A CB  1 
ATOM   824  C CB  B LYS A 1 125 ? 22.379  17.078  6.735   0.50 48.43  ? 171  LYS A CB  1 
ATOM   825  C CG  A LYS A 1 125 ? 24.132  16.844  6.348   0.50 48.59  ? 171  LYS A CG  1 
ATOM   826  C CG  B LYS A 1 125 ? 22.415  18.103  7.854   0.50 51.07  ? 171  LYS A CG  1 
ATOM   827  C CD  A LYS A 1 125 ? 24.603  18.089  5.618   0.50 50.38  ? 171  LYS A CD  1 
ATOM   828  C CD  B LYS A 1 125 ? 22.888  19.456  7.332   0.50 52.80  ? 171  LYS A CD  1 
ATOM   829  C CE  A LYS A 1 125 ? 25.982  17.890  5.020   0.50 51.56  ? 171  LYS A CE  1 
ATOM   830  C CE  B LYS A 1 125 ? 22.421  20.612  8.206   0.50 55.18  ? 171  LYS A CE  1 
ATOM   831  N NZ  A LYS A 1 125 ? 26.278  18.922  3.986   0.50 54.81  ? 171  LYS A NZ  1 
ATOM   832  N NZ  B LYS A 1 125 ? 23.417  20.993  9.250   0.50 56.09  ? 171  LYS A NZ  1 
ATOM   833  N N   A ILE A 1 126 ? 19.645  15.862  7.371   0.50 47.27  ? 172  ILE A N   1 
ATOM   834  N N   B ILE A 1 126 ? 19.559  15.928  7.358   0.50 47.54  ? 172  ILE A N   1 
ATOM   835  C CA  A ILE A 1 126 ? 18.364  15.938  8.070   0.50 47.85  ? 172  ILE A CA  1 
ATOM   836  C CA  B ILE A 1 126 ? 18.269  15.936  8.044   0.50 48.21  ? 172  ILE A CA  1 
ATOM   837  C C   A ILE A 1 126 ? 18.015  14.589  8.710   0.50 47.70  ? 172  ILE A C   1 
ATOM   838  C C   B ILE A 1 126 ? 18.003  14.585  8.710   0.50 47.89  ? 172  ILE A C   1 
ATOM   839  O O   A ILE A 1 126 ? 17.536  14.536  9.844   0.50 48.79  ? 172  ILE A O   1 
ATOM   840  O O   B ILE A 1 126 ? 17.571  14.527  9.864   0.50 48.95  ? 172  ILE A O   1 
ATOM   841  C CB  A ILE A 1 126 ? 17.229  16.373  7.123   0.50 47.93  ? 172  ILE A CB  1 
ATOM   842  C CB  B ILE A 1 126 ? 17.111  16.251  7.075   0.50 48.44  ? 172  ILE A CB  1 
ATOM   843  C CG1 A ILE A 1 126 ? 17.506  17.775  6.568   0.50 48.41  ? 172  ILE A CG1 1 
ATOM   844  C CG1 B ILE A 1 126 ? 17.268  17.656  6.483   0.50 49.37  ? 172  ILE A CG1 1 
ATOM   845  C CG2 A ILE A 1 126 ? 15.894  16.355  7.850   0.50 48.75  ? 172  ILE A CG2 1 
ATOM   846  C CG2 B ILE A 1 126 ? 15.775  16.133  7.790   0.50 49.31  ? 172  ILE A CG2 1 
ATOM   847  C CD1 A ILE A 1 126 ? 16.600  18.171  5.418   0.50 46.59  ? 172  ILE A CD1 1 
ATOM   848  C CD1 B ILE A 1 126 ? 17.222  18.755  7.512   0.50 49.94  ? 172  ILE A CD1 1 
ATOM   849  N N   . PHE A 1 127 ? 18.256  13.505  7.977   1.00 46.89  ? 173  PHE A N   1 
ATOM   850  C CA  . PHE A 1 127 ? 18.114  12.143  8.506   1.00 46.62  ? 173  PHE A CA  1 
ATOM   851  C C   . PHE A 1 127 ? 18.885  12.013  9.828   1.00 47.79  ? 173  PHE A C   1 
ATOM   852  O O   . PHE A 1 127 ? 18.318  11.624  10.861  1.00 47.72  ? 173  PHE A O   1 
ATOM   853  C CB  . PHE A 1 127 ? 18.619  11.139  7.453   1.00 45.73  ? 173  PHE A CB  1 
ATOM   854  C CG  . PHE A 1 127 ? 18.774  9.732   7.954   1.00 46.02  ? 173  PHE A CG  1 
ATOM   855  C CD1 . PHE A 1 127 ? 17.659  8.939   8.195   1.00 44.91  ? 173  PHE A CD1 1 
ATOM   856  C CD2 . PHE A 1 127 ? 20.041  9.186   8.163   1.00 46.16  ? 173  PHE A CD2 1 
ATOM   857  C CE1 . PHE A 1 127 ? 17.793  7.645   8.656   1.00 45.34  ? 173  PHE A CE1 1 
ATOM   858  C CE2 . PHE A 1 127 ? 20.184  7.894   8.615   1.00 46.21  ? 173  PHE A CE2 1 
ATOM   859  C CZ  . PHE A 1 127 ? 19.052  7.116   8.867   1.00 46.09  ? 173  PHE A CZ  1 
ATOM   860  N N   . LEU A 1 128 ? 20.161  12.389  9.807   1.00 48.35  ? 174  LEU A N   1 
ATOM   861  C CA  . LEU A 1 128 ? 21.022  12.235  10.987  1.00 50.22  ? 174  LEU A CA  1 
ATOM   862  C C   . LEU A 1 128 ? 20.625  13.165  12.130  1.00 52.43  ? 174  LEU A C   1 
ATOM   863  O O   . LEU A 1 128 ? 20.689  12.783  13.303  1.00 53.61  ? 174  LEU A O   1 
ATOM   864  C CB  . LEU A 1 128 ? 22.483  12.477  10.620  1.00 49.99  ? 174  LEU A CB  1 
ATOM   865  C CG  . LEU A 1 128 ? 23.117  11.414  9.739   1.00 49.97  ? 174  LEU A CG  1 
ATOM   866  C CD1 . LEU A 1 128 ? 24.457  11.922  9.250   1.00 52.20  ? 174  LEU A CD1 1 
ATOM   867  C CD2 . LEU A 1 128 ? 23.266  10.103  10.517  1.00 52.45  ? 174  LEU A CD2 1 
ATOM   868  N N   . GLN A 1 129 ? 20.224  14.386  11.787  1.00 53.78  ? 175  GLN A N   1 
ATOM   869  C CA  . GLN A 1 129 ? 19.723  15.326  12.786  1.00 56.65  ? 175  GLN A CA  1 
ATOM   870  C C   . GLN A 1 129 ? 18.507  14.754  13.518  1.00 56.95  ? 175  GLN A C   1 
ATOM   871  O O   . GLN A 1 129 ? 18.433  14.827  14.746  1.00 57.21  ? 175  GLN A O   1 
ATOM   872  C CB  . GLN A 1 129 ? 19.387  16.687  12.156  1.00 58.09  ? 175  GLN A CB  1 
ATOM   873  C CG  . GLN A 1 129 ? 20.602  17.609  12.030  1.00 62.22  ? 175  GLN A CG  1 
ATOM   874  C CD  . GLN A 1 129 ? 20.337  18.892  11.242  1.00 65.00  ? 175  GLN A CD  1 
ATOM   875  O OE1 . GLN A 1 129 ? 21.210  19.761  11.156  1.00 68.19  ? 175  GLN A OE1 1 
ATOM   876  N NE2 . GLN A 1 129 ? 19.143  19.015  10.663  1.00 66.17  ? 175  GLN A NE2 1 
ATOM   877  N N   . LYS A 1 130 ? 17.578  14.163  12.769  1.00 55.87  ? 176  LYS A N   1 
ATOM   878  C CA  . LYS A 1 130 ? 16.352  13.619  13.355  1.00 57.13  ? 176  LYS A CA  1 
ATOM   879  C C   . LYS A 1 130 ? 16.627  12.315  14.112  1.00 57.62  ? 176  LYS A C   1 
ATOM   880  O O   . LYS A 1 130 ? 16.067  12.088  15.187  1.00 58.47  ? 176  LYS A O   1 
ATOM   881  C CB  . LYS A 1 130 ? 15.279  13.395  12.283  1.00 56.31  ? 176  LYS A CB  1 
ATOM   882  C CG  . LYS A 1 130 ? 14.861  14.658  11.528  1.00 57.44  ? 176  LYS A CG  1 
ATOM   883  C CD  . LYS A 1 130 ? 14.102  15.651  12.386  1.00 60.40  ? 176  LYS A CD  1 
ATOM   884  C CE  . LYS A 1 130 ? 13.712  16.876  11.573  1.00 61.63  ? 176  LYS A CE  1 
ATOM   885  N NZ  . LYS A 1 130 ? 12.944  17.848  12.387  1.00 64.38  ? 176  LYS A NZ  1 
ATOM   886  N N   . VAL A 1 131 ? 17.503  11.478  13.562  1.00 55.65  ? 177  VAL A N   1 
ATOM   887  C CA  . VAL A 1 131 ? 17.852  10.204  14.189  1.00 55.65  ? 177  VAL A CA  1 
ATOM   888  C C   . VAL A 1 131 ? 18.535  10.394  15.548  1.00 57.00  ? 177  VAL A C   1 
ATOM   889  O O   . VAL A 1 131 ? 18.414  9.537   16.428  1.00 58.21  ? 177  VAL A O   1 
ATOM   890  C CB  . VAL A 1 131 ? 18.724  9.332   13.250  1.00 54.36  ? 177  VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 131 ? 19.490  8.281   14.032  1.00 55.76  ? 177  VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 131 ? 17.855  8.673   12.182  1.00 52.90  ? 177  VAL A CG2 1 
ATOM   893  N N   . ALA A 1 132 ? 19.217  11.524  15.731  1.00 57.21  ? 178  ALA A N   1 
ATOM   894  C CA  . ALA A 1 132 ? 19.843  11.857  17.018  1.00 59.24  ? 178  ALA A CA  1 
ATOM   895  C C   . ALA A 1 132 ? 18.841  12.024  18.174  1.00 62.19  ? 178  ALA A C   1 
ATOM   896  O O   . ALA A 1 132 ? 19.228  11.907  19.341  1.00 64.26  ? 178  ALA A O   1 
ATOM   897  C CB  . ALA A 1 132 ? 20.689  13.111  16.881  1.00 58.77  ? 178  ALA A CB  1 
ATOM   898  N N   . SER A 1 133 ? 17.577  12.313  17.849  1.00 62.67  ? 179  SER A N   1 
ATOM   899  C CA  . SER A 1 133 ? 16.510  12.492  18.849  1.00 65.22  ? 179  SER A CA  1 
ATOM   900  C C   . SER A 1 133 ? 15.477  11.359  18.824  1.00 65.95  ? 179  SER A C   1 
ATOM   901  O O   . SER A 1 133 ? 14.380  11.506  19.365  1.00 66.93  ? 179  SER A O   1 
ATOM   902  C CB  . SER A 1 133 ? 15.794  13.830  18.625  1.00 65.31  ? 179  SER A CB  1 
ATOM   903  O OG  . SER A 1 133 ? 16.716  14.901  18.616  1.00 65.82  ? 179  SER A OG  1 
ATOM   904  N N   . MET A 1 134 ? 15.832  10.236  18.201  1.00 65.66  ? 180  MET A N   1 
ATOM   905  C CA  . MET A 1 134 ? 14.973  9.052   18.164  1.00 67.37  ? 180  MET A CA  1 
ATOM   906  C C   . MET A 1 134 ? 14.909  8.426   19.559  1.00 70.55  ? 180  MET A C   1 
ATOM   907  O O   . MET A 1 134 ? 15.902  8.455   20.288  1.00 69.37  ? 180  MET A O   1 
ATOM   908  C CB  . MET A 1 134 ? 15.537  8.033   17.165  1.00 66.22  ? 180  MET A CB  1 
ATOM   909  C CG  . MET A 1 134 ? 14.671  6.798   16.941  1.00 67.27  ? 180  MET A CG  1 
ATOM   910  S SD  . MET A 1 134 ? 15.339  5.703   15.673  1.00 66.62  ? 180  MET A SD  1 
ATOM   911  C CE  . MET A 1 134 ? 16.908  5.260   16.416  1.00 66.13  ? 180  MET A CE  1 
ATOM   912  N N   . PRO A 1 135 ? 13.740  7.869   19.946  1.00 74.29  ? 181  PRO A N   1 
ATOM   913  C CA  . PRO A 1 135 ? 13.696  7.168   21.235  1.00 78.43  ? 181  PRO A CA  1 
ATOM   914  C C   . PRO A 1 135 ? 14.707  6.015   21.284  1.00 79.98  ? 181  PRO A C   1 
ATOM   915  O O   . PRO A 1 135 ? 15.059  5.459   20.247  1.00 77.77  ? 181  PRO A O   1 
ATOM   916  C CB  . PRO A 1 135 ? 12.246  6.666   21.330  1.00 79.73  ? 181  PRO A CB  1 
ATOM   917  C CG  . PRO A 1 135 ? 11.661  6.836   19.968  1.00 77.56  ? 181  PRO A CG  1 
ATOM   918  C CD  . PRO A 1 135 ? 12.412  7.941   19.314  1.00 74.49  ? 181  PRO A CD  1 
ATOM   919  N N   . GLN A 1 136 ? 15.161  5.669   22.486  1.00 84.41  ? 182  GLN A N   1 
ATOM   920  C CA  . GLN A 1 136 ? 16.378  4.869   22.657  1.00 86.58  ? 182  GLN A CA  1 
ATOM   921  C C   . GLN A 1 136 ? 16.160  3.355   22.742  1.00 89.79  ? 182  GLN A C   1 
ATOM   922  O O   . GLN A 1 136 ? 16.925  2.585   22.154  1.00 89.33  ? 182  GLN A O   1 
ATOM   923  C CB  . GLN A 1 136 ? 17.172  5.369   23.876  1.00 88.23  ? 182  GLN A CB  1 
ATOM   924  C CG  . GLN A 1 136 ? 16.509  5.149   25.235  1.00 91.54  ? 182  GLN A CG  1 
ATOM   925  C CD  . GLN A 1 136 ? 16.895  6.206   26.260  1.00 93.03  ? 182  GLN A CD  1 
ATOM   926  O OE1 . GLN A 1 136 ? 16.572  7.387   26.106  1.00 92.16  ? 182  GLN A OE1 1 
ATOM   927  N NE2 . GLN A 1 136 ? 17.577  5.783   27.319  1.00 95.28  ? 182  GLN A NE2 1 
ATOM   928  N N   . GLU A 1 137 ? 15.130  2.932   23.469  1.00 94.24  ? 183  GLU A N   1 
ATOM   929  C CA  . GLU A 1 137 ? 14.896  1.506   23.716  1.00 97.51  ? 183  GLU A CA  1 
ATOM   930  C C   . GLU A 1 137 ? 13.748  0.982   22.868  1.00 98.28  ? 183  GLU A C   1 
ATOM   931  O O   . GLU A 1 137 ? 12.606  1.430   23.013  1.00 99.45  ? 183  GLU A O   1 
ATOM   932  C CB  . GLU A 1 137 ? 14.604  1.255   25.196  1.00 100.86 ? 183  GLU A CB  1 
ATOM   933  C CG  . GLU A 1 137 ? 15.816  1.432   26.094  1.00 102.83 ? 183  GLU A CG  1 
ATOM   934  C CD  . GLU A 1 137 ? 15.532  1.068   27.538  1.00 106.95 ? 183  GLU A CD  1 
ATOM   935  O OE1 . GLU A 1 137 ? 15.224  -0.113  27.805  1.00 109.50 ? 183  GLU A OE1 1 
ATOM   936  O OE2 . GLU A 1 137 ? 15.625  1.961   28.407  1.00 108.56 ? 183  GLU A OE2 1 
ATOM   937  N N   . GLU A 1 138 ? 14.055  0.021   21.998  1.00 97.97  ? 184  GLU A N   1 
ATOM   938  C CA  . GLU A 1 138 ? 13.064  -0.536  21.082  1.00 98.38  ? 184  GLU A CA  1 
ATOM   939  C C   . GLU A 1 138 ? 11.988  -1.347  21.810  1.00 102.05 ? 184  GLU A C   1 
ATOM   940  O O   . GLU A 1 138 ? 12.105  -2.565  21.963  1.00 103.93 ? 184  GLU A O   1 
ATOM   941  C CB  . GLU A 1 138 ? 13.748  -1.386  20.005  1.00 96.65  ? 184  GLU A CB  1 
ATOM   942  C CG  . GLU A 1 138 ? 12.815  -1.786  18.865  1.00 95.58  ? 184  GLU A CG  1 
ATOM   943  C CD  . GLU A 1 138 ? 13.342  -1.366  17.506  1.00 92.07  ? 184  GLU A CD  1 
ATOM   944  O OE1 . GLU A 1 138 ? 14.467  -1.772  17.146  1.00 90.83  ? 184  GLU A OE1 1 
ATOM   945  O OE2 . GLU A 1 138 ? 12.630  -0.621  16.798  1.00 88.73  ? 184  GLU A OE2 1 
ATOM   946  N N   . GLN A 1 139 ? 10.945  -0.653  22.262  1.00 103.78 ? 185  GLN A N   1 
ATOM   947  C CA  . GLN A 1 139 ? 9.767   -1.296  22.840  1.00 106.79 ? 185  GLN A CA  1 
ATOM   948  C C   . GLN A 1 139 ? 8.844   -1.732  21.704  1.00 106.58 ? 185  GLN A C   1 
ATOM   949  O O   . GLN A 1 139 ? 8.525   -0.929  20.827  1.00 104.92 ? 185  GLN A O   1 
ATOM   950  C CB  . GLN A 1 139 ? 9.035   -0.331  23.775  1.00 108.36 ? 185  GLN A CB  1 
ATOM   951  N N   . GLU A 1 140 ? 8.420   -2.996  21.724  1.00 108.65 ? 186  GLU A N   1 
ATOM   952  C CA  . GLU A 1 140 ? 7.618   -3.577  20.639  1.00 108.61 ? 186  GLU A CA  1 
ATOM   953  C C   . GLU A 1 140 ? 6.253   -2.902  20.491  1.00 109.49 ? 186  GLU A C   1 
ATOM   954  O O   . GLU A 1 140 ? 5.741   -2.286  21.425  1.00 111.08 ? 186  GLU A O   1 
ATOM   955  C CB  . GLU A 1 140 ? 7.430   -5.083  20.867  1.00 111.09 ? 186  GLU A CB  1 
ATOM   956  C CG  . GLU A 1 140 ? 6.817   -5.834  19.684  1.00 111.23 ? 186  GLU A CG  1 
ATOM   957  C CD  . GLU A 1 140 ? 6.599   -7.315  19.964  1.00 114.17 ? 186  GLU A CD  1 
ATOM   958  O OE1 . GLU A 1 140 ? 7.017   -7.803  21.037  1.00 116.31 ? 186  GLU A OE1 1 
ATOM   959  O OE2 . GLU A 1 140 ? 6.001   -7.995  19.104  1.00 114.90 ? 186  GLU A OE2 1 
ATOM   960  N N   . GLY B 1 27  ? 32.278  24.568  23.220  1.00 90.84  ? 73   GLY B N   1 
ATOM   961  C CA  . GLY B 1 27  ? 31.368  23.389  23.328  1.00 89.37  ? 73   GLY B CA  1 
ATOM   962  C C   . GLY B 1 27  ? 31.200  22.875  24.745  1.00 90.46  ? 73   GLY B C   1 
ATOM   963  O O   . GLY B 1 27  ? 31.704  23.473  25.695  1.00 93.05  ? 73   GLY B O   1 
ATOM   964  N N   . ARG B 1 28  ? 30.492  21.754  24.877  1.00 89.01  ? 74   ARG B N   1 
ATOM   965  C CA  . ARG B 1 28  ? 30.106  21.214  26.183  1.00 89.92  ? 74   ARG B CA  1 
ATOM   966  C C   . ARG B 1 28  ? 30.090  19.680  26.196  1.00 87.49  ? 74   ARG B C   1 
ATOM   967  O O   . ARG B 1 28  ? 30.397  19.035  25.188  1.00 85.26  ? 74   ARG B O   1 
ATOM   968  C CB  . ARG B 1 28  ? 28.725  21.757  26.570  1.00 91.62  ? 74   ARG B CB  1 
ATOM   969  C CG  . ARG B 1 28  ? 27.582  21.191  25.731  1.00 90.60  ? 74   ARG B CG  1 
ATOM   970  C CD  . ARG B 1 28  ? 26.361  22.102  25.718  1.00 92.80  ? 74   ARG B CD  1 
ATOM   971  N NE  . ARG B 1 28  ? 25.412  21.689  24.679  1.00 91.94  ? 74   ARG B NE  1 
ATOM   972  C CZ  . ARG B 1 28  ? 24.259  21.048  24.883  1.00 92.60  ? 74   ARG B CZ  1 
ATOM   973  N NH1 . ARG B 1 28  ? 23.849  20.719  26.108  1.00 94.86  ? 74   ARG B NH1 1 
ATOM   974  N NH2 . ARG B 1 28  ? 23.500  20.732  23.836  1.00 90.61  ? 74   ARG B NH2 1 
ATOM   975  N N   . VAL B 1 29  ? 29.731  19.113  27.348  1.00 87.67  ? 75   VAL B N   1 
ATOM   976  C CA  . VAL B 1 29  ? 29.597  17.666  27.522  1.00 85.81  ? 75   VAL B CA  1 
ATOM   977  C C   . VAL B 1 29  ? 28.121  17.274  27.647  1.00 84.52  ? 75   VAL B C   1 
ATOM   978  O O   . VAL B 1 29  ? 27.370  17.905  28.394  1.00 86.56  ? 75   VAL B O   1 
ATOM   979  C CB  . VAL B 1 29  ? 30.328  17.190  28.801  1.00 87.80  ? 75   VAL B CB  1 
ATOM   980  C CG1 . VAL B 1 29  ? 30.236  15.674  28.940  1.00 87.31  ? 75   VAL B CG1 1 
ATOM   981  C CG2 . VAL B 1 29  ? 31.783  17.648  28.796  1.00 88.46  ? 75   VAL B CG2 1 
ATOM   982  N N   . THR B 1 30  ? 27.715  16.231  26.920  1.00 80.71  ? 76   THR B N   1 
ATOM   983  C CA  . THR B 1 30  ? 26.366  15.664  27.038  1.00 79.27  ? 76   THR B CA  1 
ATOM   984  C C   . THR B 1 30  ? 26.425  14.139  27.177  1.00 77.45  ? 76   THR B C   1 
ATOM   985  O O   . THR B 1 30  ? 27.449  13.517  26.877  1.00 75.77  ? 76   THR B O   1 
ATOM   986  C CB  . THR B 1 30  ? 25.478  16.023  25.821  1.00 77.74  ? 76   THR B CB  1 
ATOM   987  O OG1 . THR B 1 30  ? 25.985  15.382  24.644  1.00 74.64  ? 76   THR B OG1 1 
ATOM   988  C CG2 . THR B 1 30  ? 25.433  17.533  25.598  1.00 77.94  ? 76   THR B CG2 1 
ATOM   989  N N   . ASN B 1 31  ? 25.322  13.551  27.638  1.00 77.07  ? 77   ASN B N   1 
ATOM   990  C CA  . ASN B 1 31  ? 25.183  12.093  27.727  1.00 75.93  ? 77   ASN B CA  1 
ATOM   991  C C   . ASN B 1 31  ? 25.327  11.402  26.365  1.00 72.41  ? 77   ASN B C   1 
ATOM   992  O O   . ASN B 1 31  ? 25.911  10.318  26.265  1.00 71.42  ? 77   ASN B O   1 
ATOM   993  C CB  . ASN B 1 31  ? 23.835  11.711  28.358  1.00 77.93  ? 77   ASN B CB  1 
ATOM   994  C CG  . ASN B 1 31  ? 22.634  12.180  27.534  1.00 77.77  ? 77   ASN B CG  1 
ATOM   995  O OD1 . ASN B 1 31  ? 22.680  13.226  26.877  1.00 78.34  ? 77   ASN B OD1 1 
ATOM   996  N ND2 . ASN B 1 31  ? 21.557  11.403  27.566  1.00 77.86  ? 77   ASN B ND2 1 
ATOM   997  N N   . GLN B 1 32  ? 24.785  12.039  25.330  1.00 70.19  ? 78   GLN B N   1 
ATOM   998  C CA  . GLN B 1 32  ? 24.859  11.523  23.965  1.00 67.43  ? 78   GLN B CA  1 
ATOM   999  C C   . GLN B 1 32  ? 26.294  11.551  23.428  1.00 64.98  ? 78   GLN B C   1 
ATOM   1000 O O   . GLN B 1 32  ? 26.751  10.583  22.819  1.00 63.25  ? 78   GLN B O   1 
ATOM   1001 C CB  . GLN B 1 32  ? 23.939  12.329  23.041  1.00 67.29  ? 78   GLN B CB  1 
ATOM   1002 C CG  . GLN B 1 32  ? 22.449  12.125  23.298  1.00 70.12  ? 78   GLN B CG  1 
ATOM   1003 C CD  . GLN B 1 32  ? 21.572  12.875  22.306  1.00 71.15  ? 78   GLN B CD  1 
ATOM   1004 O OE1 . GLN B 1 32  ? 21.905  13.979  21.875  1.00 72.95  ? 78   GLN B OE1 1 
ATOM   1005 N NE2 . GLN B 1 32  ? 20.440  12.278  21.945  1.00 71.23  ? 78   GLN B NE2 1 
ATOM   1006 N N   . LEU B 1 33  ? 26.993  12.664  23.650  1.00 64.43  ? 79   LEU B N   1 
ATOM   1007 C CA  . LEU B 1 33  ? 28.385  12.806  23.208  1.00 63.04  ? 79   LEU B CA  1 
ATOM   1008 C C   . LEU B 1 33  ? 29.321  11.817  23.909  1.00 63.68  ? 79   LEU B C   1 
ATOM   1009 O O   . LEU B 1 33  ? 30.232  11.277  23.274  1.00 62.17  ? 79   LEU B O   1 
ATOM   1010 C CB  . LEU B 1 33  ? 28.872  14.254  23.381  1.00 63.43  ? 79   LEU B CB  1 
ATOM   1011 C CG  . LEU B 1 33  ? 28.293  15.235  22.349  1.00 61.95  ? 79   LEU B CG  1 
ATOM   1012 C CD1 . LEU B 1 33  ? 28.461  16.690  22.788  1.00 62.47  ? 79   LEU B CD1 1 
ATOM   1013 C CD2 . LEU B 1 33  ? 28.926  15.012  20.976  1.00 59.87  ? 79   LEU B CD2 1 
ATOM   1014 N N   . GLN B 1 34  ? 29.083  11.560  25.197  1.00 65.81  ? 80   GLN B N   1 
ATOM   1015 C CA  . GLN B 1 34  ? 29.826  10.522  25.929  1.00 67.06  ? 80   GLN B CA  1 
ATOM   1016 C C   . GLN B 1 34  ? 29.581  9.132   25.338  1.00 65.18  ? 80   GLN B C   1 
ATOM   1017 O O   . GLN B 1 34  ? 30.507  8.333   25.216  1.00 64.17  ? 80   GLN B O   1 
ATOM   1018 C CB  . GLN B 1 34  ? 29.461  10.514  27.422  1.00 70.47  ? 80   GLN B CB  1 
ATOM   1019 C CG  . GLN B 1 34  ? 30.249  11.512  28.261  1.00 74.49  ? 80   GLN B CG  1 
ATOM   1020 C CD  . GLN B 1 34  ? 29.950  11.410  29.751  1.00 79.32  ? 80   GLN B CD  1 
ATOM   1021 O OE1 . GLN B 1 34  ? 29.719  10.320  30.286  1.00 82.33  ? 80   GLN B OE1 1 
ATOM   1022 N NE2 . GLN B 1 34  ? 29.963  12.550  30.429  1.00 82.44  ? 80   GLN B NE2 1 
ATOM   1023 N N   . TYR B 1 35  ? 28.328  8.854   24.986  1.00 64.78  ? 81   TYR B N   1 
ATOM   1024 C CA  . TYR B 1 35  ? 27.956  7.604   24.323  1.00 63.12  ? 81   TYR B CA  1 
ATOM   1025 C C   . TYR B 1 35  ? 28.656  7.481   22.961  1.00 60.68  ? 81   TYR B C   1 
ATOM   1026 O O   . TYR B 1 35  ? 29.216  6.434   22.640  1.00 59.71  ? 81   TYR B O   1 
ATOM   1027 C CB  . TYR B 1 35  ? 26.432  7.521   24.166  1.00 63.28  ? 81   TYR B CB  1 
ATOM   1028 C CG  . TYR B 1 35  ? 25.932  6.263   23.486  1.00 63.39  ? 81   TYR B CG  1 
ATOM   1029 C CD1 . TYR B 1 35  ? 25.855  6.184   22.092  1.00 61.64  ? 81   TYR B CD1 1 
ATOM   1030 C CD2 . TYR B 1 35  ? 25.526  5.158   24.228  1.00 65.28  ? 81   TYR B CD2 1 
ATOM   1031 C CE1 . TYR B 1 35  ? 25.396  5.041   21.462  1.00 60.14  ? 81   TYR B CE1 1 
ATOM   1032 C CE2 . TYR B 1 35  ? 25.066  3.999   23.597  1.00 64.92  ? 81   TYR B CE2 1 
ATOM   1033 C CZ  . TYR B 1 35  ? 25.002  3.953   22.215  1.00 61.99  ? 81   TYR B CZ  1 
ATOM   1034 O OH  . TYR B 1 35  ? 24.549  2.819   21.580  1.00 61.34  ? 81   TYR B OH  1 
ATOM   1035 N N   . LEU B 1 36  ? 28.641  8.549   22.170  1.00 59.40  ? 82   LEU B N   1 
ATOM   1036 C CA  . LEU B 1 36  ? 29.354  8.546   20.885  1.00 58.35  ? 82   LEU B CA  1 
ATOM   1037 C C   . LEU B 1 36  ? 30.857  8.286   21.066  1.00 58.19  ? 82   LEU B C   1 
ATOM   1038 O O   . LEU B 1 36  ? 31.484  7.618   20.239  1.00 56.19  ? 82   LEU B O   1 
ATOM   1039 C CB  . LEU B 1 36  ? 29.135  9.861   20.127  1.00 58.01  ? 82   LEU B CB  1 
ATOM   1040 C CG  . LEU B 1 36  ? 27.754  10.078  19.498  1.00 59.30  ? 82   LEU B CG  1 
ATOM   1041 C CD1 . LEU B 1 36  ? 27.601  11.511  19.017  1.00 58.99  ? 82   LEU B CD1 1 
ATOM   1042 C CD2 . LEU B 1 36  ? 27.516  9.109   18.349  1.00 59.50  ? 82   LEU B CD2 1 
ATOM   1043 N N   . HIS B 1 37  ? 31.422  8.806   22.152  1.00 59.72  ? 83   HIS B N   1 
ATOM   1044 C CA  . HIS B 1 37  ? 32.848  8.652   22.432  1.00 61.22  ? 83   HIS B CA  1 
ATOM   1045 C C   . HIS B 1 37  ? 33.171  7.252   22.956  1.00 62.37  ? 83   HIS B C   1 
ATOM   1046 O O   . HIS B 1 37  ? 33.992  6.547   22.379  1.00 61.43  ? 83   HIS B O   1 
ATOM   1047 C CB  . HIS B 1 37  ? 33.306  9.718   23.442  1.00 63.01  ? 83   HIS B CB  1 
ATOM   1048 C CG  . HIS B 1 37  ? 34.793  9.814   23.596  1.00 64.74  ? 83   HIS B CG  1 
ATOM   1049 N ND1 . HIS B 1 37  ? 35.388  10.446  24.665  1.00 70.59  ? 83   HIS B ND1 1 
ATOM   1050 C CD2 . HIS B 1 37  ? 35.804  9.359   22.820  1.00 65.70  ? 83   HIS B CD2 1 
ATOM   1051 C CE1 . HIS B 1 37  ? 36.702  10.377  24.540  1.00 70.31  ? 83   HIS B CE1 1 
ATOM   1052 N NE2 . HIS B 1 37  ? 36.979  9.719   23.431  1.00 67.32  ? 83   HIS B NE2 1 
ATOM   1053 N N   . LYS B 1 38  ? 32.503  6.852   24.034  1.00 64.44  ? 84   LYS B N   1 
ATOM   1054 C CA  . LYS B 1 38  ? 32.876  5.644   24.773  1.00 66.84  ? 84   LYS B CA  1 
ATOM   1055 C C   . LYS B 1 38  ? 32.275  4.352   24.210  1.00 65.81  ? 84   LYS B C   1 
ATOM   1056 O O   . LYS B 1 38  ? 32.865  3.284   24.372  1.00 67.26  ? 84   LYS B O   1 
ATOM   1057 C CB  . LYS B 1 38  ? 32.491  5.792   26.247  1.00 69.84  ? 84   LYS B CB  1 
ATOM   1058 C CG  . LYS B 1 38  ? 33.072  7.032   26.939  1.00 73.70  ? 84   LYS B CG  1 
ATOM   1059 C CD  . LYS B 1 38  ? 34.600  7.014   27.009  1.00 76.05  ? 84   LYS B CD  1 
ATOM   1060 C CE  . LYS B 1 38  ? 35.119  8.217   27.792  1.00 79.09  ? 84   LYS B CE  1 
ATOM   1061 N NZ  . LYS B 1 38  ? 36.579  8.124   28.082  1.00 81.12  ? 84   LYS B NZ  1 
ATOM   1062 N N   . VAL B 1 39  ? 31.113  4.444   23.565  1.00 64.25  ? 85   VAL B N   1 
ATOM   1063 C CA  . VAL B 1 39  ? 30.438  3.271   23.004  1.00 64.21  ? 85   VAL B CA  1 
ATOM   1064 C C   . VAL B 1 39  ? 30.632  3.159   21.487  1.00 62.61  ? 85   VAL B C   1 
ATOM   1065 O O   . VAL B 1 39  ? 31.169  2.159   21.002  1.00 63.23  ? 85   VAL B O   1 
ATOM   1066 C CB  . VAL B 1 39  ? 28.927  3.273   23.340  1.00 65.06  ? 85   VAL B CB  1 
ATOM   1067 C CG1 . VAL B 1 39  ? 28.211  2.124   22.636  1.00 65.22  ? 85   VAL B CG1 1 
ATOM   1068 C CG2 . VAL B 1 39  ? 28.718  3.183   24.853  1.00 67.29  ? 85   VAL B CG2 1 
ATOM   1069 N N   . VAL B 1 40  ? 30.208  4.181   20.745  1.00 61.33  ? 86   VAL B N   1 
ATOM   1070 C CA  . VAL B 1 40  ? 30.215  4.123   19.275  1.00 59.50  ? 86   VAL B CA  1 
ATOM   1071 C C   . VAL B 1 40  ? 31.634  4.179   18.709  1.00 58.60  ? 86   VAL B C   1 
ATOM   1072 O O   . VAL B 1 40  ? 32.059  3.267   18.003  1.00 57.54  ? 86   VAL B O   1 
ATOM   1073 C CB  . VAL B 1 40  ? 29.354  5.247   18.642  1.00 58.68  ? 86   VAL B CB  1 
ATOM   1074 C CG1 . VAL B 1 40  ? 29.429  5.196   17.116  1.00 56.59  ? 86   VAL B CG1 1 
ATOM   1075 C CG2 . VAL B 1 40  ? 27.899  5.134   19.104  1.00 58.98  ? 86   VAL B CG2 1 
ATOM   1076 N N   . MET B 1 41  ? 32.370  5.241   19.027  1.00 58.86  ? 87   MET B N   1 
ATOM   1077 C CA  . MET B 1 41  ? 33.714  5.426   18.470  1.00 58.65  ? 87   MET B CA  1 
ATOM   1078 C C   . MET B 1 41  ? 34.685  4.310   18.886  1.00 59.66  ? 87   MET B C   1 
ATOM   1079 O O   . MET B 1 41  ? 35.497  3.864   18.078  1.00 58.79  ? 87   MET B O   1 
ATOM   1080 C CB  . MET B 1 41  ? 34.276  6.799   18.859  1.00 59.02  ? 87   MET B CB  1 
ATOM   1081 C CG  . MET B 1 41  ? 35.687  7.076   18.359  1.00 59.66  ? 87   MET B CG  1 
ATOM   1082 S SD  . MET B 1 41  ? 35.830  7.088   16.569  1.00 60.92  ? 87   MET B SD  1 
ATOM   1083 C CE  . MET B 1 41  ? 35.535  8.827   16.223  1.00 60.22  ? 87   MET B CE  1 
ATOM   1084 N N   . LYS B 1 42  ? 34.608  3.870   20.139  1.00 61.20  ? 88   LYS B N   1 
ATOM   1085 C CA  . LYS B 1 42  ? 35.522  2.837   20.635  1.00 63.39  ? 88   LYS B CA  1 
ATOM   1086 C C   . LYS B 1 42  ? 35.310  1.518   19.888  1.00 62.79  ? 88   LYS B C   1 
ATOM   1087 O O   . LYS B 1 42  ? 36.276  0.830   19.550  1.00 63.07  ? 88   LYS B O   1 
ATOM   1088 C CB  . LYS B 1 42  ? 35.362  2.636   22.147  1.00 65.77  ? 88   LYS B CB  1 
ATOM   1089 C CG  . LYS B 1 42  ? 36.535  1.904   22.789  1.00 69.36  ? 88   LYS B CG  1 
ATOM   1090 C CD  . LYS B 1 42  ? 36.314  1.648   24.278  1.00 73.54  ? 88   LYS B CD  1 
ATOM   1091 C CE  . LYS B 1 42  ? 36.336  2.933   25.090  1.00 75.44  ? 88   LYS B CE  1 
ATOM   1092 N NZ  . LYS B 1 42  ? 36.457  2.671   26.556  1.00 78.69  ? 88   LYS B NZ  1 
ATOM   1093 N N   . ALA B 1 43  ? 34.049  1.190   19.615  1.00 62.37  ? 89   ALA B N   1 
ATOM   1094 C CA  . ALA B 1 43  ? 33.694  -0.003  18.841  1.00 61.84  ? 89   ALA B CA  1 
ATOM   1095 C C   . ALA B 1 43  ? 34.186  0.088   17.391  1.00 59.85  ? 89   ALA B C   1 
ATOM   1096 O O   . ALA B 1 43  ? 34.786  -0.858  16.877  1.00 60.79  ? 89   ALA B O   1 
ATOM   1097 C CB  . ALA B 1 43  ? 32.182  -0.229  18.877  1.00 61.73  ? 89   ALA B CB  1 
ATOM   1098 N N   . LEU B 1 44  ? 33.942  1.221   16.739  1.00 57.03  ? 90   LEU B N   1 
ATOM   1099 C CA  . LEU B 1 44  ? 34.446  1.439   15.386  1.00 55.01  ? 90   LEU B CA  1 
ATOM   1100 C C   . LEU B 1 44  ? 35.978  1.438   15.327  1.00 54.22  ? 90   LEU B C   1 
ATOM   1101 O O   . LEU B 1 44  ? 36.562  0.831   14.438  1.00 53.48  ? 90   LEU B O   1 
ATOM   1102 C CB  . LEU B 1 44  ? 33.912  2.755   14.809  1.00 54.31  ? 90   LEU B CB  1 
ATOM   1103 C CG  . LEU B 1 44  ? 32.394  2.888   14.641  1.00 54.78  ? 90   LEU B CG  1 
ATOM   1104 C CD1 . LEU B 1 44  ? 32.051  4.255   14.069  1.00 54.25  ? 90   LEU B CD1 1 
ATOM   1105 C CD2 . LEU B 1 44  ? 31.828  1.796   13.770  1.00 55.30  ? 90   LEU B CD2 1 
ATOM   1106 N N   . TRP B 1 45  ? 36.617  2.113   16.282  1.00 54.27  ? 91   TRP B N   1 
ATOM   1107 C CA  . TRP B 1 45  ? 38.068  2.326   16.264  1.00 54.15  ? 91   TRP B CA  1 
ATOM   1108 C C   . TRP B 1 45  ? 38.870  1.023   16.243  1.00 54.72  ? 91   TRP B C   1 
ATOM   1109 O O   . TRP B 1 45  ? 39.857  0.915   15.512  1.00 54.10  ? 91   TRP B O   1 
ATOM   1110 C CB  . TRP B 1 45  ? 38.499  3.164   17.473  1.00 55.44  ? 91   TRP B CB  1 
ATOM   1111 C CG  . TRP B 1 45  ? 39.914  3.642   17.408  1.00 55.32  ? 91   TRP B CG  1 
ATOM   1112 C CD1 . TRP B 1 45  ? 41.032  2.930   17.723  1.00 56.91  ? 91   TRP B CD1 1 
ATOM   1113 C CD2 . TRP B 1 45  ? 40.365  4.946   17.023  1.00 55.16  ? 91   TRP B CD2 1 
ATOM   1114 N NE1 . TRP B 1 45  ? 42.147  3.700   17.546  1.00 57.20  ? 91   TRP B NE1 1 
ATOM   1115 C CE2 . TRP B 1 45  ? 41.769  4.945   17.121  1.00 55.57  ? 91   TRP B CE2 1 
ATOM   1116 C CE3 . TRP B 1 45  ? 39.720  6.113   16.605  1.00 53.25  ? 91   TRP B CE3 1 
ATOM   1117 C CZ2 . TRP B 1 45  ? 42.539  6.059   16.814  1.00 55.25  ? 91   TRP B CZ2 1 
ATOM   1118 C CZ3 . TRP B 1 45  ? 40.485  7.218   16.301  1.00 54.33  ? 91   TRP B CZ3 1 
ATOM   1119 C CH2 . TRP B 1 45  ? 41.878  7.186   16.410  1.00 56.04  ? 91   TRP B CH2 1 
ATOM   1120 N N   . LYS B 1 46  ? 38.435  0.050   17.044  1.00 55.26  ? 92   LYS B N   1 
ATOM   1121 C CA  . LYS B 1 46  ? 39.126  -1.238  17.184  1.00 56.99  ? 92   LYS B CA  1 
ATOM   1122 C C   . LYS B 1 46  ? 38.838  -2.230  16.068  1.00 54.95  ? 92   LYS B C   1 
ATOM   1123 O O   . LYS B 1 46  ? 39.492  -3.265  15.986  1.00 55.06  ? 92   LYS B O   1 
ATOM   1124 C CB  . LYS B 1 46  ? 38.761  -1.901  18.521  1.00 59.39  ? 92   LYS B CB  1 
ATOM   1125 C CG  . LYS B 1 46  ? 39.796  -1.724  19.607  1.00 64.60  ? 92   LYS B CG  1 
ATOM   1126 C CD  . LYS B 1 46  ? 40.029  -0.272  19.967  1.00 65.81  ? 92   LYS B CD  1 
ATOM   1127 C CE  . LYS B 1 46  ? 41.165  -0.143  20.965  1.00 68.31  ? 92   LYS B CE  1 
ATOM   1128 N NZ  . LYS B 1 46  ? 41.012  -1.106  22.091  1.00 73.06  ? 92   LYS B NZ  1 
ATOM   1129 N N   . HIS B 1 47  ? 37.852  -1.925  15.230  1.00 52.46  ? 93   HIS B N   1 
ATOM   1130 C CA  . HIS B 1 47  ? 37.448  -2.804  14.135  1.00 51.81  ? 93   HIS B CA  1 
ATOM   1131 C C   . HIS B 1 47  ? 38.612  -3.071  13.178  1.00 50.93  ? 93   HIS B C   1 
ATOM   1132 O O   . HIS B 1 47  ? 39.439  -2.189  12.935  1.00 50.02  ? 93   HIS B O   1 
ATOM   1133 C CB  . HIS B 1 47  ? 36.270  -2.183  13.364  1.00 49.77  ? 93   HIS B CB  1 
ATOM   1134 C CG  . HIS B 1 47  ? 35.526  -3.160  12.514  1.00 50.83  ? 93   HIS B CG  1 
ATOM   1135 N ND1 . HIS B 1 47  ? 34.357  -3.760  12.925  1.00 54.65  ? 93   HIS B ND1 1 
ATOM   1136 C CD2 . HIS B 1 47  ? 35.788  -3.656  11.284  1.00 48.86  ? 93   HIS B CD2 1 
ATOM   1137 C CE1 . HIS B 1 47  ? 33.937  -4.587  11.987  1.00 51.42  ? 93   HIS B CE1 1 
ATOM   1138 N NE2 . HIS B 1 47  ? 34.788  -4.543  10.980  1.00 50.25  ? 93   HIS B NE2 1 
ATOM   1139 N N   . GLN B 1 48  ? 38.657  -4.286  12.634  1.00 50.44  ? 94   GLN B N   1 
ATOM   1140 C CA  . GLN B 1 48  ? 39.715  -4.695  11.692  1.00 51.05  ? 94   GLN B CA  1 
ATOM   1141 C C   . GLN B 1 48  ? 39.762  -3.907  10.370  1.00 49.39  ? 94   GLN B C   1 
ATOM   1142 O O   . GLN B 1 48  ? 40.770  -3.943  9.674   1.00 49.96  ? 94   GLN B O   1 
ATOM   1143 C CB  . GLN B 1 48  ? 39.597  -6.198  11.376  1.00 52.27  ? 94   GLN B CB  1 
ATOM   1144 C CG  . GLN B 1 48  ? 38.320  -6.582  10.638  1.00 53.15  ? 94   GLN B CG  1 
ATOM   1145 C CD  . GLN B 1 48  ? 38.358  -7.980  10.039  1.00 57.69  ? 94   GLN B CD  1 
ATOM   1146 O OE1 . GLN B 1 48  ? 39.404  -8.458  9.597   1.00 58.90  ? 94   GLN B OE1 1 
ATOM   1147 N NE2 . GLN B 1 48  ? 37.206  -8.642  10.022  1.00 58.43  ? 94   GLN B NE2 1 
ATOM   1148 N N   . PHE B 1 49  ? 38.673  -3.226  10.022  1.00 47.49  ? 95   PHE B N   1 
ATOM   1149 C CA  . PHE B 1 49  ? 38.593  -2.403  8.813   1.00 47.38  ? 95   PHE B CA  1 
ATOM   1150 C C   . PHE B 1 49  ? 38.787  -0.914  9.118   1.00 47.50  ? 95   PHE B C   1 
ATOM   1151 O O   . PHE B 1 49  ? 38.725  -0.091  8.208   1.00 47.01  ? 95   PHE B O   1 
ATOM   1152 C CB  . PHE B 1 49  ? 37.240  -2.573  8.115   1.00 46.22  ? 95   PHE B CB  1 
ATOM   1153 C CG  . PHE B 1 49  ? 36.986  -3.953  7.545   1.00 48.60  ? 95   PHE B CG  1 
ATOM   1154 C CD1 . PHE B 1 49  ? 38.013  -4.884  7.364   1.00 50.06  ? 95   PHE B CD1 1 
ATOM   1155 C CD2 . PHE B 1 49  ? 35.703  -4.301  7.151   1.00 49.26  ? 95   PHE B CD2 1 
ATOM   1156 C CE1 . PHE B 1 49  ? 37.747  -6.134  6.831   1.00 52.49  ? 95   PHE B CE1 1 
ATOM   1157 C CE2 . PHE B 1 49  ? 35.432  -5.543  6.611   1.00 50.21  ? 95   PHE B CE2 1 
ATOM   1158 C CZ  . PHE B 1 49  ? 36.455  -6.464  6.452   1.00 53.07  ? 95   PHE B CZ  1 
ATOM   1159 N N   . ALA B 1 50  ? 39.026  -0.575  10.385  1.00 48.14  ? 96   ALA B N   1 
ATOM   1160 C CA  . ALA B 1 50  ? 39.101  0.829   10.820  1.00 47.83  ? 96   ALA B CA  1 
ATOM   1161 C C   . ALA B 1 50  ? 40.418  1.525   10.481  1.00 48.11  ? 96   ALA B C   1 
ATOM   1162 O O   . ALA B 1 50  ? 40.452  2.751   10.391  1.00 48.67  ? 96   ALA B O   1 
ATOM   1163 C CB  . ALA B 1 50  ? 38.833  0.929   12.335  1.00 48.09  ? 96   ALA B CB  1 
ATOM   1164 N N   . TRP B 1 51  ? 41.497  0.765   10.290  1.00 49.80  ? 97   TRP B N   1 
ATOM   1165 C CA  . TRP B 1 51  ? 42.840  1.354   10.134  1.00 51.11  ? 97   TRP B CA  1 
ATOM   1166 C C   . TRP B 1 51  ? 42.981  2.475   9.068   1.00 51.76  ? 97   TRP B C   1 
ATOM   1167 O O   . TRP B 1 51  ? 43.717  3.442   9.299   1.00 52.90  ? 97   TRP B O   1 
ATOM   1168 C CB  . TRP B 1 51  ? 43.930  0.273   9.966   1.00 52.65  ? 97   TRP B CB  1 
ATOM   1169 C CG  . TRP B 1 51  ? 43.821  -0.558  8.732   1.00 53.75  ? 97   TRP B CG  1 
ATOM   1170 C CD1 . TRP B 1 51  ? 43.136  -1.731  8.586   1.00 54.46  ? 97   TRP B CD1 1 
ATOM   1171 C CD2 . TRP B 1 51  ? 44.404  -0.270  7.458   1.00 54.32  ? 97   TRP B CD2 1 
ATOM   1172 N NE1 . TRP B 1 51  ? 43.256  -2.190  7.298   1.00 54.99  ? 97   TRP B NE1 1 
ATOM   1173 C CE2 . TRP B 1 51  ? 44.031  -1.313  6.584   1.00 54.20  ? 97   TRP B CE2 1 
ATOM   1174 C CE3 . TRP B 1 51  ? 45.199  0.776   6.967   1.00 55.96  ? 97   TRP B CE3 1 
ATOM   1175 C CZ2 . TRP B 1 51  ? 44.427  -1.343  5.245   1.00 54.79  ? 97   TRP B CZ2 1 
ATOM   1176 C CZ3 . TRP B 1 51  ? 45.598  0.742   5.634   1.00 56.52  ? 97   TRP B CZ3 1 
ATOM   1177 C CH2 . TRP B 1 51  ? 45.211  -0.314  4.791   1.00 55.92  ? 97   TRP B CH2 1 
ATOM   1178 N N   . PRO B 1 52  ? 42.255  2.388   7.929   1.00 50.80  ? 98   PRO B N   1 
ATOM   1179 C CA  . PRO B 1 52  ? 42.375  3.510   6.979   1.00 50.24  ? 98   PRO B CA  1 
ATOM   1180 C C   . PRO B 1 52  ? 41.698  4.815   7.433   1.00 48.48  ? 98   PRO B C   1 
ATOM   1181 O O   . PRO B 1 52  ? 41.942  5.864   6.827   1.00 47.50  ? 98   PRO B O   1 
ATOM   1182 C CB  . PRO B 1 52  ? 41.678  2.981   5.710   1.00 49.40  ? 98   PRO B CB  1 
ATOM   1183 C CG  . PRO B 1 52  ? 41.504  1.507   5.923   1.00 50.38  ? 98   PRO B CG  1 
ATOM   1184 C CD  . PRO B 1 52  ? 41.350  1.353   7.408   1.00 49.85  ? 98   PRO B CD  1 
ATOM   1185 N N   . PHE B 1 53  ? 40.871  4.738   8.481   1.00 47.95  ? 99   PHE B N   1 
ATOM   1186 C CA  . PHE B 1 53  ? 40.009  5.843   8.923   1.00 46.97  ? 99   PHE B CA  1 
ATOM   1187 C C   . PHE B 1 53  ? 40.403  6.469   10.267  1.00 47.63  ? 99   PHE B C   1 
ATOM   1188 O O   . PHE B 1 53  ? 39.720  7.373   10.753  1.00 46.75  ? 99   PHE B O   1 
ATOM   1189 C CB  . PHE B 1 53  ? 38.561  5.335   9.005   1.00 47.07  ? 99   PHE B CB  1 
ATOM   1190 C CG  . PHE B 1 53  ? 38.049  4.779   7.706   1.00 47.02  ? 99   PHE B CG  1 
ATOM   1191 C CD1 . PHE B 1 53  ? 37.604  5.626   6.704   1.00 47.63  ? 99   PHE B CD1 1 
ATOM   1192 C CD2 . PHE B 1 53  ? 38.050  3.406   7.470   1.00 47.38  ? 99   PHE B CD2 1 
ATOM   1193 C CE1 . PHE B 1 53  ? 37.150  5.117   5.491   1.00 47.66  ? 99   PHE B CE1 1 
ATOM   1194 C CE2 . PHE B 1 53  ? 37.587  2.889   6.264   1.00 47.63  ? 99   PHE B CE2 1 
ATOM   1195 C CZ  . PHE B 1 53  ? 37.143  3.740   5.273   1.00 47.47  ? 99   PHE B CZ  1 
ATOM   1196 N N   . ARG B 1 54  ? 41.497  6.005   10.865  1.00 48.65  ? 100  ARG B N   1 
ATOM   1197 C CA  . ARG B 1 54  ? 41.909  6.471   12.196  1.00 50.05  ? 100  ARG B CA  1 
ATOM   1198 C C   . ARG B 1 54  ? 42.723  7.768   12.167  1.00 51.73  ? 100  ARG B C   1 
ATOM   1199 O O   . ARG B 1 54  ? 42.995  8.356   13.211  1.00 52.74  ? 100  ARG B O   1 
ATOM   1200 C CB  . ARG B 1 54  ? 42.740  5.396   12.899  1.00 51.21  ? 100  ARG B CB  1 
ATOM   1201 C CG  . ARG B 1 54  ? 41.947  4.213   13.386  1.00 50.99  ? 100  ARG B CG  1 
ATOM   1202 C CD  . ARG B 1 54  ? 42.879  3.176   13.977  1.00 52.81  ? 100  ARG B CD  1 
ATOM   1203 N NE  . ARG B 1 54  ? 42.193  1.910   14.212  1.00 52.40  ? 100  ARG B NE  1 
ATOM   1204 C CZ  . ARG B 1 54  ? 42.728  0.705   14.024  1.00 51.81  ? 100  ARG B CZ  1 
ATOM   1205 N NH1 . ARG B 1 54  ? 43.974  0.562   13.593  1.00 52.57  ? 100  ARG B NH1 1 
ATOM   1206 N NH2 . ARG B 1 54  ? 42.000  -0.370  14.265  1.00 51.83  ? 100  ARG B NH2 1 
ATOM   1207 N N   . GLN B 1 55  ? 43.140  8.189   10.981  1.00 52.32  ? 101  GLN B N   1 
ATOM   1208 C CA  . GLN B 1 55  ? 43.940  9.407   10.835  1.00 54.25  ? 101  GLN B CA  1 
ATOM   1209 C C   . GLN B 1 55  ? 43.567  10.099  9.529   1.00 53.44  ? 101  GLN B C   1 
ATOM   1210 O O   . GLN B 1 55  ? 43.029  9.450   8.631   1.00 52.66  ? 101  GLN B O   1 
ATOM   1211 C CB  . GLN B 1 55  ? 45.438  9.077   10.856  1.00 56.18  ? 101  GLN B CB  1 
ATOM   1212 C CG  . GLN B 1 55  ? 45.903  8.112   9.763   1.00 56.87  ? 101  GLN B CG  1 
ATOM   1213 C CD  . GLN B 1 55  ? 45.358  6.703   9.947   1.00 56.91  ? 101  GLN B CD  1 
ATOM   1214 O OE1 . GLN B 1 55  ? 45.507  6.104   11.018  1.00 58.02  ? 101  GLN B OE1 1 
ATOM   1215 N NE2 . GLN B 1 55  ? 44.711  6.172   8.907   1.00 51.69  ? 101  GLN B NE2 1 
ATOM   1216 N N   . PRO B 1 56  ? 43.859  11.410  9.412   1.00 54.53  ? 102  PRO B N   1 
ATOM   1217 C CA  . PRO B 1 56  ? 43.595  12.094  8.150   1.00 54.47  ? 102  PRO B CA  1 
ATOM   1218 C C   . PRO B 1 56  ? 44.268  11.398  6.973   1.00 55.52  ? 102  PRO B C   1 
ATOM   1219 O O   . PRO B 1 56  ? 45.347  10.815  7.131   1.00 57.04  ? 102  PRO B O   1 
ATOM   1220 C CB  . PRO B 1 56  ? 44.214  13.485  8.363   1.00 56.06  ? 102  PRO B CB  1 
ATOM   1221 C CG  . PRO B 1 56  ? 44.222  13.684  9.819   1.00 56.67  ? 102  PRO B CG  1 
ATOM   1222 C CD  . PRO B 1 56  ? 44.391  12.326  10.436  1.00 55.79  ? 102  PRO B CD  1 
ATOM   1223 N N   . VAL B 1 57  ? 43.630  11.458  5.806   1.00 54.86  ? 103  VAL B N   1 
ATOM   1224 C CA  . VAL B 1 57  ? 44.239  10.979  4.575   1.00 55.07  ? 103  VAL B CA  1 
ATOM   1225 C C   . VAL B 1 57  ? 45.473  11.829  4.274   1.00 57.78  ? 103  VAL B C   1 
ATOM   1226 O O   . VAL B 1 57  ? 45.378  13.054  4.143   1.00 58.28  ? 103  VAL B O   1 
ATOM   1227 C CB  . VAL B 1 57  ? 43.254  11.055  3.385   1.00 54.20  ? 103  VAL B CB  1 
ATOM   1228 C CG1 . VAL B 1 57  ? 43.972  10.772  2.064   1.00 53.04  ? 103  VAL B CG1 1 
ATOM   1229 C CG2 . VAL B 1 57  ? 42.079  10.084  3.587   1.00 52.05  ? 103  VAL B CG2 1 
ATOM   1230 N N   . ASP B 1 58  ? 46.631  11.175  4.209   1.00 59.80  ? 104  ASP B N   1 
ATOM   1231 C CA  . ASP B 1 58  ? 47.868  11.812  3.769   1.00 62.46  ? 104  ASP B CA  1 
ATOM   1232 C C   . ASP B 1 58  ? 47.974  11.550  2.269   1.00 63.47  ? 104  ASP B C   1 
ATOM   1233 O O   . ASP B 1 58  ? 48.446  10.491  1.838   1.00 63.33  ? 104  ASP B O   1 
ATOM   1234 C CB  . ASP B 1 58  ? 49.068  11.243  4.531   1.00 64.18  ? 104  ASP B CB  1 
ATOM   1235 C CG  . ASP B 1 58  ? 50.359  12.006  4.263   1.00 66.62  ? 104  ASP B CG  1 
ATOM   1236 O OD1 . ASP B 1 58  ? 50.490  12.636  3.195   1.00 68.41  ? 104  ASP B OD1 1 
ATOM   1237 O OD2 . ASP B 1 58  ? 51.259  11.959  5.125   1.00 68.54  ? 104  ASP B OD2 1 
ATOM   1238 N N   . ALA B 1 59  ? 47.501  12.520  1.486   1.00 64.15  ? 105  ALA B N   1 
ATOM   1239 C CA  . ALA B 1 59  ? 47.426  12.406  0.026   1.00 65.55  ? 105  ALA B CA  1 
ATOM   1240 C C   . ALA B 1 59  ? 48.792  12.219  -0.638  1.00 68.58  ? 105  ALA B C   1 
ATOM   1241 O O   . ALA B 1 59  ? 48.893  11.554  -1.666  1.00 68.89  ? 105  ALA B O   1 
ATOM   1242 C CB  . ALA B 1 59  ? 46.728  13.631  -0.555  1.00 65.24  ? 105  ALA B CB  1 
ATOM   1243 N N   . VAL B 1 60  ? 49.828  12.814  -0.050  1.00 71.36  ? 106  VAL B N   1 
ATOM   1244 C CA  . VAL B 1 60  ? 51.202  12.654  -0.538  1.00 74.86  ? 106  VAL B CA  1 
ATOM   1245 C C   . VAL B 1 60  ? 51.703  11.228  -0.286  1.00 75.82  ? 106  VAL B C   1 
ATOM   1246 O O   . VAL B 1 60  ? 52.232  10.582  -1.194  1.00 76.80  ? 106  VAL B O   1 
ATOM   1247 C CB  . VAL B 1 60  ? 52.161  13.673  0.132   1.00 77.08  ? 106  VAL B CB  1 
ATOM   1248 C CG1 . VAL B 1 60  ? 53.609  13.430  -0.287  1.00 79.60  ? 106  VAL B CG1 1 
ATOM   1249 C CG2 . VAL B 1 60  ? 51.741  15.099  -0.203  1.00 77.80  ? 106  VAL B CG2 1 
ATOM   1250 N N   . LYS B 1 61  ? 51.519  10.745  0.942   1.00 75.76  ? 107  LYS B N   1 
ATOM   1251 C CA  . LYS B 1 61  ? 52.003  9.420   1.353   1.00 76.98  ? 107  LYS B CA  1 
ATOM   1252 C C   . LYS B 1 61  ? 51.298  8.295   0.595   1.00 75.45  ? 107  LYS B C   1 
ATOM   1253 O O   . LYS B 1 61  ? 51.937  7.330   0.174   1.00 76.76  ? 107  LYS B O   1 
ATOM   1254 C CB  . LYS B 1 61  ? 51.820  9.232   2.868   1.00 76.87  ? 107  LYS B CB  1 
ATOM   1255 C CG  . LYS B 1 61  ? 52.678  8.133   3.500   1.00 80.05  ? 107  LYS B CG  1 
ATOM   1256 C CD  . LYS B 1 61  ? 52.025  6.757   3.444   1.00 80.43  ? 107  LYS B CD  1 
ATOM   1257 C CE  . LYS B 1 61  ? 52.823  5.722   4.223   1.00 83.36  ? 107  LYS B CE  1 
ATOM   1258 N NZ  . LYS B 1 61  ? 52.740  5.940   5.696   1.00 84.49  ? 107  LYS B NZ  1 
ATOM   1259 N N   . LEU B 1 62  ? 49.985  8.429   0.424   1.00 72.96  ? 108  LEU B N   1 
ATOM   1260 C CA  . LEU B 1 62  ? 49.174  7.411   -0.246  1.00 71.69  ? 108  LEU B CA  1 
ATOM   1261 C C   . LEU B 1 62  ? 49.146  7.554   -1.775  1.00 72.14  ? 108  LEU B C   1 
ATOM   1262 O O   . LEU B 1 62  ? 48.580  6.705   -2.460  1.00 72.06  ? 108  LEU B O   1 
ATOM   1263 C CB  . LEU B 1 62  ? 47.743  7.424   0.318   1.00 69.27  ? 108  LEU B CB  1 
ATOM   1264 C CG  . LEU B 1 62  ? 47.630  6.958   1.775   1.00 69.19  ? 108  LEU B CG  1 
ATOM   1265 C CD1 . LEU B 1 62  ? 46.269  7.302   2.370   1.00 66.48  ? 108  LEU B CD1 1 
ATOM   1266 C CD2 . LEU B 1 62  ? 47.908  5.458   1.884   1.00 69.37  ? 108  LEU B CD2 1 
ATOM   1267 N N   . GLY B 1 63  ? 49.751  8.617   -2.305  1.00 73.74  ? 109  GLY B N   1 
ATOM   1268 C CA  . GLY B 1 63  ? 49.791  8.851   -3.750  1.00 74.90  ? 109  GLY B CA  1 
ATOM   1269 C C   . GLY B 1 63  ? 48.440  9.227   -4.340  1.00 73.54  ? 109  GLY B C   1 
ATOM   1270 O O   . GLY B 1 63  ? 47.963  8.575   -5.268  1.00 73.52  ? 109  GLY B O   1 
ATOM   1271 N N   . LEU B 1 64  ? 47.831  10.285  -3.801  1.00 72.47  ? 110  LEU B N   1 
ATOM   1272 C CA  . LEU B 1 64  ? 46.516  10.763  -4.244  1.00 70.63  ? 110  LEU B CA  1 
ATOM   1273 C C   . LEU B 1 64  ? 46.557  12.278  -4.524  1.00 70.97  ? 110  LEU B C   1 
ATOM   1274 O O   . LEU B 1 64  ? 46.077  13.072  -3.713  1.00 70.32  ? 110  LEU B O   1 
ATOM   1275 C CB  . LEU B 1 64  ? 45.462  10.448  -3.174  1.00 68.77  ? 110  LEU B CB  1 
ATOM   1276 C CG  . LEU B 1 64  ? 45.420  9.016   -2.629  1.00 68.21  ? 110  LEU B CG  1 
ATOM   1277 C CD1 . LEU B 1 64  ? 44.399  8.903   -1.504  1.00 65.91  ? 110  LEU B CD1 1 
ATOM   1278 C CD2 . LEU B 1 64  ? 45.123  8.017   -3.735  1.00 68.64  ? 110  LEU B CD2 1 
ATOM   1279 N N   . PRO B 1 65  ? 47.132  12.686  -5.678  1.00 72.09  ? 111  PRO B N   1 
ATOM   1280 C CA  . PRO B 1 65  ? 47.332  14.117  -5.993  1.00 72.29  ? 111  PRO B CA  1 
ATOM   1281 C C   . PRO B 1 65  ? 46.047  14.949  -6.129  1.00 69.51  ? 111  PRO B C   1 
ATOM   1282 O O   . PRO B 1 65  ? 46.078  16.165  -5.938  1.00 70.18  ? 111  PRO B O   1 
ATOM   1283 C CB  . PRO B 1 65  ? 48.064  14.086  -7.343  1.00 74.73  ? 111  PRO B CB  1 
ATOM   1284 C CG  . PRO B 1 65  ? 48.551  12.689  -7.508  1.00 75.50  ? 111  PRO B CG  1 
ATOM   1285 C CD  . PRO B 1 65  ? 47.588  11.824  -6.784  1.00 73.39  ? 111  PRO B CD  1 
ATOM   1286 N N   . ASP B 1 66  ? 44.939  14.297  -6.467  1.00 65.80  ? 112  ASP B N   1 
ATOM   1287 C CA  . ASP B 1 66  ? 43.673  14.986  -6.685  1.00 63.49  ? 112  ASP B CA  1 
ATOM   1288 C C   . ASP B 1 66  ? 42.729  14.866  -5.489  1.00 59.19  ? 112  ASP B C   1 
ATOM   1289 O O   . ASP B 1 66  ? 41.598  15.342  -5.550  1.00 56.87  ? 112  ASP B O   1 
ATOM   1290 C CB  . ASP B 1 66  ? 42.991  14.442  -7.944  1.00 63.96  ? 112  ASP B CB  1 
ATOM   1291 C CG  . ASP B 1 66  ? 42.707  12.946  -7.863  1.00 64.09  ? 112  ASP B CG  1 
ATOM   1292 O OD1 . ASP B 1 66  ? 43.308  12.249  -7.010  1.00 62.73  ? 112  ASP B OD1 1 
ATOM   1293 O OD2 . ASP B 1 66  ? 41.887  12.467  -8.672  1.00 67.26  ? 112  ASP B OD2 1 
ATOM   1294 N N   . TYR B 1 67  ? 43.190  14.244  -4.404  1.00 57.70  ? 113  TYR B N   1 
ATOM   1295 C CA  . TYR B 1 67  ? 42.308  13.965  -3.272  1.00 55.77  ? 113  TYR B CA  1 
ATOM   1296 C C   . TYR B 1 67  ? 41.693  15.251  -2.727  1.00 55.32  ? 113  TYR B C   1 
ATOM   1297 O O   . TYR B 1 67  ? 40.484  15.323  -2.522  1.00 53.78  ? 113  TYR B O   1 
ATOM   1298 C CB  . TYR B 1 67  ? 43.027  13.212  -2.147  1.00 55.13  ? 113  TYR B CB  1 
ATOM   1299 C CG  . TYR B 1 67  ? 42.077  12.815  -1.040  1.00 53.38  ? 113  TYR B CG  1 
ATOM   1300 C CD1 . TYR B 1 67  ? 41.337  11.640  -1.126  1.00 51.99  ? 113  TYR B CD1 1 
ATOM   1301 C CD2 . TYR B 1 67  ? 41.890  13.626  0.075   1.00 53.24  ? 113  TYR B CD2 1 
ATOM   1302 C CE1 . TYR B 1 67  ? 40.454  11.278  -0.138  1.00 50.18  ? 113  TYR B CE1 1 
ATOM   1303 C CE2 . TYR B 1 67  ? 40.997  13.271  1.073   1.00 51.69  ? 113  TYR B CE2 1 
ATOM   1304 C CZ  . TYR B 1 67  ? 40.281  12.090  0.957   1.00 49.82  ? 113  TYR B CZ  1 
ATOM   1305 O OH  . TYR B 1 67  ? 39.389  11.720  1.931   1.00 48.23  ? 113  TYR B OH  1 
ATOM   1306 N N   . HIS B 1 68  ? 42.524  16.267  -2.516  1.00 56.67  ? 114  HIS B N   1 
ATOM   1307 C CA  . HIS B 1 68  ? 42.046  17.532  -1.942  1.00 57.35  ? 114  HIS B CA  1 
ATOM   1308 C C   . HIS B 1 68  ? 41.314  18.417  -2.952  1.00 58.22  ? 114  HIS B C   1 
ATOM   1309 O O   . HIS B 1 68  ? 40.608  19.353  -2.561  1.00 58.23  ? 114  HIS B O   1 
ATOM   1310 C CB  . HIS B 1 68  ? 43.200  18.273  -1.262  1.00 58.97  ? 114  HIS B CB  1 
ATOM   1311 C CG  . HIS B 1 68  ? 43.682  17.575  -0.031  1.00 59.19  ? 114  HIS B CG  1 
ATOM   1312 N ND1 . HIS B 1 68  ? 42.954  17.557  1.139   1.00 57.70  ? 114  HIS B ND1 1 
ATOM   1313 C CD2 . HIS B 1 68  ? 44.784  16.823  0.197   1.00 60.69  ? 114  HIS B CD2 1 
ATOM   1314 C CE1 . HIS B 1 68  ? 43.597  16.841  2.043   1.00 58.23  ? 114  HIS B CE1 1 
ATOM   1315 N NE2 . HIS B 1 68  ? 44.709  16.382  1.496   1.00 60.62  ? 114  HIS B NE2 1 
ATOM   1316 N N   . LYS B 1 69  ? 41.463  18.108  -4.239  1.00 58.36  ? 115  LYS B N   1 
ATOM   1317 C CA  . LYS B 1 69  ? 40.675  18.756  -5.288  1.00 59.68  ? 115  LYS B CA  1 
ATOM   1318 C C   . LYS B 1 69  ? 39.236  18.244  -5.226  1.00 57.73  ? 115  LYS B C   1 
ATOM   1319 O O   . LYS B 1 69  ? 38.286  18.998  -5.443  1.00 58.89  ? 115  LYS B O   1 
ATOM   1320 C CB  . LYS B 1 69  ? 41.241  18.447  -6.682  1.00 61.49  ? 115  LYS B CB  1 
ATOM   1321 C CG  . LYS B 1 69  ? 42.723  18.785  -6.896  1.00 65.59  ? 115  LYS B CG  1 
ATOM   1322 C CD  . LYS B 1 69  ? 42.927  20.036  -7.725  1.00 67.82  ? 115  LYS B CD  1 
ATOM   1323 C CE  . LYS B 1 69  ? 44.337  20.090  -8.303  1.00 71.93  ? 115  LYS B CE  1 
ATOM   1324 N NZ  . LYS B 1 69  ? 45.378  19.974  -7.251  1.00 72.48  ? 115  LYS B NZ  1 
ATOM   1325 N N   . ILE B 1 70  ? 39.090  16.955  -4.936  1.00 55.49  ? 116  ILE B N   1 
ATOM   1326 C CA  . ILE B 1 70  ? 37.787  16.287  -4.930  1.00 52.60  ? 116  ILE B CA  1 
ATOM   1327 C C   . ILE B 1 70  ? 37.108  16.327  -3.556  1.00 50.71  ? 116  ILE B C   1 
ATOM   1328 O O   . ILE B 1 70  ? 35.904  16.575  -3.465  1.00 50.62  ? 116  ILE B O   1 
ATOM   1329 C CB  . ILE B 1 70  ? 37.934  14.831  -5.420  1.00 52.25  ? 116  ILE B CB  1 
ATOM   1330 C CG1 . ILE B 1 70  ? 38.320  14.830  -6.908  1.00 53.29  ? 116  ILE B CG1 1 
ATOM   1331 C CG2 . ILE B 1 70  ? 36.638  14.049  -5.181  1.00 48.69  ? 116  ILE B CG2 1 
ATOM   1332 C CD1 . ILE B 1 70  ? 39.058  13.592  -7.353  1.00 56.30  ? 116  ILE B CD1 1 
ATOM   1333 N N   . ILE B 1 71  ? 37.877  16.099  -2.498  1.00 49.80  ? 117  ILE B N   1 
ATOM   1334 C CA  . ILE B 1 71  ? 37.354  16.112  -1.130  1.00 49.10  ? 117  ILE B CA  1 
ATOM   1335 C C   . ILE B 1 71  ? 37.665  17.455  -0.452  1.00 50.80  ? 117  ILE B C   1 
ATOM   1336 O O   . ILE B 1 71  ? 38.810  17.740  -0.099  1.00 51.66  ? 117  ILE B O   1 
ATOM   1337 C CB  . ILE B 1 71  ? 37.921  14.934  -0.304  1.00 48.37  ? 117  ILE B CB  1 
ATOM   1338 C CG1 . ILE B 1 71  ? 37.460  13.594  -0.905  1.00 47.96  ? 117  ILE B CG1 1 
ATOM   1339 C CG2 . ILE B 1 71  ? 37.493  15.023  1.162   1.00 47.39  ? 117  ILE B CG2 1 
ATOM   1340 C CD1 . ILE B 1 71  ? 35.939  13.484  -1.110  1.00 45.90  ? 117  ILE B CD1 1 
ATOM   1341 N N   . LYS B 1 72  ? 36.627  18.262  -0.262  1.00 51.20  ? 118  LYS B N   1 
ATOM   1342 C CA  . LYS B 1 72  ? 36.784  19.627  0.256   1.00 54.12  ? 118  LYS B CA  1 
ATOM   1343 C C   . LYS B 1 72  ? 36.736  19.727  1.774   1.00 52.82  ? 118  LYS B C   1 
ATOM   1344 O O   . LYS B 1 72  ? 37.272  20.677  2.352   1.00 53.88  ? 118  LYS B O   1 
ATOM   1345 C CB  . LYS B 1 72  ? 35.722  20.535  -0.370  1.00 56.02  ? 118  LYS B CB  1 
ATOM   1346 C CG  . LYS B 1 72  ? 35.859  20.661  -1.888  1.00 58.15  ? 118  LYS B CG  1 
ATOM   1347 C CD  . LYS B 1 72  ? 37.309  20.949  -2.262  1.00 61.99  ? 118  LYS B CD  1 
ATOM   1348 C CE  . LYS B 1 72  ? 37.450  21.639  -3.583  1.00 65.52  ? 118  LYS B CE  1 
ATOM   1349 N NZ  . LYS B 1 72  ? 38.891  21.888  -3.854  1.00 68.99  ? 118  LYS B NZ  1 
ATOM   1350 N N   . GLN B 1 73  ? 36.097  18.755  2.415   1.00 50.51  ? 119  GLN B N   1 
ATOM   1351 C CA  . GLN B 1 73  ? 36.099  18.667  3.870   1.00 51.10  ? 119  GLN B CA  1 
ATOM   1352 C C   . GLN B 1 73  ? 36.614  17.299  4.317   1.00 49.62  ? 119  GLN B C   1 
ATOM   1353 O O   . GLN B 1 73  ? 35.817  16.391  4.592   1.00 48.00  ? 119  GLN B O   1 
ATOM   1354 C CB  . GLN B 1 73  ? 34.704  18.915  4.443   1.00 51.82  ? 119  GLN B CB  1 
ATOM   1355 C CG  . GLN B 1 73  ? 34.710  19.049  5.975   1.00 54.42  ? 119  GLN B CG  1 
ATOM   1356 C CD  . GLN B 1 73  ? 33.322  18.986  6.598   1.00 55.98  ? 119  GLN B CD  1 
ATOM   1357 O OE1 . GLN B 1 73  ? 33.191  18.857  7.812   1.00 58.58  ? 119  GLN B OE1 1 
ATOM   1358 N NE2 . GLN B 1 73  ? 32.285  19.087  5.771   1.00 58.13  ? 119  GLN B NE2 1 
ATOM   1359 N N   . PRO B 1 74  ? 37.948  17.149  4.399   1.00 49.68  ? 120  PRO B N   1 
ATOM   1360 C CA  . PRO B 1 74  ? 38.489  15.889  4.906   1.00 49.50  ? 120  PRO B CA  1 
ATOM   1361 C C   . PRO B 1 74  ? 38.012  15.626  6.333   1.00 48.50  ? 120  PRO B C   1 
ATOM   1362 O O   . PRO B 1 74  ? 37.843  16.563  7.116   1.00 48.00  ? 120  PRO B O   1 
ATOM   1363 C CB  . PRO B 1 74  ? 40.012  16.103  4.873   1.00 51.39  ? 120  PRO B CB  1 
ATOM   1364 C CG  . PRO B 1 74  ? 40.241  17.313  4.060   1.00 53.02  ? 120  PRO B CG  1 
ATOM   1365 C CD  . PRO B 1 74  ? 39.008  18.144  4.157   1.00 52.15  ? 120  PRO B CD  1 
ATOM   1366 N N   . MET B 1 75  ? 37.763  14.362  6.653   1.00 46.82  ? 121  MET B N   1 
ATOM   1367 C CA  . MET B 1 75  ? 37.378  13.986  8.003   1.00 46.86  ? 121  MET B CA  1 
ATOM   1368 C C   . MET B 1 75  ? 37.789  12.543  8.275   1.00 46.96  ? 121  MET B C   1 
ATOM   1369 O O   . MET B 1 75  ? 37.797  11.711  7.370   1.00 46.54  ? 121  MET B O   1 
ATOM   1370 C CB  . MET B 1 75  ? 35.869  14.145  8.202   1.00 45.53  ? 121  MET B CB  1 
ATOM   1371 C CG  . MET B 1 75  ? 35.397  14.014  9.655   1.00 47.02  ? 121  MET B CG  1 
ATOM   1372 S SD  . MET B 1 75  ? 36.286  15.037  10.844  1.00 49.01  ? 121  MET B SD  1 
ATOM   1373 C CE  . MET B 1 75  ? 36.077  16.679  10.131  1.00 51.81  ? 121  MET B CE  1 
ATOM   1374 N N   . ASP B 1 76  ? 38.128  12.273  9.531   1.00 48.01  ? 122  ASP B N   1 
ATOM   1375 C CA  . ASP B 1 76  ? 38.610  10.968  9.962   1.00 47.74  ? 122  ASP B CA  1 
ATOM   1376 C C   . ASP B 1 76  ? 38.270  10.775  11.437  1.00 47.56  ? 122  ASP B C   1 
ATOM   1377 O O   . ASP B 1 76  ? 37.961  11.744  12.126  1.00 46.35  ? 122  ASP B O   1 
ATOM   1378 C CB  . ASP B 1 76  ? 40.114  10.875  9.758   1.00 49.05  ? 122  ASP B CB  1 
ATOM   1379 C CG  . ASP B 1 76  ? 40.885  11.824  10.656  1.00 50.97  ? 122  ASP B CG  1 
ATOM   1380 O OD1 . ASP B 1 76  ? 40.941  13.032  10.340  1.00 52.57  ? 122  ASP B OD1 1 
ATOM   1381 O OD2 . ASP B 1 76  ? 41.434  11.362  11.682  1.00 51.85  ? 122  ASP B OD2 1 
ATOM   1382 N N   A MET B 1 77  ? 38.343  9.539   11.923  0.50 47.46  ? 123  MET B N   1 
ATOM   1383 N N   B MET B 1 77  ? 38.342  9.525   11.903  0.50 47.93  ? 123  MET B N   1 
ATOM   1384 C CA  A MET B 1 77  ? 37.967  9.245   13.305  0.50 48.14  ? 123  MET B CA  1 
ATOM   1385 C CA  B MET B 1 77  ? 38.027  9.169   13.293  0.50 49.01  ? 123  MET B CA  1 
ATOM   1386 C C   A MET B 1 77  ? 38.948  9.818   14.336  0.50 49.77  ? 123  MET B C   1 
ATOM   1387 C C   B MET B 1 77  ? 38.930  9.879   14.298  0.50 50.24  ? 123  MET B C   1 
ATOM   1388 O O   A MET B 1 77  ? 38.564  10.057  15.481  0.50 50.46  ? 123  MET B O   1 
ATOM   1389 O O   B MET B 1 77  ? 38.486  10.258  15.381  0.50 50.91  ? 123  MET B O   1 
ATOM   1390 C CB  A MET B 1 77  ? 37.796  7.732   13.510  0.50 48.24  ? 123  MET B CB  1 
ATOM   1391 C CB  B MET B 1 77  ? 38.173  7.655   13.520  0.50 49.88  ? 123  MET B CB  1 
ATOM   1392 C CG  A MET B 1 77  ? 36.552  7.153   12.836  0.50 46.79  ? 123  MET B CG  1 
ATOM   1393 C CG  B MET B 1 77  ? 37.225  6.756   12.735  0.50 49.77  ? 123  MET B CG  1 
ATOM   1394 S SD  A MET B 1 77  ? 36.144  5.465   13.341  0.50 46.44  ? 123  MET B SD  1 
ATOM   1395 S SD  B MET B 1 77  ? 37.563  5.000   13.057  0.50 52.55  ? 123  MET B SD  1 
ATOM   1396 C CE  A MET B 1 77  ? 37.676  4.610   12.962  0.50 47.78  ? 123  MET B CE  1 
ATOM   1397 C CE  B MET B 1 77  ? 36.339  4.214   12.013  0.50 48.77  ? 123  MET B CE  1 
ATOM   1398 N N   . GLY B 1 78  ? 40.202  10.034  13.942  1.00 51.00  ? 124  GLY B N   1 
ATOM   1399 C CA  . GLY B 1 78  ? 41.186  10.685  14.816  1.00 52.37  ? 124  GLY B CA  1 
ATOM   1400 C C   . GLY B 1 78  ? 40.825  12.135  15.121  1.00 52.59  ? 124  GLY B C   1 
ATOM   1401 O O   . GLY B 1 78  ? 40.898  12.572  16.264  1.00 53.81  ? 124  GLY B O   1 
ATOM   1402 N N   . THR B 1 79  ? 40.436  12.873  14.087  1.00 51.93  ? 125  THR B N   1 
ATOM   1403 C CA  . THR B 1 79  ? 39.923  14.236  14.236  1.00 51.72  ? 125  THR B CA  1 
ATOM   1404 C C   . THR B 1 79  ? 38.661  14.253  15.108  1.00 51.47  ? 125  THR B C   1 
ATOM   1405 O O   . THR B 1 79  ? 38.563  15.042  16.045  1.00 51.90  ? 125  THR B O   1 
ATOM   1406 C CB  . THR B 1 79  ? 39.627  14.864  12.858  1.00 51.16  ? 125  THR B CB  1 
ATOM   1407 O OG1 . THR B 1 79  ? 40.851  14.974  12.126  1.00 53.23  ? 125  THR B OG1 1 
ATOM   1408 C CG2 . THR B 1 79  ? 38.989  16.261  12.984  1.00 49.08  ? 125  THR B CG2 1 
ATOM   1409 N N   . ILE B 1 80  ? 37.716  13.365  14.804  1.00 50.42  ? 126  ILE B N   1 
ATOM   1410 C CA  . ILE B 1 80  ? 36.466  13.252  15.565  1.00 50.88  ? 126  ILE B CA  1 
ATOM   1411 C C   . ILE B 1 80  ? 36.716  12.935  17.037  1.00 53.12  ? 126  ILE B C   1 
ATOM   1412 O O   . ILE B 1 80  ? 36.129  13.565  17.923  1.00 53.37  ? 126  ILE B O   1 
ATOM   1413 C CB  . ILE B 1 80  ? 35.539  12.169  14.975  1.00 49.76  ? 126  ILE B CB  1 
ATOM   1414 C CG1 . ILE B 1 80  ? 35.050  12.581  13.588  1.00 49.00  ? 126  ILE B CG1 1 
ATOM   1415 C CG2 . ILE B 1 80  ? 34.333  11.922  15.883  1.00 49.55  ? 126  ILE B CG2 1 
ATOM   1416 C CD1 . ILE B 1 80  ? 34.281  11.503  12.883  1.00 46.14  ? 126  ILE B CD1 1 
ATOM   1417 N N   . LYS B 1 81  ? 37.579  11.951  17.286  1.00 54.06  ? 127  LYS B N   1 
ATOM   1418 C CA  . LYS B 1 81  ? 37.952  11.556  18.643  1.00 56.21  ? 127  LYS B CA  1 
ATOM   1419 C C   . LYS B 1 81  ? 38.537  12.747  19.414  1.00 58.14  ? 127  LYS B C   1 
ATOM   1420 O O   . LYS B 1 81  ? 38.132  13.019  20.547  1.00 59.50  ? 127  LYS B O   1 
ATOM   1421 C CB  . LYS B 1 81  ? 38.948  10.384  18.590  1.00 56.60  ? 127  LYS B CB  1 
ATOM   1422 C CG  . LYS B 1 81  ? 39.387  9.817   19.947  1.00 59.58  ? 127  LYS B CG  1 
ATOM   1423 C CD  . LYS B 1 81  ? 40.315  8.605   19.761  1.00 60.86  ? 127  LYS B CD  1 
ATOM   1424 C CE  . LYS B 1 81  ? 41.213  8.370   20.970  1.00 64.75  ? 127  LYS B CE  1 
ATOM   1425 N NZ  . LYS B 1 81  ? 42.345  9.348   21.054  1.00 66.96  ? 127  LYS B NZ  1 
ATOM   1426 N N   . ARG B 1 82  ? 39.477  13.458  18.792  1.00 59.25  ? 128  ARG B N   1 
ATOM   1427 C CA  . ARG B 1 82  ? 40.090  14.647  19.405  1.00 62.13  ? 128  ARG B CA  1 
ATOM   1428 C C   . ARG B 1 82  ? 39.046  15.719  19.713  1.00 61.61  ? 128  ARG B C   1 
ATOM   1429 O O   . ARG B 1 82  ? 39.088  16.342  20.772  1.00 62.44  ? 128  ARG B O   1 
ATOM   1430 C CB  . ARG B 1 82  ? 41.190  15.232  18.507  1.00 64.19  ? 128  ARG B CB  1 
ATOM   1431 C CG  . ARG B 1 82  ? 41.726  16.590  18.982  1.00 70.45  ? 128  ARG B CG  1 
ATOM   1432 C CD  . ARG B 1 82  ? 43.053  16.969  18.332  1.00 75.84  ? 128  ARG B CD  1 
ATOM   1433 N NE  . ARG B 1 82  ? 42.933  17.127  16.882  1.00 78.04  ? 128  ARG B NE  1 
ATOM   1434 C CZ  . ARG B 1 82  ? 43.261  16.208  15.973  1.00 80.26  ? 128  ARG B CZ  1 
ATOM   1435 N NH1 . ARG B 1 82  ? 43.748  15.020  16.331  1.00 81.58  ? 128  ARG B NH1 1 
ATOM   1436 N NH2 . ARG B 1 82  ? 43.098  16.480  14.682  1.00 80.65  ? 128  ARG B NH2 1 
ATOM   1437 N N   . ARG B 1 83  ? 38.116  15.929  18.784  1.00 59.47  ? 129  ARG B N   1 
ATOM   1438 C CA  . ARG B 1 83  ? 37.021  16.880  18.987  1.00 59.40  ? 129  ARG B CA  1 
ATOM   1439 C C   . ARG B 1 83  ? 36.132  16.498  20.176  1.00 60.08  ? 129  ARG B C   1 
ATOM   1440 O O   . ARG B 1 83  ? 35.744  17.359  20.971  1.00 60.95  ? 129  ARG B O   1 
ATOM   1441 C CB  . ARG B 1 83  ? 36.194  17.018  17.707  1.00 57.97  ? 129  ARG B CB  1 
ATOM   1442 C CG  . ARG B 1 83  ? 36.905  17.824  16.636  1.00 58.53  ? 129  ARG B CG  1 
ATOM   1443 C CD  . ARG B 1 83  ? 36.153  17.824  15.314  1.00 58.74  ? 129  ARG B CD  1 
ATOM   1444 N NE  . ARG B 1 83  ? 36.687  18.831  14.402  1.00 59.65  ? 129  ARG B NE  1 
ATOM   1445 C CZ  . ARG B 1 83  ? 36.095  19.245  13.280  1.00 60.16  ? 129  ARG B CZ  1 
ATOM   1446 N NH1 . ARG B 1 83  ? 34.924  18.748  12.888  1.00 56.13  ? 129  ARG B NH1 1 
ATOM   1447 N NH2 . ARG B 1 83  ? 36.680  20.185  12.546  1.00 63.28  ? 129  ARG B NH2 1 
ATOM   1448 N N   . LEU B 1 84  ? 35.825  15.208  20.299  1.00 59.21  ? 130  LEU B N   1 
ATOM   1449 C CA  . LEU B 1 84  ? 35.063  14.701  21.439  1.00 60.40  ? 130  LEU B CA  1 
ATOM   1450 C C   . LEU B 1 84  ? 35.806  14.929  22.759  1.00 63.06  ? 130  LEU B C   1 
ATOM   1451 O O   . LEU B 1 84  ? 35.193  15.262  23.767  1.00 64.25  ? 130  LEU B O   1 
ATOM   1452 C CB  . LEU B 1 84  ? 34.746  13.209  21.263  1.00 58.83  ? 130  LEU B CB  1 
ATOM   1453 C CG  . LEU B 1 84  ? 33.696  12.902  20.195  1.00 56.83  ? 130  LEU B CG  1 
ATOM   1454 C CD1 . LEU B 1 84  ? 33.767  11.436  19.755  1.00 54.38  ? 130  LEU B CD1 1 
ATOM   1455 C CD2 . LEU B 1 84  ? 32.299  13.274  20.690  1.00 56.78  ? 130  LEU B CD2 1 
ATOM   1456 N N   . GLU B 1 85  ? 37.126  14.761  22.731  1.00 64.40  ? 131  GLU B N   1 
ATOM   1457 C CA  . GLU B 1 85  ? 37.969  14.916  23.918  1.00 67.21  ? 131  GLU B CA  1 
ATOM   1458 C C   . GLU B 1 85  ? 38.177  16.381  24.318  1.00 69.80  ? 131  GLU B C   1 
ATOM   1459 O O   . GLU B 1 85  ? 38.301  16.688  25.509  1.00 71.79  ? 131  GLU B O   1 
ATOM   1460 C CB  . GLU B 1 85  ? 39.321  14.233  23.685  1.00 67.50  ? 131  GLU B CB  1 
ATOM   1461 C CG  . GLU B 1 85  ? 39.216  12.718  23.581  1.00 67.16  ? 131  GLU B CG  1 
ATOM   1462 C CD  . GLU B 1 85  ? 40.487  12.049  23.081  1.00 68.54  ? 131  GLU B CD  1 
ATOM   1463 O OE1 . GLU B 1 85  ? 41.452  12.755  22.715  1.00 70.25  ? 131  GLU B OE1 1 
ATOM   1464 O OE2 . GLU B 1 85  ? 40.516  10.802  23.050  1.00 69.72  ? 131  GLU B OE2 1 
ATOM   1465 N N   . ASN B 1 86  ? 38.212  17.279  23.332  1.00 69.77  ? 132  ASN B N   1 
ATOM   1466 C CA  . ASN B 1 86  ? 38.405  18.716  23.580  1.00 72.09  ? 132  ASN B CA  1 
ATOM   1467 C C   . ASN B 1 86  ? 37.096  19.504  23.753  1.00 71.52  ? 132  ASN B C   1 
ATOM   1468 O O   . ASN B 1 86  ? 37.117  20.733  23.805  1.00 72.18  ? 132  ASN B O   1 
ATOM   1469 C CB  . ASN B 1 86  ? 39.225  19.341  22.441  1.00 72.79  ? 132  ASN B CB  1 
ATOM   1470 C CG  . ASN B 1 86  ? 40.663  18.847  22.404  1.00 75.73  ? 132  ASN B CG  1 
ATOM   1471 O OD1 . ASN B 1 86  ? 41.214  18.408  23.414  1.00 79.60  ? 132  ASN B OD1 1 
ATOM   1472 N ND2 . ASN B 1 86  ? 41.286  18.940  21.232  1.00 76.65  ? 132  ASN B ND2 1 
ATOM   1473 N N   . ASN B 1 87  ? 35.968  18.799  23.845  1.00 70.14  ? 133  ASN B N   1 
ATOM   1474 C CA  . ASN B 1 87  ? 34.649  19.427  23.992  1.00 70.41  ? 133  ASN B CA  1 
ATOM   1475 C C   . ASN B 1 87  ? 34.365  20.442  22.877  1.00 69.03  ? 133  ASN B C   1 
ATOM   1476 O O   . ASN B 1 87  ? 33.949  21.573  23.127  1.00 70.41  ? 133  ASN B O   1 
ATOM   1477 C CB  . ASN B 1 87  ? 34.499  20.064  25.386  1.00 73.38  ? 133  ASN B CB  1 
ATOM   1478 C CG  . ASN B 1 87  ? 34.666  19.053  26.521  1.00 76.14  ? 133  ASN B CG  1 
ATOM   1479 O OD1 . ASN B 1 87  ? 35.020  19.421  27.643  1.00 80.60  ? 133  ASN B OD1 1 
ATOM   1480 N ND2 . ASN B 1 87  ? 34.410  17.777  26.232  1.00 75.67  ? 133  ASN B ND2 1 
ATOM   1481 N N   . TYR B 1 88  ? 34.605  20.014  21.643  1.00 66.19  ? 134  TYR B N   1 
ATOM   1482 C CA  . TYR B 1 88  ? 34.385  20.843  20.464  1.00 65.37  ? 134  TYR B CA  1 
ATOM   1483 C C   . TYR B 1 88  ? 32.907  20.848  20.073  1.00 63.54  ? 134  TYR B C   1 
ATOM   1484 O O   . TYR B 1 88  ? 32.394  21.862  19.611  1.00 63.18  ? 134  TYR B O   1 
ATOM   1485 C CB  . TYR B 1 88  ? 35.266  20.338  19.313  1.00 64.14  ? 134  TYR B CB  1 
ATOM   1486 C CG  . TYR B 1 88  ? 34.954  20.883  17.937  1.00 64.40  ? 134  TYR B CG  1 
ATOM   1487 C CD1 . TYR B 1 88  ? 34.053  20.232  17.101  1.00 62.75  ? 134  TYR B CD1 1 
ATOM   1488 C CD2 . TYR B 1 88  ? 35.584  22.031  17.455  1.00 67.23  ? 134  TYR B CD2 1 
ATOM   1489 C CE1 . TYR B 1 88  ? 33.771  20.711  15.830  1.00 63.63  ? 134  TYR B CE1 1 
ATOM   1490 C CE2 . TYR B 1 88  ? 35.305  22.519  16.175  1.00 67.14  ? 134  TYR B CE2 1 
ATOM   1491 C CZ  . TYR B 1 88  ? 34.399  21.854  15.372  1.00 65.46  ? 134  TYR B CZ  1 
ATOM   1492 O OH  . TYR B 1 88  ? 34.110  22.319  14.105  1.00 67.68  ? 134  TYR B OH  1 
ATOM   1493 N N   . TYR B 1 89  ? 32.230  19.718  20.274  1.00 62.24  ? 135  TYR B N   1 
ATOM   1494 C CA  . TYR B 1 89  ? 30.839  19.559  19.858  1.00 61.49  ? 135  TYR B CA  1 
ATOM   1495 C C   . TYR B 1 89  ? 29.852  20.124  20.872  1.00 64.32  ? 135  TYR B C   1 
ATOM   1496 O O   . TYR B 1 89  ? 29.966  19.855  22.071  1.00 65.64  ? 135  TYR B O   1 
ATOM   1497 C CB  . TYR B 1 89  ? 30.513  18.082  19.648  1.00 59.46  ? 135  TYR B CB  1 
ATOM   1498 C CG  . TYR B 1 89  ? 31.298  17.418  18.542  1.00 56.40  ? 135  TYR B CG  1 
ATOM   1499 C CD1 . TYR B 1 89  ? 31.142  17.816  17.220  1.00 54.95  ? 135  TYR B CD1 1 
ATOM   1500 C CD2 . TYR B 1 89  ? 32.179  16.379  18.815  1.00 54.20  ? 135  TYR B CD2 1 
ATOM   1501 C CE1 . TYR B 1 89  ? 31.854  17.205  16.200  1.00 54.20  ? 135  TYR B CE1 1 
ATOM   1502 C CE2 . TYR B 1 89  ? 32.892  15.768  17.811  1.00 53.19  ? 135  TYR B CE2 1 
ATOM   1503 C CZ  . TYR B 1 89  ? 32.722  16.175  16.504  1.00 53.36  ? 135  TYR B CZ  1 
ATOM   1504 O OH  . TYR B 1 89  ? 33.430  15.556  15.504  1.00 51.43  ? 135  TYR B OH  1 
ATOM   1505 N N   A TRP B 1 90  ? 28.881  20.896  20.389  0.50 65.05  ? 136  TRP B N   1 
ATOM   1506 N N   B TRP B 1 90  ? 28.891  20.905  20.381  0.50 65.21  ? 136  TRP B N   1 
ATOM   1507 C CA  A TRP B 1 90  ? 27.786  21.383  21.225  0.50 66.98  ? 136  TRP B CA  1 
ATOM   1508 C CA  B TRP B 1 90  ? 27.787  21.411  21.196  0.50 67.26  ? 136  TRP B CA  1 
ATOM   1509 C C   A TRP B 1 90  ? 26.649  20.357  21.291  0.50 65.97  ? 136  TRP B C   1 
ATOM   1510 C C   B TRP B 1 90  ? 26.641  20.385  21.272  0.50 66.14  ? 136  TRP B C   1 
ATOM   1511 O O   A TRP B 1 90  ? 25.927  20.300  22.284  0.50 67.76  ? 136  TRP B O   1 
ATOM   1512 O O   B TRP B 1 90  ? 25.905  20.357  22.256  0.50 67.95  ? 136  TRP B O   1 
ATOM   1513 C CB  A TRP B 1 90  ? 27.260  22.722  20.701  0.50 68.26  ? 136  TRP B CB  1 
ATOM   1514 C CB  B TRP B 1 90  ? 27.278  22.750  20.636  0.50 68.69  ? 136  TRP B CB  1 
ATOM   1515 C CG  A TRP B 1 90  ? 26.500  23.518  21.728  0.50 72.24  ? 136  TRP B CG  1 
ATOM   1516 C CG  B TRP B 1 90  ? 28.276  23.889  20.743  0.50 71.93  ? 136  TRP B CG  1 
ATOM   1517 C CD1 A TRP B 1 90  ? 27.029  24.258  22.746  0.50 74.74  ? 136  TRP B CD1 1 
ATOM   1518 C CD1 B TRP B 1 90  ? 29.630  23.803  20.619  0.50 72.63  ? 136  TRP B CD1 1 
ATOM   1519 C CD2 A TRP B 1 90  ? 25.077  23.661  21.827  0.50 74.28  ? 136  TRP B CD2 1 
ATOM   1520 C CD2 B TRP B 1 90  ? 27.986  25.280  20.970  0.50 75.90  ? 136  TRP B CD2 1 
ATOM   1521 N NE1 A TRP B 1 90  ? 26.025  24.847  23.475  0.50 77.92  ? 136  TRP B NE1 1 
ATOM   1522 N NE1 B TRP B 1 90  ? 30.205  25.042  20.769  0.50 74.68  ? 136  TRP B NE1 1 
ATOM   1523 C CE2 A TRP B 1 90  ? 24.817  24.496  22.932  0.50 77.62  ? 136  TRP B CE2 1 
ATOM   1524 C CE2 B TRP B 1 90  ? 29.217  25.967  20.982  0.50 76.82  ? 136  TRP B CE2 1 
ATOM   1525 C CE3 A TRP B 1 90  ? 23.998  23.162  21.091  0.50 74.26  ? 136  TRP B CE3 1 
ATOM   1526 C CE3 B TRP B 1 90  ? 26.807  26.007  21.168  0.50 77.78  ? 136  TRP B CE3 1 
ATOM   1527 C CZ2 A TRP B 1 90  ? 23.523  24.843  23.319  0.50 80.05  ? 136  TRP B CZ2 1 
ATOM   1528 C CZ2 B TRP B 1 90  ? 29.304  27.344  21.185  0.50 79.22  ? 136  TRP B CZ2 1 
ATOM   1529 C CZ3 A TRP B 1 90  ? 22.715  23.507  21.476  0.50 76.22  ? 136  TRP B CZ3 1 
ATOM   1530 C CZ3 B TRP B 1 90  ? 26.896  27.376  21.371  0.50 80.31  ? 136  TRP B CZ3 1 
ATOM   1531 C CH2 A TRP B 1 90  ? 22.488  24.339  22.579  0.50 79.24  ? 136  TRP B CH2 1 
ATOM   1532 C CH2 B TRP B 1 90  ? 28.136  28.028  21.378  0.50 80.89  ? 136  TRP B CH2 1 
ATOM   1533 N N   . ALA B 1 91  ? 26.495  19.550  20.241  1.00 63.76  ? 137  ALA B N   1 
ATOM   1534 C CA  . ALA B 1 91  ? 25.437  18.514  20.200  1.00 62.15  ? 137  ALA B CA  1 
ATOM   1535 C C   . ALA B 1 91  ? 25.867  17.237  19.470  1.00 59.66  ? 137  ALA B C   1 
ATOM   1536 O O   . ALA B 1 91  ? 26.747  17.264  18.615  1.00 57.58  ? 137  ALA B O   1 
ATOM   1537 C CB  . ALA B 1 91  ? 24.175  19.073  19.559  1.00 62.12  ? 137  ALA B CB  1 
ATOM   1538 N N   . ALA B 1 92  ? 25.213  16.129  19.813  1.00 59.10  ? 138  ALA B N   1 
ATOM   1539 C CA  . ALA B 1 92  ? 25.518  14.815  19.257  1.00 57.21  ? 138  ALA B CA  1 
ATOM   1540 C C   . ALA B 1 92  ? 25.383  14.798  17.734  1.00 55.73  ? 138  ALA B C   1 
ATOM   1541 O O   . ALA B 1 92  ? 26.192  14.179  17.049  1.00 53.30  ? 138  ALA B O   1 
ATOM   1542 C CB  . ALA B 1 92  ? 24.609  13.761  19.874  1.00 57.85  ? 138  ALA B CB  1 
ATOM   1543 N N   . SER B 1 93  ? 24.368  15.489  17.211  1.00 56.42  ? 139  SER B N   1 
ATOM   1544 C CA  . SER B 1 93  ? 24.153  15.564  15.764  1.00 55.07  ? 139  SER B CA  1 
ATOM   1545 C C   . SER B 1 93  ? 25.389  16.065  15.029  1.00 53.82  ? 139  SER B C   1 
ATOM   1546 O O   . SER B 1 93  ? 25.671  15.602  13.933  1.00 52.95  ? 139  SER B O   1 
ATOM   1547 C CB  . SER B 1 93  ? 22.953  16.455  15.421  1.00 56.23  ? 139  SER B CB  1 
ATOM   1548 O OG  . SER B 1 93  ? 23.129  17.761  15.941  1.00 57.78  ? 139  SER B OG  1 
ATOM   1549 N N   . GLU B 1 94  ? 26.129  16.992  15.635  1.00 54.68  ? 140  GLU B N   1 
ATOM   1550 C CA  . GLU B 1 94  ? 27.319  17.569  14.995  1.00 54.61  ? 140  GLU B CA  1 
ATOM   1551 C C   . GLU B 1 94  ? 28.422  16.521  14.827  1.00 53.43  ? 140  GLU B C   1 
ATOM   1552 O O   . GLU B 1 94  ? 29.098  16.458  13.794  1.00 52.15  ? 140  GLU B O   1 
ATOM   1553 C CB  . GLU B 1 94  ? 27.851  18.744  15.808  1.00 56.58  ? 140  GLU B CB  1 
ATOM   1554 C CG  . GLU B 1 94  ? 26.889  19.920  15.919  1.00 59.68  ? 140  GLU B CG  1 
ATOM   1555 C CD  . GLU B 1 94  ? 27.360  20.978  16.902  1.00 62.86  ? 140  GLU B CD  1 
ATOM   1556 O OE1 . GLU B 1 94  ? 28.409  20.770  17.554  1.00 62.36  ? 140  GLU B OE1 1 
ATOM   1557 O OE2 . GLU B 1 94  ? 26.678  22.024  17.023  1.00 65.95  ? 140  GLU B OE2 1 
ATOM   1558 N N   . CYS B 1 95  ? 28.590  15.698  15.852  1.00 53.01  ? 141  CYS B N   1 
ATOM   1559 C CA  . CYS B 1 95  ? 29.529  14.577  15.802  1.00 51.82  ? 141  CYS B CA  1 
ATOM   1560 C C   . CYS B 1 95  ? 29.119  13.541  14.748  1.00 49.78  ? 141  CYS B C   1 
ATOM   1561 O O   . CYS B 1 95  ? 29.947  13.093  13.952  1.00 47.55  ? 141  CYS B O   1 
ATOM   1562 C CB  . CYS B 1 95  ? 29.638  13.937  17.186  1.00 52.49  ? 141  CYS B CB  1 
ATOM   1563 S SG  . CYS B 1 95  ? 30.709  12.509  17.257  1.00 52.54  ? 141  CYS B SG  1 
ATOM   1564 N N   . MET B 1 96  ? 27.837  13.185  14.738  1.00 49.91  ? 142  MET B N   1 
ATOM   1565 C CA  . MET B 1 96  ? 27.295  12.246  13.756  1.00 49.68  ? 142  MET B CA  1 
ATOM   1566 C C   . MET B 1 96  ? 27.494  12.748  12.321  1.00 48.88  ? 142  MET B C   1 
ATOM   1567 O O   . MET B 1 96  ? 27.772  11.952  11.421  1.00 48.53  ? 142  MET B O   1 
ATOM   1568 C CB  . MET B 1 96  ? 25.810  11.974  14.027  1.00 50.54  ? 142  MET B CB  1 
ATOM   1569 C CG  . MET B 1 96  ? 25.557  11.208  15.307  1.00 52.63  ? 142  MET B CG  1 
ATOM   1570 S SD  . MET B 1 96  ? 23.863  11.327  15.916  1.00 53.83  ? 142  MET B SD  1 
ATOM   1571 C CE  . MET B 1 96  ? 22.919  10.794  14.498  1.00 51.84  ? 142  MET B CE  1 
ATOM   1572 N N   A GLN B 1 97  ? 27.354  14.060  12.119  0.50 49.15  ? 143  GLN B N   1 
ATOM   1573 N N   B GLN B 1 97  ? 27.358  14.054  12.119  0.50 49.28  ? 143  GLN B N   1 
ATOM   1574 C CA  A GLN B 1 97  ? 27.615  14.678  10.818  0.50 48.59  ? 143  GLN B CA  1 
ATOM   1575 C CA  B GLN B 1 97  ? 27.612  14.654  10.818  0.50 48.83  ? 143  GLN B CA  1 
ATOM   1576 C C   A GLN B 1 97  ? 29.062  14.466  10.389  0.50 47.16  ? 143  GLN B C   1 
ATOM   1577 C C   B GLN B 1 97  ? 29.065  14.488  10.384  0.50 47.31  ? 143  GLN B C   1 
ATOM   1578 O O   A GLN B 1 97  ? 29.320  14.200  9.223   0.50 45.78  ? 143  GLN B O   1 
ATOM   1579 O O   B GLN B 1 97  ? 29.328  14.269  9.209   0.50 45.98  ? 143  GLN B O   1 
ATOM   1580 C CB  A GLN B 1 97  ? 27.333  16.188  10.829  0.50 49.93  ? 143  GLN B CB  1 
ATOM   1581 C CB  B GLN B 1 97  ? 27.239  16.136  10.822  0.50 50.34  ? 143  GLN B CB  1 
ATOM   1582 C CG  A GLN B 1 97  ? 25.914  16.600  11.180  0.50 52.03  ? 143  GLN B CG  1 
ATOM   1583 C CG  B GLN B 1 97  ? 25.816  16.403  10.386  0.50 52.49  ? 143  GLN B CG  1 
ATOM   1584 C CD  A GLN B 1 97  ? 24.870  16.046  10.237  0.50 52.19  ? 143  GLN B CD  1 
ATOM   1585 C CD  B GLN B 1 97  ? 25.488  17.881  10.373  0.50 54.82  ? 143  GLN B CD  1 
ATOM   1586 O OE1 A GLN B 1 97  ? 25.189  15.368  9.262   0.50 52.10  ? 143  GLN B OE1 1 
ATOM   1587 O OE1 B GLN B 1 97  ? 25.358  18.491  9.311   0.50 55.98  ? 143  GLN B OE1 1 
ATOM   1588 N NE2 A GLN B 1 97  ? 23.606  16.343  10.522  0.50 54.57  ? 143  GLN B NE2 1 
ATOM   1589 N NE2 B GLN B 1 97  ? 25.371  18.468  11.556  0.50 56.24  ? 143  GLN B NE2 1 
ATOM   1590 N N   . ASP B 1 98  ? 30.000  14.603  11.325  1.00 47.66  ? 144  ASP B N   1 
ATOM   1591 C CA  . ASP B 1 98  ? 31.418  14.368  11.025  1.00 47.47  ? 144  ASP B CA  1 
ATOM   1592 C C   . ASP B 1 98  ? 31.691  12.909  10.642  1.00 45.76  ? 144  ASP B C   1 
ATOM   1593 O O   . ASP B 1 98  ? 32.446  12.657  9.706   1.00 45.77  ? 144  ASP B O   1 
ATOM   1594 C CB  . ASP B 1 98  ? 32.326  14.797  12.185  1.00 47.78  ? 144  ASP B CB  1 
ATOM   1595 C CG  . ASP B 1 98  ? 32.531  16.311  12.255  1.00 50.54  ? 144  ASP B CG  1 
ATOM   1596 O OD1 . ASP B 1 98  ? 32.173  17.034  11.305  1.00 50.61  ? 144  ASP B OD1 1 
ATOM   1597 O OD2 . ASP B 1 98  ? 33.064  16.784  13.274  1.00 52.31  ? 144  ASP B OD2 1 
ATOM   1598 N N   . PHE B 1 99  ? 31.078  11.956  11.347  1.00 45.34  ? 145  PHE B N   1 
ATOM   1599 C CA  . PHE B 1 99  ? 31.157  10.547  10.936  1.00 45.33  ? 145  PHE B CA  1 
ATOM   1600 C C   . PHE B 1 99  ? 30.645  10.404  9.510   1.00 44.38  ? 145  PHE B C   1 
ATOM   1601 O O   . PHE B 1 99  ? 31.282  9.763   8.685   1.00 44.01  ? 145  PHE B O   1 
ATOM   1602 C CB  . PHE B 1 99  ? 30.345  9.628   11.853  1.00 45.43  ? 145  PHE B CB  1 
ATOM   1603 C CG  . PHE B 1 99  ? 31.087  9.150   13.070  1.00 46.15  ? 145  PHE B CG  1 
ATOM   1604 C CD1 . PHE B 1 99  ? 31.991  8.101   12.979  1.00 47.92  ? 145  PHE B CD1 1 
ATOM   1605 C CD2 . PHE B 1 99  ? 30.841  9.712   14.317  1.00 47.80  ? 145  PHE B CD2 1 
ATOM   1606 C CE1 . PHE B 1 99  ? 32.661  7.629   14.115  1.00 49.40  ? 145  PHE B CE1 1 
ATOM   1607 C CE2 . PHE B 1 99  ? 31.504  9.256   15.452  1.00 49.97  ? 145  PHE B CE2 1 
ATOM   1608 C CZ  . PHE B 1 99  ? 32.415  8.206   15.351  1.00 49.79  ? 145  PHE B CZ  1 
ATOM   1609 N N   . ASN B 1 100 ? 29.498  11.014  9.218   1.00 44.54  ? 146  ASN B N   1 
ATOM   1610 C CA  . ASN B 1 100 ? 28.912  10.924  7.887   1.00 44.80  ? 146  ASN B CA  1 
ATOM   1611 C C   . ASN B 1 100 ? 29.832  11.509  6.810   1.00 44.66  ? 146  ASN B C   1 
ATOM   1612 O O   . ASN B 1 100 ? 29.976  10.935  5.727   1.00 44.36  ? 146  ASN B O   1 
ATOM   1613 C CB  . ASN B 1 100 ? 27.550  11.612  7.852   1.00 45.89  ? 146  ASN B CB  1 
ATOM   1614 C CG  . ASN B 1 100 ? 26.923  11.595  6.469   1.00 46.63  ? 146  ASN B CG  1 
ATOM   1615 O OD1 . ASN B 1 100 ? 26.509  10.543  5.977   1.00 49.59  ? 146  ASN B OD1 1 
ATOM   1616 N ND2 . ASN B 1 100 ? 26.832  12.754  5.846   1.00 46.28  ? 146  ASN B ND2 1 
ATOM   1617 N N   . THR B 1 101 ? 30.455  12.650  7.105   1.00 44.10  ? 147  THR B N   1 
ATOM   1618 C CA  . THR B 1 101 ? 31.383  13.256  6.156   1.00 43.73  ? 147  THR B CA  1 
ATOM   1619 C C   . THR B 1 101 ? 32.552  12.315  5.840   1.00 42.88  ? 147  THR B C   1 
ATOM   1620 O O   . THR B 1 101 ? 32.937  12.161  4.686   1.00 42.90  ? 147  THR B O   1 
ATOM   1621 C CB  . THR B 1 101 ? 31.908  14.603  6.675   1.00 44.28  ? 147  THR B CB  1 
ATOM   1622 O OG1 . THR B 1 101 ? 30.819  15.533  6.755   1.00 46.33  ? 147  THR B OG1 1 
ATOM   1623 C CG2 . THR B 1 101 ? 32.976  15.156  5.748   1.00 45.56  ? 147  THR B CG2 1 
ATOM   1624 N N   . MET B 1 102 ? 33.100  11.674  6.865   1.00 43.13  ? 148  MET B N   1 
ATOM   1625 C CA  . MET B 1 102 ? 34.171  10.704  6.669   1.00 43.14  ? 148  MET B CA  1 
ATOM   1626 C C   . MET B 1 102 ? 33.753  9.578   5.722   1.00 42.59  ? 148  MET B C   1 
ATOM   1627 O O   . MET B 1 102 ? 34.451  9.289   4.746   1.00 42.49  ? 148  MET B O   1 
ATOM   1628 C CB  . MET B 1 102 ? 34.616  10.131  8.012   1.00 43.41  ? 148  MET B CB  1 
ATOM   1629 C CG  . MET B 1 102 ? 35.663  9.033   7.920   1.00 43.67  ? 148  MET B CG  1 
ATOM   1630 S SD  . MET B 1 102 ? 36.024  8.354   9.543   1.00 45.26  ? 148  MET B SD  1 
ATOM   1631 C CE  . MET B 1 102 ? 34.499  7.490   9.886   1.00 44.11  ? 148  MET B CE  1 
ATOM   1632 N N   . PHE B 1 103 ? 32.612  8.952   5.989   1.00 42.97  ? 149  PHE B N   1 
ATOM   1633 C CA  . PHE B 1 103 ? 32.162  7.851   5.137   1.00 42.99  ? 149  PHE B CA  1 
ATOM   1634 C C   . PHE B 1 103 ? 31.852  8.351   3.716   1.00 42.83  ? 149  PHE B C   1 
ATOM   1635 O O   . PHE B 1 103 ? 32.306  7.770   2.736   1.00 43.69  ? 149  PHE B O   1 
ATOM   1636 C CB  . PHE B 1 103 ? 30.956  7.129   5.751   1.00 44.04  ? 149  PHE B CB  1 
ATOM   1637 C CG  . PHE B 1 103 ? 31.254  6.445   7.065   1.00 44.98  ? 149  PHE B CG  1 
ATOM   1638 C CD1 . PHE B 1 103 ? 32.269  5.510   7.161   1.00 44.87  ? 149  PHE B CD1 1 
ATOM   1639 C CD2 . PHE B 1 103 ? 30.494  6.718   8.193   1.00 47.49  ? 149  PHE B CD2 1 
ATOM   1640 C CE1 . PHE B 1 103 ? 32.535  4.871   8.363   1.00 46.39  ? 149  PHE B CE1 1 
ATOM   1641 C CE2 . PHE B 1 103 ? 30.757  6.088   9.398   1.00 48.40  ? 149  PHE B CE2 1 
ATOM   1642 C CZ  . PHE B 1 103 ? 31.785  5.170   9.485   1.00 46.31  ? 149  PHE B CZ  1 
ATOM   1643 N N   . THR B 1 104 ? 31.121  9.458   3.612   1.00 42.81  ? 150  THR B N   1 
ATOM   1644 C CA  . THR B 1 104 ? 30.742  10.010  2.309   1.00 42.05  ? 150  THR B CA  1 
ATOM   1645 C C   . THR B 1 104 ? 31.959  10.354  1.441   1.00 41.23  ? 150  THR B C   1 
ATOM   1646 O O   . THR B 1 104 ? 31.977  10.039  0.245   1.00 39.51  ? 150  THR B O   1 
ATOM   1647 C CB  . THR B 1 104 ? 29.804  11.228  2.482   1.00 43.30  ? 150  THR B CB  1 
ATOM   1648 O OG1 . THR B 1 104 ? 28.651  10.809  3.219   1.00 43.77  ? 150  THR B OG1 1 
ATOM   1649 C CG2 . THR B 1 104 ? 29.352  11.774  1.134   1.00 44.36  ? 150  THR B CG2 1 
ATOM   1650 N N   . ASN B 1 105 ? 32.973  10.976  2.046   1.00 41.21  ? 151  ASN B N   1 
ATOM   1651 C CA  . ASN B 1 105 ? 34.223  11.295  1.348   1.00 41.39  ? 151  ASN B CA  1 
ATOM   1652 C C   . ASN B 1 105 ? 34.798  10.036  0.706   1.00 41.69  ? 151  ASN B C   1 
ATOM   1653 O O   . ASN B 1 105 ? 35.261  10.062  -0.431  1.00 41.82  ? 151  ASN B O   1 
ATOM   1654 C CB  . ASN B 1 105 ? 35.279  11.852  2.317   1.00 41.09  ? 151  ASN B CB  1 
ATOM   1655 C CG  . ASN B 1 105 ? 34.998  13.284  2.776   1.00 42.60  ? 151  ASN B CG  1 
ATOM   1656 O OD1 . ASN B 1 105 ? 34.108  13.974  2.270   1.00 42.59  ? 151  ASN B OD1 1 
ATOM   1657 N ND2 . ASN B 1 105 ? 35.782  13.734  3.743   1.00 43.32  ? 151  ASN B ND2 1 
ATOM   1658 N N   . CYS B 1 106 ? 34.783  8.945   1.465   1.00 42.14  ? 152  CYS B N   1 
ATOM   1659 C CA  . CYS B 1 106 ? 35.292  7.667   0.988   1.00 42.38  ? 152  CYS B CA  1 
ATOM   1660 C C   . CYS B 1 106 ? 34.545  7.221   -0.275  1.00 42.60  ? 152  CYS B C   1 
ATOM   1661 O O   . CYS B 1 106 ? 35.175  6.866   -1.274  1.00 43.21  ? 152  CYS B O   1 
ATOM   1662 C CB  . CYS B 1 106 ? 35.210  6.609   2.082   1.00 42.65  ? 152  CYS B CB  1 
ATOM   1663 S SG  . CYS B 1 106 ? 36.065  5.090   1.652   1.00 46.86  ? 152  CYS B SG  1 
ATOM   1664 N N   . TYR B 1 107 ? 33.216  7.306   -0.253  1.00 42.45  ? 153  TYR B N   1 
ATOM   1665 C CA  . TYR B 1 107 ? 32.397  6.852   -1.388  1.00 43.03  ? 153  TYR B CA  1 
ATOM   1666 C C   . TYR B 1 107 ? 32.563  7.750   -2.603  1.00 44.32  ? 153  TYR B C   1 
ATOM   1667 O O   . TYR B 1 107 ? 32.585  7.271   -3.728  1.00 44.51  ? 153  TYR B O   1 
ATOM   1668 C CB  . TYR B 1 107 ? 30.907  6.781   -1.016  1.00 42.88  ? 153  TYR B CB  1 
ATOM   1669 C CG  . TYR B 1 107 ? 30.620  5.938   0.202   1.00 43.34  ? 153  TYR B CG  1 
ATOM   1670 C CD1 . TYR B 1 107 ? 31.222  4.687   0.364   1.00 43.49  ? 153  TYR B CD1 1 
ATOM   1671 C CD2 . TYR B 1 107 ? 29.745  6.380   1.192   1.00 40.49  ? 153  TYR B CD2 1 
ATOM   1672 C CE1 . TYR B 1 107 ? 30.963  3.916   1.474   1.00 45.24  ? 153  TYR B CE1 1 
ATOM   1673 C CE2 . TYR B 1 107 ? 29.495  5.615   2.316   1.00 42.00  ? 153  TYR B CE2 1 
ATOM   1674 C CZ  . TYR B 1 107 ? 30.112  4.385   2.450   1.00 43.87  ? 153  TYR B CZ  1 
ATOM   1675 O OH  . TYR B 1 107 ? 29.866  3.613   3.547   1.00 46.69  ? 153  TYR B OH  1 
ATOM   1676 N N   . ILE B 1 108 ? 32.661  9.058   -2.366  1.00 45.00  ? 154  ILE B N   1 
ATOM   1677 C CA  . ILE B 1 108 ? 32.778  10.027  -3.437  1.00 46.42  ? 154  ILE B CA  1 
ATOM   1678 C C   . ILE B 1 108 ? 34.129  9.940   -4.148  1.00 46.32  ? 154  ILE B C   1 
ATOM   1679 O O   . ILE B 1 108 ? 34.193  10.033  -5.373  1.00 47.05  ? 154  ILE B O   1 
ATOM   1680 C CB  . ILE B 1 108 ? 32.566  11.466  -2.901  1.00 47.18  ? 154  ILE B CB  1 
ATOM   1681 C CG1 . ILE B 1 108 ? 31.099  11.662  -2.494  1.00 48.79  ? 154  ILE B CG1 1 
ATOM   1682 C CG2 . ILE B 1 108 ? 32.968  12.501  -3.945  1.00 48.65  ? 154  ILE B CG2 1 
ATOM   1683 C CD1 . ILE B 1 108 ? 30.828  12.998  -1.738  1.00 52.56  ? 154  ILE B CD1 1 
ATOM   1684 N N   . TYR B 1 109 ? 35.205  9.781   -3.388  1.00 45.58  ? 155  TYR B N   1 
ATOM   1685 C CA  . TYR B 1 109 ? 36.540  9.797   -3.981  1.00 46.69  ? 155  TYR B CA  1 
ATOM   1686 C C   . TYR B 1 109 ? 36.939  8.474   -4.635  1.00 46.81  ? 155  TYR B C   1 
ATOM   1687 O O   . TYR B 1 109 ? 37.500  8.472   -5.729  1.00 47.78  ? 155  TYR B O   1 
ATOM   1688 C CB  . TYR B 1 109 ? 37.603  10.206  -2.954  1.00 47.86  ? 155  TYR B CB  1 
ATOM   1689 C CG  . TYR B 1 109 ? 38.987  10.174  -3.547  1.00 47.57  ? 155  TYR B CG  1 
ATOM   1690 C CD1 . TYR B 1 109 ? 39.423  11.192  -4.384  1.00 50.55  ? 155  TYR B CD1 1 
ATOM   1691 C CD2 . TYR B 1 109 ? 39.840  9.096   -3.319  1.00 48.40  ? 155  TYR B CD2 1 
ATOM   1692 C CE1 . TYR B 1 109 ? 40.684  11.153  -4.955  1.00 52.00  ? 155  TYR B CE1 1 
ATOM   1693 C CE2 . TYR B 1 109 ? 41.098  9.048   -3.888  1.00 50.19  ? 155  TYR B CE2 1 
ATOM   1694 C CZ  . TYR B 1 109 ? 41.516  10.076  -4.704  1.00 52.18  ? 155  TYR B CZ  1 
ATOM   1695 O OH  . TYR B 1 109 ? 42.767  10.031  -5.273  1.00 54.68  ? 155  TYR B OH  1 
ATOM   1696 N N   . ASN B 1 110 ? 36.664  7.356   -3.965  1.00 46.07  ? 156  ASN B N   1 
ATOM   1697 C CA  . ASN B 1 110 ? 37.160  6.054   -4.412  1.00 46.34  ? 156  ASN B CA  1 
ATOM   1698 C C   . ASN B 1 110 ? 36.292  5.384   -5.474  1.00 47.48  ? 156  ASN B C   1 
ATOM   1699 O O   . ASN B 1 110 ? 35.149  5.776   -5.690  1.00 46.73  ? 156  ASN B O   1 
ATOM   1700 C CB  . ASN B 1 110 ? 37.352  5.155   -3.199  1.00 45.25  ? 156  ASN B CB  1 
ATOM   1701 C CG  . ASN B 1 110 ? 38.431  5.680   -2.287  1.00 45.21  ? 156  ASN B CG  1 
ATOM   1702 O OD1 . ASN B 1 110 ? 39.604  5.626   -2.631  1.00 49.46  ? 156  ASN B OD1 1 
ATOM   1703 N ND2 . ASN B 1 110 ? 38.044  6.226   -1.143  1.00 42.47  ? 156  ASN B ND2 1 
ATOM   1704 N N   . LYS B 1 111 ? 36.854  4.394   -6.161  1.00 48.78  ? 157  LYS B N   1 
ATOM   1705 C CA  . LYS B 1 111 ? 36.113  3.677   -7.194  1.00 50.46  ? 157  LYS B CA  1 
ATOM   1706 C C   . LYS B 1 111 ? 35.138  2.733   -6.493  1.00 48.79  ? 157  LYS B C   1 
ATOM   1707 O O   . LYS B 1 111 ? 35.440  2.230   -5.407  1.00 48.50  ? 157  LYS B O   1 
ATOM   1708 C CB  . LYS B 1 111 ? 37.040  2.882   -8.117  1.00 52.93  ? 157  LYS B CB  1 
ATOM   1709 C CG  . LYS B 1 111 ? 38.090  3.715   -8.832  1.00 55.55  ? 157  LYS B CG  1 
ATOM   1710 C CD  . LYS B 1 111 ? 38.984  2.839   -9.684  1.00 59.59  ? 157  LYS B CD  1 
ATOM   1711 C CE  . LYS B 1 111 ? 40.233  3.580   -10.140 1.00 61.96  ? 157  LYS B CE  1 
ATOM   1712 N NZ  . LYS B 1 111 ? 41.027  2.742   -11.084 1.00 66.72  ? 157  LYS B NZ  1 
ATOM   1713 N N   . PRO B 1 112 ? 33.961  2.502   -7.097  1.00 48.40  ? 158  PRO B N   1 
ATOM   1714 C CA  . PRO B 1 112 ? 32.970  1.629   -6.467  1.00 47.39  ? 158  PRO B CA  1 
ATOM   1715 C C   . PRO B 1 112 ? 33.510  0.251   -6.084  1.00 47.88  ? 158  PRO B C   1 
ATOM   1716 O O   . PRO B 1 112 ? 33.068  -0.319  -5.093  1.00 47.81  ? 158  PRO B O   1 
ATOM   1717 C CB  . PRO B 1 112 ? 31.902  1.503   -7.544  1.00 47.89  ? 158  PRO B CB  1 
ATOM   1718 C CG  . PRO B 1 112 ? 31.971  2.808   -8.259  1.00 48.54  ? 158  PRO B CG  1 
ATOM   1719 C CD  . PRO B 1 112 ? 33.430  3.118   -8.330  1.00 49.01  ? 158  PRO B CD  1 
ATOM   1720 N N   . THR B 1 113 ? 34.467  -0.251  -6.858  1.00 48.98  ? 159  THR B N   1 
ATOM   1721 C CA  . THR B 1 113 ? 35.030  -1.588  -6.665  1.00 50.97  ? 159  THR B CA  1 
ATOM   1722 C C   . THR B 1 113 ? 36.199  -1.646  -5.666  1.00 50.52  ? 159  THR B C   1 
ATOM   1723 O O   . THR B 1 113 ? 36.703  -2.737  -5.362  1.00 51.24  ? 159  THR B O   1 
ATOM   1724 C CB  . THR B 1 113 ? 35.504  -2.149  -8.023  1.00 53.25  ? 159  THR B CB  1 
ATOM   1725 O OG1 . THR B 1 113 ? 36.333  -1.175  -8.670  1.00 56.29  ? 159  THR B OG1 1 
ATOM   1726 C CG2 . THR B 1 113 ? 34.311  -2.441  -8.913  1.00 55.02  ? 159  THR B CG2 1 
ATOM   1727 N N   . ASP B 1 114 ? 36.632  -0.495  -5.153  1.00 49.08  ? 160  ASP B N   1 
ATOM   1728 C CA  . ASP B 1 114 ? 37.758  -0.451  -4.211  1.00 48.68  ? 160  ASP B CA  1 
ATOM   1729 C C   . ASP B 1 114 ? 37.400  -1.110  -2.876  1.00 47.89  ? 160  ASP B C   1 
ATOM   1730 O O   . ASP B 1 114 ? 36.286  -0.933  -2.364  1.00 46.67  ? 160  ASP B O   1 
ATOM   1731 C CB  . ASP B 1 114 ? 38.207  0.995   -3.961  1.00 48.07  ? 160  ASP B CB  1 
ATOM   1732 C CG  . ASP B 1 114 ? 38.977  1.591   -5.127  1.00 50.18  ? 160  ASP B CG  1 
ATOM   1733 O OD1 . ASP B 1 114 ? 39.495  0.829   -5.962  1.00 51.99  ? 160  ASP B OD1 1 
ATOM   1734 O OD2 . ASP B 1 114 ? 39.087  2.837   -5.192  1.00 52.27  ? 160  ASP B OD2 1 
ATOM   1735 N N   . ASP B 1 115 ? 38.347  -1.858  -2.309  1.00 47.96  ? 161  ASP B N   1 
ATOM   1736 C CA  . ASP B 1 115 ? 38.161  -2.476  -0.993  1.00 47.58  ? 161  ASP B CA  1 
ATOM   1737 C C   . ASP B 1 115 ? 37.761  -1.471  0.082   1.00 46.13  ? 161  ASP B C   1 
ATOM   1738 O O   . ASP B 1 115 ? 36.945  -1.790  0.947   1.00 46.07  ? 161  ASP B O   1 
ATOM   1739 C CB  . ASP B 1 115 ? 39.435  -3.199  -0.527  1.00 48.90  ? 161  ASP B CB  1 
ATOM   1740 C CG  . ASP B 1 115 ? 39.775  -4.421  -1.364  1.00 52.18  ? 161  ASP B CG  1 
ATOM   1741 O OD1 . ASP B 1 115 ? 39.004  -4.817  -2.276  1.00 53.09  ? 161  ASP B OD1 1 
ATOM   1742 O OD2 . ASP B 1 115 ? 40.850  -4.996  -1.106  1.00 53.56  ? 161  ASP B OD2 1 
ATOM   1743 N N   . ILE B 1 116 ? 38.333  -0.266  0.040   1.00 46.21  ? 162  ILE B N   1 
ATOM   1744 C CA  . ILE B 1 116 ? 38.077  0.740   1.077   1.00 46.08  ? 162  ILE B CA  1 
ATOM   1745 C C   . ILE B 1 116 ? 36.600  1.135   1.156   1.00 44.51  ? 162  ILE B C   1 
ATOM   1746 O O   . ILE B 1 116 ? 36.092  1.449   2.240   1.00 43.21  ? 162  ILE B O   1 
ATOM   1747 C CB  . ILE B 1 116 ? 38.975  2.007   0.907   1.00 47.13  ? 162  ILE B CB  1 
ATOM   1748 C CG1 . ILE B 1 116 ? 39.031  2.775   2.242   1.00 46.92  ? 162  ILE B CG1 1 
ATOM   1749 C CG2 . ILE B 1 116 ? 38.499  2.862   -0.300  1.00 46.91  ? 162  ILE B CG2 1 
ATOM   1750 C CD1 . ILE B 1 116 ? 39.768  4.066   2.205   1.00 49.43  ? 162  ILE B CD1 1 
ATOM   1751 N N   . VAL B 1 117 ? 35.906  1.082   0.019   1.00 44.18  ? 163  VAL B N   1 
ATOM   1752 C CA  . VAL B 1 117 ? 34.464  1.317   -0.016  1.00 44.24  ? 163  VAL B CA  1 
ATOM   1753 C C   . VAL B 1 117 ? 33.712  0.272   0.812   1.00 44.98  ? 163  VAL B C   1 
ATOM   1754 O O   . VAL B 1 117 ? 32.838  0.611   1.613   1.00 45.46  ? 163  VAL B O   1 
ATOM   1755 C CB  . VAL B 1 117 ? 33.930  1.318   -1.467  1.00 44.24  ? 163  VAL B CB  1 
ATOM   1756 C CG1 . VAL B 1 117 ? 32.417  1.322   -1.493  1.00 43.72  ? 163  VAL B CG1 1 
ATOM   1757 C CG2 . VAL B 1 117 ? 34.484  2.516   -2.218  1.00 44.45  ? 163  VAL B CG2 1 
ATOM   1758 N N   . LEU B 1 118 ? 34.067  -0.994  0.625   1.00 45.25  ? 164  LEU B N   1 
ATOM   1759 C CA  . LEU B 1 118 ? 33.467  -2.081  1.388   1.00 46.42  ? 164  LEU B CA  1 
ATOM   1760 C C   . LEU B 1 118 ? 33.750  -1.913  2.893   1.00 45.57  ? 164  LEU B C   1 
ATOM   1761 O O   . LEU B 1 118 ? 32.876  -2.141  3.737   1.00 44.18  ? 164  LEU B O   1 
ATOM   1762 C CB  . LEU B 1 118 ? 34.035  -3.403  0.880   1.00 49.87  ? 164  LEU B CB  1 
ATOM   1763 C CG  . LEU B 1 118 ? 33.356  -4.688  1.301   1.00 54.52  ? 164  LEU B CG  1 
ATOM   1764 C CD1 . LEU B 1 118 ? 31.882  -4.684  0.861   1.00 58.26  ? 164  LEU B CD1 1 
ATOM   1765 C CD2 . LEU B 1 118 ? 34.122  -5.862  0.699   1.00 58.10  ? 164  LEU B CD2 1 
ATOM   1766 N N   . MET B 1 119 ? 34.972  -1.497  3.212   1.00 44.36  ? 165  MET B N   1 
ATOM   1767 C CA  . MET B 1 119 ? 35.394  -1.287  4.603   1.00 44.56  ? 165  MET B CA  1 
ATOM   1768 C C   . MET B 1 119 ? 34.601  -0.154  5.269   1.00 44.34  ? 165  MET B C   1 
ATOM   1769 O O   . MET B 1 119 ? 34.147  -0.284  6.413   1.00 44.47  ? 165  MET B O   1 
ATOM   1770 C CB  . MET B 1 119 ? 36.893  -1.002  4.640   1.00 45.33  ? 165  MET B CB  1 
ATOM   1771 C CG  . MET B 1 119 ? 37.745  -2.207  4.239   1.00 47.73  ? 165  MET B CG  1 
ATOM   1772 S SD  . MET B 1 119 ? 39.455  -1.824  3.799   1.00 48.67  ? 165  MET B SD  1 
ATOM   1773 C CE  . MET B 1 119 ? 40.228  -1.848  5.415   1.00 49.21  ? 165  MET B CE  1 
ATOM   1774 N N   . ALA B 1 120 ? 34.427  0.947   4.549   1.00 43.38  ? 166  ALA B N   1 
ATOM   1775 C CA  . ALA B 1 120 ? 33.606  2.055   5.037   1.00 43.67  ? 166  ALA B CA  1 
ATOM   1776 C C   . ALA B 1 120 ? 32.159  1.622   5.277   1.00 43.84  ? 166  ALA B C   1 
ATOM   1777 O O   . ALA B 1 120 ? 31.591  1.923   6.332   1.00 44.78  ? 166  ALA B O   1 
ATOM   1778 C CB  . ALA B 1 120 ? 33.660  3.243   4.069   1.00 42.47  ? 166  ALA B CB  1 
ATOM   1779 N N   . GLN B 1 121 ? 31.570  0.929   4.304   1.00 44.70  ? 167  GLN B N   1 
ATOM   1780 C CA  . GLN B 1 121 ? 30.194  0.428   4.419   1.00 45.64  ? 167  GLN B CA  1 
ATOM   1781 C C   . GLN B 1 121 ? 29.992  -0.414  5.686   1.00 45.94  ? 167  GLN B C   1 
ATOM   1782 O O   . GLN B 1 121 ? 28.983  -0.281  6.367   1.00 46.44  ? 167  GLN B O   1 
ATOM   1783 C CB  . GLN B 1 121 ? 29.795  -0.396  3.183   1.00 47.12  ? 167  GLN B CB  1 
ATOM   1784 C CG  . GLN B 1 121 ? 29.542  0.429   1.916   1.00 49.29  ? 167  GLN B CG  1 
ATOM   1785 C CD  . GLN B 1 121 ? 29.237  -0.419  0.691   1.00 53.67  ? 167  GLN B CD  1 
ATOM   1786 O OE1 . GLN B 1 121 ? 30.050  -1.241  0.266   1.00 58.00  ? 167  GLN B OE1 1 
ATOM   1787 N NE2 . GLN B 1 121 ? 28.059  -0.212  0.107   1.00 56.22  ? 167  GLN B NE2 1 
ATOM   1788 N N   . THR B 1 122 ? 30.946  -1.294  5.981   1.00 46.19  ? 168  THR B N   1 
ATOM   1789 C CA  . THR B 1 122 ? 30.886  -2.142  7.174   1.00 46.82  ? 168  THR B CA  1 
ATOM   1790 C C   . THR B 1 122 ? 30.891  -1.297  8.455   1.00 46.80  ? 168  THR B C   1 
ATOM   1791 O O   . THR B 1 122 ? 30.048  -1.479  9.335   1.00 47.07  ? 168  THR B O   1 
ATOM   1792 C CB  . THR B 1 122 ? 32.061  -3.143  7.177   1.00 47.50  ? 168  THR B CB  1 
ATOM   1793 O OG1 . THR B 1 122 ? 32.049  -3.874  5.944   1.00 47.06  ? 168  THR B OG1 1 
ATOM   1794 C CG2 . THR B 1 122 ? 31.974  -4.122  8.362   1.00 48.31  ? 168  THR B CG2 1 
ATOM   1795 N N   . LEU B 1 123 ? 31.818  -0.351  8.538   1.00 46.53  ? 169  LEU B N   1 
ATOM   1796 C CA  . LEU B 1 123 ? 31.920  0.520   9.709   1.00 47.36  ? 169  LEU B CA  1 
ATOM   1797 C C   . LEU B 1 123 ? 30.679  1.397   9.849   1.00 47.10  ? 169  LEU B C   1 
ATOM   1798 O O   . LEU B 1 123 ? 30.180  1.620   10.961  1.00 47.55  ? 169  LEU B O   1 
ATOM   1799 C CB  . LEU B 1 123 ? 33.178  1.390   9.624   1.00 47.30  ? 169  LEU B CB  1 
ATOM   1800 C CG  . LEU B 1 123 ? 34.510  0.629   9.649   1.00 49.00  ? 169  LEU B CG  1 
ATOM   1801 C CD1 . LEU B 1 123 ? 35.656  1.553   9.248   1.00 49.69  ? 169  LEU B CD1 1 
ATOM   1802 C CD2 . LEU B 1 123 ? 34.761  0.002   11.012  1.00 49.48  ? 169  LEU B CD2 1 
ATOM   1803 N N   . GLU B 1 124 ? 30.176  1.867   8.710   1.00 46.60  ? 170  GLU B N   1 
ATOM   1804 C CA  . GLU B 1 124 ? 29.028  2.763   8.672   1.00 46.72  ? 170  GLU B CA  1 
ATOM   1805 C C   . GLU B 1 124 ? 27.777  2.043   9.173   1.00 47.47  ? 170  GLU B C   1 
ATOM   1806 O O   . GLU B 1 124 ? 26.972  2.623   9.909   1.00 47.04  ? 170  GLU B O   1 
ATOM   1807 C CB  . GLU B 1 124 ? 28.837  3.288   7.245   1.00 46.63  ? 170  GLU B CB  1 
ATOM   1808 C CG  . GLU B 1 124 ? 27.814  4.367   7.099   1.00 48.97  ? 170  GLU B CG  1 
ATOM   1809 C CD  . GLU B 1 124 ? 27.755  4.911   5.678   1.00 50.88  ? 170  GLU B CD  1 
ATOM   1810 O OE1 . GLU B 1 124 ? 27.643  4.114   4.717   1.00 54.33  ? 170  GLU B OE1 1 
ATOM   1811 O OE2 . GLU B 1 124 ? 27.809  6.138   5.530   1.00 52.45  ? 170  GLU B OE2 1 
ATOM   1812 N N   . LYS B 1 125 ? 27.627  0.768   8.801   1.00 48.71  ? 171  LYS B N   1 
ATOM   1813 C CA  . LYS B 1 125 ? 26.520  -0.039  9.309   1.00 49.34  ? 171  LYS B CA  1 
ATOM   1814 C C   . LYS B 1 125 ? 26.581  -0.186  10.839  1.00 50.20  ? 171  LYS B C   1 
ATOM   1815 O O   . LYS B 1 125 ? 25.557  -0.102  11.522  1.00 50.44  ? 171  LYS B O   1 
ATOM   1816 C CB  . LYS B 1 125 ? 26.485  -1.411  8.625   1.00 51.33  ? 171  LYS B CB  1 
ATOM   1817 C CG  . LYS B 1 125 ? 25.931  -1.393  7.192   1.00 54.99  ? 171  LYS B CG  1 
ATOM   1818 C CD  . LYS B 1 125 ? 26.517  -2.532  6.346   1.00 58.21  ? 171  LYS B CD  1 
ATOM   1819 C CE  . LYS B 1 125 ? 25.693  -2.879  5.099   1.00 60.53  ? 171  LYS B CE  1 
ATOM   1820 N NZ  . LYS B 1 125 ? 24.803  -1.804  4.590   1.00 62.08  ? 171  LYS B NZ  1 
ATOM   1821 N N   . ILE B 1 126 ? 27.776  -0.390  11.380  1.00 50.23  ? 172  ILE B N   1 
ATOM   1822 C CA  . ILE B 1 126 ? 27.956  -0.501  12.831  1.00 51.67  ? 172  ILE B CA  1 
ATOM   1823 C C   . ILE B 1 126 ? 27.630  0.825   13.516  1.00 51.03  ? 172  ILE B C   1 
ATOM   1824 O O   . ILE B 1 126 ? 26.945  0.860   14.536  1.00 52.15  ? 172  ILE B O   1 
ATOM   1825 C CB  . ILE B 1 126 ? 29.395  -0.952  13.188  1.00 52.07  ? 172  ILE B CB  1 
ATOM   1826 C CG1 . ILE B 1 126 ? 29.640  -2.377  12.678  1.00 52.69  ? 172  ILE B CG1 1 
ATOM   1827 C CG2 . ILE B 1 126 ? 29.629  -0.893  14.694  1.00 53.49  ? 172  ILE B CG2 1 
ATOM   1828 C CD1 . ILE B 1 126 ? 31.103  -2.732  12.576  1.00 54.07  ? 172  ILE B CD1 1 
ATOM   1829 N N   . PHE B 1 127 ? 28.122  1.916   12.943  1.00 49.93  ? 173  PHE B N   1 
ATOM   1830 C CA  . PHE B 1 127 ? 27.809  3.267   13.426  1.00 49.56  ? 173  PHE B CA  1 
ATOM   1831 C C   . PHE B 1 127 ? 26.294  3.458   13.594  1.00 50.34  ? 173  PHE B C   1 
ATOM   1832 O O   . PHE B 1 127 ? 25.817  3.839   14.673  1.00 50.96  ? 173  PHE B O   1 
ATOM   1833 C CB  . PHE B 1 127 ? 28.422  4.291   12.458  1.00 48.22  ? 173  PHE B CB  1 
ATOM   1834 C CG  . PHE B 1 127 ? 27.931  5.699   12.640  1.00 48.77  ? 173  PHE B CG  1 
ATOM   1835 C CD1 . PHE B 1 127 ? 28.430  6.494   13.654  1.00 48.77  ? 173  PHE B CD1 1 
ATOM   1836 C CD2 . PHE B 1 127 ? 26.992  6.236   11.769  1.00 49.30  ? 173  PHE B CD2 1 
ATOM   1837 C CE1 . PHE B 1 127 ? 27.981  7.804   13.813  1.00 49.29  ? 173  PHE B CE1 1 
ATOM   1838 C CE2 . PHE B 1 127 ? 26.537  7.536   11.924  1.00 49.61  ? 173  PHE B CE2 1 
ATOM   1839 C CZ  . PHE B 1 127 ? 27.037  8.322   12.948  1.00 49.64  ? 173  PHE B CZ  1 
ATOM   1840 N N   . LEU B 1 128 ? 25.532  3.148   12.551  1.00 49.78  ? 174  LEU B N   1 
ATOM   1841 C CA  . LEU B 1 128 ? 24.078  3.314   12.608  1.00 51.65  ? 174  LEU B CA  1 
ATOM   1842 C C   . LEU B 1 128 ? 23.410  2.383   13.614  1.00 53.53  ? 174  LEU B C   1 
ATOM   1843 O O   . LEU B 1 128 ? 22.492  2.800   14.323  1.00 53.70  ? 174  LEU B O   1 
ATOM   1844 C CB  . LEU B 1 128 ? 23.445  3.116   11.233  1.00 51.89  ? 174  LEU B CB  1 
ATOM   1845 C CG  . LEU B 1 128 ? 23.672  4.242   10.237  1.00 52.65  ? 174  LEU B CG  1 
ATOM   1846 C CD1 . LEU B 1 128 ? 23.041  3.852   8.917   1.00 54.82  ? 174  LEU B CD1 1 
ATOM   1847 C CD2 . LEU B 1 128 ? 23.098  5.562   10.739  1.00 52.65  ? 174  LEU B CD2 1 
ATOM   1848 N N   . GLN B 1 129 ? 23.862  1.128   13.662  1.00 54.25  ? 175  GLN B N   1 
ATOM   1849 C CA  . GLN B 1 129 ? 23.381  0.167   14.660  1.00 56.82  ? 175  GLN B CA  1 
ATOM   1850 C C   . GLN B 1 129 ? 23.548  0.727   16.073  1.00 57.29  ? 175  GLN B C   1 
ATOM   1851 O O   . GLN B 1 129 ? 22.614  0.685   16.868  1.00 58.61  ? 175  GLN B O   1 
ATOM   1852 C CB  . GLN B 1 129 ? 24.113  -1.182  14.536  1.00 58.15  ? 175  GLN B CB  1 
ATOM   1853 C CG  . GLN B 1 129 ? 23.534  -2.118  13.478  1.00 62.83  ? 175  GLN B CG  1 
ATOM   1854 C CD  . GLN B 1 129 ? 24.426  -3.330  13.181  1.00 67.46  ? 175  GLN B CD  1 
ATOM   1855 O OE1 . GLN B 1 129 ? 25.283  -3.707  13.985  1.00 70.96  ? 175  GLN B OE1 1 
ATOM   1856 N NE2 . GLN B 1 129 ? 24.221  -3.942  12.017  1.00 69.14  ? 175  GLN B NE2 1 
ATOM   1857 N N   . LYS B 1 130 ? 24.727  1.271   16.373  1.00 55.72  ? 176  LYS B N   1 
ATOM   1858 C CA  . LYS B 1 130 ? 25.019  1.782   17.716  1.00 56.94  ? 176  LYS B CA  1 
ATOM   1859 C C   . LYS B 1 130 ? 24.300  3.104   17.999  1.00 56.65  ? 176  LYS B C   1 
ATOM   1860 O O   . LYS B 1 130 ? 23.817  3.327   19.115  1.00 57.37  ? 176  LYS B O   1 
ATOM   1861 C CB  . LYS B 1 130 ? 26.528  1.941   17.927  1.00 56.50  ? 176  LYS B CB  1 
ATOM   1862 C CG  . LYS B 1 130 ? 27.322  0.653   17.826  1.00 59.07  ? 176  LYS B CG  1 
ATOM   1863 C CD  . LYS B 1 130 ? 27.018  -0.300  18.970  1.00 64.44  ? 176  LYS B CD  1 
ATOM   1864 C CE  . LYS B 1 130 ? 28.028  -1.434  19.023  1.00 65.93  ? 176  LYS B CE  1 
ATOM   1865 N NZ  . LYS B 1 130 ? 27.773  -2.331  20.178  1.00 68.99  ? 176  LYS B NZ  1 
ATOM   1866 N N   . VAL B 1 131 ? 24.231  3.977   16.993  1.00 54.62  ? 177  VAL B N   1 
ATOM   1867 C CA  . VAL B 1 131 ? 23.446  5.213   17.092  1.00 55.22  ? 177  VAL B CA  1 
ATOM   1868 C C   . VAL B 1 131 ? 21.966  4.938   17.411  1.00 56.57  ? 177  VAL B C   1 
ATOM   1869 O O   . VAL B 1 131 ? 21.325  5.737   18.093  1.00 57.92  ? 177  VAL B O   1 
ATOM   1870 C CB  . VAL B 1 131 ? 23.571  6.071   15.804  1.00 53.69  ? 177  VAL B CB  1 
ATOM   1871 C CG1 . VAL B 1 131 ? 22.494  7.141   15.740  1.00 55.73  ? 177  VAL B CG1 1 
ATOM   1872 C CG2 . VAL B 1 131 ? 24.953  6.712   15.733  1.00 53.99  ? 177  VAL B CG2 1 
ATOM   1873 N N   . ALA B 1 132 ? 21.438  3.811   16.930  1.00 56.69  ? 178  ALA B N   1 
ATOM   1874 C CA  . ALA B 1 132 ? 20.057  3.410   17.220  1.00 59.41  ? 178  ALA B CA  1 
ATOM   1875 C C   . ALA B 1 132 ? 19.777  3.288   18.716  1.00 62.08  ? 178  ALA B C   1 
ATOM   1876 O O   . ALA B 1 132 ? 18.638  3.473   19.147  1.00 64.23  ? 178  ALA B O   1 
ATOM   1877 C CB  . ALA B 1 132 ? 19.726  2.093   16.527  1.00 59.50  ? 178  ALA B CB  1 
ATOM   1878 N N   . SER B 1 133 ? 20.811  2.983   19.498  1.00 62.75  ? 179  SER B N   1 
ATOM   1879 C CA  . SER B 1 133 ? 20.673  2.779   20.939  1.00 65.69  ? 179  SER B CA  1 
ATOM   1880 C C   . SER B 1 133 ? 21.216  3.937   21.782  1.00 66.80  ? 179  SER B C   1 
ATOM   1881 O O   . SER B 1 133 ? 21.401  3.789   22.991  1.00 68.03  ? 179  SER B O   1 
ATOM   1882 C CB  . SER B 1 133 ? 21.375  1.480   21.335  1.00 66.11  ? 179  SER B CB  1 
ATOM   1883 O OG  . SER B 1 133 ? 20.873  0.397   20.581  1.00 67.32  ? 179  SER B OG  1 
ATOM   1884 N N   . MET B 1 134 ? 21.462  5.087   21.154  1.00 66.66  ? 180  MET B N   1 
ATOM   1885 C CA  . MET B 1 134 ? 21.905  6.282   21.874  1.00 68.41  ? 180  MET B CA  1 
ATOM   1886 C C   . MET B 1 134 ? 20.726  6.847   22.682  1.00 72.00  ? 180  MET B C   1 
ATOM   1887 O O   . MET B 1 134 ? 19.591  6.787   22.218  1.00 72.07  ? 180  MET B O   1 
ATOM   1888 C CB  . MET B 1 134 ? 22.415  7.324   20.878  1.00 67.01  ? 180  MET B CB  1 
ATOM   1889 C CG  . MET B 1 134 ? 23.044  8.563   21.493  1.00 67.57  ? 180  MET B CG  1 
ATOM   1890 S SD  . MET B 1 134 ? 23.762  9.656   20.247  1.00 67.54  ? 180  MET B SD  1 
ATOM   1891 C CE  . MET B 1 134 ? 22.302  10.177  19.353  1.00 66.30  ? 180  MET B CE  1 
ATOM   1892 N N   . PRO B 1 135 ? 20.984  7.371   23.902  1.00 75.65  ? 181  PRO B N   1 
ATOM   1893 C CA  . PRO B 1 135 ? 19.933  8.026   24.704  1.00 79.32  ? 181  PRO B CA  1 
ATOM   1894 C C   . PRO B 1 135 ? 19.200  9.148   23.953  1.00 80.64  ? 181  PRO B C   1 
ATOM   1895 O O   . PRO B 1 135 ? 19.827  9.874   23.178  1.00 78.55  ? 181  PRO B O   1 
ATOM   1896 C CB  . PRO B 1 135 ? 20.711  8.587   25.893  1.00 80.40  ? 181  PRO B CB  1 
ATOM   1897 C CG  . PRO B 1 135 ? 21.854  7.640   26.060  1.00 78.97  ? 181  PRO B CG  1 
ATOM   1898 C CD  . PRO B 1 135 ? 22.233  7.206   24.674  1.00 75.83  ? 181  PRO B CD  1 
ATOM   1899 N N   . GLN B 1 136 ? 17.892  9.289   24.193  1.00 84.21  ? 182  GLN B N   1 
ATOM   1900 C CA  . GLN B 1 136 ? 17.027  10.122  23.331  1.00 85.58  ? 182  GLN B CA  1 
ATOM   1901 C C   . GLN B 1 136 ? 17.237  11.632  23.494  1.00 86.62  ? 182  GLN B C   1 
ATOM   1902 O O   . GLN B 1 136 ? 17.331  12.358  22.497  1.00 85.42  ? 182  GLN B O   1 
ATOM   1903 C CB  . GLN B 1 136 ? 15.537  9.761   23.515  1.00 88.21  ? 182  GLN B CB  1 
ATOM   1904 C CG  . GLN B 1 136 ? 14.843  10.362  24.746  1.00 92.63  ? 182  GLN B CG  1 
ATOM   1905 C CD  . GLN B 1 136 ? 13.415  9.856   24.940  1.00 96.16  ? 182  GLN B CD  1 
ATOM   1906 O OE1 . GLN B 1 136 ? 12.715  9.545   23.973  1.00 97.28  ? 182  GLN B OE1 1 
ATOM   1907 N NE2 . GLN B 1 136 ? 12.977  9.783   26.195  1.00 98.21  ? 182  GLN B NE2 1 
ATOM   1908 N N   . GLU B 1 137 ? 17.310  12.095  24.741  1.00 89.09  ? 183  GLU B N   1 
ATOM   1909 C CA  . GLU B 1 137 ? 17.429  13.522  25.046  1.00 90.52  ? 183  GLU B CA  1 
ATOM   1910 C C   . GLU B 1 137 ? 18.876  13.889  25.368  1.00 90.00  ? 183  GLU B C   1 
ATOM   1911 O O   . GLU B 1 137 ? 19.542  13.194  26.137  1.00 90.86  ? 183  GLU B O   1 
ATOM   1912 C CB  . GLU B 1 137 ? 16.522  13.891  26.227  1.00 93.37  ? 183  GLU B CB  1 
ATOM   1913 N N   . GLU B 1 138 ? 19.354  14.984  24.781  1.00 89.32  ? 184  GLU B N   1 
ATOM   1914 C CA  . GLU B 1 138 ? 20.711  15.469  25.029  1.00 88.74  ? 184  GLU B CA  1 
ATOM   1915 C C   . GLU B 1 138 ? 20.781  16.220  26.362  1.00 91.15  ? 184  GLU B C   1 
ATOM   1916 O O   . GLU B 1 138 ? 19.949  17.082  26.630  1.00 92.89  ? 184  GLU B O   1 
ATOM   1917 C CB  . GLU B 1 138 ? 21.158  16.386  23.888  1.00 87.20  ? 184  GLU B CB  1 
ATOM   1918 N N   . GLN B 1 139 ? 21.778  15.889  27.183  1.00 91.41  ? 185  GLN B N   1 
ATOM   1919 C CA  . GLN B 1 139 ? 21.962  16.514  28.496  1.00 93.65  ? 185  GLN B CA  1 
ATOM   1920 C C   . GLN B 1 139 ? 22.581  17.905  28.367  1.00 93.85  ? 185  GLN B C   1 
ATOM   1921 O O   . GLN B 1 139 ? 23.413  18.310  29.182  1.00 94.89  ? 185  GLN B O   1 
ATOM   1922 C CB  . GLN B 1 139 ? 22.843  15.631  29.384  1.00 93.96  ? 185  GLN B CB  1 
ATOM   1923 N N   . ASN C 1 31  ? -5.619  39.145  23.628  1.00 89.63  ? 77   ASN C N   1 
ATOM   1924 C CA  . ASN C 1 31  ? -4.169  38.920  23.897  1.00 88.97  ? 77   ASN C CA  1 
ATOM   1925 C C   . ASN C 1 31  ? -3.871  37.558  24.534  1.00 84.90  ? 77   ASN C C   1 
ATOM   1926 O O   . ASN C 1 31  ? -2.809  36.984  24.286  1.00 83.49  ? 77   ASN C O   1 
ATOM   1927 C CB  . ASN C 1 31  ? -3.598  40.053  24.760  1.00 92.32  ? 77   ASN C CB  1 
ATOM   1928 C CG  . ASN C 1 31  ? -2.919  41.136  23.928  1.00 97.52  ? 77   ASN C CG  1 
ATOM   1929 O OD1 . ASN C 1 31  ? -1.956  40.865  23.207  1.00 98.87  ? 77   ASN C OD1 1 
ATOM   1930 N ND2 . ASN C 1 31  ? -3.417  42.368  24.025  1.00 101.85 ? 77   ASN C ND2 1 
ATOM   1931 N N   . GLN C 1 32  ? -4.801  37.051  25.346  1.00 82.80  ? 78   GLN C N   1 
ATOM   1932 C CA  . GLN C 1 32  ? -4.662  35.722  25.955  1.00 79.29  ? 78   GLN C CA  1 
ATOM   1933 C C   . GLN C 1 32  ? -4.518  34.622  24.906  1.00 75.70  ? 78   GLN C C   1 
ATOM   1934 O O   . GLN C 1 32  ? -3.564  33.845  24.944  1.00 73.62  ? 78   GLN C O   1 
ATOM   1935 C CB  . GLN C 1 32  ? -5.862  35.394  26.853  1.00 79.40  ? 78   GLN C CB  1 
ATOM   1936 C CG  . GLN C 1 32  ? -5.720  35.850  28.287  1.00 81.63  ? 78   GLN C CG  1 
ATOM   1937 C CD  . GLN C 1 32  ? -6.813  35.293  29.181  1.00 81.64  ? 78   GLN C CD  1 
ATOM   1938 O OE1 . GLN C 1 32  ? -7.966  35.166  28.770  1.00 83.61  ? 78   GLN C OE1 1 
ATOM   1939 N NE2 . GLN C 1 32  ? -6.453  34.952  30.406  1.00 81.62  ? 78   GLN C NE2 1 
ATOM   1940 N N   . LEU C 1 33  ? -5.477  34.557  23.984  1.00 75.14  ? 79   LEU C N   1 
ATOM   1941 C CA  . LEU C 1 33  ? -5.460  33.557  22.910  1.00 72.57  ? 79   LEU C CA  1 
ATOM   1942 C C   . LEU C 1 33  ? -4.274  33.759  21.962  1.00 72.24  ? 79   LEU C C   1 
ATOM   1943 O O   . LEU C 1 33  ? -3.682  32.788  21.482  1.00 69.88  ? 79   LEU C O   1 
ATOM   1944 C CB  . LEU C 1 33  ? -6.778  33.573  22.123  1.00 73.48  ? 79   LEU C CB  1 
ATOM   1945 C CG  . LEU C 1 33  ? -7.963  32.873  22.797  1.00 72.70  ? 79   LEU C CG  1 
ATOM   1946 C CD1 . LEU C 1 33  ? -9.261  33.198  22.073  1.00 75.51  ? 79   LEU C CD1 1 
ATOM   1947 C CD2 . LEU C 1 33  ? -7.737  31.370  22.839  1.00 70.26  ? 79   LEU C CD2 1 
ATOM   1948 N N   . GLN C 1 34  ? -3.934  35.019  21.700  1.00 74.53  ? 80   GLN C N   1 
ATOM   1949 C CA  . GLN C 1 34  ? -2.772  35.351  20.870  1.00 75.19  ? 80   GLN C CA  1 
ATOM   1950 C C   . GLN C 1 34  ? -1.471  34.905  21.551  1.00 73.09  ? 80   GLN C C   1 
ATOM   1951 O O   . GLN C 1 34  ? -0.521  34.494  20.887  1.00 72.12  ? 80   GLN C O   1 
ATOM   1952 C CB  . GLN C 1 34  ? -2.733  36.854  20.572  1.00 79.21  ? 80   GLN C CB  1 
ATOM   1953 C CG  . GLN C 1 34  ? -1.842  37.235  19.396  1.00 82.70  ? 80   GLN C CG  1 
ATOM   1954 C CD  . GLN C 1 34  ? -2.507  36.999  18.047  1.00 84.93  ? 80   GLN C CD  1 
ATOM   1955 O OE1 . GLN C 1 34  ? -3.164  37.890  17.501  1.00 88.18  ? 80   GLN C OE1 1 
ATOM   1956 N NE2 . GLN C 1 34  ? -2.325  35.803  17.496  1.00 83.49  ? 80   GLN C NE2 1 
ATOM   1957 N N   . TYR C 1 35  ? -1.443  34.985  22.880  1.00 72.30  ? 81   TYR C N   1 
ATOM   1958 C CA  . TYR C 1 35  ? -0.303  34.523  23.666  1.00 70.93  ? 81   TYR C CA  1 
ATOM   1959 C C   . TYR C 1 35  ? -0.211  32.996  23.631  1.00 67.20  ? 81   TYR C C   1 
ATOM   1960 O O   . TYR C 1 35  ? 0.866   32.439  23.428  1.00 66.24  ? 81   TYR C O   1 
ATOM   1961 C CB  . TYR C 1 35  ? -0.418  35.035  25.105  1.00 72.14  ? 81   TYR C CB  1 
ATOM   1962 C CG  . TYR C 1 35  ? 0.668   34.556  26.037  1.00 71.54  ? 81   TYR C CG  1 
ATOM   1963 C CD1 . TYR C 1 35  ? 0.515   33.378  26.760  1.00 69.49  ? 81   TYR C CD1 1 
ATOM   1964 C CD2 . TYR C 1 35  ? 1.839   35.287  26.207  1.00 74.67  ? 81   TYR C CD2 1 
ATOM   1965 C CE1 . TYR C 1 35  ? 1.501   32.931  27.616  1.00 69.20  ? 81   TYR C CE1 1 
ATOM   1966 C CE2 . TYR C 1 35  ? 2.835   34.852  27.067  1.00 74.73  ? 81   TYR C CE2 1 
ATOM   1967 C CZ  . TYR C 1 35  ? 2.660   33.671  27.768  1.00 71.91  ? 81   TYR C CZ  1 
ATOM   1968 O OH  . TYR C 1 35  ? 3.637   33.229  28.625  1.00 71.72  ? 81   TYR C OH  1 
ATOM   1969 N N   . LEU C 1 36  ? -1.343  32.324  23.823  1.00 65.27  ? 82   LEU C N   1 
ATOM   1970 C CA  . LEU C 1 36  ? -1.394  30.860  23.732  1.00 62.62  ? 82   LEU C CA  1 
ATOM   1971 C C   . LEU C 1 36  ? -0.954  30.357  22.356  1.00 62.69  ? 82   LEU C C   1 
ATOM   1972 O O   . LEU C 1 36  ? -0.310  29.318  22.254  1.00 61.79  ? 82   LEU C O   1 
ATOM   1973 C CB  . LEU C 1 36  ? -2.798  30.340  24.050  1.00 60.93  ? 82   LEU C CB  1 
ATOM   1974 C CG  . LEU C 1 36  ? -3.198  30.433  25.521  1.00 61.50  ? 82   LEU C CG  1 
ATOM   1975 C CD1 . LEU C 1 36  ? -4.684  30.168  25.689  1.00 61.63  ? 82   LEU C CD1 1 
ATOM   1976 C CD2 . LEU C 1 36  ? -2.376  29.453  26.356  1.00 59.10  ? 82   LEU C CD2 1 
ATOM   1977 N N   . HIS C 1 37  ? -1.299  31.094  21.303  1.00 64.29  ? 83   HIS C N   1 
ATOM   1978 C CA  . HIS C 1 37  ? -0.897  30.718  19.952  1.00 65.26  ? 83   HIS C CA  1 
ATOM   1979 C C   . HIS C 1 37  ? 0.576   31.034  19.703  1.00 66.85  ? 83   HIS C C   1 
ATOM   1980 O O   . HIS C 1 37  ? 1.357   30.147  19.366  1.00 65.72  ? 83   HIS C O   1 
ATOM   1981 C CB  . HIS C 1 37  ? -1.780  31.418  18.912  1.00 66.88  ? 83   HIS C CB  1 
ATOM   1982 C CG  . HIS C 1 37  ? -1.524  30.979  17.502  1.00 67.62  ? 83   HIS C CG  1 
ATOM   1983 N ND1 . HIS C 1 37  ? -1.915  31.723  16.411  1.00 70.19  ? 83   HIS C ND1 1 
ATOM   1984 C CD2 . HIS C 1 37  ? -0.911  29.878  17.005  1.00 67.37  ? 83   HIS C CD2 1 
ATOM   1985 C CE1 . HIS C 1 37  ? -1.557  31.099  15.302  1.00 70.71  ? 83   HIS C CE1 1 
ATOM   1986 N NE2 . HIS C 1 37  ? -0.946  29.977  15.635  1.00 68.04  ? 83   HIS C NE2 1 
ATOM   1987 N N   . LYS C 1 38  ? 0.954   32.293  19.883  1.00 69.95  ? 84   LYS C N   1 
ATOM   1988 C CA  . LYS C 1 38  ? 2.283   32.754  19.475  1.00 73.11  ? 84   LYS C CA  1 
ATOM   1989 C C   . LYS C 1 38  ? 3.403   32.454  20.476  1.00 73.01  ? 84   LYS C C   1 
ATOM   1990 O O   . LYS C 1 38  ? 4.566   32.435  20.091  1.00 74.51  ? 84   LYS C O   1 
ATOM   1991 C CB  . LYS C 1 38  ? 2.246   34.244  19.115  1.00 76.41  ? 84   LYS C CB  1 
ATOM   1992 C CG  . LYS C 1 38  ? 1.455   34.505  17.840  1.00 79.04  ? 84   LYS C CG  1 
ATOM   1993 C CD  . LYS C 1 38  ? 1.441   35.972  17.450  1.00 84.44  ? 84   LYS C CD  1 
ATOM   1994 C CE  . LYS C 1 38  ? 1.013   36.152  15.994  1.00 86.80  ? 84   LYS C CE  1 
ATOM   1995 N NZ  . LYS C 1 38  ? -0.123  35.252  15.615  1.00 85.11  ? 84   LYS C NZ  1 
ATOM   1996 N N   . VAL C 1 39  ? 3.068   32.211  21.741  1.00 71.69  ? 85   VAL C N   1 
ATOM   1997 C CA  . VAL C 1 39  ? 4.088   31.872  22.739  1.00 71.90  ? 85   VAL C CA  1 
ATOM   1998 C C   . VAL C 1 39  ? 3.978   30.410  23.188  1.00 69.36  ? 85   VAL C C   1 
ATOM   1999 O O   . VAL C 1 39  ? 4.947   29.659  23.089  1.00 69.55  ? 85   VAL C O   1 
ATOM   2000 C CB  . VAL C 1 39  ? 4.029   32.804  23.970  1.00 73.11  ? 85   VAL C CB  1 
ATOM   2001 C CG1 . VAL C 1 39  ? 5.038   32.363  25.019  1.00 73.39  ? 85   VAL C CG1 1 
ATOM   2002 C CG2 . VAL C 1 39  ? 4.284   34.252  23.562  1.00 76.12  ? 85   VAL C CG2 1 
ATOM   2003 N N   . VAL C 1 40  ? 2.805   30.008  23.672  1.00 67.27  ? 86   VAL C N   1 
ATOM   2004 C CA  . VAL C 1 40  ? 2.632   28.662  24.234  1.00 65.11  ? 86   VAL C CA  1 
ATOM   2005 C C   . VAL C 1 40  ? 2.746   27.591  23.147  1.00 64.27  ? 86   VAL C C   1 
ATOM   2006 O O   . VAL C 1 40  ? 3.609   26.720  23.231  1.00 64.18  ? 86   VAL C O   1 
ATOM   2007 C CB  . VAL C 1 40  ? 1.296   28.515  25.010  1.00 63.79  ? 86   VAL C CB  1 
ATOM   2008 C CG1 . VAL C 1 40  ? 1.175   27.122  25.631  1.00 61.74  ? 86   VAL C CG1 1 
ATOM   2009 C CG2 . VAL C 1 40  ? 1.190   29.584  26.096  1.00 64.67  ? 86   VAL C CG2 1 
ATOM   2010 N N   . MET C 1 41  ? 1.902   27.669  22.120  1.00 64.31  ? 87   MET C N   1 
ATOM   2011 C CA  . MET C 1 41  ? 1.896   26.648  21.064  1.00 63.44  ? 87   MET C CA  1 
ATOM   2012 C C   . MET C 1 41  ? 3.187   26.649  20.234  1.00 65.61  ? 87   MET C C   1 
ATOM   2013 O O   . MET C 1 41  ? 3.646   25.589  19.819  1.00 65.47  ? 87   MET C O   1 
ATOM   2014 C CB  . MET C 1 41  ? 0.674   26.803  20.151  1.00 63.02  ? 87   MET C CB  1 
ATOM   2015 C CG  . MET C 1 41  ? 0.565   25.749  19.037  1.00 62.56  ? 87   MET C CG  1 
ATOM   2016 S SD  . MET C 1 41  ? 0.604   24.026  19.597  1.00 61.06  ? 87   MET C SD  1 
ATOM   2017 C CE  . MET C 1 41  ? -1.123  23.766  20.012  1.00 57.97  ? 87   MET C CE  1 
ATOM   2018 N N   . LYS C 1 42  ? 3.774   27.821  19.997  1.00 67.99  ? 88   LYS C N   1 
ATOM   2019 C CA  . LYS C 1 42  ? 5.045   27.892  19.262  1.00 70.62  ? 88   LYS C CA  1 
ATOM   2020 C C   . LYS C 1 42  ? 6.167   27.106  19.956  1.00 69.98  ? 88   LYS C C   1 
ATOM   2021 O O   . LYS C 1 42  ? 6.934   26.407  19.293  1.00 70.77  ? 88   LYS C O   1 
ATOM   2022 C CB  . LYS C 1 42  ? 5.484   29.347  19.028  1.00 74.29  ? 88   LYS C CB  1 
ATOM   2023 C CG  . LYS C 1 42  ? 4.816   30.005  17.823  1.00 76.99  ? 88   LYS C CG  1 
ATOM   2024 C CD  . LYS C 1 42  ? 5.642   31.166  17.280  1.00 81.60  ? 88   LYS C CD  1 
ATOM   2025 C CE  . LYS C 1 42  ? 4.943   31.851  16.112  1.00 83.55  ? 88   LYS C CE  1 
ATOM   2026 N NZ  . LYS C 1 42  ? 5.656   33.093  15.695  1.00 87.49  ? 88   LYS C NZ  1 
ATOM   2027 N N   . ALA C 1 43  ? 6.250   27.223  21.282  1.00 68.64  ? 89   ALA C N   1 
ATOM   2028 C CA  . ALA C 1 43  ? 7.252   26.500  22.074  1.00 68.24  ? 89   ALA C CA  1 
ATOM   2029 C C   . ALA C 1 43  ? 6.963   24.994  22.166  1.00 65.52  ? 89   ALA C C   1 
ATOM   2030 O O   . ALA C 1 43  ? 7.880   24.177  22.110  1.00 66.32  ? 89   ALA C O   1 
ATOM   2031 C CB  . ALA C 1 43  ? 7.351   27.098  23.474  1.00 68.20  ? 89   ALA C CB  1 
ATOM   2032 N N   . LEU C 1 44  ? 5.696   24.622  22.317  1.00 62.44  ? 90   LEU C N   1 
ATOM   2033 C CA  . LEU C 1 44  ? 5.345   23.206  22.422  1.00 60.32  ? 90   LEU C CA  1 
ATOM   2034 C C   . LEU C 1 44  ? 5.458   22.483  21.074  1.00 60.31  ? 90   LEU C C   1 
ATOM   2035 O O   . LEU C 1 44  ? 6.013   21.385  21.003  1.00 60.90  ? 90   LEU C O   1 
ATOM   2036 C CB  . LEU C 1 44  ? 3.949   23.031  23.036  1.00 58.28  ? 90   LEU C CB  1 
ATOM   2037 C CG  . LEU C 1 44  ? 3.764   23.605  24.450  1.00 57.68  ? 90   LEU C CG  1 
ATOM   2038 C CD1 . LEU C 1 44  ? 2.398   23.256  25.010  1.00 55.57  ? 90   LEU C CD1 1 
ATOM   2039 C CD2 . LEU C 1 44  ? 4.846   23.133  25.397  1.00 58.29  ? 90   LEU C CD2 1 
ATOM   2040 N N   . TRP C 1 45  ? 4.960   23.108  20.010  1.00 60.40  ? 91   TRP C N   1 
ATOM   2041 C CA  . TRP C 1 45  ? 4.933   22.489  18.675  1.00 60.78  ? 91   TRP C CA  1 
ATOM   2042 C C   . TRP C 1 45  ? 6.295   21.999  18.201  1.00 63.07  ? 91   TRP C C   1 
ATOM   2043 O O   . TRP C 1 45  ? 6.408   20.901  17.649  1.00 63.12  ? 91   TRP C O   1 
ATOM   2044 C CB  . TRP C 1 45  ? 4.391   23.474  17.637  1.00 61.55  ? 91   TRP C CB  1 
ATOM   2045 C CG  . TRP C 1 45  ? 4.141   22.865  16.289  1.00 60.49  ? 91   TRP C CG  1 
ATOM   2046 C CD1 . TRP C 1 45  ? 4.872   23.056  15.153  1.00 61.27  ? 91   TRP C CD1 1 
ATOM   2047 C CD2 . TRP C 1 45  ? 3.075   21.970  15.935  1.00 58.05  ? 91   TRP C CD2 1 
ATOM   2048 N NE1 . TRP C 1 45  ? 4.330   22.336  14.112  1.00 61.63  ? 91   TRP C NE1 1 
ATOM   2049 C CE2 . TRP C 1 45  ? 3.227   21.660  14.565  1.00 60.31  ? 91   TRP C CE2 1 
ATOM   2050 C CE3 . TRP C 1 45  ? 2.011   21.398  16.642  1.00 56.06  ? 91   TRP C CE3 1 
ATOM   2051 C CZ2 . TRP C 1 45  ? 2.352   20.804  13.889  1.00 59.95  ? 91   TRP C CZ2 1 
ATOM   2052 C CZ3 . TRP C 1 45  ? 1.140   20.547  15.965  1.00 54.92  ? 91   TRP C CZ3 1 
ATOM   2053 C CH2 . TRP C 1 45  ? 1.317   20.259  14.607  1.00 57.19  ? 91   TRP C CH2 1 
ATOM   2054 N N   . LYS C 1 46  ? 7.316   22.829  18.397  1.00 65.30  ? 92   LYS C N   1 
ATOM   2055 C CA  . LYS C 1 46  ? 8.661   22.531  17.910  1.00 68.11  ? 92   LYS C CA  1 
ATOM   2056 C C   . LYS C 1 46  ? 9.535   21.802  18.934  1.00 67.99  ? 92   LYS C C   1 
ATOM   2057 O O   . LYS C 1 46  ? 10.682  21.458  18.637  1.00 70.16  ? 92   LYS C O   1 
ATOM   2058 C CB  . LYS C 1 46  ? 9.353   23.820  17.442  1.00 71.36  ? 92   LYS C CB  1 
ATOM   2059 C CG  . LYS C 1 46  ? 9.719   24.805  18.545  1.00 72.80  ? 92   LYS C CG  1 
ATOM   2060 C CD  . LYS C 1 46  ? 10.330  26.067  17.944  1.00 77.34  ? 92   LYS C CD  1 
ATOM   2061 C CE  . LYS C 1 46  ? 10.546  27.149  18.986  1.00 78.14  ? 92   LYS C CE  1 
ATOM   2062 N NZ  . LYS C 1 46  ? 10.954  28.430  18.338  1.00 83.28  ? 92   LYS C NZ  1 
ATOM   2063 N N   . HIS C 1 47  ? 9.004   21.570  20.133  1.00 65.19  ? 93   HIS C N   1 
ATOM   2064 C CA  . HIS C 1 47  ? 9.734   20.831  21.163  1.00 65.21  ? 93   HIS C CA  1 
ATOM   2065 C C   . HIS C 1 47  ? 10.029  19.419  20.652  1.00 65.81  ? 93   HIS C C   1 
ATOM   2066 O O   . HIS C 1 47  ? 9.231   18.855  19.900  1.00 65.19  ? 93   HIS C O   1 
ATOM   2067 C CB  . HIS C 1 47  ? 8.917   20.774  22.463  1.00 62.58  ? 93   HIS C CB  1 
ATOM   2068 C CG  . HIS C 1 47  ? 9.718   20.389  23.666  1.00 62.85  ? 93   HIS C CG  1 
ATOM   2069 N ND1 . HIS C 1 47  ? 9.998   19.079  23.986  1.00 62.82  ? 93   HIS C ND1 1 
ATOM   2070 C CD2 . HIS C 1 47  ? 10.305  21.144  24.626  1.00 64.08  ? 93   HIS C CD2 1 
ATOM   2071 C CE1 . HIS C 1 47  ? 10.725  19.041  25.087  1.00 63.75  ? 93   HIS C CE1 1 
ATOM   2072 N NE2 . HIS C 1 47  ? 10.925  20.281  25.497  1.00 64.45  ? 93   HIS C NE2 1 
ATOM   2073 N N   . GLN C 1 48  ? 11.169  18.853  21.047  1.00 67.54  ? 94   GLN C N   1 
ATOM   2074 C CA  . GLN C 1 48  ? 11.550  17.507  20.594  1.00 68.58  ? 94   GLN C CA  1 
ATOM   2075 C C   . GLN C 1 48  ? 10.550  16.409  20.984  1.00 65.36  ? 94   GLN C C   1 
ATOM   2076 O O   . GLN C 1 48  ? 10.409  15.427  20.261  1.00 66.04  ? 94   GLN C O   1 
ATOM   2077 C CB  . GLN C 1 48  ? 12.970  17.132  21.058  1.00 72.51  ? 94   GLN C CB  1 
ATOM   2078 C CG  . GLN C 1 48  ? 13.176  16.994  22.567  1.00 73.00  ? 94   GLN C CG  1 
ATOM   2079 C CD  . GLN C 1 48  ? 14.526  16.372  22.927  1.00 77.73  ? 94   GLN C CD  1 
ATOM   2080 O OE1 . GLN C 1 48  ? 14.999  15.443  22.266  1.00 79.62  ? 94   GLN C OE1 1 
ATOM   2081 N NE2 . GLN C 1 48  ? 15.144  16.879  23.989  1.00 79.85  ? 94   GLN C NE2 1 
ATOM   2082 N N   . PHE C 1 49  ? 9.848   16.582  22.104  1.00 62.75  ? 95   PHE C N   1 
ATOM   2083 C CA  . PHE C 1 49  ? 8.858   15.597  22.566  1.00 59.84  ? 95   PHE C CA  1 
ATOM   2084 C C   . PHE C 1 49  ? 7.457   15.802  21.989  1.00 57.66  ? 95   PHE C C   1 
ATOM   2085 O O   . PHE C 1 49  ? 6.531   15.073  22.352  1.00 56.04  ? 95   PHE C O   1 
ATOM   2086 C CB  . PHE C 1 49  ? 8.762   15.595  24.101  1.00 58.44  ? 95   PHE C CB  1 
ATOM   2087 C CG  . PHE C 1 49  ? 10.034  15.187  24.811  1.00 61.04  ? 95   PHE C CG  1 
ATOM   2088 C CD1 . PHE C 1 49  ? 11.012  14.423  24.181  1.00 63.70  ? 95   PHE C CD1 1 
ATOM   2089 C CD2 . PHE C 1 49  ? 10.229  15.546  26.137  1.00 60.94  ? 95   PHE C CD2 1 
ATOM   2090 C CE1 . PHE C 1 49  ? 12.174  14.054  24.853  1.00 65.96  ? 95   PHE C CE1 1 
ATOM   2091 C CE2 . PHE C 1 49  ? 11.384  15.177  26.815  1.00 63.54  ? 95   PHE C CE2 1 
ATOM   2092 C CZ  . PHE C 1 49  ? 12.357  14.428  26.169  1.00 65.38  ? 95   PHE C CZ  1 
ATOM   2093 N N   . ALA C 1 50  ? 7.296   16.775  21.095  1.00 57.57  ? 96   ALA C N   1 
ATOM   2094 C CA  . ALA C 1 50  ? 5.988   17.088  20.522  1.00 55.57  ? 96   ALA C CA  1 
ATOM   2095 C C   . ALA C 1 50  ? 5.451   16.021  19.565  1.00 54.97  ? 96   ALA C C   1 
ATOM   2096 O O   . ALA C 1 50  ? 4.237   15.880  19.429  1.00 53.62  ? 96   ALA C O   1 
ATOM   2097 C CB  . ALA C 1 50  ? 6.039   18.441  19.811  1.00 56.16  ? 96   ALA C CB  1 
ATOM   2098 N N   . TRP C 1 51  ? 6.338   15.269  18.913  1.00 56.56  ? 97   TRP C N   1 
ATOM   2099 C CA  . TRP C 1 51  ? 5.944   14.444  17.757  1.00 57.06  ? 97   TRP C CA  1 
ATOM   2100 C C   . TRP C 1 51  ? 4.774   13.459  17.990  1.00 55.99  ? 97   TRP C C   1 
ATOM   2101 O O   . TRP C 1 51  ? 3.922   13.316  17.111  1.00 55.86  ? 97   TRP C O   1 
ATOM   2102 C CB  . TRP C 1 51  ? 7.164   13.758  17.097  1.00 59.76  ? 97   TRP C CB  1 
ATOM   2103 C CG  . TRP C 1 51  ? 7.794   12.690  17.908  1.00 58.59  ? 97   TRP C CG  1 
ATOM   2104 C CD1 . TRP C 1 51  ? 8.821   12.830  18.788  1.00 59.49  ? 97   TRP C CD1 1 
ATOM   2105 C CD2 . TRP C 1 51  ? 7.428   11.309  17.931  1.00 57.95  ? 97   TRP C CD2 1 
ATOM   2106 N NE1 . TRP C 1 51  ? 9.124   11.617  19.356  1.00 61.06  ? 97   TRP C NE1 1 
ATOM   2107 C CE2 . TRP C 1 51  ? 8.278   10.667  18.850  1.00 59.71  ? 97   TRP C CE2 1 
ATOM   2108 C CE3 . TRP C 1 51  ? 6.467   10.549  17.256  1.00 58.73  ? 97   TRP C CE3 1 
ATOM   2109 C CZ2 . TRP C 1 51  ? 8.195   9.300   19.116  1.00 61.14  ? 97   TRP C CZ2 1 
ATOM   2110 C CZ3 . TRP C 1 51  ? 6.388   9.186   17.520  1.00 60.06  ? 97   TRP C CZ3 1 
ATOM   2111 C CH2 . TRP C 1 51  ? 7.246   8.580   18.440  1.00 60.35  ? 97   TRP C CH2 1 
ATOM   2112 N N   . PRO C 1 52  ? 4.701   12.795  19.164  1.00 55.14  ? 98   PRO C N   1 
ATOM   2113 C CA  . PRO C 1 52  ? 3.547   11.897  19.326  1.00 55.06  ? 98   PRO C CA  1 
ATOM   2114 C C   . PRO C 1 52  ? 2.205   12.626  19.516  1.00 53.01  ? 98   PRO C C   1 
ATOM   2115 O O   . PRO C 1 52  ? 1.153   11.984  19.457  1.00 52.95  ? 98   PRO C O   1 
ATOM   2116 C CB  . PRO C 1 52  ? 3.894   11.095  20.591  1.00 55.48  ? 98   PRO C CB  1 
ATOM   2117 C CG  . PRO C 1 52  ? 5.352   11.375  20.863  1.00 56.38  ? 98   PRO C CG  1 
ATOM   2118 C CD  . PRO C 1 52  ? 5.556   12.765  20.358  1.00 55.66  ? 98   PRO C CD  1 
ATOM   2119 N N   . PHE C 1 53  ? 2.252   13.946  19.721  1.00 52.17  ? 99   PHE C N   1 
ATOM   2120 C CA  . PHE C 1 53  ? 1.066   14.754  20.019  1.00 50.67  ? 99   PHE C CA  1 
ATOM   2121 C C   . PHE C 1 53  ? 0.643   15.716  18.904  1.00 51.08  ? 99   PHE C C   1 
ATOM   2122 O O   . PHE C 1 53  ? -0.332  16.445  19.068  1.00 50.88  ? 99   PHE C O   1 
ATOM   2123 C CB  . PHE C 1 53  ? 1.306   15.558  21.302  1.00 49.77  ? 99   PHE C CB  1 
ATOM   2124 C CG  . PHE C 1 53  ? 1.751   14.723  22.469  1.00 50.32  ? 99   PHE C CG  1 
ATOM   2125 C CD1 . PHE C 1 53  ? 0.822   14.044  23.259  1.00 50.28  ? 99   PHE C CD1 1 
ATOM   2126 C CD2 . PHE C 1 53  ? 3.098   14.613  22.782  1.00 51.72  ? 99   PHE C CD2 1 
ATOM   2127 C CE1 . PHE C 1 53  ? 1.238   13.272  24.340  1.00 49.07  ? 99   PHE C CE1 1 
ATOM   2128 C CE2 . PHE C 1 53  ? 3.518   13.843  23.853  1.00 51.53  ? 99   PHE C CE2 1 
ATOM   2129 C CZ  . PHE C 1 53  ? 2.584   13.174  24.635  1.00 50.67  ? 99   PHE C CZ  1 
ATOM   2130 N N   . ARG C 1 54  ? 1.349   15.725  17.774  1.00 53.05  ? 100  ARG C N   1 
ATOM   2131 C CA  . ARG C 1 54  ? 1.056   16.685  16.698  1.00 54.46  ? 100  ARG C CA  1 
ATOM   2132 C C   . ARG C 1 54  ? -0.126  16.302  15.806  1.00 55.07  ? 100  ARG C C   1 
ATOM   2133 O O   . ARG C 1 54  ? -0.554  17.097  14.968  1.00 54.97  ? 100  ARG C O   1 
ATOM   2134 C CB  . ARG C 1 54  ? 2.285   16.900  15.815  1.00 56.96  ? 100  ARG C CB  1 
ATOM   2135 C CG  . ARG C 1 54  ? 3.408   17.642  16.494  1.00 59.40  ? 100  ARG C CG  1 
ATOM   2136 C CD  . ARG C 1 54  ? 4.504   17.967  15.493  1.00 64.47  ? 100  ARG C CD  1 
ATOM   2137 N NE  . ARG C 1 54  ? 5.718   18.426  16.165  1.00 68.16  ? 100  ARG C NE  1 
ATOM   2138 C CZ  . ARG C 1 54  ? 6.948   17.950  15.964  1.00 71.28  ? 100  ARG C CZ  1 
ATOM   2139 N NH1 . ARG C 1 54  ? 7.188   16.979  15.084  1.00 74.15  ? 100  ARG C NH1 1 
ATOM   2140 N NH2 . ARG C 1 54  ? 7.959   18.464  16.653  1.00 73.59  ? 100  ARG C NH2 1 
ATOM   2141 N N   . GLN C 1 55  ? -0.634  15.086  15.974  1.00 55.54  ? 101  GLN C N   1 
ATOM   2142 C CA  . GLN C 1 55  ? -1.761  14.593  15.189  1.00 57.82  ? 101  GLN C CA  1 
ATOM   2143 C C   . GLN C 1 55  ? -2.644  13.731  16.088  1.00 57.08  ? 101  GLN C C   1 
ATOM   2144 O O   . GLN C 1 55  ? -2.168  13.212  17.097  1.00 55.78  ? 101  GLN C O   1 
ATOM   2145 C CB  . GLN C 1 55  ? -1.279  13.785  13.969  1.00 60.59  ? 101  GLN C CB  1 
ATOM   2146 C CG  . GLN C 1 55  ? -0.398  12.572  14.295  1.00 63.97  ? 101  GLN C CG  1 
ATOM   2147 C CD  . GLN C 1 55  ? 0.981   12.959  14.827  1.00 66.47  ? 101  GLN C CD  1 
ATOM   2148 O OE1 . GLN C 1 55  ? 1.759   13.625  14.140  1.00 70.09  ? 101  GLN C OE1 1 
ATOM   2149 N NE2 . GLN C 1 55  ? 1.283   12.548  16.062  1.00 65.65  ? 101  GLN C NE2 1 
ATOM   2150 N N   . PRO C 1 56  ? -3.928  13.580  15.727  1.00 58.37  ? 102  PRO C N   1 
ATOM   2151 C CA  . PRO C 1 56  ? -4.815  12.706  16.492  1.00 58.71  ? 102  PRO C CA  1 
ATOM   2152 C C   . PRO C 1 56  ? -4.262  11.288  16.623  1.00 60.17  ? 102  PRO C C   1 
ATOM   2153 O O   . PRO C 1 56  ? -3.586  10.803  15.717  1.00 62.09  ? 102  PRO C O   1 
ATOM   2154 C CB  . PRO C 1 56  ? -6.101  12.691  15.658  1.00 60.26  ? 102  PRO C CB  1 
ATOM   2155 C CG  . PRO C 1 56  ? -6.070  13.944  14.876  1.00 60.30  ? 102  PRO C CG  1 
ATOM   2156 C CD  . PRO C 1 56  ? -4.625  14.216  14.592  1.00 59.47  ? 102  PRO C CD  1 
ATOM   2157 N N   . VAL C 1 57  ? -4.535  10.645  17.752  1.00 59.93  ? 103  VAL C N   1 
ATOM   2158 C CA  . VAL C 1 57  ? -4.221  9.236   17.926  1.00 61.96  ? 103  VAL C CA  1 
ATOM   2159 C C   . VAL C 1 57  ? -5.042  8.458   16.898  1.00 65.22  ? 103  VAL C C   1 
ATOM   2160 O O   . VAL C 1 57  ? -6.269  8.593   16.847  1.00 65.78  ? 103  VAL C O   1 
ATOM   2161 C CB  . VAL C 1 57  ? -4.560  8.744   19.365  1.00 61.14  ? 103  VAL C CB  1 
ATOM   2162 C CG1 . VAL C 1 57  ? -4.393  7.235   19.487  1.00 61.74  ? 103  VAL C CG1 1 
ATOM   2163 C CG2 . VAL C 1 57  ? -3.691  9.463   20.402  1.00 59.29  ? 103  VAL C CG2 1 
ATOM   2164 N N   . ASP C 1 58  ? -4.357  7.695   16.049  1.00 68.02  ? 104  ASP C N   1 
ATOM   2165 C CA  . ASP C 1 58  ? -5.019  6.790   15.109  1.00 71.13  ? 104  ASP C CA  1 
ATOM   2166 C C   . ASP C 1 58  ? -4.971  5.394   15.732  1.00 72.49  ? 104  ASP C C   1 
ATOM   2167 O O   . ASP C 1 58  ? -3.986  4.667   15.584  1.00 73.48  ? 104  ASP C O   1 
ATOM   2168 C CB  . ASP C 1 58  ? -4.340  6.825   13.729  1.00 72.97  ? 104  ASP C CB  1 
ATOM   2169 C CG  . ASP C 1 58  ? -5.153  6.109   12.642  1.00 76.24  ? 104  ASP C CG  1 
ATOM   2170 O OD1 . ASP C 1 58  ? -5.842  5.109   12.942  1.00 77.31  ? 104  ASP C OD1 1 
ATOM   2171 O OD2 . ASP C 1 58  ? -5.094  6.545   11.471  1.00 78.27  ? 104  ASP C OD2 1 
ATOM   2172 N N   . ALA C 1 59  ? -6.038  5.043   16.448  1.00 72.84  ? 105  ALA C N   1 
ATOM   2173 C CA  . ALA C 1 59  ? -6.119  3.768   17.167  1.00 74.56  ? 105  ALA C CA  1 
ATOM   2174 C C   . ALA C 1 59  ? -5.972  2.548   16.252  1.00 78.30  ? 105  ALA C C   1 
ATOM   2175 O O   . ALA C 1 59  ? -5.497  1.504   16.697  1.00 79.70  ? 105  ALA C O   1 
ATOM   2176 C CB  . ALA C 1 59  ? -7.423  3.686   17.953  1.00 74.11  ? 105  ALA C CB  1 
ATOM   2177 N N   . VAL C 1 60  ? -6.372  2.679   14.986  1.00 80.39  ? 106  VAL C N   1 
ATOM   2178 C CA  . VAL C 1 60  ? -6.222  1.595   14.011  1.00 84.45  ? 106  VAL C CA  1 
ATOM   2179 C C   . VAL C 1 60  ? -4.755  1.411   13.604  1.00 85.69  ? 106  VAL C C   1 
ATOM   2180 O O   . VAL C 1 60  ? -4.211  0.314   13.726  1.00 88.14  ? 106  VAL C O   1 
ATOM   2181 C CB  . VAL C 1 60  ? -7.098  1.829   12.751  1.00 86.22  ? 106  VAL C CB  1 
ATOM   2182 C CG1 . VAL C 1 60  ? -6.855  0.742   11.706  1.00 90.18  ? 106  VAL C CG1 1 
ATOM   2183 C CG2 . VAL C 1 60  ? -8.574  1.875   13.130  1.00 85.95  ? 106  VAL C CG2 1 
ATOM   2184 N N   . LYS C 1 61  ? -4.120  2.484   13.133  1.00 84.82  ? 107  LYS C N   1 
ATOM   2185 C CA  . LYS C 1 61  ? -2.715  2.428   12.700  1.00 86.37  ? 107  LYS C CA  1 
ATOM   2186 C C   . LYS C 1 61  ? -1.766  2.056   13.839  1.00 85.70  ? 107  LYS C C   1 
ATOM   2187 O O   . LYS C 1 61  ? -0.856  1.244   13.657  1.00 87.85  ? 107  LYS C O   1 
ATOM   2188 C CB  . LYS C 1 61  ? -2.276  3.762   12.085  1.00 85.32  ? 107  LYS C CB  1 
ATOM   2189 C CG  . LYS C 1 61  ? -2.870  4.040   10.717  1.00 88.15  ? 107  LYS C CG  1 
ATOM   2190 C CD  . LYS C 1 61  ? -2.373  5.369   10.164  1.00 87.85  ? 107  LYS C CD  1 
ATOM   2191 C CE  . LYS C 1 61  ? -3.092  5.744   8.881   1.00 89.82  ? 107  LYS C CE  1 
ATOM   2192 N NZ  . LYS C 1 61  ? -2.748  7.128   8.447   1.00 89.35  ? 107  LYS C NZ  1 
ATOM   2193 N N   . LEU C 1 62  ? -1.989  2.650   15.011  1.00 82.95  ? 108  LEU C N   1 
ATOM   2194 C CA  . LEU C 1 62  ? -1.166  2.381   16.194  1.00 82.30  ? 108  LEU C CA  1 
ATOM   2195 C C   . LEU C 1 62  ? -1.496  1.047   16.871  1.00 83.84  ? 108  LEU C C   1 
ATOM   2196 O O   . LEU C 1 62  ? -0.799  0.640   17.801  1.00 83.96  ? 108  LEU C O   1 
ATOM   2197 C CB  . LEU C 1 62  ? -1.317  3.517   17.213  1.00 78.99  ? 108  LEU C CB  1 
ATOM   2198 C CG  . LEU C 1 62  ? -0.921  4.911   16.725  1.00 77.89  ? 108  LEU C CG  1 
ATOM   2199 C CD1 . LEU C 1 62  ? -1.199  5.973   17.790  1.00 75.32  ? 108  LEU C CD1 1 
ATOM   2200 C CD2 . LEU C 1 62  ? 0.538   4.919   16.326  1.00 79.22  ? 108  LEU C CD2 1 
ATOM   2201 N N   . GLY C 1 63  ? -2.550  0.370   16.413  1.00 85.41  ? 109  GLY C N   1 
ATOM   2202 C CA  . GLY C 1 63  ? -2.967  -0.902  17.000  1.00 87.03  ? 109  GLY C CA  1 
ATOM   2203 C C   . GLY C 1 63  ? -3.425  -0.742  18.439  1.00 84.68  ? 109  GLY C C   1 
ATOM   2204 O O   . GLY C 1 63  ? -2.949  -1.448  19.328  1.00 85.92  ? 109  GLY C O   1 
ATOM   2205 N N   . LEU C 1 64  ? -4.346  0.195   18.663  1.00 81.54  ? 110  LEU C N   1 
ATOM   2206 C CA  . LEU C 1 64  ? -4.898  0.472   19.994  1.00 79.29  ? 110  LEU C CA  1 
ATOM   2207 C C   . LEU C 1 64  ? -6.421  0.278   19.975  1.00 79.62  ? 110  LEU C C   1 
ATOM   2208 O O   . LEU C 1 64  ? -7.169  1.254   20.067  1.00 77.71  ? 110  LEU C O   1 
ATOM   2209 C CB  . LEU C 1 64  ? -4.560  1.906   20.432  1.00 75.67  ? 110  LEU C CB  1 
ATOM   2210 C CG  . LEU C 1 64  ? -3.094  2.349   20.460  1.00 74.29  ? 110  LEU C CG  1 
ATOM   2211 C CD1 . LEU C 1 64  ? -3.006  3.866   20.568  1.00 70.83  ? 110  LEU C CD1 1 
ATOM   2212 C CD2 . LEU C 1 64  ? -2.339  1.688   21.598  1.00 74.17  ? 110  LEU C CD2 1 
ATOM   2213 N N   . PRO C 1 65  ? -6.890  -0.983  19.863  1.00 82.09  ? 111  PRO C N   1 
ATOM   2214 C CA  . PRO C 1 65  ? -8.332  -1.238  19.700  1.00 82.99  ? 111  PRO C CA  1 
ATOM   2215 C C   . PRO C 1 65  ? -9.239  -0.705  20.824  1.00 80.25  ? 111  PRO C C   1 
ATOM   2216 O O   . PRO C 1 65  ? -10.413 -0.429  20.576  1.00 81.25  ? 111  PRO C O   1 
ATOM   2217 C CB  . PRO C 1 65  ? -8.420  -2.774  19.609  1.00 86.92  ? 111  PRO C CB  1 
ATOM   2218 C CG  . PRO C 1 65  ? -7.128  -3.285  20.139  1.00 87.32  ? 111  PRO C CG  1 
ATOM   2219 C CD  . PRO C 1 65  ? -6.107  -2.233  19.849  1.00 84.70  ? 111  PRO C CD  1 
ATOM   2220 N N   . ASP C 1 66  ? -8.700  -0.554  22.031  1.00 77.17  ? 112  ASP C N   1 
ATOM   2221 C CA  . ASP C 1 66  ? -9.487  -0.098  23.185  1.00 74.99  ? 112  ASP C CA  1 
ATOM   2222 C C   . ASP C 1 66  ? -9.351  1.402   23.466  1.00 70.11  ? 112  ASP C C   1 
ATOM   2223 O O   . ASP C 1 66  ? -9.968  1.914   24.399  1.00 68.97  ? 112  ASP C O   1 
ATOM   2224 C CB  . ASP C 1 66  ? -9.105  -0.897  24.440  1.00 76.02  ? 112  ASP C CB  1 
ATOM   2225 C CG  . ASP C 1 66  ? -7.656  -0.683  24.865  1.00 75.28  ? 112  ASP C CG  1 
ATOM   2226 O OD1 . ASP C 1 66  ? -6.804  -0.384  23.996  1.00 73.98  ? 112  ASP C OD1 1 
ATOM   2227 O OD2 . ASP C 1 66  ? -7.371  -0.828  26.074  1.00 78.34  ? 112  ASP C OD2 1 
ATOM   2228 N N   . TYR C 1 67  ? -8.557  2.104   22.663  1.00 67.04  ? 113  TYR C N   1 
ATOM   2229 C CA  . TYR C 1 67  ? -8.272  3.514   22.921  1.00 63.00  ? 113  TYR C CA  1 
ATOM   2230 C C   . TYR C 1 67  ? -9.532  4.359   23.082  1.00 61.77  ? 113  TYR C C   1 
ATOM   2231 O O   . TYR C 1 67  ? -9.677  5.085   24.056  1.00 60.11  ? 113  TYR C O   1 
ATOM   2232 C CB  . TYR C 1 67  ? -7.397  4.119   21.824  1.00 61.47  ? 113  TYR C CB  1 
ATOM   2233 C CG  . TYR C 1 67  ? -6.963  5.518   22.177  1.00 58.91  ? 113  TYR C CG  1 
ATOM   2234 C CD1 . TYR C 1 67  ? -5.909  5.732   23.055  1.00 54.92  ? 113  TYR C CD1 1 
ATOM   2235 C CD2 . TYR C 1 67  ? -7.631  6.631   21.667  1.00 56.90  ? 113  TYR C CD2 1 
ATOM   2236 C CE1 . TYR C 1 67  ? -5.515  7.006   23.398  1.00 52.48  ? 113  TYR C CE1 1 
ATOM   2237 C CE2 . TYR C 1 67  ? -7.248  7.908   22.011  1.00 54.54  ? 113  TYR C CE2 1 
ATOM   2238 C CZ  . TYR C 1 67  ? -6.185  8.090   22.879  1.00 52.73  ? 113  TYR C CZ  1 
ATOM   2239 O OH  . TYR C 1 67  ? -5.793  9.358   23.229  1.00 52.71  ? 113  TYR C OH  1 
ATOM   2240 N N   . HIS C 1 68  ? -10.445 4.256   22.127  1.00 63.30  ? 114  HIS C N   1 
ATOM   2241 C CA  . HIS C 1 68  ? -11.662 5.061   22.159  1.00 63.07  ? 114  HIS C CA  1 
ATOM   2242 C C   . HIS C 1 68  ? -12.748 4.502   23.092  1.00 65.29  ? 114  HIS C C   1 
ATOM   2243 O O   . HIS C 1 68  ? -13.766 5.157   23.315  1.00 65.76  ? 114  HIS C O   1 
ATOM   2244 C CB  . HIS C 1 68  ? -12.189 5.260   20.739  1.00 63.75  ? 114  HIS C CB  1 
ATOM   2245 C CG  . HIS C 1 68  ? -11.236 6.004   19.854  1.00 61.11  ? 114  HIS C CG  1 
ATOM   2246 N ND1 . HIS C 1 68  ? -10.955 7.343   20.026  1.00 58.35  ? 114  HIS C ND1 1 
ATOM   2247 C CD2 . HIS C 1 68  ? -10.481 5.593   18.808  1.00 61.38  ? 114  HIS C CD2 1 
ATOM   2248 C CE1 . HIS C 1 68  ? -10.077 7.726   19.116  1.00 57.33  ? 114  HIS C CE1 1 
ATOM   2249 N NE2 . HIS C 1 68  ? -9.775  6.685   18.363  1.00 58.39  ? 114  HIS C NE2 1 
ATOM   2250 N N   . LYS C 1 69  ? -12.540 3.300   23.626  1.00 67.41  ? 115  LYS C N   1 
ATOM   2251 C CA  . LYS C 1 69  ? -13.386 2.793   24.711  1.00 69.85  ? 115  LYS C CA  1 
ATOM   2252 C C   . LYS C 1 69  ? -12.991 3.442   26.034  1.00 68.36  ? 115  LYS C C   1 
ATOM   2253 O O   . LYS C 1 69  ? -13.829 3.632   26.915  1.00 69.84  ? 115  LYS C O   1 
ATOM   2254 C CB  . LYS C 1 69  ? -13.273 1.273   24.842  1.00 72.99  ? 115  LYS C CB  1 
ATOM   2255 C CG  . LYS C 1 69  ? -13.847 0.489   23.680  1.00 76.51  ? 115  LYS C CG  1 
ATOM   2256 C CD  . LYS C 1 69  ? -13.689 -1.001  23.921  1.00 80.34  ? 115  LYS C CD  1 
ATOM   2257 C CE  . LYS C 1 69  ? -14.121 -1.812  22.719  1.00 84.44  ? 115  LYS C CE  1 
ATOM   2258 N NZ  . LYS C 1 69  ? -13.821 -3.257  22.917  1.00 87.96  ? 115  LYS C NZ  1 
ATOM   2259 N N   . ILE C 1 70  ? -11.706 3.768   26.165  1.00 65.60  ? 116  ILE C N   1 
ATOM   2260 C CA  . ILE C 1 70  ? -11.151 4.299   27.405  1.00 63.94  ? 116  ILE C CA  1 
ATOM   2261 C C   . ILE C 1 70  ? -11.138 5.825   27.365  1.00 61.43  ? 116  ILE C C   1 
ATOM   2262 O O   . ILE C 1 70  ? -11.522 6.478   28.335  1.00 60.48  ? 116  ILE C O   1 
ATOM   2263 C CB  . ILE C 1 70  ? -9.725  3.740   27.644  1.00 63.14  ? 116  ILE C CB  1 
ATOM   2264 C CG1 . ILE C 1 70  ? -9.792  2.241   27.964  1.00 65.98  ? 116  ILE C CG1 1 
ATOM   2265 C CG2 . ILE C 1 70  ? -9.025  4.480   28.774  1.00 61.42  ? 116  ILE C CG2 1 
ATOM   2266 C CD1 . ILE C 1 70  ? -8.460  1.541   27.881  1.00 66.53  ? 116  ILE C CD1 1 
ATOM   2267 N N   . ILE C 1 71  ? -10.705 6.383   26.237  1.00 60.31  ? 117  ILE C N   1 
ATOM   2268 C CA  . ILE C 1 71  ? -10.587 7.831   26.076  1.00 59.03  ? 117  ILE C CA  1 
ATOM   2269 C C   . ILE C 1 71  ? -11.844 8.412   25.434  1.00 60.91  ? 117  ILE C C   1 
ATOM   2270 O O   . ILE C 1 71  ? -12.144 8.142   24.266  1.00 62.19  ? 117  ILE C O   1 
ATOM   2271 C CB  . ILE C 1 71  ? -9.333  8.192   25.243  1.00 57.33  ? 117  ILE C CB  1 
ATOM   2272 C CG1 . ILE C 1 71  ? -8.068  7.715   25.966  1.00 56.13  ? 117  ILE C CG1 1 
ATOM   2273 C CG2 . ILE C 1 71  ? -9.262  9.699   24.965  1.00 56.00  ? 117  ILE C CG2 1 
ATOM   2274 C CD1 . ILE C 1 71  ? -7.937  8.201   27.422  1.00 55.57  ? 117  ILE C CD1 1 
ATOM   2275 N N   . LYS C 1 72  ? -12.564 9.226   26.202  1.00 61.81  ? 118  LYS C N   1 
ATOM   2276 C CA  . LYS C 1 72  ? -13.853 9.777   25.774  1.00 64.56  ? 118  LYS C CA  1 
ATOM   2277 C C   . LYS C 1 72  ? -13.738 10.999  24.859  1.00 62.68  ? 118  LYS C C   1 
ATOM   2278 O O   . LYS C 1 72  ? -14.577 11.176  23.972  1.00 63.90  ? 118  LYS C O   1 
ATOM   2279 C CB  . LYS C 1 72  ? -14.714 10.138  26.995  1.00 66.82  ? 118  LYS C CB  1 
ATOM   2280 C CG  . LYS C 1 72  ? -14.950 9.001   27.998  1.00 71.54  ? 118  LYS C CG  1 
ATOM   2281 C CD  . LYS C 1 72  ? -15.984 7.997   27.525  1.00 77.64  ? 118  LYS C CD  1 
ATOM   2282 C CE  . LYS C 1 72  ? -15.367 6.835   26.755  1.00 79.30  ? 118  LYS C CE  1 
ATOM   2283 N NZ  . LYS C 1 72  ? -16.414 6.067   26.014  1.00 83.78  ? 118  LYS C NZ  1 
ATOM   2284 N N   . GLN C 1 73  ? -12.728 11.843  25.087  1.00 60.08  ? 119  GLN C N   1 
ATOM   2285 C CA  . GLN C 1 73  ? -12.529 13.089  24.320  1.00 59.27  ? 119  GLN C CA  1 
ATOM   2286 C C   . GLN C 1 73  ? -11.083 13.198  23.810  1.00 56.30  ? 119  GLN C C   1 
ATOM   2287 O O   . GLN C 1 73  ? -10.229 13.790  24.472  1.00 55.14  ? 119  GLN C O   1 
ATOM   2288 C CB  . GLN C 1 73  ? -12.875 14.315  25.178  1.00 59.72  ? 119  GLN C CB  1 
ATOM   2289 C CG  . GLN C 1 73  ? -14.379 14.490  25.453  1.00 67.00  ? 119  GLN C CG  1 
ATOM   2290 C CD  . GLN C 1 73  ? -14.693 15.231  26.754  1.00 70.32  ? 119  GLN C CD  1 
ATOM   2291 O OE1 . GLN C 1 73  ? -13.818 15.838  27.376  1.00 72.70  ? 119  GLN C OE1 1 
ATOM   2292 N NE2 . GLN C 1 73  ? -15.956 15.178  27.167  1.00 75.75  ? 119  GLN C NE2 1 
ATOM   2293 N N   . PRO C 1 74  ? -10.802 12.616  22.633  1.00 55.99  ? 120  PRO C N   1 
ATOM   2294 C CA  . PRO C 1 74  ? -9.462  12.720  22.067  1.00 54.38  ? 120  PRO C CA  1 
ATOM   2295 C C   . PRO C 1 74  ? -9.056  14.170  21.803  1.00 52.90  ? 120  PRO C C   1 
ATOM   2296 O O   . PRO C 1 74  ? -9.894  14.999  21.445  1.00 53.08  ? 120  PRO C O   1 
ATOM   2297 C CB  . PRO C 1 74  ? -9.572  11.948  20.748  1.00 55.93  ? 120  PRO C CB  1 
ATOM   2298 C CG  . PRO C 1 74  ? -10.741 11.054  20.913  1.00 58.14  ? 120  PRO C CG  1 
ATOM   2299 C CD  . PRO C 1 74  ? -11.692 11.796  21.790  1.00 58.17  ? 120  PRO C CD  1 
ATOM   2300 N N   . MET C 1 75  ? -7.774  14.469  21.987  1.00 50.61  ? 121  MET C N   1 
ATOM   2301 C CA  . MET C 1 75  ? -7.256  15.793  21.680  1.00 50.04  ? 121  MET C CA  1 
ATOM   2302 C C   . MET C 1 75  ? -5.768  15.692  21.348  1.00 49.59  ? 121  MET C C   1 
ATOM   2303 O O   . MET C 1 75  ? -5.077  14.776  21.802  1.00 49.24  ? 121  MET C O   1 
ATOM   2304 C CB  . MET C 1 75  ? -7.507  16.753  22.848  1.00 49.49  ? 121  MET C CB  1 
ATOM   2305 C CG  . MET C 1 75  ? -7.212  18.235  22.566  1.00 48.67  ? 121  MET C CG  1 
ATOM   2306 S SD  . MET C 1 75  ? -7.962  18.914  21.064  1.00 50.82  ? 121  MET C SD  1 
ATOM   2307 C CE  . MET C 1 75  ? -9.710  18.584  21.347  1.00 50.16  ? 121  MET C CE  1 
ATOM   2308 N N   . ASP C 1 76  ? -5.306  16.617  20.517  1.00 49.91  ? 122  ASP C N   1 
ATOM   2309 C CA  . ASP C 1 76  ? -3.923  16.652  20.065  1.00 49.72  ? 122  ASP C CA  1 
ATOM   2310 C C   . ASP C 1 76  ? -3.547  18.093  19.741  1.00 50.30  ? 122  ASP C C   1 
ATOM   2311 O O   . ASP C 1 76  ? -4.424  18.952  19.583  1.00 49.72  ? 122  ASP C O   1 
ATOM   2312 C CB  . ASP C 1 76  ? -3.737  15.758  18.837  1.00 50.45  ? 122  ASP C CB  1 
ATOM   2313 C CG  . ASP C 1 76  ? -4.460  16.287  17.611  1.00 51.92  ? 122  ASP C CG  1 
ATOM   2314 O OD1 . ASP C 1 76  ? -5.692  16.109  17.522  1.00 50.68  ? 122  ASP C OD1 1 
ATOM   2315 O OD2 . ASP C 1 76  ? -3.791  16.879  16.735  1.00 50.42  ? 122  ASP C OD2 1 
ATOM   2316 N N   . MET C 1 77  ? -2.245  18.347  19.631  1.00 50.68  ? 123  MET C N   1 
ATOM   2317 C CA  . MET C 1 77  ? -1.737  19.692  19.359  1.00 51.54  ? 123  MET C CA  1 
ATOM   2318 C C   . MET C 1 77  ? -2.042  20.172  17.951  1.00 51.36  ? 123  MET C C   1 
ATOM   2319 O O   . MET C 1 77  ? -2.171  21.371  17.738  1.00 51.93  ? 123  MET C O   1 
ATOM   2320 C CB  . MET C 1 77  ? -0.231  19.774  19.600  1.00 52.42  ? 123  MET C CB  1 
ATOM   2321 C CG  . MET C 1 77  ? 0.148   19.726  21.053  1.00 55.32  ? 123  MET C CG  1 
ATOM   2322 S SD  . MET C 1 77  ? 1.792   20.399  21.349  1.00 61.65  ? 123  MET C SD  1 
ATOM   2323 C CE  . MET C 1 77  ? 2.778   19.230  20.455  1.00 59.75  ? 123  MET C CE  1 
ATOM   2324 N N   . GLY C 1 78  ? -2.144  19.249  16.997  1.00 51.48  ? 124  GLY C N   1 
ATOM   2325 C CA  . GLY C 1 78  ? -2.523  19.597  15.630  1.00 52.53  ? 124  GLY C CA  1 
ATOM   2326 C C   . GLY C 1 78  ? -3.893  20.253  15.587  1.00 52.52  ? 124  GLY C C   1 
ATOM   2327 O O   . GLY C 1 78  ? -4.088  21.273  14.927  1.00 53.67  ? 124  GLY C O   1 
ATOM   2328 N N   . THR C 1 79  ? -4.838  19.660  16.307  1.00 51.69  ? 125  THR C N   1 
ATOM   2329 C CA  . THR C 1 79  ? -6.193  20.185  16.418  1.00 51.47  ? 125  THR C CA  1 
ATOM   2330 C C   . THR C 1 79  ? -6.189  21.533  17.130  1.00 50.89  ? 125  THR C C   1 
ATOM   2331 O O   . THR C 1 79  ? -6.843  22.466  16.689  1.00 51.33  ? 125  THR C O   1 
ATOM   2332 C CB  . THR C 1 79  ? -7.095  19.210  17.199  1.00 50.87  ? 125  THR C CB  1 
ATOM   2333 O OG1 . THR C 1 79  ? -7.229  17.987  16.460  1.00 51.02  ? 125  THR C OG1 1 
ATOM   2334 C CG2 . THR C 1 79  ? -8.474  19.819  17.455  1.00 52.93  ? 125  THR C CG2 1 
ATOM   2335 N N   . ILE C 1 80  ? -5.445  21.630  18.227  1.00 49.89  ? 126  ILE C N   1 
ATOM   2336 C CA  . ILE C 1 80  ? -5.369  22.877  18.992  1.00 50.21  ? 126  ILE C CA  1 
ATOM   2337 C C   . ILE C 1 80  ? -4.751  23.990  18.145  1.00 51.46  ? 126  ILE C C   1 
ATOM   2338 O O   . ILE C 1 80  ? -5.240  25.128  18.141  1.00 51.15  ? 126  ILE C O   1 
ATOM   2339 C CB  . ILE C 1 80  ? -4.562  22.696  20.302  1.00 49.07  ? 126  ILE C CB  1 
ATOM   2340 C CG1 . ILE C 1 80  ? -5.303  21.747  21.259  1.00 47.76  ? 126  ILE C CG1 1 
ATOM   2341 C CG2 . ILE C 1 80  ? -4.328  24.043  20.977  1.00 49.29  ? 126  ILE C CG2 1 
ATOM   2342 C CD1 . ILE C 1 80  ? -4.444  21.223  22.393  1.00 45.53  ? 126  ILE C CD1 1 
ATOM   2343 N N   . LYS C 1 81  ? -3.686  23.653  17.420  1.00 52.45  ? 127  LYS C N   1 
ATOM   2344 C CA  . LYS C 1 81  ? -2.999  24.612  16.545  1.00 54.31  ? 127  LYS C CA  1 
ATOM   2345 C C   . LYS C 1 81  ? -3.914  25.144  15.441  1.00 56.03  ? 127  LYS C C   1 
ATOM   2346 O O   . LYS C 1 81  ? -3.958  26.350  15.191  1.00 56.01  ? 127  LYS C O   1 
ATOM   2347 C CB  . LYS C 1 81  ? -1.754  23.966  15.934  1.00 55.41  ? 127  LYS C CB  1 
ATOM   2348 C CG  . LYS C 1 81  ? -0.945  24.868  15.007  1.00 58.37  ? 127  LYS C CG  1 
ATOM   2349 C CD  . LYS C 1 81  ? 0.428   24.266  14.735  1.00 61.10  ? 127  LYS C CD  1 
ATOM   2350 C CE  . LYS C 1 81  ? 1.160   24.987  13.615  1.00 64.50  ? 127  LYS C CE  1 
ATOM   2351 N NZ  . LYS C 1 81  ? 0.477   24.801  12.303  1.00 65.83  ? 127  LYS C NZ  1 
ATOM   2352 N N   . ARG C 1 82  ? -4.633  24.240  14.781  1.00 57.14  ? 128  ARG C N   1 
ATOM   2353 C CA  . ARG C 1 82  ? -5.609  24.617  13.748  1.00 59.47  ? 128  ARG C CA  1 
ATOM   2354 C C   . ARG C 1 82  ? -6.695  25.518  14.355  1.00 58.98  ? 128  ARG C C   1 
ATOM   2355 O O   . ARG C 1 82  ? -7.094  26.519  13.758  1.00 60.73  ? 128  ARG C O   1 
ATOM   2356 C CB  . ARG C 1 82  ? -6.232  23.356  13.130  1.00 60.79  ? 128  ARG C CB  1 
ATOM   2357 C CG  . ARG C 1 82  ? -6.964  23.574  11.826  1.00 66.53  ? 128  ARG C CG  1 
ATOM   2358 C CD  . ARG C 1 82  ? -7.571  22.276  11.272  1.00 69.66  ? 128  ARG C CD  1 
ATOM   2359 N NE  . ARG C 1 82  ? -8.678  21.795  12.107  1.00 72.06  ? 128  ARG C NE  1 
ATOM   2360 C CZ  . ARG C 1 82  ? -8.709  20.639  12.777  1.00 73.17  ? 128  ARG C CZ  1 
ATOM   2361 N NH1 . ARG C 1 82  ? -7.696  19.775  12.730  1.00 73.08  ? 128  ARG C NH1 1 
ATOM   2362 N NH2 . ARG C 1 82  ? -9.777  20.338  13.507  1.00 73.73  ? 128  ARG C NH2 1 
ATOM   2363 N N   . ARG C 1 83  ? -7.152  25.168  15.555  1.00 56.87  ? 129  ARG C N   1 
ATOM   2364 C CA  . ARG C 1 83  ? -8.176  25.946  16.248  1.00 57.00  ? 129  ARG C CA  1 
ATOM   2365 C C   . ARG C 1 83  ? -7.700  27.366  16.573  1.00 57.86  ? 129  ARG C C   1 
ATOM   2366 O O   . ARG C 1 83  ? -8.443  28.331  16.384  1.00 58.90  ? 129  ARG C O   1 
ATOM   2367 C CB  . ARG C 1 83  ? -8.635  25.212  17.510  1.00 55.52  ? 129  ARG C CB  1 
ATOM   2368 C CG  . ARG C 1 83  ? -9.556  24.048  17.209  1.00 55.71  ? 129  ARG C CG  1 
ATOM   2369 C CD  . ARG C 1 83  ? -9.873  23.213  18.450  1.00 54.39  ? 129  ARG C CD  1 
ATOM   2370 N NE  . ARG C 1 83  ? -10.946 22.255  18.175  1.00 55.60  ? 129  ARG C NE  1 
ATOM   2371 C CZ  . ARG C 1 83  ? -11.624 21.569  19.096  1.00 56.20  ? 129  ARG C CZ  1 
ATOM   2372 N NH1 . ARG C 1 83  ? -11.369 21.711  20.396  1.00 55.79  ? 129  ARG C NH1 1 
ATOM   2373 N NH2 . ARG C 1 83  ? -12.585 20.737  18.710  1.00 59.03  ? 129  ARG C NH2 1 
ATOM   2374 N N   . LEU C 1 84  ? -6.456  27.494  17.031  1.00 56.58  ? 130  LEU C N   1 
ATOM   2375 C CA  . LEU C 1 84  ? -5.877  28.811  17.283  1.00 58.40  ? 130  LEU C CA  1 
ATOM   2376 C C   . LEU C 1 84  ? -5.769  29.621  15.990  1.00 60.82  ? 130  LEU C C   1 
ATOM   2377 O O   . LEU C 1 84  ? -6.116  30.805  15.963  1.00 63.01  ? 130  LEU C O   1 
ATOM   2378 C CB  . LEU C 1 84  ? -4.508  28.688  17.962  1.00 57.62  ? 130  LEU C CB  1 
ATOM   2379 C CG  . LEU C 1 84  ? -4.555  28.268  19.434  1.00 55.75  ? 130  LEU C CG  1 
ATOM   2380 C CD1 . LEU C 1 84  ? -3.198  27.758  19.905  1.00 54.37  ? 130  LEU C CD1 1 
ATOM   2381 C CD2 . LEU C 1 84  ? -5.039  29.412  20.311  1.00 55.52  ? 130  LEU C CD2 1 
ATOM   2382 N N   . GLU C 1 85  ? -5.312  28.972  14.919  1.00 60.54  ? 131  GLU C N   1 
ATOM   2383 C CA  . GLU C 1 85  ? -5.175  29.619  13.618  1.00 63.14  ? 131  GLU C CA  1 
ATOM   2384 C C   . GLU C 1 85  ? -6.510  30.105  13.058  1.00 64.58  ? 131  GLU C C   1 
ATOM   2385 O O   . GLU C 1 85  ? -6.553  31.086  12.324  1.00 66.01  ? 131  GLU C O   1 
ATOM   2386 C CB  . GLU C 1 85  ? -4.530  28.657  12.615  1.00 63.43  ? 131  GLU C CB  1 
ATOM   2387 C CG  . GLU C 1 85  ? -3.063  28.373  12.888  1.00 63.97  ? 131  GLU C CG  1 
ATOM   2388 C CD  . GLU C 1 85  ? -2.514  27.201  12.085  1.00 65.46  ? 131  GLU C CD  1 
ATOM   2389 O OE1 . GLU C 1 85  ? -3.297  26.470  11.439  1.00 67.18  ? 131  GLU C OE1 1 
ATOM   2390 O OE2 . GLU C 1 85  ? -1.282  27.005  12.107  1.00 65.91  ? 131  GLU C OE2 1 
ATOM   2391 N N   . ASN C 1 86  ? -7.593  29.415  13.412  1.00 63.74  ? 132  ASN C N   1 
ATOM   2392 C CA  . ASN C 1 86  ? -8.905  29.675  12.823  1.00 65.91  ? 132  ASN C CA  1 
ATOM   2393 C C   . ASN C 1 86  ? -9.856  30.467  13.731  1.00 65.96  ? 132  ASN C C   1 
ATOM   2394 O O   . ASN C 1 86  ? -11.040 30.598  13.413  1.00 66.78  ? 132  ASN C O   1 
ATOM   2395 C CB  . ASN C 1 86  ? -9.549  28.340  12.429  1.00 65.78  ? 132  ASN C CB  1 
ATOM   2396 C CG  . ASN C 1 86  ? -8.793  27.622  11.317  1.00 67.70  ? 132  ASN C CG  1 
ATOM   2397 O OD1 . ASN C 1 86  ? -8.022  28.225  10.577  1.00 71.74  ? 132  ASN C OD1 1 
ATOM   2398 N ND2 . ASN C 1 86  ? -9.026  26.322  11.194  1.00 70.78  ? 132  ASN C ND2 1 
ATOM   2399 N N   . ASN C 1 87  ? -9.333  30.994  14.844  1.00 64.33  ? 133  ASN C N   1 
ATOM   2400 C CA  . ASN C 1 87  ? -10.109 31.806  15.798  1.00 65.19  ? 133  ASN C CA  1 
ATOM   2401 C C   . ASN C 1 87  ? -11.235 31.019  16.472  1.00 64.20  ? 133  ASN C C   1 
ATOM   2402 O O   . ASN C 1 87  ? -12.262 31.590  16.857  1.00 65.52  ? 133  ASN C O   1 
ATOM   2403 C CB  . ASN C 1 87  ? -10.680 33.068  15.126  1.00 68.72  ? 133  ASN C CB  1 
ATOM   2404 C CG  . ASN C 1 87  ? -9.604  33.996  14.604  1.00 70.23  ? 133  ASN C CG  1 
ATOM   2405 O OD1 . ASN C 1 87  ? -8.667  34.341  15.321  1.00 69.83  ? 133  ASN C OD1 1 
ATOM   2406 N ND2 . ASN C 1 87  ? -9.747  34.427  13.356  1.00 72.37  ? 133  ASN C ND2 1 
ATOM   2407 N N   . TYR C 1 88  ? -11.033 29.713  16.613  1.00 61.15  ? 134  TYR C N   1 
ATOM   2408 C CA  . TYR C 1 88  ? -12.051 28.817  17.144  1.00 61.56  ? 134  TYR C CA  1 
ATOM   2409 C C   . TYR C 1 88  ? -12.420 29.161  18.595  1.00 62.34  ? 134  TYR C C   1 
ATOM   2410 O O   . TYR C 1 88  ? -13.595 29.144  18.953  1.00 63.36  ? 134  TYR C O   1 
ATOM   2411 C CB  . TYR C 1 88  ? -11.560 27.364  17.043  1.00 59.86  ? 134  TYR C CB  1 
ATOM   2412 C CG  . TYR C 1 88  ? -12.426 26.326  17.734  1.00 59.48  ? 134  TYR C CG  1 
ATOM   2413 C CD1 . TYR C 1 88  ? -13.457 25.695  17.051  1.00 61.30  ? 134  TYR C CD1 1 
ATOM   2414 C CD2 . TYR C 1 88  ? -12.194 25.958  19.060  1.00 59.53  ? 134  TYR C CD2 1 
ATOM   2415 C CE1 . TYR C 1 88  ? -14.252 24.742  17.663  1.00 61.64  ? 134  TYR C CE1 1 
ATOM   2416 C CE2 . TYR C 1 88  ? -12.987 24.998  19.689  1.00 59.98  ? 134  TYR C CE2 1 
ATOM   2417 C CZ  . TYR C 1 88  ? -14.014 24.392  18.974  1.00 61.10  ? 134  TYR C CZ  1 
ATOM   2418 O OH  . TYR C 1 88  ? -14.817 23.442  19.561  1.00 61.51  ? 134  TYR C OH  1 
ATOM   2419 N N   . TYR C 1 89  ? -11.421 29.478  19.418  1.00 62.12  ? 135  TYR C N   1 
ATOM   2420 C CA  . TYR C 1 89  ? -11.639 29.669  20.857  1.00 62.99  ? 135  TYR C CA  1 
ATOM   2421 C C   . TYR C 1 89  ? -12.240 31.032  21.202  1.00 67.06  ? 135  TYR C C   1 
ATOM   2422 O O   . TYR C 1 89  ? -11.937 32.041  20.560  1.00 69.11  ? 135  TYR C O   1 
ATOM   2423 C CB  . TYR C 1 89  ? -10.328 29.487  21.631  1.00 60.26  ? 135  TYR C CB  1 
ATOM   2424 C CG  . TYR C 1 89  ? -9.751  28.091  21.547  1.00 57.08  ? 135  TYR C CG  1 
ATOM   2425 C CD1 . TYR C 1 89  ? -10.374 27.018  22.179  1.00 55.69  ? 135  TYR C CD1 1 
ATOM   2426 C CD2 . TYR C 1 89  ? -8.580  27.842  20.839  1.00 56.70  ? 135  TYR C CD2 1 
ATOM   2427 C CE1 . TYR C 1 89  ? -9.854  25.733  22.099  1.00 52.47  ? 135  TYR C CE1 1 
ATOM   2428 C CE2 . TYR C 1 89  ? -8.047  26.563  20.761  1.00 53.87  ? 135  TYR C CE2 1 
ATOM   2429 C CZ  . TYR C 1 89  ? -8.687  25.512  21.389  1.00 53.55  ? 135  TYR C CZ  1 
ATOM   2430 O OH  . TYR C 1 89  ? -8.150  24.243  21.306  1.00 52.40  ? 135  TYR C OH  1 
ATOM   2431 N N   . TRP C 1 90  ? -13.076 31.037  22.241  1.00 69.77  ? 136  TRP C N   1 
ATOM   2432 C CA  . TRP C 1 90  ? -13.665 32.257  22.814  1.00 73.33  ? 136  TRP C CA  1 
ATOM   2433 C C   . TRP C 1 90  ? -12.879 32.777  24.008  1.00 73.85  ? 136  TRP C C   1 
ATOM   2434 O O   . TRP C 1 90  ? -12.799 33.987  24.226  1.00 76.39  ? 136  TRP C O   1 
ATOM   2435 C CB  . TRP C 1 90  ? -15.101 31.987  23.258  1.00 75.54  ? 136  TRP C CB  1 
ATOM   2436 C CG  . TRP C 1 90  ? -16.108 32.409  22.259  1.00 77.57  ? 136  TRP C CG  1 
ATOM   2437 C CD1 . TRP C 1 90  ? -15.982 32.372  20.902  1.00 77.81  ? 136  TRP C CD1 1 
ATOM   2438 C CD2 . TRP C 1 90  ? -17.408 32.921  22.530  1.00 80.17  ? 136  TRP C CD2 1 
ATOM   2439 N NE1 . TRP C 1 90  ? -17.122 32.843  20.312  1.00 80.08  ? 136  TRP C NE1 1 
ATOM   2440 C CE2 . TRP C 1 90  ? -18.016 33.187  21.289  1.00 82.44  ? 136  TRP C CE2 1 
ATOM   2441 C CE3 . TRP C 1 90  ? -18.118 33.193  23.701  1.00 82.04  ? 136  TRP C CE3 1 
ATOM   2442 C CZ2 . TRP C 1 90  ? -19.297 33.699  21.183  1.00 85.11  ? 136  TRP C CZ2 1 
ATOM   2443 C CZ3 . TRP C 1 90  ? -19.391 33.708  23.594  1.00 85.45  ? 136  TRP C CZ3 1 
ATOM   2444 C CH2 . TRP C 1 90  ? -19.966 33.953  22.346  1.00 87.41  ? 136  TRP C CH2 1 
ATOM   2445 N N   . ALA C 1 91  ? -12.330 31.856  24.794  1.00 71.33  ? 137  ALA C N   1 
ATOM   2446 C CA  . ALA C 1 91  ? -11.512 32.214  25.943  1.00 71.38  ? 137  ALA C CA  1 
ATOM   2447 C C   . ALA C 1 91  ? -10.268 31.349  25.970  1.00 68.50  ? 137  ALA C C   1 
ATOM   2448 O O   . ALA C 1 91  ? -10.252 30.244  25.413  1.00 66.26  ? 137  ALA C O   1 
ATOM   2449 C CB  . ALA C 1 91  ? -12.305 32.044  27.235  1.00 72.36  ? 137  ALA C CB  1 
ATOM   2450 N N   . ALA C 1 92  ? -9.226  31.860  26.620  1.00 68.69  ? 138  ALA C N   1 
ATOM   2451 C CA  . ALA C 1 92  ? -8.018  31.087  26.863  1.00 66.70  ? 138  ALA C CA  1 
ATOM   2452 C C   . ALA C 1 92  ? -8.332  29.791  27.618  1.00 64.59  ? 138  ALA C C   1 
ATOM   2453 O O   . ALA C 1 92  ? -7.707  28.768  27.364  1.00 63.28  ? 138  ALA C O   1 
ATOM   2454 C CB  . ALA C 1 92  ? -7.005  31.913  27.631  1.00 67.72  ? 138  ALA C CB  1 
ATOM   2455 N N   . SER C 1 93  ? -9.310  29.833  28.524  1.00 65.14  ? 139  SER C N   1 
ATOM   2456 C CA  . SER C 1 93  ? -9.689  28.655  29.318  1.00 63.18  ? 139  SER C CA  1 
ATOM   2457 C C   . SER C 1 93  ? -9.984  27.424  28.458  1.00 60.74  ? 139  SER C C   1 
ATOM   2458 O O   . SER C 1 93  ? -9.550  26.335  28.783  1.00 57.97  ? 139  SER C O   1 
ATOM   2459 C CB  . SER C 1 93  ? -10.893 28.956  30.231  1.00 65.54  ? 139  SER C CB  1 
ATOM   2460 O OG  . SER C 1 93  ? -12.106 29.026  29.495  1.00 65.66  ? 139  SER C OG  1 
ATOM   2461 N N   . GLU C 1 94  ? -10.714 27.605  27.359  1.00 61.66  ? 140  GLU C N   1 
ATOM   2462 C CA  . GLU C 1 94  ? -11.053 26.488  26.460  1.00 60.44  ? 140  GLU C CA  1 
ATOM   2463 C C   . GLU C 1 94  ? -9.817  25.838  25.832  1.00 57.36  ? 140  GLU C C   1 
ATOM   2464 O O   . GLU C 1 94  ? -9.711  24.612  25.787  1.00 55.57  ? 140  GLU C O   1 
ATOM   2465 C CB  . GLU C 1 94  ? -11.991 26.956  25.350  1.00 62.93  ? 140  GLU C CB  1 
ATOM   2466 C CG  . GLU C 1 94  ? -13.365 27.363  25.834  1.00 66.62  ? 140  GLU C CG  1 
ATOM   2467 C CD  . GLU C 1 94  ? -14.213 27.978  24.739  1.00 71.44  ? 140  GLU C CD  1 
ATOM   2468 O OE1 . GLU C 1 94  ? -13.934 27.727  23.545  1.00 73.02  ? 140  GLU C OE1 1 
ATOM   2469 O OE2 . GLU C 1 94  ? -15.164 28.714  25.075  1.00 76.33  ? 140  GLU C OE2 1 
ATOM   2470 N N   . CYS C 1 95  ? -8.896  26.671  25.351  1.00 56.48  ? 141  CYS C N   1 
ATOM   2471 C CA  . CYS C 1 95  ? -7.625  26.208  24.797  1.00 54.60  ? 141  CYS C CA  1 
ATOM   2472 C C   . CYS C 1 95  ? -6.815  25.473  25.861  1.00 52.57  ? 141  CYS C C   1 
ATOM   2473 O O   . CYS C 1 95  ? -6.276  24.396  25.611  1.00 50.91  ? 141  CYS C O   1 
ATOM   2474 C CB  . CYS C 1 95  ? -6.824  27.399  24.255  1.00 55.41  ? 141  CYS C CB  1 
ATOM   2475 S SG  . CYS C 1 95  ? -5.210  26.995  23.527  1.00 54.86  ? 141  CYS C SG  1 
ATOM   2476 N N   . MET C 1 96  ? -6.749  26.060  27.051  1.00 53.26  ? 142  MET C N   1 
ATOM   2477 C CA  . MET C 1 96  ? -6.081  25.432  28.189  1.00 51.62  ? 142  MET C CA  1 
ATOM   2478 C C   . MET C 1 96  ? -6.677  24.066  28.516  1.00 50.60  ? 142  MET C C   1 
ATOM   2479 O O   . MET C 1 96  ? -5.932  23.108  28.747  1.00 50.12  ? 142  MET C O   1 
ATOM   2480 C CB  . MET C 1 96  ? -6.127  26.343  29.409  1.00 53.21  ? 142  MET C CB  1 
ATOM   2481 C CG  . MET C 1 96  ? -5.212  27.545  29.296  1.00 55.15  ? 142  MET C CG  1 
ATOM   2482 S SD  . MET C 1 96  ? -5.680  28.865  30.425  1.00 58.63  ? 142  MET C SD  1 
ATOM   2483 C CE  . MET C 1 96  ? -5.293  28.129  32.004  1.00 57.26  ? 142  MET C CE  1 
ATOM   2484 N N   A GLN C 1 97  ? -8.007  23.979  28.529  0.50 51.13  ? 143  GLN C N   1 
ATOM   2485 N N   B GLN C 1 97  ? -8.004  23.961  28.526  0.50 51.14  ? 143  GLN C N   1 
ATOM   2486 C CA  A GLN C 1 97  ? -8.703  22.709  28.756  0.50 50.59  ? 143  GLN C CA  1 
ATOM   2487 C CA  B GLN C 1 97  ? -8.645  22.671  28.782  0.50 50.55  ? 143  GLN C CA  1 
ATOM   2488 C C   A GLN C 1 97  ? -8.332  21.660  27.700  0.50 49.05  ? 143  GLN C C   1 
ATOM   2489 C C   B GLN C 1 97  ? -8.320  21.642  27.696  0.50 49.04  ? 143  GLN C C   1 
ATOM   2490 O O   A GLN C 1 97  ? -8.178  20.483  28.022  0.50 48.13  ? 143  GLN C O   1 
ATOM   2491 O O   B GLN C 1 97  ? -8.188  20.456  27.992  0.50 48.14  ? 143  GLN C O   1 
ATOM   2492 C CB  A GLN C 1 97  ? -10.223 22.915  28.776  0.50 52.21  ? 143  GLN C CB  1 
ATOM   2493 C CB  B GLN C 1 97  ? -10.160 22.804  28.939  0.50 52.21  ? 143  GLN C CB  1 
ATOM   2494 C CG  A GLN C 1 97  ? -10.716 23.872  29.854  0.50 54.07  ? 143  GLN C CG  1 
ATOM   2495 C CG  B GLN C 1 97  ? -10.804 21.504  29.411  0.50 51.98  ? 143  GLN C CG  1 
ATOM   2496 C CD  A GLN C 1 97  ? -10.686 23.285  31.243  0.50 53.44  ? 143  GLN C CD  1 
ATOM   2497 C CD  B GLN C 1 97  ? -10.046 20.870  30.571  0.50 51.71  ? 143  GLN C CD  1 
ATOM   2498 O OE1 A GLN C 1 97  ? -10.393 22.107  31.424  0.50 53.02  ? 143  GLN C OE1 1 
ATOM   2499 O OE1 B GLN C 1 97  ? -9.571  19.732  30.483  0.50 45.37  ? 143  GLN C OE1 1 
ATOM   2500 N NE2 A GLN C 1 97  ? -10.989 24.111  32.241  0.50 53.71  ? 143  GLN C NE2 1 
ATOM   2501 N NE2 B GLN C 1 97  ? -9.919  21.617  31.665  0.50 52.63  ? 143  GLN C NE2 1 
ATOM   2502 N N   . ASP C 1 98  ? -8.185  22.090  26.448  1.00 49.38  ? 144  ASP C N   1 
ATOM   2503 C CA  . ASP C 1 98  ? -7.821  21.173  25.352  1.00 48.56  ? 144  ASP C CA  1 
ATOM   2504 C C   . ASP C 1 98  ? -6.424  20.595  25.555  1.00 47.09  ? 144  ASP C C   1 
ATOM   2505 O O   . ASP C 1 98  ? -6.235  19.374  25.459  1.00 46.53  ? 144  ASP C O   1 
ATOM   2506 C CB  . ASP C 1 98  ? -7.940  21.844  23.980  1.00 49.51  ? 144  ASP C CB  1 
ATOM   2507 C CG  . ASP C 1 98  ? -9.371  21.853  23.444  1.00 52.20  ? 144  ASP C CG  1 
ATOM   2508 O OD1 . ASP C 1 98  ? -10.266 21.185  24.022  1.00 51.20  ? 144  ASP C OD1 1 
ATOM   2509 O OD2 . ASP C 1 98  ? -9.589  22.520  22.416  1.00 53.25  ? 144  ASP C OD2 1 
ATOM   2510 N N   . PHE C 1 99  ? -5.456  21.459  25.860  1.00 46.52  ? 145  PHE C N   1 
ATOM   2511 C CA  . PHE C 1 99  ? -4.135  20.985  26.275  1.00 46.42  ? 145  PHE C CA  1 
ATOM   2512 C C   . PHE C 1 99  ? -4.221  19.998  27.427  1.00 46.16  ? 145  PHE C C   1 
ATOM   2513 O O   . PHE C 1 99  ? -3.610  18.934  27.376  1.00 45.16  ? 145  PHE C O   1 
ATOM   2514 C CB  . PHE C 1 99  ? -3.228  22.140  26.682  1.00 47.38  ? 145  PHE C CB  1 
ATOM   2515 C CG  . PHE C 1 99  ? -2.484  22.758  25.541  1.00 48.83  ? 145  PHE C CG  1 
ATOM   2516 C CD1 . PHE C 1 99  ? -1.449  22.073  24.925  1.00 50.66  ? 145  PHE C CD1 1 
ATOM   2517 C CD2 . PHE C 1 99  ? -2.800  24.038  25.093  1.00 52.17  ? 145  PHE C CD2 1 
ATOM   2518 C CE1 . PHE C 1 99  ? -0.747  22.645  23.882  1.00 50.27  ? 145  PHE C CE1 1 
ATOM   2519 C CE2 . PHE C 1 99  ? -2.102  24.614  24.049  1.00 52.13  ? 145  PHE C CE2 1 
ATOM   2520 C CZ  . PHE C 1 99  ? -1.082  23.916  23.439  1.00 52.36  ? 145  PHE C CZ  1 
ATOM   2521 N N   . ASN C 1 100 ? -4.974  20.353  28.471  1.00 47.16  ? 146  ASN C N   1 
ATOM   2522 C CA  . ASN C 1 100 ? -5.110  19.480  29.638  1.00 47.18  ? 146  ASN C CA  1 
ATOM   2523 C C   . ASN C 1 100 ? -5.670  18.109  29.271  1.00 46.90  ? 146  ASN C C   1 
ATOM   2524 O O   . ASN C 1 100 ? -5.163  17.087  29.731  1.00 47.36  ? 146  ASN C O   1 
ATOM   2525 C CB  . ASN C 1 100 ? -6.006  20.123  30.695  1.00 48.77  ? 146  ASN C CB  1 
ATOM   2526 C CG  . ASN C 1 100 ? -6.197  19.239  31.911  1.00 50.70  ? 146  ASN C CG  1 
ATOM   2527 O OD1 . ASN C 1 100 ? -5.280  19.069  32.716  1.00 53.15  ? 146  ASN C OD1 1 
ATOM   2528 N ND2 . ASN C 1 100 ? -7.384  18.665  32.045  1.00 49.45  ? 146  ASN C ND2 1 
ATOM   2529 N N   . THR C 1 101 ? -6.719  18.111  28.450  1.00 46.65  ? 147  THR C N   1 
ATOM   2530 C CA  . THR C 1 101 ? -7.356  16.890  27.964  1.00 46.64  ? 147  THR C CA  1 
ATOM   2531 C C   . THR C 1 101 ? -6.358  16.008  27.222  1.00 45.06  ? 147  THR C C   1 
ATOM   2532 O O   . THR C 1 101 ? -6.310  14.808  27.457  1.00 44.44  ? 147  THR C O   1 
ATOM   2533 C CB  . THR C 1 101 ? -8.544  17.220  27.032  1.00 48.42  ? 147  THR C CB  1 
ATOM   2534 O OG1 . THR C 1 101 ? -9.515  17.976  27.757  1.00 49.14  ? 147  THR C OG1 1 
ATOM   2535 C CG2 . THR C 1 101 ? -9.204  15.964  26.501  1.00 49.37  ? 147  THR C CG2 1 
ATOM   2536 N N   . MET C 1 102 ? -5.564  16.612  26.342  1.00 44.54  ? 148  MET C N   1 
ATOM   2537 C CA  . MET C 1 102 ? -4.546  15.880  25.580  1.00 44.48  ? 148  MET C CA  1 
ATOM   2538 C C   . MET C 1 102 ? -3.563  15.183  26.523  1.00 43.68  ? 148  MET C C   1 
ATOM   2539 O O   . MET C 1 102 ? -3.287  14.002  26.366  1.00 44.57  ? 148  MET C O   1 
ATOM   2540 C CB  . MET C 1 102 ? -3.780  16.829  24.655  1.00 43.68  ? 148  MET C CB  1 
ATOM   2541 C CG  . MET C 1 102 ? -2.636  16.190  23.885  1.00 44.64  ? 148  MET C CG  1 
ATOM   2542 S SD  . MET C 1 102 ? -1.692  17.403  22.946  1.00 47.15  ? 148  MET C SD  1 
ATOM   2543 C CE  . MET C 1 102 ? -0.782  18.181  24.275  1.00 45.56  ? 148  MET C CE  1 
ATOM   2544 N N   . PHE C 1 103 ? -3.023  15.923  27.488  1.00 44.45  ? 149  PHE C N   1 
ATOM   2545 C CA  . PHE C 1 103 ? -2.089  15.343  28.450  1.00 44.68  ? 149  PHE C CA  1 
ATOM   2546 C C   . PHE C 1 103 ? -2.748  14.284  29.328  1.00 44.73  ? 149  PHE C C   1 
ATOM   2547 O O   . PHE C 1 103 ? -2.192  13.199  29.513  1.00 45.46  ? 149  PHE C O   1 
ATOM   2548 C CB  . PHE C 1 103 ? -1.437  16.424  29.317  1.00 45.26  ? 149  PHE C CB  1 
ATOM   2549 C CG  . PHE C 1 103 ? -0.563  17.389  28.542  1.00 46.22  ? 149  PHE C CG  1 
ATOM   2550 C CD1 . PHE C 1 103 ? 0.443   16.923  27.705  1.00 46.11  ? 149  PHE C CD1 1 
ATOM   2551 C CD2 . PHE C 1 103 ? -0.744  18.761  28.656  1.00 46.47  ? 149  PHE C CD2 1 
ATOM   2552 C CE1 . PHE C 1 103 ? 1.248   17.811  26.999  1.00 48.86  ? 149  PHE C CE1 1 
ATOM   2553 C CE2 . PHE C 1 103 ? 0.058   19.649  27.951  1.00 48.75  ? 149  PHE C CE2 1 
ATOM   2554 C CZ  . PHE C 1 103 ? 1.048   19.177  27.119  1.00 48.03  ? 149  PHE C CZ  1 
ATOM   2555 N N   . THR C 1 104 ? -3.926  14.593  29.862  1.00 44.96  ? 150  THR C N   1 
ATOM   2556 C CA  . THR C 1 104 ? -4.646  13.654  30.736  1.00 45.13  ? 150  THR C CA  1 
ATOM   2557 C C   . THR C 1 104 ? -4.971  12.336  30.028  1.00 46.25  ? 150  THR C C   1 
ATOM   2558 O O   . THR C 1 104 ? -4.789  11.265  30.611  1.00 47.39  ? 150  THR C O   1 
ATOM   2559 C CB  . THR C 1 104 ? -5.922  14.290  31.297  1.00 45.68  ? 150  THR C CB  1 
ATOM   2560 O OG1 . THR C 1 104 ? -5.561  15.418  32.100  1.00 45.01  ? 150  THR C OG1 1 
ATOM   2561 C CG2 . THR C 1 104 ? -6.718  13.292  32.143  1.00 46.55  ? 150  THR C CG2 1 
ATOM   2562 N N   . ASN C 1 105 ? -5.439  12.407  28.779  1.00 46.73  ? 151  ASN C N   1 
ATOM   2563 C CA  . ASN C 1 105 ? -5.683  11.193  27.980  1.00 47.63  ? 151  ASN C CA  1 
ATOM   2564 C C   . ASN C 1 105 ? -4.454  10.302  27.965  1.00 47.68  ? 151  ASN C C   1 
ATOM   2565 O O   . ASN C 1 105 ? -4.541  9.083   28.139  1.00 47.84  ? 151  ASN C O   1 
ATOM   2566 C CB  . ASN C 1 105 ? -6.040  11.532  26.526  1.00 48.03  ? 151  ASN C CB  1 
ATOM   2567 C CG  . ASN C 1 105 ? -7.402  12.167  26.386  1.00 49.22  ? 151  ASN C CG  1 
ATOM   2568 O OD1 . ASN C 1 105 ? -8.213  12.145  27.319  1.00 49.13  ? 151  ASN C OD1 1 
ATOM   2569 N ND2 . ASN C 1 105 ? -7.668  12.736  25.210  1.00 49.22  ? 151  ASN C ND2 1 
ATOM   2570 N N   . CYS C 1 106 ? -3.303  10.929  27.749  1.00 48.04  ? 152  CYS C N   1 
ATOM   2571 C CA  . CYS C 1 106 ? -2.040  10.216  27.701  1.00 49.24  ? 152  CYS C CA  1 
ATOM   2572 C C   . CYS C 1 106 ? -1.762  9.500   29.025  1.00 49.13  ? 152  CYS C C   1 
ATOM   2573 O O   . CYS C 1 106 ? -1.454  8.306   29.036  1.00 49.44  ? 152  CYS C O   1 
ATOM   2574 C CB  . CYS C 1 106 ? -0.910  11.186  27.334  1.00 49.58  ? 152  CYS C CB  1 
ATOM   2575 S SG  . CYS C 1 106 ? 0.662   10.399  27.113  1.00 53.36  ? 152  CYS C SG  1 
ATOM   2576 N N   . TYR C 1 107 ? -1.922  10.210  30.141  1.00 48.58  ? 153  TYR C N   1 
ATOM   2577 C CA  . TYR C 1 107 ? -1.667  9.625   31.457  1.00 48.84  ? 153  TYR C CA  1 
ATOM   2578 C C   . TYR C 1 107 ? -2.627  8.496   31.792  1.00 50.35  ? 153  TYR C C   1 
ATOM   2579 O O   . TYR C 1 107 ? -2.232  7.506   32.401  1.00 50.96  ? 153  TYR C O   1 
ATOM   2580 C CB  . TYR C 1 107 ? -1.756  10.680  32.559  1.00 48.20  ? 153  TYR C CB  1 
ATOM   2581 C CG  . TYR C 1 107 ? -0.842  11.868  32.371  1.00 47.45  ? 153  TYR C CG  1 
ATOM   2582 C CD1 . TYR C 1 107 ? 0.475   11.707  31.927  1.00 47.46  ? 153  TYR C CD1 1 
ATOM   2583 C CD2 . TYR C 1 107 ? -1.282  13.151  32.662  1.00 46.51  ? 153  TYR C CD2 1 
ATOM   2584 C CE1 . TYR C 1 107 ? 1.307   12.792  31.763  1.00 47.74  ? 153  TYR C CE1 1 
ATOM   2585 C CE2 . TYR C 1 107 ? -0.448  14.250  32.505  1.00 47.24  ? 153  TYR C CE2 1 
ATOM   2586 C CZ  . TYR C 1 107 ? 0.844   14.062  32.050  1.00 48.37  ? 153  TYR C CZ  1 
ATOM   2587 O OH  . TYR C 1 107 ? 1.677   15.142  31.891  1.00 49.64  ? 153  TYR C OH  1 
ATOM   2588 N N   . ILE C 1 108 ? -3.890  8.648   31.398  1.00 50.37  ? 154  ILE C N   1 
ATOM   2589 C CA  . ILE C 1 108 ? -4.912  7.658   31.716  1.00 51.90  ? 154  ILE C CA  1 
ATOM   2590 C C   . ILE C 1 108 ? -4.762  6.393   30.867  1.00 53.52  ? 154  ILE C C   1 
ATOM   2591 O O   . ILE C 1 108 ? -4.844  5.292   31.398  1.00 54.82  ? 154  ILE C O   1 
ATOM   2592 C CB  . ILE C 1 108 ? -6.336  8.242   31.546  1.00 52.37  ? 154  ILE C CB  1 
ATOM   2593 C CG1 . ILE C 1 108 ? -6.609  9.293   32.630  1.00 50.03  ? 154  ILE C CG1 1 
ATOM   2594 C CG2 . ILE C 1 108 ? -7.389  7.133   31.587  1.00 55.31  ? 154  ILE C CG2 1 
ATOM   2595 C CD1 . ILE C 1 108 ? -7.892  10.090  32.385  1.00 52.01  ? 154  ILE C CD1 1 
ATOM   2596 N N   . TYR C 1 109 ? -4.529  6.547   29.563  1.00 53.85  ? 155  TYR C N   1 
ATOM   2597 C CA  . TYR C 1 109 ? -4.487  5.389   28.661  1.00 56.14  ? 155  TYR C CA  1 
ATOM   2598 C C   . TYR C 1 109 ? -3.205  4.559   28.804  1.00 57.16  ? 155  TYR C C   1 
ATOM   2599 O O   . TYR C 1 109 ? -3.258  3.330   28.901  1.00 57.97  ? 155  TYR C O   1 
ATOM   2600 C CB  . TYR C 1 109 ? -4.675  5.792   27.189  1.00 55.96  ? 155  TYR C CB  1 
ATOM   2601 C CG  . TYR C 1 109 ? -4.649  4.579   26.287  1.00 58.24  ? 155  TYR C CG  1 
ATOM   2602 C CD1 . TYR C 1 109 ? -5.732  3.706   26.243  1.00 60.69  ? 155  TYR C CD1 1 
ATOM   2603 C CD2 . TYR C 1 109 ? -3.522  4.265   25.534  1.00 59.66  ? 155  TYR C CD2 1 
ATOM   2604 C CE1 . TYR C 1 109 ? -5.706  2.569   25.456  1.00 62.81  ? 155  TYR C CE1 1 
ATOM   2605 C CE2 . TYR C 1 109 ? -3.485  3.128   24.738  1.00 62.45  ? 155  TYR C CE2 1 
ATOM   2606 C CZ  . TYR C 1 109 ? -4.583  2.284   24.706  1.00 64.15  ? 155  TYR C CZ  1 
ATOM   2607 O OH  . TYR C 1 109 ? -4.562  1.158   23.922  1.00 66.37  ? 155  TYR C OH  1 
ATOM   2608 N N   . ASN C 1 110 ? -2.062  5.241   28.821  1.00 56.55  ? 156  ASN C N   1 
ATOM   2609 C CA  . ASN C 1 110 ? -0.764  4.573   28.758  1.00 57.64  ? 156  ASN C CA  1 
ATOM   2610 C C   . ASN C 1 110 ? -0.273  4.051   30.103  1.00 58.68  ? 156  ASN C C   1 
ATOM   2611 O O   . ASN C 1 110 ? -0.750  4.471   31.156  1.00 57.93  ? 156  ASN C O   1 
ATOM   2612 C CB  . ASN C 1 110 ? 0.271   5.518   28.149  1.00 56.62  ? 156  ASN C CB  1 
ATOM   2613 C CG  . ASN C 1 110 ? -0.045  5.866   26.712  1.00 55.76  ? 156  ASN C CG  1 
ATOM   2614 O OD1 . ASN C 1 110 ? 0.196   5.071   25.805  1.00 58.38  ? 156  ASN C OD1 1 
ATOM   2615 N ND2 . ASN C 1 110 ? -0.585  7.060   26.494  1.00 52.24  ? 156  ASN C ND2 1 
ATOM   2616 N N   . LYS C 1 111 ? 0.675   3.118   30.049  1.00 60.66  ? 157  LYS C N   1 
ATOM   2617 C CA  . LYS C 1 111 ? 1.316   2.583   31.250  1.00 62.09  ? 157  LYS C CA  1 
ATOM   2618 C C   . LYS C 1 111 ? 2.239   3.632   31.879  1.00 60.11  ? 157  LYS C C   1 
ATOM   2619 O O   . LYS C 1 111 ? 2.833   4.436   31.164  1.00 58.85  ? 157  LYS C O   1 
ATOM   2620 C CB  . LYS C 1 111 ? 2.110   1.320   30.911  1.00 65.54  ? 157  LYS C CB  1 
ATOM   2621 C CG  . LYS C 1 111 ? 1.233   0.133   30.530  1.00 69.96  ? 157  LYS C CG  1 
ATOM   2622 C CD  . LYS C 1 111 ? 2.049   -1.031  29.984  1.00 75.33  ? 157  LYS C CD  1 
ATOM   2623 C CE  . LYS C 1 111 ? 1.358   -2.362  30.258  1.00 79.60  ? 157  LYS C CE  1 
ATOM   2624 N NZ  . LYS C 1 111 ? 2.065   -3.517  29.629  1.00 84.92  ? 157  LYS C NZ  1 
ATOM   2625 N N   . PRO C 1 112 ? 2.370   3.629   33.221  1.00 60.42  ? 158  PRO C N   1 
ATOM   2626 C CA  . PRO C 1 112 ? 3.225   4.617   33.889  1.00 59.69  ? 158  PRO C CA  1 
ATOM   2627 C C   . PRO C 1 112 ? 4.667   4.666   33.378  1.00 61.45  ? 158  PRO C C   1 
ATOM   2628 O O   . PRO C 1 112 ? 5.265   5.740   33.335  1.00 60.55  ? 158  PRO C O   1 
ATOM   2629 C CB  . PRO C 1 112 ? 3.203   4.163   35.351  1.00 60.56  ? 158  PRO C CB  1 
ATOM   2630 C CG  . PRO C 1 112 ? 1.913   3.466   35.504  1.00 60.83  ? 158  PRO C CG  1 
ATOM   2631 C CD  . PRO C 1 112 ? 1.687   2.759   34.199  1.00 61.37  ? 158  PRO C CD  1 
ATOM   2632 N N   . THR C 1 113 ? 5.202   3.512   32.986  1.00 64.27  ? 159  THR C N   1 
ATOM   2633 C CA  . THR C 1 113 ? 6.583   3.400   32.529  1.00 67.01  ? 159  THR C CA  1 
ATOM   2634 C C   . THR C 1 113 ? 6.796   3.687   31.036  1.00 67.62  ? 159  THR C C   1 
ATOM   2635 O O   . THR C 1 113 ? 7.933   3.650   30.565  1.00 70.03  ? 159  THR C O   1 
ATOM   2636 C CB  . THR C 1 113 ? 7.124   1.986   32.824  1.00 70.33  ? 159  THR C CB  1 
ATOM   2637 O OG1 . THR C 1 113 ? 6.315   1.018   32.143  1.00 70.79  ? 159  THR C OG1 1 
ATOM   2638 C CG2 . THR C 1 113 ? 7.101   1.709   34.321  0.50 70.26  ? 159  THR C CG2 1 
ATOM   2639 N N   . ASP C 1 114 ? 5.723   3.953   30.291  1.00 66.15  ? 160  ASP C N   1 
ATOM   2640 C CA  . ASP C 1 114 ? 5.845   4.307   28.873  1.00 66.71  ? 160  ASP C CA  1 
ATOM   2641 C C   . ASP C 1 114 ? 6.560   5.650   28.699  1.00 65.86  ? 160  ASP C C   1 
ATOM   2642 O O   . ASP C 1 114 ? 6.326   6.588   29.463  1.00 64.06  ? 160  ASP C O   1 
ATOM   2643 C CB  . ASP C 1 114 ? 4.468   4.368   28.204  1.00 65.59  ? 160  ASP C CB  1 
ATOM   2644 C CG  . ASP C 1 114 ? 3.817   3.000   28.058  1.00 67.87  ? 160  ASP C CG  1 
ATOM   2645 O OD1 . ASP C 1 114 ? 4.508   1.981   28.230  1.00 71.49  ? 160  ASP C OD1 1 
ATOM   2646 O OD2 . ASP C 1 114 ? 2.605   2.941   27.760  1.00 67.96  ? 160  ASP C OD2 1 
ATOM   2647 N N   . ASP C 1 115 ? 7.432   5.734   27.696  1.00 67.44  ? 161  ASP C N   1 
ATOM   2648 C CA  . ASP C 1 115 ? 8.195   6.961   27.424  1.00 67.24  ? 161  ASP C CA  1 
ATOM   2649 C C   . ASP C 1 115 ? 7.284   8.145   27.145  1.00 63.01  ? 161  ASP C C   1 
ATOM   2650 O O   . ASP C 1 115 ? 7.609   9.272   27.520  1.00 62.13  ? 161  ASP C O   1 
ATOM   2651 C CB  . ASP C 1 115 ? 9.136   6.785   26.220  1.00 70.81  ? 161  ASP C CB  1 
ATOM   2652 C CG  . ASP C 1 115 ? 10.279  5.835   26.495  1.00 76.64  ? 161  ASP C CG  1 
ATOM   2653 O OD1 . ASP C 1 115 ? 10.757  5.771   27.649  1.00 79.74  ? 161  ASP C OD1 1 
ATOM   2654 O OD2 . ASP C 1 115 ? 10.717  5.161   25.536  1.00 82.16  ? 161  ASP C OD2 1 
ATOM   2655 N N   . ILE C 1 116 ? 6.152   7.885   26.488  1.00 60.33  ? 162  ILE C N   1 
ATOM   2656 C CA  . ILE C 1 116 ? 5.213   8.938   26.112  1.00 57.29  ? 162  ILE C CA  1 
ATOM   2657 C C   . ILE C 1 116 ? 4.656   9.661   27.343  1.00 54.80  ? 162  ILE C C   1 
ATOM   2658 O O   . ILE C 1 116 ? 4.333   10.840  27.267  1.00 53.18  ? 162  ILE C O   1 
ATOM   2659 C CB  . ILE C 1 116 ? 4.050   8.398   25.235  1.00 56.78  ? 162  ILE C CB  1 
ATOM   2660 C CG1 . ILE C 1 116 ? 3.280   9.560   24.606  1.00 55.44  ? 162  ILE C CG1 1 
ATOM   2661 C CG2 . ILE C 1 116 ? 3.126   7.490   26.045  1.00 57.11  ? 162  ILE C CG2 1 
ATOM   2662 C CD1 . ILE C 1 116 ? 2.340   9.155   23.492  1.00 56.89  ? 162  ILE C CD1 1 
ATOM   2663 N N   . VAL C 1 117 ? 4.564   8.956   28.470  1.00 54.72  ? 163  VAL C N   1 
ATOM   2664 C CA  . VAL C 1 117 ? 4.121   9.571   29.721  1.00 54.17  ? 163  VAL C CA  1 
ATOM   2665 C C   . VAL C 1 117 ? 5.139   10.606  30.198  1.00 54.28  ? 163  VAL C C   1 
ATOM   2666 O O   . VAL C 1 117 ? 4.759   11.713  30.575  1.00 53.12  ? 163  VAL C O   1 
ATOM   2667 C CB  . VAL C 1 117 ? 3.852   8.521   30.815  1.00 54.45  ? 163  VAL C CB  1 
ATOM   2668 C CG1 . VAL C 1 117 ? 3.663   9.190   32.166  1.00 54.51  ? 163  VAL C CG1 1 
ATOM   2669 C CG2 . VAL C 1 117 ? 2.616   7.693   30.441  1.00 53.65  ? 163  VAL C CG2 1 
ATOM   2670 N N   . LEU C 1 118 ? 6.425   10.265  30.152  1.00 56.14  ? 164  LEU C N   1 
ATOM   2671 C CA  . LEU C 1 118 ? 7.475   11.228  30.514  1.00 57.60  ? 164  LEU C CA  1 
ATOM   2672 C C   . LEU C 1 118 ? 7.502   12.409  29.545  1.00 56.42  ? 164  LEU C C   1 
ATOM   2673 O O   . LEU C 1 118 ? 7.727   13.553  29.946  1.00 56.58  ? 164  LEU C O   1 
ATOM   2674 C CB  . LEU C 1 118 ? 8.855   10.560  30.561  1.00 60.98  ? 164  LEU C CB  1 
ATOM   2675 C CG  . LEU C 1 118 ? 10.015  11.479  30.975  1.00 64.66  ? 164  LEU C CG  1 
ATOM   2676 C CD1 . LEU C 1 118 ? 9.669   12.287  32.230  1.00 65.17  ? 164  LEU C CD1 1 
ATOM   2677 C CD2 . LEU C 1 118 ? 11.299  10.688  31.186  1.00 67.04  ? 164  LEU C CD2 1 
ATOM   2678 N N   . MET C 1 119 ? 7.269   12.126  28.269  1.00 56.22  ? 165  MET C N   1 
ATOM   2679 C CA  . MET C 1 119 ? 7.218   13.170  27.255  1.00 56.10  ? 165  MET C CA  1 
ATOM   2680 C C   . MET C 1 119 ? 6.073   14.147  27.528  1.00 53.59  ? 165  MET C C   1 
ATOM   2681 O O   . MET C 1 119 ? 6.267   15.362  27.474  1.00 53.48  ? 165  MET C O   1 
ATOM   2682 C CB  . MET C 1 119 ? 7.089   12.546  25.864  1.00 56.72  ? 165  MET C CB  1 
ATOM   2683 C CG  . MET C 1 119 ? 8.338   11.807  25.426  1.00 60.28  ? 165  MET C CG  1 
ATOM   2684 S SD  . MET C 1 119 ? 8.093   10.800  23.955  1.00 61.54  ? 165  MET C SD  1 
ATOM   2685 C CE  . MET C 1 119 ? 8.116   12.063  22.689  1.00 61.50  ? 165  MET C CE  1 
ATOM   2686 N N   . ALA C 1 120 ? 4.892   13.617  27.842  1.00 52.12  ? 166  ALA C N   1 
ATOM   2687 C CA  . ALA C 1 120 ? 3.738   14.457  28.189  1.00 50.69  ? 166  ALA C CA  1 
ATOM   2688 C C   . ALA C 1 120 ? 4.033   15.318  29.417  1.00 50.40  ? 166  ALA C C   1 
ATOM   2689 O O   . ALA C 1 120 ? 3.743   16.509  29.425  1.00 50.34  ? 166  ALA C O   1 
ATOM   2690 C CB  . ALA C 1 120 ? 2.491   13.598  28.435  1.00 49.74  ? 166  ALA C CB  1 
ATOM   2691 N N   . GLN C 1 121 ? 4.605   14.710  30.453  1.00 51.26  ? 167  GLN C N   1 
ATOM   2692 C CA  . GLN C 1 121 ? 4.942   15.444  31.681  1.00 51.78  ? 167  GLN C CA  1 
ATOM   2693 C C   . GLN C 1 121 ? 5.830   16.645  31.404  1.00 52.78  ? 167  GLN C C   1 
ATOM   2694 O O   . GLN C 1 121 ? 5.578   17.742  31.900  1.00 53.51  ? 167  GLN C O   1 
ATOM   2695 C CB  . GLN C 1 121 ? 5.631   14.529  32.687  1.00 53.51  ? 167  GLN C CB  1 
ATOM   2696 C CG  . GLN C 1 121 ? 4.704   13.568  33.397  1.00 53.60  ? 167  GLN C CG  1 
ATOM   2697 C CD  . GLN C 1 121 ? 5.459   12.634  34.314  1.00 58.08  ? 167  GLN C CD  1 
ATOM   2698 O OE1 . GLN C 1 121 ? 6.112   11.693  33.860  1.00 61.89  ? 167  GLN C OE1 1 
ATOM   2699 N NE2 . GLN C 1 121 ? 5.386   12.894  35.613  1.00 60.19  ? 167  GLN C NE2 1 
ATOM   2700 N N   . THR C 1 122 ? 6.877   16.431  30.616  1.00 53.69  ? 168  THR C N   1 
ATOM   2701 C CA  . THR C 1 122 ? 7.799   17.497  30.252  1.00 54.98  ? 168  THR C CA  1 
ATOM   2702 C C   . THR C 1 122 ? 7.083   18.624  29.525  1.00 53.44  ? 168  THR C C   1 
ATOM   2703 O O   . THR C 1 122 ? 7.273   19.798  29.835  1.00 54.23  ? 168  THR C O   1 
ATOM   2704 C CB  . THR C 1 122 ? 8.915   16.965  29.336  1.00 56.76  ? 168  THR C CB  1 
ATOM   2705 O OG1 . THR C 1 122 ? 9.592   15.893  29.999  1.00 57.87  ? 168  THR C OG1 1 
ATOM   2706 C CG2 . THR C 1 122 ? 9.902   18.073  28.988  1.00 59.45  ? 168  THR C CG2 1 
ATOM   2707 N N   . LEU C 1 123 ? 6.261   18.257  28.554  1.00 52.00  ? 169  LEU C N   1 
ATOM   2708 C CA  . LEU C 1 123 ? 5.501   19.232  27.785  1.00 51.59  ? 169  LEU C CA  1 
ATOM   2709 C C   . LEU C 1 123 ? 4.482   19.985  28.651  1.00 51.35  ? 169  LEU C C   1 
ATOM   2710 O O   . LEU C 1 123 ? 4.315   21.201  28.506  1.00 51.99  ? 169  LEU C O   1 
ATOM   2711 C CB  . LEU C 1 123 ? 4.789   18.536  26.623  1.00 50.58  ? 169  LEU C CB  1 
ATOM   2712 C CG  . LEU C 1 123 ? 5.676   17.963  25.523  1.00 51.74  ? 169  LEU C CG  1 
ATOM   2713 C CD1 . LEU C 1 123 ? 4.842   17.091  24.586  1.00 50.95  ? 169  LEU C CD1 1 
ATOM   2714 C CD2 . LEU C 1 123 ? 6.384   19.086  24.757  1.00 52.27  ? 169  LEU C CD2 1 
ATOM   2715 N N   . GLU C 1 124 ? 3.805   19.270  29.547  1.00 50.22  ? 170  GLU C N   1 
ATOM   2716 C CA  . GLU C 1 124 ? 2.784   19.905  30.389  1.00 50.24  ? 170  GLU C CA  1 
ATOM   2717 C C   . GLU C 1 124 ? 3.391   20.916  31.360  1.00 50.91  ? 170  GLU C C   1 
ATOM   2718 O O   . GLU C 1 124 ? 2.803   21.967  31.596  1.00 50.40  ? 170  GLU C O   1 
ATOM   2719 C CB  . GLU C 1 124 ? 1.936   18.878  31.150  1.00 49.68  ? 170  GLU C CB  1 
ATOM   2720 C CG  . GLU C 1 124 ? 0.785   19.544  31.913  1.00 51.16  ? 170  GLU C CG  1 
ATOM   2721 C CD  . GLU C 1 124 ? -0.407  18.645  32.143  1.00 54.50  ? 170  GLU C CD  1 
ATOM   2722 O OE1 . GLU C 1 124 ? -0.193  17.475  32.512  1.00 54.43  ? 170  GLU C OE1 1 
ATOM   2723 O OE2 . GLU C 1 124 ? -1.563  19.132  31.994  1.00 58.68  ? 170  GLU C OE2 1 
ATOM   2724 N N   . LYS C 1 125 ? 4.563   20.602  31.909  1.00 52.39  ? 171  LYS C N   1 
ATOM   2725 C CA  . LYS C 1 125 ? 5.267   21.526  32.800  1.00 54.51  ? 171  LYS C CA  1 
ATOM   2726 C C   . LYS C 1 125 ? 5.598   22.843  32.094  1.00 55.19  ? 171  LYS C C   1 
ATOM   2727 O O   . LYS C 1 125 ? 5.458   23.918  32.674  1.00 55.25  ? 171  LYS C O   1 
ATOM   2728 C CB  . LYS C 1 125 ? 6.544   20.886  33.362  1.00 56.56  ? 171  LYS C CB  1 
ATOM   2729 C CG  . LYS C 1 125 ? 6.287   19.799  34.404  1.00 58.55  ? 171  LYS C CG  1 
ATOM   2730 C CD  . LYS C 1 125 ? 7.569   19.119  34.866  1.00 62.49  ? 171  LYS C CD  1 
ATOM   2731 C CE  . LYS C 1 125 ? 7.284   17.997  35.863  1.00 63.09  ? 171  LYS C CE  1 
ATOM   2732 N NZ  . LYS C 1 125 ? 6.569   18.481  37.075  1.00 63.93  ? 171  LYS C NZ  1 
ATOM   2733 N N   . ILE C 1 126 ? 6.035   22.747  30.841  1.00 55.40  ? 172  ILE C N   1 
ATOM   2734 C CA  . ILE C 1 126 ? 6.324   23.923  30.020  1.00 56.51  ? 172  ILE C CA  1 
ATOM   2735 C C   . ILE C 1 126 ? 5.035   24.706  29.758  1.00 55.47  ? 172  ILE C C   1 
ATOM   2736 O O   . ILE C 1 126 ? 4.998   25.928  29.910  1.00 55.66  ? 172  ILE C O   1 
ATOM   2737 C CB  . ILE C 1 126 ? 6.981   23.522  28.670  1.00 57.58  ? 172  ILE C CB  1 
ATOM   2738 C CG1 . ILE C 1 126 ? 8.338   22.853  28.909  1.00 59.44  ? 172  ILE C CG1 1 
ATOM   2739 C CG2 . ILE C 1 126 ? 7.153   24.736  27.776  1.00 58.24  ? 172  ILE C CG2 1 
ATOM   2740 C CD1 . ILE C 1 126 ? 8.961   22.267  27.656  1.00 61.48  ? 172  ILE C CD1 1 
ATOM   2741 N N   . PHE C 1 127 ? 3.978   23.990  29.381  1.00 53.96  ? 173  PHE C N   1 
ATOM   2742 C CA  . PHE C 1 127 ? 2.661   24.594  29.168  1.00 54.02  ? 173  PHE C CA  1 
ATOM   2743 C C   . PHE C 1 127 ? 2.235   25.426  30.383  1.00 54.91  ? 173  PHE C C   1 
ATOM   2744 O O   . PHE C 1 127 ? 1.886   26.601  30.253  1.00 55.27  ? 173  PHE C O   1 
ATOM   2745 C CB  . PHE C 1 127 ? 1.627   23.499  28.841  1.00 52.64  ? 173  PHE C CB  1 
ATOM   2746 C CG  . PHE C 1 127 ? 0.194   23.937  28.983  1.00 53.85  ? 173  PHE C CG  1 
ATOM   2747 C CD1 . PHE C 1 127 ? -0.393  24.762  28.032  1.00 57.11  ? 173  PHE C CD1 1 
ATOM   2748 C CD2 . PHE C 1 127 ? -0.576  23.501  30.052  1.00 55.63  ? 173  PHE C CD2 1 
ATOM   2749 C CE1 . PHE C 1 127 ? -1.720  25.159  28.155  1.00 56.52  ? 173  PHE C CE1 1 
ATOM   2750 C CE2 . PHE C 1 127 ? -1.905  23.898  30.182  1.00 57.09  ? 173  PHE C CE2 1 
ATOM   2751 C CZ  . PHE C 1 127 ? -2.473  24.727  29.230  1.00 56.23  ? 173  PHE C CZ  1 
ATOM   2752 N N   . LEU C 1 128 ? 2.306   24.822  31.565  1.00 55.54  ? 174  LEU C N   1 
ATOM   2753 C CA  . LEU C 1 128 ? 1.925   25.495  32.809  1.00 57.14  ? 174  LEU C CA  1 
ATOM   2754 C C   . LEU C 1 128 ? 2.804   26.695  33.128  1.00 59.62  ? 174  LEU C C   1 
ATOM   2755 O O   . LEU C 1 128 ? 2.309   27.743  33.545  1.00 60.08  ? 174  LEU C O   1 
ATOM   2756 C CB  . LEU C 1 128 ? 1.987   24.518  33.979  1.00 57.49  ? 174  LEU C CB  1 
ATOM   2757 C CG  . LEU C 1 128 ? 0.864   23.493  34.030  1.00 57.22  ? 174  LEU C CG  1 
ATOM   2758 C CD1 . LEU C 1 128 ? 1.185   22.461  35.089  1.00 58.26  ? 174  LEU C CD1 1 
ATOM   2759 C CD2 . LEU C 1 128 ? -0.466  24.180  34.314  1.00 59.35  ? 174  LEU C CD2 1 
ATOM   2760 N N   . GLN C 1 129 ? 4.109   26.530  32.945  1.00 60.68  ? 175  GLN C N   1 
ATOM   2761 C CA  . GLN C 1 129 ? 5.047   27.623  33.137  1.00 63.44  ? 175  GLN C CA  1 
ATOM   2762 C C   . GLN C 1 129 ? 4.653   28.821  32.268  1.00 64.53  ? 175  GLN C C   1 
ATOM   2763 O O   . GLN C 1 129 ? 4.576   29.951  32.751  1.00 65.97  ? 175  GLN C O   1 
ATOM   2764 C CB  . GLN C 1 129 ? 6.472   27.167  32.806  1.00 65.05  ? 175  GLN C CB  1 
ATOM   2765 C CG  . GLN C 1 129 ? 7.555   27.972  33.486  1.00 69.78  ? 175  GLN C CG  1 
ATOM   2766 C CD  . GLN C 1 129 ? 7.620   27.732  34.988  1.00 72.15  ? 175  GLN C CD  1 
ATOM   2767 O OE1 . GLN C 1 129 ? 6.974   26.821  35.520  1.00 71.37  ? 175  GLN C OE1 1 
ATOM   2768 N NE2 . GLN C 1 129 ? 8.407   28.548  35.679  1.00 75.10  ? 175  GLN C NE2 1 
ATOM   2769 N N   . LYS C 1 130 ? 4.373   28.564  30.995  1.00 63.81  ? 176  LYS C N   1 
ATOM   2770 C CA  . LYS C 1 130 ? 4.003   29.631  30.068  1.00 65.40  ? 176  LYS C CA  1 
ATOM   2771 C C   . LYS C 1 130 ? 2.643   30.234  30.425  1.00 64.85  ? 176  LYS C C   1 
ATOM   2772 O O   . LYS C 1 130 ? 2.475   31.455  30.381  1.00 66.43  ? 176  LYS C O   1 
ATOM   2773 C CB  . LYS C 1 130 ? 4.012   29.122  28.627  1.00 65.34  ? 176  LYS C CB  1 
ATOM   2774 C CG  . LYS C 1 130 ? 5.385   28.667  28.137  1.00 68.57  ? 176  LYS C CG  1 
ATOM   2775 C CD  . LYS C 1 130 ? 6.292   29.839  27.799  1.00 73.82  ? 176  LYS C CD  1 
ATOM   2776 C CE  . LYS C 1 130 ? 7.722   29.380  27.526  1.00 76.87  ? 176  LYS C CE  1 
ATOM   2777 N NZ  . LYS C 1 130 ? 7.764   28.135  26.703  1.00 76.36  ? 176  LYS C NZ  1 
ATOM   2778 N N   . VAL C 1 131 ? 1.683   29.384  30.790  1.00 62.35  ? 177  VAL C N   1 
ATOM   2779 C CA  . VAL C 1 131 ? 0.372   29.855  31.247  1.00 62.99  ? 177  VAL C CA  1 
ATOM   2780 C C   . VAL C 1 131 ? 0.485   30.813  32.437  1.00 65.40  ? 177  VAL C C   1 
ATOM   2781 O O   . VAL C 1 131 ? -0.271  31.781  32.529  1.00 67.09  ? 177  VAL C O   1 
ATOM   2782 C CB  . VAL C 1 131 ? -0.560  28.677  31.620  1.00 61.26  ? 177  VAL C CB  1 
ATOM   2783 C CG1 . VAL C 1 131 ? -1.724  29.153  32.485  1.00 62.21  ? 177  VAL C CG1 1 
ATOM   2784 C CG2 . VAL C 1 131 ? -1.060  27.991  30.355  1.00 60.52  ? 177  VAL C CG2 1 
ATOM   2785 N N   . ALA C 1 132 ? 1.435   30.544  33.330  1.00 66.16  ? 178  ALA C N   1 
ATOM   2786 C CA  . ALA C 1 132 ? 1.695   31.400  34.485  1.00 69.02  ? 178  ALA C CA  1 
ATOM   2787 C C   . ALA C 1 132 ? 2.089   32.836  34.100  1.00 72.65  ? 178  ALA C C   1 
ATOM   2788 O O   . ALA C 1 132 ? 1.875   33.761  34.880  1.00 74.71  ? 178  ALA C O   1 
ATOM   2789 C CB  . ALA C 1 132 ? 2.769   30.782  35.364  1.00 68.98  ? 178  ALA C CB  1 
ATOM   2790 N N   . SER C 1 133 ? 2.668   33.018  32.913  1.00 73.64  ? 179  SER C N   1 
ATOM   2791 C CA  . SER C 1 133 ? 3.066   34.351  32.435  1.00 77.67  ? 179  SER C CA  1 
ATOM   2792 C C   . SER C 1 133 ? 2.105   34.933  31.394  1.00 78.71  ? 179  SER C C   1 
ATOM   2793 O O   . SER C 1 133 ? 2.439   35.895  30.704  1.00 81.21  ? 179  SER C O   1 
ATOM   2794 C CB  . SER C 1 133 ? 4.482   34.294  31.864  1.00 78.50  ? 179  SER C CB  1 
ATOM   2795 O OG  . SER C 1 133 ? 5.399   33.905  32.866  1.00 79.07  ? 179  SER C OG  1 
ATOM   2796 N N   . MET C 1 134 ? 0.907   34.364  31.300  1.00 77.90  ? 180  MET C N   1 
ATOM   2797 C CA  . MET C 1 134 ? -0.083  34.795  30.319  1.00 79.39  ? 180  MET C CA  1 
ATOM   2798 C C   . MET C 1 134 ? -0.700  36.132  30.747  1.00 83.38  ? 180  MET C C   1 
ATOM   2799 O O   . MET C 1 134 ? -0.873  36.374  31.939  1.00 84.49  ? 180  MET C O   1 
ATOM   2800 C CB  . MET C 1 134 ? -1.166  33.718  30.173  1.00 76.93  ? 180  MET C CB  1 
ATOM   2801 C CG  . MET C 1 134 ? -2.235  34.021  29.137  1.00 78.27  ? 180  MET C CG  1 
ATOM   2802 S SD  . MET C 1 134 ? -3.211  32.569  28.704  1.00 77.00  ? 180  MET C SD  1 
ATOM   2803 C CE  . MET C 1 134 ? -3.926  32.146  30.282  1.00 75.12  ? 180  MET C CE  1 
ATOM   2804 N N   . PRO C 1 135 ? -1.006  37.022  29.782  1.00 86.03  ? 181  PRO C N   1 
ATOM   2805 C CA  . PRO C 1 135 ? -1.721  38.257  30.142  1.00 89.91  ? 181  PRO C CA  1 
ATOM   2806 C C   . PRO C 1 135 ? -3.154  38.014  30.639  1.00 90.00  ? 181  PRO C C   1 
ATOM   2807 O O   . PRO C 1 135 ? -3.721  36.949  30.389  1.00 87.51  ? 181  PRO C O   1 
ATOM   2808 C CB  . PRO C 1 135 ? -1.744  39.049  28.826  1.00 91.48  ? 181  PRO C CB  1 
ATOM   2809 C CG  . PRO C 1 135 ? -0.618  38.508  28.027  1.00 90.09  ? 181  PRO C CG  1 
ATOM   2810 C CD  . PRO C 1 135 ? -0.515  37.058  28.393  1.00 86.20  ? 181  PRO C CD  1 
ATOM   2811 N N   A GLN C 1 136 ? -3.717  39.003  31.330  0.50 93.16  ? 182  GLN C N   1 
ATOM   2812 N N   B GLN C 1 136 ? -3.724  38.993  31.340  0.50 93.36  ? 182  GLN C N   1 
ATOM   2813 C CA  A GLN C 1 136 ? -5.081  38.916  31.849  0.50 93.56  ? 182  GLN C CA  1 
ATOM   2814 C CA  B GLN C 1 136 ? -5.106  38.906  31.824  0.50 93.92  ? 182  GLN C CA  1 
ATOM   2815 C C   A GLN C 1 136 ? -6.107  39.032  30.725  0.50 93.67  ? 182  GLN C C   1 
ATOM   2816 C C   B GLN C 1 136 ? -5.858  40.195  31.511  0.50 97.82  ? 182  GLN C C   1 
ATOM   2817 O O   A GLN C 1 136 ? -5.939  39.825  29.798  0.50 95.26  ? 182  GLN C O   1 
ATOM   2818 O O   B GLN C 1 136 ? -6.307  40.407  30.384  0.50 98.06  ? 182  GLN C O   1 
ATOM   2819 C CB  A GLN C 1 136 ? -5.325  40.010  32.889  0.50 97.39  ? 182  GLN C CB  1 
ATOM   2820 C CB  B GLN C 1 136 ? -5.136  38.641  33.332  0.50 94.20  ? 182  GLN C CB  1 
ATOM   2821 C CG  A GLN C 1 136 ? -4.382  39.952  34.079  0.50 97.59  ? 182  GLN C CG  1 
ATOM   2822 C CG  B GLN C 1 136 ? -6.500  38.214  33.866  0.50 94.14  ? 182  GLN C CG  1 
ATOM   2823 C CD  A GLN C 1 136 ? -4.750  40.946  35.162  0.50 100.99 ? 182  GLN C CD  1 
ATOM   2824 C CD  B GLN C 1 136 ? -7.641  38.619  32.954  0.50 95.42  ? 182  GLN C CD  1 
ATOM   2825 O OE1 A GLN C 1 136 ? -5.863  41.470  35.188  0.50 102.99 ? 182  GLN C OE1 1 
ATOM   2826 O OE1 B GLN C 1 136 ? -7.551  38.491  31.731  0.50 93.62  ? 182  GLN C OE1 1 
ATOM   2827 N NE2 A GLN C 1 136 ? -3.815  41.208  36.067  0.50 101.77 ? 182  GLN C NE2 1 
ATOM   2828 N NE2 B GLN C 1 136 ? -8.727  39.103  33.546  0.50 98.44  ? 182  GLN C NE2 1 
HETATM 2829 C C1  . EDO D 2 .   ? 19.576  15.848  -9.989  1.00 61.40  ? 1187 EDO A C1  1 
HETATM 2830 O O1  . EDO D 2 .   ? 20.696  16.203  -10.814 1.00 60.18  ? 1187 EDO A O1  1 
HETATM 2831 C C2  . EDO D 2 .   ? 18.920  14.559  -10.466 1.00 62.13  ? 1187 EDO A C2  1 
HETATM 2832 O O2  . EDO D 2 .   ? 18.538  14.680  -11.840 1.00 63.95  ? 1187 EDO A O2  1 
HETATM 2833 C C1  . TYL E 3 .   ? 20.294  9.503   -10.451 1.00 54.35  ? 1188 TYL A C1  1 
HETATM 2834 C C2  . TYL E 3 .   ? 19.569  10.365  -11.278 1.00 55.56  ? 1188 TYL A C2  1 
HETATM 2835 C C3  . TYL E 3 .   ? 20.118  10.857  -12.460 1.00 55.84  ? 1188 TYL A C3  1 
HETATM 2836 C C4  . TYL E 3 .   ? 21.405  10.486  -12.822 1.00 57.25  ? 1188 TYL A C4  1 
HETATM 2837 C C5  . TYL E 3 .   ? 22.136  9.634   -11.997 1.00 55.75  ? 1188 TYL A C5  1 
HETATM 2838 C C6  . TYL E 3 .   ? 21.584  9.148   -10.826 1.00 54.79  ? 1188 TYL A C6  1 
HETATM 2839 N N   . TYL E 3 .   ? 19.671  9.087   -9.248  1.00 54.01  ? 1188 TYL A N   1 
HETATM 2840 C C   . TYL E 3 .   ? 20.220  8.433   -8.187  1.00 53.50  ? 1188 TYL A C   1 
HETATM 2841 C CM  . TYL E 3 .   ? 19.289  8.221   -7.020  1.00 51.11  ? 1188 TYL A CM  1 
HETATM 2842 O O4  . TYL E 3 .   ? 21.950  10.957  -13.976 1.00 60.38  ? 1188 TYL A O4  1 
HETATM 2843 O O   . TYL E 3 .   ? 21.380  8.052   -8.159  1.00 50.73  ? 1188 TYL A O   1 
HETATM 2844 S S   . SO4 F 4 .   ? 8.164   18.286  -5.278  1.00 97.39  ? 1189 SO4 A S   1 
HETATM 2845 O O1  . SO4 F 4 .   ? 8.818   17.266  -6.092  1.00 97.05  ? 1189 SO4 A O1  1 
HETATM 2846 O O2  . SO4 F 4 .   ? 7.049   18.859  -6.030  1.00 97.70  ? 1189 SO4 A O2  1 
HETATM 2847 O O3  . SO4 F 4 .   ? 7.658   17.699  -4.040  1.00 97.28  ? 1189 SO4 A O3  1 
HETATM 2848 O O4  . SO4 F 4 .   ? 9.126   19.335  -4.948  1.00 97.64  ? 1189 SO4 A O4  1 
HETATM 2849 C C1  . EDO G 2 .   ? 42.331  -0.194  1.942   1.00 58.74  ? 1186 EDO B C1  1 
HETATM 2850 O O1  . EDO G 2 .   ? 42.149  -0.715  0.619   1.00 57.32  ? 1186 EDO B O1  1 
HETATM 2851 C C2  . EDO G 2 .   ? 43.059  1.142   1.891   1.00 59.69  ? 1186 EDO B C2  1 
HETATM 2852 O O2  . EDO G 2 .   ? 44.346  0.951   1.298   1.00 61.22  ? 1186 EDO B O2  1 
HETATM 2853 C C1  . TYL H 3 .   ? 42.246  5.949   1.008   1.00 58.83  ? 1187 TYL B C1  1 
HETATM 2854 C C2  . TYL H 3 .   ? 41.805  6.157   -0.307  1.00 60.00  ? 1187 TYL B C2  1 
HETATM 2855 C C3  . TYL H 3 .   ? 42.497  5.601   -1.383  1.00 61.94  ? 1187 TYL B C3  1 
HETATM 2856 C C4  . TYL H 3 .   ? 43.628  4.824   -1.156  1.00 62.90  ? 1187 TYL B C4  1 
HETATM 2857 C C5  . TYL H 3 .   ? 44.063  4.611   0.149   1.00 62.43  ? 1187 TYL B C5  1 
HETATM 2858 C C6  . TYL H 3 .   ? 43.375  5.163   1.214   1.00 61.34  ? 1187 TYL B C6  1 
HETATM 2859 N N   . TYL H 3 .   ? 41.577  6.446   2.153   1.00 57.30  ? 1187 TYL B N   1 
HETATM 2860 C C   . TYL H 3 .   ? 40.364  7.060   2.224   1.00 56.72  ? 1187 TYL B C   1 
HETATM 2861 C CM  . TYL H 3 .   ? 39.878  7.344   3.620   1.00 53.25  ? 1187 TYL B CM  1 
HETATM 2862 O O4  . TYL H 3 .   ? 44.312  4.283   -2.204  1.00 65.08  ? 1187 TYL B O4  1 
HETATM 2863 O O   . TYL H 3 .   ? 39.696  7.341   1.240   1.00 54.04  ? 1187 TYL B O   1 
HETATM 2864 C C1  . EDO I 2 .   ? -10.441 24.863  8.564   1.00 78.57  ? 1183 EDO C C1  1 
HETATM 2865 O O1  . EDO I 2 .   ? -10.118 23.642  9.244   1.00 78.86  ? 1183 EDO C O1  1 
HETATM 2866 C C2  . EDO I 2 .   ? -9.215  25.427  7.858   1.00 78.60  ? 1183 EDO C C2  1 
HETATM 2867 O O2  . EDO I 2 .   ? -9.162  24.902  6.528   1.00 79.32  ? 1183 EDO C O2  1 
HETATM 2868 C C1  . TYL J 3 .   ? 0.115   6.951   21.807  1.00 77.60  ? 1184 TYL C C1  1 
HETATM 2869 C C2  . TYL J 3 .   ? 0.914   6.590   20.720  1.00 78.25  ? 1184 TYL C C2  1 
HETATM 2870 C C3  . TYL J 3 .   ? 1.341   5.275   20.561  1.00 78.59  ? 1184 TYL C C3  1 
HETATM 2871 C C4  . TYL J 3 .   ? 0.973   4.314   21.496  1.00 78.97  ? 1184 TYL C C4  1 
HETATM 2872 C C5  . TYL J 3 .   ? 0.179   4.672   22.584  1.00 78.19  ? 1184 TYL C C5  1 
HETATM 2873 C C6  . TYL J 3 .   ? -0.242  5.979   22.736  1.00 77.89  ? 1184 TYL C C6  1 
HETATM 2874 N N   . TYL J 3 .   ? -0.268  8.313   21.906  1.00 77.21  ? 1184 TYL C N   1 
HETATM 2875 C C   . TYL J 3 .   ? -0.959  8.929   22.902  1.00 77.08  ? 1184 TYL C C   1 
HETATM 2876 C CM  . TYL J 3 .   ? -1.125  10.413  22.727  1.00 76.58  ? 1184 TYL C CM  1 
HETATM 2877 O O4  . TYL J 3 .   ? 1.392   3.028   21.345  1.00 80.00  ? 1184 TYL C O4  1 
HETATM 2878 O O   . TYL J 3 .   ? -1.404  8.338   23.874  1.00 75.46  ? 1184 TYL C O   1 
HETATM 2879 S S   . SO4 K 4 .   ? -11.797 25.000  13.142  1.00 72.20  ? 1185 SO4 C S   1 
HETATM 2880 O O1  . SO4 K 4 .   ? -11.602 24.972  11.691  1.00 75.06  ? 1185 SO4 C O1  1 
HETATM 2881 O O2  . SO4 K 4 .   ? -13.213 24.900  13.467  1.00 73.46  ? 1185 SO4 C O2  1 
HETATM 2882 O O3  . SO4 K 4 .   ? -11.071 23.882  13.727  1.00 73.33  ? 1185 SO4 C O3  1 
HETATM 2883 O O4  . SO4 K 4 .   ? -11.281 26.250  13.668  1.00 72.40  ? 1185 SO4 C O4  1 
HETATM 2884 S S   . SO4 L 4 .   ? -4.671  34.522  32.870  0.50 193.22 ? 1186 SO4 C S   1 
HETATM 2885 O O1  . SO4 L 4 .   ? -5.043  33.295  32.181  1.00 193.29 ? 1186 SO4 C O1  1 
HETATM 2886 O O2  . SO4 L 4 .   ? -3.328  34.921  32.481  1.00 193.13 ? 1186 SO4 C O2  1 
HETATM 2887 O O3  . SO4 L 4 .   ? -4.743  34.280  34.303  1.00 193.20 ? 1186 SO4 C O3  1 
HETATM 2888 O O4  . SO4 L 4 .   ? -5.596  35.587  32.514  1.00 193.21 ? 1186 SO4 C O4  1 
HETATM 2889 O O   . HOH M 5 .   ? 15.899  15.231  -15.459 1.00 72.20  ? 2001 HOH A O   1 
HETATM 2890 O O   . HOH M 5 .   ? 16.883  -0.935  16.347  1.00 58.07  ? 2002 HOH A O   1 
HETATM 2891 O O   . HOH M 5 .   ? 17.330  -0.146  18.860  1.00 55.46  ? 2003 HOH A O   1 
HETATM 2892 O O   . HOH M 5 .   ? 3.791   5.424   11.799  1.00 87.42  ? 2004 HOH A O   1 
HETATM 2893 O O   . HOH M 5 .   ? 3.116   7.899   17.718  1.00 55.13  ? 2005 HOH A O   1 
HETATM 2894 O O   . HOH M 5 .   ? 4.412   5.736   18.724  1.00 63.15  ? 2006 HOH A O   1 
HETATM 2895 O O   . HOH M 5 .   ? 4.883   10.078  6.946   1.00 62.71  ? 2007 HOH A O   1 
HETATM 2896 O O   . HOH M 5 .   ? 3.352   6.983   5.060   1.00 46.49  ? 2008 HOH A O   1 
HETATM 2897 O O   . HOH M 5 .   ? 0.687   4.108   7.729   1.00 59.38  ? 2009 HOH A O   1 
HETATM 2898 O O   . HOH M 5 .   ? 5.904   14.928  12.819  1.00 58.71  ? 2010 HOH A O   1 
HETATM 2899 O O   . HOH M 5 .   ? 9.091   15.881  10.659  1.00 53.37  ? 2011 HOH A O   1 
HETATM 2900 O O   . HOH M 5 .   ? 5.508   13.817  4.143   1.00 56.23  ? 2012 HOH A O   1 
HETATM 2901 O O   . HOH M 5 .   ? 11.098  18.647  5.053   1.00 46.82  ? 2013 HOH A O   1 
HETATM 2902 O O   . HOH M 5 .   ? 2.722   11.484  -1.873  1.00 61.35  ? 2014 HOH A O   1 
HETATM 2903 O O   . HOH M 5 .   ? 5.130   15.350  -1.150  1.00 65.04  ? 2015 HOH A O   1 
HETATM 2904 O O   . HOH M 5 .   ? 8.931   20.205  -2.019  1.00 58.98  ? 2016 HOH A O   1 
HETATM 2905 O O   . HOH M 5 .   ? 7.574   20.808  1.543   1.00 58.72  ? 2017 HOH A O   1 
HETATM 2906 O O   . HOH M 5 .   ? 9.785   19.225  7.581   1.00 71.20  ? 2018 HOH A O   1 
HETATM 2907 O O   . HOH M 5 .   ? 11.120  17.042  -4.092  1.00 41.06  ? 2019 HOH A O   1 
HETATM 2908 O O   . HOH M 5 .   ? 12.105  21.610  1.309   1.00 40.59  ? 2020 HOH A O   1 
HETATM 2909 O O   . HOH M 5 .   ? 11.427  20.279  -5.689  1.00 48.60  ? 2021 HOH A O   1 
HETATM 2910 O O   . HOH M 5 .   ? 13.926  23.386  -5.579  1.00 53.03  ? 2022 HOH A O   1 
HETATM 2911 O O   . HOH M 5 .   ? 10.788  24.759  -2.149  1.00 61.88  ? 2023 HOH A O   1 
HETATM 2912 O O   . HOH M 5 .   ? 9.712   12.040  -7.945  1.00 66.38  ? 2024 HOH A O   1 
HETATM 2913 O O   . HOH M 5 .   ? 14.297  7.491   -9.469  1.00 53.93  ? 2025 HOH A O   1 
HETATM 2914 O O   . HOH M 5 .   ? 16.741  9.377   -9.397  1.00 41.52  ? 2026 HOH A O   1 
HETATM 2915 O O   . HOH M 5 .   ? 15.852  6.845   -6.456  1.00 36.70  ? 2027 HOH A O   1 
HETATM 2916 O O   . HOH M 5 .   ? 11.236  4.017   -10.801 1.00 48.49  ? 2028 HOH A O   1 
HETATM 2917 O O   . HOH M 5 .   ? 13.958  6.923   -11.869 1.00 49.73  ? 2029 HOH A O   1 
HETATM 2918 O O   . HOH M 5 .   ? 16.715  0.916   -9.134  1.00 41.36  ? 2030 HOH A O   1 
HETATM 2919 O O   . HOH M 5 .   ? 16.792  2.652   -6.673  1.00 40.11  ? 2031 HOH A O   1 
HETATM 2920 O O   . HOH M 5 .   ? 16.305  0.401   -13.403 1.00 44.55  ? 2032 HOH A O   1 
HETATM 2921 O O   . HOH M 5 .   ? 5.305   10.930  4.518   1.00 63.26  ? 2033 HOH A O   1 
HETATM 2922 O O   . HOH M 5 .   ? 10.999  2.352   -17.487 1.00 46.47  ? 2034 HOH A O   1 
HETATM 2923 O O   . HOH M 5 .   ? 10.121  5.315   -14.445 1.00 51.33  ? 2035 HOH A O   1 
HETATM 2924 O O   . HOH M 5 .   ? 3.445   16.718  11.823  1.00 66.38  ? 2036 HOH A O   1 
HETATM 2925 O O   . HOH M 5 .   ? 8.143   17.529  8.928   1.00 65.26  ? 2037 HOH A O   1 
HETATM 2926 O O   . HOH M 5 .   ? 19.873  1.603   -19.586 1.00 60.43  ? 2038 HOH A O   1 
HETATM 2927 O O   . HOH M 5 .   ? 10.748  20.699  3.522   1.00 54.74  ? 2039 HOH A O   1 
HETATM 2928 O O   . HOH M 5 .   ? 13.277  19.141  6.808   1.00 57.49  ? 2040 HOH A O   1 
HETATM 2929 O O   . HOH M 5 .   ? 14.020  10.075  -19.980 1.00 44.07  ? 2041 HOH A O   1 
HETATM 2930 O O   . HOH M 5 .   ? 16.322  11.603  -18.186 1.00 80.00  ? 2042 HOH A O   1 
HETATM 2931 O O   . HOH M 5 .   ? 20.244  10.954  -16.321 1.00 53.41  ? 2043 HOH A O   1 
HETATM 2932 O O   . HOH M 5 .   ? 15.674  11.064  -11.146 1.00 56.68  ? 2044 HOH A O   1 
HETATM 2933 O O   . HOH M 5 .   ? 21.830  -0.826  -15.370 1.00 48.25  ? 2045 HOH A O   1 
HETATM 2934 O O   . HOH M 5 .   ? 11.700  0.871   -11.052 1.00 70.07  ? 2046 HOH A O   1 
HETATM 2935 O O   . HOH M 5 .   ? 11.031  6.224   -12.330 1.00 52.40  ? 2047 HOH A O   1 
HETATM 2936 O O   . HOH M 5 .   ? 29.414  5.089   -14.150 1.00 61.75  ? 2048 HOH A O   1 
HETATM 2937 O O   . HOH M 5 .   ? 15.300  -1.198  -8.805  1.00 52.57  ? 2049 HOH A O   1 
HETATM 2938 O O   . HOH M 5 .   ? 16.880  -1.159  -15.634 1.00 66.83  ? 2050 HOH A O   1 
HETATM 2939 O O   . HOH M 5 .   ? 19.366  3.098   -5.461  1.00 38.06  ? 2051 HOH A O   1 
HETATM 2940 O O   . HOH M 5 .   ? 21.803  5.938   -6.586  1.00 36.43  ? 2052 HOH A O   1 
HETATM 2941 O O   . HOH M 5 .   ? 13.196  11.552  -18.016 1.00 57.00  ? 2053 HOH A O   1 
HETATM 2942 O O   . HOH M 5 .   ? 21.894  -6.005  -10.294 1.00 59.62  ? 2054 HOH A O   1 
HETATM 2943 O O   . HOH M 5 .   ? 20.813  -3.620  -8.931  1.00 52.62  ? 2055 HOH A O   1 
HETATM 2944 O O   . HOH M 5 .   ? 18.662  -4.986  -8.607  1.00 68.03  ? 2056 HOH A O   1 
HETATM 2945 O O   . HOH M 5 .   ? 26.346  -2.313  -4.520  1.00 52.94  ? 2057 HOH A O   1 
HETATM 2946 O O   . HOH M 5 .   ? 30.067  -1.811  -7.202  1.00 57.01  ? 2058 HOH A O   1 
HETATM 2947 O O   . HOH M 5 .   ? 21.276  -3.338  4.983   1.00 63.10  ? 2059 HOH A O   1 
HETATM 2948 O O   . HOH M 5 .   ? 23.997  -1.242  -3.312  1.00 41.48  ? 2060 HOH A O   1 
HETATM 2949 O O   . HOH M 5 .   ? 19.308  -6.292  -5.791  1.00 49.54  ? 2061 HOH A O   1 
HETATM 2950 O O   . HOH M 5 .   ? 25.301  -6.937  -13.200 1.00 63.07  ? 2062 HOH A O   1 
HETATM 2951 O O   . HOH M 5 .   ? 14.256  -1.214  -6.017  1.00 46.81  ? 2063 HOH A O   1 
HETATM 2952 O O   . HOH M 5 .   ? 19.666  -1.767  3.115   1.00 46.94  ? 2064 HOH A O   1 
HETATM 2953 O O   . HOH M 5 .   ? 16.881  -3.543  -2.913  1.00 61.77  ? 2065 HOH A O   1 
HETATM 2954 O O   . HOH M 5 .   ? 11.579  -7.746  -2.734  1.00 65.33  ? 2066 HOH A O   1 
HETATM 2955 O O   . HOH M 5 .   ? 15.139  1.201   -5.131  1.00 38.83  ? 2067 HOH A O   1 
HETATM 2956 O O   . HOH M 5 .   ? 17.539  6.139   -4.523  1.00 45.76  ? 2068 HOH A O   1 
HETATM 2957 O O   . HOH M 5 .   ? 5.478   5.203   -2.137  1.00 61.33  ? 2069 HOH A O   1 
HETATM 2958 O O   . HOH M 5 .   ? 3.611   6.879   -1.193  1.00 71.82  ? 2070 HOH A O   1 
HETATM 2959 O O   . HOH M 5 .   ? 8.267   2.196   -4.985  1.00 63.57  ? 2071 HOH A O   1 
HETATM 2960 O O   . HOH M 5 .   ? 8.002   -1.238  9.945   1.00 49.72  ? 2072 HOH A O   1 
HETATM 2961 O O   . HOH M 5 .   ? 9.833   -3.982  -0.556  1.00 55.86  ? 2073 HOH A O   1 
HETATM 2962 O O   . HOH M 5 .   ? 14.825  -6.108  3.406   1.00 47.27  ? 2074 HOH A O   1 
HETATM 2963 O O   . HOH M 5 .   ? 11.237  -6.940  0.295   1.00 68.64  ? 2075 HOH A O   1 
HETATM 2964 O O   . HOH M 5 .   ? 15.513  -4.437  -0.865  1.00 56.06  ? 2076 HOH A O   1 
HETATM 2965 O O   . HOH M 5 .   ? 28.497  22.048  -7.529  1.00 60.34  ? 2077 HOH A O   1 
HETATM 2966 O O   . HOH M 5 .   ? 24.496  20.597  -14.021 1.00 86.00  ? 2078 HOH A O   1 
HETATM 2967 O O   . HOH M 5 .   ? 6.068   0.493   11.411  1.00 64.32  ? 2079 HOH A O   1 
HETATM 2968 O O   . HOH M 5 .   ? 21.971  21.285  4.424   1.00 54.96  ? 2080 HOH A O   1 
HETATM 2969 O O   . HOH M 5 .   ? -0.859  4.074   5.442   1.00 60.84  ? 2081 HOH A O   1 
HETATM 2970 O O   . HOH M 5 .   ? 2.049   -2.099  -0.355  1.00 62.96  ? 2082 HOH A O   1 
HETATM 2971 O O   . HOH M 5 .   ? 6.514   -4.132  2.072   1.00 62.02  ? 2083 HOH A O   1 
HETATM 2972 O O   . HOH M 5 .   ? 5.683   -7.341  11.730  1.00 61.66  ? 2084 HOH A O   1 
HETATM 2973 O O   . HOH M 5 .   ? 1.842   -5.985  10.786  1.00 72.58  ? 2085 HOH A O   1 
HETATM 2974 O O   . HOH M 5 .   ? 0.167   -1.258  12.862  1.00 65.61  ? 2086 HOH A O   1 
HETATM 2975 O O   . HOH M 5 .   ? 8.435   20.606  12.721  1.00 69.48  ? 2087 HOH A O   1 
HETATM 2976 O O   . HOH M 5 .   ? 19.707  -3.797  11.433  1.00 64.74  ? 2088 HOH A O   1 
HETATM 2977 O O   . HOH M 5 .   ? 17.390  -3.514  6.161   1.00 57.75  ? 2089 HOH A O   1 
HETATM 2978 O O   . HOH M 5 .   ? 16.416  -10.760 9.785   1.00 67.36  ? 2090 HOH A O   1 
HETATM 2979 O O   . HOH M 5 .   ? 23.237  0.259   5.189   1.00 44.17  ? 2091 HOH A O   1 
HETATM 2980 O O   . HOH M 5 .   ? 25.397  7.034   3.959   1.00 64.05  ? 2092 HOH A O   1 
HETATM 2981 O O   . HOH M 5 .   ? 24.274  7.847   7.736   1.00 64.66  ? 2093 HOH A O   1 
HETATM 2982 O O   . HOH M 5 .   ? 27.178  1.393   4.351   1.00 52.99  ? 2094 HOH A O   1 
HETATM 2983 O O   . HOH M 5 .   ? 24.205  -1.160  1.858   1.00 53.19  ? 2095 HOH A O   1 
HETATM 2984 O O   . HOH M 5 .   ? 20.224  6.043   -4.362  1.00 39.70  ? 2096 HOH A O   1 
HETATM 2985 O O   . HOH M 5 .   ? 25.541  0.973   -0.808  1.00 58.82  ? 2097 HOH A O   1 
HETATM 2986 O O   . HOH M 5 .   ? 31.860  7.726   -6.473  1.00 50.84  ? 2098 HOH A O   1 
HETATM 2987 O O   . HOH M 5 .   ? 30.204  10.726  -5.953  1.00 48.30  ? 2099 HOH A O   1 
HETATM 2988 O O   . HOH M 5 .   ? 26.282  13.452  3.236   1.00 66.10  ? 2100 HOH A O   1 
HETATM 2989 O O   . HOH M 5 .   ? 31.742  5.921   -9.971  1.00 61.74  ? 2101 HOH A O   1 
HETATM 2990 O O   . HOH M 5 .   ? 29.812  4.958   -11.484 1.00 69.72  ? 2102 HOH A O   1 
HETATM 2991 O O   . HOH M 5 .   ? 28.380  7.910   -12.969 1.00 65.68  ? 2103 HOH A O   1 
HETATM 2992 O O   . HOH M 5 .   ? 26.004  10.502  -12.483 1.00 48.02  ? 2104 HOH A O   1 
HETATM 2993 O O   . HOH M 5 .   ? 27.213  13.496  -14.769 1.00 60.23  ? 2105 HOH A O   1 
HETATM 2994 O O   . HOH M 5 .   ? 28.292  17.538  -5.937  1.00 48.32  ? 2106 HOH A O   1 
HETATM 2995 O O   . HOH M 5 .   ? 31.274  16.157  -3.937  1.00 54.00  ? 2107 HOH A O   1 
HETATM 2996 O O   . HOH M 5 .   ? 26.911  19.953  -8.186  1.00 47.46  ? 2108 HOH A O   1 
HETATM 2997 O O   . HOH M 5 .   ? 29.129  16.680  -12.604 1.00 47.90  ? 2109 HOH A O   1 
HETATM 2998 O O   . HOH M 5 .   ? 24.779  17.649  -11.942 1.00 39.31  ? 2110 HOH A O   1 
HETATM 2999 O O   . HOH M 5 .   ? 23.055  14.822  -10.736 1.00 39.36  ? 2111 HOH A O   1 
HETATM 3000 O O   . HOH M 5 .   ? 25.630  21.687  -11.494 1.00 48.20  ? 2112 HOH A O   1 
HETATM 3001 O O   . HOH M 5 .   ? 22.112  20.093  -12.899 1.00 53.75  ? 2113 HOH A O   1 
HETATM 3002 O O   . HOH M 5 .   ? 29.223  17.547  -2.744  1.00 65.93  ? 2114 HOH A O   1 
HETATM 3003 O O   . HOH M 5 .   ? 31.489  14.362  2.035   1.00 52.51  ? 2115 HOH A O   1 
HETATM 3004 O O   . HOH M 5 .   ? 23.840  19.748  2.438   1.00 72.17  ? 2116 HOH A O   1 
HETATM 3005 O O   . HOH M 5 .   ? 20.045  19.737  5.475   1.00 60.44  ? 2117 HOH A O   1 
HETATM 3006 O O   . HOH M 5 .   ? 26.247  19.551  1.294   1.00 78.98  ? 2118 HOH A O   1 
HETATM 3007 O O   . HOH M 5 .   ? 10.707  18.873  10.034  1.00 70.85  ? 2119 HOH A O   1 
HETATM 3008 O O   . HOH M 5 .   ? 10.183  17.705  12.508  1.00 74.75  ? 2120 HOH A O   1 
HETATM 3009 O O   . HOH M 5 .   ? 19.761  7.828   17.958  1.00 46.20  ? 2121 HOH A O   1 
HETATM 3010 O O   . HOH M 5 .   ? 12.473  12.421  21.093  1.00 51.60  ? 2122 HOH A O   1 
HETATM 3011 O O   . HOH M 5 .   ? 17.764  0.236   21.456  1.00 59.05  ? 2123 HOH A O   1 
HETATM 3012 O O   . HOH M 5 .   ? 15.169  -4.093  18.292  1.00 60.82  ? 2124 HOH A O   1 
HETATM 3013 O O   . HOH M 5 .   ? 16.739  12.814  -12.938 1.00 58.42  ? 2125 HOH A O   1 
HETATM 3014 O O   . HOH M 5 .   ? 20.346  14.194  -14.238 1.00 73.86  ? 2126 HOH A O   1 
HETATM 3015 O O   . HOH M 5 .   ? 24.572  10.541  -14.527 1.00 52.34  ? 2127 HOH A O   1 
HETATM 3016 O O   . HOH M 5 .   ? 9.880   17.339  -9.688  1.00 68.85  ? 2128 HOH A O   1 
HETATM 3017 O O   . HOH N 5 .   ? 32.112  27.269  23.463  1.00 57.38  ? 2001 HOH B O   1 
HETATM 3018 O O   . HOH N 5 .   ? 32.270  16.789  24.862  1.00 73.28  ? 2002 HOH B O   1 
HETATM 3019 O O   . HOH N 5 .   ? 23.717  16.411  22.432  1.00 57.61  ? 2003 HOH B O   1 
HETATM 3020 O O   . HOH N 5 .   ? 26.282  8.311   28.069  1.00 55.28  ? 2004 HOH B O   1 
HETATM 3021 O O   . HOH N 5 .   ? 33.249  12.681  25.678  1.00 58.39  ? 2005 HOH B O   1 
HETATM 3022 O O   . HOH N 5 .   ? 37.962  6.177   27.076  1.00 59.51  ? 2006 HOH B O   1 
HETATM 3023 O O   . HOH N 5 .   ? 30.829  -0.558  22.294  1.00 65.56  ? 2007 HOH B O   1 
HETATM 3024 O O   . HOH N 5 .   ? 34.626  -3.332  17.130  1.00 58.28  ? 2008 HOH B O   1 
HETATM 3025 O O   . HOH N 5 .   ? 40.205  -5.629  18.248  1.00 75.66  ? 2009 HOH B O   1 
HETATM 3026 O O   . HOH N 5 .   ? 36.912  -6.331  13.814  1.00 45.07  ? 2010 HOH B O   1 
HETATM 3027 O O   . HOH N 5 .   ? 41.619  -5.548  6.670   1.00 54.66  ? 2011 HOH B O   1 
HETATM 3028 O O   . HOH N 5 .   ? 42.962  -5.241  10.075  1.00 55.26  ? 2012 HOH B O   1 
HETATM 3029 O O   . HOH N 5 .   ? 41.521  -7.615  7.807   1.00 46.78  ? 2013 HOH B O   1 
HETATM 3030 O O   . HOH N 5 .   ? 40.479  -9.270  13.136  1.00 61.81  ? 2014 HOH B O   1 
HETATM 3031 O O   . HOH N 5 .   ? 46.225  3.339   10.282  1.00 45.20  ? 2015 HOH B O   1 
HETATM 3032 O O   . HOH N 5 .   ? 41.193  8.529   6.840   1.00 36.75  ? 2016 HOH B O   1 
HETATM 3033 O O   . HOH N 5 .   ? 43.338  6.122   4.463   1.00 45.52  ? 2017 HOH B O   1 
HETATM 3034 O O   . HOH N 5 .   ? 44.923  7.841   6.425   1.00 49.12  ? 2018 HOH B O   1 
HETATM 3035 O O   . HOH N 5 .   ? 44.793  9.213   14.838  1.00 54.80  ? 2019 HOH B O   1 
HETATM 3036 O O   . HOH N 5 .   ? 31.347  14.443  25.787  1.00 69.95  ? 2020 HOH B O   1 
HETATM 3037 O O   . HOH N 5 .   ? 48.396  5.159   9.671   1.00 66.98  ? 2021 HOH B O   1 
HETATM 3038 O O   . HOH N 5 .   ? 28.140  6.393   27.795  1.00 53.22  ? 2022 HOH B O   1 
HETATM 3039 O O   . HOH N 5 .   ? 47.273  8.615   5.490   1.00 52.85  ? 2023 HOH B O   1 
HETATM 3040 O O   . HOH N 5 .   ? 47.535  11.269  8.590   1.00 48.20  ? 2024 HOH B O   1 
HETATM 3041 O O   . HOH N 5 .   ? 41.230  12.972  5.816   1.00 39.99  ? 2025 HOH B O   1 
HETATM 3042 O O   . HOH N 5 .   ? 43.155  14.579  4.591   1.00 46.05  ? 2026 HOH B O   1 
HETATM 3043 O O   . HOH N 5 .   ? 46.699  15.072  2.527   1.00 44.40  ? 2027 HOH B O   1 
HETATM 3044 O O   . HOH N 5 .   ? 48.996  15.686  2.029   1.00 60.36  ? 2028 HOH B O   1 
HETATM 3045 O O   . HOH N 5 .   ? 51.363  15.098  3.179   1.00 75.39  ? 2029 HOH B O   1 
HETATM 3046 O O   . HOH N 5 .   ? 53.756  12.341  4.114   1.00 61.45  ? 2030 HOH B O   1 
HETATM 3047 O O   . HOH N 5 .   ? 35.885  -5.379  16.575  1.00 55.01  ? 2031 HOH B O   1 
HETATM 3048 O O   . HOH N 5 .   ? 54.359  6.443   1.097   1.00 65.30  ? 2032 HOH B O   1 
HETATM 3049 O O   . HOH N 5 .   ? 38.526  -8.276  14.525  1.00 62.19  ? 2033 HOH B O   1 
HETATM 3050 O O   . HOH N 5 .   ? 43.697  -7.896  11.241  1.00 75.02  ? 2034 HOH B O   1 
HETATM 3051 O O   . HOH N 5 .   ? 47.372  4.455   -1.953  1.00 68.62  ? 2035 HOH B O   1 
HETATM 3052 O O   . HOH N 5 .   ? 45.036  4.059   4.420   1.00 50.99  ? 2036 HOH B O   1 
HETATM 3053 O O   . HOH N 5 .   ? 45.433  16.263  -3.166  1.00 54.49  ? 2037 HOH B O   1 
HETATM 3054 O O   . HOH N 5 .   ? 44.919  9.893   -7.282  1.00 76.38  ? 2038 HOH B O   1 
HETATM 3055 O O   . HOH N 5 .   ? 40.337  10.397  -8.662  1.00 60.68  ? 2039 HOH B O   1 
HETATM 3056 O O   . HOH N 5 .   ? 43.631  16.764  6.091   1.00 50.55  ? 2040 HOH B O   1 
HETATM 3057 O O   . HOH N 5 .   ? 38.183  9.430   1.670   1.00 38.91  ? 2041 HOH B O   1 
HETATM 3058 O O   . HOH N 5 .   ? 38.574  12.298  4.385   1.00 39.49  ? 2042 HOH B O   1 
HETATM 3059 O O   . HOH N 5 .   ? 41.410  21.336  -0.555  1.00 63.16  ? 2043 HOH B O   1 
HETATM 3060 O O   . HOH N 5 .   ? 40.628  19.141  1.121   1.00 44.35  ? 2044 HOH B O   1 
HETATM 3061 O O   . HOH N 5 .   ? 47.585  17.537  -2.093  1.00 55.48  ? 2045 HOH B O   1 
HETATM 3062 O O   . HOH N 5 .   ? 33.942  17.484  -5.164  1.00 49.98  ? 2046 HOH B O   1 
HETATM 3063 O O   . HOH N 5 .   ? 33.745  17.441  -0.948  1.00 51.76  ? 2047 HOH B O   1 
HETATM 3064 O O   . HOH N 5 .   ? 34.057  16.675  1.595   1.00 46.09  ? 2048 HOH B O   1 
HETATM 3065 O O   . HOH N 5 .   ? 39.060  21.901  3.765   1.00 47.49  ? 2049 HOH B O   1 
HETATM 3066 O O   . HOH N 5 .   ? 41.182  22.465  -5.522  1.00 60.30  ? 2050 HOH B O   1 
HETATM 3067 O O   . HOH N 5 .   ? 40.174  23.705  -2.213  1.00 55.00  ? 2051 HOH B O   1 
HETATM 3068 O O   . HOH N 5 .   ? 41.879  16.700  8.174   1.00 45.29  ? 2052 HOH B O   1 
HETATM 3069 O O   . HOH N 5 .   ? 31.211  17.364  8.863   1.00 47.80  ? 2053 HOH B O   1 
HETATM 3070 O O   . HOH N 5 .   ? 33.469  19.576  10.415  1.00 56.77  ? 2054 HOH B O   1 
HETATM 3071 O O   . HOH N 5 .   ? 31.984  20.380  2.914   1.00 57.24  ? 2055 HOH B O   1 
HETATM 3072 O O   . HOH N 5 .   ? 39.055  21.471  16.090  1.00 67.29  ? 2056 HOH B O   1 
HETATM 3073 O O   . HOH N 5 .   ? 39.765  18.842  9.860   1.00 63.78  ? 2057 HOH B O   1 
HETATM 3074 O O   . HOH N 5 .   ? 40.737  14.253  8.048   1.00 40.47  ? 2058 HOH B O   1 
HETATM 3075 O O   . HOH N 5 .   ? 38.824  9.529   6.256   1.00 44.50  ? 2059 HOH B O   1 
HETATM 3076 O O   . HOH N 5 .   ? 42.948  11.440  17.779  1.00 58.07  ? 2060 HOH B O   1 
HETATM 3077 O O   . HOH N 5 .   ? 43.896  13.608  14.132  1.00 63.66  ? 2061 HOH B O   1 
HETATM 3078 O O   . HOH N 5 .   ? 44.744  7.379   19.587  1.00 72.08  ? 2062 HOH B O   1 
HETATM 3079 O O   . HOH N 5 .   ? 40.834  6.378   -7.203  1.00 59.54  ? 2063 HOH B O   1 
HETATM 3080 O O   . HOH N 5 .   ? 39.954  19.599  14.441  1.00 52.83  ? 2064 HOH B O   1 
HETATM 3081 O O   . HOH N 5 .   ? 36.781  19.940  9.887   1.00 65.53  ? 2065 HOH B O   1 
HETATM 3082 O O   . HOH N 5 .   ? 37.907  22.527  14.094  1.00 75.07  ? 2066 HOH B O   1 
HETATM 3083 O O   . HOH N 5 .   ? 32.767  0.612   -11.163 1.00 60.40  ? 2067 HOH B O   1 
HETATM 3084 O O   . HOH N 5 .   ? 28.661  -4.120  2.398   1.00 67.60  ? 2068 HOH B O   1 
HETATM 3085 O O   . HOH N 5 .   ? 39.042  20.364  18.856  1.00 69.62  ? 2069 HOH B O   1 
HETATM 3086 O O   . HOH N 5 .   ? 32.235  17.608  22.357  1.00 49.76  ? 2070 HOH B O   1 
HETATM 3087 O O   . HOH N 5 .   ? 22.169  16.131  18.689  1.00 54.40  ? 2071 HOH B O   1 
HETATM 3088 O O   . HOH N 5 .   ? 23.977  18.999  13.737  1.00 54.06  ? 2072 HOH B O   1 
HETATM 3089 O O   . HOH N 5 .   ? 30.037  19.179  12.588  1.00 62.70  ? 2073 HOH B O   1 
HETATM 3090 O O   . HOH N 5 .   ? 26.642  26.049  15.313  1.00 73.52  ? 2074 HOH B O   1 
HETATM 3091 O O   . HOH N 5 .   ? 27.359  15.181  7.115   1.00 50.20  ? 2075 HOH B O   1 
HETATM 3092 O O   . HOH N 5 .   ? 27.026  7.722   7.394   1.00 68.52  ? 2076 HOH B O   1 
HETATM 3093 O O   . HOH N 5 .   ? 29.692  16.340  4.436   1.00 54.98  ? 2077 HOH B O   1 
HETATM 3094 O O   . HOH N 5 .   ? 37.143  9.220   4.255   1.00 45.88  ? 2078 HOH B O   1 
HETATM 3095 O O   . HOH N 5 .   ? 27.682  8.116   3.382   1.00 49.31  ? 2079 HOH B O   1 
HETATM 3096 O O   . HOH N 5 .   ? 32.804  4.744   -4.904  1.00 45.07  ? 2080 HOH B O   1 
HETATM 3097 O O   . HOH N 5 .   ? 34.389  7.598   -7.865  1.00 73.87  ? 2081 HOH B O   1 
HETATM 3098 O O   . HOH N 5 .   ? 36.668  10.651  -8.014  1.00 80.47  ? 2082 HOH B O   1 
HETATM 3099 O O   . HOH N 5 .   ? 38.840  7.342   -8.188  1.00 76.54  ? 2083 HOH B O   1 
HETATM 3100 O O   . HOH N 5 .   ? 40.760  4.826   -4.955  1.00 49.98  ? 2084 HOH B O   1 
HETATM 3101 O O   . HOH N 5 .   ? 30.451  -0.652  -4.558  1.00 63.63  ? 2085 HOH B O   1 
HETATM 3102 O O   . HOH N 5 .   ? 33.827  -2.099  -3.178  1.00 48.06  ? 2086 HOH B O   1 
HETATM 3103 O O   . HOH N 5 .   ? 35.128  0.570   -10.243 1.00 57.42  ? 2087 HOH B O   1 
HETATM 3104 O O   . HOH N 5 .   ? 38.831  -1.174  -7.608  1.00 51.08  ? 2088 HOH B O   1 
HETATM 3105 O O   . HOH N 5 .   ? 36.384  -4.506  -3.230  1.00 51.30  ? 2089 HOH B O   1 
HETATM 3106 O O   . HOH N 5 .   ? 40.856  -2.276  -3.634  1.00 43.59  ? 2090 HOH B O   1 
HETATM 3107 O O   . HOH N 5 .   ? 40.784  0.429   -1.542  1.00 40.69  ? 2091 HOH B O   1 
HETATM 3108 O O   . HOH N 5 .   ? 39.891  -6.378  -4.182  1.00 39.90  ? 2092 HOH B O   1 
HETATM 3109 O O   . HOH N 5 .   ? 42.981  -4.811  -2.240  1.00 55.54  ? 2093 HOH B O   1 
HETATM 3110 O O   . HOH N 5 .   ? 31.132  -2.105  -2.163  1.00 58.15  ? 2094 HOH B O   1 
HETATM 3111 O O   . HOH N 5 .   ? 25.997  0.834   2.150   1.00 55.79  ? 2095 HOH B O   1 
HETATM 3112 O O   . HOH N 5 .   ? 28.835  -4.102  9.611   1.00 65.78  ? 2096 HOH B O   1 
HETATM 3113 O O   . HOH N 5 .   ? 29.157  -4.414  4.973   1.00 62.74  ? 2097 HOH B O   1 
HETATM 3114 O O   . HOH N 5 .   ? 23.221  -0.630  19.805  1.00 75.10  ? 2098 HOH B O   1 
HETATM 3115 O O   . HOH N 5 .   ? 26.513  -3.009  16.094  1.00 60.66  ? 2099 HOH B O   1 
HETATM 3116 O O   . HOH N 5 .   ? 30.932  -3.388  17.686  1.00 70.28  ? 2100 HOH B O   1 
HETATM 3117 O O   . HOH N 5 .   ? 46.128  2.751   2.422   1.00 50.58  ? 2101 HOH B O   1 
HETATM 3118 O O   . HOH N 5 .   ? 43.353  4.687   -4.557  1.00 53.20  ? 2102 HOH B O   1 
HETATM 3119 O O   . HOH N 5 .   ? 42.110  2.092   -2.621  1.00 75.39  ? 2103 HOH B O   1 
HETATM 3120 O O   . HOH O 5 .   ? -7.692  36.628  24.247  1.00 55.47  ? 2001 HOH C O   1 
HETATM 3121 O O   . HOH O 5 .   ? -3.655  33.794  16.987  1.00 56.91  ? 2002 HOH C O   1 
HETATM 3122 O O   . HOH O 5 .   ? -0.018  28.301  13.865  1.00 47.09  ? 2003 HOH C O   1 
HETATM 3123 O O   . HOH O 5 .   ? 7.875   30.570  22.111  1.00 51.57  ? 2004 HOH C O   1 
HETATM 3124 O O   . HOH O 5 .   ? 6.402   26.453  16.500  1.00 65.92  ? 2005 HOH C O   1 
HETATM 3125 O O   . HOH O 5 .   ? 10.110  25.617  25.384  1.00 56.71  ? 2006 HOH C O   1 
HETATM 3126 O O   . HOH O 5 .   ? 5.102   22.386  11.272  1.00 57.60  ? 2007 HOH C O   1 
HETATM 3127 O O   . HOH O 5 .   ? 8.960   16.616  18.098  1.00 53.72  ? 2008 HOH C O   1 
HETATM 3128 O O   . HOH O 5 .   ? 12.423  20.841  27.728  1.00 56.35  ? 2009 HOH C O   1 
HETATM 3129 O O   . HOH O 5 .   ? 13.227  20.632  22.256  1.00 43.83  ? 2010 HOH C O   1 
HETATM 3130 O O   . HOH O 5 .   ? 4.374   13.988  14.562  1.00 44.35  ? 2011 HOH C O   1 
HETATM 3131 O O   . HOH O 5 .   ? -0.259  10.076  16.756  1.00 50.89  ? 2012 HOH C O   1 
HETATM 3132 O O   . HOH O 5 .   ? -1.677  12.342  19.642  1.00 38.70  ? 2013 HOH C O   1 
HETATM 3133 O O   . HOH O 5 .   ? -1.962  17.116  12.786  1.00 58.59  ? 2014 HOH C O   1 
HETATM 3134 O O   . HOH O 5 .   ? -3.753  10.920  12.719  1.00 58.67  ? 2015 HOH C O   1 
HETATM 3135 O O   . HOH O 5 .   ? -7.784  10.074  18.308  1.00 49.34  ? 2016 HOH C O   1 
HETATM 3136 O O   . HOH O 5 .   ? -6.153  12.074  19.670  1.00 40.39  ? 2017 HOH C O   1 
HETATM 3137 O O   . HOH O 5 .   ? -8.322  6.732   16.216  1.00 46.04  ? 2018 HOH C O   1 
HETATM 3138 O O   . HOH O 5 .   ? -7.881  9.092   13.937  1.00 59.05  ? 2019 HOH C O   1 
HETATM 3139 O O   . HOH O 5 .   ? 2.175   27.454  16.294  1.00 58.48  ? 2020 HOH C O   1 
HETATM 3140 O O   . HOH O 5 .   ? 2.988   20.940  10.373  1.00 70.84  ? 2021 HOH C O   1 
HETATM 3141 O O   . HOH O 5 .   ? 12.048  20.445  30.346  1.00 67.48  ? 2022 HOH C O   1 
HETATM 3142 O O   . HOH O 5 .   ? -10.578 2.393   20.183  1.00 49.10  ? 2023 HOH C O   1 
HETATM 3143 O O   . HOH O 5 .   ? -5.182  -2.460  23.728  1.00 70.04  ? 2024 HOH C O   1 
HETATM 3144 O O   . HOH O 5 .   ? -9.813  11.541  17.217  1.00 40.83  ? 2025 HOH C O   1 
HETATM 3145 O O   . HOH O 5 .   ? -3.545  9.678   24.672  1.00 38.08  ? 2026 HOH C O   1 
HETATM 3146 O O   . HOH O 5 .   ? -6.037  11.851  22.599  1.00 39.72  ? 2027 HOH C O   1 
HETATM 3147 O O   . HOH O 5 .   ? -12.842 8.576   21.725  1.00 47.04  ? 2028 HOH C O   1 
HETATM 3148 O O   . HOH O 5 .   ? -11.626 10.038  29.178  1.00 49.80  ? 2029 HOH C O   1 
HETATM 3149 O O   . HOH O 5 .   ? -16.382 8.912   23.233  1.00 57.93  ? 2030 HOH C O   1 
HETATM 3150 O O   . HOH O 5 .   ? -10.979 12.188  27.362  1.00 45.01  ? 2031 HOH C O   1 
HETATM 3151 O O   . HOH O 5 .   ? -9.443  14.125  17.277  1.00 53.18  ? 2032 HOH C O   1 
HETATM 3152 O O   . HOH O 5 .   ? -12.074 14.526  28.778  1.00 73.43  ? 2033 HOH C O   1 
HETATM 3153 O O   . HOH O 5 .   ? -11.061 16.015  18.023  1.00 71.34  ? 2034 HOH C O   1 
HETATM 3154 O O   . HOH O 5 .   ? -7.191  14.329  18.793  1.00 39.22  ? 2035 HOH C O   1 
HETATM 3155 O O   . HOH O 5 .   ? -2.885  13.261  21.803  1.00 41.82  ? 2036 HOH C O   1 
HETATM 3156 O O   . HOH O 5 .   ? -4.624  17.597  13.483  1.00 74.81  ? 2037 HOH C O   1 
HETATM 3157 O O   . HOH O 5 .   ? -2.266  21.815  12.521  1.00 58.69  ? 2038 HOH C O   1 
HETATM 3158 O O   . HOH O 5 .   ? -5.195  19.560  11.659  1.00 72.21  ? 2039 HOH C O   1 
HETATM 3159 O O   . HOH O 5 .   ? -11.389 21.635  15.308  1.00 51.60  ? 2040 HOH C O   1 
HETATM 3160 O O   . HOH O 5 .   ? -8.727  30.508  18.654  1.00 40.72  ? 2041 HOH C O   1 
HETATM 3161 O O   . HOH O 5 .   ? -12.597 20.599  22.833  1.00 46.32  ? 2042 HOH C O   1 
HETATM 3162 O O   . HOH O 5 .   ? -14.264 22.934  22.102  1.00 57.50  ? 2043 HOH C O   1 
HETATM 3163 O O   . HOH O 5 .   ? -13.740 20.861  15.862  1.00 61.25  ? 2044 HOH C O   1 
HETATM 3164 O O   . HOH O 5 .   ? -13.723 18.783  20.894  1.00 58.17  ? 2045 HOH C O   1 
HETATM 3165 O O   . HOH O 5 .   ? 6.316   7.212   22.133  1.00 47.82  ? 2046 HOH C O   1 
HETATM 3166 O O   . HOH O 5 .   ? -6.778  32.335  18.139  1.00 60.61  ? 2047 HOH C O   1 
HETATM 3167 O O   . HOH O 5 .   ? -10.449 32.309  29.775  1.00 51.57  ? 2048 HOH C O   1 
HETATM 3168 O O   . HOH O 5 .   ? -14.953 29.844  28.182  1.00 82.56  ? 2049 HOH C O   1 
HETATM 3169 O O   . HOH O 5 .   ? -13.443 26.459  29.502  1.00 52.77  ? 2050 HOH C O   1 
HETATM 3170 O O   . HOH O 5 .   ? -11.021 19.329  26.061  1.00 46.36  ? 2051 HOH C O   1 
HETATM 3171 O O   . HOH O 5 .   ? -15.090 22.821  32.326  1.00 87.62  ? 2052 HOH C O   1 
HETATM 3172 O O   . HOH O 5 .   ? -3.352  16.706  32.718  1.00 63.67  ? 2053 HOH C O   1 
HETATM 3173 O O   . HOH O 5 .   ? -3.047  21.259  32.622  1.00 73.56  ? 2054 HOH C O   1 
HETATM 3174 O O   . HOH O 5 .   ? -9.228  17.068  33.598  1.00 59.63  ? 2055 HOH C O   1 
HETATM 3175 O O   . HOH O 5 .   ? -3.067  12.378  24.261  1.00 45.47  ? 2056 HOH C O   1 
HETATM 3176 O O   . HOH O 5 .   ? -9.044  13.242  29.872  1.00 71.93  ? 2057 HOH C O   1 
HETATM 3177 O O   . HOH O 5 .   ? -2.874  5.385   33.926  0.50 57.27  ? 2058 HOH C O   1 
HETATM 3178 O O   . HOH O 5 .   ? 0.204   6.437   32.914  1.00 50.46  ? 2059 HOH C O   1 
HETATM 3179 O O   . HOH O 5 .   ? -5.253  1.528   29.150  1.00 67.03  ? 2060 HOH C O   1 
HETATM 3180 O O   . HOH O 5 .   ? 3.369   4.538   24.220  1.00 57.19  ? 2061 HOH C O   1 
HETATM 3181 O O   . HOH O 5 .   ? 0.577   2.454   26.151  1.00 62.53  ? 2062 HOH C O   1 
HETATM 3182 O O   . HOH O 5 .   ? 4.169   0.175   33.658  1.00 57.12  ? 2063 HOH C O   1 
HETATM 3183 O O   . HOH O 5 .   ? 5.670   5.214   24.926  1.00 47.05  ? 2064 HOH C O   1 
HETATM 3184 O O   . HOH O 5 .   ? 7.314   3.017   25.477  1.00 59.41  ? 2065 HOH C O   1 
HETATM 3185 O O   . HOH O 5 .   ? 4.073   15.326  36.479  1.00 55.40  ? 2066 HOH C O   1 
HETATM 3186 O O   . HOH O 5 .   ? 9.035   15.693  34.563  1.00 74.26  ? 2067 HOH C O   1 
HETATM 3187 O O   . HOH O 5 .   ? 9.422   24.355  32.435  1.00 66.07  ? 2068 HOH C O   1 
HETATM 3188 O O   . HOH O 5 .   ? 8.806   27.646  30.384  1.00 64.55  ? 2069 HOH C O   1 
HETATM 3189 O O   . HOH O 5 .   ? -15.024 25.905  11.717  1.00 56.70  ? 2070 HOH C O   1 
HETATM 3190 O O   . HOH O 5 .   ? -15.250 23.006  14.467  1.00 47.32  ? 2071 HOH C O   1 
HETATM 3191 O O   . HOH O 5 .   ? -0.157  -9.755  13.969  1.00 91.91  ? 2072 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 29  ? 0.9950 1.0161 1.1888 -0.0320 0.3575  0.1507  75  VAL A N   
2    C CA  . VAL A 29  ? 0.9726 1.0205 1.1623 -0.0168 0.3446  0.1357  75  VAL A CA  
3    C C   . VAL A 29  ? 0.9909 1.0231 1.1197 0.0070  0.3507  0.1420  75  VAL A C   
4    O O   . VAL A 29  ? 1.0201 1.0652 1.1411 0.0164  0.3732  0.1483  75  VAL A O   
5    C CB  . VAL A 29  ? 0.9681 1.0588 1.2101 -0.0231 0.3591  0.1312  75  VAL A CB  
6    C CG1 . VAL A 29  ? 0.9472 1.0617 1.1855 -0.0063 0.3444  0.1154  75  VAL A CG1 
7    C CG2 . VAL A 29  ? 0.9549 1.0624 1.2584 -0.0474 0.3528  0.1245  75  VAL A CG2 
8    N N   . THR A 30  ? 0.9727 0.9784 1.0588 0.0169  0.3305  0.1394  76  THR A N   
9    C CA  . THR A 30  ? 0.9853 0.9748 1.0119 0.0392  0.3316  0.1432  76  THR A CA  
10   C C   . THR A 30  ? 0.9577 0.9674 0.9776 0.0536  0.3202  0.1267  76  THR A C   
11   O O   . THR A 30  ? 0.9267 0.9580 0.9829 0.0474  0.3059  0.1124  76  THR A O   
12   C CB  . THR A 30  ? 0.9869 0.9452 0.9741 0.0455  0.3115  0.1443  76  THR A CB  
13   O OG1 . THR A 30  ? 0.9359 0.9014 0.9356 0.0434  0.2814  0.1260  76  THR A OG1 
14   C CG2 . THR A 30  ? 0.9982 0.9320 0.9912 0.0327  0.3205  0.1596  76  THR A CG2 
15   N N   . ASN A 31  ? 0.9732 0.9737 0.9443 0.0736  0.3262  0.1287  77  ASN A N   
16   C CA  . ASN A 31  ? 0.9547 0.9673 0.9122 0.0890  0.3149  0.1121  77  ASN A CA  
17   C C   . ASN A 31  ? 0.9062 0.9128 0.8616 0.0889  0.2807  0.0958  77  ASN A C   
18   O O   . ASN A 31  ? 0.8768 0.8981 0.8472 0.0923  0.2684  0.0807  77  ASN A O   
19   C CB  . ASN A 31  ? 1.0026 1.0027 0.9029 0.1110  0.3271  0.1164  77  ASN A CB  
20   C CG  . ASN A 31  ? 1.0379 1.0070 0.8875 0.1191  0.3159  0.1229  77  ASN A CG  
21   O OD1 . ASN A 31  ? 1.0293 0.9842 0.8862 0.1078  0.3102  0.1316  77  ASN A OD1 
22   N ND2 . ASN A 31  ? 1.1048 1.0640 0.9030 0.1398  0.3121  0.1178  77  ASN A ND2 
23   N N   . GLN A 32  ? 0.8911 0.8761 0.8285 0.0854  0.2667  0.0995  78  GLN A N   
24   C CA  . GLN A 32  ? 0.8607 0.8408 0.7982 0.0837  0.2366  0.0860  78  GLN A CA  
25   C C   . GLN A 32  ? 0.8070 0.8035 0.7952 0.0672  0.2263  0.0787  78  GLN A C   
26   O O   . GLN A 32  ? 0.7852 0.7880 0.7817 0.0679  0.2069  0.0652  78  GLN A O   
27   C CB  . GLN A 32  ? 0.8747 0.8306 0.7835 0.0849  0.2263  0.0928  78  GLN A CB  
28   C CG  . GLN A 32  ? 0.9395 0.8787 0.7931 0.1037  0.2298  0.0981  78  GLN A CG  
29   C CD  . GLN A 32  ? 0.9763 0.8948 0.8048 0.1067  0.2159  0.1033  78  GLN A CD  
30   O OE1 . GLN A 32  ? 0.9781 0.8875 0.8226 0.0961  0.2186  0.1130  78  GLN A OE1 
31   N NE2 . GLN A 32  ? 0.9990 0.9106 0.7890 0.1218  0.2004  0.0958  78  GLN A NE2 
32   N N   . LEU A 33  ? 0.7948 0.7966 0.8155 0.0524  0.2388  0.0877  79  LEU A N   
33   C CA  . LEU A 33  ? 0.7523 0.7713 0.8209 0.0370  0.2288  0.0800  79  LEU A CA  
34   C C   . LEU A 33  ? 0.7335 0.7808 0.8301 0.0399  0.2309  0.0706  79  LEU A C   
35   O O   . LEU A 33  ? 0.6915 0.7520 0.8138 0.0352  0.2142  0.0598  79  LEU A O   
36   C CB  . LEU A 33  ? 0.7571 0.7741 0.8545 0.0198  0.2418  0.0903  79  LEU A CB  
37   C CG  . LEU A 33  ? 0.7657 0.7562 0.8488 0.0140  0.2321  0.0949  79  LEU A CG  
38   C CD1 . LEU A 33  ? 0.8003 0.7807 0.9019 0.0001  0.2509  0.1080  79  LEU A CD1 
39   C CD2 . LEU A 33  ? 0.7160 0.7110 0.8162 0.0076  0.2064  0.0812  79  LEU A CD2 
40   N N   . GLN A 34  ? 0.7576 0.8142 0.8477 0.0491  0.2521  0.0754  80  GLN A N   
41   C CA  . GLN A 34  ? 0.7554 0.8384 0.8682 0.0560  0.2556  0.0665  80  GLN A CA  
42   C C   . GLN A 34  ? 0.7325 0.8086 0.8217 0.0697  0.2351  0.0529  80  GLN A C   
43   O O   . GLN A 34  ? 0.7152 0.8075 0.8289 0.0714  0.2244  0.0425  80  GLN A O   
44   C CB  . GLN A 34  ? 0.8021 0.8949 0.9082 0.0648  0.2853  0.0752  80  GLN A CB  
45   C CG  . GLN A 34  ? 0.8461 0.9533 0.9899 0.0490  0.3080  0.0877  80  GLN A CG  
46   C CD  . GLN A 34  ? 0.8608 1.0040 1.0650 0.0393  0.3059  0.0794  80  GLN A CD  
47   O OE1 . GLN A 34  ? 0.8952 1.0634 1.1149 0.0496  0.3145  0.0740  80  GLN A OE1 
48   N NE2 . GLN A 34  ? 0.8656 1.0123 1.1040 0.0207  0.2936  0.0775  80  GLN A NE2 
49   N N   . TYR A 35  ? 0.7407 0.7923 0.7827 0.0796  0.2291  0.0529  81  TYR A N   
50   C CA  . TYR A 35  ? 0.7368 0.7783 0.7569 0.0898  0.2086  0.0396  81  TYR A CA  
51   C C   . TYR A 35  ? 0.7068 0.7478 0.7483 0.0786  0.1852  0.0332  81  TYR A C   
52   O O   . TYR A 35  ? 0.6884 0.7353 0.7413 0.0820  0.1726  0.0229  81  TYR A O   
53   C CB  . TYR A 35  ? 0.7580 0.7754 0.7266 0.1006  0.2053  0.0404  81  TYR A CB  
54   C CG  . TYR A 35  ? 0.7506 0.7571 0.6986 0.1093  0.1842  0.0254  81  TYR A CG  
55   C CD1 . TYR A 35  ? 0.7727 0.7793 0.7044 0.1246  0.1874  0.0154  81  TYR A CD1 
56   C CD2 . TYR A 35  ? 0.7179 0.7135 0.6642 0.1021  0.1620  0.0209  81  TYR A CD2 
57   C CE1 . TYR A 35  ? 0.7760 0.7694 0.6908 0.1310  0.1681  0.0008  81  TYR A CE1 
58   C CE2 . TYR A 35  ? 0.7171 0.7025 0.6484 0.1078  0.1438  0.0076  81  TYR A CE2 
59   C CZ  . TYR A 35  ? 0.7513 0.7343 0.6673 0.1215  0.1464  -0.0026 81  TYR A CZ  
60   O OH  . TYR A 35  ? 0.7585 0.7283 0.6612 0.1258  0.1285  -0.0166 81  TYR A OH  
61   N N   . LEU A 36  ? 0.7118 0.7448 0.7576 0.0662  0.1804  0.0398  82  LEU A N   
62   C CA  . LEU A 36  ? 0.6863 0.7187 0.7494 0.0561  0.1602  0.0344  82  LEU A CA  
63   C C   . LEU A 36  ? 0.6682 0.7235 0.7734 0.0497  0.1570  0.0295  82  LEU A C   
64   O O   . LEU A 36  ? 0.6325 0.6891 0.7455 0.0487  0.1396  0.0221  82  LEU A O   
65   C CB  . LEU A 36  ? 0.6930 0.7129 0.7533 0.0456  0.1584  0.0422  82  LEU A CB  
66   C CG  . LEU A 36  ? 0.7248 0.7227 0.7443 0.0530  0.1535  0.0451  82  LEU A CG  
67   C CD1 . LEU A 36  ? 0.7157 0.7009 0.7338 0.0449  0.1553  0.0544  82  LEU A CD1 
68   C CD2 . LEU A 36  ? 0.7238 0.7164 0.7307 0.0572  0.1323  0.0341  82  LEU A CD2 
69   N N   . HIS A 37  ? 0.6782 0.7525 0.8109 0.0459  0.1740  0.0341  83  HIS A N   
70   C CA  . HIS A 37  ? 0.6750 0.7758 0.8505 0.0413  0.1705  0.0286  83  HIS A CA  
71   C C   . HIS A 37  ? 0.6749 0.7866 0.8513 0.0565  0.1683  0.0206  83  HIS A C   
72   O O   . HIS A 37  ? 0.6614 0.7792 0.8506 0.0585  0.1519  0.0131  83  HIS A O   
73   C CB  . HIS A 37  ? 0.6948 0.8153 0.9046 0.0310  0.1899  0.0354  83  HIS A CB  
74   C CG  . HIS A 37  ? 0.7127 0.8612 0.9708 0.0219  0.1823  0.0291  83  HIS A CG  
75   N ND1 . HIS A 37  ? 0.7468 0.9153 1.0445 0.0084  0.1954  0.0328  83  HIS A ND1 
76   C CD2 . HIS A 37  ? 0.7153 0.8752 0.9883 0.0247  0.1622  0.0193  83  HIS A CD2 
77   C CE1 . HIS A 37  ? 0.7401 0.9337 1.0761 0.0034  0.1821  0.0239  83  HIS A CE1 
78   N NE2 . HIS A 37  ? 0.7174 0.9057 1.0371 0.0142  0.1619  0.0162  83  HIS A NE2 
79   N N   . LYS A 38  ? 0.6938 0.8062 0.8546 0.0683  0.1854  0.0224  84  LYS A N   
80   C CA  . LYS A 38  ? 0.6909 0.8146 0.8553 0.0841  0.1873  0.0146  84  LYS A CA  
81   C C   . LYS A 38  ? 0.6820 0.7828 0.8146 0.0956  0.1703  0.0055  84  LYS A C   
82   O O   . LYS A 38  ? 0.6782 0.7850 0.8197 0.1063  0.1646  -0.0022 84  LYS A O   
83   C CB  . LYS A 38  ? 0.7357 0.8676 0.8916 0.0943  0.2133  0.0190  84  LYS A CB  
84   C CG  . LYS A 38  ? 0.7619 0.9223 0.9573 0.0848  0.2344  0.0273  84  LYS A CG  
85   C CD  . LYS A 38  ? 0.8300 1.0037 1.0205 0.0992  0.2598  0.0292  84  LYS A CD  
86   C CE  . LYS A 38  ? 0.8667 1.0627 1.0874 0.0883  0.2866  0.0413  84  LYS A CE  
87   N NZ  . LYS A 38  ? 0.8652 1.0956 1.1481 0.0749  0.2834  0.0390  84  LYS A NZ  
88   N N   . VAL A 39  ? 0.6772 0.7519 0.7744 0.0937  0.1626  0.0063  85  VAL A N   
89   C CA  . VAL A 39  ? 0.6820 0.7346 0.7507 0.1025  0.1475  -0.0030 85  VAL A CA  
90   C C   . VAL A 39  ? 0.6627 0.7034 0.7320 0.0919  0.1266  -0.0041 85  VAL A C   
91   O O   . VAL A 39  ? 0.6621 0.6975 0.7355 0.0949  0.1134  -0.0105 85  VAL A O   
92   C CB  . VAL A 39  ? 0.7060 0.7395 0.7315 0.1116  0.1533  -0.0043 85  VAL A CB  
93   C CG1 . VAL A 39  ? 0.7242 0.7352 0.7249 0.1178  0.1355  -0.0158 85  VAL A CG1 
94   C CG2 . VAL A 39  ? 0.7325 0.7766 0.7524 0.1249  0.1752  -0.0038 85  VAL A CG2 
95   N N   . VAL A 40  ? 0.6500 0.6857 0.7146 0.0805  0.1249  0.0025  86  VAL A N   
96   C CA  . VAL A 40  ? 0.6336 0.6585 0.6959 0.0715  0.1071  0.0015  86  VAL A CA  
97   C C   . VAL A 40  ? 0.6157 0.6546 0.7097 0.0637  0.0990  0.0017  86  VAL A C   
98   O O   . VAL A 40  ? 0.6087 0.6420 0.7037 0.0646  0.0854  -0.0025 86  VAL A O   
99   C CB  . VAL A 40  ? 0.6330 0.6479 0.6794 0.0642  0.1075  0.0078  86  VAL A CB  
100  C CG1 . VAL A 40  ? 0.6112 0.6188 0.6589 0.0555  0.0906  0.0064  86  VAL A CG1 
101  C CG2 . VAL A 40  ? 0.6478 0.6485 0.6586 0.0740  0.1115  0.0067  86  VAL A CG2 
102  N N   . MET A 41  ? 0.6139 0.6703 0.7332 0.0562  0.1073  0.0065  87  MET A N   
103  C CA  . MET A 41  ? 0.6038 0.6752 0.7525 0.0491  0.0979  0.0051  87  MET A CA  
104  C C   . MET A 41  ? 0.6099 0.6944 0.7746 0.0593  0.0937  -0.0002 87  MET A C   
105  O O   . MET A 41  ? 0.6014 0.6878 0.7743 0.0591  0.0795  -0.0027 87  MET A O   
106  C CB  . MET A 41  ? 0.6016 0.6892 0.7769 0.0378  0.1071  0.0093  87  MET A CB  
107  C CG  . MET A 41  ? 0.5939 0.6986 0.7992 0.0307  0.0951  0.0054  87  MET A CG  
108  S SD  . MET A 41  ? 0.6279 0.7153 0.8152 0.0264  0.0748  0.0031  87  MET A SD  
109  C CE  . MET A 41  ? 0.6344 0.7096 0.8152 0.0138  0.0814  0.0079  87  MET A CE  
110  N N   . LYS A 42  ? 0.6263 0.7187 0.7934 0.0698  0.1065  -0.0014 88  LYS A N   
111  C CA  . LYS A 42  ? 0.6387 0.7415 0.8191 0.0826  0.1033  -0.0067 88  LYS A CA  
112  C C   . LYS A 42  ? 0.6360 0.7151 0.7943 0.0891  0.0880  -0.0107 88  LYS A C   
113  O O   . LYS A 42  ? 0.6435 0.7268 0.8141 0.0934  0.0766  -0.0123 88  LYS A O   
114  C CB  . LYS A 42  ? 0.6702 0.7820 0.8507 0.0951  0.1213  -0.0082 88  LYS A CB  
115  C CG  . LYS A 42  ? 0.7014 0.8344 0.9085 0.1080  0.1212  -0.0129 88  LYS A CG  
116  C CD  . LYS A 42  ? 0.7485 0.9011 0.9669 0.1175  0.1432  -0.0130 88  LYS A CD  
117  C CE  . LYS A 42  ? 0.7570 0.9386 1.0088 0.1042  0.1573  -0.0066 88  LYS A CE  
118  N NZ  . LYS A 42  ? 0.7849 0.9816 1.0411 0.1118  0.1829  -0.0042 88  LYS A NZ  
119  N N   . ALA A 43  ? 0.6377 0.6917 0.7638 0.0896  0.0874  -0.0119 89  ALA A N   
120  C CA  . ALA A 43  ? 0.6436 0.6732 0.7503 0.0930  0.0740  -0.0159 89  ALA A CA  
121  C C   . ALA A 43  ? 0.6293 0.6551 0.7405 0.0827  0.0598  -0.0123 89  ALA A C   
122  O O   . ALA A 43  ? 0.6383 0.6562 0.7509 0.0871  0.0498  -0.0128 89  ALA A O   
123  C CB  . ALA A 43  ? 0.6597 0.6675 0.7349 0.0935  0.0754  -0.0194 89  ALA A CB  
124  N N   . LEU A 44  ? 0.6027 0.6326 0.7146 0.0703  0.0596  -0.0081 90  LEU A N   
125  C CA  . LEU A 44  ? 0.5979 0.6234 0.7099 0.0613  0.0477  -0.0053 90  LEU A CA  
126  C C   . LEU A 44  ? 0.5854 0.6287 0.7203 0.0613  0.0411  -0.0041 90  LEU A C   
127  O O   . LEU A 44  ? 0.5772 0.6137 0.7082 0.0615  0.0301  -0.0025 90  LEU A O   
128  C CB  . LEU A 44  ? 0.5991 0.6226 0.7036 0.0502  0.0496  -0.0024 90  LEU A CB  
129  C CG  . LEU A 44  ? 0.6347 0.6420 0.7149 0.0506  0.0525  -0.0036 90  LEU A CG  
130  C CD1 . LEU A 44  ? 0.6490 0.6556 0.7240 0.0417  0.0534  0.0003  90  LEU A CD1 
131  C CD2 . LEU A 44  ? 0.6597 0.6491 0.7258 0.0526  0.0430  -0.0071 90  LEU A CD2 
132  N N   . TRP A 45  ? 0.5696 0.6362 0.7283 0.0614  0.0478  -0.0047 91  TRP A N   
133  C CA  . TRP A 45  ? 0.5593 0.6473 0.7430 0.0609  0.0400  -0.0055 91  TRP A CA  
134  C C   . TRP A 45  ? 0.5704 0.6576 0.7556 0.0741  0.0303  -0.0063 91  TRP A C   
135  O O   . TRP A 45  ? 0.5739 0.6651 0.7622 0.0745  0.0178  -0.0054 91  TRP A O   
136  C CB  . TRP A 45  ? 0.5562 0.6715 0.7702 0.0583  0.0503  -0.0071 91  TRP A CB  
137  C CG  . TRP A 45  ? 0.5389 0.6798 0.7826 0.0557  0.0406  -0.0101 91  TRP A CG  
138  C CD1 . TRP A 45  ? 0.5626 0.7279 0.8323 0.0654  0.0371  -0.0134 91  TRP A CD1 
139  C CD2 . TRP A 45  ? 0.5412 0.6869 0.7917 0.0433  0.0321  -0.0117 91  TRP A CD2 
140  N NE1 . TRP A 45  ? 0.5574 0.7439 0.8502 0.0594  0.0255  -0.0173 91  TRP A NE1 
141  C CE2 . TRP A 45  ? 0.5397 0.7132 0.8199 0.0457  0.0223  -0.0168 91  TRP A CE2 
142  C CE3 . TRP A 45  ? 0.5445 0.6739 0.7786 0.0317  0.0312  -0.0102 91  TRP A CE3 
143  C CZ2 . TRP A 45  ? 0.5320 0.7162 0.8243 0.0360  0.0110  -0.0216 91  TRP A CZ2 
144  C CZ3 . TRP A 45  ? 0.5414 0.6797 0.7871 0.0228  0.0216  -0.0145 91  TRP A CZ3 
145  C CH2 . TRP A 45  ? 0.5345 0.6995 0.8083 0.0246  0.0113  -0.0207 91  TRP A CH2 
146  N N   . LYS A 46  ? 0.5803 0.6607 0.7609 0.0863  0.0360  -0.0081 92  LYS A N   
147  C CA  . LYS A 46  ? 0.5899 0.6665 0.7718 0.1011  0.0279  -0.0084 92  LYS A CA  
148  C C   . LYS A 46  ? 0.5855 0.6279 0.7389 0.1032  0.0207  -0.0057 92  LYS A C   
149  O O   . LYS A 46  ? 0.5936 0.6253 0.7439 0.1158  0.0149  -0.0048 92  LYS A O   
150  C CB  . LYS A 46  ? 0.6135 0.7000 0.8072 0.1153  0.0381  -0.0127 92  LYS A CB  
151  C CG  . LYS A 46  ? 0.6504 0.7132 0.8201 0.1189  0.0480  -0.0157 92  LYS A CG  
152  C CD  . LYS A 46  ? 0.7040 0.7790 0.8849 0.1342  0.0597  -0.0207 92  LYS A CD  
153  C CE  . LYS A 46  ? 0.7402 0.7874 0.8919 0.1408  0.0666  -0.0259 92  LYS A CE  
154  N NZ  . LYS A 46  ? 0.7933 0.8444 0.9508 0.1609  0.0741  -0.0320 92  LYS A NZ  
155  N N   . HIS A 47  ? 0.5666 0.5916 0.7009 0.0910  0.0213  -0.0042 93  HIS A N   
156  C CA  . HIS A 47  ? 0.5739 0.5683 0.6854 0.0901  0.0160  -0.0019 93  HIS A CA  
157  C C   . HIS A 47  ? 0.5653 0.5559 0.6744 0.0905  0.0049  0.0049  93  HIS A C   
158  O O   . HIS A 47  ? 0.5554 0.5646 0.6736 0.0859  0.0005  0.0068  93  HIS A O   
159  C CB  . HIS A 47  ? 0.5743 0.5577 0.6708 0.0769  0.0192  -0.0026 93  HIS A CB  
160  C CG  . HIS A 47  ? 0.5981 0.5526 0.6761 0.0750  0.0160  -0.0030 93  HIS A CG  
161  N ND1 . HIS A 47  ? 0.5965 0.5373 0.6676 0.0701  0.0091  0.0031  93  HIS A ND1 
162  C CD2 . HIS A 47  ? 0.6300 0.5666 0.6957 0.0768  0.0187  -0.0095 93  HIS A CD2 
163  C CE1 . HIS A 47  ? 0.6395 0.5556 0.6985 0.0675  0.0084  0.0010  93  HIS A CE1 
164  N NE2 . HIS A 47  ? 0.6286 0.5416 0.6841 0.0715  0.0129  -0.0078 93  HIS A NE2 
165  N N   . GLN A 48  ? 0.5878 0.5527 0.6833 0.0963  0.0008  0.0085  94  GLN A N   
166  C CA  . GLN A 48  ? 0.6040 0.5611 0.6921 0.0987  -0.0082 0.0173  94  GLN A CA  
167  C C   . GLN A 48  ? 0.5868 0.5438 0.6652 0.0845  -0.0100 0.0221  94  GLN A C   
168  O O   . GLN A 48  ? 0.5982 0.5567 0.6706 0.0864  -0.0165 0.0288  94  GLN A O   
169  C CB  . GLN A 48  ? 0.6548 0.5786 0.7289 0.1070  -0.0098 0.0216  94  GLN A CB  
170  C CG  . GLN A 48  ? 0.6786 0.5746 0.7390 0.0960  -0.0051 0.0197  94  GLN A CG  
171  C CD  . GLN A 48  ? 0.7771 0.6368 0.8251 0.1015  -0.0070 0.0251  94  GLN A CD  
172  O OE1 . GLN A 48  ? 0.8316 0.6841 0.8750 0.1108  -0.0119 0.0347  94  GLN A OE1 
173  N NE2 . GLN A 48  ? 0.7790 0.6144 0.8207 0.0963  -0.0037 0.0188  94  GLN A NE2 
174  N N   . PHE A 49  ? 0.5673 0.5232 0.6428 0.0719  -0.0042 0.0185  95  PHE A N   
175  C CA  . PHE A 49  ? 0.5611 0.5194 0.6295 0.0596  -0.0047 0.0218  95  PHE A CA  
176  C C   . PHE A 49  ? 0.5414 0.5249 0.6210 0.0543  -0.0040 0.0176  95  PHE A C   
177  O O   . PHE A 49  ? 0.5332 0.5195 0.6077 0.0455  -0.0039 0.0188  95  PHE A O   
178  C CB  . PHE A 49  ? 0.5564 0.4985 0.6161 0.0496  0.0000  0.0204  95  PHE A CB  
179  C CG  . PHE A 49  ? 0.5973 0.5117 0.6470 0.0499  -0.0007 0.0247  95  PHE A CG  
180  C CD1 . PHE A 49  ? 0.6329 0.5347 0.6768 0.0582  -0.0044 0.0330  95  PHE A CD1 
181  C CD2 . PHE A 49  ? 0.6154 0.5156 0.6617 0.0415  0.0020  0.0206  95  PHE A CD2 
182  C CE1 . PHE A 49  ? 0.6716 0.5437 0.7065 0.0573  -0.0035 0.0381  95  PHE A CE1 
183  C CE2 . PHE A 49  ? 0.6517 0.5250 0.6919 0.0392  0.0016  0.0236  95  PHE A CE2 
184  C CZ  . PHE A 49  ? 0.6817 0.5392 0.7163 0.0466  -0.0002 0.0330  95  PHE A CZ  
185  N N   . ALA A 50  ? 0.5399 0.5411 0.6361 0.0597  -0.0028 0.0127  96  ALA A N   
186  C CA  . ALA A 50  ? 0.5298 0.5520 0.6397 0.0528  -0.0001 0.0084  96  ALA A CA  
187  C C   . ALA A 50  ? 0.5289 0.5663 0.6445 0.0513  -0.0086 0.0082  96  ALA A C   
188  O O   . ALA A 50  ? 0.5235 0.5706 0.6450 0.0427  -0.0073 0.0049  96  ALA A O   
189  C CB  . ALA A 50  ? 0.5311 0.5678 0.6592 0.0576  0.0064  0.0037  96  ALA A CB  
190  N N   . TRP A 51  ? 0.5515 0.5889 0.6633 0.0604  -0.0176 0.0116  97  TRP A N   
191  C CA  . TRP A 51  ? 0.5593 0.6145 0.6767 0.0621  -0.0282 0.0094  97  TRP A CA  
192  C C   . TRP A 51  ? 0.5557 0.6104 0.6624 0.0520  -0.0296 0.0081  97  TRP A C   
193  O O   . TRP A 51  ? 0.5682 0.6403 0.6865 0.0486  -0.0351 0.0012  97  TRP A O   
194  C CB  . TRP A 51  ? 0.5897 0.6419 0.6984 0.0763  -0.0386 0.0149  97  TRP A CB  
195  C CG  . TRP A 51  ? 0.6092 0.6345 0.6898 0.0778  -0.0379 0.0250  97  TRP A CG  
196  C CD1 . TRP A 51  ? 0.6324 0.6334 0.7030 0.0814  -0.0325 0.0313  97  TRP A CD1 
197  C CD2 . TRP A 51  ? 0.6397 0.6591 0.6992 0.0750  -0.0413 0.0298  97  TRP A CD2 
198  N NE1 . TRP A 51  ? 0.6538 0.6344 0.7012 0.0794  -0.0319 0.0408  97  TRP A NE1 
199  C CE2 . TRP A 51  ? 0.6571 0.6495 0.6965 0.0762  -0.0364 0.0406  97  TRP A CE2 
200  C CE3 . TRP A 51  ? 0.6422 0.6759 0.6978 0.0717  -0.0475 0.0254  97  TRP A CE3 
201  C CZ2 . TRP A 51  ? 0.7019 0.6834 0.7181 0.0741  -0.0356 0.0488  97  TRP A CZ2 
202  C CZ3 . TRP A 51  ? 0.6698 0.6920 0.6992 0.0714  -0.0477 0.0322  97  TRP A CZ3 
203  C CH2 . TRP A 51  ? 0.7095 0.7069 0.7198 0.0726  -0.0409 0.0447  97  TRP A CH2 
204  N N   . PRO A 52  ? 0.5629 0.5986 0.6494 0.0469  -0.0245 0.0134  98  PRO A N   
205  C CA  . PRO A 52  ? 0.5618 0.5994 0.6398 0.0392  -0.0249 0.0111  98  PRO A CA  
206  C C   . PRO A 52  ? 0.5467 0.5916 0.6386 0.0296  -0.0191 0.0040  98  PRO A C   
207  O O   . PRO A 52  ? 0.5548 0.6018 0.6426 0.0244  -0.0202 0.0001  98  PRO A O   
208  C CB  . PRO A 52  ? 0.5690 0.5873 0.6266 0.0365  -0.0191 0.0190  98  PRO A CB  
209  C CG  . PRO A 52  ? 0.5674 0.5718 0.6209 0.0433  -0.0186 0.0260  98  PRO A CG  
210  C CD  . PRO A 52  ? 0.5654 0.5790 0.6383 0.0473  -0.0186 0.0205  98  PRO A CD  
211  N N   . PHE A 53  ? 0.5318 0.5787 0.6380 0.0284  -0.0122 0.0026  99  PHE A N   
212  C CA  . PHE A 53  ? 0.5232 0.5723 0.6390 0.0203  -0.0043 -0.0010 99  PHE A CA  
213  C C   . PHE A 53  ? 0.5212 0.5879 0.6627 0.0187  -0.0031 -0.0062 99  PHE A C   
214  O O   . PHE A 53  ? 0.5152 0.5824 0.6655 0.0120  0.0051  -0.0077 99  PHE A O   
215  C CB  . PHE A 53  ? 0.5129 0.5491 0.6211 0.0199  0.0048  0.0026  99  PHE A CB  
216  C CG  . PHE A 53  ? 0.5328 0.5543 0.6219 0.0194  0.0043  0.0070  99  PHE A CG  
217  C CD1 . PHE A 53  ? 0.5257 0.5434 0.6068 0.0137  0.0062  0.0070  99  PHE A CD1 
218  C CD2 . PHE A 53  ? 0.5503 0.5619 0.6316 0.0245  0.0022  0.0110  99  PHE A CD2 
219  C CE1 . PHE A 53  ? 0.5389 0.5474 0.6072 0.0124  0.0066  0.0108  99  PHE A CE1 
220  C CE2 . PHE A 53  ? 0.5695 0.5683 0.6373 0.0217  0.0028  0.0152  99  PHE A CE2 
221  C CZ  . PHE A 53  ? 0.5515 0.5510 0.6143 0.0153  0.0052  0.0150  99  PHE A CZ  
222  N N   . ARG A 54  ? 0.5369 0.6183 0.6913 0.0252  -0.0108 -0.0084 100 ARG A N   
223  C CA  . ARG A 54  ? 0.5361 0.6392 0.7208 0.0236  -0.0094 -0.0137 100 ARG A CA  
224  C C   . ARG A 54  ? 0.5331 0.6484 0.7338 0.0140  -0.0146 -0.0218 100 ARG A C   
225  O O   . ARG A 54  ? 0.5262 0.6588 0.7558 0.0085  -0.0111 -0.0264 100 ARG A O   
226  C CB  . ARG A 54  ? 0.5463 0.6641 0.7425 0.0356  -0.0170 -0.0141 100 ARG A CB  
227  C CG  . ARG A 54  ? 0.5733 0.6801 0.7613 0.0450  -0.0099 -0.0084 100 ARG A CG  
228  C CD  . ARG A 54  ? 0.5817 0.7074 0.7902 0.0569  -0.0138 -0.0102 100 ARG A CD  
229  N NE  . ARG A 54  ? 0.6213 0.7316 0.8179 0.0679  -0.0085 -0.0058 100 ARG A NE  
230  C CZ  . ARG A 54  ? 0.6543 0.7558 0.8405 0.0810  -0.0165 -0.0023 100 ARG A CZ  
231  N NH1 . ARG A 54  ? 0.6769 0.7852 0.8610 0.0867  -0.0307 -0.0013 100 ARG A NH1 
232  N NH2 . ARG A 54  ? 0.6828 0.7670 0.8591 0.0896  -0.0105 0.0002  100 ARG A NH2 
233  N N   . GLN A 55  ? 0.5336 0.6402 0.7165 0.0119  -0.0223 -0.0241 101 GLN A N   
234  C CA  . GLN A 55  ? 0.5453 0.6595 0.7393 0.0035  -0.0289 -0.0339 101 GLN A CA  
235  C C   . GLN A 55  ? 0.5315 0.6253 0.7000 -0.0001 -0.0271 -0.0334 101 GLN A C   
236  O O   . GLN A 55  ? 0.5150 0.5952 0.6592 0.0053  -0.0247 -0.0259 101 GLN A O   
237  C CB  . GLN A 55  ? 0.5611 0.6939 0.7613 0.0097  -0.0466 -0.0412 101 GLN A CB  
238  C CG  . GLN A 55  ? 0.5951 0.7185 0.7629 0.0213  -0.0555 -0.0362 101 GLN A CG  
239  C CD  . GLN A 55  ? 0.6198 0.7348 0.7770 0.0313  -0.0503 -0.0245 101 GLN A CD  
240  O OE1 . GLN A 55  ? 0.6048 0.6996 0.7365 0.0332  -0.0447 -0.0162 101 GLN A OE1 
241  N NE2 . GLN A 55  ? 0.6047 0.7355 0.7834 0.0374  -0.0518 -0.0246 101 GLN A NE2 
242  N N   . PRO A 56  ? 0.5297 0.6216 0.7058 -0.0092 -0.0281 -0.0418 102 PRO A N   
243  C CA  . PRO A 56  ? 0.5400 0.6139 0.6932 -0.0106 -0.0268 -0.0428 102 PRO A CA  
244  C C   . PRO A 56  ? 0.5555 0.6274 0.6815 -0.0013 -0.0358 -0.0420 102 PRO A C   
245  O O   . PRO A 56  ? 0.5672 0.6521 0.6935 0.0045  -0.0477 -0.0454 102 PRO A O   
246  C CB  . PRO A 56  ? 0.5513 0.6265 0.7204 -0.0200 -0.0312 -0.0555 102 PRO A CB  
247  C CG  . PRO A 56  ? 0.5473 0.6364 0.7509 -0.0276 -0.0270 -0.0568 102 PRO A CG  
248  C CD  . PRO A 56  ? 0.5352 0.6413 0.7439 -0.0188 -0.0301 -0.0513 102 PRO A CD  
249  N N   . VAL A 57  ? 0.5593 0.6162 0.6624 0.0007  -0.0297 -0.0368 103 VAL A N   
250  C CA  . VAL A 57  ? 0.5775 0.6319 0.6542 0.0084  -0.0352 -0.0355 103 VAL A CA  
251  C C   . VAL A 57  ? 0.5963 0.6566 0.6691 0.0091  -0.0473 -0.0488 103 VAL A C   
252  O O   . VAL A 57  ? 0.6072 0.6622 0.6863 0.0028  -0.0469 -0.0586 103 VAL A O   
253  C CB  . VAL A 57  ? 0.5802 0.6208 0.6384 0.0089  -0.0251 -0.0295 103 VAL A CB  
254  C CG1 . VAL A 57  ? 0.5809 0.6204 0.6127 0.0162  -0.0284 -0.0282 103 VAL A CG1 
255  C CG2 . VAL A 57  ? 0.5762 0.6120 0.6370 0.0085  -0.0159 -0.0182 103 VAL A CG2 
256  N N   . ASP A 58  ? 0.6108 0.6805 0.6723 0.0175  -0.0587 -0.0494 104 ASP A N   
257  C CA  . ASP A 58  ? 0.6391 0.7150 0.6900 0.0210  -0.0725 -0.0624 104 ASP A CA  
258  C C   . ASP A 58  ? 0.6542 0.7198 0.6678 0.0295  -0.0697 -0.0581 104 ASP A C   
259  O O   . ASP A 58  ? 0.6601 0.7266 0.6535 0.0390  -0.0716 -0.0483 104 ASP A O   
260  C CB  . ASP A 58  ? 0.6526 0.7473 0.7122 0.0274  -0.0880 -0.0656 104 ASP A CB  
261  C CG  . ASP A 58  ? 0.6904 0.7945 0.7417 0.0310  -0.1056 -0.0819 104 ASP A CG  
262  O OD1 . ASP A 58  ? 0.6959 0.7891 0.7241 0.0320  -0.1053 -0.0885 104 ASP A OD1 
263  O OD2 . ASP A 58  ? 0.6974 0.8213 0.7655 0.0337  -0.1206 -0.0890 104 ASP A OD2 
264  N N   . ALA A 59  ? 0.6603 0.7155 0.6652 0.0265  -0.0641 -0.0648 105 ALA A N   
265  C CA  . ALA A 59  ? 0.6755 0.7225 0.6481 0.0342  -0.0575 -0.0605 105 ALA A CA  
266  C C   . ALA A 59  ? 0.7093 0.7618 0.6528 0.0456  -0.0693 -0.0651 105 ALA A C   
267  O O   . ALA A 59  ? 0.7305 0.7796 0.6459 0.0540  -0.0631 -0.0547 105 ALA A O   
268  C CB  . ALA A 59  ? 0.6791 0.7152 0.6510 0.0304  -0.0502 -0.0691 105 ALA A CB  
269  N N   . VAL A 60  ? 0.7257 0.7875 0.6762 0.0458  -0.0861 -0.0807 106 VAL A N   
270  C CA  . VAL A 60  ? 0.7577 0.8265 0.6794 0.0581  -0.1008 -0.0871 106 VAL A CA  
271  C C   . VAL A 60  ? 0.7666 0.8417 0.6778 0.0676  -0.1038 -0.0708 106 VAL A C   
272  O O   . VAL A 60  ? 0.7899 0.8604 0.6653 0.0794  -0.1013 -0.0610 106 VAL A O   
273  C CB  . VAL A 60  ? 0.7668 0.8470 0.7049 0.0548  -0.1209 -0.1094 106 VAL A CB  
274  C CG1 . VAL A 60  ? 0.7998 0.8880 0.7044 0.0694  -0.1383 -0.1175 106 VAL A CG1 
275  C CG2 . VAL A 60  ? 0.7810 0.8500 0.7311 0.0445  -0.1175 -0.1254 106 VAL A CG2 
276  N N   . LYS A 61  ? 0.7496 0.8340 0.6918 0.0631  -0.1077 -0.0673 107 LYS A N   
277  C CA  . LYS A 61  ? 0.7587 0.8469 0.6956 0.0725  -0.1106 -0.0523 107 LYS A CA  
278  C C   . LYS A 61  ? 0.7594 0.8308 0.6757 0.0753  -0.0930 -0.0315 107 LYS A C   
279  O O   . LYS A 61  ? 0.7684 0.8355 0.6590 0.0870  -0.0944 -0.0190 107 LYS A O   
280  C CB  . LYS A 61  ? 0.7404 0.8405 0.7188 0.0659  -0.1135 -0.0529 107 LYS A CB  
281  C CG  . LYS A 61  ? 0.7572 0.8590 0.7344 0.0760  -0.1152 -0.0381 107 LYS A CG  
282  C CD  . LYS A 61  ? 0.7528 0.8661 0.7716 0.0695  -0.1144 -0.0394 107 LYS A CD  
283  C CE  . LYS A 61  ? 0.7798 0.8884 0.7962 0.0794  -0.1117 -0.0236 107 LYS A CE  
284  N NZ  . LYS A 61  ? 0.7801 0.8968 0.8339 0.0733  -0.1061 -0.0240 107 LYS A NZ  
285  N N   . LEU A 62  ? 0.7435 0.8055 0.6722 0.0644  -0.0768 -0.0278 108 LEU A N   
286  C CA  . LEU A 62  ? 0.7465 0.7950 0.6648 0.0638  -0.0603 -0.0099 108 LEU A CA  
287  C C   . LEU A 62  ? 0.7801 0.8213 0.6675 0.0675  -0.0504 -0.0060 108 LEU A C   
288  O O   . LEU A 62  ? 0.7990 0.8309 0.6769 0.0668  -0.0365 0.0090  108 LEU A O   
289  C CB  . LEU A 62  ? 0.7158 0.7607 0.6637 0.0514  -0.0493 -0.0082 108 LEU A CB  
290  C CG  . LEU A 62  ? 0.7073 0.7591 0.6848 0.0483  -0.0550 -0.0099 108 LEU A CG  
291  C CD1 . LEU A 62  ? 0.6890 0.7366 0.6903 0.0373  -0.0439 -0.0095 108 LEU A CD1 
292  C CD2 . LEU A 62  ? 0.7189 0.7676 0.6899 0.0572  -0.0579 0.0026  108 LEU A CD2 
293  N N   . GLY A 63  ? 0.7929 0.8384 0.6655 0.0713  -0.0570 -0.0200 109 GLY A N   
294  C CA  . GLY A 63  ? 0.8221 0.8626 0.6637 0.0769  -0.0472 -0.0182 109 GLY A CA  
295  C C   . GLY A 63  ? 0.8056 0.8416 0.6598 0.0682  -0.0300 -0.0162 109 GLY A C   
296  O O   . GLY A 63  ? 0.8180 0.8505 0.6575 0.0700  -0.0152 -0.0041 109 GLY A O   
297  N N   . LEU A 64  ? 0.7765 0.8133 0.6587 0.0591  -0.0317 -0.0276 110 LEU A N   
298  C CA  . LEU A 64  ? 0.7537 0.7868 0.6509 0.0519  -0.0179 -0.0262 110 LEU A CA  
299  C C   . LEU A 64  ? 0.7591 0.7897 0.6566 0.0521  -0.0200 -0.0436 110 LEU A C   
300  O O   . LEU A 64  ? 0.7435 0.7708 0.6650 0.0445  -0.0225 -0.0513 110 LEU A O   
301  C CB  . LEU A 64  ? 0.7242 0.7563 0.6532 0.0419  -0.0165 -0.0213 110 LEU A CB  
302  C CG  . LEU A 64  ? 0.7112 0.7428 0.6439 0.0415  -0.0166 -0.0072 110 LEU A CG  
303  C CD1 . LEU A 64  ? 0.6858 0.7165 0.6481 0.0330  -0.0160 -0.0064 110 LEU A CD1 
304  C CD2 . LEU A 64  ? 0.6950 0.7228 0.6127 0.0432  -0.0038 0.0079  110 LEU A CD2 
305  N N   . PRO A 65  ? 0.7900 0.8201 0.6591 0.0615  -0.0182 -0.0498 111 PRO A N   
306  C CA  . PRO A 65  ? 0.8032 0.8276 0.6694 0.0634  -0.0217 -0.0687 111 PRO A CA  
307  C C   . PRO A 65  ? 0.7804 0.7987 0.6657 0.0588  -0.0104 -0.0700 111 PRO A C   
308  O O   . PRO A 65  ? 0.7945 0.8035 0.6850 0.0581  -0.0143 -0.0851 111 PRO A O   
309  C CB  . PRO A 65  ? 0.8404 0.8663 0.6675 0.0768  -0.0189 -0.0719 111 PRO A CB  
310  C CG  . PRO A 65  ? 0.8475 0.8790 0.6639 0.0794  -0.0053 -0.0505 111 PRO A CG  
311  C CD  . PRO A 65  ? 0.8148 0.8477 0.6520 0.0712  -0.0106 -0.0389 111 PRO A CD  
312  N N   . ASP A 66  ? 0.7486 0.7711 0.6439 0.0561  0.0027  -0.0547 112 ASP A N   
313  C CA  . ASP A 66  ? 0.7295 0.7486 0.6435 0.0532  0.0118  -0.0546 112 ASP A CA  
314  C C   . ASP A 66  ? 0.6824 0.6978 0.6251 0.0427  0.0089  -0.0505 112 ASP A C   
315  O O   . ASP A 66  ? 0.6604 0.6718 0.6172 0.0411  0.0149  -0.0496 112 ASP A O   
316  C CB  . ASP A 66  ? 0.7342 0.7633 0.6450 0.0566  0.0272  -0.0422 112 ASP A CB  
317  C CG  . ASP A 66  ? 0.7394 0.7753 0.6573 0.0504  0.0306  -0.0254 112 ASP A CG  
318  O OD1 . ASP A 66  ? 0.7512 0.7845 0.6675 0.0473  0.0215  -0.0227 112 ASP A OD1 
319  O OD2 . ASP A 66  ? 0.7678 0.8120 0.6943 0.0487  0.0421  -0.0155 112 ASP A OD2 
320  N N   . TYR A 67  ? 0.6598 0.6769 0.6099 0.0372  0.0002  -0.0478 113 TYR A N   
321  C CA  . TYR A 67  ? 0.6243 0.6398 0.5990 0.0287  0.0002  -0.0419 113 TYR A CA  
322  C C   . TYR A 67  ? 0.6184 0.6233 0.6085 0.0248  0.0007  -0.0496 113 TYR A C   
323  O O   . TYR A 67  ? 0.5987 0.6008 0.6006 0.0225  0.0074  -0.0431 113 TYR A O   
324  C CB  . TYR A 67  ? 0.6121 0.6321 0.5939 0.0250  -0.0094 -0.0401 113 TYR A CB  
325  C CG  . TYR A 67  ? 0.5868 0.6062 0.5908 0.0180  -0.0067 -0.0329 113 TYR A CG  
326  C CD1 . TYR A 67  ? 0.5810 0.6027 0.5864 0.0174  -0.0005 -0.0203 113 TYR A CD1 
327  C CD2 . TYR A 67  ? 0.5824 0.5976 0.6054 0.0118  -0.0092 -0.0390 113 TYR A CD2 
328  C CE1 . TYR A 67  ? 0.5721 0.5923 0.5944 0.0124  0.0017  -0.0154 113 TYR A CE1 
329  C CE2 . TYR A 67  ? 0.5781 0.5926 0.6178 0.0069  -0.0050 -0.0320 113 TYR A CE2 
330  C CZ  . TYR A 67  ? 0.5611 0.5783 0.5988 0.0080  -0.0002 -0.0210 113 TYR A CZ  
331  O OH  . TYR A 67  ? 0.5514 0.5672 0.6021 0.0046  0.0034  -0.0158 113 TYR A OH  
332  N N   . HIS A 68  ? 0.6350 0.6325 0.6239 0.0243  -0.0066 -0.0636 114 HIS A N   
333  C CA  . HIS A 68  ? 0.6427 0.6255 0.6464 0.0196  -0.0055 -0.0704 114 HIS A CA  
334  C C   . HIS A 68  ? 0.6544 0.6264 0.6502 0.0267  0.0026  -0.0730 114 HIS A C   
335  O O   . HIS A 68  ? 0.6683 0.6252 0.6745 0.0246  0.0056  -0.0751 114 HIS A O   
336  C CB  . HIS A 68  ? 0.6629 0.6407 0.6732 0.0141  -0.0167 -0.0852 114 HIS A CB  
337  C CG  . HIS A 68  ? 0.6588 0.6491 0.6847 0.0071  -0.0242 -0.0827 114 HIS A CG  
338  N ND1 . HIS A 68  ? 0.6753 0.6650 0.7251 -0.0015 -0.0204 -0.0763 114 HIS A ND1 
339  C CD2 . HIS A 68  ? 0.6969 0.7012 0.7172 0.0092  -0.0348 -0.0854 114 HIS A CD2 
340  C CE1 . HIS A 68  ? 0.6856 0.6900 0.7465 -0.0047 -0.0279 -0.0758 114 HIS A CE1 
341  N NE2 . HIS A 68  ? 0.6850 0.6983 0.7287 0.0020  -0.0376 -0.0812 114 HIS A NE2 
342  N N   . LYS A 69  ? 0.6664 0.6462 0.6441 0.0359  0.0072  -0.0718 115 LYS A N   
343  C CA  . LYS A 69  ? 0.6784 0.6538 0.6516 0.0446  0.0162  -0.0723 115 LYS A CA  
344  C C   . LYS A 69  ? 0.6541 0.6373 0.6403 0.0439  0.0239  -0.0579 115 LYS A C   
345  O O   . LYS A 69  ? 0.6566 0.6330 0.6484 0.0488  0.0289  -0.0573 115 LYS A O   
346  C CB  . LYS A 69  ? 0.7078 0.6919 0.6583 0.0550  0.0199  -0.0765 115 LYS A CB  
347  C CG  . LYS A 69  ? 0.7695 0.7438 0.7032 0.0584  0.0113  -0.0938 115 LYS A CG  
348  C CD  . LYS A 69  ? 0.8157 0.7991 0.7221 0.0702  0.0160  -0.0971 115 LYS A CD  
349  C CE  . LYS A 69  ? 0.8709 0.8435 0.7574 0.0748  0.0056  -0.1168 115 LYS A CE  
350  N NZ  . LYS A 69  ? 0.8800 0.8528 0.7714 0.0655  -0.0096 -0.1213 115 LYS A NZ  
351  N N   . ILE A 70  ? 0.6140 0.6106 0.6045 0.0387  0.0239  -0.0472 116 ILE A N   
352  C CA  . ILE A 70  ? 0.5913 0.5961 0.5939 0.0371  0.0291  -0.0355 116 ILE A CA  
353  C C   . ILE A 70  ? 0.5661 0.5622 0.5827 0.0303  0.0262  -0.0319 116 ILE A C   
354  O O   . ILE A 70  ? 0.5577 0.5516 0.5815 0.0324  0.0294  -0.0274 116 ILE A O   
355  C CB  . ILE A 70  ? 0.5856 0.6060 0.5856 0.0345  0.0315  -0.0262 116 ILE A CB  
356  C CG1 . ILE A 70  ? 0.6267 0.6570 0.6132 0.0419  0.0384  -0.0273 116 ILE A CG1 
357  C CG2 . ILE A 70  ? 0.5690 0.5967 0.5838 0.0308  0.0343  -0.0166 116 ILE A CG2 
358  C CD1 . ILE A 70  ? 0.6529 0.6955 0.6353 0.0390  0.0429  -0.0168 116 ILE A CD1 
359  N N   . ILE A 71  ? 0.5608 0.5534 0.5807 0.0234  0.0202  -0.0337 117 ILE A N   
360  C CA  . ILE A 71  ? 0.5464 0.5331 0.5797 0.0169  0.0194  -0.0296 117 ILE A CA  
361  C C   . ILE A 71  ? 0.5840 0.5544 0.6228 0.0139  0.0179  -0.0378 117 ILE A C   
362  O O   . ILE A 71  ? 0.6017 0.5709 0.6417 0.0101  0.0118  -0.0467 117 ILE A O   
363  C CB  . ILE A 71  ? 0.5411 0.5372 0.5785 0.0115  0.0151  -0.0256 117 ILE A CB  
364  C CG1 . ILE A 71  ? 0.5152 0.5223 0.5480 0.0133  0.0176  -0.0170 117 ILE A CG1 
365  C CG2 . ILE A 71  ? 0.5290 0.5209 0.5802 0.0058  0.0157  -0.0224 117 ILE A CG2 
366  C CD1 . ILE A 71  ? 0.4892 0.4973 0.5272 0.0144  0.0225  -0.0108 117 ILE A CD1 
367  N N   . LYS A 72  ? 0.5962 0.5536 0.6387 0.0157  0.0232  -0.0347 118 LYS A N   
368  C CA  . LYS A 72  ? 0.6404 0.5772 0.6876 0.0129  0.0240  -0.0413 118 LYS A CA  
369  C C   . LYS A 72  ? 0.6266 0.5580 0.6890 0.0029  0.0257  -0.0374 118 LYS A C   
370  O O   . LYS A 72  ? 0.6332 0.5508 0.7048 -0.0037 0.0254  -0.0440 118 LYS A O   
371  C CB  . LYS A 72  ? 0.6728 0.5945 0.7137 0.0220  0.0297  -0.0391 118 LYS A CB  
372  C CG  . LYS A 72  ? 0.7163 0.6439 0.7451 0.0328  0.0296  -0.0447 118 LYS A CG  
373  C CD  . LYS A 72  ? 0.7669 0.6936 0.7894 0.0313  0.0241  -0.0585 118 LYS A CD  
374  C CE  . LYS A 72  ? 0.8149 0.7383 0.8239 0.0434  0.0263  -0.0666 118 LYS A CE  
375  N NZ  . LYS A 72  ? 0.8530 0.7771 0.8513 0.0427  0.0200  -0.0805 118 LYS A NZ  
376  N N   . GLN A 73  ? 0.6019 0.5445 0.6679 0.0015  0.0279  -0.0275 119 GLN A N   
377  C CA  . GLN A 73  ? 0.6008 0.5426 0.6810 -0.0067 0.0313  -0.0232 119 GLN A CA  
378  C C   . GLN A 73  ? 0.5611 0.5231 0.6463 -0.0090 0.0270  -0.0216 119 GLN A C   
379  O O   . GLN A 73  ? 0.5279 0.4959 0.6097 -0.0061 0.0300  -0.0134 119 GLN A O   
380  C CB  . GLN A 73  ? 0.6203 0.5512 0.6968 -0.0035 0.0404  -0.0118 119 GLN A CB  
381  C CG  . GLN A 73  ? 0.6781 0.6067 0.7684 -0.0116 0.0472  -0.0067 119 GLN A CG  
382  C CD  . GLN A 73  ? 0.7205 0.6411 0.8010 -0.0061 0.0561  0.0057  119 GLN A CD  
383  O OE1 . GLN A 73  ? 0.7944 0.7082 0.8593 0.0036  0.0562  0.0099  119 GLN A OE1 
384  N NE2 . GLN A 73  ? 0.7197 0.6426 0.8091 -0.0113 0.0636  0.0114  119 GLN A NE2 
385  N N   . PRO A 74  ? 0.5605 0.5322 0.6529 -0.0132 0.0192  -0.0301 120 PRO A N   
386  C CA  . PRO A 74  ? 0.5504 0.5397 0.6480 -0.0138 0.0147  -0.0281 120 PRO A CA  
387  C C   . PRO A 74  ? 0.5389 0.5315 0.6519 -0.0182 0.0211  -0.0221 120 PRO A C   
388  O O   . PRO A 74  ? 0.5375 0.5219 0.6631 -0.0244 0.0273  -0.0222 120 PRO A O   
389  C CB  . PRO A 74  ? 0.5602 0.5577 0.6634 -0.0166 0.0041  -0.0396 120 PRO A CB  
390  C CG  . PRO A 74  ? 0.5946 0.5784 0.6887 -0.0158 0.0026  -0.0484 120 PRO A CG  
391  C CD  . PRO A 74  ? 0.5898 0.5559 0.6861 -0.0170 0.0131  -0.0428 120 PRO A CD  
392  N N   . MET A 75  ? 0.5122 0.5153 0.6239 -0.0147 0.0209  -0.0166 121 MET A N   
393  C CA  . MET A 75  ? 0.5034 0.5118 0.6283 -0.0168 0.0275  -0.0118 121 MET A CA  
394  C C   . MET A 75  ? 0.5030 0.5254 0.6293 -0.0125 0.0222  -0.0109 121 MET A C   
395  O O   . MET A 75  ? 0.4936 0.5164 0.6058 -0.0076 0.0165  -0.0100 121 MET A O   
396  C CB  . MET A 75  ? 0.5109 0.5074 0.6252 -0.0138 0.0378  -0.0032 121 MET A CB  
397  C CG  . MET A 75  ? 0.5131 0.5125 0.6371 -0.0151 0.0478  0.0023  121 MET A CG  
398  S SD  . MET A 75  ? 0.5517 0.5565 0.7053 -0.0261 0.0537  -0.0007 121 MET A SD  
399  C CE  . MET A 75  ? 0.5388 0.5200 0.6874 -0.0310 0.0577  -0.0008 121 MET A CE  
400  N N   . ASP A 76  ? 0.4988 0.5323 0.6432 -0.0142 0.0251  -0.0107 122 ASP A N   
401  C CA  . ASP A 76  ? 0.4983 0.5449 0.6469 -0.0086 0.0198  -0.0106 122 ASP A CA  
402  C C   . ASP A 76  ? 0.4980 0.5535 0.6637 -0.0086 0.0289  -0.0080 122 ASP A C   
403  O O   . ASP A 76  ? 0.5044 0.5596 0.6831 -0.0151 0.0381  -0.0072 122 ASP A O   
404  C CB  . ASP A 76  ? 0.4980 0.5573 0.6557 -0.0091 0.0071  -0.0181 122 ASP A CB  
405  C CG  . ASP A 76  ? 0.5201 0.5919 0.7060 -0.0172 0.0067  -0.0252 122 ASP A CG  
406  O OD1 . ASP A 76  ? 0.5466 0.6100 0.7355 -0.0250 0.0080  -0.0296 122 ASP A OD1 
407  O OD2 . ASP A 76  ? 0.5157 0.6058 0.7227 -0.0160 0.0055  -0.0267 122 ASP A OD2 
408  N N   A MET A 77  ? 0.5004 0.5629 0.6661 -0.0009 0.0276  -0.0063 123 MET A N   
409  N N   B MET A 77  ? 0.5014 0.5636 0.6664 -0.0007 0.0274  -0.0062 123 MET A N   
410  C CA  A MET A 77  ? 0.5032 0.5747 0.6825 0.0018  0.0377  -0.0041 123 MET A CA  
411  C CA  B MET A 77  ? 0.5048 0.5769 0.6840 0.0024  0.0366  -0.0043 123 MET A CA  
412  C C   A MET A 77  ? 0.5036 0.5974 0.7163 -0.0030 0.0387  -0.0086 123 MET A C   
413  C C   B MET A 77  ? 0.5042 0.5966 0.7161 -0.0039 0.0389  -0.0085 123 MET A C   
414  O O   A MET A 77  ? 0.5104 0.6127 0.7380 -0.0035 0.0510  -0.0062 123 MET A O   
415  O O   B MET A 77  ? 0.5097 0.6072 0.7350 -0.0067 0.0524  -0.0056 123 MET A O   
416  C CB  A MET A 77  ? 0.5086 0.5790 0.6778 0.0128  0.0356  -0.0024 123 MET A CB  
417  C CB  B MET A 77  ? 0.5111 0.5869 0.6860 0.0133  0.0317  -0.0040 123 MET A CB  
418  C CG  A MET A 77  ? 0.5158 0.5662 0.6579 0.0162  0.0385  0.0013  123 MET A CG  
419  C CG  B MET A 77  ? 0.5197 0.5762 0.6670 0.0188  0.0305  -0.0005 123 MET A CG  
420  S SD  A MET A 77  ? 0.5144 0.5596 0.6470 0.0279  0.0380  0.0014  123 MET A SD  
421  S SD  B MET A 77  ? 0.5320 0.5887 0.6778 0.0314  0.0277  -0.0005 123 MET A SD  
422  C CE  A MET A 77  ? 0.5291 0.5699 0.6554 0.0302  0.0234  0.0015  123 MET A CE  
423  C CE  B MET A 77  ? 0.5693 0.6303 0.7211 0.0351  0.0432  -0.0004 123 MET A CE  
424  N N   . GLY A 78  ? 0.5010 0.6058 0.7260 -0.0061 0.0258  -0.0154 124 GLY A N   
425  C CA  . GLY A 78  ? 0.5058 0.6340 0.7667 -0.0130 0.0245  -0.0219 124 GLY A CA  
426  C C   . GLY A 78  ? 0.5124 0.6347 0.7865 -0.0264 0.0363  -0.0214 124 GLY A C   
427  O O   . GLY A 78  ? 0.5195 0.6562 0.8214 -0.0320 0.0475  -0.0205 124 GLY A O   
428  N N   . THR A 79  ? 0.5070 0.6073 0.7611 -0.0310 0.0351  -0.0212 125 THR A N   
429  C CA  . THR A 79  ? 0.5185 0.6044 0.7779 -0.0419 0.0467  -0.0189 125 THR A CA  
430  C C   . THR A 79  ? 0.5334 0.6110 0.7863 -0.0399 0.0659  -0.0073 125 THR A C   
431  O O   . THR A 79  ? 0.5377 0.6167 0.8103 -0.0487 0.0794  -0.0039 125 THR A O   
432  C CB  . THR A 79  ? 0.5233 0.5853 0.7569 -0.0426 0.0410  -0.0204 125 THR A CB  
433  O OG1 . THR A 79  ? 0.5216 0.5910 0.7595 -0.0442 0.0245  -0.0319 125 THR A OG1 
434  C CG2 . THR A 79  ? 0.5373 0.5793 0.7729 -0.0516 0.0529  -0.0168 125 THR A CG2 
435  N N   . ILE A 80  ? 0.5351 0.6037 0.7600 -0.0285 0.0673  -0.0014 126 ILE A N   
436  C CA  . ILE A 80  ? 0.5542 0.6143 0.7664 -0.0240 0.0836  0.0083  126 ILE A CA  
437  C C   . ILE A 80  ? 0.5666 0.6483 0.8038 -0.0233 0.0946  0.0096  126 ILE A C   
438  O O   . ILE A 80  ? 0.5763 0.6561 0.8192 -0.0268 0.1121  0.0168  126 ILE A O   
439  C CB  . ILE A 80  ? 0.5476 0.5954 0.7263 -0.0120 0.0799  0.0113  126 ILE A CB  
440  C CG1 . ILE A 80  ? 0.5491 0.5784 0.7062 -0.0125 0.0720  0.0111  126 ILE A CG1 
441  C CG2 . ILE A 80  ? 0.5610 0.6020 0.7249 -0.0056 0.0951  0.0193  126 ILE A CG2 
442  C CD1 . ILE A 80  ? 0.5424 0.5640 0.6733 -0.0031 0.0655  0.0119  126 ILE A CD1 
443  N N   . LYS A 81  ? 0.5688 0.6711 0.8204 -0.0179 0.0850  0.0032  127 LYS A N   
444  C CA  . LYS A 81  ? 0.5816 0.7094 0.8614 -0.0155 0.0934  0.0026  127 LYS A CA  
445  C C   . LYS A 81  ? 0.5995 0.7433 0.9180 -0.0302 0.1021  0.0014  127 LYS A C   
446  O O   . LYS A 81  ? 0.6087 0.7631 0.9438 -0.0321 0.1206  0.0070  127 LYS A O   
447  C CB  . LYS A 81  ? 0.5742 0.7200 0.8633 -0.0064 0.0776  -0.0047 127 LYS A CB  
448  C CG  . LYS A 81  ? 0.6044 0.7795 0.9241 -0.0006 0.0841  -0.0066 127 LYS A CG  
449  C CD  . LYS A 81  ? 0.6091 0.7939 0.9274 0.0130  0.0680  -0.0117 127 LYS A CD  
450  C CE  . LYS A 81  ? 0.6373 0.8528 0.9873 0.0215  0.0731  -0.0142 127 LYS A CE  
451  N NZ  . LYS A 81  ? 0.6443 0.8921 1.0409 0.0106  0.0711  -0.0201 127 LYS A NZ  
452  N N   . ARG A 82  ? 0.6072 0.7525 0.9402 -0.0407 0.0892  -0.0062 128 ARG A N   
453  C CA  . ARG A 82  ? 0.6324 0.7901 1.0043 -0.0573 0.0950  -0.0096 128 ARG A CA  
454  C C   . ARG A 82  ? 0.6439 0.7787 1.0086 -0.0660 0.1161  0.0015  128 ARG A C   
455  O O   . ARG A 82  ? 0.6496 0.7962 1.0459 -0.0769 0.1321  0.0049  128 ARG A O   
456  C CB  . ARG A 82  ? 0.6427 0.8007 1.0239 -0.0656 0.0748  -0.0220 128 ARG A CB  
457  C CG  . ARG A 82  ? 0.7002 0.8775 1.1288 -0.0828 0.0752  -0.0303 128 ARG A CG  
458  C CD  . ARG A 82  ? 0.7484 0.9287 1.1830 -0.0879 0.0515  -0.0457 128 ARG A CD  
459  N NE  . ARG A 82  ? 0.7931 0.9377 1.1928 -0.0891 0.0478  -0.0455 128 ARG A NE  
460  C CZ  . ARG A 82  ? 0.8152 0.9487 1.1823 -0.0791 0.0318  -0.0497 128 ARG A CZ  
461  N NH1 . ARG A 82  ? 0.8213 0.9733 1.1827 -0.0671 0.0169  -0.0539 128 ARG A NH1 
462  N NH2 . ARG A 82  ? 0.8302 0.9333 1.1700 -0.0805 0.0316  -0.0491 128 ARG A NH2 
463  N N   . ARG A 83  ? 0.6413 0.7444 0.9651 -0.0608 0.1167  0.0078  129 ARG A N   
464  C CA  . ARG A 83  ? 0.6579 0.7354 0.9669 -0.0651 0.1353  0.0200  129 ARG A CA  
465  C C   . ARG A 83  ? 0.6674 0.7491 0.9694 -0.0578 0.1567  0.0319  129 ARG A C   
466  O O   . ARG A 83  ? 0.6883 0.7620 0.9975 -0.0653 0.1770  0.0421  129 ARG A O   
467  C CB  . ARG A 83  ? 0.6583 0.7047 0.9261 -0.0585 0.1278  0.0227  129 ARG A CB  
468  C CG  . ARG A 83  ? 0.6650 0.7001 0.9382 -0.0674 0.1140  0.0135  129 ARG A CG  
469  C CD  . ARG A 83  ? 0.6702 0.6794 0.9048 -0.0586 0.1069  0.0157  129 ARG A CD  
470  N NE  . ARG A 83  ? 0.6790 0.6761 0.9176 -0.0658 0.0959  0.0066  129 ARG A NE  
471  C CZ  . ARG A 83  ? 0.6973 0.6715 0.9092 -0.0603 0.0910  0.0072  129 ARG A CZ  
472  N NH1 . ARG A 83  ? 0.7015 0.6638 0.8823 -0.0483 0.0947  0.0165  129 ARG A NH1 
473  N NH2 . ARG A 83  ? 0.7234 0.6877 0.9405 -0.0664 0.0818  -0.0027 129 ARG A NH2 
474  N N   . LEU A 84  ? 0.6597 0.7522 0.9464 -0.0430 0.1529  0.0305  130 LEU A N   
475  C CA  . LEU A 84  ? 0.6710 0.7705 0.9505 -0.0337 0.1719  0.0388  130 LEU A CA  
476  C C   . LEU A 84  ? 0.6800 0.8106 1.0059 -0.0418 0.1859  0.0385  130 LEU A C   
477  O O   . LEU A 84  ? 0.7025 0.8332 1.0323 -0.0441 0.2096  0.0492  130 LEU A O   
478  C CB  . LEU A 84  ? 0.6593 0.7621 0.9145 -0.0162 0.1621  0.0343  130 LEU A CB  
479  C CG  . LEU A 84  ? 0.6462 0.7206 0.8552 -0.0073 0.1531  0.0362  130 LEU A CG  
480  C CD1 . LEU A 84  ? 0.6421 0.7202 0.8361 0.0058  0.1394  0.0287  130 LEU A CD1 
481  C CD2 . LEU A 84  ? 0.6548 0.7102 0.8342 -0.0022 0.1711  0.0482  130 LEU A CD2 
482  N N   . GLU A 85  ? 0.6657 0.8239 1.0267 -0.0453 0.1713  0.0266  131 GLU A N   
483  C CA  . GLU A 85  ? 0.6669 0.8612 1.0798 -0.0534 0.1809  0.0237  131 GLU A CA  
484  C C   . GLU A 85  ? 0.6894 0.8810 1.1316 -0.0742 0.1967  0.0292  131 GLU A C   
485  O O   . GLU A 85  ? 0.7001 0.9139 1.1757 -0.0806 0.2171  0.0341  131 GLU A O   
486  C CB  . GLU A 85  ? 0.6428 0.8650 1.0855 -0.0531 0.1572  0.0087  131 GLU A CB  
487  C CG  . GLU A 85  ? 0.6418 0.8731 1.0673 -0.0325 0.1460  0.0045  131 GLU A CG  
488  C CD  . GLU A 85  ? 0.6244 0.8704 1.0623 -0.0296 0.1187  -0.0080 131 GLU A CD  
489  O OE1 . GLU A 85  ? 0.6355 0.8861 1.0938 -0.0431 0.1069  -0.0152 131 GLU A OE1 
490  O OE2 . GLU A 85  ? 0.6136 0.8645 1.0385 -0.0131 0.1090  -0.0107 131 GLU A OE2 
491  N N   . ASN A 86  ? 0.6971 0.8610 1.1279 -0.0849 0.1884  0.0284  132 ASN A N   
492  C CA  . ASN A 86  ? 0.7282 0.8834 1.1867 -0.1058 0.2014  0.0325  132 ASN A CA  
493  C C   . ASN A 86  ? 0.7508 0.8686 1.1760 -0.1062 0.2234  0.0505  132 ASN A C   
494  O O   . ASN A 86  ? 0.7704 0.8688 1.2081 -0.1222 0.2319  0.0549  132 ASN A O   
495  C CB  . ASN A 86  ? 0.7321 0.8795 1.2035 -0.1180 0.1787  0.0186  132 ASN A CB  
496  C CG  . ASN A 86  ? 0.7371 0.9216 1.2413 -0.1177 0.1561  0.0010  132 ASN A CG  
497  O OD1 . ASN A 86  ? 0.7644 0.9436 1.2639 -0.1192 0.1330  -0.0114 132 ASN A OD1 
498  N ND2 . ASN A 86  ? 0.7624 0.9851 1.2986 -0.1141 0.1627  0.0000  132 ASN A ND2 
499  N N   . ASN A 87  ? 0.7577 0.8642 1.1398 -0.0881 0.2320  0.0604  133 ASN A N   
500  C CA  . ASN A 87  ? 0.7891 0.8610 1.1329 -0.0842 0.2513  0.0781  133 ASN A CA  
501  C C   . ASN A 87  ? 0.7953 0.8298 1.1215 -0.0913 0.2431  0.0798  133 ASN A C   
502  O O   . ASN A 87  ? 0.8258 0.8355 1.1494 -0.0999 0.2610  0.0929  133 ASN A O   
503  C CB  . ASN A 87  ? 0.8253 0.9056 1.1923 -0.0930 0.2834  0.0922  133 ASN A CB  
504  C CG  . ASN A 87  ? 0.8314 0.9472 1.2102 -0.0822 0.2949  0.0918  133 ASN A CG  
505  O OD1 . ASN A 87  ? 0.8373 0.9604 1.1912 -0.0641 0.2825  0.0851  133 ASN A OD1 
506  N ND2 . ASN A 87  ? 0.8603 0.9977 1.2785 -0.0935 0.3197  0.0989  133 ASN A ND2 
507  N N   . TYR A 88  ? 0.7735 0.8032 1.0872 -0.0869 0.2168  0.0670  134 TYR A N   
508  C CA  . TYR A 88  ? 0.7744 0.7715 1.0707 -0.0906 0.2064  0.0658  134 TYR A CA  
509  C C   . TYR A 88  ? 0.7821 0.7473 1.0262 -0.0756 0.2124  0.0793  134 TYR A C   
510  O O   . TYR A 88  ? 0.7955 0.7287 1.0261 -0.0788 0.2181  0.0874  134 TYR A O   
511  C CB  . TYR A 88  ? 0.7549 0.7616 1.0532 -0.0885 0.1779  0.0479  134 TYR A CB  
512  C CG  . TYR A 88  ? 0.7820 0.7581 1.0580 -0.0882 0.1656  0.0447  134 TYR A CG  
513  C CD1 . TYR A 88  ? 0.8236 0.7866 1.1225 -0.1038 0.1630  0.0382  134 TYR A CD1 
514  C CD2 . TYR A 88  ? 0.7873 0.7486 1.0212 -0.0722 0.1565  0.0468  134 TYR A CD2 
515  C CE1 . TYR A 88  ? 0.8409 0.7754 1.1186 -0.1016 0.1524  0.0343  134 TYR A CE1 
516  C CE2 . TYR A 88  ? 0.8001 0.7367 1.0157 -0.0704 0.1461  0.0436  134 TYR A CE2 
517  C CZ  . TYR A 88  ? 0.8352 0.7579 1.0715 -0.0841 0.1446  0.0375  134 TYR A CZ  
518  O OH  . TYR A 88  ? 0.8427 0.7405 1.0604 -0.0806 0.1352  0.0335  134 TYR A OH  
519  N N   . TYR A 89  ? 0.7708 0.7443 0.9860 -0.0584 0.2102  0.0810  135 TYR A N   
520  C CA  . TYR A 89  ? 0.7905 0.7387 0.9560 -0.0425 0.2114  0.0909  135 TYR A CA  
521  C C   . TYR A 89  ? 0.8445 0.7765 0.9928 -0.0396 0.2377  0.1100  135 TYR A C   
522  O O   . TYR A 89  ? 0.8493 0.7988 1.0133 -0.0420 0.2556  0.1152  135 TYR A O   
523  C CB  . TYR A 89  ? 0.7602 0.7224 0.9021 -0.0263 0.1987  0.0841  135 TYR A CB  
524  C CG  . TYR A 89  ? 0.7175 0.6917 0.8690 -0.0270 0.1740  0.0681  135 TYR A CG  
525  C CD1 . TYR A 89  ? 0.7055 0.6627 0.8449 -0.0271 0.1594  0.0641  135 TYR A CD1 
526  C CD2 . TYR A 89  ? 0.6844 0.6863 0.8551 -0.0259 0.1662  0.0580  135 TYR A CD2 
527  C CE1 . TYR A 89  ? 0.6709 0.6390 0.8166 -0.0272 0.1392  0.0509  135 TYR A CE1 
528  C CE2 . TYR A 89  ? 0.6662 0.6768 0.8420 -0.0255 0.1451  0.0456  135 TYR A CE2 
529  C CZ  . TYR A 89  ? 0.6534 0.6473 0.8161 -0.0266 0.1322  0.0424  135 TYR A CZ  
530  O OH  . TYR A 89  ? 0.6247 0.6275 0.7904 -0.0257 0.1134  0.0314  135 TYR A OH  
531  N N   . TRP A 90  ? 0.8883 0.7871 1.0032 -0.0329 0.2403  0.1210  136 TRP A N   
532  C CA  . TRP A 90  ? 0.9480 0.8258 1.0353 -0.0262 0.2639  0.1414  136 TRP A CA  
533  C C   . TRP A 90  ? 0.9420 0.8212 0.9829 -0.0039 0.2615  0.1446  136 TRP A C   
534  O O   . TRP A 90  ? 0.9673 0.8421 0.9865 0.0041  0.2818  0.1583  136 TRP A O   
535  C CB  . TRP A 90  ? 0.9955 0.8341 1.0687 -0.0284 0.2672  0.1524  136 TRP A CB  
536  C CG  . TRP A 90  ? 1.0598 0.8911 1.1771 -0.0513 0.2722  0.1498  136 TRP A CG  
537  C CD1 . TRP A 90  ? 1.0665 0.9251 1.2343 -0.0699 0.2751  0.1400  136 TRP A CD1 
538  C CD2 . TRP A 90  ? 1.1306 0.9245 1.2460 -0.0577 0.2744  0.1562  136 TRP A CD2 
539  N NE1 . TRP A 90  ? 1.0992 0.9403 1.2971 -0.0886 0.2778  0.1385  136 TRP A NE1 
540  C CE2 . TRP A 90  ? 1.1374 0.9368 1.3034 -0.0816 0.2781  0.1484  136 TRP A CE2 
541  C CE3 . TRP A 90  ? 1.1746 0.9308 1.2512 -0.0446 0.2728  0.1670  136 TRP A CE3 
542  C CZ2 . TRP A 90  ? 1.1742 0.9395 1.3518 -0.0938 0.2807  0.1503  136 TRP A CZ2 
543  C CZ3 . TRP A 90  ? 1.2120 0.9341 1.2995 -0.0550 0.2761  0.1702  136 TRP A CZ3 
544  C CH2 . TRP A 90  ? 1.2093 0.9347 1.3466 -0.0799 0.2802  0.1615  136 TRP A CH2 
545  N N   . ALA A 91  ? 0.8986 0.7840 0.9247 0.0058  0.2371  0.1314  137 ALA A N   
546  C CA  . ALA A 91  ? 0.8963 0.7837 0.8816 0.0255  0.2303  0.1303  137 ALA A CA  
547  C C   . ALA A 91  ? 0.8473 0.7581 0.8427 0.0274  0.2084  0.1113  137 ALA A C   
548  O O   . ALA A 91  ? 0.8119 0.7307 0.8348 0.0171  0.1942  0.1005  137 ALA A O   
549  C CB  . ALA A 91  ? 0.9204 0.7805 0.8659 0.0384  0.2230  0.1381  137 ALA A CB  
550  N N   . ALA A 92  ? 0.8396 0.7589 0.8104 0.0413  0.2058  0.1074  138 ALA A N   
551  C CA  . ALA A 92  ? 0.8078 0.7449 0.7847 0.0441  0.1866  0.0908  138 ALA A CA  
552  C C   . ALA A 92  ? 0.7838 0.7142 0.7541 0.0450  0.1637  0.0830  138 ALA A C   
553  O O   . ALA A 92  ? 0.7404 0.6834 0.7308 0.0393  0.1491  0.0711  138 ALA A O   
554  C CB  . ALA A 92  ? 0.8242 0.7657 0.7718 0.0596  0.1890  0.0880  138 ALA A CB  
555  N N   . SER A 93  ? 0.8041 0.7153 0.7462 0.0530  0.1612  0.0904  139 SER A N   
556  C CA  . SER A 93  ? 0.7876 0.6948 0.7254 0.0548  0.1412  0.0838  139 SER A CA  
557  C C   . SER A 93  ? 0.7590 0.6690 0.7302 0.0404  0.1353  0.0787  139 SER A C   
558  O O   . SER A 93  ? 0.7371 0.6545 0.7151 0.0391  0.1187  0.0686  139 SER A O   
559  C CB  . SER A 93  ? 0.8208 0.7076 0.7257 0.0671  0.1411  0.0941  139 SER A CB  
560  O OG  . SER A 93  ? 0.8550 0.7229 0.7622 0.0627  0.1577  0.1084  139 SER A OG  
561  N N   . GLU A 94  ? 0.7666 0.6708 0.7584 0.0295  0.1490  0.0852  140 GLU A N   
562  C CA  . GLU A 94  ? 0.7427 0.6485 0.7651 0.0158  0.1431  0.0786  140 GLU A CA  
563  C C   . GLU A 94  ? 0.7007 0.6309 0.7470 0.0096  0.1318  0.0649  140 GLU A C   
564  O O   . GLU A 94  ? 0.6786 0.6128 0.7349 0.0058  0.1177  0.0559  140 GLU A O   
565  C CB  . GLU A 94  ? 0.7734 0.6693 0.8164 0.0036  0.1604  0.0868  140 GLU A CB  
566  C CG  . GLU A 94  ? 0.8317 0.6975 0.8526 0.0085  0.1725  0.1021  140 GLU A CG  
567  C CD  . GLU A 94  ? 0.8710 0.7255 0.9142 -0.0055 0.1925  0.1115  140 GLU A CD  
568  O OE1 . GLU A 94  ? 0.8488 0.7232 0.9265 -0.0188 0.1971  0.1055  140 GLU A OE1 
569  O OE2 . GLU A 94  ? 0.9268 0.7523 0.9542 -0.0031 0.2036  0.1251  140 GLU A OE2 
570  N N   . CYS A 95  ? 0.6831 0.6289 0.7369 0.0101  0.1389  0.0641  141 CYS A N   
571  C CA  . CYS A 95  ? 0.6555 0.6229 0.7277 0.0079  0.1288  0.0527  141 CYS A CA  
572  C C   . CYS A 95  ? 0.6374 0.6056 0.6906 0.0164  0.1124  0.0457  141 CYS A C   
573  O O   . CYS A 95  ? 0.6089 0.5861 0.6746 0.0128  0.0995  0.0372  141 CYS A O   
574  C CB  . CYS A 95  ? 0.6592 0.6413 0.7400 0.0102  0.1415  0.0543  141 CYS A CB  
575  S SG  . CYS A 95  ? 0.6423 0.6477 0.7395 0.0129  0.1299  0.0418  141 CYS A SG  
576  N N   . MET A 96  ? 0.6530 0.6117 0.6761 0.0276  0.1129  0.0493  142 MET A N   
577  C CA  . MET A 96  ? 0.6424 0.6020 0.6497 0.0344  0.0974  0.0421  142 MET A CA  
578  C C   . MET A 96  ? 0.6237 0.5802 0.6357 0.0304  0.0854  0.0392  142 MET A C   
579  O O   . MET A 96  ? 0.5872 0.5513 0.6039 0.0292  0.0731  0.0315  142 MET A O   
580  C CB  . MET A 96  ? 0.6708 0.6213 0.6451 0.0472  0.0990  0.0456  142 MET A CB  
581  C CG  . MET A 96  ? 0.6960 0.6506 0.6605 0.0539  0.1086  0.0452  142 MET A CG  
582  S SD  . MET A 96  ? 0.7624 0.7041 0.6831 0.0702  0.1137  0.0511  142 MET A SD  
583  C CE  . MET A 96  ? 0.7431 0.6847 0.6491 0.0757  0.0899  0.0402  142 MET A CE  
584  N N   . GLN A 97  ? 0.6258 0.5701 0.6366 0.0287  0.0902  0.0456  143 GLN A N   
585  C CA  . GLN A 97  ? 0.6232 0.5643 0.6385 0.0264  0.0806  0.0423  143 GLN A CA  
586  C C   . GLN A 97  ? 0.5863 0.5383 0.6259 0.0162  0.0748  0.0344  143 GLN A C   
587  O O   . GLN A 97  ? 0.5695 0.5255 0.6107 0.0159  0.0645  0.0288  143 GLN A O   
588  C CB  . GLN A 97  ? 0.6445 0.5667 0.6539 0.0275  0.0876  0.0504  143 GLN A CB  
589  C CG  . GLN A 97  ? 0.7187 0.6276 0.6994 0.0403  0.0919  0.0599  143 GLN A CG  
590  C CD  . GLN A 97  ? 0.7325 0.6486 0.6971 0.0508  0.0779  0.0553  143 GLN A CD  
591  O OE1 . GLN A 97  ? 0.7326 0.6614 0.7086 0.0475  0.0665  0.0461  143 GLN A OE1 
592  N NE2 . GLN A 97  ? 0.7530 0.6616 0.6908 0.0635  0.0789  0.0617  143 GLN A NE2 
593  N N   . ASP A 98  ? 0.5753 0.5335 0.6339 0.0087  0.0816  0.0339  144 ASP A N   
594  C CA  . ASP A 98  ? 0.5617 0.5321 0.6422 0.0006  0.0743  0.0257  144 ASP A CA  
595  C C   . ASP A 98  ? 0.5419 0.5248 0.6208 0.0039  0.0643  0.0202  144 ASP A C   
596  O O   . ASP A 98  ? 0.5177 0.5052 0.6003 0.0019  0.0545  0.0148  144 ASP A O   
597  C CB  . ASP A 98  ? 0.5637 0.5413 0.6686 -0.0080 0.0826  0.0257  144 ASP A CB  
598  C CG  . ASP A 98  ? 0.6012 0.5657 0.7161 -0.0161 0.0891  0.0278  144 ASP A CG  
599  O OD1 . ASP A 98  ? 0.6086 0.5577 0.7116 -0.0142 0.0856  0.0280  144 ASP A OD1 
600  O OD2 . ASP A 98  ? 0.6366 0.6059 0.7731 -0.0245 0.0983  0.0291  144 ASP A OD2 
601  N N   . PHE A 99  ? 0.5478 0.5343 0.6197 0.0095  0.0673  0.0215  145 PHE A N   
602  C CA  . PHE A 99  ? 0.5426 0.5352 0.6105 0.0131  0.0583  0.0167  145 PHE A CA  
603  C C   . PHE A 99  ? 0.5460 0.5339 0.6016 0.0146  0.0492  0.0152  145 PHE A C   
604  O O   . PHE A 99  ? 0.5392 0.5317 0.5990 0.0125  0.0412  0.0117  145 PHE A O   
605  C CB  . PHE A 99  ? 0.5555 0.5476 0.6126 0.0204  0.0628  0.0171  145 PHE A CB  
606  C CG  . PHE A 99  ? 0.5443 0.5469 0.6169 0.0208  0.0693  0.0163  145 PHE A CG  
607  C CD1 . PHE A 99  ? 0.5727 0.5837 0.6569 0.0213  0.0619  0.0114  145 PHE A CD1 
608  C CD2 . PHE A 99  ? 0.5934 0.5976 0.6687 0.0220  0.0836  0.0211  145 PHE A CD2 
609  C CE1 . PHE A 99  ? 0.5634 0.5866 0.6638 0.0238  0.0672  0.0102  145 PHE A CE1 
610  C CE2 . PHE A 99  ? 0.5834 0.6014 0.6766 0.0231  0.0906  0.0199  145 PHE A CE2 
611  C CZ  . PHE A 99  ? 0.5801 0.6085 0.6867 0.0245  0.0817  0.0139  145 PHE A CZ  
612  N N   . ASN A 100 ? 0.5624 0.5421 0.6033 0.0190  0.0510  0.0184  146 ASN A N   
613  C CA  . ASN A 100 ? 0.5658 0.5450 0.5986 0.0211  0.0427  0.0167  146 ASN A CA  
614  C C   . ASN A 100 ? 0.5481 0.5300 0.5905 0.0164  0.0389  0.0147  146 ASN A C   
615  O O   . ASN A 100 ? 0.5310 0.5189 0.5748 0.0153  0.0322  0.0118  146 ASN A O   
616  C CB  . ASN A 100 ? 0.5913 0.5627 0.6076 0.0286  0.0448  0.0209  146 ASN A CB  
617  C CG  . ASN A 100 ? 0.6011 0.5768 0.6129 0.0318  0.0354  0.0181  146 ASN A CG  
618  O OD1 . ASN A 100 ? 0.6299 0.6121 0.6403 0.0322  0.0283  0.0134  146 ASN A OD1 
619  N ND2 . ASN A 100 ? 0.5769 0.5495 0.5887 0.0341  0.0354  0.0204  146 ASN A ND2 
620  N N   . THR A 101 ? 0.5390 0.5156 0.5877 0.0134  0.0439  0.0162  147 THR A N   
621  C CA  . THR A 101 ? 0.5398 0.5173 0.5955 0.0098  0.0403  0.0124  147 THR A CA  
622  C C   . THR A 101 ? 0.5226 0.5107 0.5864 0.0058  0.0344  0.0079  147 THR A C   
623  O O   . THR A 101 ? 0.5167 0.5087 0.5785 0.0058  0.0295  0.0054  147 THR A O   
624  C CB  . THR A 101 ? 0.5490 0.5169 0.6124 0.0056  0.0463  0.0128  147 THR A CB  
625  O OG1 . THR A 101 ? 0.5430 0.4969 0.5955 0.0109  0.0519  0.0187  147 THR A OG1 
626  C CG2 . THR A 101 ? 0.5444 0.5130 0.6142 0.0020  0.0411  0.0059  147 THR A CG2 
627  N N   . MET A 102 ? 0.5158 0.5089 0.5880 0.0035  0.0354  0.0076  148 MET A N   
628  C CA  . MET A 102 ? 0.5087 0.5107 0.5865 0.0022  0.0291  0.0046  148 MET A CA  
629  C C   . MET A 102 ? 0.5018 0.5046 0.5703 0.0046  0.0246  0.0058  148 MET A C   
630  O O   . MET A 102 ? 0.5071 0.5132 0.5741 0.0038  0.0201  0.0049  148 MET A O   
631  C CB  . MET A 102 ? 0.5094 0.5177 0.5983 0.0021  0.0312  0.0046  148 MET A CB  
632  C CG  . MET A 102 ? 0.5110 0.5270 0.6036 0.0037  0.0240  0.0029  148 MET A CG  
633  S SD  . MET A 102 ? 0.5232 0.5486 0.6310 0.0064  0.0270  0.0025  148 MET A SD  
634  C CE  . MET A 102 ? 0.5467 0.5623 0.6399 0.0124  0.0313  0.0053  148 MET A CE  
635  N N   . PHE A 103 ? 0.4996 0.4989 0.5616 0.0074  0.0261  0.0076  149 PHE A N   
636  C CA  . PHE A 103 ? 0.5074 0.5068 0.5646 0.0075  0.0219  0.0076  149 PHE A CA  
637  C C   . PHE A 103 ? 0.4992 0.5017 0.5540 0.0065  0.0204  0.0077  149 PHE A C   
638  O O   . PHE A 103 ? 0.4931 0.4988 0.5486 0.0042  0.0182  0.0085  149 PHE A O   
639  C CB  . PHE A 103 ? 0.5202 0.5152 0.5714 0.0106  0.0223  0.0068  149 PHE A CB  
640  C CG  . PHE A 103 ? 0.5400 0.5328 0.5932 0.0132  0.0245  0.0061  149 PHE A CG  
641  C CD1 . PHE A 103 ? 0.5539 0.5473 0.6130 0.0128  0.0217  0.0061  149 PHE A CD1 
642  C CD2 . PHE A 103 ? 0.5798 0.5700 0.6279 0.0176  0.0301  0.0060  149 PHE A CD2 
643  C CE1 . PHE A 103 ? 0.5880 0.5809 0.6507 0.0172  0.0238  0.0050  149 PHE A CE1 
644  C CE2 . PHE A 103 ? 0.5907 0.5812 0.6419 0.0213  0.0337  0.0049  149 PHE A CE2 
645  C CZ  . PHE A 103 ? 0.5915 0.5840 0.6513 0.0213  0.0302  0.0039  149 PHE A CZ  
646  N N   . THR A 104 ? 0.5016 0.5027 0.5536 0.0091  0.0226  0.0077  150 THR A N   
647  C CA  . THR A 104 ? 0.5077 0.5134 0.5589 0.0105  0.0216  0.0073  150 THR A CA  
648  C C   . THR A 104 ? 0.4905 0.4995 0.5436 0.0088  0.0220  0.0061  150 THR A C   
649  O O   . THR A 104 ? 0.4954 0.5119 0.5492 0.0085  0.0217  0.0063  150 THR A O   
650  C CB  . THR A 104 ? 0.5184 0.5191 0.5644 0.0163  0.0237  0.0084  150 THR A CB  
651  O OG1 . THR A 104 ? 0.5363 0.5359 0.5763 0.0195  0.0220  0.0091  150 THR A OG1 
652  C CG2 . THR A 104 ? 0.5319 0.5385 0.5788 0.0201  0.0228  0.0074  150 THR A CG2 
653  N N   . ASN A 105 ? 0.5044 0.5091 0.5587 0.0077  0.0228  0.0043  151 ASN A N   
654  C CA  . ASN A 105 ? 0.5005 0.5077 0.5533 0.0069  0.0213  0.0012  151 ASN A CA  
655  C C   . ASN A 105 ? 0.4978 0.5111 0.5477 0.0056  0.0194  0.0038  151 ASN A C   
656  O O   . ASN A 105 ? 0.4958 0.5137 0.5405 0.0067  0.0204  0.0038  151 ASN A O   
657  C CB  . ASN A 105 ? 0.5022 0.5060 0.5599 0.0044  0.0197  -0.0027 151 ASN A CB  
658  C CG  . ASN A 105 ? 0.5286 0.5229 0.5897 0.0041  0.0232  -0.0050 151 ASN A CG  
659  O OD1 . ASN A 105 ? 0.5374 0.5262 0.5938 0.0080  0.0262  -0.0037 151 ASN A OD1 
660  N ND2 . ASN A 105 ? 0.5081 0.5004 0.5786 -0.0003 0.0226  -0.0085 151 ASN A ND2 
661  N N   . CYS A 106 ? 0.4967 0.5087 0.5491 0.0039  0.0178  0.0066  152 CYS A N   
662  C CA  . CYS A 106 ? 0.4965 0.5095 0.5456 0.0028  0.0164  0.0105  152 CYS A CA  
663  C C   . CYS A 106 ? 0.4950 0.5114 0.5439 0.0006  0.0194  0.0138  152 CYS A C   
664  O O   . CYS A 106 ? 0.5030 0.5222 0.5469 0.0000  0.0216  0.0172  152 CYS A O   
665  C CB  . CYS A 106 ? 0.5100 0.5181 0.5624 0.0030  0.0142  0.0121  152 CYS A CB  
666  S SG  . CYS A 106 ? 0.5488 0.5518 0.5958 0.0030  0.0125  0.0183  152 CYS A SG  
667  N N   . TYR A 107 ? 0.4858 0.5034 0.5403 -0.0002 0.0197  0.0125  153 TYR A N   
668  C CA  . TYR A 107 ? 0.4773 0.5023 0.5376 -0.0034 0.0214  0.0139  153 TYR A CA  
669  C C   . TYR A 107 ? 0.4880 0.5237 0.5486 -0.0011 0.0255  0.0135  153 TYR A C   
670  O O   . TYR A 107 ? 0.4968 0.5409 0.5617 -0.0041 0.0296  0.0166  153 TYR A O   
671  C CB  . TYR A 107 ? 0.4697 0.4957 0.5352 -0.0031 0.0181  0.0106  153 TYR A CB  
672  C CG  . TYR A 107 ? 0.4926 0.5078 0.5555 -0.0035 0.0149  0.0094  153 TYR A CG  
673  C CD1 . TYR A 107 ? 0.5246 0.5317 0.5872 -0.0068 0.0145  0.0118  153 TYR A CD1 
674  C CD2 . TYR A 107 ? 0.4963 0.5084 0.5552 0.0010  0.0130  0.0062  153 TYR A CD2 
675  C CE1 . TYR A 107 ? 0.5284 0.5252 0.5885 -0.0053 0.0121  0.0097  153 TYR A CE1 
676  C CE2 . TYR A 107 ? 0.5223 0.5254 0.5772 0.0022  0.0115  0.0044  153 TYR A CE2 
677  C CZ  . TYR A 107 ? 0.5246 0.5205 0.5810 -0.0008 0.0109  0.0054  153 TYR A CZ  
678  O OH  . TYR A 107 ? 0.5542 0.5406 0.6066 0.0020  0.0099  0.0027  153 TYR A OH  
679  N N   . ILE A 108 ? 0.4947 0.5291 0.5512 0.0044  0.0255  0.0098  154 ILE A N   
680  C CA  . ILE A 108 ? 0.5027 0.5451 0.5585 0.0090  0.0294  0.0078  154 ILE A CA  
681  C C   . ILE A 108 ? 0.5094 0.5531 0.5559 0.0094  0.0328  0.0088  154 ILE A C   
682  O O   . ILE A 108 ? 0.5165 0.5707 0.5635 0.0106  0.0386  0.0104  154 ILE A O   
683  C CB  . ILE A 108 ? 0.5040 0.5394 0.5571 0.0152  0.0283  0.0033  154 ILE A CB  
684  C CG1 . ILE A 108 ? 0.4992 0.5357 0.5578 0.0177  0.0259  0.0038  154 ILE A CG1 
685  C CG2 . ILE A 108 ? 0.5065 0.5456 0.5560 0.0215  0.0321  -0.0003 154 ILE A CG2 
686  C CD1 . ILE A 108 ? 0.5133 0.5384 0.5670 0.0241  0.0260  0.0023  154 ILE A CD1 
687  N N   . TYR A 109 ? 0.5164 0.5511 0.5543 0.0091  0.0293  0.0080  155 TYR A N   
688  C CA  . TYR A 109 ? 0.5304 0.5657 0.5551 0.0117  0.0304  0.0077  155 TYR A CA  
689  C C   . TYR A 109 ? 0.5392 0.5774 0.5590 0.0090  0.0344  0.0165  155 TYR A C   
690  O O   . TYR A 109 ? 0.5363 0.5802 0.5465 0.0116  0.0407  0.0189  155 TYR A O   
691  C CB  . TYR A 109 ? 0.5405 0.5679 0.5594 0.0128  0.0232  0.0028  155 TYR A CB  
692  C CG  . TYR A 109 ? 0.5556 0.5844 0.5575 0.0171  0.0221  0.0014  155 TYR A CG  
693  C CD1 . TYR A 109 ? 0.5630 0.5935 0.5551 0.0225  0.0244  -0.0055 155 TYR A CD1 
694  C CD2 . TYR A 109 ? 0.5565 0.5840 0.5497 0.0175  0.0191  0.0073  155 TYR A CD2 
695  C CE1 . TYR A 109 ? 0.5922 0.6240 0.5643 0.0280  0.0234  -0.0074 155 TYR A CE1 
696  C CE2 . TYR A 109 ? 0.5946 0.6233 0.5677 0.0234  0.0177  0.0069  155 TYR A CE2 
697  C CZ  . TYR A 109 ? 0.6057 0.6371 0.5675 0.0285  0.0198  -0.0008 155 TYR A CZ  
698  O OH  . TYR A 109 ? 0.6395 0.6718 0.5773 0.0357  0.0181  -0.0022 155 TYR A OH  
699  N N   . ASN A 110 ? 0.5411 0.5735 0.5664 0.0042  0.0319  0.0215  156 ASN A N   
700  C CA  . ASN A 110 ? 0.5636 0.5923 0.5829 0.0015  0.0352  0.0309  156 ASN A CA  
701  C C   . ASN A 110 ? 0.5854 0.6207 0.6152 -0.0049 0.0436  0.0368  156 ASN A C   
702  O O   . ASN A 110 ? 0.5640 0.6085 0.6088 -0.0074 0.0443  0.0327  156 ASN A O   
703  C CB  . ASN A 110 ? 0.5541 0.5711 0.5745 0.0005  0.0287  0.0329  156 ASN A CB  
704  C CG  . ASN A 110 ? 0.5561 0.5710 0.5690 0.0065  0.0210  0.0280  156 ASN A CG  
705  O OD1 . ASN A 110 ? 0.5859 0.6008 0.5838 0.0115  0.0194  0.0298  156 ASN A OD1 
706  N ND2 . ASN A 110 ? 0.5233 0.5376 0.5465 0.0062  0.0163  0.0216  156 ASN A ND2 
707  N N   . LYS A 111 ? 0.6237 0.6549 0.6463 -0.0074 0.0498  0.0467  157 LYS A N   
708  C CA  . LYS A 111 ? 0.6498 0.6870 0.6859 -0.0161 0.0592  0.0534  157 LYS A CA  
709  C C   . LYS A 111 ? 0.6375 0.6663 0.6902 -0.0245 0.0543  0.0527  157 LYS A C   
710  O O   . LYS A 111 ? 0.6333 0.6472 0.6806 -0.0226 0.0467  0.0516  157 LYS A O   
711  C CB  . LYS A 111 ? 0.6883 0.7199 0.7095 -0.0166 0.0692  0.0663  157 LYS A CB  
712  C CG  . LYS A 111 ? 0.7405 0.7813 0.7422 -0.0075 0.0754  0.0667  157 LYS A CG  
713  C CD  . LYS A 111 ? 0.8023 0.8340 0.7823 -0.0057 0.0846  0.0808  157 LYS A CD  
714  C CE  . LYS A 111 ? 0.8376 0.8760 0.7909 0.0062  0.0882  0.0792  157 LYS A CE  
715  N NZ  . LYS A 111 ? 0.9070 0.9323 0.8303 0.0122  0.0921  0.0921  157 LYS A NZ  
716  N N   . PRO A 112 ? 0.6410 0.6805 0.7150 -0.0334 0.0582  0.0521  158 PRO A N   
717  C CA  . PRO A 112 ? 0.6456 0.6769 0.7350 -0.0419 0.0526  0.0492  158 PRO A CA  
718  C C   . PRO A 112 ? 0.6573 0.6635 0.7383 -0.0451 0.0524  0.0567  158 PRO A C   
719  O O   . PRO A 112 ? 0.6650 0.6582 0.7490 -0.0462 0.0444  0.0515  158 PRO A O   
720  C CB  . PRO A 112 ? 0.6440 0.6930 0.7577 -0.0523 0.0594  0.0499  158 PRO A CB  
721  C CG  . PRO A 112 ? 0.6413 0.7124 0.7552 -0.0455 0.0647  0.0482  158 PRO A CG  
722  C CD  . PRO A 112 ? 0.6402 0.7024 0.7266 -0.0350 0.0669  0.0519  158 PRO A CD  
723  N N   . THR A 113 ? 0.6725 0.6714 0.7408 -0.0449 0.0614  0.0689  159 THR A N   
724  C CA  . THR A 113 ? 0.7018 0.6751 0.7619 -0.0476 0.0633  0.0789  159 THR A CA  
725  C C   . THR A 113 ? 0.6963 0.6547 0.7325 -0.0347 0.0564  0.0812  159 THR A C   
726  O O   . THR A 113 ? 0.7158 0.6518 0.7423 -0.0335 0.0570  0.0902  159 THR A O   
727  C CB  . THR A 113 ? 0.7305 0.7021 0.7886 -0.0543 0.0786  0.0938  159 THR A CB  
728  O OG1 . THR A 113 ? 0.7423 0.7289 0.7834 -0.0454 0.0848  0.0972  159 THR A OG1 
729  C CG2 . THR A 113 ? 0.7334 0.7182 0.8222 -0.0699 0.0853  0.0921  159 THR A CG2 
730  N N   . ASP A 114 ? 0.6555 0.6262 0.6841 -0.0252 0.0498  0.0732  160 ASP A N   
731  C CA  . ASP A 114 ? 0.6512 0.6137 0.6623 -0.0136 0.0421  0.0733  160 ASP A CA  
732  C C   . ASP A 114 ? 0.6305 0.5793 0.6480 -0.0119 0.0336  0.0686  160 ASP A C   
733  O O   . ASP A 114 ? 0.6097 0.5621 0.6420 -0.0163 0.0305  0.0594  160 ASP A O   
734  C CB  . ASP A 114 ? 0.6312 0.6107 0.6372 -0.0064 0.0373  0.0643  160 ASP A CB  
735  C CG  . ASP A 114 ? 0.6659 0.6558 0.6582 -0.0035 0.0445  0.0681  160 ASP A CG  
736  O OD1 . ASP A 114 ? 0.6959 0.6795 0.6776 -0.0047 0.0533  0.0801  160 ASP A OD1 
737  O OD2 . ASP A 114 ? 0.6564 0.6594 0.6473 0.0005  0.0422  0.0593  160 ASP A OD2 
738  N N   . ASP A 115 ? 0.6326 0.5664 0.6375 -0.0039 0.0299  0.0747  161 ASP A N   
739  C CA  . ASP A 115 ? 0.6383 0.5604 0.6481 0.0009  0.0225  0.0700  161 ASP A CA  
740  C C   . ASP A 115 ? 0.6050 0.5427 0.6244 0.0040  0.0161  0.0568  161 ASP A C   
741  O O   . ASP A 115 ? 0.5916 0.5241 0.6203 0.0036  0.0135  0.0501  161 ASP A O   
742  C CB  . ASP A 115 ? 0.6634 0.5724 0.6578 0.0130  0.0183  0.0782  161 ASP A CB  
743  C CG  . ASP A 115 ? 0.7193 0.6039 0.7031 0.0111  0.0250  0.0931  161 ASP A CG  
744  O OD1 . ASP A 115 ? 0.7569 0.6342 0.7488 -0.0016 0.0335  0.0965  161 ASP A OD1 
745  O OD2 . ASP A 115 ? 0.7792 0.6516 0.7469 0.0226  0.0217  0.1019  161 ASP A OD2 
746  N N   . ILE A 116 ? 0.5881 0.5433 0.6043 0.0073  0.0143  0.0531  162 ILE A N   
747  C CA  . ILE A 116 ? 0.5722 0.5399 0.5975 0.0097  0.0097  0.0425  162 ILE A CA  
748  C C   . ILE A 116 ? 0.5484 0.5193 0.5854 0.0029  0.0122  0.0358  162 ILE A C   
749  O O   . ILE A 116 ? 0.5223 0.4953 0.5659 0.0050  0.0099  0.0292  162 ILE A O   
750  C CB  . ILE A 116 ? 0.5723 0.5550 0.5928 0.0128  0.0073  0.0388  162 ILE A CB  
751  C CG1 . ILE A 116 ? 0.5899 0.5818 0.6219 0.0152  0.0026  0.0297  162 ILE A CG1 
752  C CG2 . ILE A 116 ? 0.5468 0.5371 0.5656 0.0073  0.0133  0.0382  162 ILE A CG2 
753  C CD1 . ILE A 116 ? 0.6296 0.6329 0.6594 0.0188  -0.0027 0.0250  162 ILE A CD1 
754  N N   . VAL A 117 ? 0.5501 0.5224 0.5894 -0.0045 0.0170  0.0378  163 VAL A N   
755  C CA  . VAL A 117 ? 0.5474 0.5238 0.5974 -0.0101 0.0175  0.0315  163 VAL A CA  
756  C C   . VAL A 117 ? 0.5500 0.5124 0.6036 -0.0108 0.0145  0.0283  163 VAL A C   
757  O O   . VAL A 117 ? 0.5490 0.5136 0.6056 -0.0090 0.0119  0.0207  163 VAL A O   
758  C CB  . VAL A 117 ? 0.5477 0.5318 0.6034 -0.0178 0.0228  0.0343  163 VAL A CB  
759  C CG1 . VAL A 117 ? 0.5383 0.5274 0.6067 -0.0230 0.0206  0.0272  163 VAL A CG1 
760  C CG2 . VAL A 117 ? 0.5427 0.5413 0.5936 -0.0146 0.0259  0.0345  163 VAL A CG2 
761  N N   . LEU A 118 ? 0.5674 0.5134 0.6185 -0.0122 0.0154  0.0342  164 LEU A N   
762  C CA  . LEU A 118 ? 0.5848 0.5131 0.6377 -0.0118 0.0124  0.0303  164 LEU A CA  
763  C C   . LEU A 118 ? 0.5655 0.4934 0.6150 -0.0010 0.0090  0.0254  164 LEU A C   
764  O O   . LEU A 118 ? 0.5607 0.4839 0.6116 0.0010  0.0070  0.0174  164 LEU A O   
765  C CB  . LEU A 118 ? 0.6304 0.5376 0.6798 -0.0142 0.0149  0.0395  164 LEU A CB  
766  C CG  . LEU A 118 ? 0.7022 0.5850 0.7524 -0.0134 0.0122  0.0358  164 LEU A CG  
767  C CD1 . LEU A 118 ? 0.7471 0.6312 0.8074 -0.0215 0.0093  0.0239  164 LEU A CD1 
768  C CD2 . LEU A 118 ? 0.7731 0.6325 0.8198 -0.0172 0.0164  0.0475  164 LEU A CD2 
769  N N   . MET A 119 ? 0.5554 0.4900 0.6007 0.0061  0.0084  0.0297  165 MET A N   
770  C CA  . MET A 119 ? 0.5502 0.4899 0.5974 0.0156  0.0059  0.0255  165 MET A CA  
771  C C   . MET A 119 ? 0.5447 0.4981 0.5970 0.0147  0.0073  0.0178  165 MET A C   
772  O O   . MET A 119 ? 0.5531 0.5048 0.6071 0.0195  0.0080  0.0124  165 MET A O   
773  C CB  . MET A 119 ? 0.5537 0.5013 0.5980 0.0220  0.0032  0.0307  165 MET A CB  
774  C CG  . MET A 119 ? 0.5894 0.5205 0.6246 0.0263  0.0017  0.0401  165 MET A CG  
775  S SD  . MET A 119 ? 0.5950 0.5359 0.6205 0.0344  -0.0032 0.0470  165 MET A SD  
776  C CE  . MET A 119 ? 0.6250 0.5754 0.6614 0.0473  -0.0100 0.0413  165 MET A CE  
777  N N   . ALA A 120 ? 0.5189 0.4842 0.5719 0.0096  0.0087  0.0178  166 ALA A N   
778  C CA  . ALA A 120 ? 0.5205 0.4951 0.5760 0.0090  0.0106  0.0125  166 ALA A CA  
779  C C   . ALA A 120 ? 0.5275 0.4951 0.5807 0.0080  0.0105  0.0074  166 ALA A C   
780  O O   . ALA A 120 ? 0.5330 0.5019 0.5842 0.0125  0.0122  0.0032  166 ALA A O   
781  C CB  . ALA A 120 ? 0.5045 0.4895 0.5601 0.0047  0.0118  0.0136  166 ALA A CB  
782  N N   . GLN A 121 ? 0.5405 0.5012 0.5939 0.0022  0.0085  0.0073  167 GLN A N   
783  C CA  . GLN A 121 ? 0.5597 0.5145 0.6115 0.0007  0.0056  0.0001  167 GLN A CA  
784  C C   . GLN A 121 ? 0.5703 0.5122 0.6166 0.0076  0.0050  -0.0050 167 GLN A C   
785  O O   . GLN A 121 ? 0.5735 0.5148 0.6132 0.0117  0.0041  -0.0121 167 GLN A O   
786  C CB  . GLN A 121 ? 0.5814 0.5314 0.6398 -0.0089 0.0032  0.0003  167 GLN A CB  
787  C CG  . GLN A 121 ? 0.5941 0.5605 0.6595 -0.0148 0.0045  0.0031  167 GLN A CG  
788  C CD  . GLN A 121 ? 0.6811 0.6459 0.7574 -0.0255 0.0049  0.0052  167 GLN A CD  
789  O OE1 . GLN A 121 ? 0.7353 0.6877 0.8118 -0.0290 0.0081  0.0119  167 GLN A OE1 
790  N NE2 . GLN A 121 ? 0.7258 0.7040 0.8121 -0.0306 0.0020  0.0002  167 GLN A NE2 
791  N N   . THR A 122 ? 0.5671 0.4984 0.6143 0.0107  0.0055  -0.0014 168 THR A N   
792  C CA  . THR A 122 ? 0.5842 0.5030 0.6272 0.0192  0.0055  -0.0062 168 THR A CA  
793  C C   . THR A 122 ? 0.5815 0.5129 0.6230 0.0277  0.0100  -0.0086 168 THR A C   
794  O O   . THR A 122 ? 0.6052 0.5321 0.6394 0.0339  0.0115  -0.0158 168 THR A O   
795  C CB  . THR A 122 ? 0.5987 0.5046 0.6434 0.0230  0.0050  0.0000  168 THR A CB  
796  O OG1 . THR A 122 ? 0.5949 0.4867 0.6403 0.0139  0.0032  0.0039  168 THR A OG1 
797  C CG2 . THR A 122 ? 0.5964 0.4886 0.6377 0.0340  0.0052  -0.0056 168 THR A CG2 
798  N N   . LEU A 123 ? 0.5553 0.5022 0.6035 0.0278  0.0126  -0.0030 169 LEU A N   
799  C CA  . LEU A 123 ? 0.5515 0.5113 0.6027 0.0332  0.0184  -0.0039 169 LEU A CA  
800  C C   . LEU A 123 ? 0.5490 0.5120 0.5918 0.0320  0.0215  -0.0068 169 LEU A C   
801  O O   . LEU A 123 ? 0.5483 0.5132 0.5863 0.0384  0.0275  -0.0094 169 LEU A O   
802  C CB  . LEU A 123 ? 0.5334 0.5080 0.5959 0.0311  0.0190  0.0013  169 LEU A CB  
803  C CG  . LEU A 123 ? 0.5456 0.5206 0.6148 0.0352  0.0149  0.0045  169 LEU A CG  
804  C CD1 . LEU A 123 ? 0.5426 0.5327 0.6201 0.0319  0.0129  0.0074  169 LEU A CD1 
805  C CD2 . LEU A 123 ? 0.5579 0.5342 0.6332 0.0458  0.0173  0.0017  169 LEU A CD2 
806  N N   . GLU A 124 ? 0.5528 0.5168 0.5929 0.0251  0.0180  -0.0059 170 GLU A N   
807  C CA  . GLU A 124 ? 0.5684 0.5357 0.5994 0.0258  0.0194  -0.0077 170 GLU A CA  
808  C C   . GLU A 124 ? 0.5844 0.5423 0.6016 0.0309  0.0169  -0.0155 170 GLU A C   
809  O O   . GLU A 124 ? 0.5906 0.5500 0.5954 0.0367  0.0203  -0.0168 170 GLU A O   
810  C CB  . GLU A 124 ? 0.5595 0.5325 0.5930 0.0193  0.0156  -0.0054 170 GLU A CB  
811  C CG  . GLU A 124 ? 0.5957 0.5730 0.6207 0.0224  0.0177  -0.0048 170 GLU A CG  
812  C CD  . GLU A 124 ? 0.6183 0.6030 0.6481 0.0183  0.0156  -0.0018 170 GLU A CD  
813  O OE1 . GLU A 124 ? 0.6233 0.6109 0.6610 0.0126  0.0113  -0.0021 170 GLU A OE1 
814  O OE2 . GLU A 124 ? 0.6741 0.6606 0.6990 0.0216  0.0192  0.0013  170 GLU A OE2 
815  N N   A LYS A 125 ? 0.5941 0.5408 0.6119 0.0290  0.0109  -0.0207 171 LYS A N   
816  N N   B LYS A 125 ? 0.5956 0.5422 0.6135 0.0290  0.0109  -0.0207 171 LYS A N   
817  C CA  A LYS A 125 ? 0.6160 0.5517 0.6207 0.0336  0.0068  -0.0309 171 LYS A CA  
818  C CA  B LYS A 125 ? 0.6192 0.5543 0.6242 0.0340  0.0072  -0.0308 171 LYS A CA  
819  C C   A LYS A 125 ? 0.6269 0.5591 0.6219 0.0453  0.0145  -0.0335 171 LYS A C   
820  C C   B LYS A 125 ? 0.6270 0.5602 0.6224 0.0457  0.0154  -0.0327 171 LYS A C   
821  O O   A LYS A 125 ? 0.6421 0.5704 0.6198 0.0526  0.0147  -0.0404 171 LYS A O   
822  O O   B LYS A 125 ? 0.6362 0.5678 0.6145 0.0529  0.0167  -0.0382 171 LYS A O   
823  C CB  A LYS A 125 ? 0.6321 0.5533 0.6426 0.0273  -0.0007 -0.0361 171 LYS A CB  
824  C CB  B LYS A 125 ? 0.6367 0.5561 0.6473 0.0288  0.0007  -0.0356 171 LYS A CB  
825  C CG  A LYS A 125 ? 0.6332 0.5599 0.6529 0.0158  -0.0075 -0.0359 171 LYS A CG  
826  C CG  B LYS A 125 ? 0.6797 0.5830 0.6776 0.0343  -0.0038 -0.0484 171 LYS A CG  
827  C CD  A LYS A 125 ? 0.6570 0.5696 0.6875 0.0068  -0.0113 -0.0367 171 LYS A CD  
828  C CD  B LYS A 125 ? 0.7052 0.5895 0.7113 0.0269  -0.0100 -0.0525 171 LYS A CD  
829  C CE  A LYS A 125 ? 0.6640 0.5869 0.7083 -0.0055 -0.0148 -0.0345 171 LYS A CE  
830  C CE  B LYS A 125 ? 0.7465 0.6091 0.7408 0.0350  -0.0122 -0.0648 171 LYS A CE  
831  N NZ  A LYS A 125 ? 0.7054 0.6154 0.7616 -0.0152 -0.0138 -0.0296 171 LYS A NZ  
832  N NZ  B LYS A 125 ? 0.7633 0.6193 0.7484 0.0322  -0.0224 -0.0798 171 LYS A NZ  
833  N N   A ILE A 126 ? 0.6181 0.5538 0.6242 0.0480  0.0207  -0.0281 172 ILE A N   
834  N N   B ILE A 126 ? 0.6216 0.5568 0.6280 0.0485  0.0210  -0.0282 172 ILE A N   
835  C CA  A ILE A 126 ? 0.6259 0.5638 0.6283 0.0591  0.0300  -0.0295 172 ILE A CA  
836  C CA  B ILE A 126 ? 0.6300 0.5685 0.6332 0.0595  0.0306  -0.0292 172 ILE A CA  
837  C C   A ILE A 126 ? 0.6210 0.5724 0.6189 0.0613  0.0397  -0.0242 172 ILE A C   
838  C C   B ILE A 126 ? 0.6234 0.5749 0.6214 0.0613  0.0398  -0.0242 172 ILE A C   
839  O O   A ILE A 126 ? 0.6397 0.5906 0.6237 0.0705  0.0474  -0.0270 172 ILE A O   
840  O O   B ILE A 126 ? 0.6420 0.5926 0.6254 0.0704  0.0472  -0.0271 172 ILE A O   
841  C CB  A ILE A 126 ? 0.6198 0.5617 0.6395 0.0618  0.0327  -0.0255 172 ILE A CB  
842  C CB  B ILE A 126 ? 0.6250 0.5692 0.6464 0.0619  0.0336  -0.0245 172 ILE A CB  
843  C CG1 A ILE A 126 ? 0.6318 0.5551 0.6524 0.0618  0.0246  -0.0290 172 ILE A CG1 
844  C CG1 B ILE A 126 ? 0.6420 0.5687 0.6652 0.0627  0.0260  -0.0277 172 ILE A CG1 
845  C CG2 A ILE A 126 ? 0.6271 0.5770 0.6480 0.0734  0.0436  -0.0268 172 ILE A CG2 
846  C CG2 B ILE A 126 ? 0.6321 0.5858 0.6556 0.0728  0.0450  -0.0253 172 ILE A CG2 
847  C CD1 A ILE A 126 ? 0.6026 0.5291 0.6386 0.0648  0.0243  -0.0229 172 ILE A CD1 
848  C CD1 B ILE A 126 ? 0.6600 0.5686 0.6689 0.0716  0.0253  -0.0386 172 ILE A CD1 
849  N N   . PHE A 127 ? 0.6039 0.5654 0.6123 0.0532  0.0401  -0.0164 173 PHE A N   
850  C CA  . PHE A 127 ? 0.5992 0.5687 0.6035 0.0534  0.0488  -0.0102 173 PHE A CA  
851  C C   . PHE A 127 ? 0.6251 0.5872 0.6036 0.0596  0.0480  -0.0137 173 PHE A C   
852  O O   . PHE A 127 ? 0.6286 0.5910 0.5936 0.0675  0.0584  -0.0117 173 PHE A O   
853  C CB  . PHE A 127 ? 0.5817 0.5575 0.5983 0.0436  0.0456  -0.0040 173 PHE A CB  
854  C CG  . PHE A 127 ? 0.5867 0.5647 0.5972 0.0432  0.0525  0.0023  173 PHE A CG  
855  C CD1 . PHE A 127 ? 0.5681 0.5520 0.5863 0.0436  0.0652  0.0080  173 PHE A CD1 
856  C CD2 . PHE A 127 ? 0.5936 0.5677 0.5926 0.0423  0.0466  0.0029  173 PHE A CD2 
857  C CE1 . PHE A 127 ? 0.5764 0.5578 0.5884 0.0428  0.0728  0.0151  173 PHE A CE1 
858  C CE2 . PHE A 127 ? 0.5972 0.5698 0.5889 0.0437  0.0529  0.0098  173 PHE A CE2 
859  C CZ  . PHE A 127 ? 0.5934 0.5674 0.5904 0.0437  0.0665  0.0164  173 PHE A CZ  
860  N N   . LEU A 128 ? 0.6363 0.5926 0.6081 0.0565  0.0357  -0.0190 174 LEU A N   
861  C CA  . LEU A 128 ? 0.6693 0.6212 0.6174 0.0627  0.0312  -0.0235 174 LEU A CA  
862  C C   . LEU A 128 ? 0.7072 0.6499 0.6351 0.0734  0.0322  -0.0331 174 LEU A C   
863  O O   . LEU A 128 ? 0.7310 0.6717 0.6343 0.0831  0.0354  -0.0339 174 LEU A O   
864  C CB  . LEU A 128 ? 0.6651 0.6174 0.6171 0.0558  0.0166  -0.0285 174 LEU A CB  
865  C CG  . LEU A 128 ? 0.6573 0.6189 0.6224 0.0486  0.0156  -0.0202 174 LEU A CG  
866  C CD1 . LEU A 128 ? 0.6812 0.6461 0.6561 0.0411  0.0029  -0.0259 174 LEU A CD1 
867  C CD2 . LEU A 128 ? 0.6932 0.6569 0.6428 0.0557  0.0206  -0.0136 174 LEU A CD2 
868  N N   . GLN A 129 ? 0.7239 0.6594 0.6601 0.0729  0.0294  -0.0403 175 GLN A N   
869  C CA  . GLN A 129 ? 0.7699 0.6948 0.6879 0.0843  0.0313  -0.0508 175 GLN A CA  
870  C C   . GLN A 129 ? 0.7747 0.7060 0.6830 0.0951  0.0487  -0.0449 175 GLN A C   
871  O O   . GLN A 129 ? 0.7887 0.7151 0.6698 0.1068  0.0525  -0.0501 175 GLN A O   
872  C CB  . GLN A 129 ? 0.7874 0.7011 0.7186 0.0827  0.0268  -0.0578 175 GLN A CB  
873  C CG  . GLN A 129 ? 0.8442 0.7446 0.7752 0.0752  0.0108  -0.0684 175 GLN A CG  
874  C CD  . GLN A 129 ? 0.8797 0.7649 0.8251 0.0719  0.0073  -0.0721 175 GLN A CD  
875  O OE1 . GLN A 129 ? 0.9241 0.7952 0.8714 0.0650  -0.0039 -0.0808 175 GLN A OE1 
876  N NE2 . GLN A 129 ? 0.8900 0.7777 0.8467 0.0767  0.0165  -0.0653 175 GLN A NE2 
877  N N   . LYS A 130 ? 0.7497 0.6930 0.6802 0.0911  0.0593  -0.0342 176 LYS A N   
878  C CA  . LYS A 130 ? 0.7630 0.7156 0.6922 0.0988  0.0777  -0.0278 176 LYS A CA  
879  C C   . LYS A 130 ? 0.7741 0.7292 0.6860 0.1002  0.0860  -0.0184 176 LYS A C   
880  O O   . LYS A 130 ? 0.7913 0.7466 0.6838 0.1107  0.0995  -0.0162 176 LYS A O   
881  C CB  . LYS A 130 ? 0.7365 0.7036 0.6996 0.0928  0.0846  -0.0207 176 LYS A CB  
882  C CG  . LYS A 130 ? 0.7465 0.7106 0.7252 0.0944  0.0776  -0.0276 176 LYS A CG  
883  C CD  . LYS A 130 ? 0.7894 0.7485 0.7571 0.1093  0.0844  -0.0363 176 LYS A CD  
884  C CE  . LYS A 130 ? 0.8019 0.7548 0.7851 0.1119  0.0769  -0.0419 176 LYS A CE  
885  N NZ  . LYS A 130 ? 0.8420 0.7889 0.8152 0.1283  0.0838  -0.0512 176 LYS A NZ  
886  N N   . VAL A 131 ? 0.7471 0.7031 0.6644 0.0908  0.0786  -0.0126 177 VAL A N   
887  C CA  . VAL A 131 ? 0.7530 0.7078 0.6538 0.0928  0.0851  -0.0026 177 VAL A CA  
888  C C   . VAL A 131 ? 0.7862 0.7314 0.6481 0.1058  0.0813  -0.0078 177 VAL A C   
889  O O   . VAL A 131 ? 0.8099 0.7523 0.6497 0.1134  0.0922  0.0013  177 VAL A O   
890  C CB  . VAL A 131 ? 0.7312 0.6878 0.6463 0.0818  0.0764  0.0031  177 VAL A CB  
891  C CG1 . VAL A 131 ? 0.7590 0.7094 0.6502 0.0873  0.0772  0.0103  177 VAL A CG1 
892  C CG2 . VAL A 131 ? 0.6993 0.6649 0.6456 0.0713  0.0848  0.0109  177 VAL A CG2 
893  N N   . ALA A 132 ? 0.7940 0.7331 0.6466 0.1086  0.0660  -0.0224 178 ALA A N   
894  C CA  . ALA A 132 ? 0.8350 0.7658 0.6502 0.1215  0.0592  -0.0313 178 ALA A CA  
895  C C   . ALA A 132 ? 0.8825 0.8096 0.6710 0.1366  0.0756  -0.0314 178 ALA A C   
896  O O   . ALA A 132 ? 0.9232 0.8441 0.6743 0.1496  0.0743  -0.0342 178 ALA A O   
897  C CB  . ALA A 132 ? 0.8305 0.7551 0.6472 0.1188  0.0393  -0.0489 178 ALA A CB  
898  N N   . SER A 133 ? 0.8804 0.8130 0.6877 0.1360  0.0906  -0.0287 179 SER A N   
899  C CA  . SER A 133 ? 0.9192 0.8521 0.7068 0.1502  0.1094  -0.0282 179 SER A CA  
900  C C   . SER A 133 ? 0.9204 0.8646 0.7210 0.1477  0.1333  -0.0097 179 SER A C   
901  O O   . SER A 133 ? 0.9316 0.8819 0.7294 0.1561  0.1524  -0.0075 179 SER A O   
902  C CB  . SER A 133 ? 0.9165 0.8484 0.7166 0.1540  0.1091  -0.0413 179 SER A CB  
903  O OG  . SER A 133 ? 0.9306 0.8489 0.7215 0.1543  0.0879  -0.0584 179 SER A OG  
904  N N   . MET A 134 ? 0.9105 0.8576 0.7267 0.1359  0.1327  0.0028  180 MET A N   
905  C CA  . MET A 134 ? 0.9251 0.8796 0.7551 0.1309  0.1542  0.0203  180 MET A CA  
906  C C   . MET A 134 ? 0.9818 0.9280 0.7707 0.1446  0.1700  0.0300  180 MET A C   
907  O O   . MET A 134 ? 0.9833 0.9175 0.7350 0.1546  0.1587  0.0264  180 MET A O   
908  C CB  . MET A 134 ? 0.9031 0.8574 0.7556 0.1159  0.1468  0.0289  180 MET A CB  
909  C CG  . MET A 134 ? 0.9077 0.8674 0.7811 0.1071  0.1667  0.0451  180 MET A CG  
910  S SD  . MET A 134 ? 0.8917 0.8485 0.7911 0.0905  0.1559  0.0511  180 MET A SD  
911  C CE  . MET A 134 ? 0.9055 0.8444 0.7629 0.1008  0.1432  0.0532  180 MET A CE  
912  N N   . PRO A 135 ? 1.0245 0.9782 0.8200 0.1455  0.1964  0.0425  181 PRO A N   
913  C CA  . PRO A 135 ? 1.0941 1.0377 0.8483 0.1582  0.2140  0.0553  181 PRO A CA  
914  C C   . PRO A 135 ? 1.1244 1.0530 0.8615 0.1558  0.2071  0.0674  181 PRO A C   
915  O O   . PRO A 135 ? 1.0862 1.0154 0.8535 0.1410  0.1977  0.0701  181 PRO A O   
916  C CB  . PRO A 135 ? 1.0981 1.0551 0.8763 0.1537  0.2445  0.0685  181 PRO A CB  
917  C CG  . PRO A 135 ? 1.0457 1.0200 0.8810 0.1364  0.2394  0.0637  181 PRO A CG  
918  C CD  . PRO A 135 ? 1.0063 0.9788 0.8450 0.1367  0.2115  0.0450  181 PRO A CD  
919  N N   . GLN A 136 ? 1.2018 1.1165 0.8890 0.1720  0.2117  0.0742  182 GLN A N   
920  C CA  . GLN A 136 ? 1.2425 1.1422 0.9052 0.1757  0.1979  0.0809  182 GLN A CA  
921  C C   . GLN A 136 ? 1.2872 1.1750 0.9495 0.1712  0.2168  0.1052  182 GLN A C   
922  O O   . GLN A 136 ? 1.2808 1.1606 0.9529 0.1644  0.2054  0.1103  182 GLN A O   
923  C CB  . GLN A 136 ? 1.2852 1.1757 0.8913 0.1976  0.1864  0.0729  182 GLN A CB  
924  C CG  . GLN A 136 ? 1.3449 1.2278 0.9054 0.2155  0.2108  0.0844  182 GLN A CG  
925  C CD  . GLN A 136 ? 1.3801 1.2607 0.8939 0.2359  0.1990  0.0667  182 GLN A CD  
926  O OE1 . GLN A 136 ? 1.3622 1.2517 0.8878 0.2357  0.1930  0.0477  182 GLN A OE1 
927  N NE2 . GLN A 136 ? 1.4312 1.2986 0.8904 0.2546  0.1952  0.0726  182 GLN A NE2 
928  N N   . GLU A 137 ? 1.3479 1.2335 0.9992 0.1752  0.2464  0.1202  183 GLU A N   
929  C CA  . GLU A 137 ? 1.3965 1.2661 1.0425 0.1719  0.2672  0.1451  183 GLU A CA  
930  C C   . GLU A 137 ? 1.3843 1.2642 1.0856 0.1499  0.2865  0.1529  183 GLU A C   
931  O O   . GLU A 137 ? 1.3876 1.2842 1.1070 0.1472  0.3053  0.1520  183 GLU A O   
932  C CB  . GLU A 137 ? 1.4611 1.3183 1.0527 0.1915  0.2895  0.1600  183 GLU A CB  
933  C CG  . GLU A 137 ? 1.5106 1.3538 1.0427 0.2143  0.2701  0.1560  183 GLU A CG  
934  C CD  . GLU A 137 ? 1.5873 1.4159 1.0605 0.2353  0.2928  0.1731  183 GLU A CD  
935  O OE1 . GLU A 137 ? 1.6279 1.4393 1.0934 0.2335  0.3155  0.1986  183 GLU A OE1 
936  O OE2 . GLU A 137 ? 1.6198 1.4522 1.0526 0.2539  0.2883  0.1610  183 GLU A OE2 
937  N N   . GLU A 138 ? 1.3743 1.2452 1.1029 0.1351  0.2813  0.1597  184 GLU A N   
938  C CA  . GLU A 138 ? 1.3581 1.2384 1.1417 0.1127  0.2949  0.1643  184 GLU A CA  
939  C C   . GLU A 138 ? 1.4065 1.2810 1.1900 0.1095  0.3309  0.1858  184 GLU A C   
940  O O   . GLU A 138 ? 1.4402 1.2914 1.2174 0.1050  0.3430  0.2043  184 GLU A O   
941  C CB  . GLU A 138 ? 1.3321 1.2008 1.1395 0.0994  0.2793  0.1644  184 GLU A CB  
942  C CG  . GLU A 138 ? 1.2943 1.1758 1.1614 0.0756  0.2857  0.1625  184 GLU A CG  
943  C CD  . GLU A 138 ? 1.2362 1.1288 1.1332 0.0661  0.2582  0.1441  184 GLU A CD  
944  O OE1 . GLU A 138 ? 1.2297 1.1073 1.1141 0.0687  0.2408  0.1425  184 GLU A OE1 
945  O OE2 . GLU A 138 ? 1.1738 1.0909 1.1065 0.0573  0.2544  0.1315  184 GLU A OE2 
946  N N   . GLN A 139 ? 1.4190 1.3142 1.2102 0.1122  0.3489  0.1836  185 GLN A N   
947  C CA  . GLN A 139 ? 1.4526 1.3502 1.2549 0.1063  0.3856  0.2025  185 GLN A CA  
948  C C   . GLN A 139 ? 1.4205 1.3359 1.2932 0.0797  0.3914  0.2007  185 GLN A C   
949  O O   . GLN A 139 ? 1.3782 1.3194 1.2889 0.0726  0.3762  0.1819  185 GLN A O   
950  C CB  . GLN A 139 ? 1.4726 1.3888 1.2558 0.1216  0.4027  0.1992  185 GLN A CB  
951  N N   . GLU A 140 ? 1.4460 1.3465 1.3355 0.0653  0.4127  0.2199  186 GLU A N   
952  C CA  . GLU A 140 ? 1.4187 1.3327 1.3752 0.0384  0.4163  0.2176  186 GLU A CA  
953  C C   . GLU A 140 ? 1.4006 1.3554 1.4040 0.0306  0.4311  0.2100  186 GLU A C   
954  O O   . GLU A 140 ? 1.4229 1.3909 1.4069 0.0445  0.4497  0.2136  186 GLU A O   
955  C CB  . GLU A 140 ? 1.4582 1.3435 1.4193 0.0252  0.4392  0.2409  186 GLU A CB  
956  C CG  . GLU A 140 ? 1.4357 1.3277 1.4629 -0.0036 0.4378  0.2364  186 GLU A CG  
957  C CD  . GLU A 140 ? 1.4819 1.3415 1.5144 -0.0176 0.4621  0.2595  186 GLU A CD  
958  O OE1 . GLU A 140 ? 1.5364 1.3652 1.5176 -0.0037 0.4789  0.2808  186 GLU A OE1 
959  O OE2 . GLU A 140 ? 1.4715 1.3352 1.5590 -0.0425 0.4640  0.2562  186 GLU A OE2 
960  N N   . GLY B 27  ? 1.4836 0.9728 0.9950 0.0526  -0.0458 -0.1263 73  GLY B N   
961  C CA  . GLY B 27  ? 1.4488 0.9740 0.9726 0.0674  -0.0293 -0.1132 73  GLY B CA  
962  C C   . GLY B 27  ? 1.4800 0.9957 0.9614 0.0774  -0.0283 -0.1175 73  GLY B C   
963  O O   . GLY B 27  ? 1.5396 1.0188 0.9772 0.0756  -0.0403 -0.1319 73  GLY B O   
964  N N   . ARG B 28  ? 1.4472 0.9945 0.9402 0.0870  -0.0141 -0.1047 74  ARG B N   
965  C CA  . ARG B 28  ? 1.4757 1.0142 0.9266 0.0990  -0.0070 -0.1053 74  ARG B CA  
966  C C   . ARG B 28  ? 1.4245 1.0019 0.8977 0.0965  -0.0049 -0.0900 74  ARG B C   
967  O O   . ARG B 28  ? 1.3692 0.9798 0.8905 0.0859  -0.0097 -0.0804 74  ARG B O   
968  C CB  . ARG B 28  ? 1.5103 1.0332 0.9375 0.1215  0.0198  -0.1065 74  ARG B CB  
969  C CG  . ARG B 28  ? 1.4692 1.0319 0.9413 0.1301  0.0419  -0.0908 74  ARG B CG  
970  C CD  . ARG B 28  ? 1.5046 1.0537 0.9676 0.1511  0.0643  -0.0940 74  ARG B CD  
971  N NE  . ARG B 28  ? 1.4626 1.0530 0.9777 0.1561  0.0794  -0.0800 74  ARG B NE  
972  C CZ  . ARG B 28  ? 1.4571 1.0762 0.9851 0.1687  0.1022  -0.0697 74  ARG B CZ  
973  N NH1 . ARG B 28  ? 1.5009 1.1118 0.9917 0.1787  0.1164  -0.0705 74  ARG B NH1 
974  N NH2 . ARG B 28  ? 1.4023 1.0593 0.9812 0.1706  0.1109  -0.0584 74  ARG B NH2 
975  N N   . VAL B 29  ? 1.4424 1.0116 0.8770 0.1065  0.0029  -0.0879 75  VAL B N   
976  C CA  . VAL B 29  ? 1.4053 1.0030 0.8519 0.1058  0.0075  -0.0726 75  VAL B CA  
977  C C   . VAL B 29  ? 1.3833 0.9951 0.8328 0.1202  0.0390  -0.0615 75  VAL B C   
978  O O   . VAL B 29  ? 1.4290 1.0185 0.8414 0.1350  0.0558  -0.0674 75  VAL B O   
979  C CB  . VAL B 29  ? 1.4537 1.0312 0.8513 0.1055  -0.0075 -0.0759 75  VAL B CB  
980  C CG1 . VAL B 29  ? 1.4354 1.0378 0.8444 0.1046  -0.0035 -0.0588 75  VAL B CG1 
981  C CG2 . VAL B 29  ? 1.4670 1.0323 0.8618 0.0914  -0.0401 -0.0885 75  VAL B CG2 
982  N N   . THR B 30  ? 1.3078 0.9570 0.8019 0.1156  0.0471  -0.0462 76  THR B N   
983  C CA  . THR B 30  ? 1.2797 0.9488 0.7835 0.1254  0.0756  -0.0339 76  THR B CA  
984  C C   . THR B 30  ? 1.2462 0.9356 0.7611 0.1179  0.0764  -0.0184 76  THR B C   
985  O O   . THR B 30  ? 1.2192 0.9135 0.7463 0.1062  0.0550  -0.0165 76  THR B O   
986  C CB  . THR B 30  ? 1.2342 0.9307 0.7890 0.1279  0.0882  -0.0301 76  THR B CB  
987  O OG1 . THR B 30  ? 1.1700 0.8933 0.7728 0.1134  0.0744  -0.0235 76  THR B OG1 
988  C CG2 . THR B 30  ? 1.2481 0.9209 0.7922 0.1361  0.0868  -0.0442 76  THR B CG2 
989  N N   . ASN B 31  ? 1.2388 0.9394 0.7499 0.1248  0.1018  -0.0072 77  ASN B N   
990  C CA  . ASN B 31  ? 1.2148 0.9325 0.7379 0.1171  0.1065  0.0093  77  ASN B CA  
991  C C   . ASN B 31  ? 1.1393 0.8890 0.7230 0.1041  0.0974  0.0163  77  ASN B C   
992  O O   . ASN B 31  ? 1.1229 0.8768 0.7141 0.0948  0.0860  0.0244  77  ASN B O   
993  C CB  . ASN B 31  ? 1.2397 0.9668 0.7545 0.1252  0.1392  0.0202  77  ASN B CB  
994  C CG  . ASN B 31  ? 1.2116 0.9702 0.7731 0.1301  0.1588  0.0215  77  ASN B CG  
995  O OD1 . ASN B 31  ? 1.2136 0.9723 0.7906 0.1348  0.1522  0.0104  77  ASN B OD1 
996  N ND2 . ASN B 31  ? 1.1963 0.9813 0.7807 0.1286  0.1822  0.0354  77  ASN B ND2 
997  N N   . GLN B 32  ? 1.0910 0.8610 0.7147 0.1051  0.1022  0.0131  78  GLN B N   
998  C CA  . GLN B 32  ? 1.0285 0.8271 0.7062 0.0941  0.0938  0.0180  78  GLN B CA  
999  C C   . GLN B 32  ? 0.9983 0.7893 0.6812 0.0847  0.0662  0.0112  78  GLN B C   
1000 O O   . GLN B 32  ? 0.9634 0.7685 0.6714 0.0749  0.0564  0.0175  78  GLN B O   
1001 C CB  . GLN B 32  ? 1.0085 0.8273 0.7211 0.0996  0.1042  0.0156  78  GLN B CB  
1002 C CG  . GLN B 32  ? 1.0327 0.8730 0.7585 0.1073  0.1314  0.0241  78  GLN B CG  
1003 C CD  . GLN B 32  ? 1.0249 0.8888 0.7897 0.1141  0.1381  0.0221  78  GLN B CD  
1004 O OE1 . GLN B 32  ? 1.0536 0.9039 0.8145 0.1201  0.1290  0.0119  78  GLN B OE1 
1005 N NE2 . GLN B 32  ? 1.0019 0.9005 0.8041 0.1129  0.1533  0.0321  78  GLN B NE2 
1006 N N   . LEU B 33  ? 1.0065 0.7751 0.6664 0.0876  0.0544  -0.0020 79  LEU B N   
1007 C CA  . LEU B 33  ? 0.9883 0.7520 0.6549 0.0778  0.0292  -0.0091 79  LEU B CA  
1008 C C   . LEU B 33  ? 1.0049 0.7618 0.6526 0.0734  0.0145  -0.0056 79  LEU B C   
1009 O O   . LEU B 33  ? 0.9735 0.7429 0.6459 0.0648  -0.0017 -0.0047 79  LEU B O   
1010 C CB  . LEU B 33  ? 1.0088 0.7477 0.6537 0.0799  0.0205  -0.0241 79  LEU B CB  
1011 C CG  . LEU B 33  ? 0.9795 0.7242 0.6503 0.0822  0.0281  -0.0273 79  LEU B CG  
1012 C CD1 . LEU B 33  ? 1.0079 0.7189 0.6467 0.0877  0.0253  -0.0413 79  LEU B CD1 
1013 C CD2 . LEU B 33  ? 0.9314 0.6975 0.6457 0.0700  0.0161  -0.0250 79  LEU B CD2 
1014 N N   . GLN B 34  ? 1.0533 0.7905 0.6567 0.0807  0.0208  -0.0032 80  GLN B N   
1015 C CA  . GLN B 34  ? 1.0793 0.8081 0.6606 0.0791  0.0081  0.0028  80  GLN B CA  
1016 C C   . GLN B 34  ? 1.0376 0.7876 0.6512 0.0736  0.0128  0.0175  80  GLN B C   
1017 O O   . GLN B 34  ? 1.0217 0.7741 0.6425 0.0694  -0.0045 0.0204  80  GLN B O   
1018 C CB  . GLN B 34  ? 1.1515 0.8524 0.6735 0.0890  0.0172  0.0043  80  GLN B CB  
1019 C CG  . GLN B 34  ? 1.2270 0.8986 0.7046 0.0929  0.0004  -0.0111 80  GLN B CG  
1020 C CD  . GLN B 34  ? 1.3200 0.9614 0.7326 0.1035  0.0081  -0.0095 80  GLN B CD  
1021 O OE1 . GLN B 34  ? 1.3642 1.0036 0.7604 0.1055  0.0152  0.0044  80  GLN B OE1 
1022 N NE2 . GLN B 34  ? 1.3820 0.9963 0.7538 0.1102  0.0070  -0.0239 80  GLN B NE2 
1023 N N   . TYR B 35  ? 1.0209 0.7860 0.6544 0.0740  0.0358  0.0261  81  TYR B N   
1024 C CA  . TYR B 35  ? 0.9824 0.7666 0.6492 0.0668  0.0412  0.0389  81  TYR B CA  
1025 C C   . TYR B 35  ? 0.9303 0.7337 0.6415 0.0588  0.0253  0.0348  81  TYR B C   
1026 O O   . TYR B 35  ? 0.9125 0.7195 0.6366 0.0540  0.0152  0.0403  81  TYR B O   
1027 C CB  . TYR B 35  ? 0.9733 0.7738 0.6574 0.0674  0.0680  0.0468  81  TYR B CB  
1028 C CG  . TYR B 35  ? 0.9568 0.7759 0.6759 0.0577  0.0738  0.0592  81  TYR B CG  
1029 C CD1 . TYR B 35  ? 0.9108 0.7538 0.6775 0.0507  0.0681  0.0570  81  TYR B CD1 
1030 C CD2 . TYR B 35  ? 0.9896 0.7994 0.6913 0.0549  0.0849  0.0729  81  TYR B CD2 
1031 C CE1 . TYR B 35  ? 0.8773 0.7343 0.6736 0.0411  0.0718  0.0666  81  TYR B CE1 
1032 C CE2 . TYR B 35  ? 0.9702 0.7931 0.7034 0.0441  0.0895  0.0836  81  TYR B CE2 
1033 C CZ  . TYR B 35  ? 0.9094 0.7559 0.6900 0.0372  0.0822  0.0795  81  TYR B CZ  
1034 O OH  . TYR B 35  ? 0.8883 0.7449 0.6977 0.0259  0.0850  0.0883  81  TYR B OH  
1035 N N   . LEU B 36  ? 0.9040 0.7172 0.6357 0.0583  0.0236  0.0252  82  LEU B N   
1036 C CA  . LEU B 36  ? 0.8729 0.7025 0.6418 0.0511  0.0100  0.0210  82  LEU B CA  
1037 C C   . LEU B 36  ? 0.8754 0.6982 0.6373 0.0485  -0.0125 0.0163  82  LEU B C   
1038 O O   . LEU B 36  ? 0.8364 0.6729 0.6257 0.0435  -0.0220 0.0177  82  LEU B O   
1039 C CB  . LEU B 36  ? 0.8617 0.6967 0.6455 0.0516  0.0121  0.0122  82  LEU B CB  
1040 C CG  . LEU B 36  ? 0.8652 0.7164 0.6714 0.0543  0.0301  0.0166  82  LEU B CG  
1041 C CD1 . LEU B 36  ? 0.8617 0.7091 0.6707 0.0585  0.0310  0.0079  82  LEU B CD1 
1042 C CD2 . LEU B 36  ? 0.8471 0.7217 0.6919 0.0468  0.0294  0.0234  82  LEU B CD2 
1043 N N   . HIS B 37  ? 0.9138 0.7163 0.6390 0.0526  -0.0212 0.0103  83  HIS B N   
1044 C CA  . HIS B 37  ? 0.9360 0.7348 0.6553 0.0508  -0.0446 0.0050  83  HIS B CA  
1045 C C   . HIS B 37  ? 0.9553 0.7501 0.6641 0.0540  -0.0507 0.0152  83  HIS B C   
1046 O O   . HIS B 37  ? 0.9309 0.7386 0.6643 0.0517  -0.0633 0.0164  83  HIS B O   
1047 C CB  . HIS B 37  ? 0.9787 0.7554 0.6600 0.0535  -0.0543 -0.0060 83  HIS B CB  
1048 C CG  . HIS B 37  ? 0.9992 0.7779 0.6826 0.0494  -0.0805 -0.0140 83  HIS B CG  
1049 N ND1 . HIS B 37  ? 1.0926 0.8507 0.7387 0.0511  -0.0952 -0.0232 83  HIS B ND1 
1050 C CD2 . HIS B 37  ? 0.9919 0.7927 0.7117 0.0438  -0.0947 -0.0146 83  HIS B CD2 
1051 C CE1 . HIS B 37  ? 1.0794 0.8496 0.7423 0.0458  -0.1187 -0.0288 83  HIS B CE1 
1052 N NE2 . HIS B 37  ? 1.0174 0.8146 0.7259 0.0420  -0.1176 -0.0235 83  HIS B NE2 
1053 N N   . LYS B 38  ? 1.0006 0.7761 0.6717 0.0600  -0.0405 0.0230  84  LYS B N   
1054 C CA  . LYS B 38  ? 1.0428 0.8053 0.6915 0.0645  -0.0479 0.0331  84  LYS B CA  
1055 C C   . LYS B 38  ? 1.0201 0.7895 0.6910 0.0615  -0.0364 0.0466  84  LYS B C   
1056 O O   . LYS B 38  ? 1.0421 0.8045 0.7090 0.0640  -0.0471 0.0537  84  LYS B O   
1057 C CB  . LYS B 38  ? 1.1094 0.8435 0.7007 0.0721  -0.0420 0.0362  84  LYS B CB  
1058 C CG  . LYS B 38  ? 1.1729 0.8935 0.7339 0.0752  -0.0550 0.0216  84  LYS B CG  
1059 C CD  . LYS B 38  ? 1.2003 0.9240 0.7652 0.0746  -0.0864 0.0139  84  LYS B CD  
1060 C CE  . LYS B 38  ? 1.2556 0.9626 0.7869 0.0756  -0.1003 -0.0010 84  LYS B CE  
1061 N NZ  . LYS B 38  ? 1.2801 0.9907 0.8113 0.0752  -0.1325 -0.0077 84  LYS B NZ  
1062 N N   . VAL B 39  ? 0.9885 0.7705 0.6821 0.0564  -0.0159 0.0500  85  VAL B N   
1063 C CA  . VAL B 39  ? 0.9786 0.7668 0.6944 0.0510  -0.0050 0.0616  85  VAL B CA  
1064 C C   . VAL B 39  ? 0.9341 0.7461 0.6987 0.0445  -0.0100 0.0567  85  VAL B C   
1065 O O   . VAL B 39  ? 0.9371 0.7493 0.7162 0.0432  -0.0191 0.0600  85  VAL B O   
1066 C CB  . VAL B 39  ? 0.9909 0.7798 0.7013 0.0485  0.0215  0.0701  85  VAL B CB  
1067 C CG1 . VAL B 39  ? 0.9801 0.7781 0.7198 0.0394  0.0312  0.0807  85  VAL B CG1 
1068 C CG2 . VAL B 39  ? 1.0455 0.8082 0.7030 0.0552  0.0293  0.0772  85  VAL B CG2 
1069 N N   . VAL B 40  ? 0.9046 0.7341 0.6915 0.0418  -0.0041 0.0488  86  VAL B N   
1070 C CA  . VAL B 40  ? 0.8604 0.7111 0.6891 0.0358  -0.0063 0.0451  86  VAL B CA  
1071 C C   . VAL B 40  ? 0.8430 0.6992 0.6845 0.0364  -0.0255 0.0370  86  VAL B C   
1072 O O   . VAL B 40  ? 0.8213 0.6829 0.6820 0.0347  -0.0316 0.0386  86  VAL B O   
1073 C CB  . VAL B 40  ? 0.8393 0.7052 0.6851 0.0344  0.0047  0.0400  86  VAL B CB  
1074 C CG1 . VAL B 40  ? 0.7940 0.6791 0.6772 0.0289  0.0007  0.0364  86  VAL B CG1 
1075 C CG2 . VAL B 40  ? 0.8438 0.7116 0.6855 0.0344  0.0251  0.0482  86  VAL B CG2 
1076 N N   . MET B 41  ? 0.8500 0.7048 0.6815 0.0385  -0.0347 0.0278  87  MET B N   
1077 C CA  . MET B 41  ? 0.8379 0.7035 0.6870 0.0373  -0.0515 0.0198  87  MET B CA  
1078 C C   . MET B 41  ? 0.8539 0.7149 0.6982 0.0423  -0.0658 0.0232  87  MET B C   
1079 O O   . MET B 41  ? 0.8295 0.7046 0.6997 0.0421  -0.0741 0.0206  87  MET B O   
1080 C CB  . MET B 41  ? 0.8474 0.7099 0.6853 0.0362  -0.0590 0.0095  87  MET B CB  
1081 C CG  . MET B 41  ? 0.8436 0.7205 0.7027 0.0327  -0.0755 0.0014  87  MET B CG  
1082 S SD  . MET B 41  ? 0.8370 0.7380 0.7398 0.0262  -0.0703 -0.0005 87  MET B SD  
1083 C CE  . MET B 41  ? 0.8295 0.7272 0.7313 0.0195  -0.0644 -0.0081 87  MET B CE  
1084 N N   . LYS B 42  ? 0.8916 0.7324 0.7014 0.0481  -0.0682 0.0294  88  LYS B N   
1085 C CA  . LYS B 42  ? 0.9249 0.7580 0.7255 0.0554  -0.0834 0.0337  88  LYS B CA  
1086 C C   . LYS B 42  ? 0.9109 0.7443 0.7306 0.0557  -0.0788 0.0413  88  LYS B C   
1087 O O   . LYS B 42  ? 0.9078 0.7467 0.7420 0.0611  -0.0917 0.0402  88  LYS B O   
1088 C CB  . LYS B 42  ? 0.9799 0.7864 0.7327 0.0620  -0.0857 0.0403  88  LYS B CB  
1089 C CG  . LYS B 42  ? 1.0325 0.8312 0.7717 0.0716  -0.1074 0.0424  88  LYS B CG  
1090 C CD  . LYS B 42  ? 1.1135 0.8819 0.7989 0.0789  -0.1094 0.0505  88  LYS B CD  
1091 C CE  . LYS B 42  ? 1.1489 0.9115 0.8060 0.0782  -0.1128 0.0412  88  LYS B CE  
1092 N NZ  . LYS B 42  ? 1.2186 0.9517 0.8196 0.0874  -0.1210 0.0471  88  LYS B NZ  
1093 N N   . ALA B 43  ? 0.9067 0.7352 0.7280 0.0499  -0.0608 0.0483  89  ALA B N   
1094 C CA  . ALA B 43  ? 0.8948 0.7210 0.7338 0.0473  -0.0558 0.0543  89  ALA B CA  
1095 C C   . ALA B 43  ? 0.8495 0.6980 0.7266 0.0448  -0.0598 0.0452  89  ALA B C   
1096 O O   . ALA B 43  ? 0.8581 0.7047 0.7468 0.0489  -0.0668 0.0453  89  ALA B O   
1097 C CB  . ALA B 43  ? 0.8964 0.7168 0.7323 0.0390  -0.0360 0.0627  89  ALA B CB  
1098 N N   . LEU B 44  ? 0.8022 0.6692 0.6956 0.0393  -0.0547 0.0375  90  LEU B N   
1099 C CA  . LEU B 44  ? 0.7596 0.6465 0.6840 0.0369  -0.0574 0.0293  90  LEU B CA  
1100 C C   . LEU B 44  ? 0.7431 0.6400 0.6771 0.0433  -0.0727 0.0229  90  LEU B C   
1101 O O   . LEU B 44  ? 0.7240 0.6298 0.6783 0.0460  -0.0758 0.0199  90  LEU B O   
1102 C CB  . LEU B 44  ? 0.7427 0.6434 0.6773 0.0305  -0.0495 0.0238  90  LEU B CB  
1103 C CG  . LEU B 44  ? 0.7491 0.6486 0.6836 0.0253  -0.0347 0.0287  90  LEU B CG  
1104 C CD1 . LEU B 44  ? 0.7354 0.6470 0.6789 0.0224  -0.0298 0.0229  90  LEU B CD1 
1105 C CD2 . LEU B 44  ? 0.7501 0.6506 0.7004 0.0214  -0.0309 0.0322  90  LEU B CD2 
1106 N N   . TRP B 45  ? 0.7487 0.6450 0.6685 0.0460  -0.0822 0.0203  91  TRP B N   
1107 C CA  . TRP B 45  ? 0.7369 0.6492 0.6711 0.0501  -0.0977 0.0132  91  TRP B CA  
1108 C C   . TRP B 45  ? 0.7421 0.6536 0.6833 0.0610  -0.1077 0.0160  91  TRP B C   
1109 O O   . TRP B 45  ? 0.7180 0.6505 0.6869 0.0642  -0.1135 0.0100  91  TRP B O   
1110 C CB  . TRP B 45  ? 0.7622 0.6695 0.6746 0.0505  -0.1086 0.0102  91  TRP B CB  
1111 C CG  . TRP B 45  ? 0.7466 0.6757 0.6794 0.0507  -0.1247 0.0015  91  TRP B CG  
1112 C CD1 . TRP B 45  ? 0.7609 0.6992 0.7024 0.0602  -0.1411 0.0012  91  TRP B CD1 
1113 C CD2 . TRP B 45  ? 0.7338 0.6791 0.6828 0.0405  -0.1260 -0.0078 91  TRP B CD2 
1114 N NE1 . TRP B 45  ? 0.7476 0.7118 0.7138 0.0558  -0.1525 -0.0081 91  TRP B NE1 
1115 C CE2 . TRP B 45  ? 0.7247 0.6919 0.6949 0.0425  -0.1431 -0.0136 91  TRP B CE2 
1116 C CE3 . TRP B 45  ? 0.7109 0.6534 0.6588 0.0302  -0.1146 -0.0115 91  TRP B CE3 
1117 C CZ2 . TRP B 45  ? 0.7070 0.6938 0.6985 0.0317  -0.1482 -0.0226 91  TRP B CZ2 
1118 C CZ3 . TRP B 45  ? 0.7143 0.6711 0.6790 0.0207  -0.1199 -0.0200 91  TRP B CZ3 
1119 C CH2 . TRP B 45  ? 0.7213 0.7001 0.7080 0.0201  -0.1361 -0.0255 91  TRP B CH2 
1120 N N   . LYS B 46  ? 0.7660 0.6523 0.6813 0.0673  -0.1084 0.0256  92  LYS B N   
1121 C CA  . LYS B 46  ? 0.7910 0.6684 0.7060 0.0799  -0.1187 0.0299  92  LYS B CA  
1122 C C   . LYS B 46  ? 0.7609 0.6344 0.6928 0.0808  -0.1103 0.0308  92  LYS B C   
1123 O O   . LYS B 46  ? 0.7634 0.6299 0.6988 0.0926  -0.1182 0.0324  92  LYS B O   
1124 C CB  . LYS B 46  ? 0.8455 0.6909 0.7202 0.0861  -0.1226 0.0414  92  LYS B CB  
1125 C CG  . LYS B 46  ? 0.9166 0.7626 0.7756 0.0963  -0.1428 0.0407  92  LYS B CG  
1126 C CD  . LYS B 46  ? 0.9264 0.7891 0.7849 0.0888  -0.1473 0.0317  92  LYS B CD  
1127 C CE  . LYS B 46  ? 0.9609 0.8271 0.8075 0.0984  -0.1711 0.0292  92  LYS B CE  
1128 N NZ  . LYS B 46  ? 1.0460 0.8792 0.8507 0.1101  -0.1781 0.0414  92  LYS B NZ  
1129 N N   . HIS B 47  ? 0.7254 0.6017 0.6661 0.0693  -0.0954 0.0295  93  HIS B N   
1130 C CA  . HIS B 47  ? 0.7149 0.5853 0.6683 0.0679  -0.0880 0.0290  93  HIS B CA  
1131 C C   . HIS B 47  ? 0.6889 0.5778 0.6683 0.0767  -0.0938 0.0201  93  HIS B C   
1132 O O   . HIS B 47  ? 0.6623 0.5783 0.6599 0.0770  -0.0976 0.0128  93  HIS B O   
1133 C CB  . HIS B 47  ? 0.6843 0.5614 0.6452 0.0541  -0.0739 0.0274  93  HIS B CB  
1134 C CG  . HIS B 47  ? 0.7006 0.5647 0.6660 0.0500  -0.0672 0.0287  93  HIS B CG  
1135 N ND1 . HIS B 47  ? 0.7607 0.6038 0.7121 0.0424  -0.0600 0.0376  93  HIS B ND1 
1136 C CD2 . HIS B 47  ? 0.6690 0.5370 0.6503 0.0516  -0.0668 0.0218  93  HIS B CD2 
1137 C CE1 . HIS B 47  ? 0.7198 0.5541 0.6797 0.0385  -0.0574 0.0357  93  HIS B CE1 
1138 N NE2 . HIS B 47  ? 0.6954 0.5429 0.6710 0.0448  -0.0616 0.0256  93  HIS B NE2 
1139 N N   . GLN B 48  ? 0.6875 0.5606 0.6683 0.0835  -0.0935 0.0206  94  GLN B N   
1140 C CA  . GLN B 48  ? 0.6828 0.5707 0.6862 0.0945  -0.0967 0.0119  94  GLN B CA  
1141 C C   . GLN B 48  ? 0.6455 0.5597 0.6715 0.0870  -0.0873 0.0023  94  GLN B C   
1142 O O   . GLN B 48  ? 0.6391 0.5734 0.6856 0.0954  -0.0881 -0.0053 94  GLN B O   
1143 C CB  . GLN B 48  ? 0.7114 0.5690 0.7057 0.1035  -0.0971 0.0140  94  GLN B CB  
1144 C CG  . GLN B 48  ? 0.7314 0.5696 0.7184 0.0904  -0.0862 0.0145  94  GLN B CG  
1145 C CD  . GLN B 48  ? 0.8004 0.6098 0.7818 0.0984  -0.0869 0.0124  94  GLN B CD  
1146 O OE1 . GLN B 48  ? 0.8109 0.6248 0.8024 0.1144  -0.0913 0.0058  94  GLN B OE1 
1147 N NE2 . GLN B 48  ? 0.8247 0.6044 0.7909 0.0870  -0.0823 0.0177  94  GLN B NE2 
1148 N N   . PHE B 49  ? 0.6229 0.5368 0.6445 0.0723  -0.0779 0.0031  95  PHE B N   
1149 C CA  . PHE B 49  ? 0.6096 0.5440 0.6465 0.0649  -0.0694 -0.0042 95  PHE B CA  
1150 C C   . PHE B 49  ? 0.6018 0.5577 0.6451 0.0572  -0.0687 -0.0052 95  PHE B C   
1151 O O   . PHE B 49  ? 0.5875 0.5581 0.6407 0.0504  -0.0616 -0.0095 95  PHE B O   
1152 C CB  . PHE B 49  ? 0.6022 0.5228 0.6310 0.0545  -0.0611 -0.0031 95  PHE B CB  
1153 C CG  . PHE B 49  ? 0.6420 0.5398 0.6650 0.0587  -0.0613 -0.0046 95  PHE B CG  
1154 C CD1 . PHE B 49  ? 0.6612 0.5532 0.6876 0.0732  -0.0660 -0.0087 95  PHE B CD1 
1155 C CD2 . PHE B 49  ? 0.6580 0.5403 0.6732 0.0480  -0.0571 -0.0027 95  PHE B CD2 
1156 C CE1 . PHE B 49  ? 0.7038 0.5692 0.7214 0.0771  -0.0661 -0.0111 95  PHE B CE1 
1157 C CE2 . PHE B 49  ? 0.6804 0.5385 0.6890 0.0494  -0.0584 -0.0051 95  PHE B CE2 
1158 C CZ  . PHE B 49  ? 0.7207 0.5675 0.7283 0.0641  -0.0627 -0.0096 95  PHE B CZ  
1159 N N   . ALA B 50  ? 0.6134 0.5676 0.6480 0.0583  -0.0766 -0.0012 96  ALA B N   
1160 C CA  . ALA B 50  ? 0.6050 0.5721 0.6400 0.0502  -0.0771 -0.0026 96  ALA B CA  
1161 C C   . ALA B 50  ? 0.5913 0.5865 0.6501 0.0504  -0.0813 -0.0097 96  ALA B C   
1162 O O   . ALA B 50  ? 0.5936 0.5990 0.6564 0.0408  -0.0787 -0.0123 96  ALA B O   
1163 C CB  . ALA B 50  ? 0.6212 0.5729 0.6330 0.0512  -0.0843 0.0033  96  ALA B CB  
1164 N N   . TRP B 51  ? 0.6030 0.6108 0.6786 0.0613  -0.0873 -0.0127 97  TRP B N   
1165 C CA  . TRP B 51  ? 0.5996 0.6394 0.7028 0.0617  -0.0922 -0.0188 97  TRP B CA  
1166 C C   . TRP B 51  ? 0.5961 0.6549 0.7157 0.0493  -0.0805 -0.0234 97  TRP B C   
1167 O O   . TRP B 51  ? 0.5990 0.6774 0.7335 0.0416  -0.0844 -0.0265 97  TRP B O   
1168 C CB  . TRP B 51  ? 0.6082 0.6617 0.7307 0.0781  -0.0983 -0.0214 97  TRP B CB  
1169 C CG  . TRP B 51  ? 0.6213 0.6717 0.7494 0.0848  -0.0868 -0.0242 97  TRP B CG  
1170 C CD1 . TRP B 51  ? 0.6461 0.6674 0.7557 0.0926  -0.0850 -0.0214 97  TRP B CD1 
1171 C CD2 . TRP B 51  ? 0.6127 0.6873 0.7637 0.0836  -0.0749 -0.0307 97  TRP B CD2 
1172 N NE1 . TRP B 51  ? 0.6489 0.6735 0.7669 0.0969  -0.0743 -0.0271 97  TRP B NE1 
1173 C CE2 . TRP B 51  ? 0.6198 0.6774 0.7620 0.0923  -0.0671 -0.0326 97  TRP B CE2 
1174 C CE3 . TRP B 51  ? 0.6143 0.7216 0.7905 0.0749  -0.0693 -0.0348 97  TRP B CE3 
1175 C CZ2 . TRP B 51  ? 0.6183 0.6904 0.7730 0.0945  -0.0539 -0.0391 97  TRP B CZ2 
1176 C CZ3 . TRP B 51  ? 0.6112 0.7344 0.8020 0.0763  -0.0546 -0.0397 97  TRP B CZ3 
1177 C CH2 . TRP B 51  ? 0.6135 0.7190 0.7920 0.0870  -0.0469 -0.0420 97  TRP B CH2 
1178 N N   . PRO B 52  ? 0.5882 0.6392 0.7028 0.0462  -0.0670 -0.0235 98  PRO B N   
1179 C CA  . PRO B 52  ? 0.5731 0.6382 0.6978 0.0347  -0.0563 -0.0261 98  PRO B CA  
1180 C C   . PRO B 52  ? 0.5589 0.6136 0.6696 0.0217  -0.0559 -0.0236 98  PRO B C   
1181 O O   . PRO B 52  ? 0.5409 0.6048 0.6592 0.0115  -0.0490 -0.0251 98  PRO B O   
1182 C CB  . PRO B 52  ? 0.5686 0.6235 0.6850 0.0368  -0.0445 -0.0265 98  PRO B CB  
1183 C CG  . PRO B 52  ? 0.5880 0.6285 0.6975 0.0496  -0.0494 -0.0262 98  PRO B CG  
1184 C CD  . PRO B 52  ? 0.5884 0.6177 0.6880 0.0516  -0.0617 -0.0215 98  PRO B CD  
1185 N N   . PHE B 53  ? 0.5662 0.6003 0.6555 0.0226  -0.0622 -0.0197 99  PHE B N   
1186 C CA  . PHE B 53  ? 0.5645 0.5839 0.6361 0.0138  -0.0601 -0.0176 99  PHE B CA  
1187 C C   . PHE B 53  ? 0.5766 0.5927 0.6403 0.0112  -0.0715 -0.0189 99  PHE B C   
1188 O O   . PHE B 53  ? 0.5765 0.5774 0.6224 0.0057  -0.0700 -0.0182 99  PHE B O   
1189 C CB  . PHE B 53  ? 0.5795 0.5779 0.6310 0.0166  -0.0552 -0.0123 99  PHE B CB  
1190 C CG  . PHE B 53  ? 0.5774 0.5761 0.6332 0.0177  -0.0466 -0.0120 99  PHE B CG  
1191 C CD1 . PHE B 53  ? 0.5846 0.5848 0.6402 0.0114  -0.0382 -0.0124 99  PHE B CD1 
1192 C CD2 . PHE B 53  ? 0.5827 0.5776 0.6401 0.0254  -0.0479 -0.0118 99  PHE B CD2 
1193 C CE1 . PHE B 53  ? 0.5851 0.5847 0.6411 0.0127  -0.0322 -0.0128 99  PHE B CE1 
1194 C CE2 . PHE B 53  ? 0.5864 0.5788 0.6446 0.0259  -0.0415 -0.0132 99  PHE B CE2 
1195 C CZ  . PHE B 53  ? 0.5835 0.5795 0.6407 0.0196  -0.0341 -0.0140 99  PHE B CZ  
1196 N N   . ARG B 54  ? 0.5810 0.6108 0.6568 0.0162  -0.0836 -0.0215 100 ARG B N   
1197 C CA  . ARG B 54  ? 0.6036 0.6293 0.6687 0.0148  -0.0978 -0.0234 100 ARG B CA  
1198 C C   . ARG B 54  ? 0.6155 0.6549 0.6951 0.0017  -0.1017 -0.0298 100 ARG B C   
1199 O O   . ARG B 54  ? 0.6344 0.6672 0.7023 -0.0020 -0.1140 -0.0331 100 ARG B O   
1200 C CB  . ARG B 54  ? 0.6135 0.6478 0.6845 0.0269  -0.1122 -0.0230 100 ARG B CB  
1201 C CG  . ARG B 54  ? 0.6261 0.6375 0.6737 0.0383  -0.1119 -0.0158 100 ARG B CG  
1202 C CD  . ARG B 54  ? 0.6447 0.6632 0.6985 0.0518  -0.1268 -0.0149 100 ARG B CD  
1203 N NE  . ARG B 54  ? 0.6542 0.6486 0.6880 0.0624  -0.1245 -0.0072 100 ARG B NE  
1204 C CZ  . ARG B 54  ? 0.6431 0.6391 0.6862 0.0758  -0.1292 -0.0055 100 ARG B CZ  
1205 N NH1 . ARG B 54  ? 0.6326 0.6576 0.7073 0.0825  -0.1360 -0.0112 100 ARG B NH1 
1206 N NH2 . ARG B 54  ? 0.6599 0.6279 0.6813 0.0827  -0.1263 0.0022  100 ARG B NH2 
1207 N N   . GLN B 55  ? 0.6094 0.6661 0.7126 -0.0058 -0.0917 -0.0315 101 GLN B N   
1208 C CA  . GLN B 55  ? 0.6241 0.6934 0.7437 -0.0209 -0.0934 -0.0364 101 GLN B CA  
1209 C C   . GLN B 55  ? 0.6136 0.6803 0.7366 -0.0297 -0.0756 -0.0343 101 GLN B C   
1210 O O   . GLN B 55  ? 0.6046 0.6703 0.7261 -0.0227 -0.0643 -0.0306 101 GLN B O   
1211 C CB  . GLN B 55  ? 0.6241 0.7300 0.7806 -0.0211 -0.1031 -0.0409 101 GLN B CB  
1212 C CG  . GLN B 55  ? 0.6161 0.7463 0.7985 -0.0120 -0.0929 -0.0395 101 GLN B CG  
1213 C CD  . GLN B 55  ? 0.6253 0.7436 0.7933 0.0066  -0.0945 -0.0358 101 GLN B CD  
1214 O OE1 . GLN B 55  ? 0.6438 0.7574 0.8033 0.0160  -0.1096 -0.0354 101 GLN B OE1 
1215 N NE2 . GLN B 55  ? 0.5637 0.6741 0.7261 0.0114  -0.0797 -0.0330 101 GLN B NE2 
1216 N N   . PRO B 56  ? 0.6277 0.6909 0.7532 -0.0453 -0.0739 -0.0367 102 PRO B N   
1217 C CA  . PRO B 56  ? 0.6280 0.6869 0.7547 -0.0535 -0.0573 -0.0333 102 PRO B CA  
1218 C C   . PRO B 56  ? 0.6230 0.7103 0.7761 -0.0508 -0.0466 -0.0320 102 PRO B C   
1219 O O   . PRO B 56  ? 0.6228 0.7400 0.8043 -0.0484 -0.0524 -0.0354 102 PRO B O   
1220 C CB  . PRO B 56  ? 0.6477 0.7026 0.7797 -0.0722 -0.0602 -0.0367 102 PRO B CB  
1221 C CG  . PRO B 56  ? 0.6642 0.7068 0.7822 -0.0719 -0.0777 -0.0420 102 PRO B CG  
1222 C CD  . PRO B 56  ? 0.6461 0.7043 0.7692 -0.0563 -0.0877 -0.0424 102 PRO B CD  
1223 N N   . VAL B 57  ? 0.6213 0.6993 0.7640 -0.0497 -0.0316 -0.0274 103 VAL B N   
1224 C CA  . VAL B 57  ? 0.6101 0.7106 0.7716 -0.0481 -0.0187 -0.0266 103 VAL B CA  
1225 C C   . VAL B 57  ? 0.6278 0.7508 0.8166 -0.0642 -0.0137 -0.0279 103 VAL B C   
1226 O O   . VAL B 57  ? 0.6422 0.7496 0.8224 -0.0791 -0.0096 -0.0255 103 VAL B O   
1227 C CB  . VAL B 57  ? 0.6133 0.6946 0.7516 -0.0453 -0.0050 -0.0214 103 VAL B CB  
1228 C CG1 . VAL B 57  ? 0.5870 0.6887 0.7396 -0.0455 0.0103  -0.0209 103 VAL B CG1 
1229 C CG2 . VAL B 57  ? 0.5982 0.6630 0.7162 -0.0308 -0.0097 -0.0205 103 VAL B CG2 
1230 N N   . ASP B 58  ? 0.6298 0.7896 0.8528 -0.0612 -0.0142 -0.0315 104 ASP B N   
1231 C CA  . ASP B 58  ? 0.6421 0.8322 0.8988 -0.0764 -0.0064 -0.0323 104 ASP B CA  
1232 C C   . ASP B 58  ? 0.6515 0.8506 0.9096 -0.0735 0.0161  -0.0286 104 ASP B C   
1233 O O   . ASP B 58  ? 0.6361 0.8593 0.9108 -0.0596 0.0213  -0.0312 104 ASP B O   
1234 C CB  . ASP B 58  ? 0.6375 0.8672 0.9340 -0.0730 -0.0196 -0.0385 104 ASP B CB  
1235 C CG  . ASP B 58  ? 0.6427 0.9082 0.9804 -0.0919 -0.0139 -0.0399 104 ASP B CG  
1236 O OD1 . ASP B 58  ? 0.6647 0.9308 1.0038 -0.1039 0.0061  -0.0352 104 ASP B OD1 
1237 O OD2 . ASP B 58  ? 0.6471 0.9411 1.0162 -0.0951 -0.0299 -0.0452 104 ASP B OD2 
1238 N N   . ALA B 59  ? 0.6749 0.8510 0.9115 -0.0853 0.0291  -0.0226 105 ALA B N   
1239 C CA  . ALA B 59  ? 0.6962 0.8720 0.9225 -0.0829 0.0505  -0.0179 105 ALA B CA  
1240 C C   . ALA B 59  ? 0.7076 0.9263 0.9719 -0.0873 0.0657  -0.0191 105 ALA B C   
1241 O O   . ALA B 59  ? 0.7097 0.9374 0.9702 -0.0767 0.0810  -0.0187 105 ALA B O   
1242 C CB  . ALA B 59  ? 0.7143 0.8552 0.9093 -0.0957 0.0592  -0.0100 105 ALA B CB  
1243 N N   . VAL B 60  ? 0.7216 0.9672 1.0224 -0.1031 0.0614  -0.0210 106 VAL B N   
1244 C CA  . VAL B 60  ? 0.7344 1.0291 1.0808 -0.1082 0.0751  -0.0224 106 VAL B CA  
1245 C C   . VAL B 60  ? 0.7273 1.0549 1.0988 -0.0851 0.0689  -0.0298 106 VAL B C   
1246 O O   . VAL B 60  ? 0.7270 1.0792 1.1120 -0.0749 0.0866  -0.0307 106 VAL B O   
1247 C CB  . VAL B 60  ? 0.7428 1.0598 1.1261 -0.1330 0.0685  -0.0233 106 VAL B CB  
1248 C CG1 . VAL B 60  ? 0.7365 1.1127 1.1754 -0.1377 0.0817  -0.0252 106 VAL B CG1 
1249 C CG2 . VAL B 60  ? 0.7727 1.0532 1.1302 -0.1562 0.0767  -0.0156 106 VAL B CG2 
1250 N N   . LYS B 61  ? 0.7266 1.0512 1.1007 -0.0759 0.0444  -0.0349 107 LYS B N   
1251 C CA  . LYS B 61  ? 0.7258 1.0770 1.1222 -0.0535 0.0350  -0.0412 107 LYS B CA  
1252 C C   . LYS B 61  ? 0.7227 1.0543 1.0899 -0.0311 0.0441  -0.0417 107 LYS B C   
1253 O O   . LYS B 61  ? 0.7237 1.0815 1.1112 -0.0144 0.0513  -0.0458 107 LYS B O   
1254 C CB  . LYS B 61  ? 0.7275 1.0704 1.1226 -0.0494 0.0061  -0.0447 107 LYS B CB  
1255 C CG  . LYS B 61  ? 0.7448 1.1230 1.1736 -0.0307 -0.0076 -0.0505 107 LYS B CG  
1256 C CD  . LYS B 61  ? 0.7652 1.1221 1.1687 -0.0041 -0.0100 -0.0514 107 LYS B CD  
1257 C CE  . LYS B 61  ? 0.7835 1.1681 1.2155 0.0156  -0.0267 -0.0560 107 LYS B CE  
1258 N NZ  . LYS B 61  ? 0.8025 1.1781 1.2295 0.0123  -0.0541 -0.0565 107 LYS B NZ  
1259 N N   . LEU B 62  ? 0.7219 1.0076 1.0425 -0.0308 0.0432  -0.0380 108 LEU B N   
1260 C CA  . LEU B 62  ? 0.7239 0.9862 1.0137 -0.0126 0.0486  -0.0390 108 LEU B CA  
1261 C C   . LEU B 62  ? 0.7354 0.9952 1.0105 -0.0137 0.0731  -0.0368 108 LEU B C   
1262 O O   . LEU B 62  ? 0.7486 0.9908 0.9985 0.0009  0.0782  -0.0391 108 LEU B O   
1263 C CB  . LEU B 62  ? 0.7211 0.9395 0.9714 -0.0115 0.0348  -0.0364 108 LEU B CB  
1264 C CG  . LEU B 62  ? 0.7196 0.9346 0.9746 -0.0050 0.0122  -0.0387 108 LEU B CG  
1265 C CD1 . LEU B 62  ? 0.7104 0.8859 0.9295 -0.0086 0.0023  -0.0349 108 LEU B CD1 
1266 C CD2 . LEU B 62  ? 0.7166 0.9396 0.9793 0.0171  0.0074  -0.0433 108 LEU B CD2 
1267 N N   . GLY B 63  ? 0.7462 1.0212 1.0345 -0.0316 0.0881  -0.0323 109 GLY B N   
1268 C CA  . GLY B 63  ? 0.7677 1.0394 1.0386 -0.0339 0.1130  -0.0286 109 GLY B CA  
1269 C C   . GLY B 63  ? 0.7837 1.0082 1.0023 -0.0356 0.1138  -0.0232 109 GLY B C   
1270 O O   . GLY B 63  ? 0.7979 1.0073 0.9883 -0.0230 0.1221  -0.0248 109 GLY B O   
1271 N N   . LEU B 64  ? 0.7824 0.9834 0.9878 -0.0505 0.1043  -0.0174 110 LEU B N   
1272 C CA  . LEU B 64  ? 0.7887 0.9468 0.9482 -0.0516 0.1026  -0.0117 110 LEU B CA  
1273 C C   . LEU B 64  ? 0.8009 0.9445 0.9511 -0.0723 0.1113  -0.0023 110 LEU B C   
1274 O O   . LEU B 64  ? 0.8009 0.9252 0.9456 -0.0813 0.0987  0.0001  110 LEU B O   
1275 C CB  . LEU B 64  ? 0.7766 0.9126 0.9237 -0.0446 0.0800  -0.0140 110 LEU B CB  
1276 C CG  . LEU B 64  ? 0.7631 0.9086 0.9200 -0.0268 0.0687  -0.0220 110 LEU B CG  
1277 C CD1 . LEU B 64  ? 0.7455 0.8687 0.8900 -0.0240 0.0490  -0.0221 110 LEU B CD1 
1278 C CD2 . LEU B 64  ? 0.7772 0.9163 0.9144 -0.0123 0.0777  -0.0253 110 LEU B CD2 
1279 N N   . PRO B 65  ? 0.8143 0.9646 0.9602 -0.0795 0.1339  0.0031  111 PRO B N   
1280 C CA  . PRO B 65  ? 0.8240 0.9600 0.9625 -0.1009 0.1446  0.0133  111 PRO B CA  
1281 C C   . PRO B 65  ? 0.8202 0.9071 0.9136 -0.1026 0.1374  0.0209  111 PRO B C   
1282 O O   . PRO B 65  ? 0.8364 0.9047 0.9252 -0.1195 0.1385  0.0279  111 PRO B O   
1283 C CB  . PRO B 65  ? 0.8511 1.0020 0.9864 -0.1031 0.1723  0.0178  111 PRO B CB  
1284 C CG  . PRO B 65  ? 0.8438 1.0267 0.9983 -0.0843 0.1754  0.0078  111 PRO B CG  
1285 C CD  . PRO B 65  ? 0.8260 0.9933 0.9690 -0.0674 0.1518  0.0004  111 PRO B CD  
1286 N N   . ASP B 66  ? 0.7906 0.8571 0.8524 -0.0852 0.1297  0.0193  112 ASP B N   
1287 C CA  . ASP B 66  ? 0.7887 0.8136 0.8101 -0.0834 0.1224  0.0263  112 ASP B CA  
1288 C C   . ASP B 66  ? 0.7380 0.7506 0.7605 -0.0767 0.0998  0.0218  112 ASP B C   
1289 O O   . ASP B 66  ? 0.7282 0.7105 0.7220 -0.0723 0.0921  0.0264  112 ASP B O   
1290 C CB  . ASP B 66  ? 0.8120 0.8224 0.7960 -0.0696 0.1284  0.0282  112 ASP B CB  
1291 C CG  . ASP B 66  ? 0.8068 0.8319 0.7963 -0.0521 0.1196  0.0172  112 ASP B CG  
1292 O OD1 . ASP B 66  ? 0.7693 0.8207 0.7936 -0.0499 0.1142  0.0091  112 ASP B OD1 
1293 O OD2 . ASP B 66  ? 0.8632 0.8717 0.8207 -0.0406 0.1174  0.0167  112 ASP B OD2 
1294 N N   . TYR B 67  ? 0.7004 0.7369 0.7552 -0.0752 0.0897  0.0133  113 TYR B N   
1295 C CA  . TYR B 67  ? 0.6798 0.7059 0.7333 -0.0674 0.0703  0.0091  113 TYR B CA  
1296 C C   . TYR B 67  ? 0.6892 0.6855 0.7271 -0.0758 0.0641  0.0143  113 TYR B C   
1297 O O   . TYR B 67  ? 0.6842 0.6586 0.7008 -0.0667 0.0550  0.0157  113 TYR B O   
1298 C CB  . TYR B 67  ? 0.6511 0.7049 0.7387 -0.0656 0.0605  0.0006  113 TYR B CB  
1299 C CG  . TYR B 67  ? 0.6353 0.6766 0.7163 -0.0565 0.0429  -0.0028 113 TYR B CG  
1300 C CD1 . TYR B 67  ? 0.6209 0.6610 0.6934 -0.0415 0.0374  -0.0058 113 TYR B CD1 
1301 C CD2 . TYR B 67  ? 0.6378 0.6663 0.7189 -0.0637 0.0328  -0.0029 113 TYR B CD2 
1302 C CE1 . TYR B 67  ? 0.6035 0.6329 0.6704 -0.0348 0.0239  -0.0075 113 TYR B CE1 
1303 C CE2 . TYR B 67  ? 0.6248 0.6418 0.6972 -0.0548 0.0195  -0.0053 113 TYR B CE2 
1304 C CZ  . TYR B 67  ? 0.6026 0.6214 0.6691 -0.0408 0.0159  -0.0069 113 TYR B CZ  
1305 O OH  . TYR B 67  ? 0.5883 0.5970 0.6472 -0.0335 0.0051  -0.0081 113 TYR B OH  
1306 N N   . HIS B 68  ? 0.7027 0.6984 0.7521 -0.0930 0.0693  0.0168  114 HIS B N   
1307 C CA  . HIS B 68  ? 0.7274 0.6906 0.7610 -0.1014 0.0634  0.0204  114 HIS B CA  
1308 C C   . HIS B 68  ? 0.7622 0.6904 0.7596 -0.1011 0.0717  0.0311  114 HIS B C   
1309 O O   . HIS B 68  ? 0.7797 0.6754 0.7574 -0.1016 0.0657  0.0343  114 HIS B O   
1310 C CB  . HIS B 68  ? 0.7364 0.7087 0.7956 -0.1214 0.0632  0.0179  114 HIS B CB  
1311 C CG  . HIS B 68  ? 0.7208 0.7195 0.8088 -0.1193 0.0490  0.0076  114 HIS B CG  
1312 N ND1 . HIS B 68  ? 0.7102 0.6937 0.7886 -0.1118 0.0328  0.0026  114 HIS B ND1 
1313 C CD2 . HIS B 68  ? 0.7142 0.7533 0.8385 -0.1216 0.0485  0.0018  114 HIS B CD2 
1314 C CE1 . HIS B 68  ? 0.6993 0.7099 0.8035 -0.1104 0.0222  -0.0053 114 HIS B CE1 
1315 N NE2 . HIS B 68  ? 0.7082 0.7534 0.8419 -0.1156 0.0305  -0.0060 114 HIS B NE2 
1316 N N   . LYS B 69  ? 0.7660 0.6994 0.7522 -0.0986 0.0851  0.0364  115 LYS B N   
1317 C CA  . LYS B 69  ? 0.8067 0.7073 0.7536 -0.0943 0.0910  0.0469  115 LYS B CA  
1318 C C   . LYS B 69  ? 0.7921 0.6815 0.7199 -0.0744 0.0771  0.0452  115 LYS B C   
1319 O O   . LYS B 69  ? 0.8263 0.6848 0.7266 -0.0687 0.0728  0.0520  115 LYS B O   
1320 C CB  . LYS B 69  ? 0.8300 0.7400 0.7663 -0.0956 0.1090  0.0522  115 LYS B CB  
1321 C CG  . LYS B 69  ? 0.8672 0.7972 0.8276 -0.1151 0.1267  0.0542  115 LYS B CG  
1322 C CD  . LYS B 69  ? 0.9143 0.8139 0.8487 -0.1291 0.1419  0.0680  115 LYS B CD  
1323 C CE  . LYS B 69  ? 0.9502 0.8763 0.9065 -0.1461 0.1645  0.0711  115 LYS B CE  
1324 N NZ  . LYS B 69  ? 0.9281 0.8896 0.9361 -0.1597 0.1609  0.0622  115 LYS B NZ  
1325 N N   . ILE B 70  ? 0.7498 0.6649 0.6937 -0.0641 0.0701  0.0364  116 ILE B N   
1326 C CA  . ILE B 70  ? 0.7189 0.6294 0.6502 -0.0475 0.0578  0.0342  116 ILE B CA  
1327 C C   . ILE B 70  ? 0.6921 0.5999 0.6347 -0.0433 0.0440  0.0298  116 ILE B C   
1328 O O   . ILE B 70  ? 0.7012 0.5934 0.6289 -0.0335 0.0359  0.0323  116 ILE B O   
1329 C CB  . ILE B 70  ? 0.7040 0.6384 0.6428 -0.0393 0.0583  0.0274  116 ILE B CB  
1330 C CG1 . ILE B 70  ? 0.7256 0.6566 0.6425 -0.0397 0.0721  0.0320  116 ILE B CG1 
1331 C CG2 . ILE B 70  ? 0.6612 0.5941 0.5948 -0.0257 0.0437  0.0237  116 ILE B CG2 
1332 C CD1 . ILE B 70  ? 0.7514 0.7074 0.6802 -0.0356 0.0789  0.0242  116 ILE B CD1 
1333 N N   . ILE B 71  ? 0.6667 0.5907 0.6350 -0.0500 0.0414  0.0232  117 ILE B N   
1334 C CA  . ILE B 71  ? 0.6564 0.5772 0.6321 -0.0464 0.0296  0.0187  117 ILE B CA  
1335 C C   . ILE B 71  ? 0.6863 0.5860 0.6581 -0.0571 0.0295  0.0201  117 ILE B C   
1336 O O   . ILE B 71  ? 0.6887 0.5972 0.6770 -0.0707 0.0319  0.0174  117 ILE B O   
1337 C CB  . ILE B 71  ? 0.6295 0.5776 0.6306 -0.0448 0.0240  0.0103  117 ILE B CB  
1338 C CG1 . ILE B 71  ? 0.6198 0.5813 0.6211 -0.0335 0.0229  0.0083  117 ILE B CG1 
1339 C CG2 . ILE B 71  ? 0.6179 0.5603 0.6222 -0.0423 0.0132  0.0064  117 ILE B CG2 
1340 C CD1 . ILE B 71  ? 0.6043 0.5520 0.5879 -0.0228 0.0168  0.0111  117 ILE B CD1 
1341 N N   . LYS B 72  ? 0.7075 0.5796 0.6584 -0.0506 0.0258  0.0238  118 LYS B N   
1342 C CA  . LYS B 72  ? 0.7578 0.6007 0.6977 -0.0591 0.0259  0.0252  118 LYS B CA  
1343 C C   . LYS B 72  ? 0.7401 0.5802 0.6865 -0.0589 0.0164  0.0169  118 LYS B C   
1344 O O   . LYS B 72  ? 0.7610 0.5823 0.7041 -0.0702 0.0152  0.0145  118 LYS B O   
1345 C CB  . LYS B 72  ? 0.8024 0.6127 0.7132 -0.0498 0.0273  0.0336  118 LYS B CB  
1346 C CG  . LYS B 72  ? 0.8359 0.6414 0.7324 -0.0514 0.0366  0.0430  118 LYS B CG  
1347 C CD  . LYS B 72  ? 0.8794 0.6902 0.7858 -0.0716 0.0475  0.0444  118 LYS B CD  
1348 C CE  . LYS B 72  ? 0.9392 0.7288 0.8214 -0.0762 0.0591  0.0561  118 LYS B CE  
1349 N NZ  . LYS B 72  ? 0.9747 0.7744 0.8720 -0.0976 0.0718  0.0575  118 LYS B NZ  
1350 N N   . GLN B 73  ? 0.7030 0.5596 0.6564 -0.0469 0.0099  0.0126  119 GLN B N   
1351 C CA  . GLN B 73  ? 0.7094 0.5657 0.6664 -0.0457 0.0017  0.0050  119 GLN B CA  
1352 C C   . GLN B 73  ? 0.6727 0.5613 0.6513 -0.0448 -0.0030 0.0001  119 GLN B C   
1353 O O   . GLN B 73  ? 0.6487 0.5471 0.6282 -0.0331 -0.0057 -0.0001 119 GLN B O   
1354 C CB  . GLN B 73  ? 0.7298 0.5692 0.6698 -0.0305 -0.0007 0.0055  119 GLN B CB  
1355 C CG  . GLN B 73  ? 0.7669 0.5984 0.7023 -0.0294 -0.0072 -0.0022 119 GLN B CG  
1356 C CD  . GLN B 73  ? 0.7931 0.6173 0.7165 -0.0125 -0.0069 -0.0019 119 GLN B CD  
1357 O OE1 . GLN B 73  ? 0.8290 0.6502 0.7466 -0.0090 -0.0104 -0.0075 119 GLN B OE1 
1358 N NE2 . GLN B 73  ? 0.8221 0.6448 0.7418 -0.0017 -0.0027 0.0047  119 GLN B NE2 
1359 N N   . PRO B 74  ? 0.6616 0.5670 0.6590 -0.0572 -0.0041 -0.0036 120 PRO B N   
1360 C CA  . PRO B 74  ? 0.6433 0.5770 0.6605 -0.0541 -0.0100 -0.0082 120 PRO B CA  
1361 C C   . PRO B 74  ? 0.6356 0.5627 0.6445 -0.0470 -0.0199 -0.0127 120 PRO B C   
1362 O O   . PRO B 74  ? 0.6417 0.5467 0.6356 -0.0499 -0.0236 -0.0155 120 PRO B O   
1363 C CB  . PRO B 74  ? 0.6538 0.6051 0.6936 -0.0690 -0.0104 -0.0116 120 PRO B CB  
1364 C CG  . PRO B 74  ? 0.6825 0.6169 0.7152 -0.0812 -0.0014 -0.0071 120 PRO B CG  
1365 C CD  . PRO B 74  ? 0.6933 0.5921 0.6960 -0.0745 -0.0009 -0.0037 120 PRO B CD  
1366 N N   . MET B 75  ? 0.6069 0.5497 0.6222 -0.0374 -0.0233 -0.0132 121 MET B N   
1367 C CA  . MET B 75  ? 0.6125 0.5497 0.6182 -0.0308 -0.0313 -0.0161 121 MET B CA  
1368 C C   . MET B 75  ? 0.6020 0.5604 0.6217 -0.0252 -0.0364 -0.0169 121 MET B C   
1369 O O   . MET B 75  ? 0.5883 0.5605 0.6196 -0.0219 -0.0319 -0.0145 121 MET B O   
1370 C CB  . MET B 75  ? 0.6078 0.5280 0.5943 -0.0206 -0.0268 -0.0125 121 MET B CB  
1371 C CG  . MET B 75  ? 0.6353 0.5450 0.6061 -0.0142 -0.0316 -0.0150 121 MET B CG  
1372 S SD  . MET B 75  ? 0.6708 0.5634 0.6280 -0.0223 -0.0411 -0.0232 121 MET B SD  
1373 C CE  . MET B 75  ? 0.7179 0.5857 0.6648 -0.0287 -0.0347 -0.0232 121 MET B CE  
1374 N N   . ASP B 76  ? 0.6173 0.5747 0.6324 -0.0234 -0.0463 -0.0204 122 ASP B N   
1375 C CA  . ASP B 76  ? 0.6053 0.5782 0.6304 -0.0171 -0.0533 -0.0206 122 ASP B CA  
1376 C C   . ASP B 76  ? 0.6146 0.5736 0.6188 -0.0114 -0.0615 -0.0213 122 ASP B C   
1377 O O   . ASP B 76  ? 0.6117 0.5524 0.5968 -0.0140 -0.0628 -0.0239 122 ASP B O   
1378 C CB  . ASP B 76  ? 0.6058 0.6018 0.6562 -0.0232 -0.0597 -0.0249 122 ASP B CB  
1379 C CG  . ASP B 76  ? 0.6317 0.6245 0.6806 -0.0325 -0.0704 -0.0308 122 ASP B CG  
1380 O OD1 . ASP B 76  ? 0.6561 0.6388 0.7024 -0.0435 -0.0665 -0.0324 122 ASP B OD1 
1381 O OD2 . ASP B 76  ? 0.6411 0.6392 0.6896 -0.0289 -0.0839 -0.0338 122 ASP B OD2 
1382 N N   A MET B 77  ? 0.6115 0.5759 0.6159 -0.0033 -0.0665 -0.0190 123 MET B N   
1383 N N   B MET B 77  ? 0.6172 0.5818 0.6220 -0.0032 -0.0664 -0.0190 123 MET B N   
1384 C CA  A MET B 77  ? 0.6334 0.5823 0.6133 0.0029  -0.0727 -0.0178 123 MET B CA  
1385 C CA  B MET B 77  ? 0.6437 0.5938 0.6248 0.0032  -0.0732 -0.0178 123 MET B CA  
1386 C C   A MET B 77  ? 0.6572 0.6040 0.6297 -0.0006 -0.0875 -0.0243 123 MET B C   
1387 C C   B MET B 77  ? 0.6633 0.6098 0.6359 -0.0010 -0.0870 -0.0244 123 MET B C   
1388 O O   A MET B 77  ? 0.6818 0.6096 0.6258 0.0026  -0.0915 -0.0251 123 MET B O   
1389 O O   B MET B 77  ? 0.6879 0.6145 0.6319 0.0014  -0.0899 -0.0255 123 MET B O   
1390 C CB  A MET B 77  ? 0.6339 0.5851 0.6138 0.0121  -0.0740 -0.0121 123 MET B CB  
1391 C CB  B MET B 77  ? 0.6517 0.6073 0.6362 0.0121  -0.0773 -0.0132 123 MET B CB  
1392 C CG  A MET B 77  ? 0.6171 0.5640 0.5968 0.0146  -0.0610 -0.0059 123 MET B CG  
1393 C CG  B MET B 77  ? 0.6492 0.6038 0.6380 0.0158  -0.0662 -0.0072 123 MET B CG  
1394 S SD  A MET B 77  ? 0.6180 0.5570 0.5897 0.0229  -0.0619 0.0016  123 MET B SD  
1395 S SD  B MET B 77  ? 0.6842 0.6381 0.6743 0.0256  -0.0727 -0.0025 123 MET B SD  
1396 C CE  A MET B 77  ? 0.6224 0.5774 0.6155 0.0275  -0.0736 -0.0018 123 MET B CE  
1397 C CE  B MET B 77  ? 0.6361 0.5858 0.6311 0.0251  -0.0597 0.0024  123 MET B CE  
1398 N N   . GLY B 78  ? 0.6577 0.6247 0.6554 -0.0074 -0.0955 -0.0293 124 GLY B N   
1399 C CA  . GLY B 78  ? 0.6751 0.6437 0.6710 -0.0137 -0.1116 -0.0367 124 GLY B CA  
1400 C C   . GLY B 78  ? 0.6921 0.6378 0.6681 -0.0231 -0.1099 -0.0419 124 GLY B C   
1401 O O   . GLY B 78  ? 0.7216 0.6502 0.6726 -0.0233 -0.1208 -0.0470 124 GLY B O   
1402 N N   . THR B 79  ? 0.6822 0.6247 0.6661 -0.0299 -0.0966 -0.0407 125 THR B N   
1403 C CA  . THR B 79  ? 0.6957 0.6110 0.6584 -0.0363 -0.0924 -0.0444 125 THR B CA  
1404 C C   . THR B 79  ? 0.7136 0.6022 0.6399 -0.0247 -0.0874 -0.0427 125 THR B C   
1405 O O   . THR B 79  ? 0.7361 0.6007 0.6352 -0.0256 -0.0929 -0.0491 125 THR B O   
1406 C CB  . THR B 79  ? 0.6841 0.5996 0.6601 -0.0425 -0.0780 -0.0407 125 THR B CB  
1407 O OG1 . THR B 79  ? 0.6918 0.6311 0.6995 -0.0548 -0.0807 -0.0424 125 THR B OG1 
1408 C CG2 . THR B 79  ? 0.6770 0.5593 0.6284 -0.0463 -0.0731 -0.0434 125 THR B CG2 
1409 N N   . ILE B 80  ? 0.6989 0.5920 0.6250 -0.0141 -0.0766 -0.0347 126 ILE B N   
1410 C CA  . ILE B 80  ? 0.7206 0.5948 0.6180 -0.0032 -0.0687 -0.0315 126 ILE B CA  
1411 C C   . ILE B 80  ? 0.7618 0.6243 0.6322 0.0016  -0.0794 -0.0344 126 ILE B C   
1412 O O   . ILE B 80  ? 0.7838 0.6221 0.6221 0.0060  -0.0769 -0.0377 126 ILE B O   
1413 C CB  . ILE B 80  ? 0.6986 0.5851 0.6070 0.0044  -0.0572 -0.0221 126 ILE B CB  
1414 C CG1 . ILE B 80  ? 0.6807 0.5739 0.6073 0.0017  -0.0468 -0.0193 126 ILE B CG1 
1415 C CG2 . ILE B 80  ? 0.7094 0.5814 0.5920 0.0143  -0.0486 -0.0179 126 ILE B CG2 
1416 C CD1 . ILE B 80  ? 0.6352 0.5423 0.5756 0.0067  -0.0390 -0.0118 126 ILE B CD1 
1417 N N   . LYS B 81  ? 0.7647 0.6432 0.6460 0.0024  -0.0913 -0.0332 127 LYS B N   
1418 C CA  . LYS B 81  ? 0.8043 0.6724 0.6591 0.0078  -0.1044 -0.0350 127 LYS B CA  
1419 C C   . LYS B 81  ? 0.8412 0.6922 0.6756 0.0010  -0.1172 -0.0464 127 LYS B C   
1420 O O   . LYS B 81  ? 0.8799 0.7061 0.6748 0.0067  -0.1193 -0.0493 127 LYS B O   
1421 C CB  . LYS B 81  ? 0.7947 0.6852 0.6707 0.0102  -0.1173 -0.0321 127 LYS B CB  
1422 C CG  . LYS B 81  ? 0.8451 0.7254 0.6932 0.0178  -0.1333 -0.0320 127 LYS B CG  
1423 C CD  . LYS B 81  ? 0.8458 0.7485 0.7181 0.0231  -0.1451 -0.0280 127 LYS B CD  
1424 C CE  . LYS B 81  ? 0.9026 0.8017 0.7558 0.0283  -0.1685 -0.0311 127 LYS B CE  
1425 N NZ  . LYS B 81  ? 0.9206 0.8337 0.7898 0.0174  -0.1863 -0.0432 127 LYS B NZ  
1426 N N   . ARG B 82  ? 0.8426 0.7058 0.7029 -0.0118 -0.1251 -0.0531 128 ARG B N   
1427 C CA  . ARG B 82  ? 0.8898 0.7361 0.7348 -0.0220 -0.1383 -0.0649 128 ARG B CA  
1428 C C   . ARG B 82  ? 0.9068 0.7171 0.7171 -0.0196 -0.1266 -0.0686 128 ARG B C   
1429 O O   . ARG B 82  ? 0.9380 0.7217 0.7126 -0.0192 -0.1357 -0.0774 128 ARG B O   
1430 C CB  . ARG B 82  ? 0.8957 0.7630 0.7800 -0.0388 -0.1447 -0.0696 128 ARG B CB  
1431 C CG  . ARG B 82  ? 0.9867 0.8328 0.8575 -0.0531 -0.1565 -0.0819 128 ARG B CG  
1432 C CD  . ARG B 82  ? 1.0317 0.9048 0.9450 -0.0719 -0.1666 -0.0863 128 ARG B CD  
1433 N NE  . ARG B 82  ? 1.0446 0.9317 0.9887 -0.0779 -0.1485 -0.0793 128 ARG B NE  
1434 C CZ  . ARG B 82  ? 1.0491 0.9714 1.0289 -0.0749 -0.1418 -0.0717 128 ARG B CZ  
1435 N NH1 . ARG B 82  ? 1.0529 1.0010 1.0459 -0.0654 -0.1516 -0.0697 128 ARG B NH1 
1436 N NH2 . ARG B 82  ? 1.0453 0.9743 1.0448 -0.0805 -0.1251 -0.0661 128 ARG B NH2 
1437 N N   . ARG B 83  ? 0.8770 0.6860 0.6966 -0.0168 -0.1071 -0.0624 129 ARG B N   
1438 C CA  . ARG B 83  ? 0.8962 0.6740 0.6866 -0.0108 -0.0941 -0.0647 129 ARG B CA  
1439 C C   . ARG B 83  ? 0.9238 0.6840 0.6751 0.0043  -0.0886 -0.0635 129 ARG B C   
1440 O O   . ARG B 83  ? 0.9575 0.6862 0.6721 0.0085  -0.0873 -0.0712 129 ARG B O   
1441 C CB  . ARG B 83  ? 0.8684 0.6540 0.6802 -0.0086 -0.0762 -0.0567 129 ARG B CB  
1442 C CG  . ARG B 83  ? 0.8662 0.6552 0.7024 -0.0231 -0.0782 -0.0588 129 ARG B CG  
1443 C CD  . ARG B 83  ? 0.8594 0.6577 0.7149 -0.0199 -0.0625 -0.0498 129 ARG B CD  
1444 N NE  . ARG B 83  ? 0.8695 0.6602 0.7368 -0.0328 -0.0621 -0.0514 129 ARG B NE  
1445 C CZ  . ARG B 83  ? 0.8744 0.6620 0.7492 -0.0311 -0.0503 -0.0449 129 ARG B CZ  
1446 N NH1 . ARG B 83  ? 0.8208 0.6156 0.6962 -0.0172 -0.0391 -0.0374 129 ARG B NH1 
1447 N NH2 . ARG B 83  ? 0.9155 0.6921 0.7966 -0.0442 -0.0501 -0.0457 129 ARG B NH2 
1448 N N   . LEU B 84  ? 0.9046 0.6830 0.6620 0.0121  -0.0845 -0.0538 130 LEU B N   
1449 C CA  . LEU B 84  ? 0.9368 0.7005 0.6578 0.0248  -0.0781 -0.0505 130 LEU B CA  
1450 C C   . LEU B 84  ? 0.9899 0.7329 0.6731 0.0247  -0.0961 -0.0597 130 LEU B C   
1451 O O   . LEU B 84  ? 1.0283 0.7446 0.6683 0.0337  -0.0904 -0.0630 130 LEU B O   
1452 C CB  . LEU B 84  ? 0.9043 0.6898 0.6410 0.0301  -0.0722 -0.0376 130 LEU B CB  
1453 C CG  . LEU B 84  ? 0.8645 0.6660 0.6287 0.0323  -0.0532 -0.0286 130 LEU B CG  
1454 C CD1 . LEU B 84  ? 0.8181 0.6419 0.6060 0.0324  -0.0530 -0.0183 130 LEU B CD1 
1455 C CD2 . LEU B 84  ? 0.8766 0.6634 0.6172 0.0427  -0.0339 -0.0262 130 LEU B CD2 
1456 N N   . GLU B 85  ? 0.9968 0.7533 0.6967 0.0151  -0.1178 -0.0642 131 GLU B N   
1457 C CA  . GLU B 85  ? 1.0479 0.7893 0.7165 0.0139  -0.1400 -0.0734 131 GLU B CA  
1458 C C   . GLU B 85  ? 1.0989 0.8106 0.7427 0.0064  -0.1474 -0.0887 131 GLU B C   
1459 O O   . GLU B 85  ? 1.1481 0.8330 0.7465 0.0102  -0.1585 -0.0972 131 GLU B O   
1460 C CB  . GLU B 85  ? 1.0302 0.8020 0.7326 0.0066  -0.1616 -0.0731 131 GLU B CB  
1461 C CG  . GLU B 85  ? 1.0148 0.8067 0.7300 0.0165  -0.1583 -0.0595 131 GLU B CG  
1462 C CD  . GLU B 85  ? 1.0070 0.8329 0.7643 0.0117  -0.1758 -0.0587 131 GLU B CD  
1463 O OE1 . GLU B 85  ? 1.0154 0.8554 0.7985 -0.0011 -0.1889 -0.0680 131 GLU B OE1 
1464 O OE2 . GLU B 85  ? 1.0150 0.8535 0.7804 0.0208  -0.1757 -0.0487 131 GLU B OE2 
1465 N N   . ASN B 86  ? 1.0894 0.8023 0.7594 -0.0040 -0.1415 -0.0922 132 ASN B N   
1466 C CA  . ASN B 86  ? 1.1367 0.8171 0.7852 -0.0128 -0.1477 -0.1063 132 ASN B CA  
1467 C C   . ASN B 86  ? 1.1524 0.7982 0.7668 -0.0008 -0.1268 -0.1080 132 ASN B C   
1468 O O   . ASN B 86  ? 1.1771 0.7916 0.7740 -0.0063 -0.1285 -0.1190 132 ASN B O   
1469 C CB  . ASN B 86  ? 1.1257 0.8215 0.8183 -0.0319 -0.1529 -0.1087 132 ASN B CB  
1470 C CG  . ASN B 86  ? 1.1412 0.8694 0.8667 -0.0451 -0.1757 -0.1109 132 ASN B CG  
1471 O OD1 . ASN B 86  ? 1.1960 0.9251 0.9033 -0.0425 -0.1946 -0.1155 132 ASN B OD1 
1472 N ND2 . ASN B 86  ? 1.1277 0.8833 0.9015 -0.0586 -0.1740 -0.1075 132 ASN B ND2 
1473 N N   . ASN B 87  ? 1.1357 0.7871 0.7421 0.0155  -0.1069 -0.0974 133 ASN B N   
1474 C CA  . ASN B 87  ? 1.1561 0.7828 0.7365 0.0297  -0.0848 -0.0976 133 ASN B CA  
1475 C C   . ASN B 87  ? 1.1333 0.7534 0.7361 0.0251  -0.0760 -0.0988 133 ASN B C   
1476 O O   . ASN B 87  ? 1.1721 0.7564 0.7467 0.0298  -0.0710 -0.1078 133 ASN B O   
1477 C CB  . ASN B 87  ? 1.2279 0.8127 0.7473 0.0379  -0.0887 -0.1103 133 ASN B CB  
1478 C CG  . ASN B 87  ? 1.2719 0.8593 0.7617 0.0448  -0.0957 -0.1074 133 ASN B CG  
1479 O OD1 . ASN B 87  ? 1.3541 0.9118 0.7965 0.0466  -0.1085 -0.1188 133 ASN B OD1 
1480 N ND2 . ASN B 87  ? 1.2468 0.8667 0.7616 0.0486  -0.0881 -0.0921 133 ASN B ND2 
1481 N N   . TYR B 88  ? 1.0706 0.7230 0.7212 0.0168  -0.0743 -0.0894 134 TYR B N   
1482 C CA  . TYR B 88  ? 1.0540 0.7027 0.7269 0.0122  -0.0664 -0.0877 134 TYR B CA  
1483 C C   . TYR B 88  ? 1.0304 0.6803 0.7037 0.0297  -0.0437 -0.0794 134 TYR B C   
1484 O O   . TYR B 88  ? 1.0346 0.6632 0.7029 0.0340  -0.0357 -0.0815 134 TYR B O   
1485 C CB  . TYR B 88  ? 1.0112 0.6944 0.7316 -0.0030 -0.0732 -0.0811 134 TYR B CB  
1486 C CG  . TYR B 88  ? 1.0050 0.6913 0.7505 -0.0063 -0.0626 -0.0750 134 TYR B CG  
1487 C CD1 . TYR B 88  ? 0.9693 0.6788 0.7361 0.0035  -0.0481 -0.0631 134 TYR B CD1 
1488 C CD2 . TYR B 88  ? 1.0475 0.7126 0.7944 -0.0203 -0.0681 -0.0807 134 TYR B CD2 
1489 C CE1 . TYR B 88  ? 0.9734 0.6849 0.7593 0.0016  -0.0402 -0.0572 134 TYR B CE1 
1490 C CE2 . TYR B 88  ? 1.0401 0.7051 0.8057 -0.0227 -0.0581 -0.0735 134 TYR B CE2 
1491 C CZ  . TYR B 88  ? 1.0050 0.6934 0.7886 -0.0108 -0.0447 -0.0618 134 TYR B CZ  
1492 O OH  . TYR B 88  ? 1.0286 0.7160 0.8267 -0.0120 -0.0365 -0.0545 134 TYR B OH  
1493 N N   . TYR B 89  ? 1.0034 0.6780 0.6835 0.0398  -0.0339 -0.0700 135 TYR B N   
1494 C CA  . TYR B 89  ? 0.9870 0.6726 0.6767 0.0546  -0.0134 -0.0611 135 TYR B CA  
1495 C C   . TYR B 89  ? 1.0443 0.7040 0.6955 0.0720  0.0001  -0.0662 135 TYR B C   
1496 O O   . TYR B 89  ? 1.0764 0.7234 0.6944 0.0759  -0.0017 -0.0707 135 TYR B O   
1497 C CB  . TYR B 89  ? 0.9404 0.6631 0.6555 0.0556  -0.0082 -0.0489 135 TYR B CB  
1498 C CG  . TYR B 89  ? 0.8794 0.6298 0.6337 0.0423  -0.0177 -0.0433 135 TYR B CG  
1499 C CD1 . TYR B 89  ? 0.8490 0.6085 0.6305 0.0389  -0.0144 -0.0397 135 TYR B CD1 
1500 C CD2 . TYR B 89  ? 0.8437 0.6100 0.6056 0.0348  -0.0294 -0.0414 135 TYR B CD2 
1501 C CE1 . TYR B 89  ? 0.8206 0.6044 0.6344 0.0278  -0.0211 -0.0351 135 TYR B CE1 
1502 C CE2 . TYR B 89  ? 0.8109 0.6022 0.6078 0.0249  -0.0364 -0.0371 135 TYR B CE2 
1503 C CZ  . TYR B 89  ? 0.8016 0.6018 0.6238 0.0212  -0.0314 -0.0343 135 TYR B CZ  
1504 O OH  . TYR B 89  ? 0.7588 0.5829 0.6124 0.0124  -0.0365 -0.0306 135 TYR B OH  
1505 N N   A TRP B 90  ? 1.0553 0.7070 0.7095 0.0840  0.0138  -0.0653 136 TRP B N   
1506 N N   B TRP B 90  ? 1.0573 0.7088 0.7116 0.0839  0.0137  -0.0653 136 TRP B N   
1507 C CA  A TRP B 90  ? 1.0960 0.7292 0.7200 0.1041  0.0308  -0.0689 136 TRP B CA  
1508 C CA  B TRP B 90  ? 1.0994 0.7323 0.7238 0.1041  0.0307  -0.0690 136 TRP B CA  
1509 C C   A TRP B 90  ? 1.0649 0.7337 0.7080 0.1150  0.0490  -0.0567 136 TRP B C   
1510 C C   B TRP B 90  ? 1.0670 0.7355 0.7103 0.1151  0.0490  -0.0568 136 TRP B C   
1511 O O   A TRP B 90  ? 1.0986 0.7606 0.7156 0.1286  0.0634  -0.0580 136 TRP B O   
1512 O O   B TRP B 90  ? 1.1011 0.7624 0.7183 0.1291  0.0636  -0.0582 136 TRP B O   
1513 C CB  A TRP B 90  ? 1.1223 0.7298 0.7414 0.1144  0.0369  -0.0737 136 TRP B CB  
1514 C CB  B TRP B 90  ? 1.1273 0.7347 0.7478 0.1140  0.0365  -0.0736 136 TRP B CB  
1515 C CG  A TRP B 90  ? 1.1977 0.7723 0.7746 0.1345  0.0501  -0.0831 136 TRP B CG  
1516 C CG  B TRP B 90  ? 1.1917 0.7551 0.7861 0.1035  0.0210  -0.0866 136 TRP B CG  
1517 C CD1 A TRP B 90  ? 1.2606 0.7904 0.7887 0.1348  0.0430  -0.0980 136 TRP B CD1 
1518 C CD1 B TRP B 90  ? 1.2000 0.7607 0.7990 0.0813  0.0011  -0.0906 136 TRP B CD1 
1519 C CD2 A TRP B 90  ? 1.2194 0.8038 0.7993 0.1579  0.0727  -0.0790 136 TRP B CD2 
1520 C CD2 B TRP B 90  ? 1.2685 0.7848 0.8307 0.1141  0.0244  -0.0973 136 TRP B CD2 
1521 N NE1 A TRP B 90  ? 1.3186 0.8268 0.8154 0.1581  0.0611  -0.1038 136 TRP B NE1 
1522 N NE1 B TRP B 90  ? 1.2495 0.7655 0.8225 0.0749  -0.0085 -0.1029 136 TRP B NE1 
1523 C CE2 A TRP B 90  ? 1.2919 0.8352 0.8220 0.1731  0.0803  -0.0919 136 TRP B CE2 
1524 C CE2 B TRP B 90  ? 1.2954 0.7802 0.8431 0.0949  0.0053  -0.1074 136 TRP B CE2 
1525 C CE3 A TRP B 90  ? 1.1916 0.8171 0.8127 0.1676  0.0867  -0.0662 136 TRP B CE3 
1526 C CE3 B TRP B 90  ? 1.3040 0.8018 0.8493 0.1386  0.0419  -0.0996 136 TRP B CE3 
1527 C CZ2 A TRP B 90  ? 1.3255 0.8691 0.8470 0.1989  0.1035  -0.0920 136 TRP B CZ2 
1528 C CZ2 B TRP B 90  ? 1.3550 0.7860 0.8691 0.0977  0.0026  -0.1197 136 TRP B CZ2 
1529 C CZ3 A TRP B 90  ? 1.2169 0.8458 0.8332 0.1918  0.1081  -0.0659 136 TRP B CZ3 
1530 C CZ3 B TRP B 90  ? 1.3657 0.8094 0.8763 0.1443  0.0395  -0.1120 136 TRP B CZ3 
1531 C CH2 A TRP B 90  ? 1.2847 0.8738 0.8523 0.2079  0.1174  -0.0785 136 TRP B CH2 
1532 C CH2 B TRP B 90  ? 1.3904 0.7989 0.8842 0.1231  0.0198  -0.1220 136 TRP B CH2 
1533 N N   . ALA B 91  ? 1.0098 0.7156 0.6973 0.1081  0.0487  -0.0453 137 ALA B N   
1534 C CA  . ALA B 91  ? 0.9695 0.7111 0.6808 0.1145  0.0642  -0.0334 137 ALA B CA  
1535 C C   . ALA B 91  ? 0.9157 0.6894 0.6619 0.0996  0.0558  -0.0238 137 ALA B C   
1536 O O   . ALA B 91  ? 0.8831 0.6590 0.6458 0.0875  0.0412  -0.0247 137 ALA B O   
1537 C CB  . ALA B 91  ? 0.9579 0.7120 0.6903 0.1294  0.0789  -0.0298 137 ALA B CB  
1538 N N   . ALA B 92  ? 0.8974 0.6945 0.6538 0.1008  0.0665  -0.0145 138 ALA B N   
1539 C CA  . ALA B 92  ? 0.8552 0.6783 0.6401 0.0882  0.0600  -0.0055 138 ALA B CA  
1540 C C   . ALA B 92  ? 0.8157 0.6605 0.6411 0.0831  0.0550  -0.0019 138 ALA B C   
1541 O O   . ALA B 92  ? 0.7766 0.6302 0.6184 0.0712  0.0425  -0.0003 138 ALA B O   
1542 C CB  . ALA B 92  ? 0.8563 0.6971 0.6446 0.0909  0.0756  0.0044  138 ALA B CB  
1543 N N   . SER B 93  ? 0.8171 0.6700 0.6566 0.0936  0.0647  -0.0010 139 SER B N   
1544 C CA  . SER B 93  ? 0.7828 0.6539 0.6557 0.0908  0.0593  0.0026  139 SER B CA  
1545 C C   . SER B 93  ? 0.7735 0.6283 0.6429 0.0810  0.0434  -0.0025 139 SER B C   
1546 O O   . SER B 93  ? 0.7494 0.6200 0.6424 0.0726  0.0360  0.0012  139 SER B O   
1547 C CB  . SER B 93  ? 0.7923 0.6692 0.6750 0.1068  0.0698  0.0033  139 SER B CB  
1548 O OG  . SER B 93  ? 0.8335 0.6767 0.6851 0.1171  0.0716  -0.0052 139 SER B OG  
1549 N N   . GLU B 94  ? 0.8050 0.6282 0.6445 0.0811  0.0387  -0.0113 140 GLU B N   
1550 C CA  . GLU B 94  ? 0.8098 0.6176 0.6474 0.0699  0.0250  -0.0161 140 GLU B CA  
1551 C C   . GLU B 94  ? 0.7860 0.6081 0.6358 0.0549  0.0137  -0.0147 140 GLU B C   
1552 O O   . GLU B 94  ? 0.7612 0.5912 0.6289 0.0454  0.0062  -0.0136 140 GLU B O   
1553 C CB  . GLU B 94  ? 0.8590 0.6289 0.6620 0.0713  0.0216  -0.0266 140 GLU B CB  
1554 C CG  . GLU B 94  ? 0.9105 0.6592 0.6980 0.0877  0.0320  -0.0294 140 GLU B CG  
1555 C CD  . GLU B 94  ? 0.9781 0.6846 0.7255 0.0897  0.0290  -0.0415 140 GLU B CD  
1556 O OE1 . GLU B 94  ? 0.9802 0.6767 0.7124 0.0777  0.0177  -0.0476 140 GLU B OE1 
1557 O OE2 . GLU B 94  ? 1.0311 0.7134 0.7615 0.1040  0.0369  -0.0454 140 GLU B OE2 
1558 N N   . CYS B 95  ? 0.7836 0.6083 0.6221 0.0544  0.0133  -0.0145 141 CYS B N   
1559 C CA  . CYS B 95  ? 0.7602 0.5987 0.6099 0.0440  0.0030  -0.0124 141 CYS B CA  
1560 C C   . CYS B 95  ? 0.7144 0.5806 0.5963 0.0412  0.0056  -0.0041 141 CYS B C   
1561 O O   . CYS B 95  ? 0.6770 0.5537 0.5761 0.0326  -0.0030 -0.0039 141 CYS B O   
1562 C CB  . CYS B 95  ? 0.7793 0.6103 0.6047 0.0467  0.0027  -0.0125 141 CYS B CB  
1563 S SG  . CYS B 95  ? 0.7718 0.6166 0.6077 0.0381  -0.0102 -0.0089 141 CYS B SG  
1564 N N   . MET B 96  ? 0.7091 0.5876 0.5994 0.0483  0.0175  0.0021  142 MET B N   
1565 C CA  . MET B 96  ? 0.6881 0.5913 0.6080 0.0451  0.0191  0.0090  142 MET B CA  
1566 C C   . MET B 96  ? 0.6705 0.5793 0.6075 0.0421  0.0137  0.0080  142 MET B C   
1567 O O   . MET B 96  ? 0.6553 0.5781 0.6105 0.0356  0.0086  0.0103  142 MET B O   
1568 C CB  . MET B 96  ? 0.6914 0.6087 0.6201 0.0524  0.0329  0.0152  142 MET B CB  
1569 C CG  . MET B 96  ? 0.7239 0.6384 0.6375 0.0532  0.0407  0.0190  142 MET B CG  
1570 S SD  . MET B 96  ? 0.7328 0.6612 0.6514 0.0636  0.0615  0.0247  142 MET B SD  
1571 C CE  . MET B 96  ? 0.6812 0.6431 0.6453 0.0593  0.0610  0.0305  142 MET B CE  
1572 N N   A GLN B 97  ? 0.6817 0.5764 0.6093 0.0475  0.0153  0.0047  143 GLN B N   
1573 N N   B GLN B 97  ? 0.6834 0.5781 0.6111 0.0475  0.0153  0.0047  143 GLN B N   
1574 C CA  A GLN B 97  ? 0.6719 0.5656 0.6087 0.0449  0.0107  0.0047  143 GLN B CA  
1575 C CA  B GLN B 97  ? 0.6747 0.5688 0.6118 0.0449  0.0107  0.0048  143 GLN B CA  
1576 C C   A GLN B 97  ? 0.6539 0.5452 0.5926 0.0325  0.0013  0.0017  143 GLN B C   
1577 C C   B GLN B 97  ? 0.6561 0.5471 0.5946 0.0326  0.0013  0.0016  143 GLN B C   
1578 O O   A GLN B 97  ? 0.6284 0.5300 0.5811 0.0278  -0.0016 0.0039  143 GLN B O   
1579 O O   B GLN B 97  ? 0.6314 0.5321 0.5835 0.0279  -0.0016 0.0038  143 GLN B O   
1580 C CB  A GLN B 97  ? 0.7020 0.5727 0.6226 0.0529  0.0137  0.0019  143 GLN B CB  
1581 C CB  B GLN B 97  ? 0.7061 0.5786 0.6280 0.0535  0.0142  0.0024  143 GLN B CB  
1582 C CG  A GLN B 97  ? 0.7277 0.6012 0.6479 0.0685  0.0239  0.0043  143 GLN B CG  
1583 C CG  B GLN B 97  ? 0.7259 0.6097 0.6588 0.0666  0.0213  0.0073  143 GLN B CG  
1584 C CD  A GLN B 97  ? 0.7113 0.6131 0.6585 0.0728  0.0256  0.0113  143 GLN B CD  
1585 C CD  B GLN B 97  ? 0.7695 0.6279 0.6854 0.0777  0.0243  0.0050  143 GLN B CD  
1586 O OE1 A GLN B 97  ? 0.7005 0.6161 0.6630 0.0642  0.0187  0.0140  143 GLN B OE1 
1587 O OE1 B GLN B 97  ? 0.7848 0.6382 0.7039 0.0804  0.0212  0.0080  143 GLN B OE1 
1588 N NE2 A GLN B 97  ? 0.7361 0.6475 0.6898 0.0867  0.0344  0.0137  143 GLN B NE2 
1589 N NE2 B GLN B 97  ? 0.8014 0.6401 0.6954 0.0850  0.0302  -0.0004 143 GLN B NE2 
1590 N N   . ASP B 98  ? 0.6691 0.5480 0.5936 0.0279  -0.0035 -0.0037 144 ASP B N   
1591 C CA  . ASP B 98  ? 0.6634 0.5456 0.5947 0.0165  -0.0126 -0.0069 144 ASP B CA  
1592 C C   . ASP B 98  ? 0.6281 0.5325 0.5779 0.0137  -0.0154 -0.0036 144 ASP B C   
1593 O O   . ASP B 98  ? 0.6201 0.5347 0.5841 0.0075  -0.0186 -0.0039 144 ASP B O   
1594 C CB  . ASP B 98  ? 0.6783 0.5450 0.5922 0.0123  -0.0198 -0.0140 144 ASP B CB  
1595 C CG  . ASP B 98  ? 0.7272 0.5683 0.6250 0.0098  -0.0203 -0.0193 144 ASP B CG  
1596 O OD1 . ASP B 98  ? 0.7289 0.5639 0.6301 0.0104  -0.0155 -0.0167 144 ASP B OD1 
1597 O OD2 . ASP B 98  ? 0.7613 0.5855 0.6406 0.0072  -0.0266 -0.0264 144 ASP B OD2 
1598 N N   . PHE B 99  ? 0.6215 0.5315 0.5697 0.0184  -0.0130 -0.0004 145 PHE B N   
1599 C CA  . PHE B 99  ? 0.6109 0.5368 0.5747 0.0165  -0.0150 0.0032  145 PHE B CA  
1600 C C   . PHE B 99  ? 0.5894 0.5269 0.5699 0.0156  -0.0124 0.0057  145 PHE B C   
1601 O O   . PHE B 99  ? 0.5780 0.5243 0.5700 0.0117  -0.0162 0.0048  145 PHE B O   
1602 C CB  . PHE B 99  ? 0.6138 0.5402 0.5721 0.0205  -0.0105 0.0081  145 PHE B CB  
1603 C CG  . PHE B 99  ? 0.6313 0.5485 0.5737 0.0209  -0.0162 0.0072  145 PHE B CG  
1604 C CD1 . PHE B 99  ? 0.6495 0.5718 0.5994 0.0186  -0.0244 0.0075  145 PHE B CD1 
1605 C CD2 . PHE B 99  ? 0.6654 0.5677 0.5832 0.0254  -0.0134 0.0061  145 PHE B CD2 
1606 C CE1 . PHE B 99  ? 0.6766 0.5900 0.6105 0.0208  -0.0316 0.0075  145 PHE B CE1 
1607 C CE2 . PHE B 99  ? 0.7026 0.5948 0.6013 0.0266  -0.0202 0.0056  145 PHE B CE2 
1608 C CZ  . PHE B 99  ? 0.6954 0.5936 0.6027 0.0244  -0.0302 0.0068  145 PHE B CZ  
1609 N N   . ASN B 100 ? 0.5914 0.5289 0.5720 0.0206  -0.0064 0.0083  146 ASN B N   
1610 C CA  . ASN B 100 ? 0.5869 0.5350 0.5805 0.0208  -0.0062 0.0108  146 ASN B CA  
1611 C C   . ASN B 100 ? 0.5866 0.5308 0.5796 0.0164  -0.0094 0.0085  146 ASN B C   
1612 O O   . ASN B 100 ? 0.5771 0.5301 0.5784 0.0139  -0.0116 0.0089  146 ASN B O   
1613 C CB  . ASN B 100 ? 0.5996 0.5497 0.5943 0.0290  -0.0007 0.0141  146 ASN B CB  
1614 C CG  . ASN B 100 ? 0.6015 0.5625 0.6079 0.0303  -0.0034 0.0166  146 ASN B CG  
1615 O OD1 . ASN B 100 ? 0.6296 0.6051 0.6496 0.0271  -0.0062 0.0180  146 ASN B OD1 
1616 N ND2 . ASN B 100 ? 0.6027 0.5543 0.6015 0.0349  -0.0035 0.0172  146 ASN B ND2 
1617 N N   . THR B 101 ? 0.5883 0.5176 0.5696 0.0149  -0.0091 0.0060  147 THR B N   
1618 C CA  . THR B 101 ? 0.5853 0.5102 0.5661 0.0085  -0.0100 0.0049  147 THR B CA  
1619 C C   . THR B 101 ? 0.5662 0.5043 0.5587 0.0017  -0.0132 0.0023  147 THR B C   
1620 O O   . THR B 101 ? 0.5627 0.5070 0.5602 -0.0011 -0.0117 0.0030  147 THR B O   
1621 C CB  . THR B 101 ? 0.6037 0.5081 0.5708 0.0053  -0.0096 0.0023  147 THR B CB  
1622 O OG1 . THR B 101 ? 0.6386 0.5282 0.5937 0.0142  -0.0058 0.0047  147 THR B OG1 
1623 C CG2 . THR B 101 ? 0.6204 0.5214 0.5893 -0.0045 -0.0091 0.0021  147 THR B CG2 
1624 N N   . MET B 102 ? 0.5671 0.5091 0.5623 0.0007  -0.0172 -0.0006 148 MET B N   
1625 C CA  . MET B 102 ? 0.5585 0.5141 0.5665 -0.0024 -0.0208 -0.0031 148 MET B CA  
1626 C C   . MET B 102 ? 0.5456 0.5110 0.5616 0.0006  -0.0195 -0.0015 148 MET B C   
1627 O O   . MET B 102 ? 0.5392 0.5127 0.5625 -0.0015 -0.0182 -0.0032 148 MET B O   
1628 C CB  . MET B 102 ? 0.5625 0.5182 0.5689 -0.0010 -0.0272 -0.0052 148 MET B CB  
1629 C CG  . MET B 102 ? 0.5565 0.5260 0.5767 -0.0008 -0.0322 -0.0074 148 MET B CG  
1630 S SD  . MET B 102 ? 0.5804 0.5460 0.5931 0.0035  -0.0415 -0.0079 148 MET B SD  
1631 C CE  . MET B 102 ? 0.5728 0.5287 0.5744 0.0093  -0.0363 -0.0015 148 MET B CE  
1632 N N   . PHE B 103 ? 0.5513 0.5158 0.5656 0.0049  -0.0194 0.0014  149 PHE B N   
1633 C CA  . PHE B 103 ? 0.5473 0.5182 0.5682 0.0060  -0.0200 0.0019  149 PHE B CA  
1634 C C   . PHE B 103 ? 0.5453 0.5176 0.5643 0.0056  -0.0179 0.0022  149 PHE B C   
1635 O O   . PHE B 103 ? 0.5543 0.5306 0.5752 0.0049  -0.0181 -0.0004 149 PHE B O   
1636 C CB  . PHE B 103 ? 0.5603 0.5307 0.5823 0.0079  -0.0201 0.0055  149 PHE B CB  
1637 C CG  . PHE B 103 ? 0.5748 0.5406 0.5938 0.0087  -0.0216 0.0066  149 PHE B CG  
1638 C CD1 . PHE B 103 ? 0.5726 0.5380 0.5943 0.0092  -0.0262 0.0041  149 PHE B CD1 
1639 C CD2 . PHE B 103 ? 0.6106 0.5716 0.6222 0.0105  -0.0181 0.0103  149 PHE B CD2 
1640 C CE1 . PHE B 103 ? 0.5961 0.5547 0.6117 0.0114  -0.0290 0.0062  149 PHE B CE1 
1641 C CE2 . PHE B 103 ? 0.6272 0.5810 0.6306 0.0117  -0.0194 0.0123  149 PHE B CE2 
1642 C CZ  . PHE B 103 ? 0.6011 0.5528 0.6057 0.0121  -0.0258 0.0106  149 PHE B CZ  
1643 N N   . THR B 104 ? 0.5490 0.5160 0.5615 0.0073  -0.0158 0.0054  150 THR B N   
1644 C CA  . THR B 104 ? 0.5419 0.5073 0.5484 0.0084  -0.0152 0.0073  150 THR B CA  
1645 C C   . THR B 104 ? 0.5339 0.4971 0.5355 0.0041  -0.0117 0.0056  150 THR B C   
1646 O O   . THR B 104 ? 0.5132 0.4782 0.5100 0.0045  -0.0114 0.0052  150 THR B O   
1647 C CB  . THR B 104 ? 0.5627 0.5202 0.5622 0.0134  -0.0138 0.0116  150 THR B CB  
1648 O OG1 . THR B 104 ? 0.5636 0.5284 0.5713 0.0177  -0.0149 0.0132  150 THR B OG1 
1649 C CG2 . THR B 104 ? 0.5802 0.5342 0.5709 0.0164  -0.0151 0.0148  150 THR B CG2 
1650 N N   . ASN B 105 ? 0.5343 0.4944 0.5371 -0.0006 -0.0090 0.0043  151 ASN B N   
1651 C CA  . ASN B 105 ? 0.5354 0.4979 0.5392 -0.0068 -0.0040 0.0031  151 ASN B CA  
1652 C C   . ASN B 105 ? 0.5321 0.5079 0.5438 -0.0054 -0.0033 -0.0009 151 ASN B C   
1653 O O   . ASN B 105 ? 0.5347 0.5125 0.5416 -0.0066 0.0025  -0.0010 151 ASN B O   
1654 C CB  . ASN B 105 ? 0.5289 0.4920 0.5403 -0.0136 -0.0040 0.0007  151 ASN B CB  
1655 C CG  . ASN B 105 ? 0.5582 0.5025 0.5578 -0.0167 -0.0033 0.0032  151 ASN B CG  
1656 O OD1 . ASN B 105 ? 0.5673 0.4979 0.5532 -0.0128 -0.0014 0.0077  151 ASN B OD1 
1657 N ND2 . ASN B 105 ? 0.5665 0.5088 0.5706 -0.0230 -0.0061 -0.0003 151 ASN B ND2 
1658 N N   . CYS B 106 ? 0.5325 0.5147 0.5538 -0.0021 -0.0084 -0.0040 152 CYS B N   
1659 C CA  . CYS B 106 ? 0.5307 0.5212 0.5583 0.0012  -0.0086 -0.0085 152 CYS B CA  
1660 C C   . CYS B 106 ? 0.5389 0.5248 0.5550 0.0041  -0.0082 -0.0090 152 CYS B C   
1661 O O   . CYS B 106 ? 0.5468 0.5357 0.5592 0.0055  -0.0034 -0.0124 152 CYS B O   
1662 C CB  . CYS B 106 ? 0.5313 0.5226 0.5667 0.0048  -0.0152 -0.0101 152 CYS B CB  
1663 S SG  . CYS B 106 ? 0.5801 0.5774 0.6232 0.0109  -0.0158 -0.0161 152 CYS B SG  
1664 N N   . TYR B 107 ? 0.5411 0.5207 0.5511 0.0052  -0.0132 -0.0060 153 TYR B N   
1665 C CA  . TYR B 107 ? 0.5530 0.5292 0.5528 0.0073  -0.0166 -0.0072 153 TYR B CA  
1666 C C   . TYR B 107 ? 0.5764 0.5479 0.5597 0.0074  -0.0119 -0.0050 153 TYR B C   
1667 O O   . TYR B 107 ? 0.5838 0.5526 0.5546 0.0094  -0.0120 -0.0082 153 TYR B O   
1668 C CB  . TYR B 107 ? 0.5501 0.5261 0.5530 0.0079  -0.0239 -0.0040 153 TYR B CB  
1669 C CG  . TYR B 107 ? 0.5509 0.5292 0.5669 0.0067  -0.0265 -0.0042 153 TYR B CG  
1670 C CD1 . TYR B 107 ? 0.5522 0.5283 0.5720 0.0067  -0.0278 -0.0088 153 TYR B CD1 
1671 C CD2 . TYR B 107 ? 0.5117 0.4924 0.5342 0.0067  -0.0268 0.0007  153 TYR B CD2 
1672 C CE1 . TYR B 107 ? 0.5724 0.5464 0.6002 0.0056  -0.0299 -0.0073 153 TYR B CE1 
1673 C CE2 . TYR B 107 ? 0.5281 0.5091 0.5588 0.0053  -0.0273 0.0018  153 TYR B CE2 
1674 C CZ  . TYR B 107 ? 0.5526 0.5292 0.5850 0.0042  -0.0292 -0.0016 153 TYR B CZ  
1675 O OH  . TYR B 107 ? 0.5881 0.5610 0.6249 0.0028  -0.0296 0.0010  153 TYR B OH  
1676 N N   . ILE B 108 ? 0.5874 0.5547 0.5675 0.0053  -0.0079 0.0006  154 ILE B N   
1677 C CA  . ILE B 108 ? 0.6147 0.5729 0.5763 0.0049  -0.0028 0.0051  154 ILE B CA  
1678 C C   . ILE B 108 ? 0.6135 0.5749 0.5714 0.0014  0.0079  0.0028  154 ILE B C   
1679 O O   . ILE B 108 ? 0.6313 0.5867 0.5697 0.0028  0.0122  0.0039  154 ILE B O   
1680 C CB  . ILE B 108 ? 0.6289 0.5767 0.5872 0.0032  -0.0010 0.0117  154 ILE B CB  
1681 C CG1 . ILE B 108 ? 0.6497 0.5953 0.6087 0.0097  -0.0097 0.0146  154 ILE B CG1 
1682 C CG2 . ILE B 108 ? 0.6589 0.5931 0.5967 0.0009  0.0064  0.0176  154 ILE B CG2 
1683 C CD1 . ILE B 108 ? 0.7026 0.6357 0.6587 0.0109  -0.0079 0.0195  154 ILE B CD1 
1684 N N   . TYR B 109 ? 0.5944 0.5666 0.5709 -0.0027 0.0125  -0.0001 155 TYR B N   
1685 C CA  . TYR B 109 ? 0.6044 0.5855 0.5840 -0.0063 0.0244  -0.0018 155 TYR B CA  
1686 C C   . TYR B 109 ? 0.6031 0.5924 0.5828 0.0002  0.0266  -0.0092 155 TYR B C   
1687 O O   . TYR B 109 ? 0.6191 0.6093 0.5868 0.0009  0.0371  -0.0099 155 TYR B O   
1688 C CB  . TYR B 109 ? 0.6074 0.6005 0.6103 -0.0134 0.0272  -0.0024 155 TYR B CB  
1689 C CG  . TYR B 109 ? 0.5951 0.6041 0.6084 -0.0175 0.0400  -0.0041 155 TYR B CG  
1690 C CD1 . TYR B 109 ? 0.6381 0.6420 0.6407 -0.0254 0.0523  0.0018  155 TYR B CD1 
1691 C CD2 . TYR B 109 ? 0.5922 0.6212 0.6258 -0.0125 0.0409  -0.0112 155 TYR B CD2 
1692 C CE1 . TYR B 109 ? 0.6464 0.6683 0.6610 -0.0299 0.0667  0.0008  155 TYR B CE1 
1693 C CE2 . TYR B 109 ? 0.6039 0.6521 0.6509 -0.0146 0.0541  -0.0130 155 TYR B CE2 
1694 C CZ  . TYR B 109 ? 0.6326 0.6789 0.6712 -0.0240 0.0678  -0.0071 155 TYR B CZ  
1695 O OH  . TYR B 109 ? 0.6515 0.7203 0.7059 -0.0270 0.0834  -0.0083 155 TYR B OH  
1696 N N   . ASN B 110 ? 0.5888 0.5817 0.5797 0.0053  0.0178  -0.0147 156 ASN B N   
1697 C CA  . ASN B 110 ? 0.5904 0.5878 0.5827 0.0124  0.0195  -0.0228 156 ASN B CA  
1698 C C   . ASN B 110 ? 0.6175 0.6007 0.5859 0.0173  0.0152  -0.0265 156 ASN B C   
1699 O O   . ASN B 110 ? 0.6156 0.5887 0.5712 0.0155  0.0075  -0.0228 156 ASN B O   
1700 C CB  . ASN B 110 ? 0.5678 0.5709 0.5805 0.0156  0.0119  -0.0262 156 ASN B CB  
1701 C CG  . ASN B 110 ? 0.5544 0.5737 0.5896 0.0121  0.0149  -0.0246 156 ASN B CG  
1702 O OD1 . ASN B 110 ? 0.5992 0.6340 0.6460 0.0134  0.0239  -0.0274 156 ASN B OD1 
1703 N ND2 . ASN B 110 ? 0.5184 0.5355 0.5600 0.0075  0.0077  -0.0204 156 ASN B ND2 
1704 N N   . LYS B 111 ? 0.6362 0.6189 0.5985 0.0241  0.0197  -0.0346 157 LYS B N   
1705 C CA  . LYS B 111 ? 0.6714 0.6379 0.6080 0.0284  0.0144  -0.0405 157 LYS B CA  
1706 C C   . LYS B 111 ? 0.6507 0.6087 0.5945 0.0281  -0.0009 -0.0435 157 LYS B C   
1707 O O   . LYS B 111 ? 0.6383 0.6013 0.6030 0.0287  -0.0032 -0.0437 157 LYS B O   
1708 C CB  . LYS B 111 ? 0.7069 0.6722 0.6319 0.0370  0.0249  -0.0496 157 LYS B CB  
1709 C CG  . LYS B 111 ? 0.7380 0.7146 0.6580 0.0367  0.0435  -0.0464 157 LYS B CG  
1710 C CD  . LYS B 111 ? 0.7923 0.7696 0.7021 0.0473  0.0557  -0.0562 157 LYS B CD  
1711 C CE  . LYS B 111 ? 0.8137 0.8104 0.7299 0.0462  0.0774  -0.0525 157 LYS B CE  
1712 N NZ  . LYS B 111 ? 0.8783 0.8758 0.7811 0.0586  0.0917  -0.0625 157 LYS B NZ  
1713 N N   . PRO B 112 ? 0.6556 0.6011 0.5823 0.0265  -0.0118 -0.0451 158 PRO B N   
1714 C CA  . PRO B 112 ? 0.6420 0.5808 0.5780 0.0232  -0.0254 -0.0472 158 PRO B CA  
1715 C C   . PRO B 112 ? 0.6489 0.5791 0.5912 0.0276  -0.0259 -0.0551 158 PRO B C   
1716 O O   . PRO B 112 ? 0.6438 0.5713 0.6013 0.0242  -0.0327 -0.0532 158 PRO B O   
1717 C CB  . PRO B 112 ? 0.6591 0.5872 0.5731 0.0215  -0.0361 -0.0506 158 PRO B CB  
1718 C CG  . PRO B 112 ? 0.6711 0.6034 0.5698 0.0225  -0.0304 -0.0441 158 PRO B CG  
1719 C CD  . PRO B 112 ? 0.6751 0.6130 0.5741 0.0264  -0.0131 -0.0439 158 PRO B CD  
1720 N N   . THR B 113 ? 0.6688 0.5938 0.5983 0.0359  -0.0177 -0.0632 159 THR B N   
1721 C CA  . THR B 113 ? 0.6975 0.6104 0.6289 0.0434  -0.0179 -0.0719 159 THR B CA  
1722 C C   . THR B 113 ? 0.6788 0.6061 0.6347 0.0496  -0.0102 -0.0691 159 THR B C   
1723 O O   . THR B 113 ? 0.6900 0.6072 0.6495 0.0579  -0.0112 -0.0749 159 THR B O   
1724 C CB  . THR B 113 ? 0.7400 0.6394 0.6439 0.0524  -0.0121 -0.0835 159 THR B CB  
1725 O OG1 . THR B 113 ? 0.7750 0.6905 0.6734 0.0557  0.0031  -0.0807 159 THR B OG1 
1726 C CG2 . THR B 113 ? 0.7776 0.6576 0.6555 0.0468  -0.0248 -0.0889 159 THR B CG2 
1727 N N   . ASP B 114 ? 0.6480 0.5969 0.6197 0.0459  -0.0041 -0.0607 160 ASP B N   
1728 C CA  . ASP B 114 ? 0.6293 0.5950 0.6255 0.0506  0.0008  -0.0584 160 ASP B CA  
1729 C C   . ASP B 114 ? 0.6176 0.5757 0.6262 0.0500  -0.0101 -0.0551 160 ASP B C   
1730 O O   . ASP B 114 ? 0.6053 0.5559 0.6119 0.0412  -0.0181 -0.0497 160 ASP B O   
1731 C CB  . ASP B 114 ? 0.6101 0.5976 0.6187 0.0437  0.0079  -0.0506 160 ASP B CB  
1732 C CG  . ASP B 114 ? 0.6359 0.6338 0.6368 0.0452  0.0226  -0.0524 160 ASP B CG  
1733 O OD1 . ASP B 114 ? 0.6631 0.6577 0.6544 0.0547  0.0296  -0.0606 160 ASP B OD1 
1734 O OD2 . ASP B 114 ? 0.6582 0.6663 0.6614 0.0369  0.0284  -0.0455 160 ASP B OD2 
1735 N N   . ASP B 115 ? 0.6134 0.5741 0.6346 0.0602  -0.0097 -0.0578 161 ASP B N   
1736 C CA  . ASP B 115 ? 0.6088 0.5605 0.6384 0.0611  -0.0194 -0.0534 161 ASP B CA  
1737 C C   . ASP B 115 ? 0.5835 0.5463 0.6227 0.0512  -0.0229 -0.0436 161 ASP B C   
1738 O O   . ASP B 115 ? 0.5881 0.5378 0.6244 0.0466  -0.0302 -0.0384 161 ASP B O   
1739 C CB  . ASP B 115 ? 0.6188 0.5766 0.6623 0.0758  -0.0189 -0.0565 161 ASP B CB  
1740 C CG  . ASP B 115 ? 0.6702 0.6101 0.7023 0.0888  -0.0165 -0.0667 161 ASP B CG  
1741 O OD1 . ASP B 115 ? 0.6957 0.6149 0.7066 0.0854  -0.0167 -0.0722 161 ASP B OD1 
1742 O OD2 . ASP B 115 ? 0.6814 0.6279 0.7258 0.1036  -0.0151 -0.0699 161 ASP B OD2 
1743 N N   . ILE B 116 ? 0.5740 0.5588 0.6232 0.0475  -0.0169 -0.0412 162 ILE B N   
1744 C CA  . ILE B 116 ? 0.5674 0.5600 0.6235 0.0393  -0.0202 -0.0336 162 ILE B CA  
1745 C C   . ILE B 116 ? 0.5557 0.5361 0.5995 0.0302  -0.0233 -0.0287 162 ILE B C   
1746 O O   . ILE B 116 ? 0.5395 0.5176 0.5846 0.0263  -0.0275 -0.0229 162 ILE B O   
1747 C CB  . ILE B 116 ? 0.5692 0.5843 0.6373 0.0351  -0.0131 -0.0328 162 ILE B CB  
1748 C CG1 . ILE B 116 ? 0.5622 0.5826 0.6381 0.0296  -0.0192 -0.0275 162 ILE B CG1 
1749 C CG2 . ILE B 116 ? 0.5709 0.5850 0.6264 0.0286  -0.0050 -0.0322 162 ILE B CG2 
1750 C CD1 . ILE B 116 ? 0.5847 0.6221 0.6713 0.0222  -0.0144 -0.0265 162 ILE B CD1 
1751 N N   . VAL B 117 ? 0.5579 0.5314 0.5895 0.0280  -0.0215 -0.0313 163 VAL B N   
1752 C CA  . VAL B 117 ? 0.5638 0.5293 0.5877 0.0208  -0.0259 -0.0274 163 VAL B CA  
1753 C C   . VAL B 117 ? 0.5772 0.5294 0.6024 0.0192  -0.0328 -0.0255 163 VAL B C   
1754 O O   . VAL B 117 ? 0.5822 0.5348 0.6104 0.0137  -0.0348 -0.0190 163 VAL B O   
1755 C CB  . VAL B 117 ? 0.5702 0.5308 0.5798 0.0197  -0.0255 -0.0317 163 VAL B CB  
1756 C CG1 . VAL B 117 ? 0.5664 0.5217 0.5730 0.0132  -0.0330 -0.0286 163 VAL B CG1 
1757 C CG2 . VAL B 117 ? 0.5712 0.5420 0.5758 0.0195  -0.0174 -0.0305 163 VAL B CG2 
1758 N N   . LEU B 118 ? 0.5862 0.5251 0.6080 0.0243  -0.0353 -0.0307 164 LEU B N   
1759 C CA  . LEU B 118 ? 0.6072 0.5286 0.6282 0.0221  -0.0411 -0.0281 164 LEU B CA  
1760 C C   . LEU B 118 ? 0.5935 0.5173 0.6208 0.0233  -0.0415 -0.0203 164 LEU B C   
1761 O O   . LEU B 118 ? 0.5787 0.4947 0.6051 0.0173  -0.0433 -0.0136 164 LEU B O   
1762 C CB  . LEU B 118 ? 0.6594 0.5621 0.6732 0.0298  -0.0432 -0.0359 164 LEU B CB  
1763 C CG  . LEU B 118 ? 0.7290 0.6053 0.7370 0.0260  -0.0494 -0.0348 164 LEU B CG  
1764 C CD1 . LEU B 118 ? 0.7780 0.6509 0.7845 0.0119  -0.0534 -0.0341 164 LEU B CD1 
1765 C CD2 . LEU B 118 ? 0.7846 0.6401 0.7829 0.0368  -0.0507 -0.0442 164 LEU B CD2 
1766 N N   . MET B 119 ? 0.5721 0.5078 0.6055 0.0308  -0.0398 -0.0213 165 MET B N   
1767 C CA  . MET B 119 ? 0.5728 0.5111 0.6093 0.0332  -0.0425 -0.0152 165 MET B CA  
1768 C C   . MET B 119 ? 0.5681 0.5133 0.6033 0.0249  -0.0405 -0.0090 165 MET B C   
1769 O O   . MET B 119 ? 0.5742 0.5114 0.6038 0.0233  -0.0422 -0.0025 165 MET B O   
1770 C CB  . MET B 119 ? 0.5736 0.5281 0.6209 0.0418  -0.0426 -0.0191 165 MET B CB  
1771 C CG  . MET B 119 ? 0.6053 0.5531 0.6550 0.0540  -0.0444 -0.0248 165 MET B CG  
1772 S SD  . MET B 119 ? 0.6010 0.5774 0.6709 0.0641  -0.0409 -0.0313 165 MET B SD  
1773 C CE  . MET B 119 ? 0.6029 0.5857 0.6811 0.0702  -0.0519 -0.0261 165 MET B CE  
1774 N N   . ALA B 120 ? 0.5509 0.5088 0.5887 0.0207  -0.0362 -0.0107 166 ALA B N   
1775 C CA  . ALA B 120 ? 0.5539 0.5159 0.5895 0.0149  -0.0338 -0.0057 166 ALA B CA  
1776 C C   . ALA B 120 ? 0.5595 0.5137 0.5923 0.0100  -0.0336 -0.0010 166 ALA B C   
1777 O O   . ALA B 120 ? 0.5730 0.5256 0.6029 0.0083  -0.0318 0.0047  166 ALA B O   
1778 C CB  . ALA B 120 ? 0.5348 0.5072 0.5715 0.0124  -0.0296 -0.0079 166 ALA B CB  
1779 N N   . GLN B 121 ? 0.5714 0.5218 0.6053 0.0072  -0.0351 -0.0038 167 GLN B N   
1780 C CA  . GLN B 121 ? 0.5836 0.5302 0.6203 0.0002  -0.0359 0.0001  167 GLN B CA  
1781 C C   . GLN B 121 ? 0.5924 0.5265 0.6265 -0.0014 -0.0353 0.0064  167 GLN B C   
1782 O O   . GLN B 121 ? 0.5968 0.5337 0.6339 -0.0067 -0.0314 0.0130  167 GLN B O   
1783 C CB  . GLN B 121 ? 0.6043 0.5451 0.6410 -0.0032 -0.0407 -0.0058 167 GLN B CB  
1784 C CG  . GLN B 121 ? 0.6285 0.5802 0.6640 -0.0031 -0.0418 -0.0099 167 GLN B CG  
1785 C CD  . GLN B 121 ? 0.6886 0.6318 0.7187 -0.0057 -0.0482 -0.0172 167 GLN B CD  
1786 O OE1 . GLN B 121 ? 0.7507 0.6807 0.7725 -0.0015 -0.0491 -0.0237 167 GLN B OE1 
1787 N NE2 . GLN B 121 ? 0.7170 0.6677 0.7513 -0.0117 -0.0533 -0.0169 167 GLN B NE2 
1788 N N   . THR B 122 ? 0.6023 0.5226 0.6303 0.0040  -0.0384 0.0050  168 THR B N   
1789 C CA  . THR B 122 ? 0.6184 0.5218 0.6388 0.0040  -0.0386 0.0121  168 THR B CA  
1790 C C   . THR B 122 ? 0.6183 0.5272 0.6325 0.0058  -0.0348 0.0186  168 THR B C   
1791 O O   . THR B 122 ? 0.6255 0.5284 0.6347 0.0010  -0.0299 0.0266  168 THR B O   
1792 C CB  . THR B 122 ? 0.6344 0.5218 0.6485 0.0132  -0.0442 0.0088  168 THR B CB  
1793 O OG1 . THR B 122 ? 0.6307 0.5105 0.6470 0.0126  -0.0468 0.0011  168 THR B OG1 
1794 C CG2 . THR B 122 ? 0.6566 0.5207 0.6584 0.0140  -0.0454 0.0175  168 THR B CG2 
1795 N N   . LEU B 123 ? 0.6114 0.5313 0.6253 0.0119  -0.0364 0.0149  169 LEU B N   
1796 C CA  . LEU B 123 ? 0.6241 0.5464 0.6288 0.0138  -0.0347 0.0187  169 LEU B CA  
1797 C C   . LEU B 123 ? 0.6178 0.5481 0.6238 0.0085  -0.0266 0.0220  169 LEU B C   
1798 O O   . LEU B 123 ? 0.6288 0.5542 0.6238 0.0085  -0.0217 0.0278  169 LEU B O   
1799 C CB  . LEU B 123 ? 0.6189 0.5520 0.6263 0.0189  -0.0393 0.0126  169 LEU B CB  
1800 C CG  . LEU B 123 ? 0.6401 0.5714 0.6501 0.0267  -0.0474 0.0095  169 LEU B CG  
1801 C CD1 . LEU B 123 ? 0.6391 0.5886 0.6604 0.0284  -0.0501 0.0027  169 LEU B CD1 
1802 C CD2 . LEU B 123 ? 0.6565 0.5726 0.6510 0.0319  -0.0528 0.0155  169 LEU B CD2 
1803 N N   . GLU B 124 ? 0.6033 0.5456 0.6216 0.0053  -0.0251 0.0183  170 GLU B N   
1804 C CA  . GLU B 124 ? 0.5998 0.5526 0.6227 0.0028  -0.0187 0.0207  170 GLU B CA  
1805 C C   . GLU B 124 ? 0.6081 0.5602 0.6354 -0.0028 -0.0130 0.0278  170 GLU B C   
1806 O O   . GLU B 124 ? 0.6011 0.5588 0.6272 -0.0023 -0.0050 0.0324  170 GLU B O   
1807 C CB  . GLU B 124 ? 0.5915 0.5554 0.6246 0.0018  -0.0208 0.0158  170 GLU B CB  
1808 C CG  . GLU B 124 ? 0.6159 0.5909 0.6539 0.0026  -0.0163 0.0178  170 GLU B CG  
1809 C CD  . GLU B 124 ? 0.6361 0.6183 0.6788 0.0031  -0.0200 0.0138  170 GLU B CD  
1810 O OE1 . GLU B 124 ? 0.6777 0.6610 0.7255 -0.0003 -0.0251 0.0110  170 GLU B OE1 
1811 O OE2 . GLU B 124 ? 0.6569 0.6407 0.6952 0.0071  -0.0181 0.0136  170 GLU B OE2 
1812 N N   . LYS B 125 ? 0.6247 0.5691 0.6569 -0.0084 -0.0163 0.0285  171 LYS B N   
1813 C CA  . LYS B 125 ? 0.6317 0.5737 0.6694 -0.0168 -0.0106 0.0360  171 LYS B CA  
1814 C C   . LYS B 125 ? 0.6524 0.5820 0.6729 -0.0147 -0.0033 0.0443  171 LYS B C   
1815 O O   . LYS B 125 ? 0.6525 0.5883 0.6758 -0.0188 0.0072  0.0514  171 LYS B O   
1816 C CB  . LYS B 125 ? 0.6595 0.5887 0.7020 -0.0241 -0.0168 0.0343  171 LYS B CB  
1817 C CG  . LYS B 125 ? 0.6964 0.6381 0.7550 -0.0293 -0.0229 0.0275  171 LYS B CG  
1818 C CD  . LYS B 125 ? 0.7450 0.6679 0.7988 -0.0310 -0.0318 0.0208  171 LYS B CD  
1819 C CE  . LYS B 125 ? 0.7681 0.6973 0.8344 -0.0399 -0.0388 0.0149  171 LYS B CE  
1820 N NZ  . LYS B 125 ? 0.7736 0.7304 0.8546 -0.0408 -0.0387 0.0147  171 LYS B NZ  
1821 N N   . ILE B 126 ? 0.6641 0.5777 0.6665 -0.0076 -0.0087 0.0434  172 ILE B N   
1822 C CA  . ILE B 126 ? 0.6947 0.5938 0.6748 -0.0039 -0.0043 0.0509  172 ILE B CA  
1823 C C   . ILE B 126 ? 0.6857 0.5952 0.6581 0.0006  0.0031  0.0509  172 ILE B C   
1824 O O   . ILE B 126 ? 0.7052 0.6106 0.6656 0.0000  0.0137  0.0583  172 ILE B O   
1825 C CB  . ILE B 126 ? 0.7107 0.5931 0.6747 0.0046  -0.0153 0.0489  172 ILE B CB  
1826 C CG1 . ILE B 126 ? 0.7230 0.5889 0.6901 0.0024  -0.0210 0.0499  172 ILE B CG1 
1827 C CG2 . ILE B 126 ? 0.7428 0.6103 0.6792 0.0099  -0.0134 0.0559  172 ILE B CG2 
1828 C CD1 . ILE B 126 ? 0.7450 0.6028 0.7065 0.0132  -0.0330 0.0448  172 ILE B CD1 
1829 N N   . PHE B 127 ? 0.6662 0.5870 0.6440 0.0051  -0.0016 0.0425  173 PHE B N   
1830 C CA  . PHE B 127 ? 0.6618 0.5890 0.6323 0.0098  0.0046  0.0407  173 PHE B CA  
1831 C C   . PHE B 127 ? 0.6642 0.6037 0.6447 0.0071  0.0183  0.0463  173 PHE B C   
1832 O O   . PHE B 127 ? 0.6786 0.6141 0.6436 0.0108  0.0286  0.0504  173 PHE B O   
1833 C CB  . PHE B 127 ? 0.6387 0.5751 0.6184 0.0122  -0.0021 0.0318  173 PHE B CB  
1834 C CG  . PHE B 127 ? 0.6455 0.5865 0.6211 0.0165  0.0040  0.0295  173 PHE B CG  
1835 C CD1 . PHE B 127 ? 0.6570 0.5858 0.6102 0.0216  0.0039  0.0269  173 PHE B CD1 
1836 C CD2 . PHE B 127 ? 0.6415 0.5971 0.6344 0.0164  0.0083  0.0292  173 PHE B CD2 
1837 C CE1 . PHE B 127 ? 0.6660 0.5940 0.6127 0.0265  0.0096  0.0238  173 PHE B CE1 
1838 C CE2 . PHE B 127 ? 0.6466 0.6034 0.6348 0.0227  0.0137  0.0272  173 PHE B CE2 
1839 C CZ  . PHE B 127 ? 0.6601 0.6014 0.6245 0.0278  0.0150  0.0243  173 PHE B CZ  
1840 N N   . LEU B 128 ? 0.6434 0.5984 0.6494 0.0011  0.0184  0.0463  174 LEU B N   
1841 C CA  . LEU B 128 ? 0.6553 0.6287 0.6784 -0.0016 0.0301  0.0513  174 LEU B CA  
1842 C C   . LEU B 128 ? 0.6822 0.6507 0.7011 -0.0079 0.0416  0.0614  174 LEU B C   
1843 O O   . LEU B 128 ? 0.6804 0.6593 0.7005 -0.0058 0.0559  0.0663  174 LEU B O   
1844 C CB  . LEU B 128 ? 0.6424 0.6346 0.6945 -0.0076 0.0242  0.0486  174 LEU B CB  
1845 C CG  . LEU B 128 ? 0.6475 0.6484 0.7046 -0.0008 0.0173  0.0412  174 LEU B CG  
1846 C CD1 . LEU B 128 ? 0.6617 0.6783 0.7427 -0.0069 0.0098  0.0392  174 LEU B CD1 
1847 C CD2 . LEU B 128 ? 0.6456 0.6547 0.7000 0.0092  0.0263  0.0417  174 LEU B CD2 
1848 N N   . GLN B 129 ? 0.6989 0.6503 0.7120 -0.0151 0.0364  0.0648  175 GLN B N   
1849 C CA  . GLN B 129 ? 0.7388 0.6781 0.7420 -0.0220 0.0471  0.0760  175 GLN B CA  
1850 C C   . GLN B 129 ? 0.7591 0.6867 0.7309 -0.0130 0.0572  0.0803  175 GLN B C   
1851 O O   . GLN B 129 ? 0.7749 0.7076 0.7443 -0.0155 0.0739  0.0887  175 GLN B O   
1852 C CB  . GLN B 129 ? 0.7673 0.6810 0.7612 -0.0276 0.0374  0.0783  175 GLN B CB  
1853 C CG  . GLN B 129 ? 0.8159 0.7348 0.8364 -0.0409 0.0329  0.0776  175 GLN B CG  
1854 C CD  . GLN B 129 ? 0.8881 0.7779 0.8972 -0.0428 0.0212  0.0767  175 GLN B CD  
1855 O OE1 . GLN B 129 ? 0.9497 0.8149 0.9318 -0.0359 0.0190  0.0805  175 GLN B OE1 
1856 N NE2 . GLN B 129 ? 0.9025 0.7940 0.9306 -0.0511 0.0129  0.0709  175 GLN B NE2 
1857 N N   . LYS B 130 ? 0.7521 0.6651 0.7000 -0.0028 0.0471  0.0742  176 LYS B N   
1858 C CA  . LYS B 130 ? 0.7845 0.6820 0.6970 0.0060  0.0529  0.0764  176 LYS B CA  
1859 C C   . LYS B 130 ? 0.7759 0.6881 0.6884 0.0130  0.0647  0.0728  176 LYS B C   
1860 O O   . LYS B 130 ? 0.7948 0.7004 0.6847 0.0174  0.0789  0.0779  176 LYS B O   
1861 C CB  . LYS B 130 ? 0.7923 0.6720 0.6825 0.0134  0.0357  0.0700  176 LYS B CB  
1862 C CG  . LYS B 130 ? 0.8320 0.6945 0.7177 0.0109  0.0243  0.0737  176 LYS B CG  
1863 C CD  . LYS B 130 ? 0.9166 0.7563 0.7754 0.0092  0.0326  0.0868  176 LYS B CD  
1864 C CE  . LYS B 130 ? 0.9472 0.7637 0.7940 0.0114  0.0184  0.0899  176 LYS B CE  
1865 N NZ  . LYS B 130 ? 1.0059 0.7949 0.8207 0.0106  0.0259  0.1042  176 LYS B NZ  
1866 N N   . VAL B 131 ? 0.7368 0.6666 0.6720 0.0154  0.0594  0.0642  177 VAL B N   
1867 C CA  . VAL B 131 ? 0.7384 0.6819 0.6777 0.0235  0.0702  0.0608  177 VAL B CA  
1868 C C   . VAL B 131 ? 0.7432 0.7065 0.6998 0.0208  0.0899  0.0695  177 VAL B C   
1869 O O   . VAL B 131 ? 0.7618 0.7296 0.7092 0.0300  0.1043  0.0696  177 VAL B O   
1870 C CB  . VAL B 131 ? 0.7070 0.6641 0.6688 0.0258  0.0602  0.0521  177 VAL B CB  
1871 C CG1 . VAL B 131 ? 0.7233 0.6974 0.6968 0.0344  0.0718  0.0508  177 VAL B CG1 
1872 C CG2 . VAL B 131 ? 0.7233 0.6624 0.6656 0.0297  0.0459  0.0433  177 VAL B CG2 
1873 N N   . ALA B 132 ? 0.7324 0.7073 0.7143 0.0080  0.0909  0.0764  178 ALA B N   
1874 C CA  . ALA B 132 ? 0.7522 0.7492 0.7561 0.0018  0.1095  0.0856  178 ALA B CA  
1875 C C   . ALA B 132 ? 0.8005 0.7844 0.7738 0.0050  0.1288  0.0941  178 ALA B C   
1876 O O   . ALA B 132 ? 0.8162 0.8212 0.8031 0.0058  0.1489  0.0998  178 ALA B O   
1877 C CB  . ALA B 132 ? 0.7418 0.7458 0.7729 -0.0156 0.1046  0.0911  178 ALA B CB  
1878 N N   . SER B 133 ? 0.8341 0.7843 0.7660 0.0076  0.1228  0.0951  179 SER B N   
1879 C CA  . SER B 133 ? 0.8904 0.8216 0.7841 0.0109  0.1391  0.1038  179 SER B CA  
1880 C C   . SER B 133 ? 0.9237 0.8374 0.7769 0.0274  0.1394  0.0958  179 SER B C   
1881 O O   . SER B 133 ? 0.9613 0.8514 0.7721 0.0318  0.1476  0.1010  179 SER B O   
1882 C CB  . SER B 133 ? 0.9130 0.8149 0.7840 0.0024  0.1317  0.1125  179 SER B CB  
1883 O OG  . SER B 133 ? 0.9133 0.8260 0.8186 -0.0136 0.1313  0.1190  179 SER B OG  
1884 N N   . MET B 134 ? 0.9158 0.8378 0.7790 0.0360  0.1300  0.0833  180 MET B N   
1885 C CA  . MET B 134 ? 0.9561 0.8601 0.7831 0.0504  0.1297  0.0740  180 MET B CA  
1886 C C   . MET B 134 ? 1.0012 0.9146 0.8199 0.0599  0.1562  0.0770  180 MET B C   
1887 O O   . MET B 134 ? 0.9787 0.9237 0.8358 0.0577  0.1702  0.0815  180 MET B O   
1888 C CB  . MET B 134 ? 0.9313 0.8404 0.7744 0.0550  0.1138  0.0611  180 MET B CB  
1889 C CG  . MET B 134 ? 0.9584 0.8440 0.7649 0.0670  0.1090  0.0499  180 MET B CG  
1890 S SD  . MET B 134 ? 0.9509 0.8384 0.7768 0.0681  0.0898  0.0371  180 MET B SD  
1891 C CE  . MET B 134 ? 0.9105 0.8305 0.7780 0.0734  0.1039  0.0390  180 MET B CE  
1892 N N   . PRO B 135 ? 1.0728 0.9599 0.8415 0.0709  0.1632  0.0741  181 PRO B N   
1893 C CA  . PRO B 135 ? 1.1216 1.0149 0.8772 0.0832  0.1898  0.0748  181 PRO B CA  
1894 C C   . PRO B 135 ? 1.1189 1.0370 0.9080 0.0934  0.1949  0.0665  181 PRO B C   
1895 O O   . PRO B 135 ? 1.0917 1.0045 0.8885 0.0959  0.1758  0.0559  181 PRO B O   
1896 C CB  . PRO B 135 ? 1.1702 1.0233 0.8614 0.0940  0.1864  0.0677  181 PRO B CB  
1897 C CG  . PRO B 135 ? 1.1662 0.9971 0.8373 0.0838  0.1660  0.0718  181 PRO B CG  
1898 C CD  . PRO B 135 ? 1.1035 0.9540 0.8237 0.0721  0.1475  0.0713  181 PRO B CD  
1899 N N   . GLN B 136 ? 1.1486 1.0936 0.9573 0.0998  0.2209  0.0718  182 GLN B N   
1900 C CA  . GLN B 136 ? 1.1409 1.1178 0.9930 0.1091  0.2253  0.0670  182 GLN B CA  
1901 C C   . GLN B 136 ? 1.1697 1.1258 0.9955 0.1292  0.2232  0.0526  182 GLN B C   
1902 O O   . GLN B 136 ? 1.1447 1.1069 0.9938 0.1334  0.2094  0.0454  182 GLN B O   
1903 C CB  . GLN B 136 ? 1.1483 1.1666 1.0367 0.1098  0.2536  0.0774  182 GLN B CB  
1904 C CG  . GLN B 136 ? 1.2158 1.2301 1.0738 0.1276  0.2831  0.0771  182 GLN B CG  
1905 C CD  . GLN B 136 ? 1.2314 1.2918 1.1304 0.1254  0.3127  0.0892  182 GLN B CD  
1906 O OE1 . GLN B 136 ? 1.2113 1.3140 1.1711 0.1173  0.3100  0.0936  182 GLN B OE1 
1907 N NE2 . GLN B 136 ? 1.2709 1.3240 1.1365 0.1324  0.3411  0.0946  182 GLN B NE2 
1908 N N   . GLU B 137 ? 1.2275 1.1557 1.0020 0.1414  0.2367  0.0485  183 GLU B N   
1909 C CA  . GLU B 137 ? 1.2644 1.1672 1.0079 0.1612  0.2372  0.0341  183 GLU B CA  
1910 C C   . GLU B 137 ? 1.2895 1.1454 0.9844 0.1579  0.2133  0.0234  183 GLU B C   
1911 O O   . GLU B 137 ? 1.3190 1.1544 0.9790 0.1498  0.2087  0.0268  183 GLU B O   
1912 C CB  . GLU B 137 ? 1.3104 1.2113 1.0258 0.1789  0.2687  0.0343  183 GLU B CB  
1913 N N   . GLU B 138 ? 1.2870 1.1263 0.9804 0.1639  0.1976  0.0111  184 GLU B N   
1914 C CA  . GLU B 138 ? 1.3071 1.1048 0.9600 0.1596  0.1743  -0.0003 184 GLU B CA  
1915 C C   . GLU B 138 ? 1.3715 1.1301 0.9618 0.1742  0.1836  -0.0107 184 GLU B C   
1916 O O   . GLU B 138 ? 1.3975 1.1525 0.9795 0.1926  0.2017  -0.0163 184 GLU B O   
1917 C CB  . GLU B 138 ? 1.2819 1.0748 0.9566 0.1587  0.1561  -0.0088 184 GLU B CB  
1918 N N   . GLN B 139 ? 1.3995 1.1286 0.9452 0.1671  0.1703  -0.0138 185 GLN B N   
1919 C CA  . GLN B 139 ? 1.4639 1.1518 0.9428 0.1793  0.1755  -0.0246 185 GLN B CA  
1920 C C   . GLN B 139 ? 1.4858 1.1381 0.9421 0.1848  0.1594  -0.0431 185 GLN B C   
1921 O O   . GLN B 139 ? 1.5295 1.1422 0.9337 0.1846  0.1456  -0.0546 185 GLN B O   
1922 C CB  . GLN B 139 ? 1.4873 1.1564 0.9262 0.1695  0.1633  -0.0209 185 GLN B CB  
1923 N N   . ASN C 31  ? 1.5958 0.8750 0.9347 0.0962  -0.0748 0.0576  77  ASN C N   
1924 C CA  . ASN C 31  ? 1.5824 0.8673 0.9309 0.0407  -0.0723 0.0521  77  ASN C CA  
1925 C C   . ASN C 31  ? 1.4719 0.8569 0.8970 0.0328  -0.0597 0.0427  77  ASN C C   
1926 O O   . ASN C 31  ? 1.4298 0.8554 0.8873 -0.0093 -0.0548 0.0426  77  ASN C O   
1927 C CB  . ASN C 31  ? 1.6809 0.8667 0.9601 0.0294  -0.0840 0.0446  77  ASN C CB  
1928 C CG  . ASN C 31  ? 1.7981 0.8953 1.0119 -0.0076 -0.0957 0.0559  77  ASN C CG  
1929 O OD1 . ASN C 31  ? 1.7986 0.9247 1.0333 -0.0569 -0.0916 0.0637  77  ASN C OD1 
1930 N ND2 . ASN C 31  ? 1.9170 0.9043 1.0486 0.0167  -0.1094 0.0576  77  ASN C ND2 
1931 N N   . GLN C 32  ? 1.4231 0.8474 0.8755 0.0738  -0.0540 0.0359  78  GLN C N   
1932 C CA  . GLN C 32  ? 1.3263 0.8402 0.8463 0.0697  -0.0429 0.0287  78  GLN C CA  
1933 C C   . GLN C 32  ? 1.2368 0.8269 0.8126 0.0505  -0.0360 0.0360  78  GLN C C   
1934 O O   . GLN C 32  ? 1.1843 0.8177 0.7955 0.0190  -0.0307 0.0320  78  GLN C O   
1935 C CB  . GLN C 32  ? 1.3121 0.8560 0.8489 0.1180  -0.0362 0.0241  78  GLN C CB  
1936 C CG  . GLN C 32  ? 1.3661 0.8670 0.8683 0.1310  -0.0366 0.0112  78  GLN C CG  
1937 C CD  . GLN C 32  ? 1.3414 0.8905 0.8700 0.1739  -0.0244 0.0076  78  GLN C CD  
1938 O OE1 . GLN C 32  ? 1.3479 0.9316 0.8973 0.2075  -0.0192 0.0159  78  GLN C OE1 
1939 N NE2 . GLN C 32  ? 1.3393 0.8940 0.8677 0.1717  -0.0201 -0.0034 78  GLN C NE2 
1940 N N   . LEU C 33  ? 1.2232 0.8277 0.8043 0.0716  -0.0372 0.0462  79  LEU C N   
1941 C CA  . LEU C 33  ? 1.1562 0.8221 0.7789 0.0559  -0.0330 0.0527  79  LEU C CA  
1942 C C   . LEU C 33  ? 1.1650 0.8099 0.7700 0.0127  -0.0320 0.0569  79  LEU C C   
1943 O O   . LEU C 33  ? 1.1051 0.8031 0.7470 -0.0102 -0.0237 0.0559  79  LEU C O   
1944 C CB  . LEU C 33  ? 1.1628 0.8416 0.7877 0.0872  -0.0392 0.0636  79  LEU C CB  
1945 C CG  . LEU C 33  ? 1.1177 0.8574 0.7870 0.1223  -0.0360 0.0625  79  LEU C CG  
1946 C CD1 . LEU C 33  ? 1.1525 0.8979 0.8187 0.1552  -0.0460 0.0749  79  LEU C CD1 
1947 C CD2 . LEU C 33  ? 1.0420 0.8584 0.7692 0.1032  -0.0281 0.0588  79  LEU C CD2 
1948 N N   . GLN C 34  ? 1.2399 0.8060 0.7858 0.0021  -0.0396 0.0621  80  GLN C N   
1949 C CA  . GLN C 34  ? 1.2630 0.8063 0.7878 -0.0427 -0.0371 0.0683  80  GLN C CA  
1950 C C   . GLN C 34  ? 1.2146 0.7916 0.7710 -0.0772 -0.0297 0.0591  80  GLN C C   
1951 O O   . GLN C 34  ? 1.1847 0.7949 0.7606 -0.1109 -0.0202 0.0622  80  GLN C O   
1952 C CB  . GLN C 34  ? 1.3730 0.8152 0.8213 -0.0482 -0.0489 0.0769  80  GLN C CB  
1953 C CG  . GLN C 34  ? 1.4348 0.8525 0.8549 -0.0915 -0.0456 0.0891  80  GLN C CG  
1954 C CD  . GLN C 34  ? 1.4628 0.8898 0.8746 -0.0805 -0.0453 0.1011  80  GLN C CD  
1955 O OE1 . GLN C 34  ? 1.5448 0.9045 0.9011 -0.0641 -0.0576 0.1117  80  GLN C OE1 
1956 N NE2 . GLN C 34  ? 1.4018 0.9069 0.8635 -0.0889 -0.0329 0.0993  80  GLN C NE2 
1957 N N   . TYR C 35  ? 1.2055 0.7756 0.7661 -0.0666 -0.0339 0.0482  81  TYR C N   
1958 C CA  . TYR C 35  ? 1.1658 0.7709 0.7585 -0.0943 -0.0310 0.0393  81  TYR C CA  
1959 C C   . TYR C 35  ? 1.0648 0.7626 0.7259 -0.0903 -0.0191 0.0345  81  TYR C C   
1960 O O   . TYR C 35  ? 1.0270 0.7691 0.7209 -0.1190 -0.0121 0.0333  81  TYR C O   
1961 C CB  . TYR C 35  ? 1.2027 0.7668 0.7714 -0.0803 -0.0411 0.0288  81  TYR C CB  
1962 C CG  . TYR C 35  ? 1.1732 0.7721 0.7729 -0.1052 -0.0426 0.0195  81  TYR C CG  
1963 C CD1 . TYR C 35  ? 1.1085 0.7733 0.7585 -0.0881 -0.0366 0.0112  81  TYR C CD1 
1964 C CD2 . TYR C 35  ? 1.2314 0.7966 0.8092 -0.1470 -0.0520 0.0202  81  TYR C CD2 
1965 C CE1 . TYR C 35  ? 1.0857 0.7812 0.7623 -0.1081 -0.0406 0.0035  81  TYR C CE1 
1966 C CE2 . TYR C 35  ? 1.2091 0.8116 0.8187 -0.1694 -0.0567 0.0126  81  TYR C CE2 
1967 C CZ  . TYR C 35  ? 1.1356 0.8027 0.7941 -0.1476 -0.0514 0.0041  81  TYR C CZ  
1968 O OH  . TYR C 35  ? 1.1114 0.8141 0.7995 -0.1669 -0.0585 -0.0027 81  TYR C OH  
1969 N N   . LEU C 36  ? 1.0239 0.7506 0.7055 -0.0545 -0.0171 0.0325  82  LEU C N   
1970 C CA  . LEU C 36  ? 0.9462 0.7494 0.6839 -0.0502 -0.0081 0.0289  82  LEU C CA  
1971 C C   . LEU C 36  ? 0.9336 0.7647 0.6836 -0.0697 0.0002  0.0350  82  LEU C C   
1972 O O   . LEU C 36  ? 0.8920 0.7754 0.6804 -0.0805 0.0087  0.0304  82  LEU C O   
1973 C CB  . LEU C 36  ? 0.9126 0.7374 0.6650 -0.0128 -0.0087 0.0291  82  LEU C CB  
1974 C CG  . LEU C 36  ? 0.9224 0.7405 0.6738 0.0088  -0.0108 0.0215  82  LEU C CG  
1975 C CD1 . LEU C 36  ? 0.9137 0.7521 0.6757 0.0455  -0.0095 0.0255  82  LEU C CD1 
1976 C CD2 . LEU C 36  ? 0.8658 0.7264 0.6532 -0.0047 -0.0071 0.0126  82  LEU C CD2 
1977 N N   . HIS C 37  ? 0.9795 0.7715 0.6919 -0.0720 -0.0022 0.0453  83  HIS C N   
1978 C CA  . HIS C 37  ? 0.9858 0.7955 0.6981 -0.0904 0.0065  0.0516  83  HIS C CA  
1979 C C   . HIS C 37  ? 1.0061 0.8173 0.7165 -0.1291 0.0157  0.0528  83  HIS C C   
1980 O O   . HIS C 37  ? 0.9629 0.8268 0.7072 -0.1425 0.0285  0.0492  83  HIS C O   
1981 C CB  . HIS C 37  ? 1.0362 0.8009 0.7039 -0.0797 -0.0010 0.0636  83  HIS C CB  
1982 C CG  . HIS C 37  ? 1.0435 0.8224 0.7033 -0.0951 0.0072  0.0699  83  HIS C CG  
1983 N ND1 . HIS C 37  ? 1.1085 0.8400 0.7186 -0.0969 0.0016  0.0825  83  HIS C ND1 
1984 C CD2 . HIS C 37  ? 1.0135 0.8436 0.7026 -0.1073 0.0206  0.0650  83  HIS C CD2 
1985 C CE1 . HIS C 37  ? 1.1084 0.8622 0.7162 -0.1113 0.0118  0.0850  83  HIS C CE1 
1986 N NE2 . HIS C 37  ? 1.0391 0.8521 0.6941 -0.1167 0.0242  0.0739  83  HIS C NE2 
1987 N N   . LYS C 38  ? 1.0778 0.8316 0.7484 -0.1469 0.0090  0.0581  84  LYS C N   
1988 C CA  . LYS C 38  ? 1.1203 0.8730 0.7845 -0.1897 0.0170  0.0638  84  LYS C CA  
1989 C C   . LYS C 38  ? 1.0911 0.8857 0.7971 -0.2095 0.0183  0.0553  84  LYS C C   
1990 O O   . LYS C 38  ? 1.0936 0.9203 0.8173 -0.2430 0.0289  0.0593  84  LYS C O   
1991 C CB  . LYS C 38  ? 1.2131 0.8797 0.8103 -0.2068 0.0074  0.0757  84  LYS C CB  
1992 C CG  . LYS C 38  ? 1.2716 0.9041 0.8277 -0.1956 0.0078  0.0873  84  LYS C CG  
1993 C CD  . LYS C 38  ? 1.3952 0.9346 0.8784 -0.2121 -0.0026 0.1006  84  LYS C CD  
1994 C CE  . LYS C 38  ? 1.4472 0.9609 0.8900 -0.2119 0.0005  0.1147  84  LYS C CE  
1995 N NZ  . LYS C 38  ? 1.4066 0.9563 0.8709 -0.1719 -0.0016 0.1110  84  LYS C NZ  
1996 N N   . VAL C 39  ? 1.0678 0.8661 0.7902 -0.1890 0.0080  0.0445  85  VAL C N   
1997 C CA  . VAL C 39  ? 1.0444 0.8823 0.8050 -0.2053 0.0055  0.0365  85  VAL C CA  
1998 C C   . VAL C 39  ? 0.9711 0.8780 0.7863 -0.1812 0.0115  0.0263  85  VAL C C   
1999 O O   . VAL C 39  ? 0.9386 0.9064 0.7976 -0.1942 0.0204  0.0239  85  VAL C O   
2000 C CB  . VAL C 39  ? 1.0904 0.8698 0.8179 -0.2070 -0.0134 0.0318  85  VAL C CB  
2001 C CG1 . VAL C 39  ? 1.0660 0.8893 0.8333 -0.2225 -0.0194 0.0235  85  VAL C CG1 
2002 C CG2 . VAL C 39  ? 1.1739 0.8763 0.8419 -0.2357 -0.0216 0.0418  85  VAL C CG2 
2003 N N   . VAL C 40  ? 0.9489 0.8464 0.7606 -0.1460 0.0069  0.0214  86  VAL C N   
2004 C CA  . VAL C 40  ? 0.8889 0.8405 0.7445 -0.1252 0.0101  0.0129  86  VAL C CA  
2005 C C   . VAL C 40  ? 0.8535 0.8525 0.7360 -0.1233 0.0241  0.0140  86  VAL C C   
2006 O O   . VAL C 40  ? 0.8231 0.8721 0.7432 -0.1287 0.0307  0.0090  86  VAL C O   
2007 C CB  . VAL C 40  ? 0.8822 0.8148 0.7269 -0.0912 0.0034  0.0097  86  VAL C CB  
2008 C CG1 . VAL C 40  ? 0.8256 0.8090 0.7111 -0.0754 0.0061  0.0028  86  VAL C CG1 
2009 C CG2 . VAL C 40  ? 0.9229 0.8020 0.7323 -0.0889 -0.0087 0.0067  86  VAL C CG2 
2010 N N   . MET C 41  ? 0.8679 0.8482 0.7274 -0.1143 0.0275  0.0204  87  MET C N   
2011 C CA  . MET C 41  ? 0.8407 0.8551 0.7145 -0.1110 0.0388  0.0203  87  MET C CA  
2012 C C   . MET C 41  ? 0.8574 0.8968 0.7387 -0.1367 0.0538  0.0224  87  MET C C   
2013 O O   . MET C 41  ? 0.8333 0.9149 0.7393 -0.1327 0.0652  0.0172  87  MET C O   
2014 C CB  . MET C 41  ? 0.8552 0.8411 0.6982 -0.0974 0.0351  0.0274  87  MET C CB  
2015 C CG  . MET C 41  ? 0.8397 0.8505 0.6869 -0.0944 0.0435  0.0265  87  MET C CG  
2016 S SD  . MET C 41  ? 0.7904 0.8496 0.6801 -0.0792 0.0456  0.0147  87  MET C SD  
2017 C CE  . MET C 41  ? 0.7557 0.8039 0.6431 -0.0563 0.0296  0.0180  87  MET C CE  
2018 N N   . LYS C 42  ? 0.9040 0.9169 0.7624 -0.1626 0.0546  0.0303  88  LYS C N   
2019 C CA  . LYS C 42  ? 0.9231 0.9677 0.7926 -0.1907 0.0713  0.0345  88  LYS C CA  
2020 C C   . LYS C 42  ? 0.8743 0.9849 0.7997 -0.1943 0.0767  0.0263  88  LYS C C   
2021 O O   . LYS C 42  ? 0.8597 1.0197 0.8094 -0.1970 0.0947  0.0249  88  LYS C O   
2022 C CB  . LYS C 42  ? 0.9958 0.9970 0.8299 -0.2237 0.0687  0.0464  88  LYS C CB  
2023 C CG  . LYS C 42  ? 1.0661 1.0146 0.8447 -0.2266 0.0713  0.0578  88  LYS C CG  
2024 C CD  . LYS C 42  ? 1.1439 1.0646 0.8918 -0.2675 0.0769  0.0715  88  LYS C CD  
2025 C CE  . LYS C 42  ? 1.2101 1.0694 0.8949 -0.2689 0.0770  0.0841  88  LYS C CE  
2026 N NZ  . LYS C 42  ? 1.2871 1.1046 0.9324 -0.3108 0.0794  0.0993  88  LYS C NZ  
2027 N N   . ALA C 43  ? 0.8519 0.9618 0.7942 -0.1915 0.0611  0.0208  89  ALA C N   
2028 C CA  . ALA C 43  ? 0.8098 0.9792 0.8038 -0.1921 0.0607  0.0136  89  ALA C CA  
2029 C C   . ALA C 43  ? 0.7549 0.9589 0.7756 -0.1596 0.0653  0.0037  89  ALA C C   
2030 O O   . ALA C 43  ? 0.7333 0.9934 0.7930 -0.1562 0.0747  -0.0006 89  ALA C O   
2031 C CB  . ALA C 43  ? 0.8165 0.9647 0.8101 -0.1988 0.0396  0.0107  89  ALA C CB  
2032 N N   . LEU C 44  ? 0.7340 0.9049 0.7336 -0.1357 0.0582  0.0009  90  LEU C N   
2033 C CA  . LEU C 44  ? 0.6936 0.8870 0.7113 -0.1092 0.0599  -0.0071 90  LEU C CA  
2034 C C   . LEU C 44  ? 0.6899 0.8990 0.7027 -0.1041 0.0771  -0.0079 90  LEU C C   
2035 O O   . LEU C 44  ? 0.6777 0.9219 0.7143 -0.0909 0.0846  -0.0152 90  LEU C O   
2036 C CB  . LEU C 44  ? 0.6853 0.8441 0.6848 -0.0897 0.0470  -0.0079 90  LEU C CB  
2037 C CG  . LEU C 44  ? 0.6842 0.8248 0.6824 -0.0885 0.0322  -0.0091 90  LEU C CG  
2038 C CD1 . LEU C 44  ? 0.6689 0.7882 0.6545 -0.0666 0.0248  -0.0093 90  LEU C CD1 
2039 C CD2 . LEU C 44  ? 0.6691 0.8451 0.7007 -0.0910 0.0274  -0.0151 90  LEU C CD2 
2040 N N   . TRP C 45  ? 0.7131 0.8917 0.6900 -0.1130 0.0826  -0.0007 91  TRP C N   
2041 C CA  . TRP C 45  ? 0.7227 0.9048 0.6819 -0.1082 0.0975  -0.0014 91  TRP C CA  
2042 C C   . TRP C 45  ? 0.7265 0.9590 0.7108 -0.1121 0.1183  -0.0052 91  TRP C C   
2043 O O   . TRP C 45  ? 0.7228 0.9691 0.7064 -0.0944 0.1285  -0.0130 91  TRP C O   
2044 C CB  . TRP C 45  ? 0.7614 0.9022 0.6749 -0.1220 0.0993  0.0092  91  TRP C CB  
2045 C CG  . TRP C 45  ? 0.7605 0.8934 0.6442 -0.1159 0.1104  0.0085  91  TRP C CG  
2046 C CD1 . TRP C 45  ? 0.7743 0.9149 0.6387 -0.1292 0.1309  0.0122  91  TRP C CD1 
2047 C CD2 . TRP C 45  ? 0.7424 0.8556 0.6076 -0.0969 0.1009  0.0040  91  TRP C CD2 
2048 N NE1 . TRP C 45  ? 0.7967 0.9185 0.6265 -0.1172 0.1345  0.0089  91  TRP C NE1 
2049 C CE2 . TRP C 45  ? 0.7857 0.8898 0.6160 -0.0988 0.1145  0.0039  91  TRP C CE2 
2050 C CE3 . TRP C 45  ? 0.7177 0.8210 0.5913 -0.0809 0.0822  0.0009  91  TRP C CE3 
2051 C CZ2 . TRP C 45  ? 0.7989 0.8792 0.5998 -0.0859 0.1065  -0.0003 91  TRP C CZ2 
2052 C CZ3 . TRP C 45  ? 0.7168 0.8027 0.5671 -0.0706 0.0751  -0.0015 91  TRP C CZ3 
2053 C CH2 . TRP C 45  ? 0.7625 0.8347 0.5757 -0.0736 0.0854  -0.0026 91  TRP C CH2 
2054 N N   . LYS C 46  ? 0.7392 0.9982 0.7436 -0.1355 0.1246  0.0006  92  LYS C N   
2055 C CA  . LYS C 46  ? 0.7450 1.0635 0.7795 -0.1420 0.1469  0.0000  92  LYS C CA  
2056 C C   . LYS C 46  ? 0.7062 1.0806 0.7966 -0.1294 0.1431  -0.0079 92  LYS C C   
2057 O O   . LYS C 46  ? 0.7020 1.1370 0.8269 -0.1292 0.1610  -0.0089 92  LYS C O   
2058 C CB  . LYS C 46  ? 0.7863 1.1105 0.8144 -0.1795 0.1569  0.0135  92  LYS C CB  
2059 C CG  . LYS C 46  ? 0.7985 1.1217 0.8458 -0.2042 0.1391  0.0190  92  LYS C CG  
2060 C CD  . LYS C 46  ? 0.8631 1.1811 0.8942 -0.2457 0.1483  0.0340  92  LYS C CD  
2061 C CE  . LYS C 46  ? 0.8795 1.1758 0.9135 -0.2732 0.1262  0.0394  92  LYS C CE  
2062 N NZ  . LYS C 46  ? 0.9630 1.2345 0.9668 -0.3162 0.1323  0.0554  92  LYS C NZ  
2063 N N   . HIS C 47  ? 0.6737 1.0304 0.7729 -0.1176 0.1205  -0.0128 93  HIS C N   
2064 C CA  . HIS C 47  ? 0.6436 1.0449 0.7891 -0.1031 0.1127  -0.0198 93  HIS C CA  
2065 C C   . HIS C 47  ? 0.6391 1.0666 0.7947 -0.0717 0.1266  -0.0295 93  HIS C C   
2066 O O   . HIS C 47  ? 0.6559 1.0466 0.7745 -0.0574 0.1320  -0.0334 93  HIS C O   
2067 C CB  . HIS C 47  ? 0.6244 0.9897 0.7634 -0.0941 0.0872  -0.0228 93  HIS C CB  
2068 C CG  . HIS C 47  ? 0.6014 1.0050 0.7816 -0.0878 0.0741  -0.0268 93  HIS C CG  
2069 N ND1 . HIS C 47  ? 0.5860 1.0137 0.7872 -0.0585 0.0732  -0.0350 93  HIS C ND1 
2070 C CD2 . HIS C 47  ? 0.6057 1.0233 0.8057 -0.1072 0.0589  -0.0235 93  HIS C CD2 
2071 C CE1 . HIS C 47  ? 0.5764 1.0350 0.8109 -0.0585 0.0580  -0.0358 93  HIS C CE1 
2072 N NE2 . HIS C 47  ? 0.5865 1.0408 0.8215 -0.0889 0.0486  -0.0292 93  HIS C NE2 
2073 N N   . GLN C 48  ? 0.6250 1.1136 0.8277 -0.0601 0.1308  -0.0335 94  GLN C N   
2074 C CA  . GLN C 48  ? 0.6284 1.1391 0.8382 -0.0251 0.1443  -0.0437 94  GLN C CA  
2075 C C   . GLN C 48  ? 0.6154 1.0725 0.7954 0.0024  0.1293  -0.0526 94  GLN C C   
2076 O O   . GLN C 48  ? 0.6372 1.0784 0.7937 0.0262  0.1400  -0.0607 94  GLN C O   
2077 C CB  . GLN C 48  ? 0.6309 1.2220 0.9020 -0.0136 0.1489  -0.0454 94  GLN C CB  
2078 C CG  . GLN C 48  ? 0.6227 1.2255 0.9256 -0.0092 0.1209  -0.0461 94  GLN C CG  
2079 C CD  . GLN C 48  ? 0.6360 1.3190 0.9985 0.0114  0.1236  -0.0487 94  GLN C CD  
2080 O OE1 . GLN C 48  ? 0.6487 1.3583 1.0183 0.0430  0.1426  -0.0558 94  GLN C OE1 
2081 N NE2 . GLN C 48  ? 0.6367 1.3571 1.0400 -0.0046 0.1033  -0.0433 94  GLN C NE2 
2082 N N   . PHE C 49  ? 0.5939 1.0200 0.7702 -0.0024 0.1051  -0.0507 95  PHE C N   
2083 C CA  . PHE C 49  ? 0.5822 0.9599 0.7317 0.0177  0.0905  -0.0561 95  PHE C CA  
2084 C C   . PHE C 49  ? 0.5891 0.9097 0.6919 0.0086  0.0878  -0.0531 95  PHE C C   
2085 O O   . PHE C 49  ? 0.5882 0.8711 0.6698 0.0189  0.0752  -0.0551 95  PHE C O   
2086 C CB  . PHE C 49  ? 0.5597 0.9347 0.7262 0.0187  0.0674  -0.0546 95  PHE C CB  
2087 C CG  . PHE C 49  ? 0.5602 0.9879 0.7713 0.0322  0.0630  -0.0576 95  PHE C CG  
2088 C CD1 . PHE C 49  ? 0.5729 1.0418 0.8054 0.0545  0.0783  -0.0635 95  PHE C CD1 
2089 C CD2 . PHE C 49  ? 0.5503 0.9854 0.7796 0.0252  0.0423  -0.0545 95  PHE C CD2 
2090 C CE1 . PHE C 49  ? 0.5678 1.0919 0.8464 0.0700  0.0723  -0.0652 95  PHE C CE1 
2091 C CE2 . PHE C 49  ? 0.5526 1.0379 0.8236 0.0374  0.0340  -0.0562 95  PHE C CE2 
2092 C CZ  . PHE C 49  ? 0.5506 1.0838 0.8497 0.0604  0.0485  -0.0610 95  PHE C CZ  
2093 N N   . ALA C 50  ? 0.5951 0.9105 0.6819 -0.0115 0.0985  -0.0470 96  ALA C N   
2094 C CA  . ALA C 50  ? 0.5999 0.8662 0.6453 -0.0197 0.0935  -0.0425 96  ALA C CA  
2095 C C   . ALA C 50  ? 0.6135 0.8510 0.6242 -0.0050 0.0977  -0.0489 96  ALA C C   
2096 O O   . ALA C 50  ? 0.6185 0.8173 0.6014 -0.0072 0.0855  -0.0462 96  ALA C O   
2097 C CB  . ALA C 50  ? 0.6125 0.8761 0.6454 -0.0442 0.1020  -0.0334 96  ALA C CB  
2098 N N   . TRP C 51  ? 0.6273 0.8835 0.6382 0.0105  0.1141  -0.0572 97  TRP C N   
2099 C CA  . TRP C 51  ? 0.6603 0.8818 0.6258 0.0217  0.1209  -0.0641 97  TRP C CA  
2100 C C   . TRP C 51  ? 0.6733 0.8444 0.6096 0.0294  0.1004  -0.0673 97  TRP C C   
2101 O O   . TRP C 51  ? 0.6986 0.8310 0.5928 0.0233  0.0962  -0.0668 97  TRP C O   
2102 C CB  . TRP C 51  ? 0.6840 0.9340 0.6526 0.0430  0.1443  -0.0742 97  TRP C CB  
2103 C CG  . TRP C 51  ? 0.6557 0.9214 0.6490 0.0705  0.1402  -0.0831 97  TRP C CG  
2104 C CD1 . TRP C 51  ? 0.6307 0.9521 0.6777 0.0772  0.1418  -0.0822 97  TRP C CD1 
2105 C CD2 . TRP C 51  ? 0.6732 0.8939 0.6347 0.0949  0.1308  -0.0936 97  TRP C CD2 
2106 N NE1 . TRP C 51  ? 0.6512 0.9663 0.7026 0.1076  0.1342  -0.0913 97  TRP C NE1 
2107 C CE2 . TRP C 51  ? 0.6741 0.9238 0.6710 0.1186  0.1278  -0.0984 97  TRP C CE2 
2108 C CE3 . TRP C 51  ? 0.7243 0.8795 0.6278 0.0974  0.1223  -0.0988 97  TRP C CE3 
2109 C CZ2 . TRP C 51  ? 0.7138 0.9233 0.6861 0.1464  0.1178  -0.1081 97  TRP C CZ2 
2110 C CZ3 . TRP C 51  ? 0.7627 0.8777 0.6417 0.1213  0.1120  -0.1087 97  TRP C CZ3 
2111 C CH2 . TRP C 51  ? 0.7473 0.8868 0.6588 0.1464  0.1104  -0.1132 97  TRP C CH2 
2112 N N   . PRO C 52  ? 0.6562 0.8265 0.6124 0.0400  0.0861  -0.0692 98  PRO C N   
2113 C CA  . PRO C 52  ? 0.6813 0.8035 0.6075 0.0410  0.0674  -0.0696 98  PRO C CA  
2114 C C   . PRO C 52  ? 0.6614 0.7697 0.5831 0.0192  0.0528  -0.0577 98  PRO C C   
2115 O O   . PRO C 52  ? 0.6795 0.7546 0.5778 0.0146  0.0379  -0.0556 98  PRO C O   
2116 C CB  . PRO C 52  ? 0.6779 0.8042 0.6258 0.0563  0.0574  -0.0725 98  PRO C CB  
2117 C CG  . PRO C 52  ? 0.6596 0.8367 0.6458 0.0694  0.0715  -0.0766 98  PRO C CG  
2118 C CD  . PRO C 52  ? 0.6356 0.8432 0.6361 0.0491  0.0837  -0.0699 98  PRO C CD  
2119 N N   . PHE C 53  ? 0.6353 0.7685 0.5782 0.0064  0.0566  -0.0496 99  PHE C N   
2120 C CA  . PHE C 53  ? 0.6194 0.7440 0.5619 -0.0077 0.0443  -0.0384 99  PHE C CA  
2121 C C   . PHE C 53  ? 0.6355 0.7501 0.5553 -0.0201 0.0479  -0.0321 99  PHE C C   
2122 O O   . PHE C 53  ? 0.6354 0.7437 0.5542 -0.0277 0.0377  -0.0225 99  PHE C O   
2123 C CB  . PHE C 53  ? 0.5893 0.7369 0.5647 -0.0099 0.0418  -0.0338 99  PHE C CB  
2124 C CG  . PHE C 53  ? 0.5868 0.7432 0.5819 0.0018  0.0365  -0.0384 99  PHE C CG  
2125 C CD1 . PHE C 53  ? 0.5931 0.7330 0.5843 0.0039  0.0232  -0.0349 99  PHE C CD1 
2126 C CD2 . PHE C 53  ? 0.5880 0.7715 0.6057 0.0102  0.0442  -0.0449 99  PHE C CD2 
2127 C CE1 . PHE C 53  ? 0.5734 0.7153 0.5759 0.0144  0.0175  -0.0378 99  PHE C CE1 
2128 C CE2 . PHE C 53  ? 0.5785 0.7680 0.6116 0.0231  0.0364  -0.0484 99  PHE C CE2 
2129 C CZ  . PHE C 53  ? 0.5797 0.7438 0.6016 0.0253  0.0229  -0.0449 99  PHE C CZ  
2130 N N   . ARG C 54  ? 0.6679 0.7805 0.5671 -0.0202 0.0626  -0.0367 100 ARG C N   
2131 C CA  . ARG C 54  ? 0.6992 0.7987 0.5712 -0.0328 0.0666  -0.0296 100 ARG C CA  
2132 C C   . ARG C 54  ? 0.7317 0.7962 0.5645 -0.0361 0.0525  -0.0269 100 ARG C C   
2133 O O   . ARG C 54  ? 0.7440 0.7935 0.5512 -0.0454 0.0507  -0.0192 100 ARG C O   
2134 C CB  . ARG C 54  ? 0.7298 0.8428 0.5918 -0.0340 0.0904  -0.0338 100 ARG C CB  
2135 C CG  . ARG C 54  ? 0.7343 0.8871 0.6355 -0.0395 0.1026  -0.0319 100 ARG C CG  
2136 C CD  . ARG C 54  ? 0.7951 0.9673 0.6870 -0.0456 0.1278  -0.0323 100 ARG C CD  
2137 N NE  . ARG C 54  ? 0.8106 1.0315 0.7477 -0.0514 0.1389  -0.0313 100 ARG C NE  
2138 C CZ  . ARG C 54  ? 0.8281 1.0926 0.7876 -0.0427 0.1592  -0.0375 100 ARG C CZ  
2139 N NH1 . ARG C 54  ? 0.8738 1.1344 0.8092 -0.0239 0.1739  -0.0469 100 ARG C NH1 
2140 N NH2 . ARG C 54  ? 0.8255 1.1391 0.8315 -0.0521 0.1643  -0.0341 100 ARG C NH2 
2141 N N   . GLN C 55  ? 0.7454 0.7944 0.5706 -0.0300 0.0406  -0.0324 101 GLN C N   
2142 C CA  . GLN C 55  ? 0.7969 0.8138 0.5864 -0.0368 0.0229  -0.0298 101 GLN C CA  
2143 C C   . GLN C 55  ? 0.7826 0.7974 0.5886 -0.0381 0.0039  -0.0277 101 GLN C C   
2144 O O   . GLN C 55  ? 0.7541 0.7805 0.5849 -0.0298 0.0075  -0.0322 101 GLN C O   
2145 C CB  . GLN C 55  ? 0.8592 0.8440 0.5989 -0.0323 0.0307  -0.0413 101 GLN C CB  
2146 C CG  . GLN C 55  ? 0.9043 0.8832 0.6430 -0.0154 0.0402  -0.0558 101 GLN C CG  
2147 C CD  . GLN C 55  ? 0.9100 0.9299 0.6856 -0.0033 0.0640  -0.0600 101 GLN C CD  
2148 O OE1 . GLN C 55  ? 0.9526 0.9881 0.7225 -0.0038 0.0842  -0.0602 101 GLN C OE1 
2149 N NE2 . GLN C 55  ? 0.8806 0.9198 0.6941 0.0057  0.0607  -0.0618 101 GLN C NE2 
2150 N N   . PRO C 56  ? 0.8078 0.8097 0.6002 -0.0499 -0.0172 -0.0194 102 PRO C N   
2151 C CA  . PRO C 56  ? 0.8074 0.8094 0.6140 -0.0564 -0.0349 -0.0152 102 PRO C CA  
2152 C C   . PRO C 56  ? 0.8432 0.8144 0.6285 -0.0514 -0.0346 -0.0276 102 PRO C C   
2153 O O   . PRO C 56  ? 0.8912 0.8312 0.6368 -0.0447 -0.0275 -0.0395 102 PRO C O   
2154 C CB  . PRO C 56  ? 0.8372 0.8286 0.6236 -0.0722 -0.0575 -0.0057 102 PRO C CB  
2155 C CG  . PRO C 56  ? 0.8389 0.8361 0.6162 -0.0702 -0.0524 -0.0006 102 PRO C CG  
2156 C CD  . PRO C 56  ? 0.8355 0.8247 0.5994 -0.0591 -0.0269 -0.0120 102 PRO C CD  
2157 N N   . VAL C 57  ? 0.8307 0.8077 0.6384 -0.0528 -0.0415 -0.0246 103 VAL C N   
2158 C CA  . VAL C 57  ? 0.8782 0.8162 0.6598 -0.0495 -0.0467 -0.0338 103 VAL C CA  
2159 C C   . VAL C 57  ? 0.9502 0.8438 0.6841 -0.0666 -0.0670 -0.0344 103 VAL C C   
2160 O O   . VAL C 57  ? 0.9504 0.8556 0.6931 -0.0878 -0.0857 -0.0211 103 VAL C O   
2161 C CB  . VAL C 57  ? 0.8544 0.8038 0.6649 -0.0527 -0.0532 -0.0264 103 VAL C CB  
2162 C CG1 . VAL C 57  ? 0.8915 0.7885 0.6657 -0.0523 -0.0632 -0.0337 103 VAL C CG1 
2163 C CG2 . VAL C 57  ? 0.8053 0.7920 0.6556 -0.0359 -0.0361 -0.0272 103 VAL C CG2 
2164 N N   . ASP C 58  ? 1.0191 0.8638 0.7017 -0.0566 -0.0635 -0.0497 104 ASP C N   
2165 C CA  . ASP C 58  ? 1.0970 0.8843 0.7214 -0.0724 -0.0849 -0.0533 104 ASP C CA  
2166 C C   . ASP C 58  ? 1.1376 0.8778 0.7388 -0.0729 -0.0960 -0.0585 104 ASP C C   
2167 O O   . ASP C 58  ? 1.1751 0.8749 0.7420 -0.0497 -0.0854 -0.0745 104 ASP C O   
2168 C CB  . ASP C 58  ? 1.1500 0.9025 0.7198 -0.0597 -0.0739 -0.0678 104 ASP C CB  
2169 C CG  . ASP C 58  ? 1.2338 0.9255 0.7374 -0.0795 -0.0995 -0.0706 104 ASP C CG  
2170 O OD1 . ASP C 58  ? 1.2658 0.9210 0.7508 -0.0974 -0.1236 -0.0683 104 ASP C OD1 
2171 O OD2 . ASP C 58  ? 1.2769 0.9540 0.7429 -0.0791 -0.0968 -0.0747 104 ASP C OD2 
2172 N N   . ALA C 59  ? 1.1334 0.8804 0.7538 -0.0984 -0.1165 -0.0439 105 ALA C N   
2173 C CA  . ALA C 59  ? 1.1777 0.8788 0.7765 -0.1047 -0.1290 -0.0445 105 ALA C CA  
2174 C C   . ALA C 59  ? 1.2825 0.8930 0.7996 -0.1062 -0.1436 -0.0592 105 ALA C C   
2175 O O   . ALA C 59  ? 1.3286 0.8858 0.8139 -0.0955 -0.1461 -0.0670 105 ALA C O   
2176 C CB  . ALA C 59  ? 1.1510 0.8810 0.7838 -0.1383 -0.1479 -0.0231 105 ALA C CB  
2177 N N   . VAL C 60  ? 1.3299 0.9170 0.8074 -0.1178 -0.1542 -0.0632 106 VAL C N   
2178 C CA  . VAL C 60  ? 1.4420 0.9355 0.8311 -0.1179 -0.1680 -0.0794 106 VAL C CA  
2179 C C   . VAL C 60  ? 1.4790 0.9428 0.8338 -0.0726 -0.1400 -0.1019 106 VAL C C   
2180 O O   . VAL C 60  ? 1.5488 0.9452 0.8550 -0.0554 -0.1415 -0.1151 106 VAL C O   
2181 C CB  . VAL C 60  ? 1.4825 0.9589 0.8345 -0.1443 -0.1896 -0.0768 106 VAL C CB  
2182 C CG1 . VAL C 60  ? 1.6020 0.9728 0.8517 -0.1415 -0.2027 -0.0963 106 VAL C CG1 
2183 C CG2 . VAL C 60  ? 1.4563 0.9657 0.8439 -0.1890 -0.2199 -0.0538 106 VAL C CG2 
2184 N N   . LYS C 61  ? 1.4424 0.9575 0.8228 -0.0532 -0.1142 -0.1053 107 LYS C N   
2185 C CA  . LYS C 61  ? 1.4732 0.9777 0.8309 -0.0114 -0.0837 -0.1245 107 LYS C CA  
2186 C C   . LYS C 61  ? 1.4471 0.9689 0.8402 0.0177  -0.0683 -0.1285 107 LYS C C   
2187 O O   . LYS C 61  ? 1.5029 0.9798 0.8551 0.0504  -0.0574 -0.1455 107 LYS C O   
2188 C CB  . LYS C 61  ? 1.4295 0.9957 0.8166 -0.0036 -0.0590 -0.1226 107 LYS C CB  
2189 C CG  . LYS C 61  ? 1.4936 1.0292 0.8263 -0.0207 -0.0693 -0.1237 107 LYS C CG  
2190 C CD  . LYS C 61  ? 1.4626 1.0545 0.8208 -0.0131 -0.0436 -0.1200 107 LYS C CD  
2191 C CE  . LYS C 61  ? 1.5145 1.0780 0.8203 -0.0328 -0.0578 -0.1174 107 LYS C CE  
2192 N NZ  . LYS C 61  ? 1.4819 1.0988 0.8142 -0.0305 -0.0361 -0.1094 107 LYS C NZ  
2193 N N   . LEU C 62  ? 1.3667 0.9522 0.8329 0.0078  -0.0681 -0.1128 108 LEU C N   
2194 C CA  . LEU C 62  ? 1.3393 0.9455 0.8423 0.0320  -0.0576 -0.1139 108 LEU C CA  
2195 C C   . LEU C 62  ? 1.3931 0.9319 0.8604 0.0278  -0.0798 -0.1138 108 LEU C C   
2196 O O   . LEU C 62  ? 1.3884 0.9292 0.8725 0.0505  -0.0745 -0.1157 108 LEU C O   
2197 C CB  . LEU C 62  ? 1.2421 0.9326 0.8265 0.0218  -0.0508 -0.0976 108 LEU C CB  
2198 C CG  . LEU C 62  ? 1.1943 0.9490 0.8159 0.0251  -0.0296 -0.0958 108 LEU C CG  
2199 C CD1 . LEU C 62  ? 1.1162 0.9386 0.8070 0.0136  -0.0274 -0.0802 108 LEU C CD1 
2200 C CD2 . LEU C 62  ? 1.2084 0.9748 0.8269 0.0604  -0.0028 -0.1110 108 LEU C CD2 
2201 N N   . GLY C 63  ? 1.4505 0.9280 0.8668 -0.0030 -0.1064 -0.1105 109 GLY C N   
2202 C CA  . GLY C 63  ? 1.5089 0.9139 0.8839 -0.0151 -0.1302 -0.1081 109 GLY C CA  
2203 C C   . GLY C 63  ? 1.4450 0.8945 0.8780 -0.0325 -0.1359 -0.0884 109 GLY C C   
2204 O O   . GLY C 63  ? 1.4725 0.8938 0.8984 -0.0166 -0.1373 -0.0891 109 GLY C O   
2205 N N   . LEU C 64  ? 1.3644 0.8821 0.8516 -0.0626 -0.1386 -0.0708 110 LEU C N   
2206 C CA  . LEU C 64  ? 1.3012 0.8680 0.8435 -0.0800 -0.1410 -0.0512 110 LEU C CA  
2207 C C   . LEU C 64  ? 1.3054 0.8722 0.8476 -0.1289 -0.1653 -0.0325 110 LEU C C   
2208 O O   . LEU C 64  ? 1.2398 0.8782 0.8347 -0.1459 -0.1629 -0.0187 110 LEU C O   
2209 C CB  . LEU C 64  ? 1.1999 0.8600 0.8152 -0.0662 -0.1181 -0.0464 110 LEU C CB  
2210 C CG  . LEU C 64  ? 1.1694 0.8522 0.8011 -0.0243 -0.0935 -0.0612 110 LEU C CG  
2211 C CD1 . LEU C 64  ? 1.0778 0.8429 0.7704 -0.0226 -0.0763 -0.0552 110 LEU C CD1 
2212 C CD2 . LEU C 64  ? 1.1724 0.8391 0.8066 -0.0026 -0.0919 -0.0630 110 LEU C CD2 
2213 N N   . PRO C 65  ? 1.3831 0.8699 0.8661 -0.1519 -0.1896 -0.0314 111 PRO C N   
2214 C CA  . PRO C 65  ? 1.3948 0.8824 0.8760 -0.2034 -0.2157 -0.0132 111 PRO C CA  
2215 C C   . PRO C 65  ? 1.3096 0.8779 0.8615 -0.2284 -0.2133 0.0122  111 PRO C C   
2216 O O   . PRO C 65  ? 1.3004 0.9092 0.8776 -0.2642 -0.2274 0.0283  111 PRO C O   
2217 C CB  . PRO C 65  ? 1.5088 0.8851 0.9084 -0.2204 -0.2404 -0.0173 111 PRO C CB  
2218 C CG  . PRO C 65  ? 1.5382 0.8683 0.9114 -0.1759 -0.2255 -0.0325 111 PRO C CG  
2219 C CD  . PRO C 65  ? 1.4721 0.8617 0.8845 -0.1314 -0.1957 -0.0465 111 PRO C CD  
2220 N N   . ASP C 66  ? 1.2522 0.8454 0.8346 -0.2083 -0.1957 0.0158  112 ASP C N   
2221 C CA  . ASP C 66  ? 1.1817 0.8451 0.8226 -0.2276 -0.1899 0.0386  112 ASP C CA  
2222 C C   . ASP C 66  ? 1.0661 0.8222 0.7753 -0.2052 -0.1661 0.0403  112 ASP C C   
2223 O O   . ASP C 66  ? 1.0156 0.8326 0.7723 -0.2148 -0.1578 0.0572  112 ASP C O   
2224 C CB  . ASP C 66  ? 1.2129 0.8391 0.8364 -0.2237 -0.1881 0.0440  112 ASP C CB  
2225 C CG  . ASP C 66  ? 1.2069 0.8240 0.8295 -0.1741 -0.1693 0.0269  112 ASP C CG  
2226 O OD1 . ASP C 66  ? 1.1971 0.8049 0.8089 -0.1446 -0.1617 0.0072  112 ASP C OD1 
2227 O OD2 . ASP C 66  ? 1.2409 0.8622 0.8733 -0.1657 -0.1626 0.0341  112 ASP C OD2 
2228 N N   . TYR C 67  ? 1.0245 0.7881 0.7344 -0.1761 -0.1545 0.0233  113 TYR C N   
2229 C CA  . TYR C 67  ? 0.9307 0.7678 0.6954 -0.1541 -0.1329 0.0233  113 TYR C CA  
2230 C C   . TYR C 67  ? 0.8747 0.7833 0.6891 -0.1752 -0.1344 0.0425  113 TYR C C   
2231 O O   . TYR C 67  ? 0.8218 0.7830 0.6791 -0.1672 -0.1200 0.0514  113 TYR C O   
2232 C CB  . TYR C 67  ? 0.9168 0.7490 0.6698 -0.1289 -0.1230 0.0052  113 TYR C CB  
2233 C CG  . TYR C 67  ? 0.8466 0.7428 0.6490 -0.1078 -0.1017 0.0051  113 TYR C CG  
2234 C CD1 . TYR C 67  ? 0.7878 0.6934 0.6057 -0.0824 -0.0858 -0.0014 113 TYR C CD1 
2235 C CD2 . TYR C 67  ? 0.7956 0.7396 0.6266 -0.1142 -0.1002 0.0125  113 TYR C CD2 
2236 C CE1 . TYR C 67  ? 0.7265 0.6835 0.5840 -0.0673 -0.0693 -0.0014 113 TYR C CE1 
2237 C CE2 . TYR C 67  ? 0.7378 0.7288 0.6057 -0.0961 -0.0826 0.0126  113 TYR C CE2 
2238 C CZ  . TYR C 67  ? 0.7093 0.7050 0.5892 -0.0745 -0.0673 0.0053  113 TYR C CZ  
2239 O OH  . TYR C 67  ? 0.6854 0.7209 0.5966 -0.0603 -0.0526 0.0052  113 TYR C OH  
2240 N N   . HIS C 68  ? 0.8964 0.8059 0.7028 -0.2005 -0.1527 0.0485  114 HIS C N   
2241 C CA  . HIS C 68  ? 0.8522 0.8353 0.7088 -0.2169 -0.1559 0.0670  114 HIS C CA  
2242 C C   . HIS C 68  ? 0.8627 0.8747 0.7434 -0.2484 -0.1634 0.0893  114 HIS C C   
2243 O O   . HIS C 68  ? 0.8279 0.9123 0.7583 -0.2584 -0.1623 0.1064  114 HIS C O   
2244 C CB  . HIS C 68  ? 0.8669 0.8465 0.7087 -0.2299 -0.1745 0.0656  114 HIS C CB  
2245 C CG  . HIS C 68  ? 0.8449 0.8087 0.6682 -0.2003 -0.1630 0.0476  114 HIS C CG  
2246 N ND1 . HIS C 68  ? 0.7809 0.7944 0.6418 -0.1753 -0.1436 0.0474  114 HIS C ND1 
2247 C CD2 . HIS C 68  ? 0.8875 0.7894 0.6554 -0.1923 -0.1668 0.0297  114 HIS C CD2 
2248 C CE1 . HIS C 68  ? 0.7868 0.7727 0.6189 -0.1569 -0.1363 0.0319  114 HIS C CE1 
2249 N NE2 . HIS C 68  ? 0.8401 0.7617 0.6170 -0.1653 -0.1486 0.0208  114 HIS C NE2 
2250 N N   . LYS C 69  ? 0.9201 0.8763 0.7649 -0.2632 -0.1704 0.0900  115 LYS C N   
2251 C CA  . LYS C 69  ? 0.9356 0.9174 0.8008 -0.2913 -0.1716 0.1120  115 LYS C CA  
2252 C C   . LYS C 69  ? 0.8928 0.9143 0.7903 -0.2649 -0.1443 0.1149  115 LYS C C   
2253 O O   . LYS C 69  ? 0.8805 0.9582 0.8150 -0.2786 -0.1359 0.1344  115 LYS C O   
2254 C CB  . LYS C 69  ? 1.0235 0.9201 0.8295 -0.3175 -0.1899 0.1127  115 LYS C CB  
2255 C CG  . LYS C 69  ? 1.0969 0.9468 0.8634 -0.3527 -0.2210 0.1129  115 LYS C CG  
2256 C CD  . LYS C 69  ? 1.1995 0.9535 0.8996 -0.3770 -0.2389 0.1133  115 LYS C CD  
2257 C CE  . LYS C 69  ? 1.2908 0.9802 0.9372 -0.4100 -0.2720 0.1095  115 LYS C CE  
2258 N NZ  . LYS C 69  ? 1.3987 0.9762 0.9673 -0.4279 -0.2898 0.1065  115 LYS C NZ  
2259 N N   . ILE C 70  ? 0.8727 0.8654 0.7544 -0.2276 -0.1309 0.0955  116 ILE C N   
2260 C CA  . ILE C 70  ? 0.8377 0.8532 0.7386 -0.2024 -0.1093 0.0953  116 ILE C CA  
2261 C C   . ILE C 70  ? 0.7699 0.8493 0.7149 -0.1775 -0.0923 0.0923  116 ILE C C   
2262 O O   . ILE C 70  ? 0.7315 0.8590 0.7076 -0.1705 -0.0771 0.1024  116 ILE C O   
2263 C CB  . ILE C 70  ? 0.8630 0.8128 0.7233 -0.1773 -0.1076 0.0774  116 ILE C CB  
2264 C CG1 . ILE C 70  ? 0.9380 0.8188 0.7501 -0.1990 -0.1236 0.0829  116 ILE C CG1 
2265 C CG2 . ILE C 70  ? 0.8254 0.8017 0.7064 -0.1489 -0.0883 0.0744  116 ILE C CG2 
2266 C CD1 . ILE C 70  ? 0.9845 0.7929 0.7505 -0.1723 -0.1272 0.0641  116 ILE C CD1 
2267 N N   . ILE C 71  ? 0.7588 0.8327 0.7001 -0.1640 -0.0947 0.0787  117 ILE C N   
2268 C CA  . ILE C 71  ? 0.7167 0.8366 0.6897 -0.1407 -0.0809 0.0749  117 ILE C CA  
2269 C C   . ILE C 71  ? 0.7136 0.8841 0.7165 -0.1541 -0.0882 0.0882  117 ILE C C   
2270 O O   . ILE C 71  ? 0.7398 0.8952 0.7279 -0.1683 -0.1050 0.0867  117 ILE C O   
2271 C CB  . ILE C 71  ? 0.7131 0.8006 0.6647 -0.1184 -0.0771 0.0542  117 ILE C CB  
2272 C CG1 . ILE C 71  ? 0.7162 0.7678 0.6487 -0.1007 -0.0696 0.0423  117 ILE C CG1 
2273 C CG2 . ILE C 71  ? 0.6744 0.8011 0.6521 -0.0999 -0.0655 0.0521  117 ILE C CG2 
2274 C CD1 . ILE C 71  ? 0.6928 0.7713 0.6472 -0.0891 -0.0564 0.0479  117 ILE C CD1 
2275 N N   . LYS C 72  ? 0.6920 0.9218 0.7346 -0.1470 -0.0759 0.1008  118 LYS C N   
2276 C CA  . LYS C 72  ? 0.6947 0.9845 0.7739 -0.1556 -0.0820 0.1163  118 LYS C CA  
2277 C C   . LYS C 72  ? 0.6646 0.9665 0.7506 -0.1339 -0.0819 0.1094  118 LYS C C   
2278 O O   . LYS C 72  ? 0.6669 0.9948 0.7662 -0.1442 -0.0971 0.1178  118 LYS C O   
2279 C CB  . LYS C 72  ? 0.6898 1.0412 0.8080 -0.1523 -0.0662 0.1333  118 LYS C CB  
2280 C CG  . LYS C 72  ? 0.7542 1.0985 0.8655 -0.1762 -0.0641 0.1444  118 LYS C CG  
2281 C CD  . LYS C 72  ? 0.8240 1.1829 0.9429 -0.2183 -0.0846 0.1614  118 LYS C CD  
2282 C CE  . LYS C 72  ? 0.8888 1.1677 0.9566 -0.2399 -0.1066 0.1505  118 LYS C CE  
2283 N NZ  . LYS C 72  ? 0.9404 1.2304 1.0125 -0.2820 -0.1323 0.1652  118 LYS C NZ  
2284 N N   . GLN C 73  ? 0.6412 0.9244 0.7171 -0.1061 -0.0665 0.0955  119 GLN C N   
2285 C CA  . GLN C 73  ? 0.6295 0.9166 0.7060 -0.0859 -0.0645 0.0897  119 GLN C CA  
2286 C C   . GLN C 73  ? 0.6209 0.8554 0.6628 -0.0762 -0.0599 0.0704  119 GLN C C   
2287 O O   . GLN C 73  ? 0.6098 0.8354 0.6499 -0.0585 -0.0451 0.0620  119 GLN C O   
2288 C CB  . GLN C 73  ? 0.6138 0.9390 0.7164 -0.0606 -0.0482 0.0951  119 GLN C CB  
2289 C CG  . GLN C 73  ? 0.6706 1.0614 0.8136 -0.0625 -0.0502 0.1149  119 GLN C CG  
2290 C CD  . GLN C 73  ? 0.6950 1.1189 0.8579 -0.0386 -0.0289 0.1200  119 GLN C CD  
2291 O OE1 . GLN C 73  ? 0.7416 1.1355 0.8851 -0.0192 -0.0153 0.1081  119 GLN C OE1 
2292 N NE2 . GLN C 73  ? 0.7299 1.2175 0.9307 -0.0406 -0.0261 0.1380  119 GLN C NE2 
2293 N N   . PRO C 74  ? 0.6377 0.8385 0.6512 -0.0885 -0.0726 0.0636  120 PRO C N   
2294 C CA  . PRO C 74  ? 0.6411 0.8007 0.6245 -0.0782 -0.0653 0.0466  120 PRO C CA  
2295 C C   . PRO C 74  ? 0.6182 0.7862 0.6056 -0.0601 -0.0546 0.0438  120 PRO C C   
2296 O O   . PRO C 74  ? 0.6088 0.7999 0.6080 -0.0568 -0.0598 0.0535  120 PRO C O   
2297 C CB  . PRO C 74  ? 0.6829 0.8098 0.6325 -0.0940 -0.0815 0.0426  120 PRO C CB  
2298 C CG  . PRO C 74  ? 0.7038 0.8430 0.6621 -0.1176 -0.0993 0.0555  120 PRO C CG  
2299 C CD  . PRO C 74  ? 0.6688 0.8675 0.6740 -0.1133 -0.0945 0.0714  120 PRO C CD  
2300 N N   . MET C 75  ? 0.5988 0.7478 0.5762 -0.0490 -0.0409 0.0315  121 MET C N   
2301 C CA  . MET C 75  ? 0.5929 0.7410 0.5673 -0.0375 -0.0316 0.0288  121 MET C CA  
2302 C C   . MET C 75  ? 0.6006 0.7258 0.5578 -0.0349 -0.0205 0.0149  121 MET C C   
2303 O O   . MET C 75  ? 0.5991 0.7161 0.5557 -0.0339 -0.0173 0.0070  121 MET C O   
2304 C CB  . MET C 75  ? 0.5714 0.7407 0.5682 -0.0245 -0.0240 0.0341  121 MET C CB  
2305 C CG  . MET C 75  ? 0.5665 0.7276 0.5550 -0.0142 -0.0182 0.0339  121 MET C CG  
2306 S SD  . MET C 75  ? 0.6019 0.7563 0.5729 -0.0158 -0.0293 0.0421  121 MET C SD  
2307 C CE  . MET C 75  ? 0.5704 0.7657 0.5698 -0.0138 -0.0428 0.0575  121 MET C CE  
2308 N N   . ASP C 76  ? 0.6125 0.7286 0.5552 -0.0335 -0.0149 0.0131  122 ASP C N   
2309 C CA  . ASP C 76  ? 0.6184 0.7225 0.5483 -0.0327 -0.0018 0.0023  122 ASP C CA  
2310 C C   . ASP C 76  ? 0.6284 0.7301 0.5525 -0.0329 0.0058  0.0055  122 ASP C C   
2311 O O   . ASP C 76  ? 0.6232 0.7226 0.5435 -0.0316 -0.0014 0.0151  122 ASP C O   
2312 C CB  . ASP C 76  ? 0.6451 0.7274 0.5442 -0.0377 -0.0034 -0.0040 122 ASP C CB  
2313 C CG  . ASP C 76  ? 0.6772 0.7459 0.5497 -0.0447 -0.0116 0.0028  122 ASP C CG  
2314 O OD1 . ASP C 76  ? 0.6599 0.7318 0.5341 -0.0497 -0.0287 0.0117  122 ASP C OD1 
2315 O OD2 . ASP C 76  ? 0.6696 0.7264 0.5196 -0.0460 -0.0013 0.0004  122 ASP C OD2 
2316 N N   . MET C 77  ? 0.6333 0.7358 0.5566 -0.0346 0.0196  -0.0016 123 MET C N   
2317 C CA  . MET C 77  ? 0.6489 0.7453 0.5640 -0.0405 0.0270  0.0022  123 MET C CA  
2318 C C   . MET C 77  ? 0.6653 0.7403 0.5459 -0.0472 0.0267  0.0077  123 MET C C   
2319 O O   . MET C 77  ? 0.6822 0.7420 0.5488 -0.0511 0.0261  0.0155  123 MET C O   
2320 C CB  . MET C 77  ? 0.6505 0.7621 0.5790 -0.0451 0.0415  -0.0051 123 MET C CB  
2321 C CG  . MET C 77  ? 0.6718 0.8001 0.6299 -0.0402 0.0389  -0.0084 123 MET C CG  
2322 S SD  . MET C 77  ? 0.7393 0.8881 0.7150 -0.0515 0.0503  -0.0120 123 MET C SD  
2323 C CE  . MET C 77  ? 0.7054 0.8780 0.6868 -0.0470 0.0649  -0.0206 123 MET C CE  
2324 N N   . GLY C 78  ? 0.6762 0.7433 0.5364 -0.0484 0.0261  0.0038  124 GLY C N   
2325 C CA  . GLY C 78  ? 0.7110 0.7537 0.5312 -0.0546 0.0231  0.0091  124 GLY C CA  
2326 C C   . GLY C 78  ? 0.7152 0.7493 0.5308 -0.0519 0.0039  0.0215  124 GLY C C   
2327 O O   . GLY C 78  ? 0.7450 0.7590 0.5353 -0.0547 0.0016  0.0301  124 GLY C O   
2328 N N   . THR C 79  ? 0.6908 0.7416 0.5314 -0.0459 -0.0096 0.0235  125 THR C N   
2329 C CA  . THR C 79  ? 0.6835 0.7408 0.5315 -0.0396 -0.0270 0.0359  125 THR C CA  
2330 C C   . THR C 79  ? 0.6736 0.7292 0.5307 -0.0298 -0.0228 0.0416  125 THR C C   
2331 O O   . THR C 79  ? 0.6890 0.7311 0.5302 -0.0235 -0.0318 0.0515  125 THR C O   
2332 C CB  . THR C 79  ? 0.6562 0.7411 0.5355 -0.0377 -0.0381 0.0375  125 THR C CB  
2333 O OG1 . THR C 79  ? 0.6671 0.7424 0.5290 -0.0490 -0.0468 0.0331  125 THR C OG1 
2334 C CG2 . THR C 79  ? 0.6690 0.7752 0.5668 -0.0283 -0.0527 0.0516  125 THR C CG2 
2335 N N   . ILE C 80  ? 0.6512 0.7154 0.5289 -0.0277 -0.0109 0.0351  126 ILE C N   
2336 C CA  . ILE C 80  ? 0.6585 0.7120 0.5374 -0.0195 -0.0079 0.0384  126 ILE C CA  
2337 C C   . ILE C 80  ? 0.6979 0.7161 0.5411 -0.0280 -0.0036 0.0419  126 ILE C C   
2338 O O   . ILE C 80  ? 0.7083 0.7017 0.5332 -0.0194 -0.0099 0.0499  126 ILE C O   
2339 C CB  . ILE C 80  ? 0.6320 0.6978 0.5344 -0.0192 0.0016  0.0297  126 ILE C CB  
2340 C CG1 . ILE C 80  ? 0.5960 0.6907 0.5278 -0.0102 -0.0028 0.0291  126 ILE C CG1 
2341 C CG2 . ILE C 80  ? 0.6463 0.6887 0.5377 -0.0145 0.0034  0.0313  126 ILE C CG2 
2342 C CD1 . ILE C 80  ? 0.5581 0.6637 0.5083 -0.0114 0.0046  0.0201  126 ILE C CD1 
2343 N N   . LYS C 81  ? 0.7159 0.7305 0.5464 -0.0440 0.0078  0.0365  127 LYS C N   
2344 C CA  . LYS C 81  ? 0.7615 0.7456 0.5565 -0.0576 0.0151  0.0413  127 LYS C CA  
2345 C C   . LYS C 81  ? 0.8056 0.7603 0.5628 -0.0540 0.0026  0.0526  127 LYS C C   
2346 O O   . LYS C 81  ? 0.8273 0.7461 0.5548 -0.0554 -0.0004 0.0614  127 LYS C O   
2347 C CB  . LYS C 81  ? 0.7715 0.7691 0.5646 -0.0729 0.0328  0.0338  127 LYS C CB  
2348 C CG  . LYS C 81  ? 0.8287 0.8021 0.5868 -0.0914 0.0447  0.0401  127 LYS C CG  
2349 C CD  . LYS C 81  ? 0.8495 0.8521 0.6200 -0.1038 0.0668  0.0321  127 LYS C CD  
2350 C CE  . LYS C 81  ? 0.9109 0.8956 0.6440 -0.1241 0.0820  0.0400  127 LYS C CE  
2351 N NZ  . LYS C 81  ? 0.9535 0.9090 0.6388 -0.1212 0.0780  0.0446  127 LYS C NZ  
2352 N N   . ARG C 82  ? 0.8170 0.7825 0.5715 -0.0502 -0.0069 0.0527  128 ARG C N   
2353 C CA  . ARG C 82  ? 0.8651 0.8079 0.5864 -0.0458 -0.0239 0.0639  128 ARG C CA  
2354 C C   . ARG C 82  ? 0.8567 0.7963 0.5880 -0.0258 -0.0394 0.0739  128 ARG C C   
2355 O O   . ARG C 82  ? 0.9014 0.8071 0.5987 -0.0200 -0.0490 0.0848  128 ARG C O   
2356 C CB  . ARG C 82  ? 0.8763 0.8353 0.5982 -0.0473 -0.0353 0.0610  128 ARG C CB  
2357 C CG  . ARG C 82  ? 0.9718 0.9052 0.6509 -0.0487 -0.0528 0.0708  128 ARG C CG  
2358 C CD  . ARG C 82  ? 1.0083 0.9537 0.6849 -0.0539 -0.0675 0.0669  128 ARG C CD  
2359 N NE  . ARG C 82  ? 1.0098 0.9944 0.7337 -0.0453 -0.0843 0.0706  128 ARG C NE  
2360 C CZ  . ARG C 82  ? 1.0046 1.0155 0.7599 -0.0496 -0.0830 0.0624  128 ARG C CZ  
2361 N NH1 . ARG C 82  ? 1.0104 1.0111 0.7554 -0.0584 -0.0671 0.0485  128 ARG C NH1 
2362 N NH2 . ARG C 82  ? 0.9854 1.0338 0.7822 -0.0442 -0.0973 0.0692  128 ARG C NH2 
2363 N N   . ARG C 83  ? 0.8042 0.7773 0.5792 -0.0132 -0.0407 0.0705  129 ARG C N   
2364 C CA  . ARG C 83  ? 0.8001 0.7773 0.5882 0.0106  -0.0511 0.0786  129 ARG C CA  
2365 C C   . ARG C 83  ? 0.8358 0.7673 0.5951 0.0163  -0.0458 0.0809  129 ARG C C   
2366 O O   . ARG C 83  ? 0.8644 0.7708 0.6028 0.0350  -0.0574 0.0908  129 ARG C O   
2367 C CB  . ARG C 83  ? 0.7498 0.7729 0.5870 0.0204  -0.0487 0.0741  129 ARG C CB  
2368 C CG  . ARG C 83  ? 0.7300 0.7940 0.5929 0.0178  -0.0611 0.0775  129 ARG C CG  
2369 C CD  . ARG C 83  ? 0.6842 0.7908 0.5916 0.0212  -0.0560 0.0740  129 ARG C CD  
2370 N NE  . ARG C 83  ? 0.6784 0.8239 0.6101 0.0167  -0.0710 0.0811  129 ARG C NE  
2371 C CZ  . ARG C 83  ? 0.6584 0.8473 0.6295 0.0188  -0.0709 0.0842  129 ARG C CZ  
2372 N NH1 . ARG C 83  ? 0.6442 0.8424 0.6329 0.0289  -0.0558 0.0799  129 ARG C NH1 
2373 N NH2 . ARG C 83  ? 0.6767 0.8991 0.6672 0.0087  -0.0871 0.0926  129 ARG C NH2 
2374 N N   . LEU C 84  ? 0.8250 0.7436 0.5812 -0.0003 -0.0301 0.0722  130 LEU C N   
2375 C CA  . LEU C 84  ? 0.8756 0.7443 0.5989 -0.0032 -0.0268 0.0743  130 LEU C CA  
2376 C C   . LEU C 84  ? 0.9400 0.7603 0.6106 -0.0129 -0.0317 0.0851  130 LEU C C   
2377 O O   . LEU C 84  ? 0.9961 0.7673 0.6309 -0.0015 -0.0405 0.0932  130 LEU C O   
2378 C CB  . LEU C 84  ? 0.8603 0.7335 0.5955 -0.0248 -0.0114 0.0640  130 LEU C CB  
2379 C CG  . LEU C 84  ? 0.8145 0.7165 0.5874 -0.0134 -0.0089 0.0547  130 LEU C CG  
2380 C CD1 . LEU C 84  ? 0.7835 0.7056 0.5768 -0.0355 0.0035  0.0447  130 LEU C CD1 
2381 C CD2 . LEU C 84  ? 0.8307 0.6951 0.5838 0.0062  -0.0152 0.0565  130 LEU C CD2 
2382 N N   . GLU C 85  ? 0.9368 0.7662 0.5972 -0.0323 -0.0262 0.0852  131 GLU C N   
2383 C CA  . GLU C 85  ? 1.0030 0.7874 0.6087 -0.0440 -0.0291 0.0960  131 GLU C CA  
2384 C C   . GLU C 85  ? 1.0365 0.7991 0.6184 -0.0201 -0.0521 0.1084  131 GLU C C   
2385 O O   . GLU C 85  ? 1.0902 0.7984 0.6196 -0.0218 -0.0592 0.1199  131 GLU C O   
2386 C CB  . GLU C 85  ? 1.0024 0.8061 0.6016 -0.0647 -0.0172 0.0920  131 GLU C CB  
2387 C CG  . GLU C 85  ? 0.9981 0.8201 0.6125 -0.0884 0.0071  0.0829  131 GLU C CG  
2388 C CD  . GLU C 85  ? 1.0068 0.8573 0.6230 -0.0990 0.0208  0.0755  131 GLU C CD  
2389 O OE1 . GLU C 85  ? 1.0302 0.8851 0.6372 -0.0896 0.0096  0.0751  131 GLU C OE1 
2390 O OE2 . GLU C 85  ? 1.0031 0.8720 0.6292 -0.1164 0.0423  0.0698  131 GLU C OE2 
2391 N N   . ASN C 86  ? 0.9979 0.8047 0.6191 0.0014  -0.0646 0.1074  132 ASN C N   
2392 C CA  . ASN C 86  ? 1.0299 0.8340 0.6402 0.0240  -0.0886 0.1197  132 ASN C CA  
2393 C C   . ASN C 86  ? 1.0248 0.8297 0.6516 0.0590  -0.0988 0.1249  132 ASN C C   
2394 O O   . ASN C 86  ? 1.0284 0.8480 0.6611 0.0831  -0.1188 0.1352  132 ASN C O   
2395 C CB  . ASN C 86  ? 1.0000 0.8572 0.6420 0.0211  -0.0983 0.1177  132 ASN C CB  
2396 C CG  . ASN C 86  ? 1.0388 0.8839 0.6496 -0.0066 -0.0915 0.1133  132 ASN C CG  
2397 O OD1 . ASN C 86  ? 1.1218 0.9209 0.6831 -0.0212 -0.0828 0.1165  132 ASN C OD1 
2398 N ND2 . ASN C 86  ? 1.0565 0.9403 0.6925 -0.0141 -0.0948 0.1064  132 ASN C ND2 
2399 N N   . ASN C 87  ? 1.0073 0.7970 0.6398 0.0630  -0.0856 0.1176  133 ASN C N   
2400 C CA  . ASN C 87  ? 1.0190 0.8002 0.6579 0.0988  -0.0911 0.1198  133 ASN C CA  
2401 C C   . ASN C 87  ? 0.9611 0.8169 0.6612 0.1228  -0.0952 0.1196  133 ASN C C   
2402 O O   . ASN C 87  ? 0.9726 0.8360 0.6807 0.1593  -0.1041 0.1263  133 ASN C O   
2403 C CB  . ASN C 87  ? 1.1018 0.8220 0.6873 0.1211  -0.1083 0.1336  133 ASN C CB  
2404 C CG  . ASN C 87  ? 1.1702 0.8086 0.6897 0.0963  -0.1037 0.1360  133 ASN C CG  
2405 O OD1 . ASN C 87  ? 1.1773 0.7886 0.6873 0.0800  -0.0898 0.1275  133 ASN C OD1 
2406 N ND2 . ASN C 87  ? 1.2269 0.8245 0.6983 0.0917  -0.1167 0.1489  133 ASN C ND2 
2407 N N   . TYR C 88  ? 0.8905 0.8007 0.6322 0.1025  -0.0882 0.1125  134 TYR C N   
2408 C CA  . TYR C 88  ? 0.8526 0.8352 0.6514 0.1156  -0.0923 0.1142  134 TYR C CA  
2409 C C   . TYR C 88  ? 0.8479 0.8483 0.6722 0.1423  -0.0815 0.1105  134 TYR C C   
2410 O O   . TYR C 88  ? 0.8347 0.8808 0.6919 0.1696  -0.0875 0.1184  134 TYR C O   
2411 C CB  . TYR C 88  ? 0.8098 0.8292 0.6354 0.0847  -0.0861 0.1061  134 TYR C CB  
2412 C CG  . TYR C 88  ? 0.7630 0.8519 0.6451 0.0891  -0.0879 0.1074  134 TYR C CG  
2413 C CD1 . TYR C 88  ? 0.7651 0.8953 0.6688 0.0873  -0.1069 0.1176  134 TYR C CD1 
2414 C CD2 . TYR C 88  ? 0.7463 0.8581 0.6575 0.0917  -0.0717 0.0993  134 TYR C CD2 
2415 C CE1 . TYR C 88  ? 0.7307 0.9253 0.6860 0.0856  -0.1091 0.1210  134 TYR C CE1 
2416 C CE2 . TYR C 88  ? 0.7154 0.8889 0.6747 0.0923  -0.0722 0.1026  134 TYR C CE2 
2417 C CZ  . TYR C 88  ? 0.7080 0.9235 0.6902 0.0878  -0.0905 0.1139  134 TYR C CZ  
2418 O OH  . TYR C 88  ? 0.6765 0.9541 0.7064 0.0829  -0.0919 0.1195  134 TYR C OH  
2419 N N   . TYR C 89  ? 0.8618 0.8283 0.6700 0.1344  -0.0658 0.0990  135 TYR C N   
2420 C CA  . TYR C 89  ? 0.8628 0.8419 0.6885 0.1560  -0.0542 0.0930  135 TYR C CA  
2421 C C   . TYR C 89  ? 0.9386 0.8764 0.7329 0.1951  -0.0577 0.0972  135 TYR C C   
2422 O O   . TYR C 89  ? 1.0035 0.8753 0.7469 0.1970  -0.0658 0.1005  135 TYR C O   
2423 C CB  . TYR C 89  ? 0.8389 0.7948 0.6559 0.1323  -0.0398 0.0790  135 TYR C CB  
2424 C CG  . TYR C 89  ? 0.7736 0.7716 0.6236 0.1022  -0.0343 0.0733  135 TYR C CG  
2425 C CD1 . TYR C 89  ? 0.7207 0.7787 0.6164 0.1056  -0.0310 0.0735  135 TYR C CD1 
2426 C CD2 . TYR C 89  ? 0.7817 0.7580 0.6148 0.0711  -0.0316 0.0682  135 TYR C CD2 
2427 C CE1 . TYR C 89  ? 0.6633 0.7489 0.5814 0.0799  -0.0278 0.0682  135 TYR C CE1 
2428 C CE2 . TYR C 89  ? 0.7258 0.7361 0.5850 0.0494  -0.0262 0.0620  135 TYR C CE2 
2429 C CZ  . TYR C 89  ? 0.6919 0.7519 0.5908 0.0544  -0.0257 0.0617  135 TYR C CZ  
2430 O OH  . TYR C 89  ? 0.6637 0.7465 0.5807 0.0344  -0.0221 0.0554  135 TYR C OH  
2431 N N   . TRP C 90  ? 0.9516 0.9262 0.7731 0.2267  -0.0503 0.0972  136 TRP C N   
2432 C CA  . TRP C 90  ? 1.0191 0.9565 0.8108 0.2713  -0.0493 0.0982  136 TRP C CA  
2433 C C   . TRP C 90  ? 1.0548 0.9393 0.8119 0.2728  -0.0359 0.0837  136 TRP C C   
2434 O O   . TRP C 90  ? 1.1297 0.9406 0.8321 0.2952  -0.0385 0.0809  136 TRP C O   
2435 C CB  . TRP C 90  ? 1.0046 1.0193 0.8463 0.3094  -0.0466 0.1072  136 TRP C CB  
2436 C CG  . TRP C 90  ? 1.0229 1.0540 0.8703 0.3346  -0.0651 0.1226  136 TRP C CG  
2437 C CD1 . TRP C 90  ? 1.0361 1.0510 0.8695 0.3143  -0.0845 0.1307  136 TRP C CD1 
2438 C CD2 . TRP C 90  ? 1.0359 1.1058 0.9043 0.3867  -0.0665 0.1324  136 TRP C CD2 
2439 N NE1 . TRP C 90  ? 1.0539 1.0920 0.8969 0.3496  -0.1010 0.1454  136 TRP C NE1 
2440 C CE2 . TRP C 90  ? 1.0627 1.1386 0.9309 0.3956  -0.0903 0.1469  136 TRP C CE2 
2441 C CE3 . TRP C 90  ? 1.0431 1.1447 0.9292 0.4290  -0.0492 0.1306  136 TRP C CE3 
2442 C CZ2 . TRP C 90  ? 1.0752 1.1926 0.9662 0.4457  -0.0993 0.1601  136 TRP C CZ2 
2443 C CZ3 . TRP C 90  ? 1.0645 1.2089 0.9733 0.4801  -0.0546 0.1432  136 TRP C CZ3 
2444 C CH2 . TRP C 90  ? 1.0843 1.2386 0.9982 0.4884  -0.0804 0.1581  136 TRP C CH2 
2445 N N   . ALA C 91  ? 1.0024 0.9204 0.7876 0.2497  -0.0236 0.0749  137 ALA C N   
2446 C CA  . ALA C 91  ? 1.0286 0.9008 0.7826 0.2459  -0.0137 0.0610  137 ALA C CA  
2447 C C   . ALA C 91  ? 0.9847 0.8654 0.7525 0.1993  -0.0111 0.0532  137 ALA C C   
2448 O O   . ALA C 91  ? 0.9242 0.8596 0.7339 0.1776  -0.0117 0.0572  137 ALA C O   
2449 C CB  . ALA C 91  ? 1.0226 0.9315 0.7951 0.2791  0.0009  0.0581  137 ALA C CB  
2450 N N   . ALA C 92  ? 1.0181 0.8430 0.7487 0.1848  -0.0096 0.0422  138 ALA C N   
2451 C CA  . ALA C 92  ? 0.9832 0.8212 0.7299 0.1461  -0.0069 0.0342  138 ALA C CA  
2452 C C   . ALA C 92  ? 0.9170 0.8244 0.7129 0.1471  0.0027  0.0324  138 ALA C C   
2453 O O   . ALA C 92  ? 0.8789 0.8205 0.7049 0.1197  0.0034  0.0309  138 ALA C O   
2454 C CB  . ALA C 92  ? 1.0337 0.8052 0.7342 0.1343  -0.0094 0.0236  138 ALA C CB  
2455 N N   . SER C 93  ? 0.9157 0.8424 0.7171 0.1797  0.0109  0.0333  139 SER C N   
2456 C CA  . SER C 93  ? 0.8563 0.8452 0.6990 0.1800  0.0212  0.0339  139 SER C CA  
2457 C C   . SER C 93  ? 0.7881 0.8392 0.6806 0.1606  0.0183  0.0427  139 SER C C   
2458 O O   . SER C 93  ? 0.7358 0.8151 0.6518 0.1400  0.0210  0.0401  139 SER C O   
2459 C CB  . SER C 93  ? 0.8796 0.8882 0.7225 0.2207  0.0332  0.0372  139 SER C CB  
2460 O OG  . SER C 93  ? 0.8579 0.9087 0.7282 0.2423  0.0319  0.0504  139 SER C OG  
2461 N N   . GLU C 94  ? 0.7911 0.8576 0.6943 0.1675  0.0106  0.0530  140 GLU C N   
2462 C CA  . GLU C 94  ? 0.7454 0.8631 0.6879 0.1481  0.0043  0.0611  140 GLU C CA  
2463 C C   . GLU C 94  ? 0.7131 0.8149 0.6516 0.1122  0.0002  0.0541  140 GLU C C   
2464 O O   . GLU C 94  ? 0.6701 0.8060 0.6355 0.0940  0.0005  0.0540  140 GLU C O   
2465 C CB  . GLU C 94  ? 0.7721 0.9005 0.7183 0.1623  -0.0071 0.0731  140 GLU C CB  
2466 C CG  . GLU C 94  ? 0.8000 0.9661 0.7652 0.1999  -0.0033 0.0827  140 GLU C CG  
2467 C CD  . GLU C 94  ? 0.8592 1.0308 0.8245 0.2179  -0.0180 0.0947  140 GLU C CD  
2468 O OE1 . GLU C 94  ? 0.8842 1.0462 0.8442 0.1953  -0.0321 0.0979  140 GLU C OE1 
2469 O OE2 . GLU C 94  ? 0.9156 1.1007 0.8840 0.2571  -0.0155 0.1011  140 GLU C OE2 
2470 N N   . CYS C 95  ? 0.7311 0.7805 0.6343 0.1030  -0.0030 0.0489  141 CYS C N   
2471 C CA  . CYS C 95  ? 0.7126 0.7501 0.6119 0.0719  -0.0034 0.0423  141 CYS C CA  
2472 C C   . CYS C 95  ? 0.6781 0.7276 0.5915 0.0610  0.0035  0.0327  141 CYS C C   
2473 O O   . CYS C 95  ? 0.6430 0.7154 0.5760 0.0433  0.0044  0.0296  141 CYS C O   
2474 C CB  . CYS C 95  ? 0.7554 0.7362 0.6136 0.0633  -0.0062 0.0407  141 CYS C CB  
2475 S SG  . CYS C 95  ? 0.7514 0.7257 0.6072 0.0258  -0.0027 0.0345  141 CYS C SG  
2476 N N   . MET C 96  ? 0.6984 0.7281 0.5971 0.0739  0.0072  0.0278  142 MET C N   
2477 C CA  . MET C 96  ? 0.6719 0.7102 0.5792 0.0669  0.0112  0.0196  142 MET C CA  
2478 C C   . MET C 96  ? 0.6311 0.7185 0.5728 0.0674  0.0148  0.0235  142 MET C C   
2479 O O   . MET C 96  ? 0.6164 0.7163 0.5717 0.0521  0.0145  0.0187  142 MET C O   
2480 C CB  . MET C 96  ? 0.7137 0.7173 0.5907 0.0840  0.0134  0.0144  142 MET C CB  
2481 C CG  . MET C 96  ? 0.7705 0.7163 0.6085 0.0738  0.0068  0.0085  142 MET C CG  
2482 S SD  . MET C 96  ? 0.8512 0.7390 0.6374 0.1020  0.0071  0.0036  142 MET C SD  
2483 C CE  . MET C 96  ? 0.8278 0.7296 0.6180 0.1015  0.0107  -0.0051 142 MET C CE  
2484 N N   A GLN C 97  ? 0.6238 0.7393 0.5794 0.0847  0.0174  0.0331  143 GLN C N   
2485 N N   B GLN C 97  ? 0.6237 0.7396 0.5797 0.0845  0.0174  0.0331  143 GLN C N   
2486 C CA  A GLN C 97  ? 0.5906 0.7534 0.5783 0.0804  0.0197  0.0399  143 GLN C CA  
2487 C CA  B GLN C 97  ? 0.5903 0.7524 0.5778 0.0795  0.0197  0.0394  143 GLN C CA  
2488 C C   A GLN C 97  ? 0.5620 0.7368 0.5647 0.0567  0.0120  0.0403  143 GLN C C   
2489 C C   B GLN C 97  ? 0.5620 0.7368 0.5648 0.0563  0.0119  0.0402  143 GLN C C   
2490 O O   A GLN C 97  ? 0.5406 0.7313 0.5568 0.0446  0.0119  0.0398  143 GLN C O   
2491 O O   B GLN C 97  ? 0.5404 0.7317 0.5571 0.0441  0.0117  0.0399  143 GLN C O   
2492 C CB  A GLN C 97  ? 0.5930 0.7923 0.5985 0.1007  0.0228  0.0525  143 GLN C CB  
2493 C CB  B GLN C 97  ? 0.5926 0.7926 0.5985 0.0997  0.0239  0.0518  143 GLN C CB  
2494 C CG  A GLN C 97  ? 0.6253 0.8153 0.6139 0.1307  0.0338  0.0519  143 GLN C CG  
2495 C CG  B GLN C 97  ? 0.5638 0.8108 0.6002 0.0898  0.0274  0.0599  143 GLN C CG  
2496 C CD  A GLN C 97  ? 0.6133 0.8148 0.6022 0.1323  0.0452  0.0498  143 GLN C CD  
2497 C CD  B GLN C 97  ? 0.5681 0.8021 0.5945 0.0820  0.0335  0.0528  143 GLN C CD  
2498 O OE1 A GLN C 97  ? 0.5967 0.8160 0.6017 0.1111  0.0440  0.0508  143 GLN C OE1 
2499 O OE1 B GLN C 97  ? 0.4844 0.7211 0.5185 0.0612  0.0286  0.0516  143 GLN C OE1 
2500 N NE2 A GLN C 97  ? 0.6304 0.8156 0.5949 0.1589  0.0561  0.0468  143 GLN C NE2 
2501 N NE2 B GLN C 97  ? 0.5940 0.8081 0.5976 0.1004  0.0428  0.0476  143 GLN C NE2 
2502 N N   . ASP C 98  ? 0.5739 0.7348 0.5675 0.0511  0.0054  0.0410  144 ASP C N   
2503 C CA  . ASP C 98  ? 0.5607 0.7257 0.5588 0.0312  -0.0010 0.0400  144 ASP C CA  
2504 C C   . ASP C 98  ? 0.5483 0.6989 0.5419 0.0177  0.0027  0.0285  144 ASP C C   
2505 O O   . ASP C 98  ? 0.5347 0.6956 0.5376 0.0076  0.0008  0.0263  144 ASP C O   
2506 C CB  . ASP C 98  ? 0.5836 0.7325 0.5652 0.0292  -0.0077 0.0436  144 ASP C CB  
2507 C CG  . ASP C 98  ? 0.6045 0.7799 0.5988 0.0376  -0.0173 0.0565  144 ASP C CG  
2508 O OD1 . ASP C 98  ? 0.5702 0.7836 0.5916 0.0402  -0.0182 0.0633  144 ASP C OD1 
2509 O OD2 . ASP C 98  ? 0.6286 0.7887 0.6060 0.0400  -0.0250 0.0610  144 ASP C OD2 
2510 N N   . PHE C 99  ? 0.5540 0.6806 0.5331 0.0179  0.0067  0.0216  145 PHE C N   
2511 C CA  . PHE C 99  ? 0.5527 0.6761 0.5351 0.0080  0.0094  0.0118  145 PHE C CA  
2512 C C   . PHE C 99  ? 0.5400 0.6783 0.5357 0.0117  0.0094  0.0104  145 PHE C C   
2513 O O   . PHE C 99  ? 0.5222 0.6673 0.5263 0.0050  0.0083  0.0059  145 PHE C O   
2514 C CB  . PHE C 99  ? 0.5779 0.6773 0.5451 0.0053  0.0107  0.0067  145 PHE C CB  
2515 C CG  . PHE C 99  ? 0.6047 0.6903 0.5602 -0.0083 0.0123  0.0062  145 PHE C CG  
2516 C CD1 . PHE C 99  ? 0.6191 0.7197 0.5858 -0.0212 0.0165  0.0012  145 PHE C CD1 
2517 C CD2 . PHE C 99  ? 0.6655 0.7211 0.5955 -0.0071 0.0106  0.0112  145 PHE C CD2 
2518 C CE1 . PHE C 99  ? 0.6209 0.7130 0.5761 -0.0350 0.0214  0.0019  145 PHE C CE1 
2519 C CE2 . PHE C 99  ? 0.6754 0.7152 0.5900 -0.0230 0.0130  0.0126  145 PHE C CE2 
2520 C CZ  . PHE C 99  ? 0.6667 0.7276 0.5950 -0.0381 0.0196  0.0084  145 PHE C CZ  
2521 N N   . ASN C 100 ? 0.5528 0.6930 0.5462 0.0241  0.0113  0.0144  146 ASN C N   
2522 C CA  . ASN C 100 ? 0.5474 0.6983 0.5471 0.0268  0.0125  0.0150  146 ASN C CA  
2523 C C   . ASN C 100 ? 0.5325 0.7027 0.5468 0.0184  0.0098  0.0209  146 ASN C C   
2524 O O   . ASN C 100 ? 0.5387 0.7065 0.5542 0.0132  0.0073  0.0180  146 ASN C O   
2525 C CB  . ASN C 100 ? 0.5699 0.7222 0.5612 0.0432  0.0187  0.0199  146 ASN C CB  
2526 C CG  . ASN C 100 ? 0.5907 0.7526 0.5831 0.0446  0.0218  0.0223  146 ASN C CG  
2527 O OD1 . ASN C 100 ? 0.6312 0.7765 0.6119 0.0429  0.0189  0.0152  146 ASN C OD1 
2528 N ND2 . ASN C 100 ? 0.5609 0.7511 0.5670 0.0461  0.0266  0.0338  146 ASN C ND2 
2529 N N   . THR C 101 ? 0.5213 0.7073 0.5439 0.0169  0.0079  0.0295  147 THR C N   
2530 C CA  . THR C 101 ? 0.5130 0.7135 0.5458 0.0042  0.0018  0.0361  147 THR C CA  
2531 C C   . THR C 101 ? 0.5028 0.6830 0.5263 -0.0067 -0.0035 0.0270  147 THR C C   
2532 O O   . THR C 101 ? 0.4975 0.6722 0.5189 -0.0145 -0.0078 0.0272  147 THR C O   
2533 C CB  . THR C 101 ? 0.5252 0.7466 0.5680 0.0032  -0.0034 0.0465  147 THR C CB  
2534 O OG1 . THR C 101 ? 0.5222 0.7683 0.5767 0.0185  0.0032  0.0555  147 THR C OG1 
2535 C CG2 . THR C 101 ? 0.5309 0.7640 0.5811 -0.0151 -0.0136 0.0536  147 THR C CG2 
2536 N N   . MET C 102 ? 0.5035 0.6706 0.5184 -0.0063 -0.0023 0.0194  148 MET C N   
2537 C CA  . MET C 102 ? 0.5108 0.6628 0.5164 -0.0121 -0.0032 0.0099  148 MET C CA  
2538 C C   . MET C 102 ? 0.5015 0.6484 0.5098 -0.0078 -0.0018 0.0026  148 MET C C   
2539 O O   . MET C 102 ? 0.5189 0.6543 0.5204 -0.0095 -0.0058 -0.0010 148 MET C O   
2540 C CB  . MET C 102 ? 0.5057 0.6507 0.5031 -0.0125 0.0022  0.0046  148 MET C CB  
2541 C CG  . MET C 102 ? 0.5233 0.6600 0.5128 -0.0149 0.0064  -0.0054 148 MET C CG  
2542 S SD  . MET C 102 ? 0.5583 0.6934 0.5399 -0.0193 0.0166  -0.0086 148 MET C SD  
2543 C CE  . MET C 102 ? 0.5286 0.6741 0.5282 -0.0171 0.0195  -0.0114 148 MET C CE  
2544 N N   . PHE C 103 ? 0.5081 0.6587 0.5220 -0.0013 0.0017  0.0003  149 PHE C N   
2545 C CA  . PHE C 103 ? 0.5110 0.6588 0.5277 0.0037  -0.0003 -0.0056 149 PHE C CA  
2546 C C   . PHE C 103 ? 0.5151 0.6574 0.5270 0.0041  -0.0051 0.0005  149 PHE C C   
2547 O O   . PHE C 103 ? 0.5301 0.6605 0.5369 0.0063  -0.0100 -0.0031 149 PHE C O   
2548 C CB  . PHE C 103 ? 0.5168 0.6667 0.5359 0.0074  0.0009  -0.0088 149 PHE C CB  
2549 C CG  . PHE C 103 ? 0.5267 0.6799 0.5495 0.0020  0.0047  -0.0139 149 PHE C CG  
2550 C CD1 . PHE C 103 ? 0.5193 0.6821 0.5508 -0.0004 0.0076  -0.0202 149 PHE C CD1 
2551 C CD2 . PHE C 103 ? 0.5357 0.6801 0.5498 -0.0004 0.0062  -0.0120 149 PHE C CD2 
2552 C CE1 . PHE C 103 ? 0.5501 0.7207 0.5858 -0.0088 0.0134  -0.0227 149 PHE C CE1 
2553 C CE2 . PHE C 103 ? 0.5653 0.7082 0.5788 -0.0101 0.0090  -0.0147 149 PHE C CE2 
2554 C CZ  . PHE C 103 ? 0.5465 0.7058 0.5726 -0.0162 0.0133  -0.0192 149 PHE C CZ  
2555 N N   . THR C 104 ? 0.5152 0.6658 0.5274 0.0027  -0.0030 0.0106  150 THR C N   
2556 C CA  . THR C 104 ? 0.5195 0.6686 0.5268 -0.0009 -0.0051 0.0194  150 THR C CA  
2557 C C   . THR C 104 ? 0.5398 0.6767 0.5408 -0.0130 -0.0127 0.0224  150 THR C C   
2558 O O   . THR C 104 ? 0.5649 0.6825 0.5531 -0.0155 -0.0181 0.0239  150 THR C O   
2559 C CB  . THR C 104 ? 0.5174 0.6879 0.5305 0.0005  0.0022  0.0310  150 THR C CB  
2560 O OG1 . THR C 104 ? 0.5115 0.6799 0.5187 0.0137  0.0082  0.0264  150 THR C OG1 
2561 C CG2 . THR C 104 ? 0.5282 0.7030 0.5375 -0.0077 0.0027  0.0429  150 THR C CG2 
2562 N N   . ASN C 105 ? 0.5436 0.6847 0.5473 -0.0207 -0.0151 0.0232  151 ASN C N   
2563 C CA  . ASN C 105 ? 0.5668 0.6867 0.5561 -0.0334 -0.0250 0.0238  151 ASN C CA  
2564 C C   . ASN C 105 ? 0.5843 0.6719 0.5556 -0.0251 -0.0284 0.0120  151 ASN C C   
2565 O O   . ASN C 105 ? 0.6026 0.6610 0.5543 -0.0310 -0.0369 0.0137  151 ASN C O   
2566 C CB  . ASN C 105 ? 0.5715 0.6943 0.5592 -0.0398 -0.0283 0.0225  151 ASN C CB  
2567 C CG  . ASN C 105 ? 0.5700 0.7250 0.5753 -0.0476 -0.0298 0.0361  151 ASN C CG  
2568 O OD1 . ASN C 105 ? 0.5566 0.7341 0.5762 -0.0508 -0.0274 0.0476  151 ASN C OD1 
2569 N ND2 . ASN C 105 ? 0.5689 0.7283 0.5729 -0.0495 -0.0333 0.0356  151 ASN C ND2 
2570 N N   . CYS C 106 ? 0.5847 0.6778 0.5626 -0.0111 -0.0219 0.0007  152 CYS C N   
2571 C CA  . CYS C 106 ? 0.6091 0.6839 0.5780 0.0022  -0.0231 -0.0108 152 CYS C CA  
2572 C C   . CYS C 106 ? 0.6142 0.6753 0.5772 0.0086  -0.0292 -0.0082 152 CYS C C   
2573 O O   . CYS C 106 ? 0.6359 0.6645 0.5778 0.0136  -0.0369 -0.0111 152 CYS C O   
2574 C CB  . CYS C 106 ? 0.6000 0.6977 0.5862 0.0124  -0.0137 -0.0201 152 CYS C CB  
2575 S SG  . CYS C 106 ? 0.6500 0.7421 0.6353 0.0320  -0.0123 -0.0335 152 CYS C SG  
2576 N N   . TYR C 107 ? 0.5973 0.6766 0.5720 0.0091  -0.0268 -0.0025 153 TYR C N   
2577 C CA  . TYR C 107 ? 0.6090 0.6737 0.5729 0.0149  -0.0330 0.0010  153 TYR C CA  
2578 C C   . TYR C 107 ? 0.6449 0.6823 0.5860 0.0020  -0.0393 0.0123  153 TYR C C   
2579 O O   . TYR C 107 ? 0.6701 0.6763 0.5900 0.0072  -0.0481 0.0131  153 TYR C O   
2580 C CB  . TYR C 107 ? 0.5914 0.6761 0.5640 0.0169  -0.0285 0.0046  153 TYR C CB  
2581 C CG  . TYR C 107 ? 0.5685 0.6748 0.5595 0.0240  -0.0250 -0.0048 153 TYR C CG  
2582 C CD1 . TYR C 107 ? 0.5630 0.6750 0.5652 0.0336  -0.0282 -0.0154 153 TYR C CD1 
2583 C CD2 . TYR C 107 ? 0.5502 0.6709 0.5462 0.0213  -0.0183 -0.0025 153 TYR C CD2 
2584 C CE1 . TYR C 107 ? 0.5527 0.6879 0.5735 0.0343  -0.0253 -0.0217 153 TYR C CE1 
2585 C CE2 . TYR C 107 ? 0.5518 0.6842 0.5588 0.0232  -0.0172 -0.0101 153 TYR C CE2 
2586 C CZ  . TYR C 107 ? 0.5585 0.7000 0.5794 0.0268  -0.0209 -0.0188 153 TYR C CZ  
2587 O OH  . TYR C 107 ? 0.5652 0.7219 0.5989 0.0232  -0.0201 -0.0242 153 TYR C OH  
2588 N N   . ILE C 108 ? 0.6397 0.6892 0.5848 -0.0158 -0.0361 0.0223  154 ILE C N   
2589 C CA  . ILE C 108 ? 0.6708 0.7023 0.5987 -0.0350 -0.0418 0.0361  154 ILE C CA  
2590 C C   . ILE C 108 ? 0.7157 0.7018 0.6162 -0.0418 -0.0545 0.0322  154 ILE C C   
2591 O O   . ILE C 108 ? 0.7545 0.7015 0.6268 -0.0487 -0.0636 0.0382  154 ILE C O   
2592 C CB  . ILE C 108 ? 0.6573 0.7271 0.6054 -0.0523 -0.0353 0.0496  154 ILE C CB  
2593 C CG1 . ILE C 108 ? 0.6114 0.7148 0.5748 -0.0430 -0.0221 0.0548  154 ILE C CG1 
2594 C CG2 . ILE C 108 ? 0.7037 0.7598 0.6382 -0.0791 -0.0433 0.0648  154 ILE C CG2 
2595 C CD1 . ILE C 108 ? 0.6129 0.7618 0.6016 -0.0501 -0.0133 0.0658  154 ILE C CD1 
2596 N N   . TYR C 109 ? 0.7197 0.7044 0.6219 -0.0394 -0.0552 0.0220  155 TYR C N   
2597 C CA  . TYR C 109 ? 0.7765 0.7119 0.6445 -0.0455 -0.0672 0.0169  155 TYR C CA  
2598 C C   . TYR C 109 ? 0.8121 0.7049 0.6547 -0.0212 -0.0716 0.0042  155 TYR C C   
2599 O O   . TYR C 109 ? 0.8537 0.6911 0.6577 -0.0251 -0.0840 0.0056  155 TYR C O   
2600 C CB  . TYR C 109 ? 0.7713 0.7141 0.6410 -0.0499 -0.0665 0.0099  155 TYR C CB  
2601 C CG  . TYR C 109 ? 0.8350 0.7182 0.6597 -0.0558 -0.0797 0.0033  155 TYR C CG  
2602 C CD1 . TYR C 109 ? 0.8838 0.7372 0.6848 -0.0854 -0.0952 0.0151  155 TYR C CD1 
2603 C CD2 . TYR C 109 ? 0.8699 0.7244 0.6727 -0.0319 -0.0767 -0.0145 155 TYR C CD2 
2604 C CE1 . TYR C 109 ? 0.9498 0.7365 0.7001 -0.0923 -0.1101 0.0083  155 TYR C CE1 
2605 C CE2 . TYR C 109 ? 0.9435 0.7336 0.6956 -0.0334 -0.0884 -0.0224 155 TYR C CE2 
2606 C CZ  . TYR C 109 ? 0.9879 0.7391 0.7104 -0.0643 -0.1066 -0.0115 155 TYR C CZ  
2607 O OH  . TYR C 109 ? 1.0604 0.7372 0.7241 -0.0678 -0.1209 -0.0200 155 TYR C OH  
2608 N N   . ASN C 110 ? 0.7886 0.7075 0.6527 0.0038  -0.0623 -0.0074 156 ASN C N   
2609 C CA  . ASN C 110 ? 0.8157 0.7089 0.6654 0.0318  -0.0647 -0.0205 156 ASN C CA  
2610 C C   . ASN C 110 ? 0.8368 0.7138 0.6789 0.0443  -0.0728 -0.0163 156 ASN C C   
2611 O O   . ASN C 110 ? 0.8176 0.7127 0.6706 0.0333  -0.0726 -0.0048 156 ASN C O   
2612 C CB  . ASN C 110 ? 0.7777 0.7147 0.6587 0.0502  -0.0514 -0.0328 156 ASN C CB  
2613 C CG  . ASN C 110 ? 0.7670 0.7080 0.6437 0.0418  -0.0441 -0.0382 156 ASN C CG  
2614 O OD1 . ASN C 110 ? 0.8229 0.7269 0.6682 0.0501  -0.0459 -0.0474 156 ASN C OD1 
2615 N ND2 . ASN C 110 ? 0.7006 0.6813 0.6030 0.0271  -0.0366 -0.0326 156 ASN C ND2 
2616 N N   . LYS C 111 ? 0.8816 0.7221 0.7011 0.0697  -0.0799 -0.0256 157 LYS C N   
2617 C CA  . LYS C 111 ? 0.9090 0.7314 0.7187 0.0874  -0.0904 -0.0226 157 LYS C CA  
2618 C C   . LYS C 111 ? 0.8487 0.7318 0.7036 0.1025  -0.0847 -0.0260 157 LYS C C   
2619 O O   . LYS C 111 ? 0.8066 0.7348 0.6947 0.1100  -0.0733 -0.0354 157 LYS C O   
2620 C CB  . LYS C 111 ? 0.9837 0.7500 0.7565 0.1159  -0.1003 -0.0325 157 LYS C CB  
2621 C CG  . LYS C 111 ? 1.0852 0.7730 0.7998 0.0989  -0.1118 -0.0280 157 LYS C CG  
2622 C CD  . LYS C 111 ? 1.1886 0.8137 0.8600 0.1319  -0.1200 -0.0414 157 LYS C CD  
2623 C CE  . LYS C 111 ? 1.2970 0.8271 0.9002 0.1171  -0.1393 -0.0327 157 LYS C CE  
2624 N NZ  . LYS C 111 ? 1.4073 0.8623 0.9571 0.1508  -0.1480 -0.0473 157 LYS C NZ  
2625 N N   . PRO C 112 ? 0.8539 0.7355 0.7062 0.1048  -0.0937 -0.0178 158 PRO C N   
2626 C CA  . PRO C 112 ? 0.8150 0.7484 0.7045 0.1155  -0.0928 -0.0207 158 PRO C CA  
2627 C C   . PRO C 112 ? 0.8169 0.7822 0.7356 0.1448  -0.0926 -0.0343 158 PRO C C   
2628 O O   . PRO C 112 ? 0.7735 0.7944 0.7328 0.1442  -0.0863 -0.0384 158 PRO C O   
2629 C CB  . PRO C 112 ? 0.8438 0.7492 0.7079 0.1180  -0.1075 -0.0105 158 PRO C CB  
2630 C CG  . PRO C 112 ? 0.8763 0.7343 0.7008 0.0948  -0.1079 0.0022  158 PRO C CG  
2631 C CD  . PRO C 112 ? 0.8970 0.7269 0.7077 0.0938  -0.1057 -0.0041 158 PRO C CD  
2632 N N   . THR C 113 ? 0.8718 0.8016 0.7686 0.1698  -0.0990 -0.0405 159 THR C N   
2633 C CA  . THR C 113 ? 0.8861 0.8493 0.8109 0.2033  -0.0974 -0.0527 159 THR C CA  
2634 C C   . THR C 113 ? 0.8801 0.8683 0.8209 0.2064  -0.0777 -0.0639 159 THR C C   
2635 O O   . THR C 113 ? 0.8892 0.9144 0.8571 0.2339  -0.0715 -0.0735 159 THR C O   
2636 C CB  . THR C 113 ? 0.9578 0.8675 0.8470 0.2370  -0.1132 -0.0550 159 THR C CB  
2637 O OG1 . THR C 113 ? 1.0056 0.8428 0.8413 0.2315  -0.1129 -0.0559 159 THR C OG1 
2638 C CG2 . THR C 113 ? 0.9705 0.8570 0.8423 0.2374  -0.1338 -0.0434 159 THR C CG2 
2639 N N   . ASP C 114 ? 0.8728 0.8435 0.7969 0.1794  -0.0680 -0.0619 160 ASP C N   
2640 C CA  . ASP C 114 ? 0.8705 0.8610 0.8031 0.1791  -0.0499 -0.0714 160 ASP C CA  
2641 C C   . ASP C 114 ? 0.8155 0.8837 0.8030 0.1744  -0.0366 -0.0731 160 ASP C C   
2642 O O   . ASP C 114 ? 0.7761 0.8717 0.7860 0.1549  -0.0400 -0.0652 160 ASP C O   
2643 C CB  . ASP C 114 ? 0.8776 0.8339 0.7805 0.1485  -0.0469 -0.0667 160 ASP C CB  
2644 C CG  . ASP C 114 ? 0.9523 0.8292 0.7973 0.1489  -0.0594 -0.0662 160 ASP C CG  
2645 O OD1 . ASP C 114 ? 1.0180 0.8588 0.8393 0.1780  -0.0673 -0.0725 160 ASP C OD1 
2646 O OD2 . ASP C 114 ? 0.9703 0.8195 0.7922 0.1197  -0.0627 -0.0591 160 ASP C OD2 
2647 N N   . ASP C 115 ? 0.8191 0.9193 0.8240 0.1916  -0.0211 -0.0832 161 ASP C N   
2648 C CA  . ASP C 115 ? 0.7750 0.9491 0.8308 0.1840  -0.0075 -0.0836 161 ASP C CA  
2649 C C   . ASP C 115 ? 0.7186 0.8992 0.7763 0.1476  -0.0011 -0.0767 161 ASP C C   
2650 O O   . ASP C 115 ? 0.6814 0.9061 0.7731 0.1323  0.0004  -0.0723 161 ASP C O   
2651 C CB  . ASP C 115 ? 0.8062 1.0109 0.8735 0.2062  0.0129  -0.0944 161 ASP C CB  
2652 C CG  . ASP C 115 ? 0.8713 1.0899 0.9507 0.2485  0.0094  -0.1014 161 ASP C CG  
2653 O OD1 . ASP C 115 ? 0.8961 1.1339 0.9996 0.2570  -0.0078 -0.0967 161 ASP C OD1 
2654 O OD2 . ASP C 115 ? 0.9497 1.1598 1.0123 0.2757  0.0238  -0.1120 161 ASP C OD2 
2655 N N   . ILE C 116 ? 0.7128 0.8473 0.7320 0.1342  0.0007  -0.0756 162 ILE C N   
2656 C CA  . ILE C 116 ? 0.6732 0.8118 0.6917 0.1045  0.0058  -0.0688 162 ILE C CA  
2657 C C   . ILE C 116 ? 0.6352 0.7807 0.6663 0.0875  -0.0049 -0.0586 162 ILE C C   
2658 O O   . ILE C 116 ? 0.6038 0.7692 0.6477 0.0693  0.0001  -0.0539 162 ILE C O   
2659 C CB  . ILE C 116 ? 0.6976 0.7868 0.6731 0.0939  0.0049  -0.0683 162 ILE C CB  
2660 C CG1 . ILE C 116 ? 0.6749 0.7776 0.6540 0.0691  0.0117  -0.0622 162 ILE C CG1 
2661 C CG2 . ILE C 116 ? 0.7263 0.7690 0.6747 0.0888  -0.0124 -0.0618 162 ILE C CG2 
2662 C CD1 . ILE C 116 ? 0.7184 0.7835 0.6596 0.0592  0.0108  -0.0626 162 ILE C CD1 
2663 N N   . VAL C 117 ? 0.6442 0.7686 0.6663 0.0953  -0.0193 -0.0552 163 VAL C N   
2664 C CA  . VAL C 117 ? 0.6339 0.7625 0.6619 0.0830  -0.0281 -0.0465 163 VAL C CA  
2665 C C   . VAL C 117 ? 0.6082 0.7827 0.6714 0.0828  -0.0281 -0.0483 163 VAL C C   
2666 O O   . VAL C 117 ? 0.5884 0.7727 0.6571 0.0661  -0.0273 -0.0438 163 VAL C O   
2667 C CB  . VAL C 117 ? 0.6575 0.7497 0.6616 0.0910  -0.0431 -0.0416 163 VAL C CB  
2668 C CG1 . VAL C 117 ? 0.6541 0.7546 0.6626 0.0828  -0.0505 -0.0342 163 VAL C CG1 
2669 C CG2 . VAL C 117 ? 0.6746 0.7209 0.6430 0.0799  -0.0446 -0.0361 163 VAL C CG2 
2670 N N   . LEU C 118 ? 0.6147 0.8174 0.7010 0.1013  -0.0295 -0.0548 164 LEU C N   
2671 C CA  . LEU C 118 ? 0.6035 0.8569 0.7281 0.0968  -0.0313 -0.0556 164 LEU C CA  
2672 C C   . LEU C 118 ? 0.5749 0.8545 0.7143 0.0766  -0.0155 -0.0557 164 LEU C C   
2673 O O   . LEU C 118 ? 0.5656 0.8646 0.7196 0.0587  -0.0185 -0.0526 164 LEU C O   
2674 C CB  . LEU C 118 ? 0.6246 0.9143 0.7783 0.1223  -0.0354 -0.0613 164 LEU C CB  
2675 C CG  . LEU C 118 ? 0.6354 0.9863 0.8351 0.1146  -0.0408 -0.0605 164 LEU C CG  
2676 C CD1 . LEU C 118 ? 0.6495 0.9867 0.8401 0.0951  -0.0580 -0.0547 164 LEU C CD1 
2677 C CD2 . LEU C 118 ? 0.6411 1.0328 0.8732 0.1441  -0.0483 -0.0644 164 LEU C CD2 
2678 N N   . MET C 119 ? 0.5781 0.8510 0.7070 0.0790  0.0000  -0.0590 165 MET C N   
2679 C CA  . MET C 119 ? 0.5693 0.8588 0.7034 0.0602  0.0153  -0.0578 165 MET C CA  
2680 C C   . MET C 119 ? 0.5529 0.8156 0.6678 0.0384  0.0116  -0.0505 165 MET C C   
2681 O O   . MET C 119 ? 0.5433 0.8207 0.6678 0.0205  0.0143  -0.0473 165 MET C O   
2682 C CB  . MET C 119 ? 0.5872 0.8650 0.7027 0.0692  0.0308  -0.0630 165 MET C CB  
2683 C CG  . MET C 119 ? 0.6145 0.9257 0.7500 0.0936  0.0404  -0.0711 165 MET C CG  
2684 S SD  . MET C 119 ? 0.6546 0.9328 0.7509 0.1112  0.0562  -0.0801 165 MET C SD  
2685 C CE  . MET C 119 ? 0.6460 0.9476 0.7432 0.0865  0.0775  -0.0766 165 MET C CE  
2686 N N   . ALA C 120 ? 0.5563 0.7801 0.6438 0.0402  0.0051  -0.0473 166 ALA C N   
2687 C CA  . ALA C 120 ? 0.5500 0.7539 0.6221 0.0255  0.0025  -0.0399 166 ALA C CA  
2688 C C   . ALA C 120 ? 0.5413 0.7522 0.6216 0.0198  -0.0065 -0.0378 166 ALA C C   
2689 O O   . ALA C 120 ? 0.5434 0.7504 0.6188 0.0071  -0.0047 -0.0348 166 ALA C O   
2690 C CB  . ALA C 120 ? 0.5565 0.7284 0.6048 0.0283  -0.0028 -0.0352 166 ALA C CB  
2691 N N   . GLN C 121 ? 0.5487 0.7636 0.6353 0.0302  -0.0179 -0.0396 167 GLN C N   
2692 C CA  . GLN C 121 ? 0.5543 0.7709 0.6421 0.0249  -0.0296 -0.0385 167 GLN C CA  
2693 C C   . GLN C 121 ? 0.5522 0.7941 0.6593 0.0093  -0.0287 -0.0403 167 GLN C C   
2694 O O   . GLN C 121 ? 0.5713 0.7975 0.6644 -0.0035 -0.0330 -0.0384 167 GLN C O   
2695 C CB  . GLN C 121 ? 0.5732 0.7939 0.6661 0.0394  -0.0442 -0.0402 167 GLN C CB  
2696 C CG  . GLN C 121 ? 0.5958 0.7810 0.6597 0.0488  -0.0489 -0.0356 167 GLN C CG  
2697 C CD  . GLN C 121 ? 0.6531 0.8366 0.7170 0.0647  -0.0647 -0.0365 167 GLN C CD  
2698 O OE1 . GLN C 121 ? 0.6944 0.8868 0.7702 0.0803  -0.0662 -0.0401 167 GLN C OE1 
2699 N NE2 . GLN C 121 ? 0.6906 0.8593 0.7369 0.0631  -0.0772 -0.0333 167 GLN C NE2 
2700 N N   . THR C 122 ? 0.5411 0.8209 0.6779 0.0101  -0.0227 -0.0435 168 THR C N   
2701 C CA  . THR C 122 ? 0.5397 0.8505 0.6988 -0.0093 -0.0204 -0.0431 168 THR C CA  
2702 C C   . THR C 122 ? 0.5357 0.8219 0.6729 -0.0276 -0.0103 -0.0392 168 THR C C   
2703 O O   . THR C 122 ? 0.5507 0.8284 0.6815 -0.0471 -0.0162 -0.0368 168 THR C O   
2704 C CB  . THR C 122 ? 0.5331 0.8949 0.7285 -0.0027 -0.0090 -0.0460 168 THR C CB  
2705 O OG1 . THR C 122 ? 0.5333 0.9168 0.7487 0.0197  -0.0197 -0.0495 168 THR C OG1 
2706 C CG2 . THR C 122 ? 0.5450 0.9463 0.7676 -0.0279 -0.0057 -0.0428 168 THR C CG2 
2707 N N   . LEU C 123 ? 0.5281 0.7982 0.6497 -0.0213 0.0027  -0.0383 169 LEU C N   
2708 C CA  . LEU C 123 ? 0.5390 0.7840 0.6374 -0.0346 0.0107  -0.0336 169 LEU C CA  
2709 C C   . LEU C 123 ? 0.5584 0.7640 0.6287 -0.0360 0.0016  -0.0303 169 LEU C C   
2710 O O   . LEU C 123 ? 0.5791 0.7639 0.6324 -0.0495 0.0014  -0.0271 169 LEU C O   
2711 C CB  . LEU C 123 ? 0.5332 0.7693 0.6191 -0.0258 0.0223  -0.0333 169 LEU C CB  
2712 C CG  . LEU C 123 ? 0.5329 0.7989 0.6342 -0.0229 0.0361  -0.0372 169 LEU C CG  
2713 C CD1 . LEU C 123 ? 0.5378 0.7821 0.6159 -0.0120 0.0424  -0.0387 169 LEU C CD1 
2714 C CD2 . LEU C 123 ? 0.5320 0.8153 0.6389 -0.0442 0.0467  -0.0333 169 LEU C CD2 
2715 N N   . GLU C 124 ? 0.5511 0.7439 0.6132 -0.0211 -0.0050 -0.0308 170 GLU C N   
2716 C CA  . GLU C 124 ? 0.5711 0.7314 0.6062 -0.0179 -0.0097 -0.0277 170 GLU C CA  
2717 C C   . GLU C 124 ? 0.5876 0.7344 0.6123 -0.0274 -0.0206 -0.0301 170 GLU C C   
2718 O O   . GLU C 124 ? 0.6013 0.7155 0.5982 -0.0296 -0.0214 -0.0286 170 GLU C O   
2719 C CB  . GLU C 124 ? 0.5686 0.7222 0.5967 -0.0026 -0.0118 -0.0257 170 GLU C CB  
2720 C CG  . GLU C 124 ? 0.6047 0.7324 0.6066 0.0034  -0.0113 -0.0215 170 GLU C CG  
2721 C CD  . GLU C 124 ? 0.6481 0.7766 0.6460 0.0137  -0.0069 -0.0152 170 GLU C CD  
2722 O OE1 . GLU C 124 ? 0.6429 0.7780 0.6471 0.0169  -0.0107 -0.0152 170 GLU C OE1 
2723 O OE2 . GLU C 124 ? 0.7064 0.8289 0.6944 0.0185  -0.0004 -0.0093 170 GLU C OE2 
2724 N N   . LYS C 125 ? 0.5920 0.7618 0.6368 -0.0320 -0.0307 -0.0340 171 LYS C N   
2725 C CA  . LYS C 125 ? 0.6260 0.7841 0.6610 -0.0457 -0.0455 -0.0365 171 LYS C CA  
2726 C C   . LYS C 125 ? 0.6411 0.7874 0.6684 -0.0686 -0.0434 -0.0346 171 LYS C C   
2727 O O   . LYS C 125 ? 0.6664 0.7723 0.6607 -0.0778 -0.0524 -0.0355 171 LYS C O   
2728 C CB  . LYS C 125 ? 0.6289 0.8250 0.6952 -0.0475 -0.0588 -0.0395 171 LYS C CB  
2729 C CG  . LYS C 125 ? 0.6579 0.8492 0.7176 -0.0269 -0.0673 -0.0407 171 LYS C CG  
2730 C CD  . LYS C 125 ? 0.6839 0.9145 0.7760 -0.0244 -0.0823 -0.0429 171 LYS C CD  
2731 C CE  . LYS C 125 ? 0.7007 0.9178 0.7788 -0.0032 -0.0915 -0.0427 171 LYS C CE  
2732 N NZ  . LYS C 125 ? 0.7422 0.9128 0.7739 -0.0031 -0.0999 -0.0423 171 LYS C NZ  
2733 N N   . ILE C 126 ? 0.6258 0.8018 0.6774 -0.0776 -0.0313 -0.0319 172 ILE C N   
2734 C CA  . ILE C 126 ? 0.6473 0.8109 0.6889 -0.1015 -0.0269 -0.0276 172 ILE C CA  
2735 C C   . ILE C 126 ? 0.6671 0.7759 0.6647 -0.0948 -0.0224 -0.0246 172 ILE C C   
2736 O O   . ILE C 126 ? 0.6943 0.7608 0.6596 -0.1086 -0.0291 -0.0230 172 ILE C O   
2737 C CB  . ILE C 126 ? 0.6352 0.8440 0.7086 -0.1094 -0.0108 -0.0246 172 ILE C CB  
2738 C CG1 . ILE C 126 ? 0.6224 0.8926 0.7436 -0.1132 -0.0142 -0.0270 172 ILE C CG1 
2739 C CG2 . ILE C 126 ? 0.6560 0.8456 0.7113 -0.1354 -0.0046 -0.0179 172 ILE C CG2 
2740 C CD1 . ILE C 126 ? 0.6215 0.9406 0.7737 -0.1124 0.0054  -0.0256 172 ILE C CD1 
2741 N N   . PHE C 127 ? 0.6487 0.7573 0.6442 -0.0730 -0.0128 -0.0234 173 PHE C N   
2742 C CA  . PHE C 127 ? 0.6742 0.7424 0.6359 -0.0610 -0.0093 -0.0195 173 PHE C CA  
2743 C C   . PHE C 127 ? 0.7118 0.7360 0.6385 -0.0543 -0.0194 -0.0222 173 PHE C C   
2744 O O   . PHE C 127 ? 0.7432 0.7224 0.6345 -0.0570 -0.0215 -0.0202 173 PHE C O   
2745 C CB  . PHE C 127 ? 0.6475 0.7328 0.6199 -0.0404 -0.0014 -0.0174 173 PHE C CB  
2746 C CG  . PHE C 127 ? 0.6803 0.7382 0.6278 -0.0231 0.0001  -0.0130 173 PHE C CG  
2747 C CD1 . PHE C 127 ? 0.7352 0.7711 0.6636 -0.0232 0.0032  -0.0071 173 PHE C CD1 
2748 C CD2 . PHE C 127 ? 0.7041 0.7616 0.6481 -0.0055 -0.0010 -0.0134 173 PHE C CD2 
2749 C CE1 . PHE C 127 ? 0.7396 0.7578 0.6503 -0.0031 0.0039  -0.0023 173 PHE C CE1 
2750 C CE2 . PHE C 127 ? 0.7328 0.7761 0.6601 0.0127  0.0028  -0.0083 173 PHE C CE2 
2751 C CZ  . PHE C 127 ? 0.7324 0.7585 0.6456 0.0153  0.0048  -0.0029 173 PHE C CZ  
2752 N N   . LEU C 128 ? 0.7159 0.7478 0.6467 -0.0446 -0.0259 -0.0269 174 LEU C N   
2753 C CA  . LEU C 128 ? 0.7634 0.7524 0.6553 -0.0356 -0.0342 -0.0308 174 LEU C CA  
2754 C C   . LEU C 128 ? 0.8160 0.7680 0.6812 -0.0580 -0.0482 -0.0344 174 LEU C C   
2755 O O   . LEU C 128 ? 0.8566 0.7520 0.6741 -0.0525 -0.0522 -0.0364 174 LEU C O   
2756 C CB  . LEU C 128 ? 0.7598 0.7654 0.6592 -0.0242 -0.0392 -0.0343 174 LEU C CB  
2757 C CG  . LEU C 128 ? 0.7467 0.7715 0.6561 -0.0023 -0.0272 -0.0298 174 LEU C CG  
2758 C CD1 . LEU C 128 ? 0.7527 0.7921 0.6687 0.0031  -0.0337 -0.0318 174 LEU C CD1 
2759 C CD2 . LEU C 128 ? 0.7947 0.7890 0.6713 0.0171  -0.0186 -0.0272 174 LEU C CD2 
2760 N N   . GLN C 129 ? 0.8089 0.7927 0.7040 -0.0830 -0.0563 -0.0350 175 GLN C N   
2761 C CA  . GLN C 129 ? 0.8592 0.8158 0.7356 -0.1126 -0.0714 -0.0362 175 GLN C CA  
2762 C C   . GLN C 129 ? 0.9006 0.8092 0.7421 -0.1225 -0.0666 -0.0314 175 GLN C C   
2763 O O   . GLN C 129 ? 0.9574 0.8014 0.7479 -0.1300 -0.0781 -0.0339 175 GLN C O   
2764 C CB  . GLN C 129 ? 0.8418 0.8597 0.7701 -0.1382 -0.0766 -0.0344 175 GLN C CB  
2765 C CG  . GLN C 129 ? 0.9095 0.9139 0.8281 -0.1698 -0.0992 -0.0362 175 GLN C CG  
2766 C CD  . GLN C 129 ? 0.9516 0.9387 0.8509 -0.1597 -0.1185 -0.0439 175 GLN C CD  
2767 O OE1 . GLN C 129 ? 0.9387 0.9338 0.8393 -0.1296 -0.1130 -0.0468 175 GLN C OE1 
2768 N NE2 . GLN C 129 ? 1.0051 0.9657 0.8825 -0.1874 -0.1424 -0.0464 175 GLN C NE2 
2769 N N   . LYS C 130 ? 0.8764 0.8096 0.7386 -0.1209 -0.0507 -0.0246 176 LYS C N   
2770 C CA  . LYS C 130 ? 0.9230 0.8109 0.7510 -0.1295 -0.0465 -0.0182 176 LYS C CA  
2771 C C   . LYS C 130 ? 0.9523 0.7806 0.7310 -0.0991 -0.0460 -0.0195 176 LYS C C   
2772 O O   . LYS C 130 ? 1.0114 0.7731 0.7395 -0.1045 -0.0530 -0.0183 176 LYS C O   
2773 C CB  . LYS C 130 ? 0.8984 0.8275 0.7567 -0.1332 -0.0301 -0.0106 176 LYS C CB  
2774 C CG  . LYS C 130 ? 0.9044 0.8927 0.8084 -0.1613 -0.0265 -0.0086 176 LYS C CG  
2775 C CD  . LYS C 130 ? 0.9847 0.9492 0.8708 -0.2009 -0.0327 -0.0023 176 LYS C CD  
2776 C CE  . LYS C 130 ? 0.9813 1.0181 0.9213 -0.2284 -0.0292 0.0002  176 LYS C CE  
2777 N NZ  . LYS C 130 ? 0.9387 1.0400 0.9226 -0.2108 -0.0095 0.0001  176 LYS C NZ  
2778 N N   . VAL C 131 ? 0.9081 0.7602 0.7009 -0.0669 -0.0378 -0.0214 177 VAL C N   
2779 C CA  . VAL C 131 ? 0.9426 0.7533 0.6975 -0.0340 -0.0348 -0.0222 177 VAL C CA  
2780 C C   . VAL C 131 ? 1.0130 0.7585 0.7135 -0.0314 -0.0473 -0.0303 177 VAL C C   
2781 O O   . VAL C 131 ? 1.0706 0.7568 0.7218 -0.0123 -0.0476 -0.0308 177 VAL C O   
2782 C CB  . VAL C 131 ? 0.8953 0.7524 0.6800 -0.0059 -0.0240 -0.0218 177 VAL C CB  
2783 C CG1 . VAL C 131 ? 0.9310 0.7537 0.6790 0.0275  -0.0203 -0.0238 177 VAL C CG1 
2784 C CG2 . VAL C 131 ? 0.8602 0.7597 0.6796 -0.0030 -0.0136 -0.0135 177 VAL C CG2 
2785 N N   . ALA C 132 ? 1.0178 0.7717 0.7242 -0.0489 -0.0589 -0.0369 178 ALA C N   
2786 C CA  . ALA C 132 ? 1.0944 0.7833 0.7448 -0.0517 -0.0745 -0.0458 178 ALA C CA  
2787 C C   . ALA C 132 ? 1.1821 0.7972 0.7811 -0.0743 -0.0869 -0.0451 178 ALA C C   
2788 O O   . ALA C 132 ? 1.2556 0.7938 0.7891 -0.0663 -0.0973 -0.0525 178 ALA C O   
2789 C CB  . ALA C 132 ? 1.0765 0.7957 0.7487 -0.0716 -0.0886 -0.0511 178 ALA C CB  
2790 N N   . SER C 133 ? 1.1805 0.8140 0.8035 -0.1028 -0.0855 -0.0363 179 SER C N   
2791 C CA  . SER C 133 ? 1.2717 0.8342 0.8452 -0.1297 -0.0968 -0.0326 179 SER C CA  
2792 C C   . SER C 133 ? 1.3054 0.8323 0.8527 -0.1101 -0.0858 -0.0247 179 SER C C   
2793 O O   . SER C 133 ? 1.3658 0.8414 0.8783 -0.1345 -0.0924 -0.0180 179 SER C O   
2794 C CB  . SER C 133 ? 1.2557 0.8593 0.8676 -0.1806 -0.1036 -0.0261 179 SER C CB  
2795 O OG  . SER C 133 ? 1.2470 0.8783 0.8791 -0.1987 -0.1187 -0.0328 179 SER C OG  
2796 N N   . MET C 134 ? 1.2814 0.8345 0.8438 -0.0675 -0.0708 -0.0242 180 MET C N   
2797 C CA  . MET C 134 ? 1.3135 0.8445 0.8587 -0.0446 -0.0623 -0.0157 180 MET C CA  
2798 C C   . MET C 134 ? 1.4250 0.8538 0.8891 -0.0224 -0.0712 -0.0194 180 MET C C   
2799 O O   . MET C 134 ? 1.4627 0.8550 0.8924 -0.0052 -0.0762 -0.0303 180 MET C O   
2800 C CB  . MET C 134 ? 1.2443 0.8429 0.8360 -0.0084 -0.0461 -0.0135 180 MET C CB  
2801 C CG  . MET C 134 ? 1.2666 0.8570 0.8505 0.0162  -0.0397 -0.0037 180 MET C CG  
2802 S SD  . MET C 134 ? 1.1959 0.8817 0.8481 0.0401  -0.0247 0.0018  180 MET C SD  
2803 C CE  . MET C 134 ? 1.1666 0.8668 0.8208 0.0737  -0.0187 -0.0071 180 MET C CE  
2804 N N   . PRO C 135 ? 1.4888 0.8645 0.9155 -0.0218 -0.0738 -0.0105 181 PRO C N   
2805 C CA  . PRO C 135 ? 1.5987 0.8727 0.9446 0.0084  -0.0817 -0.0140 181 PRO C CA  
2806 C C   . PRO C 135 ? 1.5939 0.8839 0.9418 0.0701  -0.0692 -0.0178 181 PRO C C   
2807 O O   . PRO C 135 ? 1.5111 0.8901 0.9239 0.0860  -0.0551 -0.0135 181 PRO C O   
2808 C CB  . PRO C 135 ? 1.6441 0.8717 0.9599 -0.0045 -0.0863 -0.0005 181 PRO C CB  
2809 C CG  . PRO C 135 ? 1.5914 0.8761 0.9556 -0.0572 -0.0843 0.0075  181 PRO C CG  
2810 C CD  . PRO C 135 ? 1.4794 0.8719 0.9238 -0.0536 -0.0719 0.0026  181 PRO C CD  
2811 N N   A GLN C 136 ? 1.6869 0.8904 0.9625 0.1036  -0.0743 -0.0254 182 GLN C N   
2812 N N   B GLN C 136 ? 1.6890 0.8933 0.9651 0.1040  -0.0741 -0.0255 182 GLN C N   
2813 C CA  A GLN C 136 ? 1.6882 0.9053 0.9614 0.1656  -0.0604 -0.0286 182 GLN C CA  
2814 C CA  B GLN C 136 ? 1.6918 0.9104 0.9662 0.1663  -0.0601 -0.0282 182 GLN C CA  
2815 C C   A GLN C 136 ? 1.6769 0.9149 0.9673 0.1960  -0.0546 -0.0150 182 GLN C C   
2816 C C   B GLN C 136 ? 1.7973 0.9215 0.9981 0.2039  -0.0661 -0.0263 182 GLN C C   
2817 O O   A GLN C 136 ? 1.7283 0.9086 0.9825 0.1843  -0.0659 -0.0069 182 GLN C O   
2818 O O   B GLN C 136 ? 1.7960 0.9245 1.0054 0.2118  -0.0672 -0.0135 182 GLN C O   
2819 C CB  A GLN C 136 ? 1.8025 0.9132 0.9848 0.1955  -0.0669 -0.0418 182 GLN C CB  
2820 C CB  B GLN C 136 ? 1.7009 0.9179 0.9603 0.1828  -0.0550 -0.0429 182 GLN C CB  
2821 C CG  A GLN C 136 ? 1.8233 0.9055 0.9790 0.1677  -0.0761 -0.0559 182 GLN C CG  
2822 C CG  B GLN C 136 ? 1.6770 0.9428 0.9570 0.2414  -0.0340 -0.0436 182 GLN C CG  
2823 C CD  A GLN C 136 ? 1.9337 0.9096 0.9938 0.2033  -0.0807 -0.0708 182 GLN C CD  
2824 C CD  B GLN C 136 ? 1.6899 0.9610 0.9744 0.2816  -0.0281 -0.0324 182 GLN C CD  
2825 O OE1 A GLN C 136 ? 1.9809 0.9250 1.0073 0.2595  -0.0706 -0.0716 182 GLN C OE1 
2826 O OE1 B GLN C 136 ? 1.6480 0.9447 0.9643 0.2620  -0.0334 -0.0200 182 GLN C OE1 
2827 N NE2 A GLN C 136 ? 1.9774 0.8978 0.9917 0.1724  -0.0969 -0.0830 182 GLN C NE2 
2828 N NE2 B GLN C 136 ? 1.7465 0.9954 0.9984 0.3402  -0.0170 -0.0365 182 GLN C NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   47  ?   ?   ?   A . n 
A 1 2   SER 2   48  ?   ?   ?   A . n 
A 1 3   SER 3   49  ?   ?   ?   A . n 
A 1 4   HIS 4   50  ?   ?   ?   A . n 
A 1 5   HIS 5   51  ?   ?   ?   A . n 
A 1 6   HIS 6   52  ?   ?   ?   A . n 
A 1 7   HIS 7   53  ?   ?   ?   A . n 
A 1 8   HIS 8   54  ?   ?   ?   A . n 
A 1 9   HIS 9   55  ?   ?   ?   A . n 
A 1 10  SER 10  56  ?   ?   ?   A . n 
A 1 11  SER 11  57  ?   ?   ?   A . n 
A 1 12  GLY 12  58  ?   ?   ?   A . n 
A 1 13  LEU 13  59  ?   ?   ?   A . n 
A 1 14  VAL 14  60  ?   ?   ?   A . n 
A 1 15  PRO 15  61  ?   ?   ?   A . n 
A 1 16  ARG 16  62  ?   ?   ?   A . n 
A 1 17  GLY 17  63  ?   ?   ?   A . n 
A 1 18  SER 18  64  ?   ?   ?   A . n 
A 1 19  HIS 19  65  ?   ?   ?   A . n 
A 1 20  MET 20  66  ?   ?   ?   A . n 
A 1 21  SER 21  67  ?   ?   ?   A . n 
A 1 22  ASN 22  68  ?   ?   ?   A . n 
A 1 23  PRO 23  69  ?   ?   ?   A . n 
A 1 24  LYS 24  70  ?   ?   ?   A . n 
A 1 25  LYS 25  71  ?   ?   ?   A . n 
A 1 26  PRO 26  72  ?   ?   ?   A . n 
A 1 27  GLY 27  73  ?   ?   ?   A . n 
A 1 28  ARG 28  74  ?   ?   ?   A . n 
A 1 29  VAL 29  75  75  VAL VAL A . n 
A 1 30  THR 30  76  76  THR THR A . n 
A 1 31  ASN 31  77  77  ASN ASN A . n 
A 1 32  GLN 32  78  78  GLN GLN A . n 
A 1 33  LEU 33  79  79  LEU LEU A . n 
A 1 34  GLN 34  80  80  GLN GLN A . n 
A 1 35  TYR 35  81  81  TYR TYR A . n 
A 1 36  LEU 36  82  82  LEU LEU A . n 
A 1 37  HIS 37  83  83  HIS HIS A . n 
A 1 38  LYS 38  84  84  LYS LYS A . n 
A 1 39  VAL 39  85  85  VAL VAL A . n 
A 1 40  VAL 40  86  86  VAL VAL A . n 
A 1 41  MET 41  87  87  MET MET A . n 
A 1 42  LYS 42  88  88  LYS LYS A . n 
A 1 43  ALA 43  89  89  ALA ALA A . n 
A 1 44  LEU 44  90  90  LEU LEU A . n 
A 1 45  TRP 45  91  91  TRP TRP A . n 
A 1 46  LYS 46  92  92  LYS LYS A . n 
A 1 47  HIS 47  93  93  HIS HIS A . n 
A 1 48  GLN 48  94  94  GLN GLN A . n 
A 1 49  PHE 49  95  95  PHE PHE A . n 
A 1 50  ALA 50  96  96  ALA ALA A . n 
A 1 51  TRP 51  97  97  TRP TRP A . n 
A 1 52  PRO 52  98  98  PRO PRO A . n 
A 1 53  PHE 53  99  99  PHE PHE A . n 
A 1 54  ARG 54  100 100 ARG ARG A . n 
A 1 55  GLN 55  101 101 GLN GLN A . n 
A 1 56  PRO 56  102 102 PRO PRO A . n 
A 1 57  VAL 57  103 103 VAL VAL A . n 
A 1 58  ASP 58  104 104 ASP ASP A . n 
A 1 59  ALA 59  105 105 ALA ALA A . n 
A 1 60  VAL 60  106 106 VAL VAL A . n 
A 1 61  LYS 61  107 107 LYS LYS A . n 
A 1 62  LEU 62  108 108 LEU LEU A . n 
A 1 63  GLY 63  109 109 GLY GLY A . n 
A 1 64  LEU 64  110 110 LEU LEU A . n 
A 1 65  PRO 65  111 111 PRO PRO A . n 
A 1 66  ASP 66  112 112 ASP ASP A . n 
A 1 67  TYR 67  113 113 TYR TYR A . n 
A 1 68  HIS 68  114 114 HIS HIS A . n 
A 1 69  LYS 69  115 115 LYS LYS A . n 
A 1 70  ILE 70  116 116 ILE ILE A . n 
A 1 71  ILE 71  117 117 ILE ILE A . n 
A 1 72  LYS 72  118 118 LYS LYS A . n 
A 1 73  GLN 73  119 119 GLN GLN A . n 
A 1 74  PRO 74  120 120 PRO PRO A . n 
A 1 75  MET 75  121 121 MET MET A . n 
A 1 76  ASP 76  122 122 ASP ASP A . n 
A 1 77  MET 77  123 123 MET MET A . n 
A 1 78  GLY 78  124 124 GLY GLY A . n 
A 1 79  THR 79  125 125 THR THR A . n 
A 1 80  ILE 80  126 126 ILE ILE A . n 
A 1 81  LYS 81  127 127 LYS LYS A . n 
A 1 82  ARG 82  128 128 ARG ARG A . n 
A 1 83  ARG 83  129 129 ARG ARG A . n 
A 1 84  LEU 84  130 130 LEU LEU A . n 
A 1 85  GLU 85  131 131 GLU GLU A . n 
A 1 86  ASN 86  132 132 ASN ASN A . n 
A 1 87  ASN 87  133 133 ASN ASN A . n 
A 1 88  TYR 88  134 134 TYR TYR A . n 
A 1 89  TYR 89  135 135 TYR TYR A . n 
A 1 90  TRP 90  136 136 TRP TRP A . n 
A 1 91  ALA 91  137 137 ALA ALA A . n 
A 1 92  ALA 92  138 138 ALA ALA A . n 
A 1 93  SER 93  139 139 SER SER A . n 
A 1 94  GLU 94  140 140 GLU GLU A . n 
A 1 95  CYS 95  141 141 CYS CYS A . n 
A 1 96  MET 96  142 142 MET MET A . n 
A 1 97  GLN 97  143 143 GLN GLN A . n 
A 1 98  ASP 98  144 144 ASP ASP A . n 
A 1 99  PHE 99  145 145 PHE PHE A . n 
A 1 100 ASN 100 146 146 ASN ASN A . n 
A 1 101 THR 101 147 147 THR THR A . n 
A 1 102 MET 102 148 148 MET MET A . n 
A 1 103 PHE 103 149 149 PHE PHE A . n 
A 1 104 THR 104 150 150 THR THR A . n 
A 1 105 ASN 105 151 151 ASN ASN A . n 
A 1 106 CYS 106 152 152 CYS CYS A . n 
A 1 107 TYR 107 153 153 TYR TYR A . n 
A 1 108 ILE 108 154 154 ILE ILE A . n 
A 1 109 TYR 109 155 155 TYR TYR A . n 
A 1 110 ASN 110 156 156 ASN ASN A . n 
A 1 111 LYS 111 157 157 LYS LYS A . n 
A 1 112 PRO 112 158 158 PRO PRO A . n 
A 1 113 THR 113 159 159 THR THR A . n 
A 1 114 ASP 114 160 160 ASP ASP A . n 
A 1 115 ASP 115 161 161 ASP ASP A . n 
A 1 116 ILE 116 162 162 ILE ILE A . n 
A 1 117 VAL 117 163 163 VAL VAL A . n 
A 1 118 LEU 118 164 164 LEU LEU A . n 
A 1 119 MET 119 165 165 MET MET A . n 
A 1 120 ALA 120 166 166 ALA ALA A . n 
A 1 121 GLN 121 167 167 GLN GLN A . n 
A 1 122 THR 122 168 168 THR THR A . n 
A 1 123 LEU 123 169 169 LEU LEU A . n 
A 1 124 GLU 124 170 170 GLU GLU A . n 
A 1 125 LYS 125 171 171 LYS LYS A . n 
A 1 126 ILE 126 172 172 ILE ILE A . n 
A 1 127 PHE 127 173 173 PHE PHE A . n 
A 1 128 LEU 128 174 174 LEU LEU A . n 
A 1 129 GLN 129 175 175 GLN GLN A . n 
A 1 130 LYS 130 176 176 LYS LYS A . n 
A 1 131 VAL 131 177 177 VAL VAL A . n 
A 1 132 ALA 132 178 178 ALA ALA A . n 
A 1 133 SER 133 179 179 SER SER A . n 
A 1 134 MET 134 180 180 MET MET A . n 
A 1 135 PRO 135 181 181 PRO PRO A . n 
A 1 136 GLN 136 182 182 GLN GLN A . n 
A 1 137 GLU 137 183 183 GLU GLU A . n 
A 1 138 GLU 138 184 184 GLU GLU A . n 
A 1 139 GLN 139 185 185 GLN GLN A . n 
A 1 140 GLU 140 186 186 GLU GLU A . n 
A 1 141 LEU 141 187 ?   ?   ?   A . n 
A 1 142 VAL 142 188 ?   ?   ?   A . n 
A 1 143 VAL 143 189 ?   ?   ?   A . n 
A 1 144 THR 144 190 ?   ?   ?   A . n 
A 1 145 ILE 145 191 ?   ?   ?   A . n 
A 1 146 PRO 146 192 ?   ?   ?   A . n 
A 1 147 LYS 147 193 ?   ?   ?   A . n 
A 1 148 ASN 148 194 ?   ?   ?   A . n 
A 1 149 SER 149 195 ?   ?   ?   A . n 
A 1 150 HIS 150 196 ?   ?   ?   A . n 
A 1 151 LYS 151 197 ?   ?   ?   A . n 
A 1 152 LYS 152 198 ?   ?   ?   A . n 
A 1 153 GLY 153 199 ?   ?   ?   A . n 
A 1 154 ALA 154 200 ?   ?   ?   A . n 
B 1 1   GLY 1   47  ?   ?   ?   B . n 
B 1 2   SER 2   48  ?   ?   ?   B . n 
B 1 3   SER 3   49  ?   ?   ?   B . n 
B 1 4   HIS 4   50  ?   ?   ?   B . n 
B 1 5   HIS 5   51  ?   ?   ?   B . n 
B 1 6   HIS 6   52  ?   ?   ?   B . n 
B 1 7   HIS 7   53  ?   ?   ?   B . n 
B 1 8   HIS 8   54  ?   ?   ?   B . n 
B 1 9   HIS 9   55  ?   ?   ?   B . n 
B 1 10  SER 10  56  ?   ?   ?   B . n 
B 1 11  SER 11  57  ?   ?   ?   B . n 
B 1 12  GLY 12  58  ?   ?   ?   B . n 
B 1 13  LEU 13  59  ?   ?   ?   B . n 
B 1 14  VAL 14  60  ?   ?   ?   B . n 
B 1 15  PRO 15  61  ?   ?   ?   B . n 
B 1 16  ARG 16  62  ?   ?   ?   B . n 
B 1 17  GLY 17  63  ?   ?   ?   B . n 
B 1 18  SER 18  64  ?   ?   ?   B . n 
B 1 19  HIS 19  65  ?   ?   ?   B . n 
B 1 20  MET 20  66  ?   ?   ?   B . n 
B 1 21  SER 21  67  ?   ?   ?   B . n 
B 1 22  ASN 22  68  ?   ?   ?   B . n 
B 1 23  PRO 23  69  ?   ?   ?   B . n 
B 1 24  LYS 24  70  ?   ?   ?   B . n 
B 1 25  LYS 25  71  ?   ?   ?   B . n 
B 1 26  PRO 26  72  ?   ?   ?   B . n 
B 1 27  GLY 27  73  73  GLY GLY B . n 
B 1 28  ARG 28  74  74  ARG ARG B . n 
B 1 29  VAL 29  75  75  VAL VAL B . n 
B 1 30  THR 30  76  76  THR THR B . n 
B 1 31  ASN 31  77  77  ASN ASN B . n 
B 1 32  GLN 32  78  78  GLN GLN B . n 
B 1 33  LEU 33  79  79  LEU LEU B . n 
B 1 34  GLN 34  80  80  GLN GLN B . n 
B 1 35  TYR 35  81  81  TYR TYR B . n 
B 1 36  LEU 36  82  82  LEU LEU B . n 
B 1 37  HIS 37  83  83  HIS HIS B . n 
B 1 38  LYS 38  84  84  LYS LYS B . n 
B 1 39  VAL 39  85  85  VAL VAL B . n 
B 1 40  VAL 40  86  86  VAL VAL B . n 
B 1 41  MET 41  87  87  MET MET B . n 
B 1 42  LYS 42  88  88  LYS LYS B . n 
B 1 43  ALA 43  89  89  ALA ALA B . n 
B 1 44  LEU 44  90  90  LEU LEU B . n 
B 1 45  TRP 45  91  91  TRP TRP B . n 
B 1 46  LYS 46  92  92  LYS LYS B . n 
B 1 47  HIS 47  93  93  HIS HIS B . n 
B 1 48  GLN 48  94  94  GLN GLN B . n 
B 1 49  PHE 49  95  95  PHE PHE B . n 
B 1 50  ALA 50  96  96  ALA ALA B . n 
B 1 51  TRP 51  97  97  TRP TRP B . n 
B 1 52  PRO 52  98  98  PRO PRO B . n 
B 1 53  PHE 53  99  99  PHE PHE B . n 
B 1 54  ARG 54  100 100 ARG ARG B . n 
B 1 55  GLN 55  101 101 GLN GLN B . n 
B 1 56  PRO 56  102 102 PRO PRO B . n 
B 1 57  VAL 57  103 103 VAL VAL B . n 
B 1 58  ASP 58  104 104 ASP ASP B . n 
B 1 59  ALA 59  105 105 ALA ALA B . n 
B 1 60  VAL 60  106 106 VAL VAL B . n 
B 1 61  LYS 61  107 107 LYS LYS B . n 
B 1 62  LEU 62  108 108 LEU LEU B . n 
B 1 63  GLY 63  109 109 GLY GLY B . n 
B 1 64  LEU 64  110 110 LEU LEU B . n 
B 1 65  PRO 65  111 111 PRO PRO B . n 
B 1 66  ASP 66  112 112 ASP ASP B . n 
B 1 67  TYR 67  113 113 TYR TYR B . n 
B 1 68  HIS 68  114 114 HIS HIS B . n 
B 1 69  LYS 69  115 115 LYS LYS B . n 
B 1 70  ILE 70  116 116 ILE ILE B . n 
B 1 71  ILE 71  117 117 ILE ILE B . n 
B 1 72  LYS 72  118 118 LYS LYS B . n 
B 1 73  GLN 73  119 119 GLN GLN B . n 
B 1 74  PRO 74  120 120 PRO PRO B . n 
B 1 75  MET 75  121 121 MET MET B . n 
B 1 76  ASP 76  122 122 ASP ASP B . n 
B 1 77  MET 77  123 123 MET MET B . n 
B 1 78  GLY 78  124 124 GLY GLY B . n 
B 1 79  THR 79  125 125 THR THR B . n 
B 1 80  ILE 80  126 126 ILE ILE B . n 
B 1 81  LYS 81  127 127 LYS LYS B . n 
B 1 82  ARG 82  128 128 ARG ARG B . n 
B 1 83  ARG 83  129 129 ARG ARG B . n 
B 1 84  LEU 84  130 130 LEU LEU B . n 
B 1 85  GLU 85  131 131 GLU GLU B . n 
B 1 86  ASN 86  132 132 ASN ASN B . n 
B 1 87  ASN 87  133 133 ASN ASN B . n 
B 1 88  TYR 88  134 134 TYR TYR B . n 
B 1 89  TYR 89  135 135 TYR TYR B . n 
B 1 90  TRP 90  136 136 TRP TRP B . n 
B 1 91  ALA 91  137 137 ALA ALA B . n 
B 1 92  ALA 92  138 138 ALA ALA B . n 
B 1 93  SER 93  139 139 SER SER B . n 
B 1 94  GLU 94  140 140 GLU GLU B . n 
B 1 95  CYS 95  141 141 CYS CYS B . n 
B 1 96  MET 96  142 142 MET MET B . n 
B 1 97  GLN 97  143 143 GLN GLN B . n 
B 1 98  ASP 98  144 144 ASP ASP B . n 
B 1 99  PHE 99  145 145 PHE PHE B . n 
B 1 100 ASN 100 146 146 ASN ASN B . n 
B 1 101 THR 101 147 147 THR THR B . n 
B 1 102 MET 102 148 148 MET MET B . n 
B 1 103 PHE 103 149 149 PHE PHE B . n 
B 1 104 THR 104 150 150 THR THR B . n 
B 1 105 ASN 105 151 151 ASN ASN B . n 
B 1 106 CYS 106 152 152 CYS CYS B . n 
B 1 107 TYR 107 153 153 TYR TYR B . n 
B 1 108 ILE 108 154 154 ILE ILE B . n 
B 1 109 TYR 109 155 155 TYR TYR B . n 
B 1 110 ASN 110 156 156 ASN ASN B . n 
B 1 111 LYS 111 157 157 LYS LYS B . n 
B 1 112 PRO 112 158 158 PRO PRO B . n 
B 1 113 THR 113 159 159 THR THR B . n 
B 1 114 ASP 114 160 160 ASP ASP B . n 
B 1 115 ASP 115 161 161 ASP ASP B . n 
B 1 116 ILE 116 162 162 ILE ILE B . n 
B 1 117 VAL 117 163 163 VAL VAL B . n 
B 1 118 LEU 118 164 164 LEU LEU B . n 
B 1 119 MET 119 165 165 MET MET B . n 
B 1 120 ALA 120 166 166 ALA ALA B . n 
B 1 121 GLN 121 167 167 GLN GLN B . n 
B 1 122 THR 122 168 168 THR THR B . n 
B 1 123 LEU 123 169 169 LEU LEU B . n 
B 1 124 GLU 124 170 170 GLU GLU B . n 
B 1 125 LYS 125 171 171 LYS LYS B . n 
B 1 126 ILE 126 172 172 ILE ILE B . n 
B 1 127 PHE 127 173 173 PHE PHE B . n 
B 1 128 LEU 128 174 174 LEU LEU B . n 
B 1 129 GLN 129 175 175 GLN GLN B . n 
B 1 130 LYS 130 176 176 LYS LYS B . n 
B 1 131 VAL 131 177 177 VAL VAL B . n 
B 1 132 ALA 132 178 178 ALA ALA B . n 
B 1 133 SER 133 179 179 SER SER B . n 
B 1 134 MET 134 180 180 MET MET B . n 
B 1 135 PRO 135 181 181 PRO PRO B . n 
B 1 136 GLN 136 182 182 GLN GLN B . n 
B 1 137 GLU 137 183 183 GLU GLU B . n 
B 1 138 GLU 138 184 184 GLU GLU B . n 
B 1 139 GLN 139 185 185 GLN GLN B . n 
B 1 140 GLU 140 186 ?   ?   ?   B . n 
B 1 141 LEU 141 187 ?   ?   ?   B . n 
B 1 142 VAL 142 188 ?   ?   ?   B . n 
B 1 143 VAL 143 189 ?   ?   ?   B . n 
B 1 144 THR 144 190 ?   ?   ?   B . n 
B 1 145 ILE 145 191 ?   ?   ?   B . n 
B 1 146 PRO 146 192 ?   ?   ?   B . n 
B 1 147 LYS 147 193 ?   ?   ?   B . n 
B 1 148 ASN 148 194 ?   ?   ?   B . n 
B 1 149 SER 149 195 ?   ?   ?   B . n 
B 1 150 HIS 150 196 ?   ?   ?   B . n 
B 1 151 LYS 151 197 ?   ?   ?   B . n 
B 1 152 LYS 152 198 ?   ?   ?   B . n 
B 1 153 GLY 153 199 ?   ?   ?   B . n 
B 1 154 ALA 154 200 ?   ?   ?   B . n 
C 1 1   GLY 1   47  ?   ?   ?   C . n 
C 1 2   SER 2   48  ?   ?   ?   C . n 
C 1 3   SER 3   49  ?   ?   ?   C . n 
C 1 4   HIS 4   50  ?   ?   ?   C . n 
C 1 5   HIS 5   51  ?   ?   ?   C . n 
C 1 6   HIS 6   52  ?   ?   ?   C . n 
C 1 7   HIS 7   53  ?   ?   ?   C . n 
C 1 8   HIS 8   54  ?   ?   ?   C . n 
C 1 9   HIS 9   55  ?   ?   ?   C . n 
C 1 10  SER 10  56  ?   ?   ?   C . n 
C 1 11  SER 11  57  ?   ?   ?   C . n 
C 1 12  GLY 12  58  ?   ?   ?   C . n 
C 1 13  LEU 13  59  ?   ?   ?   C . n 
C 1 14  VAL 14  60  ?   ?   ?   C . n 
C 1 15  PRO 15  61  ?   ?   ?   C . n 
C 1 16  ARG 16  62  ?   ?   ?   C . n 
C 1 17  GLY 17  63  ?   ?   ?   C . n 
C 1 18  SER 18  64  ?   ?   ?   C . n 
C 1 19  HIS 19  65  ?   ?   ?   C . n 
C 1 20  MET 20  66  ?   ?   ?   C . n 
C 1 21  SER 21  67  ?   ?   ?   C . n 
C 1 22  ASN 22  68  ?   ?   ?   C . n 
C 1 23  PRO 23  69  ?   ?   ?   C . n 
C 1 24  LYS 24  70  ?   ?   ?   C . n 
C 1 25  LYS 25  71  ?   ?   ?   C . n 
C 1 26  PRO 26  72  ?   ?   ?   C . n 
C 1 27  GLY 27  73  ?   ?   ?   C . n 
C 1 28  ARG 28  74  ?   ?   ?   C . n 
C 1 29  VAL 29  75  ?   ?   ?   C . n 
C 1 30  THR 30  76  ?   ?   ?   C . n 
C 1 31  ASN 31  77  77  ASN ASN C . n 
C 1 32  GLN 32  78  78  GLN GLN C . n 
C 1 33  LEU 33  79  79  LEU LEU C . n 
C 1 34  GLN 34  80  80  GLN GLN C . n 
C 1 35  TYR 35  81  81  TYR TYR C . n 
C 1 36  LEU 36  82  82  LEU LEU C . n 
C 1 37  HIS 37  83  83  HIS HIS C . n 
C 1 38  LYS 38  84  84  LYS LYS C . n 
C 1 39  VAL 39  85  85  VAL VAL C . n 
C 1 40  VAL 40  86  86  VAL VAL C . n 
C 1 41  MET 41  87  87  MET MET C . n 
C 1 42  LYS 42  88  88  LYS LYS C . n 
C 1 43  ALA 43  89  89  ALA ALA C . n 
C 1 44  LEU 44  90  90  LEU LEU C . n 
C 1 45  TRP 45  91  91  TRP TRP C . n 
C 1 46  LYS 46  92  92  LYS LYS C . n 
C 1 47  HIS 47  93  93  HIS HIS C . n 
C 1 48  GLN 48  94  94  GLN GLN C . n 
C 1 49  PHE 49  95  95  PHE PHE C . n 
C 1 50  ALA 50  96  96  ALA ALA C . n 
C 1 51  TRP 51  97  97  TRP TRP C . n 
C 1 52  PRO 52  98  98  PRO PRO C . n 
C 1 53  PHE 53  99  99  PHE PHE C . n 
C 1 54  ARG 54  100 100 ARG ARG C . n 
C 1 55  GLN 55  101 101 GLN GLN C . n 
C 1 56  PRO 56  102 102 PRO PRO C . n 
C 1 57  VAL 57  103 103 VAL VAL C . n 
C 1 58  ASP 58  104 104 ASP ASP C . n 
C 1 59  ALA 59  105 105 ALA ALA C . n 
C 1 60  VAL 60  106 106 VAL VAL C . n 
C 1 61  LYS 61  107 107 LYS LYS C . n 
C 1 62  LEU 62  108 108 LEU LEU C . n 
C 1 63  GLY 63  109 109 GLY GLY C . n 
C 1 64  LEU 64  110 110 LEU LEU C . n 
C 1 65  PRO 65  111 111 PRO PRO C . n 
C 1 66  ASP 66  112 112 ASP ASP C . n 
C 1 67  TYR 67  113 113 TYR TYR C . n 
C 1 68  HIS 68  114 114 HIS HIS C . n 
C 1 69  LYS 69  115 115 LYS LYS C . n 
C 1 70  ILE 70  116 116 ILE ILE C . n 
C 1 71  ILE 71  117 117 ILE ILE C . n 
C 1 72  LYS 72  118 118 LYS LYS C . n 
C 1 73  GLN 73  119 119 GLN GLN C . n 
C 1 74  PRO 74  120 120 PRO PRO C . n 
C 1 75  MET 75  121 121 MET MET C . n 
C 1 76  ASP 76  122 122 ASP ASP C . n 
C 1 77  MET 77  123 123 MET MET C . n 
C 1 78  GLY 78  124 124 GLY GLY C . n 
C 1 79  THR 79  125 125 THR THR C . n 
C 1 80  ILE 80  126 126 ILE ILE C . n 
C 1 81  LYS 81  127 127 LYS LYS C . n 
C 1 82  ARG 82  128 128 ARG ARG C . n 
C 1 83  ARG 83  129 129 ARG ARG C . n 
C 1 84  LEU 84  130 130 LEU LEU C . n 
C 1 85  GLU 85  131 131 GLU GLU C . n 
C 1 86  ASN 86  132 132 ASN ASN C . n 
C 1 87  ASN 87  133 133 ASN ASN C . n 
C 1 88  TYR 88  134 134 TYR TYR C . n 
C 1 89  TYR 89  135 135 TYR TYR C . n 
C 1 90  TRP 90  136 136 TRP TRP C . n 
C 1 91  ALA 91  137 137 ALA ALA C . n 
C 1 92  ALA 92  138 138 ALA ALA C . n 
C 1 93  SER 93  139 139 SER SER C . n 
C 1 94  GLU 94  140 140 GLU GLU C . n 
C 1 95  CYS 95  141 141 CYS CYS C . n 
C 1 96  MET 96  142 142 MET MET C . n 
C 1 97  GLN 97  143 143 GLN GLN C . n 
C 1 98  ASP 98  144 144 ASP ASP C . n 
C 1 99  PHE 99  145 145 PHE PHE C . n 
C 1 100 ASN 100 146 146 ASN ASN C . n 
C 1 101 THR 101 147 147 THR THR C . n 
C 1 102 MET 102 148 148 MET MET C . n 
C 1 103 PHE 103 149 149 PHE PHE C . n 
C 1 104 THR 104 150 150 THR THR C . n 
C 1 105 ASN 105 151 151 ASN ASN C . n 
C 1 106 CYS 106 152 152 CYS CYS C . n 
C 1 107 TYR 107 153 153 TYR TYR C . n 
C 1 108 ILE 108 154 154 ILE ILE C . n 
C 1 109 TYR 109 155 155 TYR TYR C . n 
C 1 110 ASN 110 156 156 ASN ASN C . n 
C 1 111 LYS 111 157 157 LYS LYS C . n 
C 1 112 PRO 112 158 158 PRO PRO C . n 
C 1 113 THR 113 159 159 THR THR C . n 
C 1 114 ASP 114 160 160 ASP ASP C . n 
C 1 115 ASP 115 161 161 ASP ASP C . n 
C 1 116 ILE 116 162 162 ILE ILE C . n 
C 1 117 VAL 117 163 163 VAL VAL C . n 
C 1 118 LEU 118 164 164 LEU LEU C . n 
C 1 119 MET 119 165 165 MET MET C . n 
C 1 120 ALA 120 166 166 ALA ALA C . n 
C 1 121 GLN 121 167 167 GLN GLN C . n 
C 1 122 THR 122 168 168 THR THR C . n 
C 1 123 LEU 123 169 169 LEU LEU C . n 
C 1 124 GLU 124 170 170 GLU GLU C . n 
C 1 125 LYS 125 171 171 LYS LYS C . n 
C 1 126 ILE 126 172 172 ILE ILE C . n 
C 1 127 PHE 127 173 173 PHE PHE C . n 
C 1 128 LEU 128 174 174 LEU LEU C . n 
C 1 129 GLN 129 175 175 GLN GLN C . n 
C 1 130 LYS 130 176 176 LYS LYS C . n 
C 1 131 VAL 131 177 177 VAL VAL C . n 
C 1 132 ALA 132 178 178 ALA ALA C . n 
C 1 133 SER 133 179 179 SER SER C . n 
C 1 134 MET 134 180 180 MET MET C . n 
C 1 135 PRO 135 181 181 PRO PRO C . n 
C 1 136 GLN 136 182 182 GLN GLN C . n 
C 1 137 GLU 137 183 ?   ?   ?   C . n 
C 1 138 GLU 138 184 ?   ?   ?   C . n 
C 1 139 GLN 139 185 ?   ?   ?   C . n 
C 1 140 GLU 140 186 ?   ?   ?   C . n 
C 1 141 LEU 141 187 ?   ?   ?   C . n 
C 1 142 VAL 142 188 ?   ?   ?   C . n 
C 1 143 VAL 143 189 ?   ?   ?   C . n 
C 1 144 THR 144 190 ?   ?   ?   C . n 
C 1 145 ILE 145 191 ?   ?   ?   C . n 
C 1 146 PRO 146 192 ?   ?   ?   C . n 
C 1 147 LYS 147 193 ?   ?   ?   C . n 
C 1 148 ASN 148 194 ?   ?   ?   C . n 
C 1 149 SER 149 195 ?   ?   ?   C . n 
C 1 150 HIS 150 196 ?   ?   ?   C . n 
C 1 151 LYS 151 197 ?   ?   ?   C . n 
C 1 152 LYS 152 198 ?   ?   ?   C . n 
C 1 153 GLY 153 199 ?   ?   ?   C . n 
C 1 154 ALA 154 200 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 EDO 1   1187 1187 EDO EDO A . 
E 3 TYL 1   1188 1188 TYL TYL A . 
F 4 SO4 1   1189 1189 SO4 SO4 A . 
G 2 EDO 1   1186 1186 EDO EDO B . 
H 3 TYL 1   1187 1187 TYL TYL B . 
I 2 EDO 1   1183 1183 EDO EDO C . 
J 3 TYL 1   1184 1184 TYL TYL C . 
K 4 SO4 1   1185 1185 SO4 SO4 C . 
L 4 SO4 1   1186 1186 SO4 SO4 C . 
M 5 HOH 1   2001 2001 HOH HOH A . 
M 5 HOH 2   2002 2002 HOH HOH A . 
M 5 HOH 3   2003 2003 HOH HOH A . 
M 5 HOH 4   2004 2004 HOH HOH A . 
M 5 HOH 5   2005 2005 HOH HOH A . 
M 5 HOH 6   2006 2006 HOH HOH A . 
M 5 HOH 7   2007 2007 HOH HOH A . 
M 5 HOH 8   2008 2008 HOH HOH A . 
M 5 HOH 9   2009 2009 HOH HOH A . 
M 5 HOH 10  2010 2010 HOH HOH A . 
M 5 HOH 11  2011 2011 HOH HOH A . 
M 5 HOH 12  2012 2012 HOH HOH A . 
M 5 HOH 13  2013 2013 HOH HOH A . 
M 5 HOH 14  2014 2014 HOH HOH A . 
M 5 HOH 15  2015 2015 HOH HOH A . 
M 5 HOH 16  2016 2016 HOH HOH A . 
M 5 HOH 17  2017 2017 HOH HOH A . 
M 5 HOH 18  2018 2018 HOH HOH A . 
M 5 HOH 19  2019 2019 HOH HOH A . 
M 5 HOH 20  2020 2020 HOH HOH A . 
M 5 HOH 21  2021 2021 HOH HOH A . 
M 5 HOH 22  2022 2022 HOH HOH A . 
M 5 HOH 23  2023 2023 HOH HOH A . 
M 5 HOH 24  2024 2024 HOH HOH A . 
M 5 HOH 25  2025 2025 HOH HOH A . 
M 5 HOH 26  2026 2026 HOH HOH A . 
M 5 HOH 27  2027 2027 HOH HOH A . 
M 5 HOH 28  2028 2028 HOH HOH A . 
M 5 HOH 29  2029 2029 HOH HOH A . 
M 5 HOH 30  2030 2030 HOH HOH A . 
M 5 HOH 31  2031 2031 HOH HOH A . 
M 5 HOH 32  2032 2032 HOH HOH A . 
M 5 HOH 33  2033 2033 HOH HOH A . 
M 5 HOH 34  2034 2034 HOH HOH A . 
M 5 HOH 35  2035 2035 HOH HOH A . 
M 5 HOH 36  2036 2036 HOH HOH A . 
M 5 HOH 37  2037 2037 HOH HOH A . 
M 5 HOH 38  2038 2038 HOH HOH A . 
M 5 HOH 39  2039 2039 HOH HOH A . 
M 5 HOH 40  2040 2040 HOH HOH A . 
M 5 HOH 41  2041 2041 HOH HOH A . 
M 5 HOH 42  2042 2042 HOH HOH A . 
M 5 HOH 43  2043 2043 HOH HOH A . 
M 5 HOH 44  2044 2044 HOH HOH A . 
M 5 HOH 45  2045 2045 HOH HOH A . 
M 5 HOH 46  2046 2046 HOH HOH A . 
M 5 HOH 47  2047 2047 HOH HOH A . 
M 5 HOH 48  2048 2048 HOH HOH A . 
M 5 HOH 49  2049 2049 HOH HOH A . 
M 5 HOH 50  2050 2050 HOH HOH A . 
M 5 HOH 51  2051 2051 HOH HOH A . 
M 5 HOH 52  2052 2052 HOH HOH A . 
M 5 HOH 53  2053 2053 HOH HOH A . 
M 5 HOH 54  2054 2054 HOH HOH A . 
M 5 HOH 55  2055 2055 HOH HOH A . 
M 5 HOH 56  2056 2056 HOH HOH A . 
M 5 HOH 57  2057 2057 HOH HOH A . 
M 5 HOH 58  2058 2058 HOH HOH A . 
M 5 HOH 59  2059 2059 HOH HOH A . 
M 5 HOH 60  2060 2060 HOH HOH A . 
M 5 HOH 61  2061 2061 HOH HOH A . 
M 5 HOH 62  2062 2062 HOH HOH A . 
M 5 HOH 63  2063 2063 HOH HOH A . 
M 5 HOH 64  2064 2064 HOH HOH A . 
M 5 HOH 65  2065 2065 HOH HOH A . 
M 5 HOH 66  2066 2066 HOH HOH A . 
M 5 HOH 67  2067 2067 HOH HOH A . 
M 5 HOH 68  2068 2068 HOH HOH A . 
M 5 HOH 69  2069 2069 HOH HOH A . 
M 5 HOH 70  2070 2070 HOH HOH A . 
M 5 HOH 71  2071 2071 HOH HOH A . 
M 5 HOH 72  2072 2072 HOH HOH A . 
M 5 HOH 73  2073 2073 HOH HOH A . 
M 5 HOH 74  2074 2074 HOH HOH A . 
M 5 HOH 75  2075 2075 HOH HOH A . 
M 5 HOH 76  2076 2076 HOH HOH A . 
M 5 HOH 77  2077 2077 HOH HOH A . 
M 5 HOH 78  2078 2078 HOH HOH A . 
M 5 HOH 79  2079 2079 HOH HOH A . 
M 5 HOH 80  2080 2080 HOH HOH A . 
M 5 HOH 81  2081 2081 HOH HOH A . 
M 5 HOH 82  2082 2082 HOH HOH A . 
M 5 HOH 83  2083 2083 HOH HOH A . 
M 5 HOH 84  2084 2084 HOH HOH A . 
M 5 HOH 85  2085 2085 HOH HOH A . 
M 5 HOH 86  2086 2086 HOH HOH A . 
M 5 HOH 87  2087 2087 HOH HOH A . 
M 5 HOH 88  2088 2088 HOH HOH A . 
M 5 HOH 89  2089 2089 HOH HOH A . 
M 5 HOH 90  2090 2090 HOH HOH A . 
M 5 HOH 91  2091 2091 HOH HOH A . 
M 5 HOH 92  2092 2092 HOH HOH A . 
M 5 HOH 93  2093 2093 HOH HOH A . 
M 5 HOH 94  2094 2094 HOH HOH A . 
M 5 HOH 95  2095 2095 HOH HOH A . 
M 5 HOH 96  2096 2096 HOH HOH A . 
M 5 HOH 97  2097 2097 HOH HOH A . 
M 5 HOH 98  2098 2098 HOH HOH A . 
M 5 HOH 99  2099 2099 HOH HOH A . 
M 5 HOH 100 2100 2100 HOH HOH A . 
M 5 HOH 101 2101 2101 HOH HOH A . 
M 5 HOH 102 2102 2102 HOH HOH A . 
M 5 HOH 103 2103 2103 HOH HOH A . 
M 5 HOH 104 2104 2104 HOH HOH A . 
M 5 HOH 105 2105 2105 HOH HOH A . 
M 5 HOH 106 2106 2106 HOH HOH A . 
M 5 HOH 107 2107 2107 HOH HOH A . 
M 5 HOH 108 2108 2108 HOH HOH A . 
M 5 HOH 109 2109 2109 HOH HOH A . 
M 5 HOH 110 2110 2110 HOH HOH A . 
M 5 HOH 111 2111 2111 HOH HOH A . 
M 5 HOH 112 2112 2112 HOH HOH A . 
M 5 HOH 113 2113 2113 HOH HOH A . 
M 5 HOH 114 2114 2114 HOH HOH A . 
M 5 HOH 115 2115 2115 HOH HOH A . 
M 5 HOH 116 2116 2116 HOH HOH A . 
M 5 HOH 117 2117 2117 HOH HOH A . 
M 5 HOH 118 2118 2118 HOH HOH A . 
M 5 HOH 119 2119 2119 HOH HOH A . 
M 5 HOH 120 2120 2120 HOH HOH A . 
M 5 HOH 121 2121 2121 HOH HOH A . 
M 5 HOH 122 2122 2122 HOH HOH A . 
M 5 HOH 123 2123 2123 HOH HOH A . 
M 5 HOH 124 2124 2124 HOH HOH A . 
M 5 HOH 125 2125 2125 HOH HOH A . 
M 5 HOH 126 2126 2126 HOH HOH A . 
M 5 HOH 127 2127 2127 HOH HOH A . 
M 5 HOH 128 2128 2128 HOH HOH A . 
N 5 HOH 1   2001 2001 HOH HOH B . 
N 5 HOH 2   2002 2002 HOH HOH B . 
N 5 HOH 3   2003 2003 HOH HOH B . 
N 5 HOH 4   2004 2004 HOH HOH B . 
N 5 HOH 5   2005 2005 HOH HOH B . 
N 5 HOH 6   2006 2006 HOH HOH B . 
N 5 HOH 7   2007 2007 HOH HOH B . 
N 5 HOH 8   2008 2008 HOH HOH B . 
N 5 HOH 9   2009 2009 HOH HOH B . 
N 5 HOH 10  2010 2010 HOH HOH B . 
N 5 HOH 11  2011 2011 HOH HOH B . 
N 5 HOH 12  2012 2012 HOH HOH B . 
N 5 HOH 13  2013 2013 HOH HOH B . 
N 5 HOH 14  2014 2014 HOH HOH B . 
N 5 HOH 15  2015 2015 HOH HOH B . 
N 5 HOH 16  2016 2016 HOH HOH B . 
N 5 HOH 17  2017 2017 HOH HOH B . 
N 5 HOH 18  2018 2018 HOH HOH B . 
N 5 HOH 19  2019 2019 HOH HOH B . 
N 5 HOH 20  2020 2020 HOH HOH B . 
N 5 HOH 21  2021 2021 HOH HOH B . 
N 5 HOH 22  2022 2022 HOH HOH B . 
N 5 HOH 23  2023 2023 HOH HOH B . 
N 5 HOH 24  2024 2024 HOH HOH B . 
N 5 HOH 25  2025 2025 HOH HOH B . 
N 5 HOH 26  2026 2026 HOH HOH B . 
N 5 HOH 27  2027 2027 HOH HOH B . 
N 5 HOH 28  2028 2028 HOH HOH B . 
N 5 HOH 29  2029 2029 HOH HOH B . 
N 5 HOH 30  2030 2030 HOH HOH B . 
N 5 HOH 31  2031 2031 HOH HOH B . 
N 5 HOH 32  2032 2032 HOH HOH B . 
N 5 HOH 33  2033 2033 HOH HOH B . 
N 5 HOH 34  2034 2034 HOH HOH B . 
N 5 HOH 35  2035 2035 HOH HOH B . 
N 5 HOH 36  2036 2036 HOH HOH B . 
N 5 HOH 37  2037 2037 HOH HOH B . 
N 5 HOH 38  2038 2038 HOH HOH B . 
N 5 HOH 39  2039 2039 HOH HOH B . 
N 5 HOH 40  2040 2040 HOH HOH B . 
N 5 HOH 41  2041 2041 HOH HOH B . 
N 5 HOH 42  2042 2042 HOH HOH B . 
N 5 HOH 43  2043 2043 HOH HOH B . 
N 5 HOH 44  2044 2044 HOH HOH B . 
N 5 HOH 45  2045 2045 HOH HOH B . 
N 5 HOH 46  2046 2046 HOH HOH B . 
N 5 HOH 47  2047 2047 HOH HOH B . 
N 5 HOH 48  2048 2048 HOH HOH B . 
N 5 HOH 49  2049 2049 HOH HOH B . 
N 5 HOH 50  2050 2050 HOH HOH B . 
N 5 HOH 51  2051 2051 HOH HOH B . 
N 5 HOH 52  2052 2052 HOH HOH B . 
N 5 HOH 53  2053 2053 HOH HOH B . 
N 5 HOH 54  2054 2054 HOH HOH B . 
N 5 HOH 55  2055 2055 HOH HOH B . 
N 5 HOH 56  2056 2056 HOH HOH B . 
N 5 HOH 57  2057 2057 HOH HOH B . 
N 5 HOH 58  2058 2058 HOH HOH B . 
N 5 HOH 59  2059 2059 HOH HOH B . 
N 5 HOH 60  2060 2060 HOH HOH B . 
N 5 HOH 61  2061 2061 HOH HOH B . 
N 5 HOH 62  2062 2062 HOH HOH B . 
N 5 HOH 63  2063 2063 HOH HOH B . 
N 5 HOH 64  2064 2064 HOH HOH B . 
N 5 HOH 65  2065 2065 HOH HOH B . 
N 5 HOH 66  2066 2066 HOH HOH B . 
N 5 HOH 67  2067 2067 HOH HOH B . 
N 5 HOH 68  2068 2068 HOH HOH B . 
N 5 HOH 69  2069 2069 HOH HOH B . 
N 5 HOH 70  2070 2070 HOH HOH B . 
N 5 HOH 71  2071 2071 HOH HOH B . 
N 5 HOH 72  2072 2072 HOH HOH B . 
N 5 HOH 73  2073 2073 HOH HOH B . 
N 5 HOH 74  2074 2074 HOH HOH B . 
N 5 HOH 75  2075 2075 HOH HOH B . 
N 5 HOH 76  2076 2076 HOH HOH B . 
N 5 HOH 77  2077 2077 HOH HOH B . 
N 5 HOH 78  2078 2078 HOH HOH B . 
N 5 HOH 79  2079 2079 HOH HOH B . 
N 5 HOH 80  2080 2080 HOH HOH B . 
N 5 HOH 81  2081 2081 HOH HOH B . 
N 5 HOH 82  2082 2082 HOH HOH B . 
N 5 HOH 83  2083 2083 HOH HOH B . 
N 5 HOH 84  2084 2084 HOH HOH B . 
N 5 HOH 85  2085 2085 HOH HOH B . 
N 5 HOH 86  2086 2086 HOH HOH B . 
N 5 HOH 87  2087 2087 HOH HOH B . 
N 5 HOH 88  2088 2088 HOH HOH B . 
N 5 HOH 89  2089 2089 HOH HOH B . 
N 5 HOH 90  2090 2090 HOH HOH B . 
N 5 HOH 91  2091 2091 HOH HOH B . 
N 5 HOH 92  2092 2092 HOH HOH B . 
N 5 HOH 93  2093 2093 HOH HOH B . 
N 5 HOH 94  2094 2094 HOH HOH B . 
N 5 HOH 95  2095 2095 HOH HOH B . 
N 5 HOH 96  2096 2096 HOH HOH B . 
N 5 HOH 97  2097 2097 HOH HOH B . 
N 5 HOH 98  2098 2098 HOH HOH B . 
N 5 HOH 99  2099 2099 HOH HOH B . 
N 5 HOH 100 2100 2100 HOH HOH B . 
N 5 HOH 101 2101 2101 HOH HOH B . 
N 5 HOH 102 2102 2102 HOH HOH B . 
N 5 HOH 103 2103 2103 HOH HOH B . 
O 5 HOH 1   2001 2001 HOH HOH C . 
O 5 HOH 2   2002 2002 HOH HOH C . 
O 5 HOH 3   2003 2003 HOH HOH C . 
O 5 HOH 4   2004 2004 HOH HOH C . 
O 5 HOH 5   2005 2005 HOH HOH C . 
O 5 HOH 6   2006 2006 HOH HOH C . 
O 5 HOH 7   2007 2007 HOH HOH C . 
O 5 HOH 8   2008 2008 HOH HOH C . 
O 5 HOH 9   2009 2009 HOH HOH C . 
O 5 HOH 10  2010 2010 HOH HOH C . 
O 5 HOH 11  2011 2011 HOH HOH C . 
O 5 HOH 12  2012 2012 HOH HOH C . 
O 5 HOH 13  2013 2013 HOH HOH C . 
O 5 HOH 14  2014 2014 HOH HOH C . 
O 5 HOH 15  2015 2015 HOH HOH C . 
O 5 HOH 16  2016 2016 HOH HOH C . 
O 5 HOH 17  2017 2017 HOH HOH C . 
O 5 HOH 18  2018 2018 HOH HOH C . 
O 5 HOH 19  2019 2019 HOH HOH C . 
O 5 HOH 20  2020 2020 HOH HOH C . 
O 5 HOH 21  2021 2021 HOH HOH C . 
O 5 HOH 22  2022 2022 HOH HOH C . 
O 5 HOH 23  2023 2023 HOH HOH C . 
O 5 HOH 24  2024 2024 HOH HOH C . 
O 5 HOH 25  2025 2025 HOH HOH C . 
O 5 HOH 26  2026 2026 HOH HOH C . 
O 5 HOH 27  2027 2027 HOH HOH C . 
O 5 HOH 28  2028 2028 HOH HOH C . 
O 5 HOH 29  2029 2029 HOH HOH C . 
O 5 HOH 30  2030 2030 HOH HOH C . 
O 5 HOH 31  2031 2031 HOH HOH C . 
O 5 HOH 32  2032 2032 HOH HOH C . 
O 5 HOH 33  2033 2033 HOH HOH C . 
O 5 HOH 34  2034 2034 HOH HOH C . 
O 5 HOH 35  2035 2035 HOH HOH C . 
O 5 HOH 36  2036 2036 HOH HOH C . 
O 5 HOH 37  2037 2037 HOH HOH C . 
O 5 HOH 38  2038 2038 HOH HOH C . 
O 5 HOH 39  2039 2039 HOH HOH C . 
O 5 HOH 40  2040 2040 HOH HOH C . 
O 5 HOH 41  2041 2041 HOH HOH C . 
O 5 HOH 42  2042 2042 HOH HOH C . 
O 5 HOH 43  2043 2043 HOH HOH C . 
O 5 HOH 44  2044 2044 HOH HOH C . 
O 5 HOH 45  2045 2045 HOH HOH C . 
O 5 HOH 46  2046 2046 HOH HOH C . 
O 5 HOH 47  2047 2047 HOH HOH C . 
O 5 HOH 48  2048 2048 HOH HOH C . 
O 5 HOH 49  2049 2049 HOH HOH C . 
O 5 HOH 50  2050 2050 HOH HOH C . 
O 5 HOH 51  2051 2051 HOH HOH C . 
O 5 HOH 52  2052 2052 HOH HOH C . 
O 5 HOH 53  2053 2053 HOH HOH C . 
O 5 HOH 54  2054 2054 HOH HOH C . 
O 5 HOH 55  2055 2055 HOH HOH C . 
O 5 HOH 56  2056 2056 HOH HOH C . 
O 5 HOH 57  2057 2057 HOH HOH C . 
O 5 HOH 58  2058 2058 HOH HOH C . 
O 5 HOH 59  2059 2059 HOH HOH C . 
O 5 HOH 60  2060 2060 HOH HOH C . 
O 5 HOH 61  2061 2061 HOH HOH C . 
O 5 HOH 62  2062 2062 HOH HOH C . 
O 5 HOH 63  2063 2063 HOH HOH C . 
O 5 HOH 64  2064 2064 HOH HOH C . 
O 5 HOH 65  2065 2065 HOH HOH C . 
O 5 HOH 66  2066 2066 HOH HOH C . 
O 5 HOH 67  2067 2067 HOH HOH C . 
O 5 HOH 68  2068 2068 HOH HOH C . 
O 5 HOH 69  2069 2069 HOH HOH C . 
O 5 HOH 70  2070 2070 HOH HOH C . 
O 5 HOH 71  2071 2071 HOH HOH C . 
O 5 HOH 72  2072 2072 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 C,I,J,K,L,O       
2 1   A,B,D,E,F,G,H,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3280  ? 
1 MORE         -75.5 ? 
1 'SSA (A^2)'  11360 ? 
2 'ABSA (A^2)' 2400  ? 
2 MORE         -19.7 ? 
2 'SSA (A^2)'  11870 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -5.7908256691 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 67.8252425139 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    C 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2058 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   O 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-01-11 
2 'Structure model' 1 1 2012-02-08 
3 'Structure model' 1 2 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Other                      
2 3 'Structure model' 'Data collection'          
3 3 'Structure model' 'Experimental preparation' 
4 3 'Structure model' Other                      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow   
2 3 'Structure model' pdbx_database_proc   
3 3 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.temp'                    
2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 16.2453 6.7251  1.7237  0.0189 0.0387 0.1241 0.0086  0.0431  0.0067  2.2505 2.4662 2.3402 -0.9181 
-0.1680 0.2940  -0.1070 -0.0432 -0.1281 0.1519  0.0296 0.3839  0.0255  -0.2419 0.0774  
'X-RAY DIFFRACTION' 2 ? refined 34.6568 8.9221  10.9180 0.0795 0.0236 0.0645 0.0072  -0.0383 -0.0046 1.6319 2.9279 2.9391 -0.3823 
0.0955  0.0071  -0.0148 -0.1290 0.0049  0.3495  0.1025 -0.1790 -0.1393 0.1540  -0.0877 
'X-RAY DIFFRACTION' 3 ? refined -2.0166 18.8512 23.5905 0.0346 0.1678 0.0185 -0.0187 0.0159  -0.0024 1.6224 3.9340 5.9683 -0.0767 
0.9326  -0.8271 -0.0605 0.1606  0.0267  -0.3055 0.1973 -0.0986 -0.1672 0.0818  -0.1367 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 75 ? ? A 186 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 73 ? ? B 185 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 77 ? ? C 182 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.5.0109 ? 1 
d*TREK 'data reduction' .        ? 2 
d*TREK 'data scaling'   .        ? 3 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2022 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2011 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_555 
_pdbx_validate_symm_contact.dist              2.18 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     184 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -68.20 
_pdbx_validate_torsion.psi             86.83 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      C 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2072 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.77 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 185 ? CG  ? A GLN 139 CG  
2  1 Y 1 A GLN 185 ? CD  ? A GLN 139 CD  
3  1 Y 1 A GLN 185 ? OE1 ? A GLN 139 OE1 
4  1 Y 1 A GLN 185 ? NE2 ? A GLN 139 NE2 
5  1 Y 1 B GLU 183 ? CG  ? B GLU 137 CG  
6  1 Y 1 B GLU 183 ? CD  ? B GLU 137 CD  
7  1 Y 1 B GLU 183 ? OE1 ? B GLU 137 OE1 
8  1 Y 1 B GLU 183 ? OE2 ? B GLU 137 OE2 
9  1 Y 1 B GLU 184 ? CG  ? B GLU 138 CG  
10 1 Y 1 B GLU 184 ? CD  ? B GLU 138 CD  
11 1 Y 1 B GLU 184 ? OE1 ? B GLU 138 OE1 
12 1 Y 1 B GLU 184 ? OE2 ? B GLU 138 OE2 
13 1 Y 1 B GLN 185 ? CG  ? B GLN 139 CG  
14 1 Y 1 B GLN 185 ? CD  ? B GLN 139 CD  
15 1 Y 1 B GLN 185 ? OE1 ? B GLN 139 OE1 
16 1 Y 1 B GLN 185 ? NE2 ? B GLN 139 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 47  ? A GLY 1   
2   1 Y 1 A SER 48  ? A SER 2   
3   1 Y 1 A SER 49  ? A SER 3   
4   1 Y 1 A HIS 50  ? A HIS 4   
5   1 Y 1 A HIS 51  ? A HIS 5   
6   1 Y 1 A HIS 52  ? A HIS 6   
7   1 Y 1 A HIS 53  ? A HIS 7   
8   1 Y 1 A HIS 54  ? A HIS 8   
9   1 Y 1 A HIS 55  ? A HIS 9   
10  1 Y 1 A SER 56  ? A SER 10  
11  1 Y 1 A SER 57  ? A SER 11  
12  1 Y 1 A GLY 58  ? A GLY 12  
13  1 Y 1 A LEU 59  ? A LEU 13  
14  1 Y 1 A VAL 60  ? A VAL 14  
15  1 Y 1 A PRO 61  ? A PRO 15  
16  1 Y 1 A ARG 62  ? A ARG 16  
17  1 Y 1 A GLY 63  ? A GLY 17  
18  1 Y 1 A SER 64  ? A SER 18  
19  1 Y 1 A HIS 65  ? A HIS 19  
20  1 Y 1 A MET 66  ? A MET 20  
21  1 Y 1 A SER 67  ? A SER 21  
22  1 Y 1 A ASN 68  ? A ASN 22  
23  1 Y 1 A PRO 69  ? A PRO 23  
24  1 Y 1 A LYS 70  ? A LYS 24  
25  1 Y 1 A LYS 71  ? A LYS 25  
26  1 Y 1 A PRO 72  ? A PRO 26  
27  1 Y 1 A GLY 73  ? A GLY 27  
28  1 Y 1 A ARG 74  ? A ARG 28  
29  1 Y 1 A LEU 187 ? A LEU 141 
30  1 Y 1 A VAL 188 ? A VAL 142 
31  1 Y 1 A VAL 189 ? A VAL 143 
32  1 Y 1 A THR 190 ? A THR 144 
33  1 Y 1 A ILE 191 ? A ILE 145 
34  1 Y 1 A PRO 192 ? A PRO 146 
35  1 Y 1 A LYS 193 ? A LYS 147 
36  1 Y 1 A ASN 194 ? A ASN 148 
37  1 Y 1 A SER 195 ? A SER 149 
38  1 Y 1 A HIS 196 ? A HIS 150 
39  1 Y 1 A LYS 197 ? A LYS 151 
40  1 Y 1 A LYS 198 ? A LYS 152 
41  1 Y 1 A GLY 199 ? A GLY 153 
42  1 Y 1 A ALA 200 ? A ALA 154 
43  1 Y 1 B GLY 47  ? B GLY 1   
44  1 Y 1 B SER 48  ? B SER 2   
45  1 Y 1 B SER 49  ? B SER 3   
46  1 Y 1 B HIS 50  ? B HIS 4   
47  1 Y 1 B HIS 51  ? B HIS 5   
48  1 Y 1 B HIS 52  ? B HIS 6   
49  1 Y 1 B HIS 53  ? B HIS 7   
50  1 Y 1 B HIS 54  ? B HIS 8   
51  1 Y 1 B HIS 55  ? B HIS 9   
52  1 Y 1 B SER 56  ? B SER 10  
53  1 Y 1 B SER 57  ? B SER 11  
54  1 Y 1 B GLY 58  ? B GLY 12  
55  1 Y 1 B LEU 59  ? B LEU 13  
56  1 Y 1 B VAL 60  ? B VAL 14  
57  1 Y 1 B PRO 61  ? B PRO 15  
58  1 Y 1 B ARG 62  ? B ARG 16  
59  1 Y 1 B GLY 63  ? B GLY 17  
60  1 Y 1 B SER 64  ? B SER 18  
61  1 Y 1 B HIS 65  ? B HIS 19  
62  1 Y 1 B MET 66  ? B MET 20  
63  1 Y 1 B SER 67  ? B SER 21  
64  1 Y 1 B ASN 68  ? B ASN 22  
65  1 Y 1 B PRO 69  ? B PRO 23  
66  1 Y 1 B LYS 70  ? B LYS 24  
67  1 Y 1 B LYS 71  ? B LYS 25  
68  1 Y 1 B PRO 72  ? B PRO 26  
69  1 Y 1 B GLU 186 ? B GLU 140 
70  1 Y 1 B LEU 187 ? B LEU 141 
71  1 Y 1 B VAL 188 ? B VAL 142 
72  1 Y 1 B VAL 189 ? B VAL 143 
73  1 Y 1 B THR 190 ? B THR 144 
74  1 Y 1 B ILE 191 ? B ILE 145 
75  1 Y 1 B PRO 192 ? B PRO 146 
76  1 Y 1 B LYS 193 ? B LYS 147 
77  1 Y 1 B ASN 194 ? B ASN 148 
78  1 Y 1 B SER 195 ? B SER 149 
79  1 Y 1 B HIS 196 ? B HIS 150 
80  1 Y 1 B LYS 197 ? B LYS 151 
81  1 Y 1 B LYS 198 ? B LYS 152 
82  1 Y 1 B GLY 199 ? B GLY 153 
83  1 Y 1 B ALA 200 ? B ALA 154 
84  1 Y 1 C GLY 47  ? C GLY 1   
85  1 Y 1 C SER 48  ? C SER 2   
86  1 Y 1 C SER 49  ? C SER 3   
87  1 Y 1 C HIS 50  ? C HIS 4   
88  1 Y 1 C HIS 51  ? C HIS 5   
89  1 Y 1 C HIS 52  ? C HIS 6   
90  1 Y 1 C HIS 53  ? C HIS 7   
91  1 Y 1 C HIS 54  ? C HIS 8   
92  1 Y 1 C HIS 55  ? C HIS 9   
93  1 Y 1 C SER 56  ? C SER 10  
94  1 Y 1 C SER 57  ? C SER 11  
95  1 Y 1 C GLY 58  ? C GLY 12  
96  1 Y 1 C LEU 59  ? C LEU 13  
97  1 Y 1 C VAL 60  ? C VAL 14  
98  1 Y 1 C PRO 61  ? C PRO 15  
99  1 Y 1 C ARG 62  ? C ARG 16  
100 1 Y 1 C GLY 63  ? C GLY 17  
101 1 Y 1 C SER 64  ? C SER 18  
102 1 Y 1 C HIS 65  ? C HIS 19  
103 1 Y 1 C MET 66  ? C MET 20  
104 1 Y 1 C SER 67  ? C SER 21  
105 1 Y 1 C ASN 68  ? C ASN 22  
106 1 Y 1 C PRO 69  ? C PRO 23  
107 1 Y 1 C LYS 70  ? C LYS 24  
108 1 Y 1 C LYS 71  ? C LYS 25  
109 1 Y 1 C PRO 72  ? C PRO 26  
110 1 Y 1 C GLY 73  ? C GLY 27  
111 1 Y 1 C ARG 74  ? C ARG 28  
112 1 Y 1 C VAL 75  ? C VAL 29  
113 1 Y 1 C THR 76  ? C THR 30  
114 1 Y 1 C GLU 183 ? C GLU 137 
115 1 Y 1 C GLU 184 ? C GLU 138 
116 1 Y 1 C GLN 185 ? C GLN 139 
117 1 Y 1 C GLU 186 ? C GLU 140 
118 1 Y 1 C LEU 187 ? C LEU 141 
119 1 Y 1 C VAL 188 ? C VAL 142 
120 1 Y 1 C VAL 189 ? C VAL 143 
121 1 Y 1 C THR 190 ? C THR 144 
122 1 Y 1 C ILE 191 ? C ILE 145 
123 1 Y 1 C PRO 192 ? C PRO 146 
124 1 Y 1 C LYS 193 ? C LYS 147 
125 1 Y 1 C ASN 194 ? C ASN 148 
126 1 Y 1 C SER 195 ? C SER 149 
127 1 Y 1 C HIS 196 ? C HIS 150 
128 1 Y 1 C LYS 197 ? C LYS 151 
129 1 Y 1 C LYS 198 ? C LYS 152 
130 1 Y 1 C GLY 199 ? C GLY 153 
131 1 Y 1 C ALA 200 ? C ALA 154 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL                           EDO 
3 'N-(4-HYDROXYPHENYL)ACETAMIDE (TYLENOL)' TYL 
4 'SULFATE ION'                            SO4 
5 water                                    HOH 
#