data_4A9N
# 
_entry.id   4A9N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4A9N         
PDBE  EBI-50493    
WWPDB D_1290050493 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2YEK unspecified 'CRYSTAL STRUCTURE OF THE FIRST BROMODOMAIN OF HUMAN BRD2 WITH THE INHIBITOR GSK525762 (IBET)' 
PDB 4A9E unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3-METHYL-1 ,2,3,4-TETRAHYDROQUINAZOLIN-2-ONE' 
PDB 4A9H unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1-(2- METHYL-1,2,3,4-TETRAHYDROQUINOLIN-1-YL)ETHAN-1-ONE' 
PDB 4A9M unspecified 
'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N- CYCLOPENTYL-5-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-2- METHYLBENZENE-1-SULFONAMIDE' 
PDB 4A9F unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 1- METHYLPYRROLIDIN-2-ONE' 
PDB 4A9O unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 5 ETHYL-3 -METHYL-4-PHENYL-1,2-OXAZOLE' 
PDB 2YDW unspecified 'CRYSTAL STRUCTURE OF THE FIRST BROMODOMAIN OF HUMAN BRD2 WITH THE INHIBITOR GW841819X' 
PDB 4A9J unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N-(4- HYDROXYPHENYL)ACETAMIDE' 
PDB 1X0J unspecified 'CRYSTAL STRUCTURE ANALYSIS OF THE N-TERMINAL BROMODOMAIN OFHUMAN BRD2' 
PDB 4A9P unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3,5 DIMETHYL-4-PHENYL-1,2-OXAZOLE' 
PDB 4A9I unspecified 'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH 3-METHYL-1 ,2,3,4-TETRAHYDROQUINAZOLIN-2-ONE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4A9N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-11-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chung, C.'      1 
'Bamborough, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Fragment-Based Discovery of Bromodomain Inhibitors Part 2: Optimization of Phenylisoxazole Sulfonamides.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            55 
_citation.page_first                587 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22136469 
_citation.pdbx_database_id_DOI      10.1021/JM201283Q 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bamborough, P.' 1 ? 
primary 'Diallo, H.'     2 ? 
primary 'Goodacre, J.D.' 3 ? 
primary 'Gordon, L.'     4 ? 
primary 'Lewis, A.'      5 ? 
primary 'Seal, J.T.'     6 ? 
primary 'Wilson, D.M.'   7 ? 
primary 'Woodrow, M.D.'  8 ? 
primary 'Chung, C.W.'    9 ? 
# 
_cell.entry_id           4A9N 
_cell.length_a           113.967 
_cell.length_b           55.725 
_cell.length_c           68.126 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.96 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4A9N 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'BROMODOMAIN CONTAINING 2'                                                           17908.727 3   ? ? 
'N-TERMINAL BROMODOMAIN (BD1), RESIDUES 67-200' ? 
2 non-polymer syn 1,2-ETHANEDIOL                                                                       62.068    6   ? ? ? ? 
3 non-polymer syn 'N-CYCLOPROP-2-EN-1-YL-5-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-2-METHYL-BENZENESULFONAMIDE' 304.364   2   ? ? ? ? 
4 non-polymer syn 'SULFATE ION'                                                                        96.063    4   ? ? ? ? 
5 non-polymer syn 'DIMETHYL SULFOXIDE'                                                                 78.133    1   ? ? ? ? 
6 water       nat water                                                                                18.015    281 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN BRD2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTI
KRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTI
KRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  VAL n 
1 15  PRO n 
1 16  ARG n 
1 17  GLY n 
1 18  SER n 
1 19  HIS n 
1 20  MET n 
1 21  SER n 
1 22  ASN n 
1 23  PRO n 
1 24  LYS n 
1 25  LYS n 
1 26  PRO n 
1 27  GLY n 
1 28  ARG n 
1 29  VAL n 
1 30  THR n 
1 31  ASN n 
1 32  GLN n 
1 33  LEU n 
1 34  GLN n 
1 35  TYR n 
1 36  LEU n 
1 37  HIS n 
1 38  LYS n 
1 39  VAL n 
1 40  VAL n 
1 41  MET n 
1 42  LYS n 
1 43  ALA n 
1 44  LEU n 
1 45  TRP n 
1 46  LYS n 
1 47  HIS n 
1 48  GLN n 
1 49  PHE n 
1 50  ALA n 
1 51  TRP n 
1 52  PRO n 
1 53  PHE n 
1 54  ARG n 
1 55  GLN n 
1 56  PRO n 
1 57  VAL n 
1 58  ASP n 
1 59  ALA n 
1 60  VAL n 
1 61  LYS n 
1 62  LEU n 
1 63  GLY n 
1 64  LEU n 
1 65  PRO n 
1 66  ASP n 
1 67  TYR n 
1 68  HIS n 
1 69  LYS n 
1 70  ILE n 
1 71  ILE n 
1 72  LYS n 
1 73  GLN n 
1 74  PRO n 
1 75  MET n 
1 76  ASP n 
1 77  MET n 
1 78  GLY n 
1 79  THR n 
1 80  ILE n 
1 81  LYS n 
1 82  ARG n 
1 83  ARG n 
1 84  LEU n 
1 85  GLU n 
1 86  ASN n 
1 87  ASN n 
1 88  TYR n 
1 89  TYR n 
1 90  TRP n 
1 91  ALA n 
1 92  ALA n 
1 93  SER n 
1 94  GLU n 
1 95  CYS n 
1 96  MET n 
1 97  GLN n 
1 98  ASP n 
1 99  PHE n 
1 100 ASN n 
1 101 THR n 
1 102 MET n 
1 103 PHE n 
1 104 THR n 
1 105 ASN n 
1 106 CYS n 
1 107 TYR n 
1 108 ILE n 
1 109 TYR n 
1 110 ASN n 
1 111 LYS n 
1 112 PRO n 
1 113 THR n 
1 114 ASP n 
1 115 ASP n 
1 116 ILE n 
1 117 VAL n 
1 118 LEU n 
1 119 MET n 
1 120 ALA n 
1 121 GLN n 
1 122 THR n 
1 123 LEU n 
1 124 GLU n 
1 125 LYS n 
1 126 ILE n 
1 127 PHE n 
1 128 LEU n 
1 129 GLN n 
1 130 LYS n 
1 131 VAL n 
1 132 ALA n 
1 133 SER n 
1 134 MET n 
1 135 PRO n 
1 136 GLN n 
1 137 GLU n 
1 138 GLU n 
1 139 GLN n 
1 140 GLU n 
1 141 LEU n 
1 142 VAL n 
1 143 VAL n 
1 144 THR n 
1 145 ILE n 
1 146 PRO n 
1 147 LYS n 
1 148 ASN n 
1 149 SER n 
1 150 HIS n 
1 151 LYS n 
1 152 LYS n 
1 153 GLY n 
1 154 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRD2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P25440 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4A9N A 21 ? 154 ? P25440 67 ? 200 ? 67 200 
2 1 4A9N B 21 ? 154 ? P25440 67 ? 200 ? 67 200 
3 1 4A9N C 21 ? 154 ? P25440 67 ? 200 ? 67 200 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4A9N GLY A 1  ? UNP P25440 ? ? 'expression tag' 47 1  
1 4A9N SER A 2  ? UNP P25440 ? ? 'expression tag' 48 2  
1 4A9N SER A 3  ? UNP P25440 ? ? 'expression tag' 49 3  
1 4A9N HIS A 4  ? UNP P25440 ? ? 'expression tag' 50 4  
1 4A9N HIS A 5  ? UNP P25440 ? ? 'expression tag' 51 5  
1 4A9N HIS A 6  ? UNP P25440 ? ? 'expression tag' 52 6  
1 4A9N HIS A 7  ? UNP P25440 ? ? 'expression tag' 53 7  
1 4A9N HIS A 8  ? UNP P25440 ? ? 'expression tag' 54 8  
1 4A9N HIS A 9  ? UNP P25440 ? ? 'expression tag' 55 9  
1 4A9N SER A 10 ? UNP P25440 ? ? 'expression tag' 56 10 
1 4A9N SER A 11 ? UNP P25440 ? ? 'expression tag' 57 11 
1 4A9N GLY A 12 ? UNP P25440 ? ? 'expression tag' 58 12 
1 4A9N LEU A 13 ? UNP P25440 ? ? 'expression tag' 59 13 
1 4A9N VAL A 14 ? UNP P25440 ? ? 'expression tag' 60 14 
1 4A9N PRO A 15 ? UNP P25440 ? ? 'expression tag' 61 15 
1 4A9N ARG A 16 ? UNP P25440 ? ? 'expression tag' 62 16 
1 4A9N GLY A 17 ? UNP P25440 ? ? 'expression tag' 63 17 
1 4A9N SER A 18 ? UNP P25440 ? ? 'expression tag' 64 18 
1 4A9N HIS A 19 ? UNP P25440 ? ? 'expression tag' 65 19 
1 4A9N MET A 20 ? UNP P25440 ? ? 'expression tag' 66 20 
2 4A9N GLY B 1  ? UNP P25440 ? ? 'expression tag' 47 21 
2 4A9N SER B 2  ? UNP P25440 ? ? 'expression tag' 48 22 
2 4A9N SER B 3  ? UNP P25440 ? ? 'expression tag' 49 23 
2 4A9N HIS B 4  ? UNP P25440 ? ? 'expression tag' 50 24 
2 4A9N HIS B 5  ? UNP P25440 ? ? 'expression tag' 51 25 
2 4A9N HIS B 6  ? UNP P25440 ? ? 'expression tag' 52 26 
2 4A9N HIS B 7  ? UNP P25440 ? ? 'expression tag' 53 27 
2 4A9N HIS B 8  ? UNP P25440 ? ? 'expression tag' 54 28 
2 4A9N HIS B 9  ? UNP P25440 ? ? 'expression tag' 55 29 
2 4A9N SER B 10 ? UNP P25440 ? ? 'expression tag' 56 30 
2 4A9N SER B 11 ? UNP P25440 ? ? 'expression tag' 57 31 
2 4A9N GLY B 12 ? UNP P25440 ? ? 'expression tag' 58 32 
2 4A9N LEU B 13 ? UNP P25440 ? ? 'expression tag' 59 33 
2 4A9N VAL B 14 ? UNP P25440 ? ? 'expression tag' 60 34 
2 4A9N PRO B 15 ? UNP P25440 ? ? 'expression tag' 61 35 
2 4A9N ARG B 16 ? UNP P25440 ? ? 'expression tag' 62 36 
2 4A9N GLY B 17 ? UNP P25440 ? ? 'expression tag' 63 37 
2 4A9N SER B 18 ? UNP P25440 ? ? 'expression tag' 64 38 
2 4A9N HIS B 19 ? UNP P25440 ? ? 'expression tag' 65 39 
2 4A9N MET B 20 ? UNP P25440 ? ? 'expression tag' 66 40 
3 4A9N GLY C 1  ? UNP P25440 ? ? 'expression tag' 47 41 
3 4A9N SER C 2  ? UNP P25440 ? ? 'expression tag' 48 42 
3 4A9N SER C 3  ? UNP P25440 ? ? 'expression tag' 49 43 
3 4A9N HIS C 4  ? UNP P25440 ? ? 'expression tag' 50 44 
3 4A9N HIS C 5  ? UNP P25440 ? ? 'expression tag' 51 45 
3 4A9N HIS C 6  ? UNP P25440 ? ? 'expression tag' 52 46 
3 4A9N HIS C 7  ? UNP P25440 ? ? 'expression tag' 53 47 
3 4A9N HIS C 8  ? UNP P25440 ? ? 'expression tag' 54 48 
3 4A9N HIS C 9  ? UNP P25440 ? ? 'expression tag' 55 49 
3 4A9N SER C 10 ? UNP P25440 ? ? 'expression tag' 56 50 
3 4A9N SER C 11 ? UNP P25440 ? ? 'expression tag' 57 51 
3 4A9N GLY C 12 ? UNP P25440 ? ? 'expression tag' 58 52 
3 4A9N LEU C 13 ? UNP P25440 ? ? 'expression tag' 59 53 
3 4A9N VAL C 14 ? UNP P25440 ? ? 'expression tag' 60 54 
3 4A9N PRO C 15 ? UNP P25440 ? ? 'expression tag' 61 55 
3 4A9N ARG C 16 ? UNP P25440 ? ? 'expression tag' 62 56 
3 4A9N GLY C 17 ? UNP P25440 ? ? 'expression tag' 63 57 
3 4A9N SER C 18 ? UNP P25440 ? ? 'expression tag' 64 58 
3 4A9N HIS C 19 ? UNP P25440 ? ? 'expression tag' 65 59 
3 4A9N MET C 20 ? UNP P25440 ? ? 'expression tag' 66 60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A9N non-polymer         . 'N-CYCLOPROP-2-EN-1-YL-5-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-2-METHYL-BENZENESULFONAMIDE' ?                 
'C15 H16 N2 O3 S' 304.364 
ALA 'L-peptide linking' y ALANINE                                                                              ?                 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                             ?                 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                           ?                 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                      ?                 
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                             ?                 
'C3 H7 N O2 S'    121.158 
DMS non-polymer         . 'DIMETHYL SULFOXIDE'                                                                 ?                 
'C2 H6 O S'       78.133  
EDO non-polymer         . 1,2-ETHANEDIOL                                                                       'ETHYLENE GLYCOL' 
'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                            ?                 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                      ?                 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                              ?                 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                            ?                 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                ?                 
'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                           ?                 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                              ?                 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                               ?                 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                           ?                 
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                        ?                 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                              ?                 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                               ?                 
'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                        ?                 
'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                                            ?                 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                           ?                 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                             ?                 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                               ?                 
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4A9N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.01 
_exptl_crystal.density_percent_sol   38.67 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES PH 7.0, 22-28% PEG 3350, 0.2 M (NH4)2SO4, 20 DEGREES CELSIUS.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-02-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    1.072 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.072 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_wavelength             1.072 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4A9N 
_reflns.observed_criterion_sigma_I   . 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             67.88 
_reflns.d_resolution_high            1.86 
_reflns.number_obs                   35351 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.86 
_reflns_shell.d_res_low              1.89 
_reflns_shell.percent_possible_all   86.0 
_reflns_shell.Rmerge_I_obs           0.38 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.10 
_reflns_shell.pdbx_redundancy        2.9 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4A9N 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     33945 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             67.88 
_refine.ls_d_res_high                            1.85 
_refine.ls_percent_reflns_obs                    97.48 
_refine.ls_R_factor_obs                          0.17470 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17383 
_refine.ls_R_factor_R_free                       0.19507 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.0 
_refine.ls_number_reflns_R_free                  1405 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.963 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.B_iso_mean                               39.975 
_refine.aniso_B[1][1]                            2.23 
_refine.aniso_B[2][2]                            -1.60 
_refine.aniso_B[3][3]                            -0.93 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.78 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.128 
_refine.pdbx_overall_ESU_R_Free                  0.113 
_refine.overall_SU_ML                            0.082 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.090 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2774 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         90 
_refine_hist.number_atoms_solvent             281 
_refine_hist.number_atoms_total               3145 
_refine_hist.d_res_high                       1.85 
_refine_hist.d_res_low                        67.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 2989 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2038 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.904  1.957  ? 4049 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.768  3.000  ? 4981 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.103  5.000  ? 342  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.949 24.965 ? 141  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       11.067 15.000 ? 534  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.174 15.000 ? 10   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.050  0.200  ? 416  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 3257 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 586  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.631  2.000  ? 1711 'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.091  2.000  ? 666  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.222  4.000  ? 2790 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.457  4.000  ? 1278 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.403  6.000  ? 1253 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.855 
_refine_ls_shell.d_res_low                        1.903 
_refine_ls_shell.number_reflns_R_work             2137 
_refine_ls_shell.R_factor_R_work                  0.304 
_refine_ls_shell.percent_reflns_obs               83.64 
_refine_ls_shell.R_factor_R_free                  0.345 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             97 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4A9N 
_struct.title                     
'N-TERMINAL BROMODOMAIN OF HUMAN BRD2 WITH N-cyclopropyl-5-(3,5- dimethyl-1,2-oxazol-4-yl)-2-methylbenzene-1-sulfonamide' 
_struct.pdbx_descriptor           'BROMODOMAIN CONTAINING 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4A9N 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/INHIBITOR' 
_struct_keywords.text            'SIGNALING PROTEIN-INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 2 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
O N N 2 ? 
P N N 4 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 30  ? VAL A 39  ? THR A 76  VAL A 85  1 ? 10 
HELX_P HELX_P2  2  VAL A 39  ? LYS A 46  ? VAL A 85  LYS A 92  1 ? 8  
HELX_P HELX_P3  3  ALA A 50  ? ARG A 54  ? ALA A 96  ARG A 100 5 ? 5  
HELX_P HELX_P4  4  ASP A 58  ? GLY A 63  ? ASP A 104 GLY A 109 1 ? 6  
HELX_P HELX_P5  5  ASP A 66  ? ILE A 71  ? ASP A 112 ILE A 117 1 ? 6  
HELX_P HELX_P6  6  ASP A 76  ? ASN A 86  ? ASP A 122 ASN A 132 1 ? 11 
HELX_P HELX_P7  7  ALA A 91  ? ASN A 110 ? ALA A 137 ASN A 156 1 ? 20 
HELX_P HELX_P8  8  ASP A 114 ? ALA A 132 ? ASP A 160 ALA A 178 1 ? 19 
HELX_P HELX_P9  9  THR B 30  ? VAL B 39  ? THR B 76  VAL B 85  1 ? 10 
HELX_P HELX_P10 10 VAL B 39  ? LYS B 46  ? VAL B 85  LYS B 92  1 ? 8  
HELX_P HELX_P11 11 ALA B 50  ? ARG B 54  ? ALA B 96  ARG B 100 5 ? 5  
HELX_P HELX_P12 12 ASP B 58  ? GLY B 63  ? ASP B 104 GLY B 109 1 ? 6  
HELX_P HELX_P13 13 ASP B 66  ? ILE B 71  ? ASP B 112 ILE B 117 1 ? 6  
HELX_P HELX_P14 14 ASP B 76  ? ASN B 86  ? ASP B 122 ASN B 132 1 ? 11 
HELX_P HELX_P15 15 ALA B 91  ? ASN B 110 ? ALA B 137 ASN B 156 1 ? 20 
HELX_P HELX_P16 16 ASP B 114 ? ALA B 132 ? ASP B 160 ALA B 178 1 ? 19 
HELX_P HELX_P17 17 ASN C 31  ? VAL C 39  ? ASN C 77  VAL C 85  1 ? 9  
HELX_P HELX_P18 18 VAL C 39  ? LYS C 46  ? VAL C 85  LYS C 92  1 ? 8  
HELX_P HELX_P19 19 ALA C 50  ? ARG C 54  ? ALA C 96  ARG C 100 5 ? 5  
HELX_P HELX_P20 20 ASP C 66  ? ILE C 71  ? ASP C 112 ILE C 117 1 ? 6  
HELX_P HELX_P21 21 ASP C 76  ? ASN C 86  ? ASP C 122 ASN C 132 1 ? 11 
HELX_P HELX_P22 22 ALA C 91  ? ASN C 110 ? ALA C 137 ASN C 156 1 ? 20 
HELX_P HELX_P23 23 ASP C 114 ? SER C 133 ? ASP C 160 SER C 179 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO A 1187' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 1188' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO A 1189' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE A9N A 1190' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 1191' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 1192' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO B 1187' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO B 1188' 
AC9 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE A9N B 1189' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 1190' 
BC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE DMS C 1183' 
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO C 1184' 
BC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 C 1185' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  HIS A 68  ? HIS A 114  . ? 1_555 ? 
2  AC1 7  LYS A 72  ? LYS A 118  . ? 1_555 ? 
3  AC1 7  HOH Q .   ? HOH A 2054 . ? 1_555 ? 
4  AC1 7  GLN B 73  ? GLN B 119  . ? 4_545 ? 
5  AC1 7  ARG B 83  ? ARG B 129  . ? 4_545 ? 
6  AC1 7  ASP B 98  ? ASP B 144  . ? 4_545 ? 
7  AC1 7  HOH R .   ? HOH B 2052 . ? 4_545 ? 
8  AC2 5  ILE A 70  ? ILE A 116  . ? 1_555 ? 
9  AC2 5  ILE A 71  ? ILE A 117  . ? 1_555 ? 
10 AC2 5  LYS A 72  ? LYS A 118  . ? 1_555 ? 
11 AC2 5  GLN A 73  ? GLN A 119  . ? 1_555 ? 
12 AC2 5  ASN A 105 ? ASN A 151  . ? 1_555 ? 
13 AC3 3  GLN A 97  ? GLN A 143  . ? 1_555 ? 
14 AC3 3  HOH Q .   ? HOH A 2082 . ? 1_555 ? 
15 AC3 3  LYS B 72  ? LYS B 118  . ? 4_545 ? 
16 AC4 10 TRP A 51  ? TRP A 97   . ? 1_555 ? 
17 AC4 10 PRO A 52  ? PRO A 98   . ? 1_555 ? 
18 AC4 10 PHE A 53  ? PHE A 99   . ? 1_555 ? 
19 AC4 10 LEU A 62  ? LEU A 108  . ? 1_555 ? 
20 AC4 10 LEU A 64  ? LEU A 110  . ? 1_555 ? 
21 AC4 10 ASN A 110 ? ASN A 156  . ? 1_555 ? 
22 AC4 10 HOH Q .   ? HOH A 2051 . ? 1_555 ? 
23 AC4 10 HOH Q .   ? HOH A 2094 . ? 1_555 ? 
24 AC4 10 HOH Q .   ? HOH A 2121 . ? 1_555 ? 
25 AC4 10 GLN B 48  ? GLN B 94   . ? 4_555 ? 
26 AC5 4  ARG A 54  ? ARG A 100  . ? 1_555 ? 
27 AC5 4  HOH Q .   ? HOH A 2011 . ? 1_555 ? 
28 AC5 4  HOH Q .   ? HOH A 2013 . ? 1_555 ? 
29 AC5 4  HOH Q .   ? HOH A 2015 . ? 1_555 ? 
30 AC6 3  THR A 79  ? THR A 125  . ? 1_555 ? 
31 AC6 3  ARG A 82  ? ARG A 128  . ? 1_555 ? 
32 AC6 3  ARG A 83  ? ARG A 129  . ? 1_555 ? 
33 AC7 5  GLN A 48  ? GLN A 94   . ? 4_545 ? 
34 AC7 5  TRP A 51  ? TRP A 97   . ? 4_545 ? 
35 AC7 5  MET A 119 ? MET A 165  . ? 4_545 ? 
36 AC7 5  GLN B 48  ? GLN B 94   . ? 1_555 ? 
37 AC7 5  TRP B 51  ? TRP B 97   . ? 1_555 ? 
38 AC8 3  LYS A 125 ? LYS A 171  . ? 1_555 ? 
39 AC8 3  GLN B 97  ? GLN B 143  . ? 1_555 ? 
40 AC8 3  ASN B 100 ? ASN B 146  . ? 1_555 ? 
41 AC9 9  GLN A 48  ? GLN A 94   . ? 4_545 ? 
42 AC9 9  TRP B 51  ? TRP B 97   . ? 1_555 ? 
43 AC9 9  PRO B 52  ? PRO B 98   . ? 1_555 ? 
44 AC9 9  PHE B 53  ? PHE B 99   . ? 1_555 ? 
45 AC9 9  LEU B 62  ? LEU B 108  . ? 1_555 ? 
46 AC9 9  ASN B 110 ? ASN B 156  . ? 1_555 ? 
47 AC9 9  HOH R .   ? HOH B 2028 . ? 1_555 ? 
48 AC9 9  HOH R .   ? HOH B 2076 . ? 1_555 ? 
49 AC9 9  HOH R .   ? HOH B 2088 . ? 1_555 ? 
50 BC1 3  THR B 79  ? THR B 125  . ? 1_555 ? 
51 BC1 3  ARG B 82  ? ARG B 128  . ? 1_555 ? 
52 BC1 3  ARG B 83  ? ARG B 129  . ? 1_555 ? 
53 BC2 2  ASN C 110 ? ASN C 156  . ? 1_555 ? 
54 BC2 2  HOH S .   ? HOH C 2026 . ? 1_555 ? 
55 BC3 3  ARG C 83  ? ARG C 129  . ? 1_555 ? 
56 BC3 3  ASP C 98  ? ASP C 144  . ? 1_555 ? 
57 BC3 3  HOH S .   ? HOH C 2039 . ? 1_555 ? 
58 BC4 7  ARG B 54  ? ARG B 100  . ? 3_455 ? 
59 BC4 7  ARG C 82  ? ARG C 128  . ? 1_555 ? 
60 BC4 7  ASN C 86  ? ASN C 132  . ? 1_555 ? 
61 BC4 7  TYR C 88  ? TYR C 134  . ? 1_555 ? 
62 BC4 7  HOH S .   ? HOH C 2037 . ? 1_555 ? 
63 BC4 7  HOH S .   ? HOH C 2067 . ? 1_555 ? 
64 BC4 7  HOH S .   ? HOH C 2068 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4A9N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4A9N 
_atom_sites.fract_transf_matrix[1][1]   0.008774 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000761 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014734 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 29  ? 5.267   -3.237  14.820  1.00 63.68  ? 75   VAL A N   1 
ATOM   2    C CA  . VAL A 1 29  ? 5.307   -1.780  15.133  1.00 62.55  ? 75   VAL A CA  1 
ATOM   3    C C   . VAL A 1 29  ? 6.099   -1.534  16.415  1.00 62.13  ? 75   VAL A C   1 
ATOM   4    O O   . VAL A 1 29  ? 5.841   -2.175  17.436  1.00 64.45  ? 75   VAL A O   1 
ATOM   5    C CB  . VAL A 1 29  ? 3.882   -1.205  15.319  1.00 64.73  ? 75   VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 29  ? 3.942   0.287   15.628  1.00 64.15  ? 75   VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 29  ? 3.031   -1.461  14.082  1.00 65.27  ? 75   VAL A CG2 1 
ATOM   8    N N   . THR A 1 30  ? 7.058   -0.610  16.352  1.00 58.88  ? 76   THR A N   1 
ATOM   9    C CA  . THR A 1 30  ? 7.809   -0.166  17.529  1.00 58.28  ? 76   THR A CA  1 
ATOM   10   C C   . THR A 1 30  ? 7.770   1.359   17.642  1.00 56.69  ? 76   THR A C   1 
ATOM   11   O O   . THR A 1 30  ? 7.358   2.053   16.709  1.00 55.66  ? 76   THR A O   1 
ATOM   12   C CB  . THR A 1 30  ? 9.290   -0.610  17.482  1.00 56.93  ? 76   THR A CB  1 
ATOM   13   O OG1 . THR A 1 30  ? 10.006  0.181   16.521  1.00 53.89  ? 76   THR A OG1 1 
ATOM   14   C CG2 . THR A 1 30  ? 9.415   -2.090  17.127  1.00 57.63  ? 76   THR A CG2 1 
ATOM   15   N N   . ASN A 1 31  ? 8.211   1.866   18.789  1.00 56.33  ? 77   ASN A N   1 
ATOM   16   C CA  . ASN A 1 31  ? 8.269   3.313   19.046  1.00 54.82  ? 77   ASN A CA  1 
ATOM   17   C C   . ASN A 1 31  ? 9.265   4.043   18.140  1.00 50.91  ? 77   ASN A C   1 
ATOM   18   O O   . ASN A 1 31  ? 8.993   5.154   17.671  1.00 49.91  ? 77   ASN A O   1 
ATOM   19   C CB  . ASN A 1 31  ? 8.615   3.582   20.518  1.00 56.72  ? 77   ASN A CB  1 
ATOM   20   C CG  . ASN A 1 31  ? 9.924   2.920   20.952  1.00 57.04  ? 77   ASN A CG  1 
ATOM   21   O OD1 . ASN A 1 31  ? 10.324  1.881   20.415  1.00 56.29  ? 77   ASN A OD1 1 
ATOM   22   N ND2 . ASN A 1 31  ? 10.592  3.521   21.930  1.00 59.02  ? 77   ASN A ND2 1 
ATOM   23   N N   . GLN A 1 32  ? 10.413  3.414   17.904  1.00 48.03  ? 78   GLN A N   1 
ATOM   24   C CA  . GLN A 1 32  ? 11.442  3.973   17.024  1.00 45.05  ? 78   GLN A CA  1 
ATOM   25   C C   . GLN A 1 32  ? 10.960  4.013   15.578  1.00 42.10  ? 78   GLN A C   1 
ATOM   26   O O   . GLN A 1 32  ? 11.142  5.013   14.887  1.00 40.84  ? 78   GLN A O   1 
ATOM   27   C CB  . GLN A 1 32  ? 12.730  3.153   17.118  1.00 44.54  ? 78   GLN A CB  1 
ATOM   28   C CG  . GLN A 1 32  ? 13.429  3.215   18.473  1.00 47.11  ? 78   GLN A CG  1 
ATOM   29   C CD  . GLN A 1 32  ? 14.762  2.474   18.473  1.00 48.78  ? 78   GLN A CD  1 
ATOM   30   O OE1 . GLN A 1 32  ? 14.891  1.413   17.864  1.00 50.03  ? 78   GLN A OE1 1 
ATOM   31   N NE2 . GLN A 1 32  ? 15.757  3.031   19.157  1.00 48.86  ? 78   GLN A NE2 1 
ATOM   32   N N   . LEU A 1 33  ? 10.349  2.921   15.129  1.00 41.72  ? 79   LEU A N   1 
ATOM   33   C CA  . LEU A 1 33  ? 9.780   2.838   13.783  1.00 40.51  ? 79   LEU A CA  1 
ATOM   34   C C   . LEU A 1 33  ? 8.696   3.890   13.554  1.00 41.20  ? 79   LEU A C   1 
ATOM   35   O O   . LEU A 1 33  ? 8.620   4.491   12.477  1.00 38.85  ? 79   LEU A O   1 
ATOM   36   C CB  . LEU A 1 33  ? 9.224   1.433   13.519  1.00 41.62  ? 79   LEU A CB  1 
ATOM   37   C CG  . LEU A 1 33  ? 10.298  0.380   13.238  1.00 41.08  ? 79   LEU A CG  1 
ATOM   38   C CD1 . LEU A 1 33  ? 9.748   -1.037  13.330  1.00 42.93  ? 79   LEU A CD1 1 
ATOM   39   C CD2 . LEU A 1 33  ? 10.917  0.627   11.867  1.00 38.76  ? 79   LEU A CD2 1 
ATOM   40   N N   . GLN A 1 34  ? 7.860   4.104   14.569  1.00 43.07  ? 80   GLN A N   1 
ATOM   41   C CA  . GLN A 1 34  ? 6.873   5.177   14.532  1.00 44.74  ? 80   GLN A CA  1 
ATOM   42   C C   . GLN A 1 34  ? 7.531   6.536   14.352  1.00 42.40  ? 80   GLN A C   1 
ATOM   43   O O   . GLN A 1 34  ? 7.064   7.354   13.561  1.00 42.60  ? 80   GLN A O   1 
ATOM   44   C CB  . GLN A 1 34  ? 6.022   5.182   15.806  1.00 48.16  ? 80   GLN A CB  1 
ATOM   45   C CG  . GLN A 1 34  ? 4.866   4.221   15.749  1.00 53.50  ? 80   GLN A CG  1 
ATOM   46   C CD  . GLN A 1 34  ? 3.832   4.648   14.726  1.00 57.11  ? 80   GLN A CD  1 
ATOM   47   O OE1 . GLN A 1 34  ? 3.085   5.606   14.943  1.00 59.57  ? 80   GLN A OE1 1 
ATOM   48   N NE2 . GLN A 1 34  ? 3.791   3.945   13.597  1.00 57.85  ? 80   GLN A NE2 1 
ATOM   49   N N   . TYR A 1 35  ? 8.610   6.769   15.093  1.00 41.02  ? 81   TYR A N   1 
ATOM   50   C CA  . TYR A 1 35  ? 9.369   8.003   14.974  1.00 39.39  ? 81   TYR A CA  1 
ATOM   51   C C   . TYR A 1 35  ? 9.935   8.132   13.560  1.00 37.87  ? 81   TYR A C   1 
ATOM   52   O O   . TYR A 1 35  ? 9.835   9.190   12.940  1.00 36.75  ? 81   TYR A O   1 
ATOM   53   C CB  . TYR A 1 35  ? 10.499  8.034   16.004  1.00 39.21  ? 81   TYR A CB  1 
ATOM   54   C CG  . TYR A 1 35  ? 11.342  9.288   15.964  1.00 37.39  ? 81   TYR A CG  1 
ATOM   55   C CD1 . TYR A 1 35  ? 10.939  10.438  16.623  1.00 39.24  ? 81   TYR A CD1 1 
ATOM   56   C CD2 . TYR A 1 35  ? 12.547  9.322   15.267  1.00 35.65  ? 81   TYR A CD2 1 
ATOM   57   C CE1 . TYR A 1 35  ? 11.708  11.594  16.599  1.00 38.47  ? 81   TYR A CE1 1 
ATOM   58   C CE2 . TYR A 1 35  ? 13.324  10.472  15.235  1.00 34.73  ? 81   TYR A CE2 1 
ATOM   59   C CZ  . TYR A 1 35  ? 12.901  11.604  15.901  1.00 37.34  ? 81   TYR A CZ  1 
ATOM   60   O OH  . TYR A 1 35  ? 13.658  12.752  15.877  1.00 37.51  ? 81   TYR A OH  1 
ATOM   61   N N   . LEU A 1 36  ? 10.513  7.050   13.048  1.00 37.90  ? 82   LEU A N   1 
ATOM   62   C CA  . LEU A 1 36  ? 11.090  7.064   11.703  1.00 36.76  ? 82   LEU A CA  1 
ATOM   63   C C   . LEU A 1 36  ? 10.025  7.366   10.644  1.00 37.65  ? 82   LEU A C   1 
ATOM   64   O O   . LEU A 1 36  ? 10.306  8.036   9.652   1.00 36.64  ? 82   LEU A O   1 
ATOM   65   C CB  . LEU A 1 36  ? 11.805  5.744   11.400  1.00 36.44  ? 82   LEU A CB  1 
ATOM   66   C CG  . LEU A 1 36  ? 13.102  5.511   12.187  1.00 35.98  ? 82   LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 36  ? 13.595  4.081   12.014  1.00 36.05  ? 82   LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 36  ? 14.182  6.505   11.784  1.00 35.68  ? 82   LEU A CD2 1 
ATOM   69   N N   . HIS A 1 37  ? 8.801   6.897   10.873  1.00 39.80  ? 83   HIS A N   1 
ATOM   70   C CA  . HIS A 1 37  ? 7.699   7.139   9.947   1.00 41.09  ? 83   HIS A CA  1 
ATOM   71   C C   . HIS A 1 37  ? 7.136   8.555   10.091  1.00 40.76  ? 83   HIS A C   1 
ATOM   72   O O   . HIS A 1 37  ? 7.064   9.295   9.112   1.00 39.57  ? 83   HIS A O   1 
ATOM   73   C CB  . HIS A 1 37  ? 6.576   6.122   10.164  1.00 43.60  ? 83   HIS A CB  1 
ATOM   74   C CG  . HIS A 1 37  ? 5.601   6.040   9.030   1.00 46.69  ? 83   HIS A CG  1 
ATOM   75   N ND1 . HIS A 1 37  ? 4.585   5.109   8.991   1.00 49.89  ? 83   HIS A ND1 1 
ATOM   76   C CD2 . HIS A 1 37  ? 5.498   6.756   7.883   1.00 47.32  ? 83   HIS A CD2 1 
ATOM   77   C CE1 . HIS A 1 37  ? 3.889   5.266   7.880   1.00 51.51  ? 83   HIS A CE1 1 
ATOM   78   N NE2 . HIS A 1 37  ? 4.424   6.257   7.188   1.00 49.42  ? 83   HIS A NE2 1 
ATOM   79   N N   . LYS A 1 38  ? 6.739   8.924   11.308  1.00 42.11  ? 84   LYS A N   1 
ATOM   80   C CA  . LYS A 1 38  ? 6.075   10.209  11.551  1.00 42.55  ? 84   LYS A CA  1 
ATOM   81   C C   . LYS A 1 38  ? 7.000   11.427  11.547  1.00 40.30  ? 84   LYS A C   1 
ATOM   82   O O   . LYS A 1 38  ? 6.545   12.532  11.264  1.00 40.53  ? 84   LYS A O   1 
ATOM   83   C CB  . LYS A 1 38  ? 5.302   10.184  12.878  1.00 45.34  ? 84   LYS A CB  1 
ATOM   84   C CG  . LYS A 1 38  ? 4.085   9.283   12.877  1.00 48.99  ? 84   LYS A CG  1 
ATOM   85   C CD  . LYS A 1 38  ? 3.079   9.725   13.938  1.00 53.81  ? 84   LYS A CD  1 
ATOM   86   C CE  . LYS A 1 38  ? 1.981   8.694   14.152  1.00 57.89  ? 84   LYS A CE  1 
ATOM   87   N NZ  . LYS A 1 38  ? 1.515   8.072   12.877  1.00 58.44  ? 84   LYS A NZ  1 
ATOM   88   N N   . VAL A 1 39  ? 8.279   11.239  11.869  1.00 38.89  ? 85   VAL A N   1 
ATOM   89   C CA  . VAL A 1 39  ? 9.217   12.365  11.972  1.00 37.24  ? 85   VAL A CA  1 
ATOM   90   C C   . VAL A 1 39  ? 10.246  12.384  10.833  1.00 35.50  ? 85   VAL A C   1 
ATOM   91   O O   . VAL A 1 39  ? 10.364  13.388  10.124  1.00 35.21  ? 85   VAL A O   1 
ATOM   92   C CB  . VAL A 1 39  ? 9.928   12.376  13.345  1.00 37.35  ? 85   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 39  ? 10.929  13.520  13.429  1.00 36.81  ? 85   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 39  ? 8.885   12.492  14.481  1.00 39.46  ? 85   VAL A CG2 1 
ATOM   95   N N   . VAL A 1 40  ? 10.978  11.287  10.659  1.00 33.81  ? 86   VAL A N   1 
ATOM   96   C CA  . VAL A 1 40  ? 12.065  11.240  9.661   1.00 32.51  ? 86   VAL A CA  1 
ATOM   97   C C   . VAL A 1 40  ? 11.516  11.176  8.239   1.00 32.66  ? 86   VAL A C   1 
ATOM   98   O O   . VAL A 1 40  ? 11.825  12.044  7.421   1.00 32.66  ? 86   VAL A O   1 
ATOM   99   C CB  . VAL A 1 40  ? 13.047  10.080  9.922   1.00 31.12  ? 86   VAL A CB  1 
ATOM   100  C CG1 . VAL A 1 40  ? 14.171  10.061  8.862   1.00 29.38  ? 86   VAL A CG1 1 
ATOM   101  C CG2 . VAL A 1 40  ? 13.635  10.201  11.324  1.00 32.12  ? 86   VAL A CG2 1 
ATOM   102  N N   . MET A 1 41  ? 10.692  10.173  7.941   1.00 33.48  ? 87   MET A N   1 
ATOM   103  C CA  . MET A 1 41  ? 10.136  10.048  6.594   1.00 34.08  ? 87   MET A CA  1 
ATOM   104  C C   . MET A 1 41  ? 9.255   11.244  6.227   1.00 35.71  ? 87   MET A C   1 
ATOM   105  O O   . MET A 1 41  ? 9.305   11.725  5.102   1.00 35.48  ? 87   MET A O   1 
ATOM   106  C CB  . MET A 1 41  ? 9.352   8.750   6.410   1.00 35.22  ? 87   MET A CB  1 
ATOM   107  C CG  . MET A 1 41  ? 8.758   8.597   5.005   1.00 37.00  ? 87   MET A CG  1 
ATOM   108  S SD  . MET A 1 41  ? 10.033  8.641   3.719   1.00 38.75  ? 87   MET A SD  1 
ATOM   109  C CE  . MET A 1 41  ? 10.675  6.994   3.961   1.00 38.96  ? 87   MET A CE  1 
ATOM   110  N N   . LYS A 1 42  ? 8.450   11.718  7.171   1.00 37.99  ? 88   LYS A N   1 
ATOM   111  C CA  . LYS A 1 42  ? 7.603   12.880  6.918   1.00 40.04  ? 88   LYS A CA  1 
ATOM   112  C C   . LYS A 1 42  ? 8.443   14.078  6.484   1.00 38.60  ? 88   LYS A C   1 
ATOM   113  O O   . LYS A 1 42  ? 8.097   14.762  5.520   1.00 39.47  ? 88   LYS A O   1 
ATOM   114  C CB  . LYS A 1 42  ? 6.778   13.243  8.156   1.00 42.30  ? 88   LYS A CB  1 
ATOM   115  C CG  . LYS A 1 42  ? 5.799   14.395  7.923   1.00 46.78  ? 88   LYS A CG  1 
ATOM   116  C CD  . LYS A 1 42  ? 5.237   14.964  9.224   1.00 51.65  ? 88   LYS A CD  1 
ATOM   117  C CE  . LYS A 1 42  ? 6.300   15.677  10.071  1.00 53.44  ? 88   LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 42  ? 7.130   16.664  9.303   1.00 54.78  ? 88   LYS A NZ  1 
ATOM   119  N N   . ALA A 1 43  ? 9.538   14.323  7.202   1.00 37.06  ? 89   ALA A N   1 
ATOM   120  C CA  . ALA A 1 43  ? 10.430  15.443  6.908   1.00 36.23  ? 89   ALA A CA  1 
ATOM   121  C C   . ALA A 1 43  ? 11.125  15.288  5.550   1.00 34.79  ? 89   ALA A C   1 
ATOM   122  O O   . ALA A 1 43  ? 11.200  16.241  4.778   1.00 35.31  ? 89   ALA A O   1 
ATOM   123  C CB  . ALA A 1 43  ? 11.467  15.598  8.015   1.00 35.67  ? 89   ALA A CB  1 
ATOM   124  N N   . LEU A 1 44  ? 11.619  14.089  5.261   1.00 33.36  ? 90   LEU A N   1 
ATOM   125  C CA  . LEU A 1 44  ? 12.366  13.843  4.021   1.00 32.39  ? 90   LEU A CA  1 
ATOM   126  C C   . LEU A 1 44  ? 11.484  13.771  2.774   1.00 31.99  ? 90   LEU A C   1 
ATOM   127  O O   . LEU A 1 44  ? 11.867  14.273  1.713   1.00 31.04  ? 90   LEU A O   1 
ATOM   128  C CB  . LEU A 1 44  ? 13.193  12.564  4.140   1.00 32.25  ? 90   LEU A CB  1 
ATOM   129  C CG  . LEU A 1 44  ? 14.289  12.541  5.212   1.00 34.11  ? 90   LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 44  ? 15.188  11.329  5.019   1.00 35.14  ? 90   LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 44  ? 15.106  13.812  5.205   1.00 34.56  ? 90   LEU A CD2 1 
ATOM   132  N N   . TRP A 1 45  ? 10.322  13.135  2.900   1.00 32.20  ? 91   TRP A N   1 
ATOM   133  C CA  . TRP A 1 45  ? 9.410   12.923  1.770   1.00 32.43  ? 91   TRP A CA  1 
ATOM   134  C C   . TRP A 1 45  ? 8.928   14.227  1.129   1.00 33.13  ? 91   TRP A C   1 
ATOM   135  O O   . TRP A 1 45  ? 8.829   14.319  -0.095  1.00 33.03  ? 91   TRP A O   1 
ATOM   136  C CB  . TRP A 1 45  ? 8.197   12.111  2.220   1.00 33.77  ? 91   TRP A CB  1 
ATOM   137  C CG  . TRP A 1 45  ? 7.288   11.725  1.105   1.00 35.22  ? 91   TRP A CG  1 
ATOM   138  C CD1 . TRP A 1 45  ? 6.067   12.264  0.811   1.00 36.98  ? 91   TRP A CD1 1 
ATOM   139  C CD2 . TRP A 1 45  ? 7.521   10.701  0.136   1.00 35.72  ? 91   TRP A CD2 1 
ATOM   140  N NE1 . TRP A 1 45  ? 5.527   11.639  -0.285  1.00 37.72  ? 91   TRP A NE1 1 
ATOM   141  C CE2 . TRP A 1 45  ? 6.403   10.678  -0.724  1.00 37.42  ? 91   TRP A CE2 1 
ATOM   142  C CE3 . TRP A 1 45  ? 8.571   9.805   -0.095  1.00 35.22  ? 91   TRP A CE3 1 
ATOM   143  C CZ2 . TRP A 1 45  ? 6.301   9.788   -1.794  1.00 38.22  ? 91   TRP A CZ2 1 
ATOM   144  C CZ3 . TRP A 1 45  ? 8.471   8.922   -1.159  1.00 36.06  ? 91   TRP A CZ3 1 
ATOM   145  C CH2 . TRP A 1 45  ? 7.337   8.917   -1.993  1.00 36.71  ? 91   TRP A CH2 1 
ATOM   146  N N   . LYS A 1 46  ? 8.623   15.219  1.963   1.00 33.91  ? 92   LYS A N   1 
ATOM   147  C CA  . LYS A 1 46  ? 8.101   16.507  1.496   1.00 35.49  ? 92   LYS A CA  1 
ATOM   148  C C   . LYS A 1 46  ? 9.185   17.532  1.138   1.00 34.07  ? 92   LYS A C   1 
ATOM   149  O O   . LYS A 1 46  ? 8.867   18.646  0.721   1.00 35.16  ? 92   LYS A O   1 
ATOM   150  C CB  . LYS A 1 46  ? 7.162   17.108  2.556   1.00 38.10  ? 92   LYS A CB  1 
ATOM   151  C CG  . LYS A 1 46  ? 7.866   17.656  3.797   1.00 40.65  ? 92   LYS A CG  1 
ATOM   152  C CD  . LYS A 1 46  ? 6.865   18.014  4.889   1.00 44.58  ? 92   LYS A CD  1 
ATOM   153  C CE  . LYS A 1 46  ? 7.549   18.686  6.072   1.00 46.18  ? 92   LYS A CE  1 
ATOM   154  N NZ  . LYS A 1 46  ? 6.583   19.003  7.168   1.00 50.51  ? 92   LYS A NZ  1 
ATOM   155  N N   . HIS A 1 47  ? 10.454  17.165  1.299   1.00 31.52  ? 93   HIS A N   1 
ATOM   156  C CA  . HIS A 1 47  ? 11.559  18.099  1.068   1.00 30.41  ? 93   HIS A CA  1 
ATOM   157  C C   . HIS A 1 47  ? 11.689  18.437  -0.420  1.00 29.28  ? 93   HIS A C   1 
ATOM   158  O O   . HIS A 1 47  ? 11.454  17.597  -1.285  1.00 28.75  ? 93   HIS A O   1 
ATOM   159  C CB  . HIS A 1 47  ? 12.868  17.510  1.603   1.00 29.67  ? 93   HIS A CB  1 
ATOM   160  C CG  . HIS A 1 47  ? 13.967  18.513  1.758   1.00 29.99  ? 93   HIS A CG  1 
ATOM   161  N ND1 . HIS A 1 47  ? 14.756  18.921  0.704   1.00 28.79  ? 93   HIS A ND1 1 
ATOM   162  C CD2 . HIS A 1 47  ? 14.411  19.190  2.844   1.00 30.56  ? 93   HIS A CD2 1 
ATOM   163  C CE1 . HIS A 1 47  ? 15.637  19.807  1.135   1.00 31.64  ? 93   HIS A CE1 1 
ATOM   164  N NE2 . HIS A 1 47  ? 15.443  19.994  2.429   1.00 30.30  ? 93   HIS A NE2 1 
ATOM   165  N N   . GLN A 1 48  ? 12.071  19.672  -0.714  1.00 29.25  ? 94   GLN A N   1 
ATOM   166  C CA  . GLN A 1 48  ? 12.178  20.121  -2.099  1.00 30.35  ? 94   GLN A CA  1 
ATOM   167  C C   . GLN A 1 48  ? 13.213  19.343  -2.922  1.00 28.35  ? 94   GLN A C   1 
ATOM   168  O O   . GLN A 1 48  ? 13.127  19.333  -4.143  1.00 29.58  ? 94   GLN A O   1 
ATOM   169  C CB  . GLN A 1 48  ? 12.483  21.622  -2.166  1.00 31.97  ? 94   GLN A CB  1 
ATOM   170  C CG  . GLN A 1 48  ? 13.823  22.013  -1.538  1.00 33.35  ? 94   GLN A CG  1 
ATOM   171  C CD  . GLN A 1 48  ? 14.309  23.376  -1.989  1.00 38.80  ? 94   GLN A CD  1 
ATOM   172  O OE1 . GLN A 1 48  ? 14.110  23.773  -3.141  1.00 41.62  ? 94   GLN A OE1 1 
ATOM   173  N NE2 . GLN A 1 48  ? 14.957  24.103  -1.078  1.00 39.16  ? 94   GLN A NE2 1 
ATOM   174  N N   . PHE A 1 49  ? 14.177  18.698  -2.261  1.00 26.97  ? 95   PHE A N   1 
ATOM   175  C CA  . PHE A 1 49  ? 15.212  17.906  -2.938  1.00 25.96  ? 95   PHE A CA  1 
ATOM   176  C C   . PHE A 1 49  ? 14.896  16.403  -2.962  1.00 25.55  ? 95   PHE A C   1 
ATOM   177  O O   . PHE A 1 49  ? 15.719  15.603  -3.409  1.00 24.20  ? 95   PHE A O   1 
ATOM   178  C CB  . PHE A 1 49  ? 16.580  18.084  -2.256  1.00 25.86  ? 95   PHE A CB  1 
ATOM   179  C CG  . PHE A 1 49  ? 17.172  19.470  -2.363  1.00 27.00  ? 95   PHE A CG  1 
ATOM   180  C CD1 . PHE A 1 49  ? 16.694  20.419  -3.264  1.00 29.23  ? 95   PHE A CD1 1 
ATOM   181  C CD2 . PHE A 1 49  ? 18.269  19.802  -1.572  1.00 27.77  ? 95   PHE A CD2 1 
ATOM   182  C CE1 . PHE A 1 49  ? 17.279  21.680  -3.341  1.00 30.51  ? 95   PHE A CE1 1 
ATOM   183  C CE2 . PHE A 1 49  ? 18.857  21.060  -1.651  1.00 29.21  ? 95   PHE A CE2 1 
ATOM   184  C CZ  . PHE A 1 49  ? 18.360  21.997  -2.531  1.00 30.26  ? 95   PHE A CZ  1 
ATOM   185  N N   . ALA A 1 50  ? 13.719  16.016  -2.473  1.00 25.91  ? 96   ALA A N   1 
ATOM   186  C CA  . ALA A 1 50  ? 13.376  14.601  -2.332  1.00 25.67  ? 96   ALA A CA  1 
ATOM   187  C C   . ALA A 1 50  ? 12.999  13.921  -3.635  1.00 26.26  ? 96   ALA A C   1 
ATOM   188  O O   . ALA A 1 50  ? 13.165  12.710  -3.754  1.00 25.89  ? 96   ALA A O   1 
ATOM   189  C CB  . ALA A 1 50  ? 12.248  14.428  -1.326  1.00 25.93  ? 96   ALA A CB  1 
ATOM   190  N N   . TRP A 1 51  ? 12.506  14.686  -4.609  1.00 27.65  ? 97   TRP A N   1 
ATOM   191  C CA  . TRP A 1 51  ? 11.884  14.098  -5.804  1.00 28.82  ? 97   TRP A CA  1 
ATOM   192  C C   . TRP A 1 51  ? 12.722  13.031  -6.547  1.00 28.14  ? 97   TRP A C   1 
ATOM   193  O O   . TRP A 1 51  ? 12.161  12.041  -7.017  1.00 29.04  ? 97   TRP A O   1 
ATOM   194  C CB  . TRP A 1 51  ? 11.363  15.186  -6.766  1.00 31.03  ? 97   TRP A CB  1 
ATOM   195  C CG  . TRP A 1 51  ? 12.417  16.062  -7.344  1.00 31.82  ? 97   TRP A CG  1 
ATOM   196  C CD1 . TRP A 1 51  ? 12.872  17.246  -6.831  1.00 32.46  ? 97   TRP A CD1 1 
ATOM   197  C CD2 . TRP A 1 51  ? 13.164  15.829  -8.543  1.00 31.92  ? 97   TRP A CD2 1 
ATOM   198  N NE1 . TRP A 1 51  ? 13.862  17.759  -7.636  1.00 32.58  ? 97   TRP A NE1 1 
ATOM   199  C CE2 . TRP A 1 51  ? 14.060  16.912  -8.694  1.00 33.15  ? 97   TRP A CE2 1 
ATOM   200  C CE3 . TRP A 1 51  ? 13.167  14.810  -9.503  1.00 34.08  ? 97   TRP A CE3 1 
ATOM   201  C CZ2 . TRP A 1 51  ? 14.945  17.009  -9.772  1.00 34.84  ? 97   TRP A CZ2 1 
ATOM   202  C CZ3 . TRP A 1 51  ? 14.050  14.905  -10.574 1.00 35.36  ? 97   TRP A CZ3 1 
ATOM   203  C CH2 . TRP A 1 51  ? 14.926  15.997  -10.698 1.00 36.46  ? 97   TRP A CH2 1 
ATOM   204  N N   . PRO A 1 52  ? 14.061  13.204  -6.638  1.00 27.14  ? 98   PRO A N   1 
ATOM   205  C CA  . PRO A 1 52  ? 14.853  12.153  -7.293  1.00 27.35  ? 98   PRO A CA  1 
ATOM   206  C C   . PRO A 1 52  ? 14.899  10.818  -6.531  1.00 26.94  ? 98   PRO A C   1 
ATOM   207  O O   . PRO A 1 52  ? 15.256  9.787   -7.118  1.00 26.73  ? 98   PRO A O   1 
ATOM   208  C CB  . PRO A 1 52  ? 16.266  12.755  -7.348  1.00 26.96  ? 98   PRO A CB  1 
ATOM   209  C CG  . PRO A 1 52  ? 16.090  14.230  -7.086  1.00 27.09  ? 98   PRO A CG  1 
ATOM   210  C CD  . PRO A 1 52  ? 14.932  14.280  -6.139  1.00 27.34  ? 98   PRO A CD  1 
ATOM   211  N N   . PHE A 1 53  ? 14.542  10.847  -5.249  1.00 26.57  ? 99   PHE A N   1 
ATOM   212  C CA  . PHE A 1 53  ? 14.654  9.685   -4.369  1.00 26.97  ? 99   PHE A CA  1 
ATOM   213  C C   . PHE A 1 53  ? 13.299  9.060   -4.015  1.00 27.92  ? 99   PHE A C   1 
ATOM   214  O O   . PHE A 1 53  ? 13.256  8.090   -3.271  1.00 27.46  ? 99   PHE A O   1 
ATOM   215  C CB  . PHE A 1 53  ? 15.361  10.086  -3.074  1.00 25.88  ? 99   PHE A CB  1 
ATOM   216  C CG  . PHE A 1 53  ? 16.683  10.747  -3.290  1.00 26.83  ? 99   PHE A CG  1 
ATOM   217  C CD1 . PHE A 1 53  ? 17.840  9.994   -3.398  1.00 28.49  ? 99   PHE A CD1 1 
ATOM   218  C CD2 . PHE A 1 53  ? 16.773  12.130  -3.389  1.00 26.08  ? 99   PHE A CD2 1 
ATOM   219  C CE1 . PHE A 1 53  ? 19.080  10.621  -3.604  1.00 27.14  ? 99   PHE A CE1 1 
ATOM   220  C CE2 . PHE A 1 53  ? 17.995  12.754  -3.602  1.00 27.27  ? 99   PHE A CE2 1 
ATOM   221  C CZ  . PHE A 1 53  ? 19.146  11.997  -3.701  1.00 25.75  ? 99   PHE A CZ  1 
ATOM   222  N N   . ARG A 1 54  ? 12.203  9.604   -4.542  1.00 29.77  ? 100  ARG A N   1 
ATOM   223  C CA  . ARG A 1 54  ? 10.862  9.134   -4.168  1.00 31.35  ? 100  ARG A CA  1 
ATOM   224  C C   . ARG A 1 54  ? 10.457  7.829   -4.859  1.00 31.82  ? 100  ARG A C   1 
ATOM   225  O O   . ARG A 1 54  ? 9.439   7.238   -4.510  1.00 32.79  ? 100  ARG A O   1 
ATOM   226  C CB  . ARG A 1 54  ? 9.805   10.205  -4.444  1.00 33.01  ? 100  ARG A CB  1 
ATOM   227  C CG  . ARG A 1 54  ? 9.866   11.390  -3.498  1.00 34.71  ? 100  ARG A CG  1 
ATOM   228  C CD  . ARG A 1 54  ? 8.593   12.205  -3.582  1.00 37.75  ? 100  ARG A CD  1 
ATOM   229  N NE  . ARG A 1 54  ? 8.688   13.444  -2.813  1.00 39.47  ? 100  ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 54  ? 8.537   14.678  -3.299  1.00 41.62  ? 100  ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 54  ? 8.260   14.893  -4.585  1.00 43.07  ? 100  ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 54  ? 8.652   15.718  -2.478  1.00 42.23  ? 100  ARG A NH2 1 
ATOM   233  N N   . GLN A 1 55  ? 11.243  7.399   -5.841  1.00 31.29  ? 101  GLN A N   1 
ATOM   234  C CA  . GLN A 1 55  ? 10.965  6.172   -6.585  1.00 32.80  ? 101  GLN A CA  1 
ATOM   235  C C   . GLN A 1 55  ? 12.290  5.534   -6.991  1.00 31.13  ? 101  GLN A C   1 
ATOM   236  O O   . GLN A 1 55  ? 13.313  6.221   -7.051  1.00 29.67  ? 101  GLN A O   1 
ATOM   237  C CB  . GLN A 1 55  ? 10.112  6.467   -7.828  1.00 34.98  ? 101  GLN A CB  1 
ATOM   238  C CG  . GLN A 1 55  ? 10.756  7.425   -8.831  1.00 38.08  ? 101  GLN A CG  1 
ATOM   239  C CD  . GLN A 1 55  ? 10.779  8.864   -8.334  1.00 40.93  ? 101  GLN A CD  1 
ATOM   240  O OE1 . GLN A 1 55  ? 9.733   9.434   -8.008  1.00 45.12  ? 101  GLN A OE1 1 
ATOM   241  N NE2 . GLN A 1 55  ? 11.974  9.453   -8.261  1.00 39.06  ? 101  GLN A NE2 1 
ATOM   242  N N   . PRO A 1 56  ? 12.277  4.222   -7.273  1.00 31.35  ? 102  PRO A N   1 
ATOM   243  C CA  . PRO A 1 56  ? 13.506  3.552   -7.681  1.00 31.20  ? 102  PRO A CA  1 
ATOM   244  C C   . PRO A 1 56  ? 14.191  4.258   -8.854  1.00 31.22  ? 102  PRO A C   1 
ATOM   245  O O   . PRO A 1 56  ? 13.520  4.818   -9.732  1.00 32.10  ? 102  PRO A O   1 
ATOM   246  C CB  . PRO A 1 56  ? 13.024  2.160   -8.097  1.00 32.20  ? 102  PRO A CB  1 
ATOM   247  C CG  . PRO A 1 56  ? 11.767  1.947   -7.330  1.00 33.61  ? 102  PRO A CG  1 
ATOM   248  C CD  . PRO A 1 56  ? 11.131  3.292   -7.208  1.00 32.78  ? 102  PRO A CD  1 
ATOM   249  N N   . VAL A 1 57  ? 15.515  4.242   -8.853  1.00 30.20  ? 103  VAL A N   1 
ATOM   250  C CA  . VAL A 1 57  ? 16.278  4.744   -9.988  1.00 30.36  ? 103  VAL A CA  1 
ATOM   251  C C   . VAL A 1 57  ? 15.844  3.960   -11.225 1.00 31.18  ? 103  VAL A C   1 
ATOM   252  O O   . VAL A 1 57  ? 15.896  2.732   -11.238 1.00 31.98  ? 103  VAL A O   1 
ATOM   253  C CB  . VAL A 1 57  ? 17.802  4.593   -9.775  1.00 29.22  ? 103  VAL A CB  1 
ATOM   254  C CG1 . VAL A 1 57  ? 18.569  5.035   -11.019 1.00 30.14  ? 103  VAL A CG1 1 
ATOM   255  C CG2 . VAL A 1 57  ? 18.255  5.386   -8.552  1.00 28.89  ? 103  VAL A CG2 1 
ATOM   256  N N   . ASP A 1 58  ? 15.380  4.675   -12.243 1.00 32.08  ? 104  ASP A N   1 
ATOM   257  C CA  . ASP A 1 58  ? 15.027  4.060   -13.519 1.00 33.94  ? 104  ASP A CA  1 
ATOM   258  C C   . ASP A 1 58  ? 16.203  4.251   -14.474 1.00 33.40  ? 104  ASP A C   1 
ATOM   259  O O   . ASP A 1 58  ? 16.343  5.310   -15.096 1.00 33.06  ? 104  ASP A O   1 
ATOM   260  C CB  . ASP A 1 58  ? 13.749  4.696   -14.082 1.00 35.48  ? 104  ASP A CB  1 
ATOM   261  C CG  . ASP A 1 58  ? 13.269  4.025   -15.364 1.00 37.82  ? 104  ASP A CG  1 
ATOM   262  O OD1 . ASP A 1 58  ? 14.072  3.349   -16.035 1.00 37.32  ? 104  ASP A OD1 1 
ATOM   263  O OD2 . ASP A 1 58  ? 12.081  4.191   -15.714 1.00 39.04  ? 104  ASP A OD2 1 
ATOM   264  N N   . ALA A 1 59  ? 17.037  3.217   -14.588 1.00 33.18  ? 105  ALA A N   1 
ATOM   265  C CA  . ALA A 1 59  ? 18.277  3.285   -15.374 1.00 33.51  ? 105  ALA A CA  1 
ATOM   266  C C   . ALA A 1 59  ? 18.042  3.487   -16.871 1.00 34.74  ? 105  ALA A C   1 
ATOM   267  O O   . ALA A 1 59  ? 18.863  4.098   -17.555 1.00 35.31  ? 105  ALA A O   1 
ATOM   268  C CB  . ALA A 1 59  ? 19.131  2.021   -15.140 1.00 33.33  ? 105  ALA A CB  1 
ATOM   269  N N   . VAL A 1 60  ? 16.929  2.968   -17.378 1.00 36.03  ? 106  VAL A N   1 
ATOM   270  C CA  . VAL A 1 60  ? 16.562  3.146   -18.783 1.00 37.53  ? 106  VAL A CA  1 
ATOM   271  C C   . VAL A 1 60  ? 16.212  4.613   -19.039 1.00 38.02  ? 106  VAL A C   1 
ATOM   272  O O   . VAL A 1 60  ? 16.755  5.251   -19.943 1.00 38.30  ? 106  VAL A O   1 
ATOM   273  C CB  . VAL A 1 60  ? 15.366  2.241   -19.167 1.00 38.85  ? 106  VAL A CB  1 
ATOM   274  C CG1 . VAL A 1 60  ? 14.954  2.465   -20.620 1.00 40.70  ? 106  VAL A CG1 1 
ATOM   275  C CG2 . VAL A 1 60  ? 15.708  0.774   -18.927 1.00 39.75  ? 106  VAL A CG2 1 
ATOM   276  N N   . LYS A 1 61  ? 15.309  5.140   -18.220 1.00 37.80  ? 107  LYS A N   1 
ATOM   277  C CA  . LYS A 1 61  ? 14.881  6.535   -18.305 1.00 38.68  ? 107  LYS A CA  1 
ATOM   278  C C   . LYS A 1 61  ? 16.054  7.514   -18.216 1.00 37.52  ? 107  LYS A C   1 
ATOM   279  O O   . LYS A 1 61  ? 16.136  8.464   -18.992 1.00 37.68  ? 107  LYS A O   1 
ATOM   280  C CB  . LYS A 1 61  ? 13.888  6.817   -17.181 1.00 39.04  ? 107  LYS A CB  1 
ATOM   281  C CG  . LYS A 1 61  ? 13.233  8.178   -17.222 1.00 41.17  ? 107  LYS A CG  1 
ATOM   282  C CD  . LYS A 1 61  ? 12.328  8.346   -16.025 1.00 43.15  ? 107  LYS A CD  1 
ATOM   283  C CE  . LYS A 1 61  ? 11.898  9.780   -15.870 1.00 45.94  ? 107  LYS A CE  1 
ATOM   284  N NZ  . LYS A 1 61  ? 11.019  9.959   -14.681 1.00 48.50  ? 107  LYS A NZ  1 
ATOM   285  N N   . LEU A 1 62  ? 16.959  7.273   -17.270 1.00 36.36  ? 108  LEU A N   1 
ATOM   286  C CA  . LEU A 1 62  ? 18.075  8.182   -17.015 1.00 36.37  ? 108  LEU A CA  1 
ATOM   287  C C   . LEU A 1 62  ? 19.285  7.919   -17.920 1.00 37.70  ? 108  LEU A C   1 
ATOM   288  O O   . LEU A 1 62  ? 20.257  8.678   -17.890 1.00 38.78  ? 108  LEU A O   1 
ATOM   289  C CB  . LEU A 1 62  ? 18.489  8.105   -15.541 1.00 35.16  ? 108  LEU A CB  1 
ATOM   290  C CG  . LEU A 1 62  ? 17.391  8.450   -14.523 1.00 35.83  ? 108  LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 62  ? 17.908  8.320   -13.099 1.00 36.11  ? 108  LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 62  ? 16.837  9.845   -14.757 1.00 37.45  ? 108  LEU A CD2 1 
ATOM   293  N N   . GLY A 1 63  ? 19.230  6.855   -18.719 1.00 37.98  ? 109  GLY A N   1 
ATOM   294  C CA  . GLY A 1 63  ? 20.329  6.512   -19.620 1.00 39.49  ? 109  GLY A CA  1 
ATOM   295  C C   . GLY A 1 63  ? 21.586  6.108   -18.871 1.00 38.68  ? 109  GLY A C   1 
ATOM   296  O O   . GLY A 1 63  ? 22.677  6.597   -19.163 1.00 38.90  ? 109  GLY A O   1 
ATOM   297  N N   . LEU A 1 64  ? 21.421  5.202   -17.911 1.00 37.78  ? 110  LEU A N   1 
ATOM   298  C CA  . LEU A 1 64  ? 22.498  4.779   -17.022 1.00 36.75  ? 110  LEU A CA  1 
ATOM   299  C C   . LEU A 1 64  ? 22.691  3.264   -17.140 1.00 37.01  ? 110  LEU A C   1 
ATOM   300  O O   . LEU A 1 64  ? 22.356  2.521   -16.221 1.00 36.31  ? 110  LEU A O   1 
ATOM   301  C CB  . LEU A 1 64  ? 22.148  5.160   -15.580 1.00 35.46  ? 110  LEU A CB  1 
ATOM   302  C CG  . LEU A 1 64  ? 21.815  6.631   -15.310 1.00 35.09  ? 110  LEU A CG  1 
ATOM   303  C CD1 . LEU A 1 64  ? 21.374  6.816   -13.868 1.00 34.30  ? 110  LEU A CD1 1 
ATOM   304  C CD2 . LEU A 1 64  ? 22.986  7.539   -15.628 1.00 36.51  ? 110  LEU A CD2 1 
ATOM   305  N N   . PRO A 1 65  ? 23.237  2.799   -18.276 1.00 38.73  ? 111  PRO A N   1 
ATOM   306  C CA  . PRO A 1 65  ? 23.314  1.360   -18.553 1.00 39.36  ? 111  PRO A CA  1 
ATOM   307  C C   . PRO A 1 65  ? 24.143  0.547   -17.547 1.00 38.09  ? 111  PRO A C   1 
ATOM   308  O O   . PRO A 1 65  ? 23.970  -0.671  -17.455 1.00 38.51  ? 111  PRO A O   1 
ATOM   309  C CB  . PRO A 1 65  ? 23.965  1.306   -19.942 1.00 41.12  ? 111  PRO A CB  1 
ATOM   310  C CG  . PRO A 1 65  ? 24.692  2.588   -20.078 1.00 41.65  ? 111  PRO A CG  1 
ATOM   311  C CD  . PRO A 1 65  ? 23.869  3.595   -19.346 1.00 40.05  ? 111  PRO A CD  1 
ATOM   312  N N   . ASP A 1 66  ? 25.033  1.209   -16.815 1.00 36.47  ? 112  ASP A N   1 
ATOM   313  C CA  . ASP A 1 66  ? 25.870  0.532   -15.829 1.00 35.52  ? 112  ASP A CA  1 
ATOM   314  C C   . ASP A 1 66  ? 25.328  0.619   -14.400 1.00 32.70  ? 112  ASP A C   1 
ATOM   315  O O   . ASP A 1 66  ? 25.944  0.082   -13.482 1.00 31.62  ? 112  ASP A O   1 
ATOM   316  C CB  . ASP A 1 66  ? 27.293  1.099   -15.865 1.00 36.84  ? 112  ASP A CB  1 
ATOM   317  C CG  . ASP A 1 66  ? 27.354  2.571   -15.485 1.00 37.96  ? 112  ASP A CG  1 
ATOM   318  O OD1 . ASP A 1 66  ? 26.295  3.246   -15.468 1.00 39.65  ? 112  ASP A OD1 1 
ATOM   319  O OD2 . ASP A 1 66  ? 28.473  3.054   -15.212 1.00 41.59  ? 112  ASP A OD2 1 
ATOM   320  N N   . TYR A 1 67  ? 24.192  1.288   -14.203 1.00 30.99  ? 113  TYR A N   1 
ATOM   321  C CA  . TYR A 1 67  ? 23.722  1.561   -12.845 1.00 28.95  ? 113  TYR A CA  1 
ATOM   322  C C   . TYR A 1 67  ? 23.628  0.290   -12.005 1.00 28.19  ? 113  TYR A C   1 
ATOM   323  O O   . TYR A 1 67  ? 24.146  0.236   -10.894 1.00 25.61  ? 113  TYR A O   1 
ATOM   324  C CB  . TYR A 1 67  ? 22.379  2.292   -12.825 1.00 28.60  ? 113  TYR A CB  1 
ATOM   325  C CG  . TYR A 1 67  ? 21.990  2.678   -11.415 1.00 28.01  ? 113  TYR A CG  1 
ATOM   326  C CD1 . TYR A 1 67  ? 22.561  3.792   -10.794 1.00 26.04  ? 113  TYR A CD1 1 
ATOM   327  C CD2 . TYR A 1 67  ? 21.105  1.896   -10.677 1.00 26.98  ? 113  TYR A CD2 1 
ATOM   328  C CE1 . TYR A 1 67  ? 22.232  4.135   -9.487  1.00 25.44  ? 113  TYR A CE1 1 
ATOM   329  C CE2 . TYR A 1 67  ? 20.769  2.229   -9.365  1.00 27.26  ? 113  TYR A CE2 1 
ATOM   330  C CZ  . TYR A 1 67  ? 21.332  3.347   -8.777  1.00 26.57  ? 113  TYR A CZ  1 
ATOM   331  O OH  . TYR A 1 67  ? 20.997  3.673   -7.483  1.00 27.15  ? 113  TYR A OH  1 
ATOM   332  N N   . HIS A 1 68  ? 22.982  -0.735  -12.548 1.00 28.86  ? 114  HIS A N   1 
ATOM   333  C CA  . HIS A 1 68  ? 22.758  -1.972  -11.801 1.00 29.33  ? 114  HIS A CA  1 
ATOM   334  C C   . HIS A 1 68  ? 23.972  -2.898  -11.775 1.00 29.98  ? 114  HIS A C   1 
ATOM   335  O O   . HIS A 1 68  ? 24.003  -3.851  -10.988 1.00 30.17  ? 114  HIS A O   1 
ATOM   336  C CB  . HIS A 1 68  ? 21.514  -2.686  -12.335 1.00 30.10  ? 114  HIS A CB  1 
ATOM   337  C CG  . HIS A 1 68  ? 20.260  -1.908  -12.106 1.00 30.41  ? 114  HIS A CG  1 
ATOM   338  N ND1 . HIS A 1 68  ? 19.699  -1.761  -10.856 1.00 31.14  ? 114  HIS A ND1 1 
ATOM   339  C CD2 . HIS A 1 68  ? 19.481  -1.197  -12.955 1.00 32.01  ? 114  HIS A CD2 1 
ATOM   340  C CE1 . HIS A 1 68  ? 18.616  -1.012  -10.949 1.00 31.47  ? 114  HIS A CE1 1 
ATOM   341  N NE2 . HIS A 1 68  ? 18.463  -0.653  -12.211 1.00 31.30  ? 114  HIS A NE2 1 
ATOM   342  N N   . LYS A 1 69  ? 24.966  -2.605  -12.613 1.00 30.36  ? 115  LYS A N   1 
ATOM   343  C CA  . LYS A 1 69  ? 26.275  -3.263  -12.534 1.00 31.60  ? 115  LYS A CA  1 
ATOM   344  C C   . LYS A 1 69  ? 27.042  -2.783  -11.297 1.00 30.40  ? 115  LYS A C   1 
ATOM   345  O O   . LYS A 1 69  ? 27.795  -3.542  -10.692 1.00 30.78  ? 115  LYS A O   1 
ATOM   346  C CB  . LYS A 1 69  ? 27.132  -2.968  -13.775 1.00 33.27  ? 115  LYS A CB  1 
ATOM   347  C CG  . LYS A 1 69  ? 26.477  -3.208  -15.135 1.00 38.01  ? 115  LYS A CG  1 
ATOM   348  C CD  . LYS A 1 69  ? 26.416  -4.669  -15.498 1.00 40.34  ? 115  LYS A CD  1 
ATOM   349  C CE  . LYS A 1 69  ? 25.801  -4.877  -16.884 1.00 42.69  ? 115  LYS A CE  1 
ATOM   350  N NZ  . LYS A 1 69  ? 26.789  -4.719  -17.994 1.00 45.22  ? 115  LYS A NZ  1 
ATOM   351  N N   . ILE A 1 70  ? 26.849  -1.516  -10.935 1.00 28.87  ? 116  ILE A N   1 
ATOM   352  C CA  . ILE A 1 70  ? 27.597  -0.883  -9.848  1.00 27.45  ? 116  ILE A CA  1 
ATOM   353  C C   . ILE A 1 70  ? 26.818  -0.934  -8.528  1.00 27.03  ? 116  ILE A C   1 
ATOM   354  O O   . ILE A 1 70  ? 27.386  -1.246  -7.479  1.00 27.22  ? 116  ILE A O   1 
ATOM   355  C CB  . ILE A 1 70  ? 27.937  0.579   -10.210 1.00 28.12  ? 116  ILE A CB  1 
ATOM   356  C CG1 . ILE A 1 70  ? 28.925  0.609   -11.382 1.00 30.18  ? 116  ILE A CG1 1 
ATOM   357  C CG2 . ILE A 1 70  ? 28.533  1.320   -9.012  1.00 25.77  ? 116  ILE A CG2 1 
ATOM   358  C CD1 . ILE A 1 70  ? 29.084  1.971   -12.002 1.00 32.83  ? 116  ILE A CD1 1 
ATOM   359  N N   . ILE A 1 71  ? 25.524  -0.632  -8.595  1.00 25.79  ? 117  ILE A N   1 
ATOM   360  C CA  . ILE A 1 71  ? 24.642  -0.616  -7.423  1.00 25.65  ? 117  ILE A CA  1 
ATOM   361  C C   . ILE A 1 71  ? 23.825  -1.912  -7.350  1.00 27.69  ? 117  ILE A C   1 
ATOM   362  O O   . ILE A 1 71  ? 22.874  -2.114  -8.111  1.00 28.24  ? 117  ILE A O   1 
ATOM   363  C CB  . ILE A 1 71  ? 23.686  0.600   -7.463  1.00 24.52  ? 117  ILE A CB  1 
ATOM   364  C CG1 . ILE A 1 71  ? 24.484  1.909   -7.482  1.00 23.67  ? 117  ILE A CG1 1 
ATOM   365  C CG2 . ILE A 1 71  ? 22.720  0.576   -6.276  1.00 24.61  ? 117  ILE A CG2 1 
ATOM   366  C CD1 . ILE A 1 71  ? 25.432  2.074   -6.301  1.00 22.42  ? 117  ILE A CD1 1 
ATOM   367  N N   . LYS A 1 72  ? 24.194  -2.771  -6.407  1.00 28.54  ? 118  LYS A N   1 
ATOM   368  C CA  . LYS A 1 72  ? 23.619  -4.111  -6.310  1.00 30.39  ? 118  LYS A CA  1 
ATOM   369  C C   . LYS A 1 72  ? 22.414  -4.178  -5.383  1.00 29.65  ? 118  LYS A C   1 
ATOM   370  O O   . LYS A 1 72  ? 21.650  -5.139  -5.440  1.00 30.70  ? 118  LYS A O   1 
ATOM   371  C CB  . LYS A 1 72  ? 24.693  -5.102  -5.853  1.00 31.65  ? 118  LYS A CB  1 
ATOM   372  C CG  . LYS A 1 72  ? 25.886  -5.189  -6.793  1.00 34.90  ? 118  LYS A CG  1 
ATOM   373  C CD  . LYS A 1 72  ? 25.422  -5.349  -8.230  1.00 37.98  ? 118  LYS A CD  1 
ATOM   374  C CE  . LYS A 1 72  ? 26.412  -6.077  -9.086  1.00 41.40  ? 118  LYS A CE  1 
ATOM   375  N NZ  . LYS A 1 72  ? 25.850  -6.297  -10.449 1.00 43.51  ? 118  LYS A NZ  1 
ATOM   376  N N   . GLN A 1 73  ? 22.250  -3.162  -4.539  1.00 28.13  ? 119  GLN A N   1 
ATOM   377  C CA  . GLN A 1 73  ? 21.102  -3.074  -3.640  1.00 29.00  ? 119  GLN A CA  1 
ATOM   378  C C   . GLN A 1 73  ? 20.450  -1.706  -3.787  1.00 27.63  ? 119  GLN A C   1 
ATOM   379  O O   . GLN A 1 73  ? 20.692  -0.809  -2.973  1.00 27.31  ? 119  GLN A O   1 
ATOM   380  C CB  . GLN A 1 73  ? 21.542  -3.303  -2.196  1.00 30.17  ? 119  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 73  ? 22.258  -4.629  -1.983  1.00 34.21  ? 119  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 73  ? 22.881  -4.742  -0.609  1.00 37.45  ? 119  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 73  ? 22.336  -4.245  0.374   1.00 40.29  ? 119  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 73  ? 24.031  -5.406  -0.533  1.00 41.36  ? 119  GLN A NE2 1 
ATOM   385  N N   . PRO A 1 74  ? 19.631  -1.529  -4.841  1.00 27.03  ? 120  PRO A N   1 
ATOM   386  C CA  . PRO A 1 74  ? 18.958  -0.242  -5.015  1.00 25.57  ? 120  PRO A CA  1 
ATOM   387  C C   . PRO A 1 74  ? 17.982  0.023   -3.872  1.00 25.16  ? 120  PRO A C   1 
ATOM   388  O O   . PRO A 1 74  ? 17.363  -0.912  -3.350  1.00 24.17  ? 120  PRO A O   1 
ATOM   389  C CB  . PRO A 1 74  ? 18.192  -0.414  -6.334  1.00 27.01  ? 120  PRO A CB  1 
ATOM   390  C CG  . PRO A 1 74  ? 18.881  -1.537  -7.043  1.00 29.72  ? 120  PRO A CG  1 
ATOM   391  C CD  . PRO A 1 74  ? 19.346  -2.453  -5.951  1.00 28.57  ? 120  PRO A CD  1 
ATOM   392  N N   . MET A 1 75  ? 17.849  1.285   -3.493  1.00 23.44  ? 121  MET A N   1 
ATOM   393  C CA  . MET A 1 75  ? 16.899  1.667   -2.467  1.00 24.53  ? 121  MET A CA  1 
ATOM   394  C C   . MET A 1 75  ? 16.442  3.098   -2.726  1.00 24.59  ? 121  MET A C   1 
ATOM   395  O O   . MET A 1 75  ? 17.168  3.906   -3.316  1.00 23.99  ? 121  MET A O   1 
ATOM   396  C CB  . MET A 1 75  ? 17.519  1.519   -1.074  1.00 24.31  ? 121  MET A CB  1 
ATOM   397  C CG  . MET A 1 75  ? 16.540  1.708   0.099   1.00 25.40  ? 121  MET A CG  1 
ATOM   398  S SD  . MET A 1 75  ? 15.035  0.720   0.017   1.00 29.35  ? 121  MET A SD  1 
ATOM   399  C CE  . MET A 1 75  ? 15.703  -0.945  -0.032  1.00 28.40  ? 121  MET A CE  1 
ATOM   400  N N   . ASP A 1 76  ? 15.221  3.388   -2.299  1.00 25.02  ? 122  ASP A N   1 
ATOM   401  C CA  . ASP A 1 76  ? 14.597  4.684   -2.526  1.00 25.01  ? 122  ASP A CA  1 
ATOM   402  C C   . ASP A 1 76  ? 13.574  4.918   -1.420  1.00 25.35  ? 122  ASP A C   1 
ATOM   403  O O   . ASP A 1 76  ? 13.200  3.983   -0.732  1.00 25.75  ? 122  ASP A O   1 
ATOM   404  C CB  . ASP A 1 76  ? 13.916  4.712   -3.885  1.00 25.41  ? 122  ASP A CB  1 
ATOM   405  C CG  . ASP A 1 76  ? 12.732  3.783   -3.954  1.00 27.83  ? 122  ASP A CG  1 
ATOM   406  O OD1 . ASP A 1 76  ? 12.941  2.567   -4.147  1.00 30.17  ? 122  ASP A OD1 1 
ATOM   407  O OD2 . ASP A 1 76  ? 11.589  4.263   -3.788  1.00 28.78  ? 122  ASP A OD2 1 
ATOM   408  N N   A MET A 1 77  ? 13.118  6.153   -1.267  0.50 25.93  ? 123  MET A N   1 
ATOM   409  N N   B MET A 1 77  ? 13.147  6.173   -1.277  0.50 25.64  ? 123  MET A N   1 
ATOM   410  C CA  A MET A 1 77  ? 12.223  6.501   -0.165  0.50 27.15  ? 123  MET A CA  1 
ATOM   411  C CA  B MET A 1 77  ? 12.201  6.596   -0.236  0.50 26.66  ? 123  MET A CA  1 
ATOM   412  C C   A MET A 1 77  ? 10.781  6.026   -0.346  0.50 28.54  ? 123  MET A C   1 
ATOM   413  C C   B MET A 1 77  ? 10.845  5.918   -0.352  0.50 28.26  ? 123  MET A C   1 
ATOM   414  O O   A MET A 1 77  ? 10.048  5.918   0.636   0.50 29.18  ? 123  MET A O   1 
ATOM   415  O O   B MET A 1 77  ? 10.236  5.565   0.658   0.50 29.07  ? 123  MET A O   1 
ATOM   416  C CB  A MET A 1 77  ? 12.252  8.008   0.082   0.50 27.17  ? 123  MET A CB  1 
ATOM   417  C CB  B MET A 1 77  ? 11.959  8.106   -0.311  0.50 26.59  ? 123  MET A CB  1 
ATOM   418  C CG  A MET A 1 77  ? 13.253  8.412   1.146   0.50 28.10  ? 123  MET A CG  1 
ATOM   419  C CG  B MET A 1 77  ? 13.055  8.986   0.243   0.50 25.93  ? 123  MET A CG  1 
ATOM   420  S SD  A MET A 1 77  ? 13.396  10.192  1.343   0.50 29.97  ? 123  MET A SD  1 
ATOM   421  S SD  B MET A 1 77  ? 12.476  10.696  0.405   0.50 26.13  ? 123  MET A SD  1 
ATOM   422  C CE  A MET A 1 77  ? 13.476  11.049  -0.157  0.50 21.54  ? 123  MET A CE  1 
ATOM   423  C CE  B MET A 1 77  ? 14.031  11.570  0.492   0.50 23.32  ? 123  MET A CE  1 
ATOM   424  N N   . GLY A 1 78  ? 10.365  5.762   -1.582  1.00 29.32  ? 124  GLY A N   1 
ATOM   425  C CA  . GLY A 1 78  ? 9.035   5.184   -1.837  1.00 31.01  ? 124  GLY A CA  1 
ATOM   426  C C   . GLY A 1 78  ? 8.933   3.772   -1.289  1.00 32.01  ? 124  GLY A C   1 
ATOM   427  O O   . GLY A 1 78  ? 7.936   3.403   -0.645  1.00 33.16  ? 124  GLY A O   1 
ATOM   428  N N   . THR A 1 79  ? 9.981   2.992   -1.549  1.00 30.98  ? 125  THR A N   1 
ATOM   429  C CA  . THR A 1 79  ? 10.146  1.648   -1.003  1.00 31.52  ? 125  THR A CA  1 
ATOM   430  C C   . THR A 1 79  ? 10.150  1.678   0.529   1.00 32.53  ? 125  THR A C   1 
ATOM   431  O O   . THR A 1 79  ? 9.405   0.934   1.170   1.00 33.50  ? 125  THR A O   1 
ATOM   432  C CB  . THR A 1 79  ? 11.454  1.005   -1.540  1.00 31.01  ? 125  THR A CB  1 
ATOM   433  O OG1 . THR A 1 79  ? 11.356  0.854   -2.961  1.00 31.45  ? 125  THR A OG1 1 
ATOM   434  C CG2 . THR A 1 79  ? 11.732  -0.370  -0.900  1.00 30.39  ? 125  THR A CG2 1 
ATOM   435  N N   . ILE A 1 80  ? 10.961  2.560   1.112   1.00 32.18  ? 126  ILE A N   1 
ATOM   436  C CA  . ILE A 1 80  ? 11.046  2.676   2.571   1.00 32.63  ? 126  ILE A CA  1 
ATOM   437  C C   . ILE A 1 80  ? 9.703   3.103   3.164   1.00 34.40  ? 126  ILE A C   1 
ATOM   438  O O   . ILE A 1 80  ? 9.269   2.565   4.187   1.00 34.46  ? 126  ILE A O   1 
ATOM   439  C CB  . ILE A 1 80  ? 12.156  3.669   3.019   1.00 31.45  ? 126  ILE A CB  1 
ATOM   440  C CG1 . ILE A 1 80  ? 13.530  3.187   2.563   1.00 30.22  ? 126  ILE A CG1 1 
ATOM   441  C CG2 . ILE A 1 80  ? 12.163  3.815   4.540   1.00 30.57  ? 126  ILE A CG2 1 
ATOM   442  C CD1 . ILE A 1 80  ? 14.657  4.200   2.796   1.00 28.98  ? 126  ILE A CD1 1 
ATOM   443  N N   . LYS A 1 81  ? 9.053   4.068   2.513   1.00 35.33  ? 127  LYS A N   1 
ATOM   444  C CA  . LYS A 1 81  ? 7.744   4.554   2.928   1.00 36.81  ? 127  LYS A CA  1 
ATOM   445  C C   . LYS A 1 81  ? 6.725   3.421   2.886   1.00 38.68  ? 127  LYS A C   1 
ATOM   446  O O   . LYS A 1 81  ? 6.048   3.156   3.877   1.00 38.90  ? 127  LYS A O   1 
ATOM   447  C CB  . LYS A 1 81  ? 7.293   5.702   2.017   1.00 37.18  ? 127  LYS A CB  1 
ATOM   448  C CG  . LYS A 1 81  ? 5.975   6.342   2.404   1.00 39.41  ? 127  LYS A CG  1 
ATOM   449  C CD  . LYS A 1 81  ? 5.738   7.622   1.618   1.00 39.71  ? 127  LYS A CD  1 
ATOM   450  C CE  . LYS A 1 81  ? 4.327   8.152   1.816   1.00 42.92  ? 127  LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 81  ? 3.319   7.309   1.112   1.00 43.85  ? 127  LYS A NZ  1 
ATOM   452  N N   . ARG A 1 82  ? 6.641   2.755   1.736   1.00 39.21  ? 128  ARG A N   1 
ATOM   453  C CA  . ARG A 1 82  ? 5.782   1.585   1.563   1.00 42.41  ? 128  ARG A CA  1 
ATOM   454  C C   . ARG A 1 82  ? 6.063   0.538   2.645   1.00 42.50  ? 128  ARG A C   1 
ATOM   455  O O   . ARG A 1 82  ? 5.131   -0.005  3.242   1.00 43.66  ? 128  ARG A O   1 
ATOM   456  C CB  . ARG A 1 82  ? 5.968   0.988   0.160   1.00 42.94  ? 128  ARG A CB  1 
ATOM   457  C CG  . ARG A 1 82  ? 5.044   -0.169  -0.177  1.00 49.58  ? 128  ARG A CG  1 
ATOM   458  C CD  . ARG A 1 82  ? 4.827   -0.316  -1.691  1.00 53.34  ? 128  ARG A CD  1 
ATOM   459  N NE  . ARG A 1 82  ? 6.082   -0.487  -2.432  1.00 55.28  ? 128  ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 82  ? 6.719   0.466   -3.120  1.00 56.82  ? 128  ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 82  ? 6.245   1.709   -3.197  1.00 57.78  ? 128  ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 82  ? 7.855   0.169   -3.744  1.00 56.83  ? 128  ARG A NH2 1 
ATOM   463  N N   . ARG A 1 83  ? 7.341   0.282   2.915   1.00 40.33  ? 129  ARG A N   1 
ATOM   464  C CA  . ARG A 1 83  ? 7.734   -0.689  3.942   1.00 40.74  ? 129  ARG A CA  1 
ATOM   465  C C   . ARG A 1 83  ? 7.310   -0.305  5.359   1.00 41.35  ? 129  ARG A C   1 
ATOM   466  O O   . ARG A 1 83  ? 6.939   -1.175  6.145   1.00 42.46  ? 129  ARG A O   1 
ATOM   467  C CB  . ARG A 1 83  ? 9.240   -0.929  3.911   1.00 38.91  ? 129  ARG A CB  1 
ATOM   468  C CG  . ARG A 1 83  ? 9.660   -1.843  2.789   1.00 38.75  ? 129  ARG A CG  1 
ATOM   469  C CD  . ARG A 1 83  ? 11.169  -1.968  2.693   1.00 37.52  ? 129  ARG A CD  1 
ATOM   470  N NE  . ARG A 1 83  ? 11.543  -2.791  1.546   1.00 37.96  ? 129  ARG A NE  1 
ATOM   471  C CZ  . ARG A 1 83  ? 12.767  -3.247  1.294   1.00 38.31  ? 129  ARG A CZ  1 
ATOM   472  N NH1 . ARG A 1 83  ? 13.781  -2.978  2.109   1.00 36.80  ? 129  ARG A NH1 1 
ATOM   473  N NH2 . ARG A 1 83  ? 12.972  -3.994  0.216   1.00 39.41  ? 129  ARG A NH2 1 
ATOM   474  N N   . LEU A 1 84  ? 7.393   0.984   5.685   1.00 40.59  ? 130  LEU A N   1 
ATOM   475  C CA  . LEU A 1 84  ? 6.921   1.489   6.984   1.00 41.71  ? 130  LEU A CA  1 
ATOM   476  C C   . LEU A 1 84  ? 5.406   1.382   7.108   1.00 44.52  ? 130  LEU A C   1 
ATOM   477  O O   . LEU A 1 84  ? 4.883   1.047   8.178   1.00 46.08  ? 130  LEU A O   1 
ATOM   478  C CB  . LEU A 1 84  ? 7.346   2.948   7.187   1.00 40.49  ? 130  LEU A CB  1 
ATOM   479  C CG  . LEU A 1 84  ? 8.827   3.187   7.490   1.00 37.33  ? 130  LEU A CG  1 
ATOM   480  C CD1 . LEU A 1 84  ? 9.176   4.649   7.291   1.00 36.36  ? 130  LEU A CD1 1 
ATOM   481  C CD2 . LEU A 1 84  ? 9.170   2.733   8.906   1.00 37.35  ? 130  LEU A CD2 1 
ATOM   482  N N   . GLU A 1 85  ? 4.702   1.684   6.020   1.00 45.11  ? 131  GLU A N   1 
ATOM   483  C CA  . GLU A 1 85  ? 3.236   1.592   5.991   1.00 47.29  ? 131  GLU A CA  1 
ATOM   484  C C   . GLU A 1 85  ? 2.742   0.152   6.130   1.00 49.52  ? 131  GLU A C   1 
ATOM   485  O O   . GLU A 1 85  ? 1.685   -0.088  6.719   1.00 51.60  ? 131  GLU A O   1 
ATOM   486  C CB  . GLU A 1 85  ? 2.684   2.190   4.695   1.00 47.16  ? 131  GLU A CB  1 
ATOM   487  C CG  . GLU A 1 85  ? 2.838   3.707   4.593   1.00 47.44  ? 131  GLU A CG  1 
ATOM   488  C CD  . GLU A 1 85  ? 2.686   4.235   3.172   1.00 47.80  ? 131  GLU A CD  1 
ATOM   489  O OE1 . GLU A 1 85  ? 2.622   3.425   2.224   1.00 49.86  ? 131  GLU A OE1 1 
ATOM   490  O OE2 . GLU A 1 85  ? 2.635   5.472   3.002   1.00 47.30  ? 131  GLU A OE2 1 
ATOM   491  N N   . ASN A 1 86  ? 3.505   -0.799  5.591   1.00 49.30  ? 132  ASN A N   1 
ATOM   492  C CA  . ASN A 1 86  ? 3.107   -2.209  5.593   1.00 51.39  ? 132  ASN A CA  1 
ATOM   493  C C   . ASN A 1 86  ? 3.701   -3.037  6.737   1.00 51.06  ? 132  ASN A C   1 
ATOM   494  O O   . ASN A 1 86  ? 3.639   -4.265  6.704   1.00 52.41  ? 132  ASN A O   1 
ATOM   495  C CB  . ASN A 1 86  ? 3.472   -2.853  4.249   1.00 51.52  ? 132  ASN A CB  1 
ATOM   496  C CG  . ASN A 1 86  ? 2.747   -2.214  3.080   1.00 53.49  ? 132  ASN A CG  1 
ATOM   497  O OD1 . ASN A 1 86  ? 1.575   -1.855  3.180   1.00 56.93  ? 132  ASN A OD1 1 
ATOM   498  N ND2 . ASN A 1 86  ? 3.441   -2.080  1.957   1.00 55.30  ? 132  ASN A ND2 1 
ATOM   499  N N   . ASN A 1 87  ? 4.267   -2.370  7.743   1.00 49.91  ? 133  ASN A N   1 
ATOM   500  C CA  . ASN A 1 87  ? 4.894   -3.043  8.887   1.00 50.16  ? 133  ASN A CA  1 
ATOM   501  C C   . ASN A 1 87  ? 5.909   -4.109  8.469   1.00 49.19  ? 133  ASN A C   1 
ATOM   502  O O   . ASN A 1 87  ? 5.952   -5.203  9.029   1.00 50.50  ? 133  ASN A O   1 
ATOM   503  C CB  . ASN A 1 87  ? 3.822   -3.638  9.813   1.00 53.17  ? 133  ASN A CB  1 
ATOM   504  C CG  . ASN A 1 87  ? 2.925   -2.578  10.418  1.00 54.11  ? 133  ASN A CG  1 
ATOM   505  O OD1 . ASN A 1 87  ? 3.312   -1.416  10.537  1.00 53.22  ? 133  ASN A OD1 1 
ATOM   506  N ND2 . ASN A 1 87  ? 1.720   -2.975  10.809  1.00 57.83  ? 133  ASN A ND2 1 
ATOM   507  N N   . TYR A 1 88  ? 6.728   -3.768  7.477   1.00 47.17  ? 134  TYR A N   1 
ATOM   508  C CA  . TYR A 1 88  ? 7.755   -4.672  6.972   1.00 46.13  ? 134  TYR A CA  1 
ATOM   509  C C   . TYR A 1 88  ? 8.891   -4.831  7.980   1.00 45.12  ? 134  TYR A C   1 
ATOM   510  O O   . TYR A 1 88  ? 9.364   -5.943  8.221   1.00 45.85  ? 134  TYR A O   1 
ATOM   511  C CB  . TYR A 1 88  ? 8.296   -4.152  5.633   1.00 44.72  ? 134  TYR A CB  1 
ATOM   512  C CG  . TYR A 1 88  ? 9.444   -4.955  5.056   1.00 45.27  ? 134  TYR A CG  1 
ATOM   513  C CD1 . TYR A 1 88  ? 9.211   -6.124  4.334   1.00 48.82  ? 134  TYR A CD1 1 
ATOM   514  C CD2 . TYR A 1 88  ? 10.764  -4.540  5.224   1.00 45.29  ? 134  TYR A CD2 1 
ATOM   515  C CE1 . TYR A 1 88  ? 10.266  -6.864  3.798   1.00 48.68  ? 134  TYR A CE1 1 
ATOM   516  C CE2 . TYR A 1 88  ? 11.820  -5.269  4.694   1.00 45.05  ? 134  TYR A CE2 1 
ATOM   517  C CZ  . TYR A 1 88  ? 11.565  -6.431  3.985   1.00 47.65  ? 134  TYR A CZ  1 
ATOM   518  O OH  . TYR A 1 88  ? 12.609  -7.156  3.455   1.00 49.74  ? 134  TYR A OH  1 
ATOM   519  N N   . TYR A 1 89  ? 9.323   -3.719  8.569   1.00 43.72  ? 135  TYR A N   1 
ATOM   520  C CA  . TYR A 1 89  ? 10.498  -3.721  9.439   1.00 43.13  ? 135  TYR A CA  1 
ATOM   521  C C   . TYR A 1 89  ? 10.205  -4.329  10.805  1.00 46.35  ? 135  TYR A C   1 
ATOM   522  O O   . TYR A 1 89  ? 9.133   -4.124  11.377  1.00 47.04  ? 135  TYR A O   1 
ATOM   523  C CB  . TYR A 1 89  ? 11.035  -2.303  9.640   1.00 40.92  ? 135  TYR A CB  1 
ATOM   524  C CG  . TYR A 1 89  ? 11.467  -1.622  8.370   1.00 37.69  ? 135  TYR A CG  1 
ATOM   525  C CD1 . TYR A 1 89  ? 12.558  -2.096  7.643   1.00 35.60  ? 135  TYR A CD1 1 
ATOM   526  C CD2 . TYR A 1 89  ? 10.800  -0.496  7.896   1.00 36.63  ? 135  TYR A CD2 1 
ATOM   527  C CE1 . TYR A 1 89  ? 12.963  -1.467  6.478   1.00 34.72  ? 135  TYR A CE1 1 
ATOM   528  C CE2 . TYR A 1 89  ? 11.204  0.142   6.729   1.00 35.34  ? 135  TYR A CE2 1 
ATOM   529  C CZ  . TYR A 1 89  ? 12.281  -0.345  6.027   1.00 33.89  ? 135  TYR A CZ  1 
ATOM   530  O OH  . TYR A 1 89  ? 12.687  0.284   4.868   1.00 32.63  ? 135  TYR A OH  1 
ATOM   531  N N   . TRP A 1 90  ? 11.185  -5.065  11.319  1.00 47.79  ? 136  TRP A N   1 
ATOM   532  C CA  . TRP A 1 90  ? 11.116  -5.648  12.650  1.00 51.07  ? 136  TRP A CA  1 
ATOM   533  C C   . TRP A 1 90  ? 11.869  -4.798  13.681  1.00 50.01  ? 136  TRP A C   1 
ATOM   534  O O   . TRP A 1 90  ? 11.579  -4.868  14.877  1.00 51.90  ? 136  TRP A O   1 
ATOM   535  C CB  . TRP A 1 90  ? 11.662  -7.079  12.613  1.00 53.16  ? 136  TRP A CB  1 
ATOM   536  C CG  . TRP A 1 90  ? 10.810  -8.027  11.795  1.00 58.31  ? 136  TRP A CG  1 
ATOM   537  C CD1 . TRP A 1 90  ? 9.534   -7.809  11.334  1.00 61.53  ? 136  TRP A CD1 1 
ATOM   538  C CD2 . TRP A 1 90  ? 11.156  -9.357  11.387  1.00 62.18  ? 136  TRP A CD2 1 
ATOM   539  N NE1 . TRP A 1 90  ? 9.080   -8.912  10.651  1.00 63.47  ? 136  TRP A NE1 1 
ATOM   540  C CE2 . TRP A 1 90  ? 10.053  -9.876  10.669  1.00 64.44  ? 136  TRP A CE2 1 
ATOM   541  C CE3 . TRP A 1 90  ? 12.294  -10.159 11.551  1.00 63.24  ? 136  TRP A CE3 1 
ATOM   542  C CZ2 . TRP A 1 90  ? 10.055  -11.162 10.116  1.00 66.59  ? 136  TRP A CZ2 1 
ATOM   543  C CZ3 . TRP A 1 90  ? 12.295  -11.437 11.000  1.00 65.47  ? 136  TRP A CZ3 1 
ATOM   544  C CH2 . TRP A 1 90  ? 11.182  -11.925 10.292  1.00 66.61  ? 136  TRP A CH2 1 
ATOM   545  N N   . ALA A 1 91  ? 12.816  -3.990  13.211  1.00 46.51  ? 137  ALA A N   1 
ATOM   546  C CA  . ALA A 1 91  ? 13.579  -3.085  14.067  1.00 45.20  ? 137  ALA A CA  1 
ATOM   547  C C   . ALA A 1 91  ? 13.841  -1.763  13.349  1.00 42.24  ? 137  ALA A C   1 
ATOM   548  O O   . ALA A 1 91  ? 13.855  -1.715  12.118  1.00 41.17  ? 137  ALA A O   1 
ATOM   549  C CB  . ALA A 1 91  ? 14.895  -3.729  14.461  1.00 45.55  ? 137  ALA A CB  1 
ATOM   550  N N   . ALA A 1 92  ? 14.064  -0.702  14.124  1.00 40.85  ? 138  ALA A N   1 
ATOM   551  C CA  . ALA A 1 92  ? 14.349  0.627   13.576  1.00 38.58  ? 138  ALA A CA  1 
ATOM   552  C C   . ALA A 1 92  ? 15.662  0.643   12.793  1.00 36.09  ? 138  ALA A C   1 
ATOM   553  O O   . ALA A 1 92  ? 15.771  1.316   11.771  1.00 33.48  ? 138  ALA A O   1 
ATOM   554  C CB  . ALA A 1 92  ? 14.404  1.652   14.688  1.00 39.56  ? 138  ALA A CB  1 
ATOM   555  N N   . SER A 1 93  ? 16.652  -0.102  13.279  1.00 36.95  ? 139  SER A N   1 
ATOM   556  C CA  . SER A 1 93  ? 17.958  -0.183  12.612  1.00 36.75  ? 139  SER A CA  1 
ATOM   557  C C   . SER A 1 93  ? 17.865  -0.666  11.161  1.00 35.64  ? 139  SER A C   1 
ATOM   558  O O   . SER A 1 93  ? 18.662  -0.249  10.317  1.00 34.73  ? 139  SER A O   1 
ATOM   559  C CB  . SER A 1 93  ? 18.909  -1.087  13.406  1.00 38.23  ? 139  SER A CB  1 
ATOM   560  O OG  . SER A 1 93  ? 18.408  -2.412  13.510  1.00 40.68  ? 139  SER A OG  1 
ATOM   561  N N   . GLU A 1 94  ? 16.902  -1.540  10.874  1.00 36.38  ? 140  GLU A N   1 
ATOM   562  C CA  . GLU A 1 94  ? 16.705  -2.068  9.519   1.00 35.85  ? 140  GLU A CA  1 
ATOM   563  C C   . GLU A 1 94  ? 16.265  -0.964  8.556   1.00 34.06  ? 140  GLU A C   1 
ATOM   564  O O   . GLU A 1 94  ? 16.739  -0.880  7.421   1.00 32.28  ? 140  GLU A O   1 
ATOM   565  C CB  . GLU A 1 94  ? 15.661  -3.185  9.527   1.00 38.07  ? 140  GLU A CB  1 
ATOM   566  C CG  . GLU A 1 94  ? 16.038  -4.400  10.370  1.00 41.18  ? 140  GLU A CG  1 
ATOM   567  C CD  . GLU A 1 94  ? 14.924  -5.427  10.463  1.00 44.55  ? 140  GLU A CD  1 
ATOM   568  O OE1 . GLU A 1 94  ? 13.772  -5.111  10.096  1.00 45.82  ? 140  GLU A OE1 1 
ATOM   569  O OE2 . GLU A 1 94  ? 15.201  -6.559  10.910  1.00 46.97  ? 140  GLU A OE2 1 
ATOM   570  N N   . CYS A 1 95  ? 15.345  -0.127  9.020   1.00 33.96  ? 141  CYS A N   1 
ATOM   571  C CA  . CYS A 1 95  ? 14.884  1.027   8.254   1.00 32.84  ? 141  CYS A CA  1 
ATOM   572  C C   . CYS A 1 95  ? 15.997  2.048   8.070   1.00 31.06  ? 141  CYS A C   1 
ATOM   573  O O   . CYS A 1 95  ? 16.168  2.607   6.981   1.00 30.54  ? 141  CYS A O   1 
ATOM   574  C CB  . CYS A 1 95  ? 13.695  1.675   8.962   1.00 33.78  ? 141  CYS A CB  1 
ATOM   575  S SG  . CYS A 1 95  ? 13.128  3.213   8.248   1.00 32.55  ? 141  CYS A SG  1 
ATOM   576  N N   . MET A 1 96  ? 16.761  2.283   9.134   1.00 30.56  ? 142  MET A N   1 
ATOM   577  C CA  . MET A 1 96  ? 17.897  3.202   9.073   1.00 29.50  ? 142  MET A CA  1 
ATOM   578  C C   . MET A 1 96  ? 18.943  2.736   8.064   1.00 28.20  ? 142  MET A C   1 
ATOM   579  O O   . MET A 1 96  ? 19.540  3.553   7.369   1.00 26.64  ? 142  MET A O   1 
ATOM   580  C CB  . MET A 1 96  ? 18.532  3.359   10.452  1.00 30.35  ? 142  MET A CB  1 
ATOM   581  C CG  . MET A 1 96  ? 17.654  4.122   11.434  1.00 33.17  ? 142  MET A CG  1 
ATOM   582  S SD  . MET A 1 96  ? 18.209  3.926   13.133  1.00 37.62  ? 142  MET A SD  1 
ATOM   583  C CE  . MET A 1 96  ? 19.833  4.682   13.054  1.00 34.44  ? 142  MET A CE  1 
ATOM   584  N N   . GLN A 1 97  ? 19.161  1.423   7.989   1.00 28.59  ? 143  GLN A N   1 
ATOM   585  C CA  . GLN A 1 97  ? 20.094  0.863   7.015   1.00 27.76  ? 143  GLN A CA  1 
ATOM   586  C C   . GLN A 1 97  ? 19.605  1.080   5.586   1.00 26.34  ? 143  GLN A C   1 
ATOM   587  O O   . GLN A 1 97  ? 20.411  1.316   4.683   1.00 25.99  ? 143  GLN A O   1 
ATOM   588  C CB  . GLN A 1 97  ? 20.345  -0.629  7.278   1.00 28.99  ? 143  GLN A CB  1 
ATOM   589  C CG  . GLN A 1 97  ? 20.972  -0.940  8.643   1.00 31.59  ? 143  GLN A CG  1 
ATOM   590  C CD  . GLN A 1 97  ? 22.404  -0.463  8.801   1.00 33.53  ? 143  GLN A CD  1 
ATOM   591  O OE1 . GLN A 1 97  ? 22.990  0.112   7.888   1.00 33.92  ? 143  GLN A OE1 1 
ATOM   592  N NE2 . GLN A 1 97  ? 22.971  -0.692  9.981   1.00 34.78  ? 143  GLN A NE2 1 
ATOM   593  N N   . ASP A 1 98  ? 18.294  0.992   5.373   1.00 26.89  ? 144  ASP A N   1 
ATOM   594  C CA  . ASP A 1 98  ? 17.715  1.268   4.051   1.00 25.96  ? 144  ASP A CA  1 
ATOM   595  C C   . ASP A 1 98  ? 17.924  2.725   3.642   1.00 24.63  ? 144  ASP A C   1 
ATOM   596  O O   . ASP A 1 98  ? 18.336  2.998   2.505   1.00 23.98  ? 144  ASP A O   1 
ATOM   597  C CB  . ASP A 1 98  ? 16.222  0.900   3.995   1.00 26.88  ? 144  ASP A CB  1 
ATOM   598  C CG  . ASP A 1 98  ? 15.980  -0.592  3.768   1.00 29.32  ? 144  ASP A CG  1 
ATOM   599  O OD1 . ASP A 1 98  ? 16.940  -1.349  3.493   1.00 29.52  ? 144  ASP A OD1 1 
ATOM   600  O OD2 . ASP A 1 98  ? 14.812  -1.013  3.865   1.00 32.12  ? 144  ASP A OD2 1 
ATOM   601  N N   . PHE A 1 99  ? 17.674  3.658   4.562   1.00 24.72  ? 145  PHE A N   1 
ATOM   602  C CA  . PHE A 1 99  ? 17.978  5.072   4.309   1.00 25.03  ? 145  PHE A CA  1 
ATOM   603  C C   . PHE A 1 99  ? 19.445  5.249   3.921   1.00 24.61  ? 145  PHE A C   1 
ATOM   604  O O   . PHE A 1 99  ? 19.760  5.923   2.946   1.00 23.94  ? 145  PHE A O   1 
ATOM   605  C CB  . PHE A 1 99  ? 17.670  5.947   5.532   1.00 25.99  ? 145  PHE A CB  1 
ATOM   606  C CG  . PHE A 1 99  ? 16.256  6.451   5.584   1.00 26.96  ? 145  PHE A CG  1 
ATOM   607  C CD1 . PHE A 1 99  ? 15.842  7.466   4.728   1.00 29.29  ? 145  PHE A CD1 1 
ATOM   608  C CD2 . PHE A 1 99  ? 15.348  5.943   6.503   1.00 29.09  ? 145  PHE A CD2 1 
ATOM   609  C CE1 . PHE A 1 99  ? 14.541  7.954   4.776   1.00 29.11  ? 145  PHE A CE1 1 
ATOM   610  C CE2 . PHE A 1 99  ? 14.044  6.424   6.560   1.00 29.41  ? 145  PHE A CE2 1 
ATOM   611  C CZ  . PHE A 1 99  ? 13.640  7.432   5.691   1.00 29.26  ? 145  PHE A CZ  1 
ATOM   612  N N   . ASN A 1 100 ? 20.335  4.626   4.691   1.00 24.67  ? 146  ASN A N   1 
ATOM   613  C CA  . ASN A 1 100 ? 21.769  4.755   4.468   1.00 24.74  ? 146  ASN A CA  1 
ATOM   614  C C   . ASN A 1 100 ? 22.198  4.201   3.111   1.00 24.05  ? 146  ASN A C   1 
ATOM   615  O O   . ASN A 1 100 ? 23.010  4.811   2.411   1.00 23.81  ? 146  ASN A O   1 
ATOM   616  C CB  . ASN A 1 100 ? 22.514  4.037   5.586   1.00 26.20  ? 146  ASN A CB  1 
ATOM   617  C CG  . ASN A 1 100 ? 24.013  4.171   5.463   1.00 27.38  ? 146  ASN A CG  1 
ATOM   618  O OD1 . ASN A 1 100 ? 24.569  5.240   5.711   1.00 27.69  ? 146  ASN A OD1 1 
ATOM   619  N ND2 . ASN A 1 100 ? 24.674  3.083   5.094   1.00 26.43  ? 146  ASN A ND2 1 
ATOM   620  N N   . THR A 1 101 ? 21.646  3.043   2.756   1.00 23.58  ? 147  THR A N   1 
ATOM   621  C CA  . THR A 1 101 ? 21.879  2.423   1.462   1.00 23.74  ? 147  THR A CA  1 
ATOM   622  C C   . THR A 1 101 ? 21.462  3.350   0.314   1.00 22.50  ? 147  THR A C   1 
ATOM   623  O O   . THR A 1 101 ? 22.200  3.518   -0.652  1.00 21.97  ? 147  THR A O   1 
ATOM   624  C CB  . THR A 1 101 ? 21.132  1.080   1.368   1.00 23.71  ? 147  THR A CB  1 
ATOM   625  O OG1 . THR A 1 101 ? 21.707  0.167   2.312   1.00 25.89  ? 147  THR A OG1 1 
ATOM   626  C CG2 . THR A 1 101 ? 21.226  0.489   -0.042  1.00 24.84  ? 147  THR A CG2 1 
ATOM   627  N N   . MET A 1 102 ? 20.289  3.961   0.426   1.00 22.68  ? 148  MET A N   1 
ATOM   628  C CA  . MET A 1 102 ? 19.832  4.914   -0.587  1.00 23.23  ? 148  MET A CA  1 
ATOM   629  C C   . MET A 1 102 ? 20.867  6.026   -0.801  1.00 22.96  ? 148  MET A C   1 
ATOM   630  O O   . MET A 1 102 ? 21.255  6.326   -1.936  1.00 23.71  ? 148  MET A O   1 
ATOM   631  C CB  . MET A 1 102 ? 18.476  5.507   -0.185  1.00 23.31  ? 148  MET A CB  1 
ATOM   632  C CG  . MET A 1 102 ? 17.921  6.581   -1.132  1.00 23.27  ? 148  MET A CG  1 
ATOM   633  S SD  . MET A 1 102 ? 16.378  7.216   -0.469  1.00 26.92  ? 148  MET A SD  1 
ATOM   634  C CE  . MET A 1 102 ? 16.985  8.266   0.855   1.00 28.07  ? 148  MET A CE  1 
ATOM   635  N N   . PHE A 1 103 ? 21.336  6.619   0.290   1.00 23.05  ? 149  PHE A N   1 
ATOM   636  C CA  . PHE A 1 103 ? 22.285  7.727   0.185   1.00 23.10  ? 149  PHE A CA  1 
ATOM   637  C C   . PHE A 1 103 ? 23.652  7.239   -0.299  1.00 22.30  ? 149  PHE A C   1 
ATOM   638  O O   . PHE A 1 103 ? 24.282  7.849   -1.166  1.00 21.85  ? 149  PHE A O   1 
ATOM   639  C CB  . PHE A 1 103 ? 22.424  8.445   1.527   1.00 24.01  ? 149  PHE A CB  1 
ATOM   640  C CG  . PHE A 1 103 ? 21.166  9.143   1.990   1.00 25.21  ? 149  PHE A CG  1 
ATOM   641  C CD1 . PHE A 1 103 ? 20.541  10.089  1.189   1.00 25.47  ? 149  PHE A CD1 1 
ATOM   642  C CD2 . PHE A 1 103 ? 20.633  8.877   3.242   1.00 26.86  ? 149  PHE A CD2 1 
ATOM   643  C CE1 . PHE A 1 103 ? 19.395  10.746  1.622   1.00 27.83  ? 149  PHE A CE1 1 
ATOM   644  C CE2 . PHE A 1 103 ? 19.484  9.532   3.683   1.00 26.97  ? 149  PHE A CE2 1 
ATOM   645  C CZ  . PHE A 1 103 ? 18.867  10.468  2.871   1.00 26.02  ? 149  PHE A CZ  1 
ATOM   646  N N   . THR A 1 104 ? 24.110  6.125   0.264   1.00 22.21  ? 150  THR A N   1 
ATOM   647  C CA  . THR A 1 104 ? 25.406  5.581   -0.093  1.00 22.47  ? 150  THR A CA  1 
ATOM   648  C C   . THR A 1 104 ? 25.466  5.192   -1.573  1.00 21.73  ? 150  THR A C   1 
ATOM   649  O O   . THR A 1 104 ? 26.471  5.455   -2.252  1.00 21.08  ? 150  THR A O   1 
ATOM   650  C CB  . THR A 1 104 ? 25.771  4.396   0.829   1.00 23.15  ? 150  THR A CB  1 
ATOM   651  O OG1 . THR A 1 104 ? 25.903  4.885   2.168   1.00 23.90  ? 150  THR A OG1 1 
ATOM   652  C CG2 . THR A 1 104 ? 27.067  3.755   0.401   1.00 24.28  ? 150  THR A CG2 1 
ATOM   653  N N   . ASN A 1 105 ? 24.387  4.596   -2.078  1.00 22.28  ? 151  ASN A N   1 
ATOM   654  C CA  . ASN A 1 105 ? 24.300  4.258   -3.497  1.00 22.36  ? 151  ASN A CA  1 
ATOM   655  C C   . ASN A 1 105 ? 24.523  5.492   -4.350  1.00 21.73  ? 151  ASN A C   1 
ATOM   656  O O   . ASN A 1 105 ? 25.238  5.451   -5.340  1.00 21.58  ? 151  ASN A O   1 
ATOM   657  C CB  . ASN A 1 105 ? 22.930  3.661   -3.854  1.00 21.63  ? 151  ASN A CB  1 
ATOM   658  C CG  . ASN A 1 105 ? 22.740  2.245   -3.343  1.00 24.29  ? 151  ASN A CG  1 
ATOM   659  O OD1 . ASN A 1 105 ? 23.684  1.582   -2.891  1.00 23.73  ? 151  ASN A OD1 1 
ATOM   660  N ND2 . ASN A 1 105 ? 21.502  1.760   -3.438  1.00 22.85  ? 151  ASN A ND2 1 
ATOM   661  N N   . CYS A 1 106 ? 23.899  6.592   -3.951  1.00 21.58  ? 152  CYS A N   1 
ATOM   662  C CA  . CYS A 1 106 ? 24.006  7.849   -4.681  1.00 21.63  ? 152  CYS A CA  1 
ATOM   663  C C   . CYS A 1 106 ? 25.464  8.343   -4.716  1.00 21.03  ? 152  CYS A C   1 
ATOM   664  O O   . CYS A 1 106 ? 26.000  8.677   -5.785  1.00 22.09  ? 152  CYS A O   1 
ATOM   665  C CB  . CYS A 1 106 ? 23.077  8.877   -4.034  1.00 22.68  ? 152  CYS A CB  1 
ATOM   666  S SG  . CYS A 1 106 ? 23.054  10.470  -4.839  1.00 25.82  ? 152  CYS A SG  1 
ATOM   667  N N   . TYR A 1 107 ? 26.130  8.327   -3.563  1.00 20.26  ? 153  TYR A N   1 
ATOM   668  C CA  . TYR A 1 107 ? 27.533  8.774   -3.488  1.00 19.80  ? 153  TYR A CA  1 
ATOM   669  C C   . TYR A 1 107 ? 28.502  7.884   -4.273  1.00 20.86  ? 153  TYR A C   1 
ATOM   670  O O   . TYR A 1 107 ? 29.433  8.375   -4.892  1.00 20.36  ? 153  TYR A O   1 
ATOM   671  C CB  . TYR A 1 107 ? 28.002  8.847   -2.037  1.00 19.69  ? 153  TYR A CB  1 
ATOM   672  C CG  . TYR A 1 107 ? 27.118  9.674   -1.145  1.00 20.07  ? 153  TYR A CG  1 
ATOM   673  C CD1 . TYR A 1 107 ? 26.618  10.903  -1.569  1.00 23.09  ? 153  TYR A CD1 1 
ATOM   674  C CD2 . TYR A 1 107 ? 26.802  9.245   0.133   1.00 21.90  ? 153  TYR A CD2 1 
ATOM   675  C CE1 . TYR A 1 107 ? 25.814  11.664  -0.748  1.00 22.57  ? 153  TYR A CE1 1 
ATOM   676  C CE2 . TYR A 1 107 ? 26.008  10.007  0.967   1.00 22.20  ? 153  TYR A CE2 1 
ATOM   677  C CZ  . TYR A 1 107 ? 25.506  11.212  0.510   1.00 23.18  ? 153  TYR A CZ  1 
ATOM   678  O OH  . TYR A 1 107 ? 24.704  11.983  1.312   1.00 24.26  ? 153  TYR A OH  1 
ATOM   679  N N   . ILE A 1 108 ? 28.272  6.576   -4.239  1.00 21.80  ? 154  ILE A N   1 
ATOM   680  C CA  . ILE A 1 108 ? 29.131  5.623   -4.931  1.00 21.77  ? 154  ILE A CA  1 
ATOM   681  C C   . ILE A 1 108 ? 28.984  5.727   -6.445  1.00 22.68  ? 154  ILE A C   1 
ATOM   682  O O   . ILE A 1 108 ? 29.982  5.744   -7.175  1.00 22.35  ? 154  ILE A O   1 
ATOM   683  C CB  . ILE A 1 108 ? 28.832  4.173   -4.459  1.00 22.31  ? 154  ILE A CB  1 
ATOM   684  C CG1 . ILE A 1 108 ? 29.371  3.971   -3.043  1.00 21.38  ? 154  ILE A CG1 1 
ATOM   685  C CG2 . ILE A 1 108 ? 29.440  3.152   -5.405  1.00 23.12  ? 154  ILE A CG2 1 
ATOM   686  C CD1 . ILE A 1 108 ? 28.888  2.667   -2.374  1.00 23.96  ? 154  ILE A CD1 1 
ATOM   687  N N   . TYR A 1 109 ? 27.747  5.811   -6.923  1.00 22.75  ? 155  TYR A N   1 
ATOM   688  C CA  . TYR A 1 109 ? 27.499  5.777   -8.357  1.00 23.41  ? 155  TYR A CA  1 
ATOM   689  C C   . TYR A 1 109 ? 27.869  7.090   -9.043  1.00 23.90  ? 155  TYR A C   1 
ATOM   690  O O   . TYR A 1 109 ? 28.485  7.098   -10.111 1.00 22.18  ? 155  TYR A O   1 
ATOM   691  C CB  . TYR A 1 109 ? 26.029  5.446   -8.674  1.00 23.77  ? 155  TYR A CB  1 
ATOM   692  C CG  . TYR A 1 109 ? 25.823  5.426   -10.170 1.00 25.04  ? 155  TYR A CG  1 
ATOM   693  C CD1 . TYR A 1 109 ? 26.359  4.399   -10.939 1.00 24.62  ? 155  TYR A CD1 1 
ATOM   694  C CD2 . TYR A 1 109 ? 25.183  6.474   -10.825 1.00 25.03  ? 155  TYR A CD2 1 
ATOM   695  C CE1 . TYR A 1 109 ? 26.221  4.384   -12.312 1.00 27.12  ? 155  TYR A CE1 1 
ATOM   696  C CE2 . TYR A 1 109 ? 25.042  6.473   -12.205 1.00 27.10  ? 155  TYR A CE2 1 
ATOM   697  C CZ  . TYR A 1 109 ? 25.567  5.420   -12.942 1.00 27.13  ? 155  TYR A CZ  1 
ATOM   698  O OH  . TYR A 1 109 ? 25.441  5.405   -14.307 1.00 31.64  ? 155  TYR A OH  1 
ATOM   699  N N   . ASN A 1 110 ? 27.481  8.204   -8.432  1.00 24.17  ? 156  ASN A N   1 
ATOM   700  C CA  . ASN A 1 110 ? 27.570  9.493   -9.106  1.00 26.12  ? 156  ASN A CA  1 
ATOM   701  C C   . ASN A 1 110 ? 28.941  10.141  -9.003  1.00 28.62  ? 156  ASN A C   1 
ATOM   702  O O   . ASN A 1 110 ? 29.752  9.777   -8.153  1.00 28.49  ? 156  ASN A O   1 
ATOM   703  C CB  . ASN A 1 110 ? 26.478  10.415  -8.580  1.00 25.53  ? 156  ASN A CB  1 
ATOM   704  C CG  . ASN A 1 110 ? 25.106  9.947   -8.992  1.00 24.92  ? 156  ASN A CG  1 
ATOM   705  O OD1 . ASN A 1 110 ? 24.756  10.024  -10.169 1.00 25.82  ? 156  ASN A OD1 1 
ATOM   706  N ND2 . ASN A 1 110 ? 24.327  9.432   -8.039  1.00 24.02  ? 156  ASN A ND2 1 
ATOM   707  N N   . LYS A 1 111 ? 29.187  11.094  -9.897  1.00 32.56  ? 157  LYS A N   1 
ATOM   708  C CA  . LYS A 1 111 ? 30.426  11.866  -9.895  1.00 35.12  ? 157  LYS A CA  1 
ATOM   709  C C   . LYS A 1 111 ? 30.407  12.858  -8.733  1.00 34.72  ? 157  LYS A C   1 
ATOM   710  O O   . LYS A 1 111 ? 29.345  13.346  -8.361  1.00 34.10  ? 157  LYS A O   1 
ATOM   711  C CB  . LYS A 1 111 ? 30.597  12.612  -11.216 1.00 37.58  ? 157  LYS A CB  1 
ATOM   712  C CG  . LYS A 1 111 ? 30.722  11.709  -12.441 1.00 41.25  ? 157  LYS A CG  1 
ATOM   713  C CD  . LYS A 1 111 ? 30.614  12.508  -13.729 1.00 44.71  ? 157  LYS A CD  1 
ATOM   714  C CE  . LYS A 1 111 ? 30.464  11.607  -14.946 1.00 46.96  ? 157  LYS A CE  1 
ATOM   715  N NZ  . LYS A 1 111 ? 30.329  12.398  -16.203 1.00 50.85  ? 157  LYS A NZ  1 
ATOM   716  N N   . PRO A 1 112 ? 31.585  13.164  -8.158  1.00 35.48  ? 158  PRO A N   1 
ATOM   717  C CA  . PRO A 1 112 ? 31.678  14.109  -7.035  1.00 35.82  ? 158  PRO A CA  1 
ATOM   718  C C   . PRO A 1 112 ? 30.939  15.438  -7.249  1.00 36.13  ? 158  PRO A C   1 
ATOM   719  O O   . PRO A 1 112 ? 30.377  15.988  -6.299  1.00 35.67  ? 158  PRO A O   1 
ATOM   720  C CB  . PRO A 1 112 ? 33.186  14.372  -6.929  1.00 37.24  ? 158  PRO A CB  1 
ATOM   721  C CG  . PRO A 1 112 ? 33.821  13.159  -7.477  1.00 37.03  ? 158  PRO A CG  1 
ATOM   722  C CD  . PRO A 1 112 ? 32.912  12.656  -8.555  1.00 36.34  ? 158  PRO A CD  1 
ATOM   723  N N   . THR A 1 113 ? 30.946  15.929  -8.487  1.00 36.68  ? 159  THR A N   1 
ATOM   724  C CA  . THR A 1 113 ? 30.403  17.244  -8.837  1.00 37.86  ? 159  THR A CA  1 
ATOM   725  C C   . THR A 1 113 ? 28.926  17.250  -9.271  1.00 36.79  ? 159  THR A C   1 
ATOM   726  O O   . THR A 1 113 ? 28.384  18.308  -9.604  1.00 37.64  ? 159  THR A O   1 
ATOM   727  C CB  . THR A 1 113 ? 31.226  17.854  -9.979  1.00 39.80  ? 159  THR A CB  1 
ATOM   728  O OG1 . THR A 1 113 ? 31.265  16.928  -11.076 1.00 40.25  ? 159  THR A OG1 1 
ATOM   729  C CG2 . THR A 1 113 ? 32.648  18.147  -9.509  1.00 41.75  ? 159  THR A CG2 1 
ATOM   730  N N   . ASP A 1 114 ? 28.284  16.082  -9.276  1.00 34.49  ? 160  ASP A N   1 
ATOM   731  C CA  . ASP A 1 114 ? 26.874  15.975  -9.661  1.00 33.35  ? 160  ASP A CA  1 
ATOM   732  C C   . ASP A 1 114 ? 25.976  16.603  -8.592  1.00 31.86  ? 160  ASP A C   1 
ATOM   733  O O   . ASP A 1 114 ? 26.213  16.426  -7.399  1.00 30.22  ? 160  ASP A O   1 
ATOM   734  C CB  . ASP A 1 114 ? 26.483  14.502  -9.868  1.00 32.85  ? 160  ASP A CB  1 
ATOM   735  C CG  . ASP A 1 114 ? 27.081  13.897  -11.133 1.00 35.52  ? 160  ASP A CG  1 
ATOM   736  O OD1 . ASP A 1 114 ? 27.434  14.654  -12.062 1.00 37.68  ? 160  ASP A OD1 1 
ATOM   737  O OD2 . ASP A 1 114 ? 27.183  12.651  -11.208 1.00 36.79  ? 160  ASP A OD2 1 
ATOM   738  N N   . ASP A 1 115 ? 24.946  17.330  -9.030  1.00 31.26  ? 161  ASP A N   1 
ATOM   739  C CA  . ASP A 1 115 ? 24.000  17.978  -8.118  1.00 30.57  ? 161  ASP A CA  1 
ATOM   740  C C   . ASP A 1 115 ? 23.274  16.985  -7.208  1.00 27.57  ? 161  ASP A C   1 
ATOM   741  O O   . ASP A 1 115 ? 22.935  17.321  -6.077  1.00 25.76  ? 161  ASP A O   1 
ATOM   742  C CB  . ASP A 1 115 ? 22.938  18.772  -8.890  1.00 31.89  ? 161  ASP A CB  1 
ATOM   743  C CG  . ASP A 1 115 ? 23.493  20.012  -9.571  1.00 36.57  ? 161  ASP A CG  1 
ATOM   744  O OD1 . ASP A 1 115 ? 24.638  20.427  -9.291  1.00 39.17  ? 161  ASP A OD1 1 
ATOM   745  O OD2 . ASP A 1 115 ? 22.756  20.579  -10.399 1.00 42.18  ? 161  ASP A OD2 1 
ATOM   746  N N   . ILE A 1 116 ? 23.020  15.776  -7.704  1.00 25.99  ? 162  ILE A N   1 
ATOM   747  C CA  . ILE A 1 116 ? 22.320  14.763  -6.915  1.00 25.53  ? 162  ILE A CA  1 
ATOM   748  C C   . ILE A 1 116 ? 23.045  14.469  -5.590  1.00 24.12  ? 162  ILE A C   1 
ATOM   749  O O   . ILE A 1 116 ? 22.409  14.215  -4.567  1.00 23.49  ? 162  ILE A O   1 
ATOM   750  C CB  . ILE A 1 116 ? 22.086  13.458  -7.733  1.00 25.28  ? 162  ILE A CB  1 
ATOM   751  C CG1 . ILE A 1 116 ? 21.067  12.554  -7.037  1.00 26.09  ? 162  ILE A CG1 1 
ATOM   752  C CG2 . ILE A 1 116 ? 23.410  12.719  -7.997  1.00 25.45  ? 162  ILE A CG2 1 
ATOM   753  C CD1 . ILE A 1 116 ? 19.659  13.105  -7.024  1.00 29.03  ? 162  ILE A CD1 1 
ATOM   754  N N   . VAL A 1 117 ? 24.370  14.541  -5.605  1.00 24.01  ? 163  VAL A N   1 
ATOM   755  C CA  . VAL A 1 117 ? 25.173  14.304  -4.402  1.00 24.02  ? 163  VAL A CA  1 
ATOM   756  C C   . VAL A 1 117 ? 24.911  15.368  -3.326  1.00 24.18  ? 163  VAL A C   1 
ATOM   757  O O   . VAL A 1 117 ? 24.748  15.047  -2.141  1.00 23.77  ? 163  VAL A O   1 
ATOM   758  C CB  . VAL A 1 117 ? 26.668  14.221  -4.769  1.00 24.68  ? 163  VAL A CB  1 
ATOM   759  C CG1 . VAL A 1 117 ? 27.548  14.305  -3.529  1.00 27.32  ? 163  VAL A CG1 1 
ATOM   760  C CG2 . VAL A 1 117 ? 26.931  12.927  -5.546  1.00 25.62  ? 163  VAL A CG2 1 
ATOM   761  N N   . LEU A 1 118 ? 24.816  16.622  -3.757  1.00 25.11  ? 164  LEU A N   1 
ATOM   762  C CA  . LEU A 1 118 ? 24.479  17.734  -2.868  1.00 26.64  ? 164  LEU A CA  1 
ATOM   763  C C   . LEU A 1 118 ? 23.081  17.567  -2.284  1.00 25.48  ? 164  LEU A C   1 
ATOM   764  O O   . LEU A 1 118 ? 22.850  17.821  -1.102  1.00 25.38  ? 164  LEU A O   1 
ATOM   765  C CB  . LEU A 1 118 ? 24.551  19.047  -3.649  1.00 29.22  ? 164  LEU A CB  1 
ATOM   766  C CG  . LEU A 1 118 ? 24.436  20.345  -2.865  1.00 34.95  ? 164  LEU A CG  1 
ATOM   767  C CD1 . LEU A 1 118 ? 25.522  20.406  -1.780  1.00 37.79  ? 164  LEU A CD1 1 
ATOM   768  C CD2 . LEU A 1 118 ? 24.560  21.531  -3.816  1.00 37.35  ? 164  LEU A CD2 1 
ATOM   769  N N   . MET A 1 119 ? 22.153  17.144  -3.131  1.00 25.09  ? 165  MET A N   1 
ATOM   770  C CA  . MET A 1 119 ? 20.777  16.912  -2.717  1.00 25.00  ? 165  MET A CA  1 
ATOM   771  C C   . MET A 1 119 ? 20.703  15.774  -1.694  1.00 23.98  ? 165  MET A C   1 
ATOM   772  O O   . MET A 1 119 ? 20.031  15.898  -0.669  1.00 24.32  ? 165  MET A O   1 
ATOM   773  C CB  . MET A 1 119 ? 19.914  16.616  -3.946  1.00 25.39  ? 165  MET A CB  1 
ATOM   774  C CG  . MET A 1 119 ? 19.811  17.794  -4.906  1.00 26.88  ? 165  MET A CG  1 
ATOM   775  S SD  . MET A 1 119 ? 19.001  17.394  -6.461  1.00 28.34  ? 165  MET A SD  1 
ATOM   776  C CE  . MET A 1 119 ? 17.277  17.608  -6.004  1.00 30.98  ? 165  MET A CE  1 
ATOM   777  N N   . ALA A 1 120 ? 21.405  14.677  -1.973  1.00 23.13  ? 166  ALA A N   1 
ATOM   778  C CA  . ALA A 1 120 ? 21.496  13.551  -1.048  1.00 23.23  ? 166  ALA A CA  1 
ATOM   779  C C   . ALA A 1 120 ? 22.072  13.983  0.304   1.00 23.06  ? 166  ALA A C   1 
ATOM   780  O O   . ALA A 1 120 ? 21.531  13.637  1.356   1.00 23.21  ? 166  ALA A O   1 
ATOM   781  C CB  . ALA A 1 120 ? 22.337  12.408  -1.660  1.00 21.73  ? 166  ALA A CB  1 
ATOM   782  N N   . GLN A 1 121 ? 23.153  14.749  0.271   1.00 24.08  ? 167  GLN A N   1 
ATOM   783  C CA  . GLN A 1 121 ? 23.776  15.270  1.498   1.00 25.41  ? 167  GLN A CA  1 
ATOM   784  C C   . GLN A 1 121 ? 22.831  16.124  2.330   1.00 25.39  ? 167  GLN A C   1 
ATOM   785  O O   . GLN A 1 121 ? 22.807  16.022  3.561   1.00 25.51  ? 167  GLN A O   1 
ATOM   786  C CB  . GLN A 1 121 ? 25.023  16.092  1.159   1.00 27.16  ? 167  GLN A CB  1 
ATOM   787  C CG  . GLN A 1 121 ? 26.260  15.256  0.973   1.00 28.62  ? 167  GLN A CG  1 
ATOM   788  C CD  . GLN A 1 121 ? 26.818  14.773  2.301   1.00 31.77  ? 167  GLN A CD  1 
ATOM   789  O OE1 . GLN A 1 121 ? 26.508  13.663  2.760   1.00 32.98  ? 167  GLN A OE1 1 
ATOM   790  N NE2 . GLN A 1 121 ? 27.623  15.614  2.939   1.00 30.55  ? 167  GLN A NE2 1 
ATOM   791  N N   . THR A 1 122 ? 22.066  16.981  1.658   1.00 24.97  ? 168  THR A N   1 
ATOM   792  C CA  . THR A 1 122 ? 21.116  17.842  2.343   1.00 25.25  ? 168  THR A CA  1 
ATOM   793  C C   . THR A 1 122 ? 20.081  16.999  3.073   1.00 24.81  ? 168  THR A C   1 
ATOM   794  O O   . THR A 1 122 ? 19.779  17.242  4.239   1.00 25.56  ? 168  THR A O   1 
ATOM   795  C CB  . THR A 1 122 ? 20.404  18.803  1.372   1.00 25.81  ? 168  THR A CB  1 
ATOM   796  O OG1 . THR A 1 122 ? 21.371  19.632  0.725   1.00 26.92  ? 168  THR A OG1 1 
ATOM   797  C CG2 . THR A 1 122 ? 19.408  19.695  2.120   1.00 25.76  ? 168  THR A CG2 1 
ATOM   798  N N   . LEU A 1 123 ? 19.547  16.004  2.380   1.00 24.67  ? 169  LEU A N   1 
ATOM   799  C CA  . LEU A 1 123 ? 18.553  15.115  2.960   1.00 25.12  ? 169  LEU A CA  1 
ATOM   800  C C   . LEU A 1 123 ? 19.167  14.268  4.077   1.00 25.22  ? 169  LEU A C   1 
ATOM   801  O O   . LEU A 1 123 ? 18.543  14.058  5.113   1.00 24.47  ? 169  LEU A O   1 
ATOM   802  C CB  . LEU A 1 123 ? 17.965  14.208  1.884   1.00 24.76  ? 169  LEU A CB  1 
ATOM   803  C CG  . LEU A 1 123 ? 17.217  14.923  0.753   1.00 26.22  ? 169  LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 123 ? 16.995  13.979  -0.411  1.00 24.65  ? 169  LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 123 ? 15.894  15.481  1.264   1.00 26.89  ? 169  LEU A CD2 1 
ATOM   806  N N   . GLU A 1 124 ? 20.391  13.793  3.871   1.00 25.30  ? 170  GLU A N   1 
ATOM   807  C CA  . GLU A 1 124 ? 21.034  12.949  4.884   1.00 26.75  ? 170  GLU A CA  1 
ATOM   808  C C   . GLU A 1 124 ? 21.346  13.718  6.173   1.00 26.97  ? 170  GLU A C   1 
ATOM   809  O O   . GLU A 1 124 ? 21.274  13.148  7.263   1.00 26.73  ? 170  GLU A O   1 
ATOM   810  C CB  . GLU A 1 124 ? 22.276  12.250  4.341   1.00 27.09  ? 170  GLU A CB  1 
ATOM   811  C CG  . GLU A 1 124 ? 22.690  11.048  5.182   1.00 29.38  ? 170  GLU A CG  1 
ATOM   812  C CD  . GLU A 1 124 ? 23.642  10.114  4.478   1.00 31.36  ? 170  GLU A CD  1 
ATOM   813  O OE1 . GLU A 1 124 ? 24.438  10.590  3.641   1.00 30.53  ? 170  GLU A OE1 1 
ATOM   814  O OE2 . GLU A 1 124 ? 23.623  8.905   4.801   1.00 33.25  ? 170  GLU A OE2 1 
ATOM   815  N N   . LYS A 1 125 ? 21.661  15.010  6.052   1.00 27.66  ? 171  LYS A N   1 
ATOM   816  C CA  . LYS A 1 125 ? 21.837  15.869  7.222   1.00 28.44  ? 171  LYS A CA  1 
ATOM   817  C C   . LYS A 1 125 ? 20.584  15.871  8.084   1.00 28.48  ? 171  LYS A C   1 
ATOM   818  O O   . LYS A 1 125 ? 20.669  15.734  9.301   1.00 28.70  ? 171  LYS A O   1 
ATOM   819  C CB  . LYS A 1 125 ? 22.160  17.314  6.831   1.00 29.80  ? 171  LYS A CB  1 
ATOM   820  C CG  . LYS A 1 125 ? 22.303  18.243  8.041   1.00 32.42  ? 171  LYS A CG  1 
ATOM   821  C CD  . LYS A 1 125 ? 22.663  19.676  7.665   1.00 35.03  ? 171  LYS A CD  1 
ATOM   822  C CE  . LYS A 1 125 ? 22.719  20.557  8.907   1.00 38.82  ? 171  LYS A CE  1 
ATOM   823  N NZ  . LYS A 1 125 ? 22.924  22.004  8.606   1.00 40.94  ? 171  LYS A NZ  1 
ATOM   824  N N   A ILE A 1 126 ? 19.428  16.045  7.444   0.50 28.17  ? 172  ILE A N   1 
ATOM   825  N N   B ILE A 1 126 ? 19.427  16.045  7.445   0.50 28.42  ? 172  ILE A N   1 
ATOM   826  C CA  A ILE A 1 126 ? 18.144  16.039  8.140   0.50 28.52  ? 172  ILE A CA  1 
ATOM   827  C CA  B ILE A 1 126 ? 18.144  16.038  8.144   0.50 28.97  ? 172  ILE A CA  1 
ATOM   828  C C   A ILE A 1 126 ? 17.884  14.671  8.768   0.50 28.52  ? 172  ILE A C   1 
ATOM   829  C C   B ILE A 1 126 ? 17.891  14.670  8.773   0.50 28.76  ? 172  ILE A C   1 
ATOM   830  O O   A ILE A 1 126 ? 17.447  14.581  9.916   0.50 29.31  ? 172  ILE A O   1 
ATOM   831  O O   B ILE A 1 126 ? 17.465  14.578  9.925   0.50 29.54  ? 172  ILE A O   1 
ATOM   832  C CB  A ILE A 1 126 ? 16.990  16.394  7.178   0.50 28.36  ? 172  ILE A CB  1 
ATOM   833  C CB  B ILE A 1 126 ? 16.979  16.379  7.189   0.50 29.13  ? 172  ILE A CB  1 
ATOM   834  C CG1 A ILE A 1 126 ? 17.109  17.852  6.721   0.50 28.46  ? 172  ILE A CG1 1 
ATOM   835  C CG1 B ILE A 1 126 ? 17.183  17.762  6.567   0.50 29.81  ? 172  ILE A CG1 1 
ATOM   836  C CG2 A ILE A 1 126 ? 15.646  16.154  7.844   0.50 29.35  ? 172  ILE A CG2 1 
ATOM   837  C CG2 B ILE A 1 126 ? 15.651  16.324  7.924   0.50 30.29  ? 172  ILE A CG2 1 
ATOM   838  C CD1 A ILE A 1 126 ? 16.230  18.195  5.532   0.50 27.33  ? 172  ILE A CD1 1 
ATOM   839  C CD1 B ILE A 1 126 ? 17.289  18.875  7.576   0.50 31.11  ? 172  ILE A CD1 1 
ATOM   840  N N   . PHE A 1 127 ? 18.159  13.613  8.010   1.00 27.45  ? 173  PHE A N   1 
ATOM   841  C CA  . PHE A 1 127 ? 18.056  12.238  8.516   1.00 27.67  ? 173  PHE A CA  1 
ATOM   842  C C   . PHE A 1 127 ? 18.845  12.093  9.826   1.00 27.92  ? 173  PHE A C   1 
ATOM   843  O O   . PHE A 1 127 ? 18.304  11.640  10.840  1.00 28.02  ? 173  PHE A O   1 
ATOM   844  C CB  . PHE A 1 127 ? 18.568  11.250  7.456   1.00 26.67  ? 173  PHE A CB  1 
ATOM   845  C CG  . PHE A 1 127 ? 18.698  9.835   7.946   1.00 27.74  ? 173  PHE A CG  1 
ATOM   846  C CD1 . PHE A 1 127 ? 17.565  9.054   8.160   1.00 28.41  ? 173  PHE A CD1 1 
ATOM   847  C CD2 . PHE A 1 127 ? 19.948  9.278   8.185   1.00 29.11  ? 173  PHE A CD2 1 
ATOM   848  C CE1 . PHE A 1 127 ? 17.676  7.742   8.610   1.00 28.60  ? 173  PHE A CE1 1 
ATOM   849  C CE2 . PHE A 1 127 ? 20.071  7.965   8.628   1.00 30.68  ? 173  PHE A CE2 1 
ATOM   850  C CZ  . PHE A 1 127 ? 18.924  7.197   8.847   1.00 29.59  ? 173  PHE A CZ  1 
ATOM   851  N N   . LEU A 1 128 ? 20.102  12.533  9.811   1.00 27.38  ? 174  LEU A N   1 
ATOM   852  C CA  . LEU A 1 128 ? 20.973  12.394  10.979  1.00 29.15  ? 174  LEU A CA  1 
ATOM   853  C C   . LEU A 1 128 ? 20.519  13.261  12.152  1.00 31.05  ? 174  LEU A C   1 
ATOM   854  O O   . LEU A 1 128 ? 20.532  12.808  13.302  1.00 31.38  ? 174  LEU A O   1 
ATOM   855  C CB  . LEU A 1 128 ? 22.425  12.707  10.619  1.00 29.22  ? 174  LEU A CB  1 
ATOM   856  C CG  . LEU A 1 128 ? 23.093  11.700  9.685   1.00 29.34  ? 174  LEU A CG  1 
ATOM   857  C CD1 . LEU A 1 128 ? 24.383  12.272  9.142   1.00 31.81  ? 174  LEU A CD1 1 
ATOM   858  C CD2 . LEU A 1 128 ? 23.353  10.375  10.405  1.00 30.41  ? 174  LEU A CD2 1 
ATOM   859  N N   . GLN A 1 129 ? 20.119  14.500  11.859  1.00 31.30  ? 175  GLN A N   1 
ATOM   860  C CA  . GLN A 1 129 ? 19.622  15.402  12.885  1.00 34.07  ? 175  GLN A CA  1 
ATOM   861  C C   . GLN A 1 129 ? 18.415  14.800  13.595  1.00 34.69  ? 175  GLN A C   1 
ATOM   862  O O   . GLN A 1 129 ? 18.368  14.780  14.822  1.00 35.34  ? 175  GLN A O   1 
ATOM   863  C CB  . GLN A 1 129 ? 19.270  16.772  12.295  1.00 35.14  ? 175  GLN A CB  1 
ATOM   864  C CG  . GLN A 1 129 ? 20.491  17.630  12.043  1.00 38.38  ? 175  GLN A CG  1 
ATOM   865  C CD  . GLN A 1 129 ? 20.160  18.981  11.451  1.00 41.22  ? 175  GLN A CD  1 
ATOM   866  O OE1 . GLN A 1 129 ? 19.218  19.121  10.666  1.00 43.35  ? 175  GLN A OE1 1 
ATOM   867  N NE2 . GLN A 1 129 ? 20.948  19.989  11.813  1.00 44.10  ? 175  GLN A NE2 1 
ATOM   868  N N   . LYS A 1 130 ? 17.466  14.283  12.816  1.00 34.32  ? 176  LYS A N   1 
ATOM   869  C CA  . LYS A 1 130 ? 16.270  13.659  13.375  1.00 36.20  ? 176  LYS A CA  1 
ATOM   870  C C   . LYS A 1 130 ? 16.594  12.356  14.121  1.00 36.54  ? 176  LYS A C   1 
ATOM   871  O O   . LYS A 1 130 ? 16.076  12.118  15.215  1.00 37.19  ? 176  LYS A O   1 
ATOM   872  C CB  . LYS A 1 130 ? 15.232  13.390  12.279  1.00 36.02  ? 176  LYS A CB  1 
ATOM   873  C CG  . LYS A 1 130 ? 14.709  14.637  11.554  1.00 38.02  ? 176  LYS A CG  1 
ATOM   874  C CD  . LYS A 1 130 ? 13.988  15.602  12.463  1.00 39.80  ? 176  LYS A CD  1 
ATOM   875  C CE  . LYS A 1 130 ? 13.344  16.723  11.655  1.00 41.39  ? 176  LYS A CE  1 
ATOM   876  N NZ  . LYS A 1 130 ? 12.844  17.819  12.516  1.00 42.01  ? 176  LYS A NZ  1 
ATOM   877  N N   . VAL A 1 131 ? 17.458  11.524  13.540  1.00 35.31  ? 177  VAL A N   1 
ATOM   878  C CA  . VAL A 1 131 ? 17.824  10.245  14.162  1.00 35.94  ? 177  VAL A CA  1 
ATOM   879  C C   . VAL A 1 131 ? 18.514  10.428  15.518  1.00 36.98  ? 177  VAL A C   1 
ATOM   880  O O   . VAL A 1 131 ? 18.381  9.579   16.406  1.00 37.73  ? 177  VAL A O   1 
ATOM   881  C CB  . VAL A 1 131 ? 18.688  9.374   13.219  1.00 34.96  ? 177  VAL A CB  1 
ATOM   882  C CG1 . VAL A 1 131 ? 19.371  8.240   13.985  1.00 36.90  ? 177  VAL A CG1 1 
ATOM   883  C CG2 . VAL A 1 131 ? 17.824  8.814   12.096  1.00 35.42  ? 177  VAL A CG2 1 
ATOM   884  N N   . ALA A 1 132 ? 19.222  11.544  15.684  1.00 36.95  ? 178  ALA A N   1 
ATOM   885  C CA  . ALA A 1 132 ? 19.811  11.908  16.977  1.00 38.65  ? 178  ALA A CA  1 
ATOM   886  C C   . ALA A 1 132 ? 18.779  11.976  18.120  1.00 40.68  ? 178  ALA A C   1 
ATOM   887  O O   . ALA A 1 132 ? 19.137  11.772  19.279  1.00 42.19  ? 178  ALA A O   1 
ATOM   888  C CB  . ALA A 1 132 ? 20.542  13.236  16.867  1.00 38.55  ? 178  ALA A CB  1 
ATOM   889  N N   . SER A 1 133 ? 17.520  12.272  17.791  1.00 41.03  ? 179  SER A N   1 
ATOM   890  C CA  . SER A 1 133 ? 16.444  12.395  18.795  1.00 43.42  ? 179  SER A CA  1 
ATOM   891  C C   . SER A 1 133 ? 15.449  11.227  18.795  1.00 43.97  ? 179  SER A C   1 
ATOM   892  O O   . SER A 1 133 ? 14.379  11.315  19.408  1.00 44.30  ? 179  SER A O   1 
ATOM   893  C CB  . SER A 1 133 ? 15.686  13.712  18.592  1.00 43.51  ? 179  SER A CB  1 
ATOM   894  O OG  . SER A 1 133 ? 16.519  14.820  18.880  1.00 45.83  ? 179  SER A OG  1 
ATOM   895  N N   . MET A 1 134 ? 15.804  10.132  18.131  1.00 43.24  ? 180  MET A N   1 
ATOM   896  C CA  . MET A 1 134 ? 14.965  8.935   18.110  1.00 45.03  ? 180  MET A CA  1 
ATOM   897  C C   . MET A 1 134 ? 14.932  8.295   19.501  1.00 47.97  ? 180  MET A C   1 
ATOM   898  O O   . MET A 1 134 ? 15.927  8.350   20.228  1.00 47.08  ? 180  MET A O   1 
ATOM   899  C CB  . MET A 1 134 ? 15.517  7.930   17.092  1.00 44.14  ? 180  MET A CB  1 
ATOM   900  C CG  . MET A 1 134 ? 14.661  6.683   16.897  1.00 45.30  ? 180  MET A CG  1 
ATOM   901  S SD  . MET A 1 134 ? 15.317  5.588   15.624  1.00 46.12  ? 180  MET A SD  1 
ATOM   902  C CE  . MET A 1 134 ? 16.985  5.355   16.233  1.00 44.60  ? 180  MET A CE  1 
ATOM   903  N N   . PRO A 1 135 ? 13.786  7.693   19.881  1.00 51.58  ? 181  PRO A N   1 
ATOM   904  C CA  . PRO A 1 135 ? 13.721  6.946   21.143  1.00 55.35  ? 181  PRO A CA  1 
ATOM   905  C C   . PRO A 1 135 ? 14.845  5.914   21.268  1.00 56.77  ? 181  PRO A C   1 
ATOM   906  O O   . PRO A 1 135 ? 15.185  5.254   20.289  1.00 55.05  ? 181  PRO A O   1 
ATOM   907  C CB  . PRO A 1 135 ? 12.358  6.257   21.066  1.00 56.30  ? 181  PRO A CB  1 
ATOM   908  C CG  . PRO A 1 135 ? 11.528  7.179   20.257  1.00 54.91  ? 181  PRO A CG  1 
ATOM   909  C CD  . PRO A 1 135 ? 12.459  7.798   19.245  1.00 51.82  ? 181  PRO A CD  1 
ATOM   910  N N   . GLN A 1 136 ? 15.407  5.785   22.466  1.00 60.70  ? 182  GLN A N   1 
ATOM   911  C CA  . GLN A 1 136 ? 16.640  5.017   22.671  1.00 62.99  ? 182  GLN A CA  1 
ATOM   912  C C   . GLN A 1 136 ? 16.434  3.500   22.752  1.00 65.64  ? 182  GLN A C   1 
ATOM   913  O O   . GLN A 1 136 ? 17.198  2.740   22.154  1.00 64.96  ? 182  GLN A O   1 
ATOM   914  C CB  . GLN A 1 136 ? 17.390  5.522   23.912  1.00 64.63  ? 182  GLN A CB  1 
ATOM   915  C CG  . GLN A 1 136 ? 16.697  5.272   25.247  1.00 68.02  ? 182  GLN A CG  1 
ATOM   916  C CD  . GLN A 1 136 ? 17.176  6.212   26.341  1.00 69.87  ? 182  GLN A CD  1 
ATOM   917  O OE1 . GLN A 1 136 ? 17.033  7.432   26.237  1.00 69.12  ? 182  GLN A OE1 1 
ATOM   918  N NE2 . GLN A 1 136 ? 17.739  5.646   27.404  1.00 72.21  ? 182  GLN A NE2 1 
ATOM   919  N N   . GLU A 1 137 ? 15.412  3.066   23.486  1.00 69.29  ? 183  GLU A N   1 
ATOM   920  C CA  . GLU A 1 137 ? 15.133  1.638   23.662  1.00 72.02  ? 183  GLU A CA  1 
ATOM   921  C C   . GLU A 1 137 ? 13.922  1.213   22.840  1.00 72.38  ? 183  GLU A C   1 
ATOM   922  O O   . GLU A 1 137 ? 12.815  1.721   23.043  1.00 73.41  ? 183  GLU A O   1 
ATOM   923  C CB  . GLU A 1 137 ? 14.898  1.308   25.138  1.00 75.27  ? 183  GLU A CB  1 
ATOM   924  C CG  . GLU A 1 137 ? 16.172  1.261   25.965  1.00 77.31  ? 183  GLU A CG  1 
ATOM   925  C CD  . GLU A 1 137 ? 15.911  0.933   27.421  1.00 81.62  ? 183  GLU A CD  1 
ATOM   926  O OE1 . GLU A 1 137 ? 15.341  -0.146  27.698  1.00 84.29  ? 183  GLU A OE1 1 
ATOM   927  O OE2 . GLU A 1 137 ? 16.283  1.751   28.290  1.00 83.54  ? 183  GLU A OE2 1 
ATOM   928  N N   . GLU A 1 138 ? 14.138  0.272   21.922  1.00 71.73  ? 184  GLU A N   1 
ATOM   929  C CA  . GLU A 1 138 ? 13.072  -0.223  21.057  1.00 71.92  ? 184  GLU A CA  1 
ATOM   930  C C   . GLU A 1 138 ? 12.073  -1.072  21.843  1.00 75.25  ? 184  GLU A C   1 
ATOM   931  O O   . GLU A 1 138 ? 12.420  -2.139  22.349  1.00 76.62  ? 184  GLU A O   1 
ATOM   932  C CB  . GLU A 1 138 ? 13.654  -1.038  19.900  1.00 70.01  ? 184  GLU A CB  1 
ATOM   933  C CG  . GLU A 1 138 ? 12.648  -1.342  18.793  1.00 68.71  ? 184  GLU A CG  1 
ATOM   934  C CD  . GLU A 1 138 ? 13.289  -1.398  17.416  1.00 65.52  ? 184  GLU A CD  1 
ATOM   935  O OE1 . GLU A 1 138 ? 14.349  -2.042  17.274  1.00 64.30  ? 184  GLU A OE1 1 
ATOM   936  O OE2 . GLU A 1 138 ? 12.733  -0.795  16.473  1.00 61.67  ? 184  GLU A OE2 1 
ATOM   937  N N   . GLN A 1 139 ? 10.842  -0.577  21.948  1.00 76.99  ? 185  GLN A N   1 
ATOM   938  C CA  . GLN A 1 139 ? 9.753   -1.297  22.603  1.00 80.10  ? 185  GLN A CA  1 
ATOM   939  C C   . GLN A 1 139 ? 8.661   -1.577  21.576  1.00 80.35  ? 185  GLN A C   1 
ATOM   940  O O   . GLN A 1 139 ? 8.162   -0.651  20.932  1.00 79.21  ? 185  GLN A O   1 
ATOM   941  C CB  . GLN A 1 139 ? 9.187   -0.474  23.760  1.00 82.03  ? 185  GLN A CB  1 
ATOM   942  N N   . GLU A 1 140 ? 8.299   -2.851  21.422  1.00 81.93  ? 186  GLU A N   1 
ATOM   943  C CA  . GLU A 1 140 ? 7.283   -3.263  20.450  1.00 82.33  ? 186  GLU A CA  1 
ATOM   944  C C   . GLU A 1 140 ? 5.915   -2.668  20.784  1.00 84.11  ? 186  GLU A C   1 
ATOM   945  O O   . GLU A 1 140 ? 5.576   -2.482  21.952  1.00 86.42  ? 186  GLU A O   1 
ATOM   946  C CB  . GLU A 1 140 ? 7.183   -4.791  20.397  1.00 84.06  ? 186  GLU A CB  1 
ATOM   947  C CG  . GLU A 1 140 ? 6.276   -5.327  19.290  1.00 84.41  ? 186  GLU A CG  1 
ATOM   948  C CD  . GLU A 1 140 ? 6.179   -6.845  19.281  1.00 86.56  ? 186  GLU A CD  1 
ATOM   949  O OE1 . GLU A 1 140 ? 6.422   -7.477  20.332  1.00 88.43  ? 186  GLU A OE1 1 
ATOM   950  O OE2 . GLU A 1 140 ? 5.846   -7.408  18.217  1.00 86.49  ? 186  GLU A OE2 1 
ATOM   951  N N   . PRO B 1 26  ? 31.960  27.025  22.903  1.00 64.95  ? 72   PRO B N   1 
ATOM   952  C CA  . PRO B 1 26  ? 32.482  26.164  21.833  1.00 62.93  ? 72   PRO B CA  1 
ATOM   953  C C   . PRO B 1 26  ? 31.725  24.839  21.721  1.00 61.21  ? 72   PRO B C   1 
ATOM   954  O O   . PRO B 1 26  ? 31.154  24.535  20.672  1.00 59.80  ? 72   PRO B O   1 
ATOM   955  C CB  . PRO B 1 26  ? 33.951  25.949  22.233  1.00 63.37  ? 72   PRO B CB  1 
ATOM   956  C CG  . PRO B 1 26  ? 34.279  27.091  23.128  1.00 66.15  ? 72   PRO B CG  1 
ATOM   957  C CD  . PRO B 1 26  ? 33.012  27.452  23.841  1.00 66.80  ? 72   PRO B CD  1 
ATOM   958  N N   . GLY B 1 27  ? 31.720  24.069  22.804  1.00 61.39  ? 73   GLY B N   1 
ATOM   959  C CA  . GLY B 1 27  ? 30.940  22.843  22.888  1.00 59.93  ? 73   GLY B CA  1 
ATOM   960  C C   . GLY B 1 27  ? 30.639  22.535  24.340  1.00 60.97  ? 73   GLY B C   1 
ATOM   961  O O   . GLY B 1 27  ? 30.757  23.406  25.202  1.00 62.52  ? 73   GLY B O   1 
ATOM   962  N N   . ARG B 1 28  ? 30.255  21.294  24.612  1.00 59.93  ? 74   ARG B N   1 
ATOM   963  C CA  . ARG B 1 28  ? 29.931  20.872  25.973  1.00 61.14  ? 74   ARG B CA  1 
ATOM   964  C C   . ARG B 1 28  ? 29.939  19.351  26.085  1.00 59.58  ? 74   ARG B C   1 
ATOM   965  O O   . ARG B 1 28  ? 30.070  18.649  25.080  1.00 57.69  ? 74   ARG B O   1 
ATOM   966  C CB  . ARG B 1 28  ? 28.563  21.423  26.384  1.00 62.55  ? 74   ARG B CB  1 
ATOM   967  C CG  . ARG B 1 28  ? 27.414  20.950  25.506  1.00 61.62  ? 74   ARG B CG  1 
ATOM   968  C CD  . ARG B 1 28  ? 26.280  21.964  25.463  1.00 63.82  ? 74   ARG B CD  1 
ATOM   969  N NE  . ARG B 1 28  ? 25.271  21.578  24.476  1.00 63.65  ? 74   ARG B NE  1 
ATOM   970  C CZ  . ARG B 1 28  ? 24.057  21.094  24.747  1.00 64.42  ? 74   ARG B CZ  1 
ATOM   971  N NH1 . ARG B 1 28  ? 23.637  20.928  25.998  1.00 66.18  ? 74   ARG B NH1 1 
ATOM   972  N NH2 . ARG B 1 28  ? 23.247  20.778  23.741  1.00 63.51  ? 74   ARG B NH2 1 
ATOM   973  N N   . VAL B 1 29  ? 29.807  18.855  27.313  1.00 60.14  ? 75   VAL B N   1 
ATOM   974  C CA  . VAL B 1 29  ? 29.713  17.420  27.564  1.00 58.90  ? 75   VAL B CA  1 
ATOM   975  C C   . VAL B 1 29  ? 28.244  17.037  27.710  1.00 58.05  ? 75   VAL B C   1 
ATOM   976  O O   . VAL B 1 29  ? 27.542  17.579  28.565  1.00 60.04  ? 75   VAL B O   1 
ATOM   977  C CB  . VAL B 1 29  ? 30.466  17.010  28.852  1.00 60.71  ? 75   VAL B CB  1 
ATOM   978  C CG1 . VAL B 1 29  ? 30.504  15.490  28.985  1.00 60.46  ? 75   VAL B CG1 1 
ATOM   979  C CG2 . VAL B 1 29  ? 31.877  17.582  28.854  1.00 61.17  ? 75   VAL B CG2 1 
ATOM   980  N N   . THR B 1 30  ? 27.781  16.113  26.868  1.00 54.89  ? 76   THR B N   1 
ATOM   981  C CA  . THR B 1 30  ? 26.422  15.581  26.973  1.00 53.90  ? 76   THR B CA  1 
ATOM   982  C C   . THR B 1 30  ? 26.457  14.059  27.094  1.00 52.33  ? 76   THR B C   1 
ATOM   983  O O   . THR B 1 30  ? 27.454  13.421  26.743  1.00 50.60  ? 76   THR B O   1 
ATOM   984  C CB  . THR B 1 30  ? 25.548  15.967  25.754  1.00 52.34  ? 76   THR B CB  1 
ATOM   985  O OG1 . THR B 1 30  ? 25.891  15.148  24.627  1.00 50.52  ? 76   THR B OG1 1 
ATOM   986  C CG2 . THR B 1 30  ? 25.731  17.438  25.392  1.00 52.03  ? 76   THR B CG2 1 
ATOM   987  N N   . ASN B 1 31  ? 25.362  13.489  27.592  1.00 52.09  ? 77   ASN B N   1 
ATOM   988  C CA  . ASN B 1 31  ? 25.194  12.036  27.628  1.00 51.35  ? 77   ASN B CA  1 
ATOM   989  C C   . ASN B 1 31  ? 25.356  11.398  26.238  1.00 48.48  ? 77   ASN B C   1 
ATOM   990  O O   . ASN B 1 31  ? 25.982  10.344  26.097  1.00 47.53  ? 77   ASN B O   1 
ATOM   991  C CB  . ASN B 1 31  ? 23.831  11.665  28.231  1.00 53.28  ? 77   ASN B CB  1 
ATOM   992  C CG  . ASN B 1 31  ? 22.656  12.217  27.428  1.00 53.42  ? 77   ASN B CG  1 
ATOM   993  O OD1 . ASN B 1 31  ? 22.755  13.276  26.799  1.00 53.62  ? 77   ASN B OD1 1 
ATOM   994  N ND2 . ASN B 1 31  ? 21.543  11.495  27.441  1.00 54.30  ? 77   ASN B ND2 1 
ATOM   995  N N   . GLN B 1 32  ? 24.810  12.056  25.217  1.00 46.47  ? 78   GLN B N   1 
ATOM   996  C CA  . GLN B 1 32  ? 24.876  11.546  23.848  1.00 44.29  ? 78   GLN B CA  1 
ATOM   997  C C   . GLN B 1 32  ? 26.303  11.563  23.307  1.00 42.18  ? 78   GLN B C   1 
ATOM   998  O O   . GLN B 1 32  ? 26.752  10.588  22.701  1.00 40.82  ? 78   GLN B O   1 
ATOM   999  C CB  . GLN B 1 32  ? 23.958  12.352  22.928  1.00 44.03  ? 78   GLN B CB  1 
ATOM   1000 C CG  . GLN B 1 32  ? 22.478  12.167  23.218  1.00 46.22  ? 78   GLN B CG  1 
ATOM   1001 C CD  . GLN B 1 32  ? 21.593  12.832  22.184  1.00 47.60  ? 78   GLN B CD  1 
ATOM   1002 O OE1 . GLN B 1 32  ? 21.987  13.808  21.545  1.00 49.69  ? 78   GLN B OE1 1 
ATOM   1003 N NE2 . GLN B 1 32  ? 20.391  12.303  22.009  1.00 49.28  ? 78   GLN B NE2 1 
ATOM   1004 N N   . LEU B 1 33  ? 27.007  12.671  23.526  1.00 41.30  ? 79   LEU B N   1 
ATOM   1005 C CA  . LEU B 1 33  ? 28.404  12.794  23.102  1.00 40.24  ? 79   LEU B CA  1 
ATOM   1006 C C   . LEU B 1 33  ? 29.312  11.778  23.813  1.00 40.32  ? 79   LEU B C   1 
ATOM   1007 O O   . LEU B 1 33  ? 30.241  11.243  23.199  1.00 38.83  ? 79   LEU B O   1 
ATOM   1008 C CB  . LEU B 1 33  ? 28.913  14.228  23.303  1.00 40.45  ? 79   LEU B CB  1 
ATOM   1009 C CG  . LEU B 1 33  ? 28.368  15.228  22.275  1.00 39.36  ? 79   LEU B CG  1 
ATOM   1010 C CD1 . LEU B 1 33  ? 28.638  16.667  22.701  1.00 39.79  ? 79   LEU B CD1 1 
ATOM   1011 C CD2 . LEU B 1 33  ? 28.953  14.958  20.898  1.00 37.12  ? 79   LEU B CD2 1 
ATOM   1012 N N   A GLN B 1 34  ? 29.035  11.525  25.093  0.50 41.69  ? 80   GLN B N   1 
ATOM   1013 N N   B GLN B 1 34  ? 29.038  11.511  25.087  0.50 41.78  ? 80   GLN B N   1 
ATOM   1014 C CA  A GLN B 1 34  ? 29.720  10.478  25.857  0.50 42.58  ? 80   GLN B CA  1 
ATOM   1015 C CA  B GLN B 1 34  ? 29.762  10.478  25.829  0.50 42.72  ? 80   GLN B CA  1 
ATOM   1016 C C   A GLN B 1 34  ? 29.498  9.101   25.237  0.50 41.22  ? 80   GLN B C   1 
ATOM   1017 C C   B GLN B 1 34  ? 29.497  9.084   25.255  0.50 41.33  ? 80   GLN B C   1 
ATOM   1018 O O   A GLN B 1 34  ? 30.429  8.300   25.133  0.50 40.68  ? 80   GLN B O   1 
ATOM   1019 O O   B GLN B 1 34  ? 30.404  8.251   25.199  0.50 40.85  ? 80   GLN B O   1 
ATOM   1020 C CB  A GLN B 1 34  ? 29.233  10.458  27.311  0.50 45.25  ? 80   GLN B CB  1 
ATOM   1021 C CB  B GLN B 1 34  ? 29.385  10.520  27.311  0.50 45.54  ? 80   GLN B CB  1 
ATOM   1022 C CG  A GLN B 1 34  ? 29.900  11.482  28.215  0.50 47.78  ? 80   GLN B CG  1 
ATOM   1023 C CG  B GLN B 1 34  ? 30.054  11.646  28.086  0.50 48.24  ? 80   GLN B CG  1 
ATOM   1024 C CD  A GLN B 1 34  ? 29.751  11.152  29.692  0.50 50.34  ? 80   GLN B CD  1 
ATOM   1025 C CD  B GLN B 1 34  ? 31.543  11.416  28.291  0.50 49.26  ? 80   GLN B CD  1 
ATOM   1026 O OE1 A GLN B 1 34  ? 29.053  10.208  30.068  0.50 51.60  ? 80   GLN B OE1 1 
ATOM   1027 O OE1 B GLN B 1 34  ? 32.118  11.849  29.290  0.50 51.12  ? 80   GLN B OE1 1 
ATOM   1028 N NE2 A GLN B 1 34  ? 30.419  11.927  30.537  0.50 52.46  ? 80   GLN B NE2 1 
ATOM   1029 N NE2 B GLN B 1 34  ? 32.170  10.726  27.347  0.50 48.71  ? 80   GLN B NE2 1 
ATOM   1030 N N   . TYR B 1 35  ? 28.257  8.835   24.834  1.00 40.73  ? 81   TYR B N   1 
ATOM   1031 C CA  . TYR B 1 35  ? 27.901  7.581   24.165  1.00 39.93  ? 81   TYR B CA  1 
ATOM   1032 C C   . TYR B 1 35  ? 28.628  7.452   22.817  1.00 38.02  ? 81   TYR B C   1 
ATOM   1033 O O   . TYR B 1 35  ? 29.216  6.412   22.519  1.00 37.90  ? 81   TYR B O   1 
ATOM   1034 C CB  . TYR B 1 35  ? 26.386  7.502   23.957  1.00 40.52  ? 81   TYR B CB  1 
ATOM   1035 C CG  . TYR B 1 35  ? 25.919  6.231   23.287  1.00 40.87  ? 81   TYR B CG  1 
ATOM   1036 C CD1 . TYR B 1 35  ? 25.609  5.100   24.037  1.00 42.99  ? 81   TYR B CD1 1 
ATOM   1037 C CD2 . TYR B 1 35  ? 25.790  6.159   21.903  1.00 39.59  ? 81   TYR B CD2 1 
ATOM   1038 C CE1 . TYR B 1 35  ? 25.182  3.929   23.424  1.00 43.89  ? 81   TYR B CE1 1 
ATOM   1039 C CE2 . TYR B 1 35  ? 25.367  4.996   21.282  1.00 40.32  ? 81   TYR B CE2 1 
ATOM   1040 C CZ  . TYR B 1 35  ? 25.066  3.883   22.046  1.00 41.35  ? 81   TYR B CZ  1 
ATOM   1041 O OH  . TYR B 1 35  ? 24.643  2.726   21.433  1.00 41.77  ? 81   TYR B OH  1 
ATOM   1042 N N   . LEU B 1 36  ? 28.599  8.512   22.016  1.00 36.49  ? 82   LEU B N   1 
ATOM   1043 C CA  . LEU B 1 36  ? 29.306  8.513   20.728  1.00 35.88  ? 82   LEU B CA  1 
ATOM   1044 C C   . LEU B 1 36  ? 30.811  8.273   20.909  1.00 35.68  ? 82   LEU B C   1 
ATOM   1045 O O   . LEU B 1 36  ? 31.437  7.599   20.096  1.00 34.63  ? 82   LEU B O   1 
ATOM   1046 C CB  . LEU B 1 36  ? 29.061  9.825   19.969  1.00 35.25  ? 82   LEU B CB  1 
ATOM   1047 C CG  . LEU B 1 36  ? 27.631  10.039  19.459  1.00 36.42  ? 82   LEU B CG  1 
ATOM   1048 C CD1 . LEU B 1 36  ? 27.414  11.477  19.019  1.00 37.88  ? 82   LEU B CD1 1 
ATOM   1049 C CD2 . LEU B 1 36  ? 27.309  9.085   18.322  1.00 37.19  ? 82   LEU B CD2 1 
ATOM   1050 N N   . HIS B 1 37  ? 31.372  8.818   21.984  1.00 37.43  ? 83   HIS B N   1 
ATOM   1051 C CA  . HIS B 1 37  ? 32.796  8.686   22.282  1.00 38.51  ? 83   HIS B CA  1 
ATOM   1052 C C   . HIS B 1 37  ? 33.129  7.278   22.786  1.00 39.51  ? 83   HIS B C   1 
ATOM   1053 O O   . HIS B 1 37  ? 33.950  6.579   22.201  1.00 38.77  ? 83   HIS B O   1 
ATOM   1054 C CB  . HIS B 1 37  ? 33.199  9.725   23.336  1.00 40.23  ? 83   HIS B CB  1 
ATOM   1055 C CG  . HIS B 1 37  ? 34.678  9.876   23.522  1.00 42.95  ? 83   HIS B CG  1 
ATOM   1056 N ND1 . HIS B 1 37  ? 35.222  10.834  24.351  1.00 46.36  ? 83   HIS B ND1 1 
ATOM   1057 C CD2 . HIS B 1 37  ? 35.726  9.215   22.973  1.00 43.49  ? 83   HIS B CD2 1 
ATOM   1058 C CE1 . HIS B 1 37  ? 36.540  10.741  24.322  1.00 47.05  ? 83   HIS B CE1 1 
ATOM   1059 N NE2 . HIS B 1 37  ? 36.871  9.767   23.493  1.00 44.70  ? 83   HIS B NE2 1 
ATOM   1060 N N   . LYS B 1 38  ? 32.469  6.863   23.860  1.00 40.99  ? 84   LYS B N   1 
ATOM   1061 C CA  . LYS B 1 38  ? 32.865  5.658   24.593  1.00 43.06  ? 84   LYS B CA  1 
ATOM   1062 C C   . LYS B 1 38  ? 32.254  4.373   24.042  1.00 42.26  ? 84   LYS B C   1 
ATOM   1063 O O   . LYS B 1 38  ? 32.823  3.296   24.226  1.00 42.66  ? 84   LYS B O   1 
ATOM   1064 C CB  . LYS B 1 38  ? 32.515  5.808   26.075  1.00 45.70  ? 84   LYS B CB  1 
ATOM   1065 C CG  . LYS B 1 38  ? 33.094  7.058   26.735  1.00 49.25  ? 84   LYS B CG  1 
ATOM   1066 C CD  . LYS B 1 38  ? 34.618  7.037   26.796  1.00 51.91  ? 84   LYS B CD  1 
ATOM   1067 C CE  . LYS B 1 38  ? 35.157  8.305   27.446  1.00 54.07  ? 84   LYS B CE  1 
ATOM   1068 N NZ  . LYS B 1 38  ? 36.550  8.127   27.940  1.00 56.65  ? 84   LYS B NZ  1 
ATOM   1069 N N   . VAL B 1 39  ? 31.108  4.478   23.372  1.00 41.49  ? 85   VAL B N   1 
ATOM   1070 C CA  . VAL B 1 39  ? 30.438  3.302   22.812  1.00 41.55  ? 85   VAL B CA  1 
ATOM   1071 C C   . VAL B 1 39  ? 30.634  3.217   21.297  1.00 39.65  ? 85   VAL B C   1 
ATOM   1072 O O   . VAL B 1 39  ? 31.225  2.258   20.800  1.00 39.72  ? 85   VAL B O   1 
ATOM   1073 C CB  . VAL B 1 39  ? 28.932  3.283   23.163  1.00 42.23  ? 85   VAL B CB  1 
ATOM   1074 C CG1 . VAL B 1 39  ? 28.238  2.105   22.492  1.00 42.68  ? 85   VAL B CG1 1 
ATOM   1075 C CG2 . VAL B 1 39  ? 28.742  3.218   24.678  1.00 45.06  ? 85   VAL B CG2 1 
ATOM   1076 N N   . VAL B 1 40  ? 30.157  4.222   20.568  1.00 38.56  ? 86   VAL B N   1 
ATOM   1077 C CA  . VAL B 1 40  ? 30.178  4.175   19.103  1.00 36.96  ? 86   VAL B CA  1 
ATOM   1078 C C   . VAL B 1 40  ? 31.602  4.227   18.551  1.00 36.21  ? 86   VAL B C   1 
ATOM   1079 O O   . VAL B 1 40  ? 32.025  3.312   17.842  1.00 35.41  ? 86   VAL B O   1 
ATOM   1080 C CB  . VAL B 1 40  ? 29.336  5.305   18.470  1.00 36.26  ? 86   VAL B CB  1 
ATOM   1081 C CG1 . VAL B 1 40  ? 29.382  5.222   16.939  1.00 35.31  ? 86   VAL B CG1 1 
ATOM   1082 C CG2 . VAL B 1 40  ? 27.895  5.246   18.964  1.00 36.86  ? 86   VAL B CG2 1 
ATOM   1083 N N   . MET B 1 41  ? 32.341  5.284   18.884  1.00 36.05  ? 87   MET B N   1 
ATOM   1084 C CA  . MET B 1 41  ? 33.696  5.465   18.355  1.00 36.29  ? 87   MET B CA  1 
ATOM   1085 C C   . MET B 1 41  ? 34.644  4.329   18.785  1.00 37.57  ? 87   MET B C   1 
ATOM   1086 O O   . MET B 1 41  ? 35.461  3.873   17.982  1.00 36.88  ? 87   MET B O   1 
ATOM   1087 C CB  . MET B 1 41  ? 34.262  6.832   18.762  1.00 36.72  ? 87   MET B CB  1 
ATOM   1088 C CG  . MET B 1 41  ? 35.663  7.136   18.240  1.00 38.66  ? 87   MET B CG  1 
ATOM   1089 S SD  . MET B 1 41  ? 35.817  7.110   16.444  1.00 40.44  ? 87   MET B SD  1 
ATOM   1090 C CE  . MET B 1 41  ? 35.505  8.833   16.060  1.00 40.44  ? 87   MET B CE  1 
ATOM   1091 N N   . LYS B 1 42  ? 34.535  3.871   20.030  1.00 39.28  ? 88   LYS B N   1 
ATOM   1092 C CA  . LYS B 1 42  ? 35.386  2.767   20.506  1.00 41.43  ? 88   LYS B CA  1 
ATOM   1093 C C   . LYS B 1 42  ? 35.145  1.488   19.689  1.00 41.08  ? 88   LYS B C   1 
ATOM   1094 O O   . LYS B 1 42  ? 36.098  0.800   19.313  1.00 41.31  ? 88   LYS B O   1 
ATOM   1095 C CB  . LYS B 1 42  ? 35.181  2.505   22.004  1.00 43.99  ? 88   LYS B CB  1 
ATOM   1096 C CG  . LYS B 1 42  ? 36.162  1.482   22.592  1.00 47.61  ? 88   LYS B CG  1 
ATOM   1097 C CD  . LYS B 1 42  ? 36.113  1.419   24.118  1.00 51.67  ? 88   LYS B CD  1 
ATOM   1098 C CE  . LYS B 1 42  ? 37.004  2.473   24.772  1.00 53.74  ? 88   LYS B CE  1 
ATOM   1099 N NZ  . LYS B 1 42  ? 37.211  2.210   26.232  1.00 56.14  ? 88   LYS B NZ  1 
ATOM   1100 N N   . ALA B 1 43  ? 33.876  1.196   19.398  1.00 40.68  ? 89   ALA B N   1 
ATOM   1101 C CA  . ALA B 1 43  ? 33.497  0.029   18.591  1.00 40.25  ? 89   ALA B CA  1 
ATOM   1102 C C   . ALA B 1 43  ? 34.025  0.110   17.159  1.00 38.47  ? 89   ALA B C   1 
ATOM   1103 O O   . ALA B 1 43  ? 34.537  -0.876  16.623  1.00 39.16  ? 89   ALA B O   1 
ATOM   1104 C CB  . ALA B 1 43  ? 31.989  -0.124  18.567  1.00 40.63  ? 89   ALA B CB  1 
ATOM   1105 N N   . LEU B 1 44  ? 33.890  1.278   16.541  1.00 35.73  ? 90   LEU B N   1 
ATOM   1106 C CA  . LEU B 1 44  ? 34.405  1.490   15.194  1.00 34.32  ? 90   LEU B CA  1 
ATOM   1107 C C   . LEU B 1 44  ? 35.932  1.460   15.155  1.00 33.38  ? 90   LEU B C   1 
ATOM   1108 O O   . LEU B 1 44  ? 36.517  0.816   14.283  1.00 32.44  ? 90   LEU B O   1 
ATOM   1109 C CB  . LEU B 1 44  ? 33.912  2.822   14.634  1.00 33.84  ? 90   LEU B CB  1 
ATOM   1110 C CG  . LEU B 1 44  ? 32.403  2.937   14.410  1.00 35.45  ? 90   LEU B CG  1 
ATOM   1111 C CD1 . LEU B 1 44  ? 32.047  4.341   13.966  1.00 34.94  ? 90   LEU B CD1 1 
ATOM   1112 C CD2 . LEU B 1 44  ? 31.939  1.915   13.397  1.00 35.61  ? 90   LEU B CD2 1 
ATOM   1113 N N   . TRP B 1 45  ? 36.564  2.163   16.097  1.00 32.95  ? 91   TRP B N   1 
ATOM   1114 C CA  . TRP B 1 45  ? 38.021  2.340   16.109  1.00 32.62  ? 91   TRP B CA  1 
ATOM   1115 C C   . TRP B 1 45  ? 38.770  1.019   16.117  1.00 32.18  ? 91   TRP B C   1 
ATOM   1116 O O   . TRP B 1 45  ? 39.774  0.868   15.418  1.00 31.25  ? 91   TRP B O   1 
ATOM   1117 C CB  . TRP B 1 45  ? 38.458  3.162   17.328  1.00 34.01  ? 91   TRP B CB  1 
ATOM   1118 C CG  . TRP B 1 45  ? 39.880  3.610   17.268  1.00 33.85  ? 91   TRP B CG  1 
ATOM   1119 C CD1 . TRP B 1 45  ? 40.985  2.872   17.568  1.00 35.76  ? 91   TRP B CD1 1 
ATOM   1120 C CD2 . TRP B 1 45  ? 40.356  4.911   16.894  1.00 34.78  ? 91   TRP B CD2 1 
ATOM   1121 N NE1 . TRP B 1 45  ? 42.117  3.625   17.401  1.00 35.91  ? 91   TRP B NE1 1 
ATOM   1122 C CE2 . TRP B 1 45  ? 41.761  4.882   16.987  1.00 34.78  ? 91   TRP B CE2 1 
ATOM   1123 C CE3 . TRP B 1 45  ? 39.728  6.100   16.494  1.00 33.58  ? 91   TRP B CE3 1 
ATOM   1124 C CZ2 . TRP B 1 45  ? 42.556  5.992   16.690  1.00 35.50  ? 91   TRP B CZ2 1 
ATOM   1125 C CZ3 . TRP B 1 45  ? 40.516  7.200   16.206  1.00 34.16  ? 91   TRP B CZ3 1 
ATOM   1126 C CH2 . TRP B 1 45  ? 41.916  7.138   16.301  1.00 35.04  ? 91   TRP B CH2 1 
ATOM   1127 N N   . LYS B 1 46  ? 38.275  0.076   16.915  1.00 32.62  ? 92   LYS B N   1 
ATOM   1128 C CA  . LYS B 1 46  ? 38.921  -1.231  17.099  1.00 34.64  ? 92   LYS B CA  1 
ATOM   1129 C C   . LYS B 1 46  ? 38.641  -2.231  15.978  1.00 32.83  ? 92   LYS B C   1 
ATOM   1130 O O   . LYS B 1 46  ? 39.240  -3.306  15.945  1.00 33.69  ? 92   LYS B O   1 
ATOM   1131 C CB  . LYS B 1 46  ? 38.484  -1.848  18.439  1.00 36.90  ? 92   LYS B CB  1 
ATOM   1132 C CG  . LYS B 1 46  ? 39.495  -1.712  19.554  1.00 42.87  ? 92   LYS B CG  1 
ATOM   1133 C CD  . LYS B 1 46  ? 39.834  -0.273  19.886  1.00 44.77  ? 92   LYS B CD  1 
ATOM   1134 C CE  . LYS B 1 46  ? 40.966  -0.209  20.904  1.00 47.41  ? 92   LYS B CE  1 
ATOM   1135 N NZ  . LYS B 1 46  ? 40.708  -1.070  22.089  1.00 52.22  ? 92   LYS B NZ  1 
ATOM   1136 N N   . HIS B 1 47  ? 37.723  -1.890  15.078  1.00 30.86  ? 93   HIS B N   1 
ATOM   1137 C CA  . HIS B 1 47  ? 37.329  -2.783  13.992  1.00 29.69  ? 93   HIS B CA  1 
ATOM   1138 C C   . HIS B 1 47  ? 38.512  -3.058  13.053  1.00 29.67  ? 93   HIS B C   1 
ATOM   1139 O O   . HIS B 1 47  ? 39.364  -2.190  12.837  1.00 29.22  ? 93   HIS B O   1 
ATOM   1140 C CB  . HIS B 1 47  ? 36.139  -2.193  13.217  1.00 28.57  ? 93   HIS B CB  1 
ATOM   1141 C CG  . HIS B 1 47  ? 35.426  -3.193  12.364  1.00 29.53  ? 93   HIS B CG  1 
ATOM   1142 N ND1 . HIS B 1 47  ? 35.874  -3.552  11.111  1.00 29.18  ? 93   HIS B ND1 1 
ATOM   1143 C CD2 . HIS B 1 47  ? 34.323  -3.940  12.598  1.00 30.06  ? 93   HIS B CD2 1 
ATOM   1144 C CE1 . HIS B 1 47  ? 35.063  -4.462  10.601  1.00 31.66  ? 93   HIS B CE1 1 
ATOM   1145 N NE2 . HIS B 1 47  ? 34.116  -4.718  11.486  1.00 30.48  ? 93   HIS B NE2 1 
ATOM   1146 N N   . GLN B 1 48  ? 38.568  -4.274  12.515  1.00 29.16  ? 94   GLN B N   1 
ATOM   1147 C CA  . GLN B 1 48  ? 39.660  -4.674  11.621  1.00 30.08  ? 94   GLN B CA  1 
ATOM   1148 C C   . GLN B 1 48  ? 39.742  -3.861  10.330  1.00 28.36  ? 94   GLN B C   1 
ATOM   1149 O O   . GLN B 1 48  ? 40.790  -3.833  9.698   1.00 29.18  ? 94   GLN B O   1 
ATOM   1150 C CB  . GLN B 1 48  ? 39.562  -6.164  11.266  1.00 31.71  ? 94   GLN B CB  1 
ATOM   1151 C CG  . GLN B 1 48  ? 38.308  -6.541  10.480  1.00 32.98  ? 94   GLN B CG  1 
ATOM   1152 C CD  . GLN B 1 48  ? 38.451  -7.854  9.726   1.00 37.99  ? 94   GLN B CD  1 
ATOM   1153 O OE1 . GLN B 1 48  ? 39.540  -8.215  9.269   1.00 40.15  ? 94   GLN B OE1 1 
ATOM   1154 N NE2 . GLN B 1 48  ? 37.346  -8.575  9.591   1.00 39.39  ? 94   GLN B NE2 1 
ATOM   1155 N N   . PHE B 1 49  ? 38.639  -3.231  9.929   1.00 27.41  ? 95   PHE B N   1 
ATOM   1156 C CA  . PHE B 1 49  ? 38.603  -2.384  8.738   1.00 26.74  ? 95   PHE B CA  1 
ATOM   1157 C C   . PHE B 1 49  ? 38.792  -0.890  9.039   1.00 26.86  ? 95   PHE B C   1 
ATOM   1158 O O   . PHE B 1 49  ? 38.708  -0.073  8.120   1.00 26.57  ? 95   PHE B O   1 
ATOM   1159 C CB  . PHE B 1 49  ? 37.262  -2.527  8.003   1.00 26.09  ? 95   PHE B CB  1 
ATOM   1160 C CG  . PHE B 1 49  ? 37.011  -3.873  7.387   1.00 27.69  ? 95   PHE B CG  1 
ATOM   1161 C CD1 . PHE B 1 49  ? 38.026  -4.807  7.201   1.00 29.35  ? 95   PHE B CD1 1 
ATOM   1162 C CD2 . PHE B 1 49  ? 35.733  -4.183  6.933   1.00 28.89  ? 95   PHE B CD2 1 
ATOM   1163 C CE1 . PHE B 1 49  ? 37.756  -6.034  6.612   1.00 30.59  ? 95   PHE B CE1 1 
ATOM   1164 C CE2 . PHE B 1 49  ? 35.464  -5.402  6.335   1.00 30.23  ? 95   PHE B CE2 1 
ATOM   1165 C CZ  . PHE B 1 49  ? 36.478  -6.327  6.175   1.00 30.57  ? 95   PHE B CZ  1 
ATOM   1166 N N   . ALA B 1 50  ? 39.050  -0.535  10.298  1.00 26.95  ? 96   ALA B N   1 
ATOM   1167 C CA  . ALA B 1 50  ? 39.141  0.876   10.709  1.00 26.98  ? 96   ALA B CA  1 
ATOM   1168 C C   . ALA B 1 50  ? 40.480  1.564   10.398  1.00 27.27  ? 96   ALA B C   1 
ATOM   1169 O O   . ALA B 1 50  ? 40.527  2.796   10.321  1.00 27.54  ? 96   ALA B O   1 
ATOM   1170 C CB  . ALA B 1 50  ? 38.833  1.001   12.200  1.00 27.50  ? 96   ALA B CB  1 
ATOM   1171 N N   . TRP B 1 51  ? 41.551  0.793   10.211  1.00 28.08  ? 97   TRP B N   1 
ATOM   1172 C CA  . TRP B 1 51  ? 42.904  1.371   10.100  1.00 29.41  ? 97   TRP B CA  1 
ATOM   1173 C C   . TRP B 1 51  ? 43.075  2.500   9.057   1.00 29.05  ? 97   TRP B C   1 
ATOM   1174 O O   . TRP B 1 51  ? 43.787  3.467   9.334   1.00 29.29  ? 97   TRP B O   1 
ATOM   1175 C CB  . TRP B 1 51  ? 43.987  0.291   9.927   1.00 31.06  ? 97   TRP B CB  1 
ATOM   1176 C CG  . TRP B 1 51  ? 43.878  -0.539  8.694   1.00 32.12  ? 97   TRP B CG  1 
ATOM   1177 C CD1 . TRP B 1 51  ? 43.186  -1.712  8.545   1.00 32.84  ? 97   TRP B CD1 1 
ATOM   1178 C CD2 . TRP B 1 51  ? 44.489  -0.269  7.428   1.00 33.13  ? 97   TRP B CD2 1 
ATOM   1179 N NE1 . TRP B 1 51  ? 43.329  -2.185  7.258   1.00 33.61  ? 97   TRP B NE1 1 
ATOM   1180 C CE2 . TRP B 1 51  ? 44.122  -1.316  6.553   1.00 33.60  ? 97   TRP B CE2 1 
ATOM   1181 C CE3 . TRP B 1 51  ? 45.300  0.765   6.943   1.00 35.67  ? 97   TRP B CE3 1 
ATOM   1182 C CZ2 . TRP B 1 51  ? 44.545  -1.362  5.226   1.00 35.27  ? 97   TRP B CZ2 1 
ATOM   1183 C CZ3 . TRP B 1 51  ? 45.725  0.715   5.619   1.00 36.07  ? 97   TRP B CZ3 1 
ATOM   1184 C CH2 . TRP B 1 51  ? 45.342  -0.339  4.777   1.00 35.17  ? 97   TRP B CH2 1 
ATOM   1185 N N   . PRO B 1 52  ? 42.399  2.417   7.889   1.00 27.89  ? 98   PRO B N   1 
ATOM   1186 C CA  . PRO B 1 52  ? 42.524  3.560   6.962   1.00 27.67  ? 98   PRO B CA  1 
ATOM   1187 C C   . PRO B 1 52  ? 41.826  4.844   7.419   1.00 26.41  ? 98   PRO B C   1 
ATOM   1188 O O   . PRO B 1 52  ? 42.073  5.903   6.847   1.00 26.83  ? 98   PRO B O   1 
ATOM   1189 C CB  . PRO B 1 52  ? 41.867  3.044   5.667   1.00 26.79  ? 98   PRO B CB  1 
ATOM   1190 C CG  . PRO B 1 52  ? 41.796  1.532   5.829   1.00 26.63  ? 98   PRO B CG  1 
ATOM   1191 C CD  . PRO B 1 52  ? 41.556  1.360   7.302   1.00 27.65  ? 98   PRO B CD  1 
ATOM   1192 N N   . PHE B 1 53  ? 40.961  4.745   8.425   1.00 26.59  ? 99   PHE B N   1 
ATOM   1193 C CA  . PHE B 1 53  ? 40.101  5.846   8.842   1.00 26.69  ? 99   PHE B CA  1 
ATOM   1194 C C   . PHE B 1 53  ? 40.516  6.503   10.157  1.00 28.13  ? 99   PHE B C   1 
ATOM   1195 O O   . PHE B 1 53  ? 39.892  7.474   10.577  1.00 28.25  ? 99   PHE B O   1 
ATOM   1196 C CB  . PHE B 1 53  ? 38.664  5.342   8.971   1.00 26.60  ? 99   PHE B CB  1 
ATOM   1197 C CG  . PHE B 1 53  ? 38.105  4.801   7.690   1.00 26.84  ? 99   PHE B CG  1 
ATOM   1198 C CD1 . PHE B 1 53  ? 37.520  5.649   6.763   1.00 27.94  ? 99   PHE B CD1 1 
ATOM   1199 C CD2 . PHE B 1 53  ? 38.186  3.444   7.399   1.00 27.55  ? 99   PHE B CD2 1 
ATOM   1200 C CE1 . PHE B 1 53  ? 37.008  5.149   5.565   1.00 28.24  ? 99   PHE B CE1 1 
ATOM   1201 C CE2 . PHE B 1 53  ? 37.683  2.939   6.210   1.00 27.43  ? 99   PHE B CE2 1 
ATOM   1202 C CZ  . PHE B 1 53  ? 37.096  3.794   5.288   1.00 27.69  ? 99   PHE B CZ  1 
ATOM   1203 N N   . ARG B 1 54  ? 41.550  5.974   10.809  1.00 29.05  ? 100  ARG B N   1 
ATOM   1204 C CA  . ARG B 1 54  ? 41.958  6.462   12.131  1.00 30.64  ? 100  ARG B CA  1 
ATOM   1205 C C   . ARG B 1 54  ? 42.771  7.754   12.110  1.00 32.50  ? 100  ARG B C   1 
ATOM   1206 O O   . ARG B 1 54  ? 43.023  8.338   13.166  1.00 33.92  ? 100  ARG B O   1 
ATOM   1207 C CB  . ARG B 1 54  ? 42.775  5.390   12.857  1.00 31.53  ? 100  ARG B CB  1 
ATOM   1208 C CG  . ARG B 1 54  ? 41.955  4.232   13.339  1.00 31.18  ? 100  ARG B CG  1 
ATOM   1209 C CD  . ARG B 1 54  ? 42.862  3.132   13.823  1.00 32.63  ? 100  ARG B CD  1 
ATOM   1210 N NE  . ARG B 1 54  ? 42.137  1.898   14.105  1.00 31.85  ? 100  ARG B NE  1 
ATOM   1211 C CZ  . ARG B 1 54  ? 42.665  0.681   14.014  1.00 31.44  ? 100  ARG B CZ  1 
ATOM   1212 N NH1 . ARG B 1 54  ? 43.929  0.517   13.634  1.00 31.75  ? 100  ARG B NH1 1 
ATOM   1213 N NH2 . ARG B 1 54  ? 41.923  -0.380  14.291  1.00 31.62  ? 100  ARG B NH2 1 
ATOM   1214 N N   . GLN B 1 55  ? 43.212  8.171   10.926  1.00 33.28  ? 101  GLN B N   1 
ATOM   1215 C CA  . GLN B 1 55  ? 44.020  9.383   10.769  1.00 35.02  ? 101  GLN B CA  1 
ATOM   1216 C C   . GLN B 1 55  ? 43.677  10.035  9.430   1.00 34.64  ? 101  GLN B C   1 
ATOM   1217 O O   . GLN B 1 55  ? 43.135  9.369   8.544   1.00 32.95  ? 101  GLN B O   1 
ATOM   1218 C CB  . GLN B 1 55  ? 45.520  9.062   10.842  1.00 36.51  ? 101  GLN B CB  1 
ATOM   1219 C CG  . GLN B 1 55  ? 46.014  8.072   9.796   1.00 36.99  ? 101  GLN B CG  1 
ATOM   1220 C CD  . GLN B 1 55  ? 45.487  6.666   10.020  1.00 37.07  ? 101  GLN B CD  1 
ATOM   1221 O OE1 . GLN B 1 55  ? 45.622  6.112   11.111  1.00 39.94  ? 101  GLN B OE1 1 
ATOM   1222 N NE2 . GLN B 1 55  ? 44.873  6.085   8.990   1.00 35.00  ? 101  GLN B NE2 1 
ATOM   1223 N N   . PRO B 1 56  ? 43.982  11.338  9.276   1.00 36.27  ? 102  PRO B N   1 
ATOM   1224 C CA  . PRO B 1 56  ? 43.672  12.000  8.012   1.00 36.77  ? 102  PRO B CA  1 
ATOM   1225 C C   . PRO B 1 56  ? 44.320  11.305  6.821   1.00 38.86  ? 102  PRO B C   1 
ATOM   1226 O O   . PRO B 1 56  ? 45.425  10.768  6.943   1.00 40.33  ? 102  PRO B O   1 
ATOM   1227 C CB  . PRO B 1 56  ? 44.259  13.406  8.191   1.00 37.62  ? 102  PRO B CB  1 
ATOM   1228 C CG  . PRO B 1 56  ? 44.330  13.616  9.637   1.00 37.72  ? 102  PRO B CG  1 
ATOM   1229 C CD  . PRO B 1 56  ? 44.570  12.272  10.253  1.00 37.88  ? 102  PRO B CD  1 
ATOM   1230 N N   . VAL B 1 57  ? 43.621  11.307  5.690   1.00 39.56  ? 103  VAL B N   1 
ATOM   1231 C CA  . VAL B 1 57  ? 44.163  10.799  4.439   1.00 41.10  ? 103  VAL B CA  1 
ATOM   1232 C C   . VAL B 1 57  ? 45.411  11.595  4.070   1.00 43.86  ? 103  VAL B C   1 
ATOM   1233 O O   . VAL B 1 57  ? 45.378  12.827  4.046   1.00 44.44  ? 103  VAL B O   1 
ATOM   1234 C CB  . VAL B 1 57  ? 43.136  10.915  3.287   1.00 40.31  ? 103  VAL B CB  1 
ATOM   1235 C CG1 . VAL B 1 57  ? 43.783  10.564  1.943   1.00 40.68  ? 103  VAL B CG1 1 
ATOM   1236 C CG2 . VAL B 1 57  ? 41.932  10.023  3.548   1.00 38.79  ? 103  VAL B CG2 1 
ATOM   1237 N N   . ASP B 1 58  ? 46.510  10.884  3.814   1.00 45.81  ? 104  ASP B N   1 
ATOM   1238 C CA  . ASP B 1 58  ? 47.750  11.504  3.358   1.00 48.26  ? 104  ASP B CA  1 
ATOM   1239 C C   . ASP B 1 58  ? 47.856  11.282  1.854   1.00 48.36  ? 104  ASP B C   1 
ATOM   1240 O O   . ASP B 1 58  ? 48.300  10.225  1.396   1.00 48.14  ? 104  ASP B O   1 
ATOM   1241 C CB  . ASP B 1 58  ? 48.957  10.916  4.097   1.00 50.18  ? 104  ASP B CB  1 
ATOM   1242 C CG  . ASP B 1 58  ? 50.216  11.759  3.937   1.00 53.51  ? 104  ASP B CG  1 
ATOM   1243 O OD1 . ASP B 1 58  ? 50.534  12.176  2.801   1.00 54.73  ? 104  ASP B OD1 1 
ATOM   1244 O OD2 . ASP B 1 58  ? 50.898  11.999  4.955   1.00 55.79  ? 104  ASP B OD2 1 
ATOM   1245 N N   . ALA B 1 59  ? 47.414  12.282  1.094   1.00 48.36  ? 105  ALA B N   1 
ATOM   1246 C CA  . ALA B 1 59  ? 47.407  12.213  -0.365  1.00 48.80  ? 105  ALA B CA  1 
ATOM   1247 C C   . ALA B 1 59  ? 48.815  12.066  -0.942  1.00 50.70  ? 105  ALA B C   1 
ATOM   1248 O O   . ALA B 1 59  ? 48.995  11.414  -1.969  1.00 50.88  ? 105  ALA B O   1 
ATOM   1249 C CB  . ALA B 1 59  ? 46.721  13.442  -0.950  1.00 48.85  ? 105  ALA B CB  1 
ATOM   1250 N N   . VAL B 1 60  ? 49.802  12.665  -0.278  1.00 52.53  ? 106  VAL B N   1 
ATOM   1251 C CA  . VAL B 1 60  ? 51.202  12.557  -0.703  1.00 55.25  ? 106  VAL B CA  1 
ATOM   1252 C C   . VAL B 1 60  ? 51.716  11.130  -0.501  1.00 55.77  ? 106  VAL B C   1 
ATOM   1253 O O   . VAL B 1 60  ? 52.211  10.511  -1.441  1.00 56.48  ? 106  VAL B O   1 
ATOM   1254 C CB  . VAL B 1 60  ? 52.116  13.552  0.052   1.00 56.97  ? 106  VAL B CB  1 
ATOM   1255 C CG1 . VAL B 1 60  ? 53.567  13.404  -0.401  1.00 59.76  ? 106  VAL B CG1 1 
ATOM   1256 C CG2 . VAL B 1 60  ? 51.636  14.985  -0.157  1.00 57.48  ? 106  VAL B CG2 1 
ATOM   1257 N N   . LYS B 1 61  ? 51.576  10.610  0.718   1.00 55.78  ? 107  LYS B N   1 
ATOM   1258 C CA  . LYS B 1 61  ? 52.027  9.251   1.047   1.00 56.83  ? 107  LYS B CA  1 
ATOM   1259 C C   . LYS B 1 61  ? 51.356  8.193   0.166   1.00 55.86  ? 107  LYS B C   1 
ATOM   1260 O O   . LYS B 1 61  ? 52.015  7.254   -0.290  1.00 57.17  ? 107  LYS B O   1 
ATOM   1261 C CB  . LYS B 1 61  ? 51.757  8.934   2.523   1.00 56.63  ? 107  LYS B CB  1 
ATOM   1262 C CG  . LYS B 1 61  ? 52.411  7.641   3.022   1.00 58.94  ? 107  LYS B CG  1 
ATOM   1263 C CD  . LYS B 1 61  ? 51.772  7.146   4.317   1.00 58.52  ? 107  LYS B CD  1 
ATOM   1264 C CE  . LYS B 1 61  ? 52.135  5.691   4.599   1.00 59.67  ? 107  LYS B CE  1 
ATOM   1265 N NZ  . LYS B 1 61  ? 53.597  5.499   4.813   1.00 61.77  ? 107  LYS B NZ  1 
ATOM   1266 N N   . LEU B 1 62  ? 50.054  8.356   -0.069  1.00 53.61  ? 108  LEU B N   1 
ATOM   1267 C CA  . LEU B 1 62  ? 49.271  7.416   -0.882  1.00 52.65  ? 108  LEU B CA  1 
ATOM   1268 C C   . LEU B 1 62  ? 49.343  7.686   -2.389  1.00 52.77  ? 108  LEU B C   1 
ATOM   1269 O O   . LEU B 1 62  ? 48.849  6.886   -3.184  1.00 52.41  ? 108  LEU B O   1 
ATOM   1270 C CB  . LEU B 1 62  ? 47.802  7.438   -0.450  1.00 51.00  ? 108  LEU B CB  1 
ATOM   1271 C CG  . LEU B 1 62  ? 47.493  7.000   0.981   1.00 51.15  ? 108  LEU B CG  1 
ATOM   1272 C CD1 . LEU B 1 62  ? 46.016  7.210   1.277   1.00 50.00  ? 108  LEU B CD1 1 
ATOM   1273 C CD2 . LEU B 1 62  ? 47.881  5.547   1.205   1.00 52.30  ? 108  LEU B CD2 1 
ATOM   1274 N N   . GLY B 1 63  ? 49.934  8.813   -2.780  1.00 53.32  ? 109  GLY B N   1 
ATOM   1275 C CA  . GLY B 1 63  ? 50.073  9.161   -4.195  1.00 53.68  ? 109  GLY B CA  1 
ATOM   1276 C C   . GLY B 1 63  ? 48.760  9.537   -4.862  1.00 51.73  ? 109  GLY B C   1 
ATOM   1277 O O   . GLY B 1 63  ? 48.476  9.100   -5.979  1.00 51.82  ? 109  GLY B O   1 
ATOM   1278 N N   . LEU B 1 64  ? 47.969  10.358  -4.174  1.00 49.90  ? 110  LEU B N   1 
ATOM   1279 C CA  . LEU B 1 64  ? 46.661  10.803  -4.656  1.00 47.98  ? 110  LEU B CA  1 
ATOM   1280 C C   . LEU B 1 64  ? 46.664  12.325  -4.842  1.00 48.00  ? 110  LEU B C   1 
ATOM   1281 O O   . LEU B 1 64  ? 46.125  13.051  -4.008  1.00 47.63  ? 110  LEU B O   1 
ATOM   1282 C CB  . LEU B 1 64  ? 45.585  10.398  -3.648  1.00 46.05  ? 110  LEU B CB  1 
ATOM   1283 C CG  . LEU B 1 64  ? 45.508  8.903   -3.330  1.00 45.49  ? 110  LEU B CG  1 
ATOM   1284 C CD1 . LEU B 1 64  ? 44.557  8.650   -2.169  1.00 42.77  ? 110  LEU B CD1 1 
ATOM   1285 C CD2 . LEU B 1 64  ? 45.089  8.120   -4.561  1.00 45.76  ? 110  LEU B CD2 1 
ATOM   1286 N N   . PRO B 1 65  ? 47.268  12.816  -5.943  1.00 49.06  ? 111  PRO B N   1 
ATOM   1287 C CA  . PRO B 1 65  ? 47.440  14.268  -6.111  1.00 49.29  ? 111  PRO B CA  1 
ATOM   1288 C C   . PRO B 1 65  ? 46.135  15.052  -6.309  1.00 47.27  ? 111  PRO B C   1 
ATOM   1289 O O   . PRO B 1 65  ? 46.122  16.273  -6.121  1.00 47.32  ? 111  PRO B O   1 
ATOM   1290 C CB  . PRO B 1 65  ? 48.335  14.380  -7.351  1.00 51.82  ? 111  PRO B CB  1 
ATOM   1291 C CG  . PRO B 1 65  ? 48.116  13.116  -8.109  1.00 51.95  ? 111  PRO B CG  1 
ATOM   1292 C CD  . PRO B 1 65  ? 47.787  12.056  -7.097  1.00 50.06  ? 111  PRO B CD  1 
ATOM   1293 N N   . ASP B 1 66  ? 45.057  14.356  -6.675  1.00 44.62  ? 112  ASP B N   1 
ATOM   1294 C CA  . ASP B 1 66  ? 43.753  14.986  -6.886  1.00 42.85  ? 112  ASP B CA  1 
ATOM   1295 C C   . ASP B 1 66  ? 42.845  14.915  -5.650  1.00 39.70  ? 112  ASP B C   1 
ATOM   1296 O O   . ASP B 1 66  ? 41.715  15.402  -5.685  1.00 37.41  ? 112  ASP B O   1 
ATOM   1297 C CB  . ASP B 1 66  ? 43.043  14.342  -8.086  1.00 43.21  ? 112  ASP B CB  1 
ATOM   1298 C CG  . ASP B 1 66  ? 42.729  12.860  -7.873  1.00 43.79  ? 112  ASP B CG  1 
ATOM   1299 O OD1 . ASP B 1 66  ? 43.296  12.232  -6.947  1.00 43.69  ? 112  ASP B OD1 1 
ATOM   1300 O OD2 . ASP B 1 66  ? 41.911  12.319  -8.647  1.00 46.02  ? 112  ASP B OD2 1 
ATOM   1301 N N   . TYR B 1 67  ? 43.336  14.320  -4.564  1.00 38.20  ? 113  TYR B N   1 
ATOM   1302 C CA  . TYR B 1 67  ? 42.480  14.044  -3.420  1.00 35.76  ? 113  TYR B CA  1 
ATOM   1303 C C   . TYR B 1 67  ? 41.834  15.305  -2.861  1.00 35.59  ? 113  TYR B C   1 
ATOM   1304 O O   . TYR B 1 67  ? 40.623  15.342  -2.650  1.00 33.76  ? 113  TYR B O   1 
ATOM   1305 C CB  . TYR B 1 67  ? 43.214  13.302  -2.301  1.00 34.91  ? 113  TYR B CB  1 
ATOM   1306 C CG  . TYR B 1 67  ? 42.247  12.908  -1.202  1.00 32.97  ? 113  TYR B CG  1 
ATOM   1307 C CD1 . TYR B 1 67  ? 41.421  11.797  -1.344  1.00 30.91  ? 113  TYR B CD1 1 
ATOM   1308 C CD2 . TYR B 1 67  ? 42.109  13.685  -0.056  1.00 31.94  ? 113  TYR B CD2 1 
ATOM   1309 C CE1 . TYR B 1 67  ? 40.520  11.447  -0.359  1.00 29.25  ? 113  TYR B CE1 1 
ATOM   1310 C CE2 . TYR B 1 67  ? 41.203  13.344  0.935   1.00 30.30  ? 113  TYR B CE2 1 
ATOM   1311 C CZ  . TYR B 1 67  ? 40.409  12.222  0.776   1.00 29.47  ? 113  TYR B CZ  1 
ATOM   1312 O OH  . TYR B 1 67  ? 39.494  11.880  1.753   1.00 28.04  ? 113  TYR B OH  1 
ATOM   1313 N N   . HIS B 1 68  ? 42.637  16.339  -2.637  1.00 36.74  ? 114  HIS B N   1 
ATOM   1314 C CA  . HIS B 1 68  ? 42.129  17.570  -2.028  1.00 37.30  ? 114  HIS B CA  1 
ATOM   1315 C C   . HIS B 1 68  ? 41.421  18.497  -3.011  1.00 37.63  ? 114  HIS B C   1 
ATOM   1316 O O   . HIS B 1 68  ? 40.756  19.438  -2.594  1.00 37.19  ? 114  HIS B O   1 
ATOM   1317 C CB  . HIS B 1 68  ? 43.250  18.291  -1.279  1.00 38.47  ? 114  HIS B CB  1 
ATOM   1318 C CG  . HIS B 1 68  ? 43.710  17.543  -0.071  1.00 38.65  ? 114  HIS B CG  1 
ATOM   1319 N ND1 . HIS B 1 68  ? 42.956  17.466  1.082   1.00 38.66  ? 114  HIS B ND1 1 
ATOM   1320 C CD2 . HIS B 1 68  ? 44.816  16.796  0.151   1.00 39.08  ? 114  HIS B CD2 1 
ATOM   1321 C CE1 . HIS B 1 68  ? 43.593  16.724  1.971   1.00 38.41  ? 114  HIS B CE1 1 
ATOM   1322 N NE2 . HIS B 1 68  ? 44.722  16.304  1.430   1.00 39.55  ? 114  HIS B NE2 1 
ATOM   1323 N N   . LYS B 1 69  ? 41.549  18.218  -4.306  1.00 38.45  ? 115  LYS B N   1 
ATOM   1324 C CA  . LYS B 1 69  ? 40.770  18.920  -5.327  1.00 39.25  ? 115  LYS B CA  1 
ATOM   1325 C C   . LYS B 1 69  ? 39.347  18.371  -5.395  1.00 37.52  ? 115  LYS B C   1 
ATOM   1326 O O   . LYS B 1 69  ? 38.427  19.076  -5.809  1.00 37.75  ? 115  LYS B O   1 
ATOM   1327 C CB  . LYS B 1 69  ? 41.445  18.808  -6.696  1.00 41.43  ? 115  LYS B CB  1 
ATOM   1328 C CG  . LYS B 1 69  ? 42.763  19.565  -6.783  1.00 44.56  ? 115  LYS B CG  1 
ATOM   1329 C CD  . LYS B 1 69  ? 43.367  19.493  -8.170  1.00 47.98  ? 115  LYS B CD  1 
ATOM   1330 C CE  . LYS B 1 69  ? 44.625  20.345  -8.280  1.00 50.59  ? 115  LYS B CE  1 
ATOM   1331 N NZ  . LYS B 1 69  ? 45.636  19.960  -7.260  1.00 51.64  ? 115  LYS B NZ  1 
ATOM   1332 N N   . ILE B 1 70  ? 39.175  17.114  -4.987  1.00 35.62  ? 116  ILE B N   1 
ATOM   1333 C CA  . ILE B 1 70  ? 37.870  16.453  -5.003  1.00 33.50  ? 116  ILE B CA  1 
ATOM   1334 C C   . ILE B 1 70  ? 37.194  16.493  -3.629  1.00 31.60  ? 116  ILE B C   1 
ATOM   1335 O O   . ILE B 1 70  ? 35.997  16.764  -3.534  1.00 31.73  ? 116  ILE B O   1 
ATOM   1336 C CB  . ILE B 1 70  ? 38.006  14.986  -5.482  1.00 33.41  ? 116  ILE B CB  1 
ATOM   1337 C CG1 . ILE B 1 70  ? 38.421  14.960  -6.957  1.00 35.94  ? 116  ILE B CG1 1 
ATOM   1338 C CG2 . ILE B 1 70  ? 36.695  14.229  -5.288  1.00 31.11  ? 116  ILE B CG2 1 
ATOM   1339 C CD1 . ILE B 1 70  ? 38.925  13.616  -7.435  1.00 38.27  ? 116  ILE B CD1 1 
ATOM   1340 N N   . ILE B 1 71  ? 37.959  16.219  -2.576  1.00 30.29  ? 117  ILE B N   1 
ATOM   1341 C CA  . ILE B 1 71  ? 37.437  16.214  -1.208  1.00 29.41  ? 117  ILE B CA  1 
ATOM   1342 C C   . ILE B 1 71  ? 37.847  17.506  -0.511  1.00 31.18  ? 117  ILE B C   1 
ATOM   1343 O O   . ILE B 1 71  ? 39.012  17.693  -0.144  1.00 32.14  ? 117  ILE B O   1 
ATOM   1344 C CB  . ILE B 1 71  ? 37.940  14.992  -0.426  1.00 28.45  ? 117  ILE B CB  1 
ATOM   1345 C CG1 . ILE B 1 71  ? 37.422  13.698  -1.080  1.00 27.18  ? 117  ILE B CG1 1 
ATOM   1346 C CG2 . ILE B 1 71  ? 37.515  15.057  1.035   1.00 27.70  ? 117  ILE B CG2 1 
ATOM   1347 C CD1 . ILE B 1 71  ? 35.910  13.621  -1.224  1.00 26.96  ? 117  ILE B CD1 1 
ATOM   1348 N N   . LYS B 1 72  ? 36.873  18.392  -0.338  1.00 32.06  ? 118  LYS B N   1 
ATOM   1349 C CA  . LYS B 1 72  ? 37.123  19.738  0.173   1.00 34.51  ? 118  LYS B CA  1 
ATOM   1350 C C   . LYS B 1 72  ? 36.958  19.836  1.686   1.00 33.24  ? 118  LYS B C   1 
ATOM   1351 O O   . LYS B 1 72  ? 37.381  20.821  2.287   1.00 34.22  ? 118  LYS B O   1 
ATOM   1352 C CB  . LYS B 1 72  ? 36.193  20.739  -0.518  1.00 36.23  ? 118  LYS B CB  1 
ATOM   1353 C CG  . LYS B 1 72  ? 36.435  20.877  -2.010  1.00 39.98  ? 118  LYS B CG  1 
ATOM   1354 C CD  . LYS B 1 72  ? 37.841  21.385  -2.272  1.00 43.75  ? 118  LYS B CD  1 
ATOM   1355 C CE  . LYS B 1 72  ? 38.022  21.857  -3.681  1.00 46.73  ? 118  LYS B CE  1 
ATOM   1356 N NZ  . LYS B 1 72  ? 39.461  22.075  -3.966  1.00 49.59  ? 118  LYS B NZ  1 
ATOM   1357 N N   . GLN B 1 73  ? 36.349  18.822  2.291   1.00 31.33  ? 119  GLN B N   1 
ATOM   1358 C CA  . GLN B 1 73  ? 36.233  18.742  3.741   1.00 31.21  ? 119  GLN B CA  1 
ATOM   1359 C C   . GLN B 1 73  ? 36.713  17.380  4.245   1.00 29.23  ? 119  GLN B C   1 
ATOM   1360 O O   . GLN B 1 73  ? 35.894  16.505  4.559   1.00 27.11  ? 119  GLN B O   1 
ATOM   1361 C CB  . GLN B 1 73  ? 34.794  18.982  4.168   1.00 31.75  ? 119  GLN B CB  1 
ATOM   1362 C CG  . GLN B 1 73  ? 34.636  19.154  5.669   1.00 35.60  ? 119  GLN B CG  1 
ATOM   1363 C CD  . GLN B 1 73  ? 33.200  19.025  6.136   1.00 38.44  ? 119  GLN B CD  1 
ATOM   1364 O OE1 . GLN B 1 73  ? 32.951  18.699  7.293   1.00 39.98  ? 119  GLN B OE1 1 
ATOM   1365 N NE2 . GLN B 1 73  ? 32.247  19.286  5.239   1.00 40.91  ? 119  GLN B NE2 1 
ATOM   1366 N N   . PRO B 1 74  ? 38.043  17.192  4.320   1.00 29.70  ? 120  PRO B N   1 
ATOM   1367 C CA  . PRO B 1 74  ? 38.572  15.926  4.821   1.00 28.85  ? 120  PRO B CA  1 
ATOM   1368 C C   . PRO B 1 74  ? 38.108  15.669  6.247   1.00 28.41  ? 120  PRO B C   1 
ATOM   1369 O O   . PRO B 1 74  ? 37.955  16.613  7.032   1.00 28.40  ? 120  PRO B O   1 
ATOM   1370 C CB  . PRO B 1 74  ? 40.090  16.129  4.787   1.00 30.31  ? 120  PRO B CB  1 
ATOM   1371 C CG  . PRO B 1 74  ? 40.313  17.270  3.872   1.00 32.02  ? 120  PRO B CG  1 
ATOM   1372 C CD  . PRO B 1 74  ? 39.121  18.147  4.014   1.00 31.12  ? 120  PRO B CD  1 
ATOM   1373 N N   . MET B 1 75  ? 37.857  14.403  6.561   1.00 26.94  ? 121  MET B N   1 
ATOM   1374 C CA  . MET B 1 75  ? 37.482  14.013  7.908   1.00 26.72  ? 121  MET B CA  1 
ATOM   1375 C C   . MET B 1 75  ? 37.938  12.581  8.172   1.00 27.00  ? 121  MET B C   1 
ATOM   1376 O O   . MET B 1 75  ? 38.002  11.758  7.254   1.00 26.33  ? 121  MET B O   1 
ATOM   1377 C CB  . MET B 1 75  ? 35.968  14.123  8.081   1.00 26.12  ? 121  MET B CB  1 
ATOM   1378 C CG  . MET B 1 75  ? 35.471  14.029  9.525   1.00 27.57  ? 121  MET B CG  1 
ATOM   1379 S SD  . MET B 1 75  ? 36.358  15.057  10.712  1.00 29.85  ? 121  MET B SD  1 
ATOM   1380 C CE  . MET B 1 75  ? 36.127  16.682  9.990   1.00 30.02  ? 121  MET B CE  1 
ATOM   1381 N N   . ASP B 1 76  ? 38.246  12.302  9.435   1.00 27.96  ? 122  ASP B N   1 
ATOM   1382 C CA  . ASP B 1 76  ? 38.707  10.985  9.868   1.00 27.06  ? 122  ASP B CA  1 
ATOM   1383 C C   . ASP B 1 76  ? 38.323  10.782  11.328  1.00 26.73  ? 122  ASP B C   1 
ATOM   1384 O O   . ASP B 1 76  ? 37.981  11.740  12.017  1.00 26.58  ? 122  ASP B O   1 
ATOM   1385 C CB  . ASP B 1 76  ? 40.218  10.883  9.706   1.00 27.98  ? 122  ASP B CB  1 
ATOM   1386 C CG  . ASP B 1 76  ? 40.963  11.835  10.617  1.00 29.49  ? 122  ASP B CG  1 
ATOM   1387 O OD1 . ASP B 1 76  ? 40.976  13.049  10.329  1.00 29.33  ? 122  ASP B OD1 1 
ATOM   1388 O OD2 . ASP B 1 76  ? 41.527  11.369  11.629  1.00 30.79  ? 122  ASP B OD2 1 
ATOM   1389 N N   A MET B 1 77  ? 38.399  9.547   11.811  0.50 27.02  ? 123  MET B N   1 
ATOM   1390 N N   B MET B 1 77  ? 38.400  9.532   11.789  0.50 26.92  ? 123  MET B N   1 
ATOM   1391 C CA  A MET B 1 77  ? 37.997  9.257   13.187  0.50 27.68  ? 123  MET B CA  1 
ATOM   1392 C CA  B MET B 1 77  ? 38.050  9.174   13.167  0.50 27.53  ? 123  MET B CA  1 
ATOM   1393 C C   A MET B 1 77  ? 38.956  9.840   14.225  0.50 28.58  ? 123  MET B C   1 
ATOM   1394 C C   B MET B 1 77  ? 38.942  9.873   14.190  0.50 28.45  ? 123  MET B C   1 
ATOM   1395 O O   A MET B 1 77  ? 38.551  10.097  15.355  0.50 28.66  ? 123  MET B O   1 
ATOM   1396 O O   B MET B 1 77  ? 38.482  10.239  15.267  0.50 28.40  ? 123  MET B O   1 
ATOM   1397 C CB  A MET B 1 77  ? 37.848  7.752   13.395  0.50 28.01  ? 123  MET B CB  1 
ATOM   1398 C CB  B MET B 1 77  ? 38.159  7.659   13.373  0.50 27.91  ? 123  MET B CB  1 
ATOM   1399 C CG  A MET B 1 77  ? 36.703  7.154   12.601  0.50 28.36  ? 123  MET B CG  1 
ATOM   1400 C CG  B MET B 1 77  ? 37.203  6.826   12.529  0.50 27.92  ? 123  MET B CG  1 
ATOM   1401 S SD  A MET B 1 77  ? 36.060  5.633   13.303  0.50 30.57  ? 123  MET B SD  1 
ATOM   1402 S SD  B MET B 1 77  ? 37.455  5.044   12.716  0.50 29.53  ? 123  MET B SD  1 
ATOM   1403 C CE  A MET B 1 77  ? 37.569  4.680   13.448  0.50 29.84  ? 123  MET B CE  1 
ATOM   1404 C CE  B MET B 1 77  ? 35.998  4.412   11.885  0.50 28.58  ? 123  MET B CE  1 
ATOM   1405 N N   . GLY B 1 78  ? 40.218  10.044  13.850  1.00 29.19  ? 124  GLY B N   1 
ATOM   1406 C CA  . GLY B 1 78  ? 41.194  10.670  14.751  1.00 30.71  ? 124  GLY B CA  1 
ATOM   1407 C C   . GLY B 1 78  ? 40.835  12.114  15.059  1.00 31.39  ? 124  GLY B C   1 
ATOM   1408 O O   . GLY B 1 78  ? 40.896  12.555  16.208  1.00 33.40  ? 124  GLY B O   1 
ATOM   1409 N N   . THR B 1 79  ? 40.451  12.847  14.021  1.00 30.50  ? 125  THR B N   1 
ATOM   1410 C CA  . THR B 1 79  ? 39.974  14.220  14.168  1.00 31.09  ? 125  THR B CA  1 
ATOM   1411 C C   . THR B 1 79  ? 38.679  14.252  14.988  1.00 30.38  ? 125  THR B C   1 
ATOM   1412 O O   . THR B 1 79  ? 38.519  15.085  15.873  1.00 30.55  ? 125  THR B O   1 
ATOM   1413 C CB  . THR B 1 79  ? 39.736  14.857  12.790  1.00 30.30  ? 125  THR B CB  1 
ATOM   1414 O OG1 . THR B 1 79  ? 40.971  14.873  12.062  1.00 32.65  ? 125  THR B OG1 1 
ATOM   1415 C CG2 . THR B 1 79  ? 39.188  16.279  12.916  1.00 31.52  ? 125  THR B CG2 1 
ATOM   1416 N N   . ILE B 1 80  ? 37.767  13.332  14.697  1.00 29.35  ? 126  ILE B N   1 
ATOM   1417 C CA  . ILE B 1 80  ? 36.506  13.248  15.434  1.00 29.28  ? 126  ILE B CA  1 
ATOM   1418 C C   . ILE B 1 80  ? 36.739  12.928  16.914  1.00 31.46  ? 126  ILE B C   1 
ATOM   1419 O O   . ILE B 1 80  ? 36.125  13.538  17.800  1.00 31.91  ? 126  ILE B O   1 
ATOM   1420 C CB  . ILE B 1 80  ? 35.561  12.190  14.828  1.00 28.51  ? 126  ILE B CB  1 
ATOM   1421 C CG1 . ILE B 1 80  ? 35.103  12.616  13.433  1.00 27.06  ? 126  ILE B CG1 1 
ATOM   1422 C CG2 . ILE B 1 80  ? 34.339  11.989  15.739  1.00 28.08  ? 126  ILE B CG2 1 
ATOM   1423 C CD1 . ILE B 1 80  ? 34.299  11.558  12.702  1.00 26.50  ? 126  ILE B CD1 1 
ATOM   1424 N N   . LYS B 1 81  ? 37.627  11.972  17.173  1.00 33.12  ? 127  LYS B N   1 
ATOM   1425 C CA  . LYS B 1 81  ? 37.971  11.574  18.540  1.00 35.47  ? 127  LYS B CA  1 
ATOM   1426 C C   . LYS B 1 81  ? 38.560  12.749  19.325  1.00 37.59  ? 127  LYS B C   1 
ATOM   1427 O O   . LYS B 1 81  ? 38.183  12.984  20.474  1.00 38.73  ? 127  LYS B O   1 
ATOM   1428 C CB  . LYS B 1 81  ? 38.948  10.394  18.518  1.00 35.72  ? 127  LYS B CB  1 
ATOM   1429 C CG  . LYS B 1 81  ? 39.356  9.873   19.893  1.00 38.47  ? 127  LYS B CG  1 
ATOM   1430 C CD  . LYS B 1 81  ? 40.147  8.577   19.773  1.00 40.28  ? 127  LYS B CD  1 
ATOM   1431 C CE  . LYS B 1 81  ? 40.951  8.287   21.027  1.00 43.51  ? 127  LYS B CE  1 
ATOM   1432 N NZ  . LYS B 1 81  ? 42.037  9.288   21.254  1.00 44.81  ? 127  LYS B NZ  1 
ATOM   1433 N N   . ARG B 1 82  ? 39.476  13.485  18.698  1.00 38.62  ? 128  ARG B N   1 
ATOM   1434 C CA  . ARG B 1 82  ? 40.087  14.661  19.331  1.00 40.46  ? 128  ARG B CA  1 
ATOM   1435 C C   . ARG B 1 82  ? 39.043  15.734  19.634  1.00 39.77  ? 128  ARG B C   1 
ATOM   1436 O O   . ARG B 1 82  ? 39.099  16.379  20.681  1.00 40.09  ? 128  ARG B O   1 
ATOM   1437 C CB  . ARG B 1 82  ? 41.203  15.237  18.450  1.00 42.05  ? 128  ARG B CB  1 
ATOM   1438 C CG  . ARG B 1 82  ? 41.896  16.463  19.042  1.00 47.91  ? 128  ARG B CG  1 
ATOM   1439 C CD  . ARG B 1 82  ? 43.229  16.768  18.362  1.00 52.67  ? 128  ARG B CD  1 
ATOM   1440 N NE  . ARG B 1 82  ? 43.073  17.059  16.934  1.00 54.85  ? 128  ARG B NE  1 
ATOM   1441 C CZ  . ARG B 1 82  ? 43.331  16.212  15.934  1.00 56.84  ? 128  ARG B CZ  1 
ATOM   1442 N NH1 . ARG B 1 82  ? 43.774  14.976  16.164  1.00 58.79  ? 128  ARG B NH1 1 
ATOM   1443 N NH2 . ARG B 1 82  ? 43.139  16.608  14.680  1.00 57.26  ? 128  ARG B NH2 1 
ATOM   1444 N N   . ARG B 1 83  ? 38.092  15.919  18.718  1.00 37.96  ? 129  ARG B N   1 
ATOM   1445 C CA  . ARG B 1 83  ? 36.999  16.872  18.924  1.00 37.88  ? 129  ARG B CA  1 
ATOM   1446 C C   . ARG B 1 83  ? 36.102  16.475  20.092  1.00 38.34  ? 129  ARG B C   1 
ATOM   1447 O O   . ARG B 1 83  ? 35.668  17.331  20.866  1.00 39.07  ? 129  ARG B O   1 
ATOM   1448 C CB  . ARG B 1 83  ? 36.175  17.036  17.645  1.00 36.65  ? 129  ARG B CB  1 
ATOM   1449 C CG  . ARG B 1 83  ? 36.857  17.929  16.624  1.00 36.92  ? 129  ARG B CG  1 
ATOM   1450 C CD  . ARG B 1 83  ? 36.119  17.975  15.301  1.00 35.98  ? 129  ARG B CD  1 
ATOM   1451 N NE  . ARG B 1 83  ? 36.911  18.681  14.299  1.00 35.90  ? 129  ARG B NE  1 
ATOM   1452 C CZ  . ARG B 1 83  ? 36.473  19.068  13.105  1.00 36.36  ? 129  ARG B CZ  1 
ATOM   1453 N NH1 . ARG B 1 83  ? 35.224  18.821  12.709  1.00 33.57  ? 129  ARG B NH1 1 
ATOM   1454 N NH2 . ARG B 1 83  ? 37.307  19.706  12.290  1.00 38.63  ? 129  ARG B NH2 1 
ATOM   1455 N N   . LEU B 1 84  ? 35.831  15.178  20.218  1.00 37.88  ? 130  LEU B N   1 
ATOM   1456 C CA  . LEU B 1 84  ? 35.078  14.654  21.357  1.00 39.02  ? 130  LEU B CA  1 
ATOM   1457 C C   . LEU B 1 84  ? 35.829  14.896  22.668  1.00 41.44  ? 130  LEU B C   1 
ATOM   1458 O O   . LEU B 1 84  ? 35.233  15.300  23.664  1.00 42.61  ? 130  LEU B O   1 
ATOM   1459 C CB  . LEU B 1 84  ? 34.792  13.160  21.172  1.00 37.88  ? 130  LEU B CB  1 
ATOM   1460 C CG  . LEU B 1 84  ? 33.743  12.840  20.104  1.00 37.01  ? 130  LEU B CG  1 
ATOM   1461 C CD1 . LEU B 1 84  ? 33.800  11.379  19.686  1.00 35.15  ? 130  LEU B CD1 1 
ATOM   1462 C CD2 . LEU B 1 84  ? 32.357  13.214  20.600  1.00 37.09  ? 130  LEU B CD2 1 
ATOM   1463 N N   . GLU B 1 85  ? 37.139  14.664  22.645  1.00 42.84  ? 131  GLU B N   1 
ATOM   1464 C CA  . GLU B 1 85  ? 37.994  14.822  23.827  1.00 45.56  ? 131  GLU B CA  1 
ATOM   1465 C C   . GLU B 1 85  ? 38.188  16.282  24.243  1.00 47.53  ? 131  GLU B C   1 
ATOM   1466 O O   . GLU B 1 85  ? 38.350  16.577  25.431  1.00 49.10  ? 131  GLU B O   1 
ATOM   1467 C CB  . GLU B 1 85  ? 39.355  14.171  23.571  1.00 45.93  ? 131  GLU B CB  1 
ATOM   1468 C CG  . GLU B 1 85  ? 39.302  12.654  23.558  1.00 46.50  ? 131  GLU B CG  1 
ATOM   1469 C CD  . GLU B 1 85  ? 40.542  12.009  22.968  1.00 48.30  ? 131  GLU B CD  1 
ATOM   1470 O OE1 . GLU B 1 85  ? 41.485  12.737  22.578  1.00 50.80  ? 131  GLU B OE1 1 
ATOM   1471 O OE2 . GLU B 1 85  ? 40.569  10.762  22.893  1.00 50.02  ? 131  GLU B OE2 1 
ATOM   1472 N N   . ASN B 1 86  ? 38.168  17.191  23.269  1.00 47.60  ? 132  ASN B N   1 
ATOM   1473 C CA  . ASN B 1 86  ? 38.343  18.622  23.536  1.00 49.26  ? 132  ASN B CA  1 
ATOM   1474 C C   . ASN B 1 86  ? 37.018  19.385  23.658  1.00 48.94  ? 132  ASN B C   1 
ATOM   1475 O O   . ASN B 1 86  ? 37.003  20.616  23.617  1.00 49.38  ? 132  ASN B O   1 
ATOM   1476 C CB  . ASN B 1 86  ? 39.221  19.252  22.446  1.00 49.66  ? 132  ASN B CB  1 
ATOM   1477 C CG  . ASN B 1 86  ? 40.650  18.730  22.470  1.00 51.90  ? 132  ASN B CG  1 
ATOM   1478 O OD1 . ASN B 1 86  ? 41.196  18.433  23.531  1.00 55.21  ? 132  ASN B OD1 1 
ATOM   1479 N ND2 . ASN B 1 86  ? 41.262  18.626  21.297  1.00 52.40  ? 132  ASN B ND2 1 
ATOM   1480 N N   . ASN B 1 87  ? 35.914  18.652  23.815  1.00 48.22  ? 133  ASN B N   1 
ATOM   1481 C CA  . ASN B 1 87  ? 34.577  19.241  23.955  1.00 48.22  ? 133  ASN B CA  1 
ATOM   1482 C C   . ASN B 1 87  ? 34.259  20.244  22.843  1.00 46.70  ? 133  ASN B C   1 
ATOM   1483 O O   . ASN B 1 87  ? 33.733  21.329  23.086  1.00 47.41  ? 133  ASN B O   1 
ATOM   1484 C CB  . ASN B 1 87  ? 34.415  19.882  25.342  1.00 51.11  ? 133  ASN B CB  1 
ATOM   1485 C CG  . ASN B 1 87  ? 34.627  18.887  26.476  1.00 53.22  ? 133  ASN B CG  1 
ATOM   1486 O OD1 . ASN B 1 87  ? 35.097  19.252  27.555  1.00 57.64  ? 133  ASN B OD1 1 
ATOM   1487 N ND2 . ASN B 1 87  ? 34.284  17.624  26.236  1.00 52.30  ? 133  ASN B ND2 1 
ATOM   1488 N N   . TYR B 1 88  ? 34.590  19.862  21.615  1.00 44.42  ? 134  TYR B N   1 
ATOM   1489 C CA  . TYR B 1 88  ? 34.376  20.715  20.458  1.00 43.11  ? 134  TYR B CA  1 
ATOM   1490 C C   . TYR B 1 88  ? 32.907  20.750  20.050  1.00 41.52  ? 134  TYR B C   1 
ATOM   1491 O O   . TYR B 1 88  ? 32.404  21.789  19.622  1.00 41.87  ? 134  TYR B O   1 
ATOM   1492 C CB  . TYR B 1 88  ? 35.232  20.229  19.289  1.00 42.44  ? 134  TYR B CB  1 
ATOM   1493 C CG  . TYR B 1 88  ? 35.003  20.985  18.009  1.00 42.74  ? 134  TYR B CG  1 
ATOM   1494 C CD1 . TYR B 1 88  ? 35.568  22.241  17.814  1.00 46.11  ? 134  TYR B CD1 1 
ATOM   1495 C CD2 . TYR B 1 88  ? 34.216  20.450  16.995  1.00 42.53  ? 134  TYR B CD2 1 
ATOM   1496 C CE1 . TYR B 1 88  ? 35.363  22.940  16.638  1.00 46.75  ? 134  TYR B CE1 1 
ATOM   1497 C CE2 . TYR B 1 88  ? 34.007  21.140  15.813  1.00 44.14  ? 134  TYR B CE2 1 
ATOM   1498 C CZ  . TYR B 1 88  ? 34.583  22.387  15.646  1.00 45.56  ? 134  TYR B CZ  1 
ATOM   1499 O OH  . TYR B 1 88  ? 34.382  23.079  14.480  1.00 48.02  ? 134  TYR B OH  1 
ATOM   1500 N N   . TYR B 1 89  ? 32.225  19.615  20.184  1.00 39.87  ? 135  TYR B N   1 
ATOM   1501 C CA  . TYR B 1 89  ? 30.841  19.496  19.743  1.00 39.06  ? 135  TYR B CA  1 
ATOM   1502 C C   . TYR B 1 89  ? 29.874  20.087  20.761  1.00 41.21  ? 135  TYR B C   1 
ATOM   1503 O O   . TYR B 1 89  ? 30.044  19.907  21.969  1.00 41.70  ? 135  TYR B O   1 
ATOM   1504 C CB  . TYR B 1 89  ? 30.485  18.032  19.487  1.00 37.44  ? 135  TYR B CB  1 
ATOM   1505 C CG  . TYR B 1 89  ? 31.302  17.395  18.390  1.00 35.69  ? 135  TYR B CG  1 
ATOM   1506 C CD1 . TYR B 1 89  ? 31.197  17.837  17.079  1.00 33.78  ? 135  TYR B CD1 1 
ATOM   1507 C CD2 . TYR B 1 89  ? 32.170  16.339  18.660  1.00 33.95  ? 135  TYR B CD2 1 
ATOM   1508 C CE1 . TYR B 1 89  ? 31.941  17.253  16.062  1.00 33.32  ? 135  TYR B CE1 1 
ATOM   1509 C CE2 . TYR B 1 89  ? 32.916  15.753  17.655  1.00 32.21  ? 135  TYR B CE2 1 
ATOM   1510 C CZ  . TYR B 1 89  ? 32.795  16.209  16.361  1.00 31.84  ? 135  TYR B CZ  1 
ATOM   1511 O OH  . TYR B 1 89  ? 33.530  15.623  15.367  1.00 31.28  ? 135  TYR B OH  1 
ATOM   1512 N N   . TRP B 1 90  ? 28.867  20.798  20.259  1.00 42.18  ? 136  TRP B N   1 
ATOM   1513 C CA  . TRP B 1 90  ? 27.781  21.308  21.090  1.00 44.64  ? 136  TRP B CA  1 
ATOM   1514 C C   . TRP B 1 90  ? 26.640  20.290  21.183  1.00 43.74  ? 136  TRP B C   1 
ATOM   1515 O O   . TRP B 1 90  ? 25.941  20.231  22.200  1.00 45.32  ? 136  TRP B O   1 
ATOM   1516 C CB  . TRP B 1 90  ? 27.262  22.641  20.538  1.00 46.16  ? 136  TRP B CB  1 
ATOM   1517 C CG  . TRP B 1 90  ? 26.367  23.372  21.497  1.00 52.83  ? 136  TRP B CG  1 
ATOM   1518 C CD1 . TRP B 1 90  ? 26.754  24.090  22.594  1.00 56.19  ? 136  TRP B CD1 1 
ATOM   1519 C CD2 . TRP B 1 90  ? 24.936  23.451  21.449  1.00 56.62  ? 136  TRP B CD2 1 
ATOM   1520 N NE1 . TRP B 1 90  ? 25.653  24.612  23.231  1.00 59.71  ? 136  TRP B NE1 1 
ATOM   1521 C CE2 . TRP B 1 90  ? 24.525  24.235  22.549  1.00 59.82  ? 136  TRP B CE2 1 
ATOM   1522 C CE3 . TRP B 1 90  ? 23.963  22.939  20.581  1.00 57.63  ? 136  TRP B CE3 1 
ATOM   1523 C CZ2 . TRP B 1 90  ? 23.177  24.521  22.805  1.00 62.81  ? 136  TRP B CZ2 1 
ATOM   1524 C CZ3 . TRP B 1 90  ? 22.621  23.224  20.837  1.00 59.73  ? 136  TRP B CZ3 1 
ATOM   1525 C CH2 . TRP B 1 90  ? 22.244  24.008  21.940  1.00 62.14  ? 136  TRP B CH2 1 
ATOM   1526 N N   . ALA B 1 91  ? 26.459  19.494  20.130  1.00 41.48  ? 137  ALA B N   1 
ATOM   1527 C CA  . ALA B 1 91  ? 25.385  18.501  20.070  1.00 40.72  ? 137  ALA B CA  1 
ATOM   1528 C C   . ALA B 1 91  ? 25.844  17.229  19.361  1.00 38.66  ? 137  ALA B C   1 
ATOM   1529 O O   . ALA B 1 91  ? 26.694  17.279  18.466  1.00 37.05  ? 137  ALA B O   1 
ATOM   1530 C CB  . ALA B 1 91  ? 24.173  19.085  19.353  1.00 41.08  ? 137  ALA B CB  1 
ATOM   1531 N N   . ALA B 1 92  ? 25.264  16.098  19.757  1.00 37.79  ? 138  ALA B N   1 
ATOM   1532 C CA  . ALA B 1 92  ? 25.585  14.793  19.173  1.00 36.40  ? 138  ALA B CA  1 
ATOM   1533 C C   . ALA B 1 92  ? 25.435  14.782  17.654  1.00 34.88  ? 138  ALA B C   1 
ATOM   1534 O O   . ALA B 1 92  ? 26.265  14.209  16.950  1.00 33.95  ? 138  ALA B O   1 
ATOM   1535 C CB  . ALA B 1 92  ? 24.707  13.715  19.788  1.00 36.78  ? 138  ALA B CB  1 
ATOM   1536 N N   . SER B 1 93  ? 24.383  15.428  17.152  1.00 35.28  ? 139  SER B N   1 
ATOM   1537 C CA  . SER B 1 93  ? 24.135  15.499  15.714  1.00 34.13  ? 139  SER B CA  1 
ATOM   1538 C C   . SER B 1 93  ? 25.345  16.042  14.957  1.00 32.83  ? 139  SER B C   1 
ATOM   1539 O O   . SER B 1 93  ? 25.635  15.575  13.865  1.00 31.88  ? 139  SER B O   1 
ATOM   1540 C CB  . SER B 1 93  ? 22.907  16.366  15.417  1.00 35.50  ? 139  SER B CB  1 
ATOM   1541 O OG  . SER B 1 93  ? 23.128  17.697  15.825  1.00 35.98  ? 139  SER B OG  1 
ATOM   1542 N N   . GLU B 1 94  ? 26.050  17.007  15.549  1.00 33.11  ? 140  GLU B N   1 
ATOM   1543 C CA  . GLU B 1 94  ? 27.248  17.597  14.932  1.00 32.69  ? 140  GLU B CA  1 
ATOM   1544 C C   . GLU B 1 94  ? 28.364  16.563  14.758  1.00 31.54  ? 140  GLU B C   1 
ATOM   1545 O O   . GLU B 1 94  ? 29.055  16.532  13.731  1.00 29.26  ? 140  GLU B O   1 
ATOM   1546 C CB  . GLU B 1 94  ? 27.766  18.769  15.771  1.00 34.37  ? 140  GLU B CB  1 
ATOM   1547 C CG  . GLU B 1 94  ? 26.808  19.949  15.882  1.00 37.45  ? 140  GLU B CG  1 
ATOM   1548 C CD  . GLU B 1 94  ? 27.318  21.052  16.801  1.00 41.32  ? 140  GLU B CD  1 
ATOM   1549 O OE1 . GLU B 1 94  ? 28.386  20.879  17.428  1.00 42.46  ? 140  GLU B OE1 1 
ATOM   1550 O OE2 . GLU B 1 94  ? 26.642  22.102  16.898  1.00 44.15  ? 140  GLU B OE2 1 
ATOM   1551 N N   . CYS B 1 95  ? 28.537  15.724  15.772  1.00 31.50  ? 141  CYS B N   1 
ATOM   1552 C CA  . CYS B 1 95  ? 29.506  14.633  15.718  1.00 30.79  ? 141  CYS B CA  1 
ATOM   1553 C C   . CYS B 1 95  ? 29.120  13.604  14.656  1.00 29.40  ? 141  CYS B C   1 
ATOM   1554 O O   . CYS B 1 95  ? 29.961  13.167  13.871  1.00 27.74  ? 141  CYS B O   1 
ATOM   1555 C CB  . CYS B 1 95  ? 29.633  13.977  17.094  1.00 32.18  ? 141  CYS B CB  1 
ATOM   1556 S SG  . CYS B 1 95  ? 30.676  12.530  17.127  1.00 32.53  ? 141  CYS B SG  1 
ATOM   1557 N N   . MET B 1 96  ? 27.843  13.247  14.618  1.00 29.14  ? 142  MET B N   1 
ATOM   1558 C CA  . MET B 1 96  ? 27.313  12.346  13.586  1.00 28.78  ? 142  MET B CA  1 
ATOM   1559 C C   . MET B 1 96  ? 27.516  12.880  12.156  1.00 27.98  ? 142  MET B C   1 
ATOM   1560 O O   . MET B 1 96  ? 27.796  12.100  11.239  1.00 26.88  ? 142  MET B O   1 
ATOM   1561 C CB  . MET B 1 96  ? 25.835  12.062  13.849  1.00 29.61  ? 142  MET B CB  1 
ATOM   1562 C CG  . MET B 1 96  ? 25.601  11.214  15.085  1.00 32.43  ? 142  MET B CG  1 
ATOM   1563 S SD  . MET B 1 96  ? 23.944  11.393  15.752  1.00 35.26  ? 142  MET B SD  1 
ATOM   1564 C CE  . MET B 1 96  ? 22.956  10.655  14.452  1.00 34.50  ? 142  MET B CE  1 
ATOM   1565 N N   A GLN B 1 97  ? 27.376  14.198  11.977  0.50 28.54  ? 143  GLN B N   1 
ATOM   1566 N N   B GLN B 1 97  ? 27.380  14.191  11.977  0.50 27.95  ? 143  GLN B N   1 
ATOM   1567 C CA  A GLN B 1 97  ? 27.651  14.844  10.688  0.50 28.39  ? 143  GLN B CA  1 
ATOM   1568 C CA  B GLN B 1 97  ? 27.645  14.819  10.689  0.50 27.33  ? 143  GLN B CA  1 
ATOM   1569 C C   A GLN B 1 97  ? 29.089  14.594  10.260  0.50 26.89  ? 143  GLN B C   1 
ATOM   1570 C C   B GLN B 1 97  ? 29.092  14.620  10.255  0.50 26.32  ? 143  GLN B C   1 
ATOM   1571 O O   A GLN B 1 97  ? 29.351  14.305  9.094   0.50 26.36  ? 143  GLN B O   1 
ATOM   1572 O O   B GLN B 1 97  ? 29.360  14.388  9.077   0.50 25.83  ? 143  GLN B O   1 
ATOM   1573 C CB  A GLN B 1 97  ? 27.440  16.364  10.745  0.50 29.53  ? 143  GLN B CB  1 
ATOM   1574 C CB  B GLN B 1 97  ? 27.336  16.312  10.752  0.50 27.77  ? 143  GLN B CB  1 
ATOM   1575 C CG  A GLN B 1 97  ? 26.091  16.852  11.245  0.50 32.31  ? 143  GLN B CG  1 
ATOM   1576 C CG  B GLN B 1 97  ? 25.876  16.656  10.568  0.50 28.09  ? 143  GLN B CG  1 
ATOM   1577 C CD  A GLN B 1 97  ? 24.919  16.278  10.487  0.50 33.85  ? 143  GLN B CD  1 
ATOM   1578 C CD  B GLN B 1 97  ? 25.624  18.141  10.736  0.50 28.64  ? 143  GLN B CD  1 
ATOM   1579 O OE1 A GLN B 1 97  ? 25.088  15.463  9.584   0.50 34.19  ? 143  GLN B OE1 1 
ATOM   1580 O OE1 B GLN B 1 97  ? 25.411  18.619  11.843  0.50 30.06  ? 143  GLN B OE1 1 
ATOM   1581 N NE2 A GLN B 1 97  ? 23.711  16.702  10.856  0.50 36.62  ? 143  GLN B NE2 1 
ATOM   1582 N NE2 B GLN B 1 97  ? 25.661  18.878  9.636   0.50 27.82  ? 143  GLN B NE2 1 
ATOM   1583 N N   . ASP B 1 98  ? 30.019  14.724  11.206  1.00 26.80  ? 144  ASP B N   1 
ATOM   1584 C CA  . ASP B 1 98  ? 31.433  14.475  10.933  1.00 26.23  ? 144  ASP B CA  1 
ATOM   1585 C C   . ASP B 1 98  ? 31.683  13.021  10.539  1.00 24.25  ? 144  ASP B C   1 
ATOM   1586 O O   . ASP B 1 98  ? 32.412  12.770  9.583   1.00 23.35  ? 144  ASP B O   1 
ATOM   1587 C CB  . ASP B 1 98  ? 32.326  14.889  12.114  1.00 27.06  ? 144  ASP B CB  1 
ATOM   1588 C CG  . ASP B 1 98  ? 32.601  16.395  12.153  1.00 29.88  ? 144  ASP B CG  1 
ATOM   1589 O OD1 . ASP B 1 98  ? 32.163  17.118  11.234  1.00 28.71  ? 144  ASP B OD1 1 
ATOM   1590 O OD2 . ASP B 1 98  ? 33.271  16.852  13.105  1.00 30.32  ? 144  ASP B OD2 1 
ATOM   1591 N N   . PHE B 1 99  ? 31.074  12.070  11.246  1.00 23.25  ? 145  PHE B N   1 
ATOM   1592 C CA  . PHE B 1 99  ? 31.139  10.659  10.821  1.00 23.74  ? 145  PHE B CA  1 
ATOM   1593 C C   . PHE B 1 99  ? 30.622  10.492  9.393   1.00 23.54  ? 145  PHE B C   1 
ATOM   1594 O O   . PHE B 1 99  ? 31.241  9.811   8.577   1.00 24.91  ? 145  PHE B O   1 
ATOM   1595 C CB  . PHE B 1 99  ? 30.324  9.748   11.741  1.00 24.56  ? 145  PHE B CB  1 
ATOM   1596 C CG  . PHE B 1 99  ? 31.078  9.241   12.931  1.00 26.76  ? 145  PHE B CG  1 
ATOM   1597 C CD1 . PHE B 1 99  ? 31.983  8.200   12.798  1.00 28.82  ? 145  PHE B CD1 1 
ATOM   1598 C CD2 . PHE B 1 99  ? 30.856  9.775   14.192  1.00 28.47  ? 145  PHE B CD2 1 
ATOM   1599 C CE1 . PHE B 1 99  ? 32.678  7.714   13.902  1.00 29.46  ? 145  PHE B CE1 1 
ATOM   1600 C CE2 . PHE B 1 99  ? 31.541  9.290   15.296  1.00 31.44  ? 145  PHE B CE2 1 
ATOM   1601 C CZ  . PHE B 1 99  ? 32.448  8.257   15.148  1.00 30.04  ? 145  PHE B CZ  1 
ATOM   1602 N N   . ASN B 1 100 ? 29.496  11.127  9.086   1.00 23.82  ? 146  ASN B N   1 
ATOM   1603 C CA  . ASN B 1 100 ? 28.923  11.023  7.743   1.00 24.38  ? 146  ASN B CA  1 
ATOM   1604 C C   . ASN B 1 100 ? 29.861  11.598  6.677   1.00 23.58  ? 146  ASN B C   1 
ATOM   1605 O O   . ASN B 1 100 ? 30.031  11.007  5.616   1.00 21.73  ? 146  ASN B O   1 
ATOM   1606 C CB  . ASN B 1 100 ? 27.560  11.699  7.681   1.00 25.49  ? 146  ASN B CB  1 
ATOM   1607 C CG  . ASN B 1 100 ? 26.956  11.660  6.293   1.00 27.37  ? 146  ASN B CG  1 
ATOM   1608 O OD1 . ASN B 1 100 ? 26.323  10.678  5.900   1.00 29.57  ? 146  ASN B OD1 1 
ATOM   1609 N ND2 . ASN B 1 100 ? 27.141  12.731  5.547   1.00 27.33  ? 146  ASN B ND2 1 
ATOM   1610 N N   . THR B 1 101 ? 30.469  12.745  6.966   1.00 23.70  ? 147  THR B N   1 
ATOM   1611 C CA  . THR B 1 101 ? 31.420  13.349  6.036   1.00 23.48  ? 147  THR B CA  1 
ATOM   1612 C C   . THR B 1 101 ? 32.580  12.401  5.731   1.00 23.25  ? 147  THR B C   1 
ATOM   1613 O O   . THR B 1 101 ? 32.977  12.258  4.577   1.00 23.81  ? 147  THR B O   1 
ATOM   1614 C CB  . THR B 1 101 ? 31.944  14.703  6.562   1.00 24.07  ? 147  THR B CB  1 
ATOM   1615 O OG1 . THR B 1 101 ? 30.852  15.622  6.644   1.00 24.50  ? 147  THR B OG1 1 
ATOM   1616 C CG2 . THR B 1 101 ? 33.005  15.291  5.627   1.00 23.25  ? 147  THR B CG2 1 
ATOM   1617 N N   . MET B 1 102 ? 33.117  11.751  6.761   1.00 22.92  ? 148  MET B N   1 
ATOM   1618 C CA  . MET B 1 102 ? 34.199  10.797  6.576   1.00 23.29  ? 148  MET B CA  1 
ATOM   1619 C C   . MET B 1 102 ? 33.799  9.679   5.604   1.00 21.74  ? 148  MET B C   1 
ATOM   1620 O O   . MET B 1 102 ? 34.516  9.386   4.639   1.00 21.09  ? 148  MET B O   1 
ATOM   1621 C CB  . MET B 1 102 ? 34.622  10.212  7.926   1.00 23.65  ? 148  MET B CB  1 
ATOM   1622 C CG  . MET B 1 102 ? 35.665  9.130   7.833   1.00 25.75  ? 148  MET B CG  1 
ATOM   1623 S SD  . MET B 1 102 ? 36.026  8.431   9.449   1.00 27.44  ? 148  MET B SD  1 
ATOM   1624 C CE  . MET B 1 102 ? 34.483  7.617   9.846   1.00 29.87  ? 148  MET B CE  1 
ATOM   1625 N N   . PHE B 1 103 ? 32.660  9.057   5.855   1.00 22.40  ? 149  PHE B N   1 
ATOM   1626 C CA  . PHE B 1 103 ? 32.185  7.976   4.983   1.00 22.58  ? 149  PHE B CA  1 
ATOM   1627 C C   . PHE B 1 103 ? 31.854  8.488   3.578   1.00 22.19  ? 149  PHE B C   1 
ATOM   1628 O O   . PHE B 1 103 ? 32.243  7.879   2.582   1.00 21.94  ? 149  PHE B O   1 
ATOM   1629 C CB  . PHE B 1 103 ? 30.973  7.280   5.587   1.00 23.61  ? 149  PHE B CB  1 
ATOM   1630 C CG  . PHE B 1 103 ? 31.271  6.540   6.858   1.00 26.05  ? 149  PHE B CG  1 
ATOM   1631 C CD1 . PHE B 1 103 ? 32.269  5.577   6.898   1.00 27.36  ? 149  PHE B CD1 1 
ATOM   1632 C CD2 . PHE B 1 103 ? 30.549  6.799   8.017   1.00 26.21  ? 149  PHE B CD2 1 
ATOM   1633 C CE1 . PHE B 1 103 ? 32.542  4.889   8.068   1.00 27.83  ? 149  PHE B CE1 1 
ATOM   1634 C CE2 . PHE B 1 103 ? 30.825  6.110   9.187   1.00 27.98  ? 149  PHE B CE2 1 
ATOM   1635 C CZ  . PHE B 1 103 ? 31.822  5.158   9.211   1.00 26.37  ? 149  PHE B CZ  1 
ATOM   1636 N N   . THR B 1 104 ? 31.159  9.620   3.501   1.00 21.86  ? 150  THR B N   1 
ATOM   1637 C CA  . THR B 1 104 ? 30.754  10.176  2.215   1.00 20.99  ? 150  THR B CA  1 
ATOM   1638 C C   . THR B 1 104 ? 31.964  10.524  1.343   1.00 21.47  ? 150  THR B C   1 
ATOM   1639 O O   . THR B 1 104 ? 31.985  10.214  0.149   1.00 21.25  ? 150  THR B O   1 
ATOM   1640 C CB  . THR B 1 104 ? 29.824  11.393  2.404   1.00 21.93  ? 150  THR B CB  1 
ATOM   1641 O OG1 . THR B 1 104 ? 28.679  10.990  3.165   1.00 22.97  ? 150  THR B OG1 1 
ATOM   1642 C CG2 . THR B 1 104 ? 29.366  11.941  1.064   1.00 22.58  ? 150  THR B CG2 1 
ATOM   1643 N N   . ASN B 1 105 ? 32.982  11.135  1.950   1.00 22.29  ? 151  ASN B N   1 
ATOM   1644 C CA  . ASN B 1 105 ? 34.243  11.407  1.257   1.00 22.03  ? 151  ASN B CA  1 
ATOM   1645 C C   . ASN B 1 105 ? 34.807  10.159  0.606   1.00 21.85  ? 151  ASN B C   1 
ATOM   1646 O O   . ASN B 1 105 ? 35.310  10.204  -0.522  1.00 22.51  ? 151  ASN B O   1 
ATOM   1647 C CB  . ASN B 1 105 ? 35.307  11.937  2.229   1.00 21.95  ? 151  ASN B CB  1 
ATOM   1648 C CG  . ASN B 1 105 ? 35.053  13.360  2.673   1.00 23.73  ? 151  ASN B CG  1 
ATOM   1649 O OD1 . ASN B 1 105 ? 34.212  14.071  2.115   1.00 23.54  ? 151  ASN B OD1 1 
ATOM   1650 N ND2 . ASN B 1 105 ? 35.807  13.792  3.685   1.00 23.49  ? 151  ASN B ND2 1 
ATOM   1651 N N   . CYS B 1 106 ? 34.767  9.055   1.343   1.00 22.16  ? 152  CYS B N   1 
ATOM   1652 C CA  . CYS B 1 106 ? 35.317  7.792   0.863   1.00 23.16  ? 152  CYS B CA  1 
ATOM   1653 C C   . CYS B 1 106 ? 34.557  7.321   -0.389  1.00 23.37  ? 152  CYS B C   1 
ATOM   1654 O O   . CYS B 1 106 ? 35.178  6.969   -1.403  1.00 24.17  ? 152  CYS B O   1 
ATOM   1655 C CB  . CYS B 1 106 ? 35.271  6.740   1.970   1.00 23.56  ? 152  CYS B CB  1 
ATOM   1656 S SG  . CYS B 1 106 ? 36.011  5.168   1.528   1.00 25.32  ? 152  CYS B SG  1 
ATOM   1657 N N   . TYR B 1 107 ? 33.228  7.379   -0.331  1.00 22.94  ? 153  TYR B N   1 
ATOM   1658 C CA  . TYR B 1 107 ? 32.373  6.940   -1.443  1.00 23.20  ? 153  TYR B CA  1 
ATOM   1659 C C   . TYR B 1 107 ? 32.513  7.840   -2.659  1.00 24.45  ? 153  TYR B C   1 
ATOM   1660 O O   . TYR B 1 107 ? 32.527  7.365   -3.790  1.00 24.29  ? 153  TYR B O   1 
ATOM   1661 C CB  . TYR B 1 107 ? 30.902  6.901   -1.037  1.00 23.09  ? 153  TYR B CB  1 
ATOM   1662 C CG  . TYR B 1 107 ? 30.606  6.021   0.145   1.00 21.82  ? 153  TYR B CG  1 
ATOM   1663 C CD1 . TYR B 1 107 ? 31.158  4.743   0.246   1.00 22.93  ? 153  TYR B CD1 1 
ATOM   1664 C CD2 . TYR B 1 107 ? 29.757  6.450   1.153   1.00 22.07  ? 153  TYR B CD2 1 
ATOM   1665 C CE1 . TYR B 1 107 ? 30.882  3.941   1.330   1.00 22.79  ? 153  TYR B CE1 1 
ATOM   1666 C CE2 . TYR B 1 107 ? 29.482  5.658   2.239   1.00 22.49  ? 153  TYR B CE2 1 
ATOM   1667 C CZ  . TYR B 1 107 ? 30.049  4.404   2.326   1.00 22.60  ? 153  TYR B CZ  1 
ATOM   1668 O OH  . TYR B 1 107 ? 29.775  3.602   3.406   1.00 25.58  ? 153  TYR B OH  1 
ATOM   1669 N N   . ILE B 1 108 ? 32.607  9.142   -2.409  1.00 25.12  ? 154  ILE B N   1 
ATOM   1670 C CA  . ILE B 1 108 ? 32.715  10.135  -3.471  1.00 26.62  ? 154  ILE B CA  1 
ATOM   1671 C C   . ILE B 1 108 ? 34.047  10.048  -4.222  1.00 26.54  ? 154  ILE B C   1 
ATOM   1672 O O   . ILE B 1 108 ? 34.070  10.121  -5.451  1.00 28.06  ? 154  ILE B O   1 
ATOM   1673 C CB  . ILE B 1 108 ? 32.512  11.564  -2.888  1.00 27.19  ? 154  ILE B CB  1 
ATOM   1674 C CG1 . ILE B 1 108 ? 31.028  11.778  -2.561  1.00 29.86  ? 154  ILE B CG1 1 
ATOM   1675 C CG2 . ILE B 1 108 ? 33.004  12.619  -3.851  1.00 30.52  ? 154  ILE B CG2 1 
ATOM   1676 C CD1 . ILE B 1 108 ? 30.759  13.064  -1.763  1.00 33.28  ? 154  ILE B CD1 1 
ATOM   1677 N N   . TYR B 1 109 ? 35.149  9.895   -3.489  1.00 25.94  ? 155  TYR B N   1 
ATOM   1678 C CA  . TYR B 1 109 ? 36.480  9.888   -4.094  1.00 26.67  ? 155  TYR B CA  1 
ATOM   1679 C C   . TYR B 1 109 ? 36.853  8.572   -4.792  1.00 26.31  ? 155  TYR B C   1 
ATOM   1680 O O   . TYR B 1 109 ? 37.381  8.581   -5.901  1.00 25.83  ? 155  TYR B O   1 
ATOM   1681 C CB  . TYR B 1 109 ? 37.566  10.211  -3.055  1.00 27.64  ? 155  TYR B CB  1 
ATOM   1682 C CG  . TYR B 1 109 ? 38.947  10.189  -3.676  1.00 28.77  ? 155  TYR B CG  1 
ATOM   1683 C CD1 . TYR B 1 109 ? 39.388  11.243  -4.464  1.00 30.96  ? 155  TYR B CD1 1 
ATOM   1684 C CD2 . TYR B 1 109 ? 39.791  9.092   -3.516  1.00 30.82  ? 155  TYR B CD2 1 
ATOM   1685 C CE1 . TYR B 1 109 ? 40.645  11.215  -5.067  1.00 33.07  ? 155  TYR B CE1 1 
ATOM   1686 C CE2 . TYR B 1 109 ? 41.050  9.056   -4.113  1.00 32.44  ? 155  TYR B CE2 1 
ATOM   1687 C CZ  . TYR B 1 109 ? 41.469  10.120  -4.886  1.00 33.84  ? 155  TYR B CZ  1 
ATOM   1688 O OH  . TYR B 1 109 ? 42.716  10.086  -5.480  1.00 36.77  ? 155  TYR B OH  1 
ATOM   1689 N N   . ASN B 1 110 ? 36.605  7.446   -4.131  1.00 26.02  ? 156  ASN B N   1 
ATOM   1690 C CA  . ASN B 1 110 ? 37.141  6.164   -4.593  1.00 26.66  ? 156  ASN B CA  1 
ATOM   1691 C C   . ASN B 1 110 ? 36.296  5.510   -5.683  1.00 27.68  ? 156  ASN B C   1 
ATOM   1692 O O   . ASN B 1 110 ? 35.134  5.870   -5.880  1.00 27.25  ? 156  ASN B O   1 
ATOM   1693 C CB  . ASN B 1 110 ? 37.319  5.226   -3.400  1.00 26.10  ? 156  ASN B CB  1 
ATOM   1694 C CG  . ASN B 1 110 ? 38.381  5.722   -2.444  1.00 26.85  ? 156  ASN B CG  1 
ATOM   1695 O OD1 . ASN B 1 110 ? 39.578  5.623   -2.727  1.00 27.52  ? 156  ASN B OD1 1 
ATOM   1696 N ND2 . ASN B 1 110 ? 37.956  6.280   -1.320  1.00 23.62  ? 156  ASN B ND2 1 
ATOM   1697 N N   . LYS B 1 111 ? 36.891  4.570   -6.414  1.00 29.02  ? 157  LYS B N   1 
ATOM   1698 C CA  . LYS B 1 111 ? 36.126  3.801   -7.400  1.00 29.97  ? 157  LYS B CA  1 
ATOM   1699 C C   . LYS B 1 111 ? 35.166  2.884   -6.642  1.00 28.30  ? 157  LYS B C   1 
ATOM   1700 O O   . LYS B 1 111 ? 35.529  2.375   -5.585  1.00 25.89  ? 157  LYS B O   1 
ATOM   1701 C CB  . LYS B 1 111 ? 37.033  2.953   -8.287  1.00 31.96  ? 157  LYS B CB  1 
ATOM   1702 C CG  . LYS B 1 111 ? 38.044  3.727   -9.098  1.00 36.51  ? 157  LYS B CG  1 
ATOM   1703 C CD  . LYS B 1 111 ? 38.810  2.797   -10.025 1.00 40.55  ? 157  LYS B CD  1 
ATOM   1704 C CE  . LYS B 1 111 ? 39.958  3.515   -10.711 1.00 44.10  ? 157  LYS B CE  1 
ATOM   1705 N NZ  . LYS B 1 111 ? 40.987  3.955   -9.729  1.00 45.34  ? 157  LYS B NZ  1 
ATOM   1706 N N   . PRO B 1 112 ? 33.947  2.664   -7.185  1.00 28.33  ? 158  PRO B N   1 
ATOM   1707 C CA  . PRO B 1 112 ? 32.962  1.798   -6.540  1.00 27.96  ? 158  PRO B CA  1 
ATOM   1708 C C   . PRO B 1 112 ? 33.492  0.418   -6.172  1.00 28.19  ? 158  PRO B C   1 
ATOM   1709 O O   . PRO B 1 112 ? 33.055  -0.153  -5.181  1.00 28.35  ? 158  PRO B O   1 
ATOM   1710 C CB  . PRO B 1 112 ? 31.874  1.666   -7.605  1.00 29.09  ? 158  PRO B CB  1 
ATOM   1711 C CG  . PRO B 1 112 ? 31.938  2.949   -8.334  1.00 30.15  ? 158  PRO B CG  1 
ATOM   1712 C CD  . PRO B 1 112 ? 33.394  3.287   -8.403  1.00 29.17  ? 158  PRO B CD  1 
ATOM   1713 N N   . THR B 1 113 ? 34.422  -0.102  -6.968  1.00 28.79  ? 159  THR B N   1 
ATOM   1714 C CA  . THR B 1 113 ? 34.941  -1.452  -6.774  1.00 30.59  ? 159  THR B CA  1 
ATOM   1715 C C   . THR B 1 113 ? 36.119  -1.551  -5.797  1.00 29.98  ? 159  THR B C   1 
ATOM   1716 O O   . THR B 1 113 ? 36.530  -2.661  -5.454  1.00 30.72  ? 159  THR B O   1 
ATOM   1717 C CB  . THR B 1 113 ? 35.351  -2.070  -8.123  1.00 32.40  ? 159  THR B CB  1 
ATOM   1718 O OG1 . THR B 1 113 ? 36.196  -1.157  -8.835  1.00 34.58  ? 159  THR B OG1 1 
ATOM   1719 C CG2 . THR B 1 113 ? 34.122  -2.368  -8.958  1.00 34.63  ? 159  THR B CG2 1 
ATOM   1720 N N   . ASP B 1 114 ? 36.651  -0.410  -5.345  1.00 28.92  ? 160  ASP B N   1 
ATOM   1721 C CA  . ASP B 1 114 ? 37.795  -0.395  -4.418  1.00 28.73  ? 160  ASP B CA  1 
ATOM   1722 C C   . ASP B 1 114 ? 37.423  -1.027  -3.073  1.00 27.46  ? 160  ASP B C   1 
ATOM   1723 O O   . ASP B 1 114 ? 36.323  -0.801  -2.558  1.00 26.21  ? 160  ASP B O   1 
ATOM   1724 C CB  . ASP B 1 114 ? 38.275  1.041   -4.151  1.00 29.41  ? 160  ASP B CB  1 
ATOM   1725 C CG  . ASP B 1 114 ? 39.003  1.671   -5.332  1.00 33.08  ? 160  ASP B CG  1 
ATOM   1726 O OD1 . ASP B 1 114 ? 39.535  0.945   -6.196  1.00 35.68  ? 160  ASP B OD1 1 
ATOM   1727 O OD2 . ASP B 1 114 ? 39.060  2.924   -5.376  1.00 37.04  ? 160  ASP B OD2 1 
ATOM   1728 N N   . ASP B 1 115 ? 38.354  -1.785  -2.493  1.00 27.34  ? 161  ASP B N   1 
ATOM   1729 C CA  . ASP B 1 115 ? 38.155  -2.403  -1.181  1.00 27.02  ? 161  ASP B CA  1 
ATOM   1730 C C   . ASP B 1 115 ? 37.772  -1.378  -0.109  1.00 25.47  ? 161  ASP B C   1 
ATOM   1731 O O   . ASP B 1 115 ? 36.940  -1.662  0.747   1.00 24.40  ? 161  ASP B O   1 
ATOM   1732 C CB  . ASP B 1 115 ? 39.424  -3.142  -0.721  1.00 28.21  ? 161  ASP B CB  1 
ATOM   1733 C CG  . ASP B 1 115 ? 39.744  -4.368  -1.561  1.00 30.45  ? 161  ASP B CG  1 
ATOM   1734 O OD1 . ASP B 1 115 ? 39.012  -4.682  -2.528  1.00 31.80  ? 161  ASP B OD1 1 
ATOM   1735 O OD2 . ASP B 1 115 ? 40.749  -5.029  -1.238  1.00 31.54  ? 161  ASP B OD2 1 
ATOM   1736 N N   . ILE B 1 116 ? 38.375  -0.187  -0.154  1.00 25.62  ? 162  ILE B N   1 
ATOM   1737 C CA  . ILE B 1 116 ? 38.094  0.849   0.852   1.00 25.18  ? 162  ILE B CA  1 
ATOM   1738 C C   . ILE B 1 116 ? 36.598  1.185   0.941   1.00 24.41  ? 162  ILE B C   1 
ATOM   1739 O O   . ILE B 1 116 ? 36.060  1.422   2.034   1.00 22.74  ? 162  ILE B O   1 
ATOM   1740 C CB  . ILE B 1 116 ? 38.952  2.134   0.621   1.00 25.43  ? 162  ILE B CB  1 
ATOM   1741 C CG1 . ILE B 1 116 ? 38.922  3.040   1.857   1.00 25.76  ? 162  ILE B CG1 1 
ATOM   1742 C CG2 . ILE B 1 116 ? 38.496  2.883   -0.636  1.00 23.38  ? 162  ILE B CG2 1 
ATOM   1743 C CD1 . ILE B 1 116 ? 39.568  2.429   3.096   1.00 27.14  ? 162  ILE B CD1 1 
ATOM   1744 N N   . VAL B 1 117 ? 35.914  1.157   -0.199  1.00 24.92  ? 163  VAL B N   1 
ATOM   1745 C CA  . VAL B 1 117 ? 34.476  1.398   -0.232  1.00 24.37  ? 163  VAL B CA  1 
ATOM   1746 C C   . VAL B 1 117 ? 33.713  0.351   0.583   1.00 24.76  ? 163  VAL B C   1 
ATOM   1747 O O   . VAL B 1 117 ? 32.821  0.691   1.363   1.00 23.55  ? 163  VAL B O   1 
ATOM   1748 C CB  . VAL B 1 117 ? 33.956  1.442   -1.687  1.00 25.42  ? 163  VAL B CB  1 
ATOM   1749 C CG1 . VAL B 1 117 ? 32.437  1.420   -1.730  1.00 25.89  ? 163  VAL B CG1 1 
ATOM   1750 C CG2 . VAL B 1 117 ? 34.511  2.679   -2.401  1.00 26.96  ? 163  VAL B CG2 1 
ATOM   1751 N N   . LEU B 1 118 ? 34.077  -0.916  0.412   1.00 25.74  ? 164  LEU B N   1 
ATOM   1752 C CA  . LEU B 1 118 ? 33.449  -2.007  1.158   1.00 26.87  ? 164  LEU B CA  1 
ATOM   1753 C C   . LEU B 1 118 ? 33.728  -1.869  2.657   1.00 26.23  ? 164  LEU B C   1 
ATOM   1754 O O   . LEU B 1 118 ? 32.850  -2.097  3.499   1.00 24.67  ? 164  LEU B O   1 
ATOM   1755 C CB  . LEU B 1 118 ? 33.970  -3.348  0.639   1.00 28.61  ? 164  LEU B CB  1 
ATOM   1756 C CG  . LEU B 1 118 ? 33.324  -4.624  1.166   1.00 33.22  ? 164  LEU B CG  1 
ATOM   1757 C CD1 . LEU B 1 118 ? 31.804  -4.576  1.038   1.00 35.42  ? 164  LEU B CD1 1 
ATOM   1758 C CD2 . LEU B 1 118 ? 33.893  -5.843  0.423   1.00 35.61  ? 164  LEU B CD2 1 
ATOM   1759 N N   . MET B 1 119 ? 34.955  -1.478  2.981   1.00 25.69  ? 165  MET B N   1 
ATOM   1760 C CA  . MET B 1 119 ? 35.359  -1.263  4.371   1.00 25.67  ? 165  MET B CA  1 
ATOM   1761 C C   . MET B 1 119 ? 34.558  -0.124  5.010   1.00 25.15  ? 165  MET B C   1 
ATOM   1762 O O   . MET B 1 119 ? 34.074  -0.260  6.132   1.00 25.65  ? 165  MET B O   1 
ATOM   1763 C CB  . MET B 1 119 ? 36.858  -0.989  4.434   1.00 25.89  ? 165  MET B CB  1 
ATOM   1764 C CG  . MET B 1 119 ? 37.699  -2.200  4.038   1.00 27.49  ? 165  MET B CG  1 
ATOM   1765 S SD  . MET B 1 119 ? 39.420  -1.808  3.644   1.00 27.40  ? 165  MET B SD  1 
ATOM   1766 C CE  . MET B 1 119 ? 40.138  -1.681  5.284   1.00 30.64  ? 165  MET B CE  1 
ATOM   1767 N N   . ALA B 1 120 ? 34.392  0.980   4.282   1.00 24.28  ? 166  ALA B N   1 
ATOM   1768 C CA  . ALA B 1 120 ? 33.565  2.087   4.758   1.00 24.49  ? 166  ALA B CA  1 
ATOM   1769 C C   . ALA B 1 120 ? 32.118  1.644   4.969   1.00 24.66  ? 166  ALA B C   1 
ATOM   1770 O O   . ALA B 1 120 ? 31.521  1.953   6.004   1.00 25.54  ? 166  ALA B O   1 
ATOM   1771 C CB  . ALA B 1 120 ? 33.624  3.274   3.790   1.00 23.46  ? 166  ALA B CB  1 
ATOM   1772 N N   . GLN B 1 121 ? 31.569  0.911   4.001   1.00 25.52  ? 167  GLN B N   1 
ATOM   1773 C CA  . GLN B 1 121 ? 30.187  0.418   4.091   1.00 26.55  ? 167  GLN B CA  1 
ATOM   1774 C C   . GLN B 1 121 ? 29.979  -0.387  5.375   1.00 27.19  ? 167  GLN B C   1 
ATOM   1775 O O   . GLN B 1 121 ? 28.989  -0.202  6.072   1.00 26.63  ? 167  GLN B O   1 
ATOM   1776 C CB  . GLN B 1 121 ? 29.801  -0.422  2.855   1.00 27.33  ? 167  GLN B CB  1 
ATOM   1777 C CG  . GLN B 1 121 ? 29.539  0.402   1.582   1.00 28.86  ? 167  GLN B CG  1 
ATOM   1778 C CD  . GLN B 1 121 ? 29.318  -0.452  0.330   1.00 32.45  ? 167  GLN B CD  1 
ATOM   1779 O OE1 . GLN B 1 121 ? 30.177  -1.241  -0.062  1.00 34.48  ? 167  GLN B OE1 1 
ATOM   1780 N NE2 . GLN B 1 121 ? 28.173  -0.268  -0.317  1.00 33.13  ? 167  GLN B NE2 1 
ATOM   1781 N N   . THR B 1 122 ? 30.925  -1.273  5.682   1.00 27.47  ? 168  THR B N   1 
ATOM   1782 C CA  . THR B 1 122 ? 30.853  -2.105  6.883   1.00 27.58  ? 168  THR B CA  1 
ATOM   1783 C C   . THR B 1 122 ? 30.863  -1.256  8.160   1.00 26.94  ? 168  THR B C   1 
ATOM   1784 O O   . THR B 1 122 ? 30.032  -1.448  9.054   1.00 26.78  ? 168  THR B O   1 
ATOM   1785 C CB  . THR B 1 122 ? 32.024  -3.118  6.918   1.00 27.67  ? 168  THR B CB  1 
ATOM   1786 O OG1 . THR B 1 122 ? 32.008  -3.904  5.721   1.00 27.81  ? 168  THR B OG1 1 
ATOM   1787 C CG2 . THR B 1 122 ? 31.932  -4.034  8.139   1.00 27.62  ? 168  THR B CG2 1 
ATOM   1788 N N   . LEU B 1 123 ? 31.803  -0.323  8.238   1.00 26.19  ? 169  LEU B N   1 
ATOM   1789 C CA  . LEU B 1 123 ? 31.931  0.553   9.404   1.00 26.41  ? 169  LEU B CA  1 
ATOM   1790 C C   . LEU B 1 123 ? 30.701  1.438   9.559   1.00 26.48  ? 169  LEU B C   1 
ATOM   1791 O O   . LEU B 1 123 ? 30.209  1.634   10.671  1.00 26.69  ? 169  LEU B O   1 
ATOM   1792 C CB  . LEU B 1 123 ? 33.199  1.411   9.307   1.00 26.37  ? 169  LEU B CB  1 
ATOM   1793 C CG  . LEU B 1 123 ? 34.525  0.643   9.370   1.00 27.20  ? 169  LEU B CG  1 
ATOM   1794 C CD1 . LEU B 1 123 ? 35.714  1.522   8.963   1.00 28.51  ? 169  LEU B CD1 1 
ATOM   1795 C CD2 . LEU B 1 123 ? 34.739  0.072   10.760  1.00 28.84  ? 169  LEU B CD2 1 
ATOM   1796 N N   . GLU B 1 124 ? 30.198  1.950   8.437   1.00 26.10  ? 170  GLU B N   1 
ATOM   1797 C CA  . GLU B 1 124 ? 29.012  2.814   8.436   1.00 26.79  ? 170  GLU B CA  1 
ATOM   1798 C C   . GLU B 1 124 ? 27.771  2.085   8.953   1.00 27.46  ? 170  GLU B C   1 
ATOM   1799 O O   . GLU B 1 124 ? 26.973  2.653   9.709   1.00 25.36  ? 170  GLU B O   1 
ATOM   1800 C CB  . GLU B 1 124 ? 28.785  3.350   7.021   1.00 26.67  ? 170  GLU B CB  1 
ATOM   1801 C CG  . GLU B 1 124 ? 27.701  4.395   6.882   1.00 30.15  ? 170  GLU B CG  1 
ATOM   1802 C CD  . GLU B 1 124 ? 27.657  4.961   5.469   1.00 30.53  ? 170  GLU B CD  1 
ATOM   1803 O OE1 . GLU B 1 124 ? 27.558  4.172   4.495   1.00 30.68  ? 170  GLU B OE1 1 
ATOM   1804 O OE2 . GLU B 1 124 ? 27.719  6.193   5.339   1.00 31.09  ? 170  GLU B OE2 1 
ATOM   1805 N N   . LYS B 1 125 ? 27.616  0.818   8.565   1.00 28.51  ? 171  LYS B N   1 
ATOM   1806 C CA  . LYS B 1 125 ? 26.501  0.005   9.054   1.00 30.64  ? 171  LYS B CA  1 
ATOM   1807 C C   . LYS B 1 125 ? 26.572  -0.182  10.572  1.00 31.25  ? 171  LYS B C   1 
ATOM   1808 O O   . LYS B 1 125 ? 25.553  -0.095  11.260  1.00 32.87  ? 171  LYS B O   1 
ATOM   1809 C CB  . LYS B 1 125 ? 26.467  -1.356  8.346   1.00 32.38  ? 171  LYS B CB  1 
ATOM   1810 C CG  . LYS B 1 125 ? 25.907  -1.312  6.920   1.00 36.02  ? 171  LYS B CG  1 
ATOM   1811 C CD  . LYS B 1 125 ? 26.421  -2.491  6.082   1.00 39.20  ? 171  LYS B CD  1 
ATOM   1812 C CE  . LYS B 1 125 ? 25.458  -2.916  4.984   1.00 41.87  ? 171  LYS B CE  1 
ATOM   1813 N NZ  . LYS B 1 125 ? 24.739  -1.791  4.325   1.00 42.78  ? 171  LYS B NZ  1 
ATOM   1814 N N   . ILE B 1 126 ? 27.771  -0.433  11.094  1.00 31.09  ? 172  ILE B N   1 
ATOM   1815 C CA  . ILE B 1 126 ? 27.963  -0.556  12.543  1.00 32.19  ? 172  ILE B CA  1 
ATOM   1816 C C   . ILE B 1 126 ? 27.647  0.771   13.226  1.00 31.42  ? 172  ILE B C   1 
ATOM   1817 O O   . ILE B 1 126 ? 26.962  0.807   14.249  1.00 32.08  ? 172  ILE B O   1 
ATOM   1818 C CB  . ILE B 1 126 ? 29.403  -0.969  12.903  1.00 32.83  ? 172  ILE B CB  1 
ATOM   1819 C CG1 . ILE B 1 126 ? 29.710  -2.377  12.387  1.00 34.45  ? 172  ILE B CG1 1 
ATOM   1820 C CG2 . ILE B 1 126 ? 29.607  -0.921  14.409  1.00 33.97  ? 172  ILE B CG2 1 
ATOM   1821 C CD1 . ILE B 1 126 ? 31.179  -2.710  12.425  1.00 36.28  ? 172  ILE B CD1 1 
ATOM   1822 N N   . PHE B 1 127 ? 28.148  1.861   12.649  1.00 29.97  ? 173  PHE B N   1 
ATOM   1823 C CA  . PHE B 1 127 ? 27.858  3.202   13.166  1.00 29.85  ? 173  PHE B CA  1 
ATOM   1824 C C   . PHE B 1 127 ? 26.355  3.396   13.366  1.00 30.76  ? 173  PHE B C   1 
ATOM   1825 O O   . PHE B 1 127 ? 25.909  3.789   14.450  1.00 31.45  ? 173  PHE B O   1 
ATOM   1826 C CB  . PHE B 1 127 ? 28.443  4.269   12.228  1.00 28.49  ? 173  PHE B CB  1 
ATOM   1827 C CG  . PHE B 1 127 ? 28.015  5.670   12.554  1.00 29.67  ? 173  PHE B CG  1 
ATOM   1828 C CD1 . PHE B 1 127 ? 28.604  6.365   13.603  1.00 31.11  ? 173  PHE B CD1 1 
ATOM   1829 C CD2 . PHE B 1 127 ? 27.028  6.296   11.807  1.00 30.91  ? 173  PHE B CD2 1 
ATOM   1830 C CE1 . PHE B 1 127 ? 28.200  7.665   13.907  1.00 31.29  ? 173  PHE B CE1 1 
ATOM   1831 C CE2 . PHE B 1 127 ? 26.626  7.594   12.095  1.00 32.09  ? 173  PHE B CE2 1 
ATOM   1832 C CZ  . PHE B 1 127 ? 27.213  8.277   13.151  1.00 31.88  ? 173  PHE B CZ  1 
ATOM   1833 N N   . LEU B 1 128 ? 25.567  3.101   12.337  1.00 30.66  ? 174  LEU B N   1 
ATOM   1834 C CA  . LEU B 1 128 ? 24.116  3.284   12.427  1.00 32.71  ? 174  LEU B CA  1 
ATOM   1835 C C   . LEU B 1 128 ? 23.445  2.367   13.445  1.00 33.96  ? 174  LEU B C   1 
ATOM   1836 O O   . LEU B 1 128 ? 22.530  2.798   14.153  1.00 34.97  ? 174  LEU B O   1 
ATOM   1837 C CB  . LEU B 1 128 ? 23.457  3.102   11.062  1.00 33.60  ? 174  LEU B CB  1 
ATOM   1838 C CG  . LEU B 1 128 ? 23.682  4.268   10.107  1.00 34.06  ? 174  LEU B CG  1 
ATOM   1839 C CD1 . LEU B 1 128 ? 23.196  3.885   8.732   1.00 35.08  ? 174  LEU B CD1 1 
ATOM   1840 C CD2 . LEU B 1 128 ? 22.962  5.506   10.609  1.00 34.99  ? 174  LEU B CD2 1 
ATOM   1841 N N   A GLN B 1 129 ? 23.888  1.113   13.500  0.50 34.53  ? 175  GLN B N   1 
ATOM   1842 N N   B GLN B 1 129 ? 23.889  1.112   13.508  0.50 34.25  ? 175  GLN B N   1 
ATOM   1843 C CA  A GLN B 1 129 ? 23.382  0.150   14.473  0.50 36.61  ? 175  GLN B CA  1 
ATOM   1844 C CA  B GLN B 1 129 ? 23.362  0.150   14.476  0.50 36.12  ? 175  GLN B CA  1 
ATOM   1845 C C   A GLN B 1 129 ? 23.562  0.661   15.894  0.50 37.29  ? 175  GLN B C   1 
ATOM   1846 C C   B GLN B 1 129 ? 23.560  0.657   15.899  0.50 37.03  ? 175  GLN B C   1 
ATOM   1847 O O   A GLN B 1 129 ? 22.630  0.622   16.696  0.50 38.76  ? 175  GLN B O   1 
ATOM   1848 O O   B GLN B 1 129 ? 22.636  0.612   16.710  0.50 38.51  ? 175  GLN B O   1 
ATOM   1849 C CB  A GLN B 1 129 ? 24.105  -1.190  14.325  0.50 37.06  ? 175  GLN B CB  1 
ATOM   1850 C CB  B GLN B 1 129 ? 24.045  -1.214  14.325  0.50 36.31  ? 175  GLN B CB  1 
ATOM   1851 C CG  A GLN B 1 129 ? 23.388  -2.185  13.443  0.50 39.08  ? 175  GLN B CG  1 
ATOM   1852 C CG  B GLN B 1 129 ? 23.736  -1.936  13.029  0.50 36.58  ? 175  GLN B CG  1 
ATOM   1853 C CD  A GLN B 1 129 ? 24.147  -3.488  13.307  0.50 39.78  ? 175  GLN B CD  1 
ATOM   1854 C CD  B GLN B 1 129 ? 22.334  -2.521  12.983  0.50 38.07  ? 175  GLN B CD  1 
ATOM   1855 O OE1 A GLN B 1 129 ? 25.267  -3.620  13.798  0.50 40.91  ? 175  GLN B OE1 1 
ATOM   1856 O OE1 B GLN B 1 129 ? 21.682  -2.508  11.940  0.50 36.74  ? 175  GLN B OE1 1 
ATOM   1857 N NE2 A GLN B 1 129 ? 23.543  -4.457  12.634  0.50 41.85  ? 175  GLN B NE2 1 
ATOM   1858 N NE2 B GLN B 1 129 ? 21.870  -3.044  14.111  0.50 38.04  ? 175  GLN B NE2 1 
ATOM   1859 N N   . LYS B 1 130 ? 24.766  1.141   16.192  1.00 36.59  ? 176  LYS B N   1 
ATOM   1860 C CA  . LYS B 1 130 ? 25.088  1.665   17.518  1.00 38.26  ? 176  LYS B CA  1 
ATOM   1861 C C   . LYS B 1 130 ? 24.373  2.986   17.807  1.00 38.37  ? 176  LYS B C   1 
ATOM   1862 O O   . LYS B 1 130 ? 23.912  3.209   18.930  1.00 38.66  ? 176  LYS B O   1 
ATOM   1863 C CB  . LYS B 1 130 ? 26.601  1.832   17.685  1.00 37.95  ? 176  LYS B CB  1 
ATOM   1864 C CG  . LYS B 1 130 ? 27.404  0.529   17.565  1.00 41.28  ? 176  LYS B CG  1 
ATOM   1865 C CD  . LYS B 1 130 ? 26.997  -0.497  18.609  1.00 45.47  ? 176  LYS B CD  1 
ATOM   1866 C CE  . LYS B 1 130 ? 27.924  -1.709  18.604  1.00 48.70  ? 176  LYS B CE  1 
ATOM   1867 N NZ  . LYS B 1 130 ? 29.313  -1.354  19.000  1.00 50.65  ? 176  LYS B NZ  1 
ATOM   1868 N N   . VAL B 1 131 ? 24.273  3.852   16.800  1.00 36.87  ? 177  VAL B N   1 
ATOM   1869 C CA  . VAL B 1 131 ? 23.553  5.119   16.957  1.00 37.43  ? 177  VAL B CA  1 
ATOM   1870 C C   . VAL B 1 131 ? 22.076  4.899   17.308  1.00 38.45  ? 177  VAL B C   1 
ATOM   1871 O O   . VAL B 1 131 ? 21.487  5.694   18.043  1.00 39.36  ? 177  VAL B O   1 
ATOM   1872 C CB  . VAL B 1 131 ? 23.694  6.020   15.697  1.00 36.05  ? 177  VAL B CB  1 
ATOM   1873 C CG1 . VAL B 1 131 ? 22.623  7.100   15.668  1.00 38.68  ? 177  VAL B CG1 1 
ATOM   1874 C CG2 . VAL B 1 131 ? 25.073  6.655   15.668  1.00 36.09  ? 177  VAL B CG2 1 
ATOM   1875 N N   . ALA B 1 132 ? 21.490  3.813   16.805  1.00 38.59  ? 178  ALA B N   1 
ATOM   1876 C CA  . ALA B 1 132 ? 20.094  3.479   17.099  1.00 40.19  ? 178  ALA B CA  1 
ATOM   1877 C C   . ALA B 1 132 ? 19.810  3.345   18.603  1.00 42.03  ? 178  ALA B C   1 
ATOM   1878 O O   . ALA B 1 132 ? 18.687  3.594   19.045  1.00 43.48  ? 178  ALA B O   1 
ATOM   1879 C CB  . ALA B 1 132 ? 19.687  2.196   16.369  1.00 40.31  ? 178  ALA B CB  1 
ATOM   1880 N N   . SER B 1 133 ? 20.826  2.959   19.377  1.00 42.01  ? 179  SER B N   1 
ATOM   1881 C CA  . SER B 1 133 ? 20.691  2.774   20.828  1.00 44.01  ? 179  SER B CA  1 
ATOM   1882 C C   . SER B 1 133 ? 21.240  3.953   21.652  1.00 44.62  ? 179  SER B C   1 
ATOM   1883 O O   . SER B 1 133 ? 21.437  3.828   22.862  1.00 44.89  ? 179  SER B O   1 
ATOM   1884 C CB  . SER B 1 133 ? 21.391  1.477   21.245  1.00 44.29  ? 179  SER B CB  1 
ATOM   1885 O OG  . SER B 1 133 ? 20.746  0.350   20.677  1.00 45.68  ? 179  SER B OG  1 
ATOM   1886 N N   . MET B 1 134 ? 21.486  5.091   21.004  1.00 44.29  ? 180  MET B N   1 
ATOM   1887 C CA  . MET B 1 134 ? 21.965  6.286   21.700  1.00 45.45  ? 180  MET B CA  1 
ATOM   1888 C C   . MET B 1 134 ? 20.829  6.853   22.561  1.00 48.10  ? 180  MET B C   1 
ATOM   1889 O O   . MET B 1 134 ? 19.664  6.766   22.171  1.00 48.54  ? 180  MET B O   1 
ATOM   1890 C CB  . MET B 1 134 ? 22.442  7.336   20.688  1.00 43.95  ? 180  MET B CB  1 
ATOM   1891 C CG  . MET B 1 134 ? 23.040  8.596   21.307  1.00 44.89  ? 180  MET B CG  1 
ATOM   1892 S SD  . MET B 1 134 ? 23.795  9.702   20.098  1.00 45.53  ? 180  MET B SD  1 
ATOM   1893 C CE  . MET B 1 134 ? 22.376  10.129  19.093  1.00 45.74  ? 180  MET B CE  1 
ATOM   1894 N N   . PRO B 1 135 ? 21.158  7.416   23.742  1.00 50.87  ? 181  PRO B N   1 
ATOM   1895 C CA  . PRO B 1 135 ? 20.142  8.082   24.577  1.00 53.94  ? 181  PRO B CA  1 
ATOM   1896 C C   . PRO B 1 135 ? 19.333  9.130   23.805  1.00 54.78  ? 181  PRO B C   1 
ATOM   1897 O O   . PRO B 1 135 ? 19.911  9.892   23.026  1.00 52.69  ? 181  PRO B O   1 
ATOM   1898 C CB  . PRO B 1 135 ? 20.979  8.743   25.671  1.00 54.76  ? 181  PRO B CB  1 
ATOM   1899 C CG  . PRO B 1 135 ? 22.164  7.850   25.818  1.00 53.72  ? 181  PRO B CG  1 
ATOM   1900 C CD  . PRO B 1 135 ? 22.443  7.277   24.454  1.00 50.94  ? 181  PRO B CD  1 
ATOM   1901 N N   . GLN B 1 136 ? 18.016  9.166   24.028  1.00 57.69  ? 182  GLN B N   1 
ATOM   1902 C CA  . GLN B 1 136 ? 17.100  9.934   23.164  1.00 58.91  ? 182  GLN B CA  1 
ATOM   1903 C C   . GLN B 1 136 ? 17.125  11.443  23.407  1.00 59.98  ? 182  GLN B C   1 
ATOM   1904 O O   . GLN B 1 136 ? 17.048  12.224  22.459  1.00 58.75  ? 182  GLN B O   1 
ATOM   1905 C CB  . GLN B 1 136 ? 15.654  9.408   23.262  1.00 60.90  ? 182  GLN B CB  1 
ATOM   1906 C CG  . GLN B 1 136 ? 14.916  9.696   24.579  1.00 64.37  ? 182  GLN B CG  1 
ATOM   1907 C CD  . GLN B 1 136 ? 13.399  9.561   24.461  1.00 67.40  ? 182  GLN B CD  1 
ATOM   1908 O OE1 . GLN B 1 136 ? 12.841  9.571   23.361  1.00 67.60  ? 182  GLN B OE1 1 
ATOM   1909 N NE2 . GLN B 1 136 ? 12.725  9.449   25.605  1.00 70.02  ? 182  GLN B NE2 1 
ATOM   1910 N N   . GLU B 1 137 ? 17.223  11.843  24.672  1.00 62.56  ? 183  GLU B N   1 
ATOM   1911 C CA  . GLU B 1 137 ? 17.221  13.255  25.047  1.00 64.04  ? 183  GLU B CA  1 
ATOM   1912 C C   . GLU B 1 137 ? 18.639  13.702  25.384  1.00 63.74  ? 183  GLU B C   1 
ATOM   1913 O O   . GLU B 1 137 ? 19.282  13.125  26.263  1.00 64.66  ? 183  GLU B O   1 
ATOM   1914 C CB  . GLU B 1 137 ? 16.300  13.485  26.249  1.00 66.58  ? 183  GLU B CB  1 
ATOM   1915 N N   . GLU B 1 138 ? 19.126  14.725  24.683  1.00 63.11  ? 184  GLU B N   1 
ATOM   1916 C CA  . GLU B 1 138 ? 20.459  15.266  24.941  1.00 62.75  ? 184  GLU B CA  1 
ATOM   1917 C C   . GLU B 1 138 ? 20.437  16.100  26.219  1.00 65.37  ? 184  GLU B C   1 
ATOM   1918 O O   . GLU B 1 138 ? 19.679  17.064  26.321  1.00 66.62  ? 184  GLU B O   1 
ATOM   1919 C CB  . GLU B 1 138 ? 20.945  16.113  23.760  1.00 61.05  ? 184  GLU B CB  1 
ATOM   1920 C CG  . GLU B 1 138 ? 22.429  16.488  23.843  1.00 59.72  ? 184  GLU B CG  1 
ATOM   1921 C CD  . GLU B 1 138 ? 23.112  16.564  22.481  1.00 57.42  ? 184  GLU B CD  1 
ATOM   1922 O OE1 . GLU B 1 138 ? 22.481  17.025  21.506  1.00 56.57  ? 184  GLU B OE1 1 
ATOM   1923 O OE2 . GLU B 1 138 ? 24.287  16.151  22.385  1.00 54.24  ? 184  GLU B OE2 1 
ATOM   1924 N N   . GLN B 1 139 ? 21.264  15.714  27.189  1.00 66.54  ? 185  GLN B N   1 
ATOM   1925 C CA  . GLN B 1 139 ? 21.318  16.379  28.487  1.00 69.03  ? 185  GLN B CA  1 
ATOM   1926 C C   . GLN B 1 139 ? 22.761  16.683  28.879  1.00 69.28  ? 185  GLN B C   1 
ATOM   1927 O O   . GLN B 1 139 ? 23.612  15.791  28.874  1.00 68.29  ? 185  GLN B O   1 
ATOM   1928 C CB  . GLN B 1 139 ? 20.670  15.496  29.554  1.00 70.94  ? 185  GLN B CB  1 
ATOM   1929 N N   . GLU B 1 140 ? 23.026  17.944  29.216  1.00 70.88  ? 186  GLU B N   1 
ATOM   1930 C CA  . GLU B 1 140 ? 24.350  18.372  29.667  1.00 71.58  ? 186  GLU B CA  1 
ATOM   1931 C C   . GLU B 1 140 ? 24.584  17.939  31.111  1.00 73.72  ? 186  GLU B C   1 
ATOM   1932 O O   . GLU B 1 140 ? 25.597  17.314  31.424  1.00 73.63  ? 186  GLU B O   1 
ATOM   1933 C CB  . GLU B 1 140 ? 24.492  19.893  29.541  1.00 72.61  ? 186  GLU B CB  1 
ATOM   1934 C CG  . GLU B 1 140 ? 25.871  20.441  29.923  1.00 73.95  ? 186  GLU B CG  1 
ATOM   1935 C CD  . GLU B 1 140 ? 26.063  21.909  29.552  1.00 75.38  ? 186  GLU B CD  1 
ATOM   1936 O OE1 . GLU B 1 140 ? 25.189  22.493  28.873  1.00 75.37  ? 186  GLU B OE1 1 
ATOM   1937 O OE2 . GLU B 1 140 ? 27.101  22.484  29.944  1.00 76.93  ? 186  GLU B OE2 1 
ATOM   1938 N N   . ASN C 1 31  ? -3.412  39.546  23.275  1.00 66.46  ? 77   ASN C N   1 
ATOM   1939 C CA  . ASN C 1 31  ? -4.326  39.028  24.334  1.00 65.05  ? 77   ASN C CA  1 
ATOM   1940 C C   . ASN C 1 31  ? -3.984  37.580  24.710  1.00 60.98  ? 77   ASN C C   1 
ATOM   1941 O O   . ASN C 1 31  ? -2.969  37.044  24.259  1.00 59.31  ? 77   ASN C O   1 
ATOM   1942 C CB  . ASN C 1 31  ? -5.786  39.162  23.876  1.00 65.97  ? 77   ASN C CB  1 
ATOM   1943 C CG  . ASN C 1 31  ? -6.137  38.234  22.721  1.00 64.70  ? 77   ASN C CG  1 
ATOM   1944 O OD1 . ASN C 1 31  ? -5.354  37.367  22.330  1.00 63.69  ? 77   ASN C OD1 1 
ATOM   1945 N ND2 . ASN C 1 31  ? -7.334  38.412  22.174  1.00 66.34  ? 77   ASN C ND2 1 
ATOM   1946 N N   . GLN C 1 32  ? -4.834  36.960  25.527  1.00 59.31  ? 78   GLN C N   1 
ATOM   1947 C CA  . GLN C 1 32  ? -4.594  35.608  26.047  1.00 56.12  ? 78   GLN C CA  1 
ATOM   1948 C C   . GLN C 1 32  ? -4.455  34.542  24.959  1.00 52.80  ? 78   GLN C C   1 
ATOM   1949 O O   . GLN C 1 32  ? -3.527  33.733  24.998  1.00 50.63  ? 78   GLN C O   1 
ATOM   1950 C CB  . GLN C 1 32  ? -5.715  35.201  27.011  1.00 56.40  ? 78   GLN C CB  1 
ATOM   1951 C CG  . GLN C 1 32  ? -5.739  36.003  28.298  1.00 59.63  ? 78   GLN C CG  1 
ATOM   1952 C CD  . GLN C 1 32  ? -6.694  35.430  29.334  1.00 60.48  ? 78   GLN C CD  1 
ATOM   1953 O OE1 . GLN C 1 32  ? -7.845  35.117  29.030  1.00 62.22  ? 78   GLN C OE1 1 
ATOM   1954 N NE2 . GLN C 1 32  ? -6.220  35.300  30.567  1.00 60.66  ? 78   GLN C NE2 1 
ATOM   1955 N N   . LEU C 1 33  ? -5.383  34.535  24.006  1.00 52.33  ? 79   LEU C N   1 
ATOM   1956 C CA  . LEU C 1 33  ? -5.378  33.538  22.931  1.00 50.31  ? 79   LEU C CA  1 
ATOM   1957 C C   . LEU C 1 33  ? -4.208  33.733  21.968  1.00 50.32  ? 79   LEU C C   1 
ATOM   1958 O O   . LEU C 1 33  ? -3.612  32.758  21.506  1.00 48.68  ? 79   LEU C O   1 
ATOM   1959 C CB  . LEU C 1 33  ? -6.705  33.550  22.163  1.00 51.07  ? 79   LEU C CB  1 
ATOM   1960 C CG  . LEU C 1 33  ? -7.882  32.872  22.867  1.00 50.45  ? 79   LEU C CG  1 
ATOM   1961 C CD1 . LEU C 1 33  ? -9.162  33.081  22.072  1.00 52.32  ? 79   LEU C CD1 1 
ATOM   1962 C CD2 . LEU C 1 33  ? -7.607  31.386  23.067  1.00 47.55  ? 79   LEU C CD2 1 
ATOM   1963 N N   . GLN C 1 34  ? -3.882  34.988  21.670  1.00 52.53  ? 80   GLN C N   1 
ATOM   1964 C CA  . GLN C 1 34  ? -2.715  35.302  20.842  1.00 53.38  ? 80   GLN C CA  1 
ATOM   1965 C C   . GLN C 1 34  ? -1.436  34.817  21.527  1.00 51.87  ? 80   GLN C C   1 
ATOM   1966 O O   . GLN C 1 34  ? -0.534  34.293  20.876  1.00 51.10  ? 80   GLN C O   1 
ATOM   1967 C CB  . GLN C 1 34  ? -2.622  36.807  20.572  1.00 56.92  ? 80   GLN C CB  1 
ATOM   1968 C CG  . GLN C 1 34  ? -1.875  37.151  19.294  1.00 60.13  ? 80   GLN C CG  1 
ATOM   1969 C CD  . GLN C 1 34  ? -2.783  37.171  18.078  1.00 61.65  ? 80   GLN C CD  1 
ATOM   1970 O OE1 . GLN C 1 34  ? -3.377  38.200  17.751  1.00 65.52  ? 80   GLN C OE1 1 
ATOM   1971 N NE2 . GLN C 1 34  ? -2.888  36.036  17.398  1.00 60.90  ? 80   GLN C NE2 1 
ATOM   1972 N N   . TYR C 1 35  ? -1.378  34.993  22.845  1.00 51.42  ? 81   TYR C N   1 
ATOM   1973 C CA  . TYR C 1 35  ? -0.268  34.500  23.659  1.00 50.61  ? 81   TYR C CA  1 
ATOM   1974 C C   . TYR C 1 35  ? -0.194  32.971  23.637  1.00 47.72  ? 81   TYR C C   1 
ATOM   1975 O O   . TYR C 1 35  ? 0.880   32.403  23.441  1.00 47.46  ? 81   TYR C O   1 
ATOM   1976 C CB  . TYR C 1 35  ? -0.404  35.015  25.099  1.00 51.65  ? 81   TYR C CB  1 
ATOM   1977 C CG  . TYR C 1 35  ? 0.657   34.510  26.050  1.00 51.00  ? 81   TYR C CG  1 
ATOM   1978 C CD1 . TYR C 1 35  ? 1.854   35.205  26.223  1.00 53.40  ? 81   TYR C CD1 1 
ATOM   1979 C CD2 . TYR C 1 35  ? 0.460   33.343  26.785  1.00 48.16  ? 81   TYR C CD2 1 
ATOM   1980 C CE1 . TYR C 1 35  ? 2.831   34.744  27.099  1.00 53.19  ? 81   TYR C CE1 1 
ATOM   1981 C CE2 . TYR C 1 35  ? 1.428   32.874  27.659  1.00 48.21  ? 81   TYR C CE2 1 
ATOM   1982 C CZ  . TYR C 1 35  ? 2.611   33.578  27.812  1.00 50.90  ? 81   TYR C CZ  1 
ATOM   1983 O OH  . TYR C 1 35  ? 3.572   33.116  28.677  1.00 51.78  ? 81   TYR C OH  1 
ATOM   1984 N N   . LEU C 1 36  ? -1.331  32.311  23.841  1.00 46.08  ? 82   LEU C N   1 
ATOM   1985 C CA  . LEU C 1 36  ? -1.398  30.846  23.765  1.00 43.65  ? 82   LEU C CA  1 
ATOM   1986 C C   . LEU C 1 36  ? -0.963  30.320  22.395  1.00 43.18  ? 82   LEU C C   1 
ATOM   1987 O O   . LEU C 1 36  ? -0.338  29.264  22.302  1.00 42.34  ? 82   LEU C O   1 
ATOM   1988 C CB  . LEU C 1 36  ? -2.809  30.341  24.092  1.00 42.56  ? 82   LEU C CB  1 
ATOM   1989 C CG  . LEU C 1 36  ? -3.213  30.397  25.569  1.00 42.70  ? 82   LEU C CG  1 
ATOM   1990 C CD1 . LEU C 1 36  ? -4.669  30.025  25.732  1.00 42.68  ? 82   LEU C CD1 1 
ATOM   1991 C CD2 . LEU C 1 36  ? -2.341  29.481  26.407  1.00 42.57  ? 82   LEU C CD2 1 
ATOM   1992 N N   . HIS C 1 37  ? -1.286  31.058  21.336  1.00 44.50  ? 83   HIS C N   1 
ATOM   1993 C CA  . HIS C 1 37  ? -0.860  30.682  19.986  1.00 44.94  ? 83   HIS C CA  1 
ATOM   1994 C C   . HIS C 1 37  ? 0.621   30.989  19.764  1.00 46.56  ? 83   HIS C C   1 
ATOM   1995 O O   . HIS C 1 37  ? 1.402   30.093  19.434  1.00 45.17  ? 83   HIS C O   1 
ATOM   1996 C CB  . HIS C 1 37  ? -1.721  31.388  18.930  1.00 46.01  ? 83   HIS C CB  1 
ATOM   1997 C CG  . HIS C 1 37  ? -1.519  30.873  17.537  1.00 46.31  ? 83   HIS C CG  1 
ATOM   1998 N ND1 . HIS C 1 37  ? -1.892  31.586  16.419  1.00 48.32  ? 83   HIS C ND1 1 
ATOM   1999 C CD2 . HIS C 1 37  ? -0.974  29.719  17.082  1.00 45.83  ? 83   HIS C CD2 1 
ATOM   2000 C CE1 . HIS C 1 37  ? -1.591  30.893  15.336  1.00 48.02  ? 83   HIS C CE1 1 
ATOM   2001 N NE2 . HIS C 1 37  ? -1.033  29.757  15.710  1.00 46.22  ? 83   HIS C NE2 1 
ATOM   2002 N N   . LYS C 1 38  ? 1.001   32.251  19.966  1.00 49.66  ? 84   LYS C N   1 
ATOM   2003 C CA  . LYS C 1 38  ? 2.343   32.730  19.609  1.00 52.89  ? 84   LYS C CA  1 
ATOM   2004 C C   . LYS C 1 38  ? 3.448   32.284  20.567  1.00 53.30  ? 84   LYS C C   1 
ATOM   2005 O O   . LYS C 1 38  ? 4.592   32.124  20.148  1.00 54.96  ? 84   LYS C O   1 
ATOM   2006 C CB  . LYS C 1 38  ? 2.364   34.261  19.498  1.00 55.96  ? 84   LYS C CB  1 
ATOM   2007 C CG  . LYS C 1 38  ? 1.602   34.810  18.305  1.00 58.33  ? 84   LYS C CG  1 
ATOM   2008 C CD  . LYS C 1 38  ? 1.717   36.327  18.219  1.00 62.46  ? 84   LYS C CD  1 
ATOM   2009 C CE  . LYS C 1 38  ? 1.296   36.848  16.852  1.00 65.13  ? 84   LYS C CE  1 
ATOM   2010 N NZ  . LYS C 1 38  ? -0.057  36.366  16.454  1.00 64.44  ? 84   LYS C NZ  1 
ATOM   2011 N N   . VAL C 1 39  ? 3.118   32.104  21.845  1.00 52.34  ? 85   VAL C N   1 
ATOM   2012 C CA  . VAL C 1 39  ? 4.117   31.732  22.850  1.00 52.53  ? 85   VAL C CA  1 
ATOM   2013 C C   . VAL C 1 39  ? 3.981   30.265  23.255  1.00 49.87  ? 85   VAL C C   1 
ATOM   2014 O O   . VAL C 1 39  ? 4.922   29.484  23.111  1.00 50.17  ? 85   VAL C O   1 
ATOM   2015 C CB  . VAL C 1 39  ? 4.013   32.617  24.113  1.00 53.54  ? 85   VAL C CB  1 
ATOM   2016 C CG1 . VAL C 1 39  ? 5.038   32.185  25.155  1.00 54.06  ? 85   VAL C CG1 1 
ATOM   2017 C CG2 . VAL C 1 39  ? 4.198   34.089  23.752  1.00 56.06  ? 85   VAL C CG2 1 
ATOM   2018 N N   . VAL C 1 40  ? 2.811   29.892  23.756  1.00 47.86  ? 86   VAL C N   1 
ATOM   2019 C CA  . VAL C 1 40  ? 2.624   28.552  24.309  1.00 45.52  ? 86   VAL C CA  1 
ATOM   2020 C C   . VAL C 1 40  ? 2.711   27.486  23.214  1.00 44.35  ? 86   VAL C C   1 
ATOM   2021 O O   . VAL C 1 40  ? 3.527   26.570  23.312  1.00 44.05  ? 86   VAL C O   1 
ATOM   2022 C CB  . VAL C 1 40  ? 1.304   28.435  25.100  1.00 44.50  ? 86   VAL C CB  1 
ATOM   2023 C CG1 . VAL C 1 40  ? 1.151   27.035  25.685  1.00 43.03  ? 86   VAL C CG1 1 
ATOM   2024 C CG2 . VAL C 1 40  ? 1.260   29.487  26.212  1.00 45.75  ? 86   VAL C CG2 1 
ATOM   2025 N N   . MET C 1 41  ? 1.904   27.616  22.163  1.00 44.01  ? 87   MET C N   1 
ATOM   2026 C CA  . MET C 1 41  ? 1.877   26.595  21.109  1.00 43.84  ? 87   MET C CA  1 
ATOM   2027 C C   . MET C 1 41  ? 3.184   26.521  20.310  1.00 45.66  ? 87   MET C C   1 
ATOM   2028 O O   . MET C 1 41  ? 3.622   25.432  19.950  1.00 45.24  ? 87   MET C O   1 
ATOM   2029 C CB  . MET C 1 41  ? 0.686   26.790  20.161  1.00 43.62  ? 87   MET C CB  1 
ATOM   2030 C CG  . MET C 1 41  ? 0.581   25.722  19.063  1.00 44.41  ? 87   MET C CG  1 
ATOM   2031 S SD  . MET C 1 41  ? 0.504   24.028  19.698  1.00 44.26  ? 87   MET C SD  1 
ATOM   2032 C CE  . MET C 1 41  ? -1.260  23.869  19.962  1.00 42.39  ? 87   MET C CE  1 
ATOM   2033 N N   . LYS C 1 42  ? 3.806   27.664  20.031  1.00 48.31  ? 88   LYS C N   1 
ATOM   2034 C CA  . LYS C 1 42  ? 5.086   27.662  19.306  1.00 51.21  ? 88   LYS C CA  1 
ATOM   2035 C C   . LYS C 1 42  ? 6.197   26.949  20.081  1.00 51.23  ? 88   LYS C C   1 
ATOM   2036 O O   . LYS C 1 42  ? 7.023   26.264  19.482  1.00 52.81  ? 88   LYS C O   1 
ATOM   2037 C CB  . LYS C 1 42  ? 5.521   29.080  18.920  1.00 54.22  ? 88   LYS C CB  1 
ATOM   2038 C CG  . LYS C 1 42  ? 5.033   29.495  17.538  1.00 57.10  ? 88   LYS C CG  1 
ATOM   2039 C CD  . LYS C 1 42  ? 5.515   30.882  17.140  1.00 61.25  ? 88   LYS C CD  1 
ATOM   2040 C CE  . LYS C 1 42  ? 5.049   31.238  15.736  1.00 62.68  ? 88   LYS C CE  1 
ATOM   2041 N NZ  . LYS C 1 42  ? 5.347   32.655  15.386  1.00 66.93  ? 88   LYS C NZ  1 
ATOM   2042 N N   . ALA C 1 43  ? 6.206   27.104  21.404  1.00 50.19  ? 89   ALA C N   1 
ATOM   2043 C CA  . ALA C 1 43  ? 7.169   26.410  22.261  1.00 49.95  ? 89   ALA C CA  1 
ATOM   2044 C C   . ALA C 1 43  ? 6.902   24.898  22.327  1.00 47.71  ? 89   ALA C C   1 
ATOM   2045 O O   . ALA C 1 43  ? 7.838   24.102  22.392  1.00 48.79  ? 89   ALA C O   1 
ATOM   2046 C CB  . ALA C 1 43  ? 7.158   27.007  23.661  1.00 49.88  ? 89   ALA C CB  1 
ATOM   2047 N N   . LEU C 1 44  ? 5.632   24.502  22.306  1.00 44.62  ? 90   LEU C N   1 
ATOM   2048 C CA  . LEU C 1 44  ? 5.281   23.082  22.408  1.00 42.85  ? 90   LEU C CA  1 
ATOM   2049 C C   . LEU C 1 44  ? 5.363   22.345  21.066  1.00 42.57  ? 90   LEU C C   1 
ATOM   2050 O O   . LEU C 1 44  ? 5.822   21.206  21.010  1.00 42.48  ? 90   LEU C O   1 
ATOM   2051 C CB  . LEU C 1 44  ? 3.891   22.916  23.030  1.00 41.43  ? 90   LEU C CB  1 
ATOM   2052 C CG  . LEU C 1 44  ? 3.767   23.382  24.484  1.00 42.02  ? 90   LEU C CG  1 
ATOM   2053 C CD1 . LEU C 1 44  ? 2.344   23.219  24.981  1.00 40.32  ? 90   LEU C CD1 1 
ATOM   2054 C CD2 . LEU C 1 44  ? 4.730   22.630  25.387  1.00 43.54  ? 90   LEU C CD2 1 
ATOM   2055 N N   . TRP C 1 45  ? 4.929   23.001  19.992  1.00 42.56  ? 91   TRP C N   1 
ATOM   2056 C CA  . TRP C 1 45  ? 4.840   22.368  18.671  1.00 42.70  ? 91   TRP C CA  1 
ATOM   2057 C C   . TRP C 1 45  ? 6.192   21.885  18.150  1.00 44.73  ? 91   TRP C C   1 
ATOM   2058 O O   . TRP C 1 45  ? 6.278   20.825  17.529  1.00 45.00  ? 91   TRP C O   1 
ATOM   2059 C CB  . TRP C 1 45  ? 4.217   23.340  17.660  1.00 42.76  ? 91   TRP C CB  1 
ATOM   2060 C CG  . TRP C 1 45  ? 3.986   22.749  16.310  1.00 41.85  ? 91   TRP C CG  1 
ATOM   2061 C CD1 . TRP C 1 45  ? 4.738   22.952  15.186  1.00 43.84  ? 91   TRP C CD1 1 
ATOM   2062 C CD2 . TRP C 1 45  ? 2.933   21.855  15.932  1.00 39.59  ? 91   TRP C CD2 1 
ATOM   2063 N NE1 . TRP C 1 45  ? 4.215   22.242  14.133  1.00 43.21  ? 91   TRP C NE1 1 
ATOM   2064 C CE2 . TRP C 1 45  ? 3.107   21.559  14.563  1.00 41.54  ? 91   TRP C CE2 1 
ATOM   2065 C CE3 . TRP C 1 45  ? 1.857   21.275  16.616  1.00 37.60  ? 91   TRP C CE3 1 
ATOM   2066 C CZ2 . TRP C 1 45  ? 2.247   20.707  13.865  1.00 40.92  ? 91   TRP C CZ2 1 
ATOM   2067 C CZ3 . TRP C 1 45  ? 1.002   20.432  15.920  1.00 36.44  ? 91   TRP C CZ3 1 
ATOM   2068 C CH2 . TRP C 1 45  ? 1.204   20.155  14.561  1.00 38.53  ? 91   TRP C CH2 1 
ATOM   2069 N N   . LYS C 1 46  ? 7.239   22.666  18.406  1.00 46.68  ? 92   LYS C N   1 
ATOM   2070 C CA  . LYS C 1 46  ? 8.579   22.359  17.899  1.00 49.71  ? 92   LYS C CA  1 
ATOM   2071 C C   . LYS C 1 46  ? 9.451   21.609  18.911  1.00 49.70  ? 92   LYS C C   1 
ATOM   2072 O O   . LYS C 1 46  ? 10.613  21.316  18.626  1.00 52.43  ? 92   LYS C O   1 
ATOM   2073 C CB  . LYS C 1 46  ? 9.285   23.646  17.446  1.00 52.56  ? 92   LYS C CB  1 
ATOM   2074 C CG  . LYS C 1 46  ? 9.739   24.566  18.580  1.00 54.10  ? 92   LYS C CG  1 
ATOM   2075 C CD  . LYS C 1 46  ? 10.311  25.870  18.040  1.00 57.51  ? 92   LYS C CD  1 
ATOM   2076 C CE  . LYS C 1 46  ? 10.647  26.835  19.168  1.00 58.45  ? 92   LYS C CE  1 
ATOM   2077 N NZ  . LYS C 1 46  ? 11.121  28.152  18.652  1.00 61.74  ? 92   LYS C NZ  1 
ATOM   2078 N N   . HIS C 1 47  ? 8.901   21.306  20.086  1.00 47.01  ? 93   HIS C N   1 
ATOM   2079 C CA  . HIS C 1 47  ? 9.636   20.561  21.114  1.00 46.96  ? 93   HIS C CA  1 
ATOM   2080 C C   . HIS C 1 47  ? 9.931   19.146  20.613  1.00 47.26  ? 93   HIS C C   1 
ATOM   2081 O O   . HIS C 1 47  ? 9.160   18.590  19.835  1.00 46.32  ? 93   HIS C O   1 
ATOM   2082 C CB  . HIS C 1 47  ? 8.834   20.516  22.421  1.00 44.58  ? 93   HIS C CB  1 
ATOM   2083 C CG  . HIS C 1 47  ? 9.646   20.143  23.623  1.00 45.11  ? 93   HIS C CG  1 
ATOM   2084 N ND1 . HIS C 1 47  ? 9.935   18.837  23.951  1.00 44.44  ? 93   HIS C ND1 1 
ATOM   2085 C CD2 . HIS C 1 47  ? 10.217  20.907  24.585  1.00 45.95  ? 93   HIS C CD2 1 
ATOM   2086 C CE1 . HIS C 1 47  ? 10.658  18.811  25.056  1.00 45.55  ? 93   HIS C CE1 1 
ATOM   2087 N NE2 . HIS C 1 47  ? 10.842  20.055  25.462  1.00 45.75  ? 93   HIS C NE2 1 
ATOM   2088 N N   . GLN C 1 48  ? 11.051  18.571  21.047  1.00 49.04  ? 94   GLN C N   1 
ATOM   2089 C CA  . GLN C 1 48  ? 11.465  17.248  20.562  1.00 50.29  ? 94   GLN C CA  1 
ATOM   2090 C C   . GLN C 1 48  ? 10.504  16.129  20.972  1.00 47.32  ? 94   GLN C C   1 
ATOM   2091 O O   . GLN C 1 48  ? 10.460  15.088  20.320  1.00 47.99  ? 94   GLN C O   1 
ATOM   2092 C CB  . GLN C 1 48  ? 12.901  16.912  20.999  1.00 53.87  ? 94   GLN C CB  1 
ATOM   2093 C CG  . GLN C 1 48  ? 13.124  16.732  22.499  1.00 54.40  ? 94   GLN C CG  1 
ATOM   2094 C CD  . GLN C 1 48  ? 14.491  16.137  22.822  1.00 59.22  ? 94   GLN C CD  1 
ATOM   2095 O OE1 . GLN C 1 48  ? 14.910  15.146  22.220  1.00 61.23  ? 94   GLN C OE1 1 
ATOM   2096 N NE2 . GLN C 1 48  ? 15.187  16.736  23.784  1.00 61.35  ? 94   GLN C NE2 1 
ATOM   2097 N N   . PHE C 1 49  ? 9.737   16.351  22.041  1.00 43.96  ? 95   PHE C N   1 
ATOM   2098 C CA  . PHE C 1 49  ? 8.768   15.368  22.527  1.00 41.39  ? 95   PHE C CA  1 
ATOM   2099 C C   . PHE C 1 49  ? 7.360   15.553  21.949  1.00 38.43  ? 95   PHE C C   1 
ATOM   2100 O O   . PHE C 1 49  ? 6.461   14.798  22.305  1.00 35.77  ? 95   PHE C O   1 
ATOM   2101 C CB  . PHE C 1 49  ? 8.665   15.414  24.061  1.00 40.29  ? 95   PHE C CB  1 
ATOM   2102 C CG  . PHE C 1 49  ? 9.906   14.957  24.795  1.00 43.82  ? 95   PHE C CG  1 
ATOM   2103 C CD1 . PHE C 1 49  ? 10.833  14.092  24.214  1.00 46.02  ? 95   PHE C CD1 1 
ATOM   2104 C CD2 . PHE C 1 49  ? 10.118  15.366  26.108  1.00 43.79  ? 95   PHE C CD2 1 
ATOM   2105 C CE1 . PHE C 1 49  ? 11.957  13.675  24.921  1.00 48.98  ? 95   PHE C CE1 1 
ATOM   2106 C CE2 . PHE C 1 49  ? 11.243  14.953  26.817  1.00 46.44  ? 95   PHE C CE2 1 
ATOM   2107 C CZ  . PHE C 1 49  ? 12.162  14.106  26.221  1.00 48.23  ? 95   PHE C CZ  1 
ATOM   2108 N N   . ALA C 1 50  ? 7.168   16.528  21.060  1.00 37.25  ? 96   ALA C N   1 
ATOM   2109 C CA  . ALA C 1 50  ? 5.823   16.857  20.571  1.00 35.49  ? 96   ALA C CA  1 
ATOM   2110 C C   . ALA C 1 50  ? 5.256   15.834  19.587  1.00 35.22  ? 96   ALA C C   1 
ATOM   2111 O O   . ALA C 1 50  ? 4.035   15.666  19.501  1.00 34.33  ? 96   ALA C O   1 
ATOM   2112 C CB  . ALA C 1 50  ? 5.819   18.251  19.936  1.00 35.91  ? 96   ALA C CB  1 
ATOM   2113 N N   . TRP C 1 51  ? 6.132   15.136  18.868  1.00 36.74  ? 97   TRP C N   1 
ATOM   2114 C CA  . TRP C 1 51  ? 5.725   14.354  17.690  1.00 37.18  ? 97   TRP C CA  1 
ATOM   2115 C C   . TRP C 1 51  ? 4.554   13.377  17.895  1.00 35.90  ? 97   TRP C C   1 
ATOM   2116 O O   . TRP C 1 51  ? 3.670   13.304  17.038  1.00 35.89  ? 97   TRP C O   1 
ATOM   2117 C CB  . TRP C 1 51  ? 6.934   13.663  17.021  1.00 39.36  ? 97   TRP C CB  1 
ATOM   2118 C CG  . TRP C 1 51  ? 7.588   12.583  17.830  1.00 38.59  ? 97   TRP C CG  1 
ATOM   2119 C CD1 . TRP C 1 51  ? 8.620   12.726  18.712  1.00 38.53  ? 97   TRP C CD1 1 
ATOM   2120 C CD2 . TRP C 1 51  ? 7.258   11.189  17.822  1.00 37.46  ? 97   TRP C CD2 1 
ATOM   2121 N NE1 . TRP C 1 51  ? 8.945   11.508  19.263  1.00 38.70  ? 97   TRP C NE1 1 
ATOM   2122 C CE2 . TRP C 1 51  ? 8.121   10.549  18.734  1.00 38.10  ? 97   TRP C CE2 1 
ATOM   2123 C CE3 . TRP C 1 51  ? 6.305   10.423  17.141  1.00 38.02  ? 97   TRP C CE3 1 
ATOM   2124 C CZ2 . TRP C 1 51  ? 8.065   9.176   18.978  1.00 39.81  ? 97   TRP C CZ2 1 
ATOM   2125 C CZ3 . TRP C 1 51  ? 6.255   9.054   17.381  1.00 39.30  ? 97   TRP C CZ3 1 
ATOM   2126 C CH2 . TRP C 1 51  ? 7.131   8.447   18.287  1.00 39.90  ? 97   TRP C CH2 1 
ATOM   2127 N N   . PRO C 1 52  ? 4.513   12.644  19.025  1.00 35.28  ? 98   PRO C N   1 
ATOM   2128 C CA  . PRO C 1 52  ? 3.358   11.750  19.158  1.00 35.43  ? 98   PRO C CA  1 
ATOM   2129 C C   . PRO C 1 52  ? 2.026   12.492  19.381  1.00 33.93  ? 98   PRO C C   1 
ATOM   2130 O O   . PRO C 1 52  ? 0.966   11.880  19.254  1.00 34.56  ? 98   PRO C O   1 
ATOM   2131 C CB  . PRO C 1 52  ? 3.710   10.894  20.386  1.00 35.31  ? 98   PRO C CB  1 
ATOM   2132 C CG  . PRO C 1 52  ? 5.125   11.280  20.782  1.00 35.72  ? 98   PRO C CG  1 
ATOM   2133 C CD  . PRO C 1 52  ? 5.308   12.662  20.262  1.00 34.82  ? 98   PRO C CD  1 
ATOM   2134 N N   . PHE C 1 53  ? 2.089   13.793  19.673  1.00 33.04  ? 99   PHE C N   1 
ATOM   2135 C CA  . PHE C 1 53  ? 0.903   14.592  20.006  1.00 31.98  ? 99   PHE C CA  1 
ATOM   2136 C C   . PHE C 1 53  ? 0.449   15.544  18.897  1.00 32.75  ? 99   PHE C C   1 
ATOM   2137 O O   . PHE C 1 53  ? -0.555  16.233  19.057  1.00 32.13  ? 99   PHE C O   1 
ATOM   2138 C CB  . PHE C 1 53  ? 1.171   15.406  21.274  1.00 30.74  ? 99   PHE C CB  1 
ATOM   2139 C CG  . PHE C 1 53  ? 1.569   14.570  22.457  1.00 31.88  ? 99   PHE C CG  1 
ATOM   2140 C CD1 . PHE C 1 53  ? 0.601   13.987  23.274  1.00 30.99  ? 99   PHE C CD1 1 
ATOM   2141 C CD2 . PHE C 1 53  ? 2.908   14.375  22.763  1.00 33.67  ? 99   PHE C CD2 1 
ATOM   2142 C CE1 . PHE C 1 53  ? 0.974   13.215  24.369  1.00 31.71  ? 99   PHE C CE1 1 
ATOM   2143 C CE2 . PHE C 1 53  ? 3.286   13.607  23.855  1.00 33.36  ? 99   PHE C CE2 1 
ATOM   2144 C CZ  . PHE C 1 53  ? 2.318   13.024  24.658  1.00 32.50  ? 99   PHE C CZ  1 
ATOM   2145 N N   . ARG C 1 54  ? 1.164   15.574  17.773  1.00 34.51  ? 100  ARG C N   1 
ATOM   2146 C CA  . ARG C 1 54  ? 0.875   16.541  16.707  1.00 36.25  ? 100  ARG C CA  1 
ATOM   2147 C C   . ARG C 1 54  ? -0.320  16.175  15.824  1.00 37.01  ? 100  ARG C C   1 
ATOM   2148 O O   . ARG C 1 54  ? -0.757  16.988  15.012  1.00 37.64  ? 100  ARG C O   1 
ATOM   2149 C CB  . ARG C 1 54  ? 2.109   16.750  15.823  1.00 38.70  ? 100  ARG C CB  1 
ATOM   2150 C CG  . ARG C 1 54  ? 3.250   17.472  16.512  1.00 40.77  ? 100  ARG C CG  1 
ATOM   2151 C CD  . ARG C 1 54  ? 4.302   17.914  15.503  1.00 46.36  ? 100  ARG C CD  1 
ATOM   2152 N NE  . ARG C 1 54  ? 5.545   18.325  16.161  1.00 49.67  ? 100  ARG C NE  1 
ATOM   2153 C CZ  . ARG C 1 54  ? 6.759   17.831  15.910  1.00 53.19  ? 100  ARG C CZ  1 
ATOM   2154 N NH1 . ARG C 1 54  ? 6.954   16.887  14.990  1.00 55.40  ? 100  ARG C NH1 1 
ATOM   2155 N NH2 . ARG C 1 54  ? 7.803   18.299  16.587  1.00 55.45  ? 100  ARG C NH2 1 
ATOM   2156 N N   . GLN C 1 55  ? -0.821  14.952  15.950  1.00 37.97  ? 101  GLN C N   1 
ATOM   2157 C CA  . GLN C 1 55  ? -2.014  14.535  15.216  1.00 39.97  ? 101  GLN C CA  1 
ATOM   2158 C C   . GLN C 1 55  ? -2.876  13.635  16.100  1.00 39.45  ? 101  GLN C C   1 
ATOM   2159 O O   . GLN C 1 55  ? -2.381  13.079  17.083  1.00 37.19  ? 101  GLN C O   1 
ATOM   2160 C CB  . GLN C 1 55  ? -1.637  13.837  13.897  1.00 43.64  ? 101  GLN C CB  1 
ATOM   2161 C CG  . GLN C 1 55  ? -0.812  12.558  14.039  1.00 47.99  ? 101  GLN C CG  1 
ATOM   2162 C CD  . GLN C 1 55  ? -0.353  11.990  12.695  1.00 53.55  ? 101  GLN C CD  1 
ATOM   2163 O OE1 . GLN C 1 55  ? -0.301  12.695  11.682  1.00 57.24  ? 101  GLN C OE1 1 
ATOM   2164 N NE2 . GLN C 1 55  ? -0.017  10.706  12.685  1.00 58.18  ? 101  GLN C NE2 1 
ATOM   2165 N N   . PRO C 1 56  ? -4.173  13.503  15.762  1.00 40.40  ? 102  PRO C N   1 
ATOM   2166 C CA  . PRO C 1 56  ? -5.059  12.627  16.523  1.00 40.79  ? 102  PRO C CA  1 
ATOM   2167 C C   . PRO C 1 56  ? -4.524  11.201  16.649  1.00 42.70  ? 102  PRO C C   1 
ATOM   2168 O O   . PRO C 1 56  ? -3.883  10.696  15.723  1.00 44.19  ? 102  PRO C O   1 
ATOM   2169 C CB  . PRO C 1 56  ? -6.350  12.634  15.696  1.00 42.25  ? 102  PRO C CB  1 
ATOM   2170 C CG  . PRO C 1 56  ? -6.336  13.930  14.992  1.00 41.73  ? 102  PRO C CG  1 
ATOM   2171 C CD  . PRO C 1 56  ? -4.896  14.215  14.690  1.00 41.22  ? 102  PRO C CD  1 
ATOM   2172 N N   . VAL C 1 57  ? -4.783  10.567  17.789  1.00 42.72  ? 103  VAL C N   1 
ATOM   2173 C CA  . VAL C 1 57  ? -4.421  9.168   17.977  1.00 45.01  ? 103  VAL C CA  1 
ATOM   2174 C C   . VAL C 1 57  ? -5.226  8.328   16.989  1.00 48.61  ? 103  VAL C C   1 
ATOM   2175 O O   . VAL C 1 57  ? -6.459  8.366   16.995  1.00 49.33  ? 103  VAL C O   1 
ATOM   2176 C CB  . VAL C 1 57  ? -4.706  8.683   19.415  1.00 43.98  ? 103  VAL C CB  1 
ATOM   2177 C CG1 . VAL C 1 57  ? -4.358  7.207   19.561  1.00 45.27  ? 103  VAL C CG1 1 
ATOM   2178 C CG2 . VAL C 1 57  ? -3.927  9.520   20.429  1.00 41.39  ? 103  VAL C CG2 1 
ATOM   2179 N N   . ASP C 1 58  ? -4.523  7.613   16.116  1.00 51.66  ? 104  ASP C N   1 
ATOM   2180 C CA  . ASP C 1 58  ? -5.158  6.673   15.201  1.00 55.15  ? 104  ASP C CA  1 
ATOM   2181 C C   . ASP C 1 58  ? -5.045  5.286   15.828  1.00 57.06  ? 104  ASP C C   1 
ATOM   2182 O O   . ASP C 1 58  ? -4.021  4.611   15.699  1.00 58.68  ? 104  ASP C O   1 
ATOM   2183 C CB  . ASP C 1 58  ? -4.507  6.726   13.814  1.00 57.11  ? 104  ASP C CB  1 
ATOM   2184 C CG  . ASP C 1 58  ? -5.391  6.125   12.726  1.00 60.33  ? 104  ASP C CG  1 
ATOM   2185 O OD1 . ASP C 1 58  ? -5.970  5.040   12.947  1.00 62.24  ? 104  ASP C OD1 1 
ATOM   2186 O OD2 . ASP C 1 58  ? -5.506  6.741   11.645  1.00 62.34  ? 104  ASP C OD2 1 
ATOM   2187 N N   . ALA C 1 59  ? -6.104  4.883   16.527  1.00 57.45  ? 105  ALA C N   1 
ATOM   2188 C CA  . ALA C 1 59  ? -6.126  3.623   17.270  1.00 59.42  ? 105  ALA C CA  1 
ATOM   2189 C C   . ALA C 1 59  ? -5.949  2.394   16.375  1.00 63.50  ? 105  ALA C C   1 
ATOM   2190 O O   . ALA C 1 59  ? -5.430  1.374   16.826  1.00 64.75  ? 105  ALA C O   1 
ATOM   2191 C CB  . ALA C 1 59  ? -7.419  3.510   18.071  1.00 59.12  ? 105  ALA C CB  1 
ATOM   2192 N N   . VAL C 1 60  ? -6.378  2.492   15.118  1.00 66.08  ? 106  VAL C N   1 
ATOM   2193 C CA  . VAL C 1 60  ? -6.238  1.389   14.163  1.00 70.81  ? 106  VAL C CA  1 
ATOM   2194 C C   . VAL C 1 60  ? -4.781  1.240   13.712  1.00 72.60  ? 106  VAL C C   1 
ATOM   2195 O O   . VAL C 1 60  ? -4.209  0.153   13.805  1.00 75.02  ? 106  VAL C O   1 
ATOM   2196 C CB  . VAL C 1 60  ? -7.150  1.582   12.924  1.00 72.57  ? 106  VAL C CB  1 
ATOM   2197 C CG1 . VAL C 1 60  ? -7.058  0.374   11.994  1.00 76.77  ? 106  VAL C CG1 1 
ATOM   2198 C CG2 . VAL C 1 60  ? -8.596  1.810   13.350  1.00 71.91  ? 106  VAL C CG2 1 
ATOM   2199 N N   . LYS C 1 61  ? -4.188  2.334   13.234  1.00 72.14  ? 107  LYS C N   1 
ATOM   2200 C CA  . LYS C 1 61  ? -2.789  2.334   12.781  1.00 74.11  ? 107  LYS C CA  1 
ATOM   2201 C C   . LYS C 1 61  ? -1.808  2.005   13.912  1.00 73.77  ? 107  LYS C C   1 
ATOM   2202 O O   . LYS C 1 61  ? -0.880  1.215   13.725  1.00 76.35  ? 107  LYS C O   1 
ATOM   2203 C CB  . LYS C 1 61  ? -2.420  3.686   12.156  1.00 72.79  ? 107  LYS C CB  1 
ATOM   2204 C CG  . LYS C 1 61  ? -3.119  3.977   10.836  1.00 75.25  ? 107  LYS C CG  1 
ATOM   2205 C CD  . LYS C 1 61  ? -2.712  5.332   10.272  1.00 74.44  ? 107  LYS C CD  1 
ATOM   2206 C CE  . LYS C 1 61  ? -3.343  5.576   8.906   1.00 76.98  ? 107  LYS C CE  1 
ATOM   2207 N NZ  . LYS C 1 61  ? -2.942  6.888   8.322   1.00 76.22  ? 107  LYS C NZ  1 
ATOM   2208 N N   . LEU C 1 62  ? -2.024  2.607   15.081  1.00 70.98  ? 108  LEU C N   1 
ATOM   2209 C CA  . LEU C 1 62  ? -1.166  2.371   16.251  1.00 70.39  ? 108  LEU C CA  1 
ATOM   2210 C C   . LEU C 1 62  ? -1.431  1.029   16.939  1.00 72.15  ? 108  LEU C C   1 
ATOM   2211 O O   . LEU C 1 62  ? -0.654  0.615   17.802  1.00 72.41  ? 108  LEU C O   1 
ATOM   2212 C CB  . LEU C 1 62  ? -1.325  3.507   17.269  1.00 66.80  ? 108  LEU C CB  1 
ATOM   2213 C CG  . LEU C 1 62  ? -0.796  4.869   16.815  1.00 65.98  ? 108  LEU C CG  1 
ATOM   2214 C CD1 . LEU C 1 62  ? -1.246  5.977   17.759  1.00 63.29  ? 108  LEU C CD1 1 
ATOM   2215 C CD2 . LEU C 1 62  ? 0.723   4.835   16.710  1.00 67.51  ? 108  LEU C CD2 1 
ATOM   2216 N N   . GLY C 1 63  ? -2.521  0.358   16.568  1.00 73.78  ? 109  GLY C N   1 
ATOM   2217 C CA  . GLY C 1 63  ? -2.867  -0.939  17.145  1.00 75.69  ? 109  GLY C CA  1 
ATOM   2218 C C   . GLY C 1 63  ? -3.360  -0.808  18.574  1.00 73.06  ? 109  GLY C C   1 
ATOM   2219 O O   . GLY C 1 63  ? -2.830  -1.451  19.482  1.00 73.73  ? 109  GLY C O   1 
ATOM   2220 N N   . LEU C 1 64  ? -4.378  0.031   18.761  1.00 70.32  ? 110  LEU C N   1 
ATOM   2221 C CA  . LEU C 1 64  ? -4.962  0.307   20.075  1.00 67.80  ? 110  LEU C CA  1 
ATOM   2222 C C   . LEU C 1 64  ? -6.485  0.121   20.028  1.00 67.88  ? 110  LEU C C   1 
ATOM   2223 O O   . LEU C 1 64  ? -7.233  1.095   20.128  1.00 66.16  ? 110  LEU C O   1 
ATOM   2224 C CB  . LEU C 1 64  ? -4.623  1.736   20.511  1.00 64.43  ? 110  LEU C CB  1 
ATOM   2225 C CG  . LEU C 1 64  ? -3.144  2.133   20.569  1.00 63.63  ? 110  LEU C CG  1 
ATOM   2226 C CD1 . LEU C 1 64  ? -3.010  3.622   20.864  1.00 60.18  ? 110  LEU C CD1 1 
ATOM   2227 C CD2 . LEU C 1 64  ? -2.393  1.311   21.598  1.00 64.93  ? 110  LEU C CD2 1 
ATOM   2228 N N   . PRO C 1 65  ? -6.953  -1.134  19.884  1.00 70.10  ? 111  PRO C N   1 
ATOM   2229 C CA  . PRO C 1 65  ? -8.394  -1.401  19.721  1.00 70.74  ? 111  PRO C CA  1 
ATOM   2230 C C   . PRO C 1 65  ? -9.303  -0.864  20.841  1.00 67.46  ? 111  PRO C C   1 
ATOM   2231 O O   . PRO C 1 65  ? -10.488 -0.627  20.600  1.00 67.96  ? 111  PRO C O   1 
ATOM   2232 C CB  . PRO C 1 65  ? -8.471  -2.938  19.655  1.00 74.92  ? 111  PRO C CB  1 
ATOM   2233 C CG  . PRO C 1 65  ? -7.164  -3.433  20.162  1.00 75.42  ? 111  PRO C CG  1 
ATOM   2234 C CD  . PRO C 1 65  ? -6.159  -2.376  19.849  1.00 73.00  ? 111  PRO C CD  1 
ATOM   2235 N N   . ASP C 1 66  ? -8.758  -0.671  22.041  1.00 63.96  ? 112  ASP C N   1 
ATOM   2236 C CA  . ASP C 1 66  ? -9.550  -0.209  23.186  1.00 61.29  ? 112  ASP C CA  1 
ATOM   2237 C C   . ASP C 1 66  ? -9.416  1.292   23.473  1.00 55.86  ? 112  ASP C C   1 
ATOM   2238 O O   . ASP C 1 66  ? -9.986  1.788   24.445  1.00 54.35  ? 112  ASP C O   1 
ATOM   2239 C CB  . ASP C 1 66  ? -9.187  -1.018  24.442  1.00 62.47  ? 112  ASP C CB  1 
ATOM   2240 C CG  . ASP C 1 66  ? -7.727  -0.859  24.857  1.00 61.83  ? 112  ASP C CG  1 
ATOM   2241 O OD1 . ASP C 1 66  ? -6.912  -0.344  24.059  1.00 61.54  ? 112  ASP C OD1 1 
ATOM   2242 O OD2 . ASP C 1 66  ? -7.392  -1.269  25.989  1.00 64.19  ? 112  ASP C OD2 1 
ATOM   2243 N N   . TYR C 1 67  ? -8.681  2.019   22.634  1.00 52.49  ? 113  TYR C N   1 
ATOM   2244 C CA  . TYR C 1 67  ? -8.392  3.425   22.922  1.00 47.77  ? 113  TYR C CA  1 
ATOM   2245 C C   . TYR C 1 67  ? -9.665  4.253   23.114  1.00 46.17  ? 113  TYR C C   1 
ATOM   2246 O O   . TYR C 1 67  ? -9.819  4.935   24.122  1.00 43.31  ? 113  TYR C O   1 
ATOM   2247 C CB  . TYR C 1 67  ? -7.516  4.062   21.839  1.00 46.38  ? 113  TYR C CB  1 
ATOM   2248 C CG  . TYR C 1 67  ? -7.095  5.461   22.218  1.00 43.10  ? 113  TYR C CG  1 
ATOM   2249 C CD1 . TYR C 1 67  ? -6.072  5.668   23.134  1.00 40.52  ? 113  TYR C CD1 1 
ATOM   2250 C CD2 . TYR C 1 67  ? -7.749  6.578   21.698  1.00 41.07  ? 113  TYR C CD2 1 
ATOM   2251 C CE1 . TYR C 1 67  ? -5.692  6.942   23.510  1.00 38.16  ? 113  TYR C CE1 1 
ATOM   2252 C CE2 . TYR C 1 67  ? -7.380  7.860   22.069  1.00 37.92  ? 113  TYR C CE2 1 
ATOM   2253 C CZ  . TYR C 1 67  ? -6.344  8.036   22.977  1.00 37.20  ? 113  TYR C CZ  1 
ATOM   2254 O OH  . TYR C 1 67  ? -5.954  9.297   23.359  1.00 33.63  ? 113  TYR C OH  1 
ATOM   2255 N N   . HIS C 1 68  ? -10.583 4.180   22.157  1.00 47.43  ? 114  HIS C N   1 
ATOM   2256 C CA  . HIS C 1 68  ? -11.788 5.010   22.208  1.00 47.39  ? 114  HIS C CA  1 
ATOM   2257 C C   . HIS C 1 68  ? -12.878 4.460   23.135  1.00 49.75  ? 114  HIS C C   1 
ATOM   2258 O O   . HIS C 1 68  ? -13.883 5.132   23.382  1.00 50.09  ? 114  HIS C O   1 
ATOM   2259 C CB  . HIS C 1 68  ? -12.318 5.247   20.794  1.00 48.53  ? 114  HIS C CB  1 
ATOM   2260 C CG  . HIS C 1 68  ? -11.358 6.001   19.928  1.00 45.92  ? 114  HIS C CG  1 
ATOM   2261 N ND1 . HIS C 1 68  ? -11.072 7.334   20.127  1.00 42.38  ? 114  HIS C ND1 1 
ATOM   2262 C CD2 . HIS C 1 68  ? -10.590 5.602   18.887  1.00 46.17  ? 114  HIS C CD2 1 
ATOM   2263 C CE1 . HIS C 1 68  ? -10.185 7.730   19.233  1.00 41.58  ? 114  HIS C CE1 1 
ATOM   2264 N NE2 . HIS C 1 68  ? -9.874  6.698   18.469  1.00 43.46  ? 114  HIS C NE2 1 
ATOM   2265 N N   . LYS C 1 69  ? -12.680 3.245   23.642  1.00 51.84  ? 115  LYS C N   1 
ATOM   2266 C CA  . LYS C 1 69  ? -13.509 2.717   24.727  1.00 54.30  ? 115  LYS C CA  1 
ATOM   2267 C C   . LYS C 1 69  ? -13.100 3.343   26.063  1.00 52.38  ? 115  LYS C C   1 
ATOM   2268 O O   . LYS C 1 69  ? -13.936 3.520   26.950  1.00 53.71  ? 115  LYS C O   1 
ATOM   2269 C CB  . LYS C 1 69  ? -13.387 1.194   24.816  1.00 57.35  ? 115  LYS C CB  1 
ATOM   2270 C CG  . LYS C 1 69  ? -13.946 0.459   23.612  1.00 61.60  ? 115  LYS C CG  1 
ATOM   2271 C CD  . LYS C 1 69  ? -13.888 -1.045  23.811  1.00 65.33  ? 115  LYS C CD  1 
ATOM   2272 C CE  . LYS C 1 69  ? -14.436 -1.779  22.602  1.00 69.76  ? 115  LYS C CE  1 
ATOM   2273 N NZ  . LYS C 1 69  ? -14.271 -3.252  22.734  1.00 74.16  ? 115  LYS C NZ  1 
ATOM   2274 N N   . ILE C 1 70  ? -11.816 3.670   26.198  1.00 49.55  ? 116  ILE C N   1 
ATOM   2275 C CA  . ILE C 1 70  ? -11.276 4.229   27.437  1.00 47.99  ? 116  ILE C CA  1 
ATOM   2276 C C   . ILE C 1 70  ? -11.298 5.758   27.405  1.00 45.80  ? 116  ILE C C   1 
ATOM   2277 O O   . ILE C 1 70  ? -11.744 6.392   28.362  1.00 45.92  ? 116  ILE C O   1 
ATOM   2278 C CB  . ILE C 1 70  ? -9.836  3.724   27.697  1.00 46.90  ? 116  ILE C CB  1 
ATOM   2279 C CG1 . ILE C 1 70  ? -9.840  2.210   27.925  1.00 50.15  ? 116  ILE C CG1 1 
ATOM   2280 C CG2 . ILE C 1 70  ? -9.212  4.442   28.894  1.00 45.20  ? 116  ILE C CG2 1 
ATOM   2281 C CD1 . ILE C 1 70  ? -8.461  1.595   27.986  1.00 50.53  ? 116  ILE C CD1 1 
ATOM   2282 N N   . ILE C 1 71  ? -10.819 6.339   26.305  1.00 44.09  ? 117  ILE C N   1 
ATOM   2283 C CA  . ILE C 1 71  ? -10.721 7.794   26.162  1.00 42.13  ? 117  ILE C CA  1 
ATOM   2284 C C   . ILE C 1 71  ? -11.967 8.376   25.496  1.00 43.66  ? 117  ILE C C   1 
ATOM   2285 O O   . ILE C 1 71  ? -12.264 8.066   24.341  1.00 44.80  ? 117  ILE C O   1 
ATOM   2286 C CB  . ILE C 1 71  ? -9.478  8.187   25.339  1.00 40.44  ? 117  ILE C CB  1 
ATOM   2287 C CG1 . ILE C 1 71  ? -8.202  7.714   26.047  1.00 39.73  ? 117  ILE C CG1 1 
ATOM   2288 C CG2 . ILE C 1 71  ? -9.444  9.700   25.094  1.00 38.18  ? 117  ILE C CG2 1 
ATOM   2289 C CD1 . ILE C 1 71  ? -8.074  8.172   27.500  1.00 39.22  ? 117  ILE C CD1 1 
ATOM   2290 N N   . LYS C 1 72  ? -12.680 9.232   26.223  1.00 43.84  ? 118  LYS C N   1 
ATOM   2291 C CA  . LYS C 1 72  ? -13.974 9.741   25.763  1.00 45.90  ? 118  LYS C CA  1 
ATOM   2292 C C   . LYS C 1 72  ? -13.876 11.002  24.902  1.00 44.09  ? 118  LYS C C   1 
ATOM   2293 O O   . LYS C 1 72  ? -14.717 11.209  24.027  1.00 44.56  ? 118  LYS C O   1 
ATOM   2294 C CB  . LYS C 1 72  ? -14.907 9.981   26.955  1.00 48.11  ? 118  LYS C CB  1 
ATOM   2295 C CG  . LYS C 1 72  ? -15.288 8.707   27.725  1.00 51.99  ? 118  LYS C CG  1 
ATOM   2296 C CD  . LYS C 1 72  ? -16.043 7.704   26.846  1.00 56.53  ? 118  LYS C CD  1 
ATOM   2297 C CE  . LYS C 1 72  ? -16.498 6.489   27.636  1.00 60.59  ? 118  LYS C CE  1 
ATOM   2298 N NZ  . LYS C 1 72  ? -15.355 5.726   28.210  1.00 59.81  ? 118  LYS C NZ  1 
ATOM   2299 N N   . GLN C 1 73  ? -12.869 11.840  25.155  1.00 40.90  ? 119  GLN C N   1 
ATOM   2300 C CA  . GLN C 1 73  ? -12.645 13.050  24.361  1.00 39.97  ? 119  GLN C CA  1 
ATOM   2301 C C   . GLN C 1 73  ? -11.197 13.120  23.867  1.00 37.40  ? 119  GLN C C   1 
ATOM   2302 O O   . GLN C 1 73  ? -10.325 13.681  24.542  1.00 35.54  ? 119  GLN C O   1 
ATOM   2303 C CB  . GLN C 1 73  ? -13.012 14.309  25.162  1.00 39.96  ? 119  GLN C CB  1 
ATOM   2304 C CG  . GLN C 1 73  ? -12.821 15.633  24.396  1.00 41.68  ? 119  GLN C CG  1 
ATOM   2305 C CD  . GLN C 1 73  ? -13.519 15.648  23.044  1.00 45.64  ? 119  GLN C CD  1 
ATOM   2306 O OE1 . GLN C 1 73  ? -14.744 15.589  22.971  1.00 48.89  ? 119  GLN C OE1 1 
ATOM   2307 N NE2 . GLN C 1 73  ? -12.739 15.729  21.966  1.00 45.13  ? 119  GLN C NE2 1 
ATOM   2308 N N   . PRO C 1 74  ? -10.932 12.537  22.685  1.00 36.96  ? 120  PRO C N   1 
ATOM   2309 C CA  . PRO C 1 74  ? -9.612  12.652  22.080  1.00 35.14  ? 120  PRO C CA  1 
ATOM   2310 C C   . PRO C 1 74  ? -9.212  14.107  21.841  1.00 33.43  ? 120  PRO C C   1 
ATOM   2311 O O   . PRO C 1 74  ? -10.064 14.952  21.543  1.00 33.29  ? 120  PRO C O   1 
ATOM   2312 C CB  . PRO C 1 74  ? -9.769  11.920  20.739  1.00 36.82  ? 120  PRO C CB  1 
ATOM   2313 C CG  . PRO C 1 74  ? -10.942 11.037  20.906  1.00 39.39  ? 120  PRO C CG  1 
ATOM   2314 C CD  . PRO C 1 74  ? -11.855 11.744  21.849  1.00 38.98  ? 120  PRO C CD  1 
ATOM   2315 N N   . MET C 1 75  ? -7.921  14.389  21.969  1.00 31.26  ? 121  MET C N   1 
ATOM   2316 C CA  . MET C 1 75  ? -7.394  15.713  21.675  1.00 30.55  ? 121  MET C CA  1 
ATOM   2317 C C   . MET C 1 75  ? -5.906  15.618  21.359  1.00 30.15  ? 121  MET C C   1 
ATOM   2318 O O   . MET C 1 75  ? -5.204  14.741  21.866  1.00 30.38  ? 121  MET C O   1 
ATOM   2319 C CB  . MET C 1 75  ? -7.644  16.661  22.854  1.00 29.65  ? 121  MET C CB  1 
ATOM   2320 C CG  . MET C 1 75  ? -7.301  18.135  22.593  1.00 29.27  ? 121  MET C CG  1 
ATOM   2321 S SD  . MET C 1 75  ? -8.063  18.870  21.138  1.00 30.98  ? 121  MET C SD  1 
ATOM   2322 C CE  . MET C 1 75  ? -9.799  18.575  21.490  1.00 31.44  ? 121  MET C CE  1 
ATOM   2323 N N   . ASP C 1 76  ? -5.441  16.525  20.510  1.00 30.28  ? 122  ASP C N   1 
ATOM   2324 C CA  . ASP C 1 76  ? -4.067  16.535  20.041  1.00 29.82  ? 122  ASP C CA  1 
ATOM   2325 C C   . ASP C 1 76  ? -3.658  17.964  19.715  1.00 30.34  ? 122  ASP C C   1 
ATOM   2326 O O   . ASP C 1 76  ? -4.515  18.835  19.518  1.00 30.02  ? 122  ASP C O   1 
ATOM   2327 C CB  . ASP C 1 76  ? -3.939  15.666  18.799  1.00 31.10  ? 122  ASP C CB  1 
ATOM   2328 C CG  . ASP C 1 76  ? -4.703  16.232  17.620  1.00 33.05  ? 122  ASP C CG  1 
ATOM   2329 O OD1 . ASP C 1 76  ? -5.943  16.093  17.601  1.00 33.51  ? 122  ASP C OD1 1 
ATOM   2330 O OD2 . ASP C 1 76  ? -4.064  16.831  16.730  1.00 32.79  ? 122  ASP C OD2 1 
ATOM   2331 N N   . MET C 1 77  ? -2.354  18.196  19.638  1.00 31.02  ? 123  MET C N   1 
ATOM   2332 C CA  . MET C 1 77  ? -1.824  19.528  19.347  1.00 32.09  ? 123  MET C CA  1 
ATOM   2333 C C   . MET C 1 77  ? -2.177  20.030  17.950  1.00 31.36  ? 123  MET C C   1 
ATOM   2334 O O   . MET C 1 77  ? -2.310  21.228  17.755  1.00 31.67  ? 123  MET C O   1 
ATOM   2335 C CB  . MET C 1 77  ? -0.306  19.565  19.520  1.00 33.59  ? 123  MET C CB  1 
ATOM   2336 C CG  . MET C 1 77  ? 0.145   19.745  20.941  1.00 37.69  ? 123  MET C CG  1 
ATOM   2337 S SD  . MET C 1 77  ? 1.897   20.159  21.011  1.00 44.21  ? 123  MET C SD  1 
ATOM   2338 C CE  . MET C 1 77  ? 2.622   18.650  20.404  1.00 46.09  ? 123  MET C CE  1 
ATOM   2339 N N   . GLY C 1 78  ? -2.303  19.126  16.983  1.00 31.65  ? 124  GLY C N   1 
ATOM   2340 C CA  . GLY C 1 78  ? -2.691  19.510  15.627  1.00 32.55  ? 124  GLY C CA  1 
ATOM   2341 C C   . GLY C 1 78  ? -4.046  20.193  15.609  1.00 31.80  ? 124  GLY C C   1 
ATOM   2342 O O   . GLY C 1 78  ? -4.223  21.241  14.985  1.00 32.52  ? 124  GLY C O   1 
ATOM   2343 N N   . THR C 1 79  ? -4.997  19.591  16.313  1.00 31.00  ? 125  THR C N   1 
ATOM   2344 C CA  . THR C 1 79  ? -6.342  20.138  16.455  1.00 30.73  ? 125  THR C CA  1 
ATOM   2345 C C   . THR C 1 79  ? -6.294  21.490  17.157  1.00 30.06  ? 125  THR C C   1 
ATOM   2346 O O   . THR C 1 79  ? -6.923  22.451  16.710  1.00 30.21  ? 125  THR C O   1 
ATOM   2347 C CB  . THR C 1 79  ? -7.236  19.163  17.243  1.00 30.49  ? 125  THR C CB  1 
ATOM   2348 O OG1 . THR C 1 79  ? -7.363  17.946  16.499  1.00 29.35  ? 125  THR C OG1 1 
ATOM   2349 C CG2 . THR C 1 79  ? -8.626  19.752  17.491  1.00 32.26  ? 125  THR C CG2 1 
ATOM   2350 N N   . ILE C 1 80  ? -5.523  21.570  18.240  1.00 28.58  ? 126  ILE C N   1 
ATOM   2351 C CA  . ILE C 1 80  ? -5.428  22.803  19.009  1.00 28.60  ? 126  ILE C CA  1 
ATOM   2352 C C   . ILE C 1 80  ? -4.811  23.909  18.156  1.00 29.54  ? 126  ILE C C   1 
ATOM   2353 O O   . ILE C 1 80  ? -5.294  25.045  18.152  1.00 29.61  ? 126  ILE C O   1 
ATOM   2354 C CB  . ILE C 1 80  ? -4.616  22.609  20.314  1.00 27.46  ? 126  ILE C CB  1 
ATOM   2355 C CG1 . ILE C 1 80  ? -5.342  21.634  21.248  1.00 27.34  ? 126  ILE C CG1 1 
ATOM   2356 C CG2 . ILE C 1 80  ? -4.422  23.943  21.012  1.00 28.62  ? 126  ILE C CG2 1 
ATOM   2357 C CD1 . ILE C 1 80  ? -4.520  21.181  22.451  1.00 26.68  ? 126  ILE C CD1 1 
ATOM   2358 N N   . LYS C 1 81  ? -3.758  23.562  17.419  1.00 30.02  ? 127  LYS C N   1 
ATOM   2359 C CA  . LYS C 1 81  ? -3.076  24.507  16.539  1.00 31.50  ? 127  LYS C CA  1 
ATOM   2360 C C   . LYS C 1 81  ? -4.022  25.049  15.464  1.00 32.87  ? 127  LYS C C   1 
ATOM   2361 O O   . LYS C 1 81  ? -4.090  26.259  15.246  1.00 32.97  ? 127  LYS C O   1 
ATOM   2362 C CB  . LYS C 1 81  ? -1.862  23.839  15.895  1.00 32.40  ? 127  LYS C CB  1 
ATOM   2363 C CG  . LYS C 1 81  ? -1.053  24.740  14.971  1.00 34.85  ? 127  LYS C CG  1 
ATOM   2364 C CD  . LYS C 1 81  ? 0.322   24.137  14.691  1.00 37.47  ? 127  LYS C CD  1 
ATOM   2365 C CE  . LYS C 1 81  ? 1.034   24.837  13.539  1.00 40.04  ? 127  LYS C CE  1 
ATOM   2366 N NZ  . LYS C 1 81  ? 0.326   24.636  12.240  1.00 42.18  ? 127  LYS C NZ  1 
ATOM   2367 N N   . ARG C 1 82  ? -4.750  24.151  14.801  1.00 33.12  ? 128  ARG C N   1 
ATOM   2368 C CA  . ARG C 1 82  ? -5.739  24.551  13.794  1.00 35.66  ? 128  ARG C CA  1 
ATOM   2369 C C   . ARG C 1 82  ? -6.788  25.482  14.408  1.00 35.05  ? 128  ARG C C   1 
ATOM   2370 O O   . ARG C 1 82  ? -7.141  26.497  13.814  1.00 36.47  ? 128  ARG C O   1 
ATOM   2371 C CB  . ARG C 1 82  ? -6.424  23.323  13.172  1.00 36.79  ? 128  ARG C CB  1 
ATOM   2372 C CG  . ARG C 1 82  ? -7.304  23.653  11.966  1.00 42.75  ? 128  ARG C CG  1 
ATOM   2373 C CD  . ARG C 1 82  ? -8.131  22.462  11.487  1.00 46.00  ? 128  ARG C CD  1 
ATOM   2374 N NE  . ARG C 1 82  ? -9.027  21.959  12.532  1.00 48.63  ? 128  ARG C NE  1 
ATOM   2375 C CZ  . ARG C 1 82  ? -9.035  20.715  13.015  1.00 49.98  ? 128  ARG C CZ  1 
ATOM   2376 N NH1 . ARG C 1 82  ? -8.206  19.782  12.551  1.00 51.28  ? 128  ARG C NH1 1 
ATOM   2377 N NH2 . ARG C 1 82  ? -9.898  20.392  13.971  1.00 50.58  ? 128  ARG C NH2 1 
ATOM   2378 N N   . ARG C 1 83  ? -7.265  25.138  15.602  1.00 33.50  ? 129  ARG C N   1 
ATOM   2379 C CA  . ARG C 1 83  ? -8.270  25.946  16.296  1.00 33.70  ? 129  ARG C CA  1 
ATOM   2380 C C   . ARG C 1 83  ? -7.780  27.355  16.618  1.00 34.77  ? 129  ARG C C   1 
ATOM   2381 O O   . ARG C 1 83  ? -8.525  28.324  16.453  1.00 36.37  ? 129  ARG C O   1 
ATOM   2382 C CB  . ARG C 1 83  ? -8.739  25.239  17.562  1.00 32.44  ? 129  ARG C CB  1 
ATOM   2383 C CG  . ARG C 1 83  ? -9.635  24.063  17.261  1.00 33.99  ? 129  ARG C CG  1 
ATOM   2384 C CD  . ARG C 1 83  ? -10.010 23.282  18.507  1.00 34.02  ? 129  ARG C CD  1 
ATOM   2385 N NE  . ARG C 1 83  ? -11.010 22.267  18.185  1.00 36.35  ? 129  ARG C NE  1 
ATOM   2386 C CZ  . ARG C 1 83  ? -11.698 21.561  19.082  1.00 37.19  ? 129  ARG C CZ  1 
ATOM   2387 N NH1 . ARG C 1 83  ? -11.505 21.733  20.385  1.00 36.94  ? 129  ARG C NH1 1 
ATOM   2388 N NH2 . ARG C 1 83  ? -12.583 20.669  18.665  1.00 39.20  ? 129  ARG C NH2 1 
ATOM   2389 N N   . LEU C 1 84  ? -6.531  27.469  17.061  1.00 34.01  ? 130  LEU C N   1 
ATOM   2390 C CA  . LEU C 1 84  ? -5.926  28.779  17.301  1.00 35.10  ? 130  LEU C CA  1 
ATOM   2391 C C   . LEU C 1 84  ? -5.782  29.569  15.998  1.00 36.90  ? 130  LEU C C   1 
ATOM   2392 O O   . LEU C 1 84  ? -6.112  30.756  15.946  1.00 38.16  ? 130  LEU C O   1 
ATOM   2393 C CB  . LEU C 1 84  ? -4.567  28.626  17.993  1.00 34.76  ? 130  LEU C CB  1 
ATOM   2394 C CG  . LEU C 1 84  ? -4.642  28.157  19.447  1.00 33.29  ? 130  LEU C CG  1 
ATOM   2395 C CD1 . LEU C 1 84  ? -3.278  27.707  19.955  1.00 32.17  ? 130  LEU C CD1 1 
ATOM   2396 C CD2 . LEU C 1 84  ? -5.214  29.249  20.340  1.00 33.23  ? 130  LEU C CD2 1 
ATOM   2397 N N   . GLU C 1 85  ? -5.308  28.897  14.950  1.00 36.77  ? 131  GLU C N   1 
ATOM   2398 C CA  . GLU C 1 85  ? -5.154  29.512  13.631  1.00 39.05  ? 131  GLU C CA  1 
ATOM   2399 C C   . GLU C 1 85  ? -6.487  30.009  13.064  1.00 39.73  ? 131  GLU C C   1 
ATOM   2400 O O   . GLU C 1 85  ? -6.534  31.042  12.397  1.00 41.35  ? 131  GLU C O   1 
ATOM   2401 C CB  . GLU C 1 85  ? -4.525  28.511  12.651  1.00 39.65  ? 131  GLU C CB  1 
ATOM   2402 C CG  . GLU C 1 85  ? -3.054  28.206  12.929  1.00 40.86  ? 131  GLU C CG  1 
ATOM   2403 C CD  . GLU C 1 85  ? -2.525  27.009  12.143  1.00 42.92  ? 131  GLU C CD  1 
ATOM   2404 O OE1 . GLU C 1 85  ? -3.320  26.314  11.469  1.00 44.23  ? 131  GLU C OE1 1 
ATOM   2405 O OE2 . GLU C 1 85  ? -1.302  26.758  12.209  1.00 43.21  ? 131  GLU C OE2 1 
ATOM   2406 N N   . ASN C 1 86  ? -7.562  29.275  13.343  1.00 38.59  ? 132  ASN C N   1 
ATOM   2407 C CA  . ASN C 1 86  ? -8.881  29.570  12.780  1.00 40.43  ? 132  ASN C CA  1 
ATOM   2408 C C   . ASN C 1 86  ? -9.806  30.369  13.711  1.00 40.27  ? 132  ASN C C   1 
ATOM   2409 O O   . ASN C 1 86  ? -10.992 30.526  13.418  1.00 40.64  ? 132  ASN C O   1 
ATOM   2410 C CB  . ASN C 1 86  ? -9.562  28.260  12.373  1.00 40.66  ? 132  ASN C CB  1 
ATOM   2411 C CG  . ASN C 1 86  ? -8.832  27.538  11.250  1.00 43.95  ? 132  ASN C CG  1 
ATOM   2412 O OD1 . ASN C 1 86  ? -7.806  28.002  10.751  1.00 47.72  ? 132  ASN C OD1 1 
ATOM   2413 N ND2 . ASN C 1 86  ? -9.368  26.391  10.844  1.00 46.90  ? 132  ASN C ND2 1 
ATOM   2414 N N   . ASN C 1 87  ? -9.262  30.878  14.817  1.00 39.68  ? 133  ASN C N   1 
ATOM   2415 C CA  . ASN C 1 87  ? -10.022 31.689  15.781  1.00 40.90  ? 133  ASN C CA  1 
ATOM   2416 C C   . ASN C 1 87  ? -11.205 30.957  16.421  1.00 40.13  ? 133  ASN C C   1 
ATOM   2417 O O   . ASN C 1 87  ? -12.225 31.565  16.748  1.00 41.31  ? 133  ASN C O   1 
ATOM   2418 C CB  . ASN C 1 87  ? -10.501 32.995  15.133  1.00 44.09  ? 133  ASN C CB  1 
ATOM   2419 C CG  . ASN C 1 87  ? -9.359  33.835  14.605  1.00 46.16  ? 133  ASN C CG  1 
ATOM   2420 O OD1 . ASN C 1 87  ? -8.370  34.057  15.302  1.00 47.21  ? 133  ASN C OD1 1 
ATOM   2421 N ND2 . ASN C 1 87  ? -9.493  34.313  13.374  1.00 48.73  ? 133  ASN C ND2 1 
ATOM   2422 N N   . TYR C 1 88  ? -11.052 29.655  16.618  1.00 38.10  ? 134  TYR C N   1 
ATOM   2423 C CA  . TYR C 1 88  ? -12.119 28.821  17.162  1.00 38.67  ? 134  TYR C CA  1 
ATOM   2424 C C   . TYR C 1 88  ? -12.482 29.164  18.614  1.00 39.29  ? 134  TYR C C   1 
ATOM   2425 O O   . TYR C 1 88  ? -13.658 29.173  18.968  1.00 40.06  ? 134  TYR C O   1 
ATOM   2426 C CB  . TYR C 1 88  ? -11.714 27.348  17.053  1.00 37.45  ? 134  TYR C CB  1 
ATOM   2427 C CG  . TYR C 1 88  ? -12.596 26.368  17.795  1.00 37.70  ? 134  TYR C CG  1 
ATOM   2428 C CD1 . TYR C 1 88  ? -12.330 26.026  19.118  1.00 38.48  ? 134  TYR C CD1 1 
ATOM   2429 C CD2 . TYR C 1 88  ? -13.674 25.762  17.165  1.00 40.56  ? 134  TYR C CD2 1 
ATOM   2430 C CE1 . TYR C 1 88  ? -13.127 25.119  19.800  1.00 38.82  ? 134  TYR C CE1 1 
ATOM   2431 C CE2 . TYR C 1 88  ? -14.476 24.857  17.833  1.00 41.63  ? 134  TYR C CE2 1 
ATOM   2432 C CZ  . TYR C 1 88  ? -14.193 24.533  19.146  1.00 41.42  ? 134  TYR C CZ  1 
ATOM   2433 O OH  . TYR C 1 88  ? -14.997 23.636  19.802  1.00 45.07  ? 134  TYR C OH  1 
ATOM   2434 N N   . TYR C 1 89  ? -11.477 29.434  19.447  1.00 39.17  ? 135  TYR C N   1 
ATOM   2435 C CA  . TYR C 1 89  ? -11.699 29.617  20.888  1.00 39.91  ? 135  TYR C CA  1 
ATOM   2436 C C   . TYR C 1 89  ? -12.277 30.989  21.235  1.00 42.94  ? 135  TYR C C   1 
ATOM   2437 O O   . TYR C 1 89  ? -11.970 31.982  20.579  1.00 43.95  ? 135  TYR C O   1 
ATOM   2438 C CB  . TYR C 1 89  ? -10.393 29.424  21.668  1.00 37.87  ? 135  TYR C CB  1 
ATOM   2439 C CG  . TYR C 1 89  ? -9.806  28.034  21.568  1.00 35.28  ? 135  TYR C CG  1 
ATOM   2440 C CD1 . TYR C 1 89  ? -10.443 26.947  22.156  1.00 35.02  ? 135  TYR C CD1 1 
ATOM   2441 C CD2 . TYR C 1 89  ? -8.609  27.810  20.895  1.00 34.83  ? 135  TYR C CD2 1 
ATOM   2442 C CE1 . TYR C 1 89  ? -9.911  25.672  22.075  1.00 33.47  ? 135  TYR C CE1 1 
ATOM   2443 C CE2 . TYR C 1 89  ? -8.063  26.539  20.806  1.00 34.02  ? 135  TYR C CE2 1 
ATOM   2444 C CZ  . TYR C 1 89  ? -8.716  25.471  21.396  1.00 33.66  ? 135  TYR C CZ  1 
ATOM   2445 O OH  . TYR C 1 89  ? -8.175  24.210  21.306  1.00 32.06  ? 135  TYR C OH  1 
ATOM   2446 N N   . TRP C 1 90  ? -13.099 31.023  22.285  1.00 45.29  ? 136  TRP C N   1 
ATOM   2447 C CA  . TRP C 1 90  ? -13.646 32.264  22.852  1.00 48.58  ? 136  TRP C CA  1 
ATOM   2448 C C   . TRP C 1 90  ? -12.868 32.742  24.068  1.00 49.74  ? 136  TRP C C   1 
ATOM   2449 O O   . TRP C 1 90  ? -12.811 33.945  24.343  1.00 51.79  ? 136  TRP C O   1 
ATOM   2450 C CB  . TRP C 1 90  ? -15.103 32.056  23.261  1.00 50.86  ? 136  TRP C CB  1 
ATOM   2451 C CG  . TRP C 1 90  ? -16.067 32.405  22.199  1.00 52.04  ? 136  TRP C CG  1 
ATOM   2452 C CD1 . TRP C 1 90  ? -15.866 32.330  20.853  1.00 51.31  ? 136  TRP C CD1 1 
ATOM   2453 C CD2 . TRP C 1 90  ? -17.405 32.864  22.382  1.00 53.98  ? 136  TRP C CD2 1 
ATOM   2454 N NE1 . TRP C 1 90  ? -16.991 32.731  20.189  1.00 53.26  ? 136  TRP C NE1 1 
ATOM   2455 C CE2 . TRP C 1 90  ? -17.952 33.064  21.102  1.00 55.32  ? 136  TRP C CE2 1 
ATOM   2456 C CE3 . TRP C 1 90  ? -18.193 33.139  23.504  1.00 55.80  ? 136  TRP C CE3 1 
ATOM   2457 C CZ2 . TRP C 1 90  ? -19.248 33.515  20.909  1.00 56.87  ? 136  TRP C CZ2 1 
ATOM   2458 C CZ3 . TRP C 1 90  ? -19.477 33.591  23.310  1.00 58.21  ? 136  TRP C CZ3 1 
ATOM   2459 C CH2 . TRP C 1 90  ? -19.992 33.775  22.024  1.00 59.26  ? 136  TRP C CH2 1 
ATOM   2460 N N   . ALA C 1 91  ? -12.301 31.795  24.811  1.00 47.84  ? 137  ALA C N   1 
ATOM   2461 C CA  . ALA C 1 91  ? -11.529 32.110  25.998  1.00 48.60  ? 137  ALA C CA  1 
ATOM   2462 C C   . ALA C 1 91  ? -10.253 31.285  26.023  1.00 45.94  ? 137  ALA C C   1 
ATOM   2463 O O   . ALA C 1 91  ? -10.180 30.212  25.415  1.00 43.59  ? 137  ALA C O   1 
ATOM   2464 C CB  . ALA C 1 91  ? -12.356 31.845  27.245  1.00 50.17  ? 137  ALA C CB  1 
ATOM   2465 N N   . ALA C 1 92  ? -9.248  31.811  26.715  1.00 46.41  ? 138  ALA C N   1 
ATOM   2466 C CA  . ALA C 1 92  ? -8.015  31.084  26.975  1.00 44.53  ? 138  ALA C CA  1 
ATOM   2467 C C   . ALA C 1 92  ? -8.312  29.775  27.700  1.00 42.89  ? 138  ALA C C   1 
ATOM   2468 O O   . ALA C 1 92  ? -7.682  28.759  27.421  1.00 41.85  ? 138  ALA C O   1 
ATOM   2469 C CB  . ALA C 1 92  ? -7.068  31.933  27.802  1.00 45.87  ? 138  ALA C CB  1 
ATOM   2470 N N   . SER C 1 93  ? -9.274  29.808  28.622  1.00 43.43  ? 139  SER C N   1 
ATOM   2471 C CA  . SER C 1 93  ? -9.667  28.620  29.390  1.00 41.94  ? 139  SER C CA  1 
ATOM   2472 C C   . SER C 1 93  ? -9.977  27.411  28.501  1.00 39.57  ? 139  SER C C   1 
ATOM   2473 O O   . SER C 1 93  ? -9.591  26.297  28.820  1.00 37.26  ? 139  SER C O   1 
ATOM   2474 C CB  . SER C 1 93  ? -10.870 28.936  30.291  1.00 44.47  ? 139  SER C CB  1 
ATOM   2475 O OG  . SER C 1 93  ? -12.026 29.246  29.533  1.00 45.08  ? 139  SER C OG  1 
ATOM   2476 N N   . GLU C 1 94  ? -10.651 27.640  27.377  1.00 40.22  ? 140  GLU C N   1 
ATOM   2477 C CA  . GLU C 1 94  ? -11.056 26.553  26.481  1.00 39.24  ? 140  GLU C CA  1 
ATOM   2478 C C   . GLU C 1 94  ? -9.849  25.869  25.848  1.00 36.54  ? 140  GLU C C   1 
ATOM   2479 O O   . GLU C 1 94  ? -9.780  24.636  25.785  1.00 34.64  ? 140  GLU C O   1 
ATOM   2480 C CB  . GLU C 1 94  ? -11.980 27.081  25.380  1.00 41.80  ? 140  GLU C CB  1 
ATOM   2481 C CG  . GLU C 1 94  ? -13.286 27.668  25.891  1.00 46.05  ? 140  GLU C CG  1 
ATOM   2482 C CD  . GLU C 1 94  ? -14.068 28.385  24.807  1.00 51.26  ? 140  GLU C CD  1 
ATOM   2483 O OE1 . GLU C 1 94  ? -13.942 27.999  23.622  1.00 53.34  ? 140  GLU C OE1 1 
ATOM   2484 O OE2 . GLU C 1 94  ? -14.807 29.335  25.142  1.00 55.06  ? 140  GLU C OE2 1 
ATOM   2485 N N   . CYS C 1 95  ? -8.902  26.680  25.388  1.00 35.72  ? 141  CYS C N   1 
ATOM   2486 C CA  . CYS C 1 95  ? -7.653  26.183  24.820  1.00 34.23  ? 141  CYS C CA  1 
ATOM   2487 C C   . CYS C 1 95  ? -6.850  25.438  25.884  1.00 32.33  ? 141  CYS C C   1 
ATOM   2488 O O   . CYS C 1 95  ? -6.300  24.374  25.623  1.00 30.50  ? 141  CYS C O   1 
ATOM   2489 C CB  . CYS C 1 95  ? -6.838  27.348  24.253  1.00 34.33  ? 141  CYS C CB  1 
ATOM   2490 S SG  . CYS C 1 95  ? -5.241  26.904  23.570  1.00 35.37  ? 141  CYS C SG  1 
ATOM   2491 N N   . MET C 1 96  ? -6.808  25.998  27.090  1.00 33.36  ? 142  MET C N   1 
ATOM   2492 C CA  . MET C 1 96  ? -6.131  25.354  28.216  1.00 32.29  ? 142  MET C CA  1 
ATOM   2493 C C   . MET C 1 96  ? -6.752  24.005  28.558  1.00 31.23  ? 142  MET C C   1 
ATOM   2494 O O   . MET C 1 96  ? -6.032  23.036  28.827  1.00 29.48  ? 142  MET C O   1 
ATOM   2495 C CB  . MET C 1 96  ? -6.158  26.259  29.444  1.00 34.61  ? 142  MET C CB  1 
ATOM   2496 C CG  . MET C 1 96  ? -5.296  27.494  29.298  1.00 36.34  ? 142  MET C CG  1 
ATOM   2497 S SD  . MET C 1 96  ? -5.729  28.774  30.476  1.00 40.33  ? 142  MET C SD  1 
ATOM   2498 C CE  . MET C 1 96  ? -5.444  27.947  32.039  1.00 39.79  ? 142  MET C CE  1 
ATOM   2499 N N   . GLN C 1 97  ? -8.082  23.936  28.536  1.00 32.40  ? 143  GLN C N   1 
ATOM   2500 C CA  . GLN C 1 97  ? -8.778  22.677  28.795  1.00 32.43  ? 143  GLN C CA  1 
ATOM   2501 C C   . GLN C 1 97  ? -8.455  21.624  27.731  1.00 29.96  ? 143  GLN C C   1 
ATOM   2502 O O   . GLN C 1 97  ? -8.375  20.440  28.052  1.00 28.55  ? 143  GLN C O   1 
ATOM   2503 C CB  . GLN C 1 97  ? -10.291 22.880  28.901  1.00 35.03  ? 143  GLN C CB  1 
ATOM   2504 C CG  . GLN C 1 97  ? -10.735 23.766  30.063  1.00 39.84  ? 143  GLN C CG  1 
ATOM   2505 C CD  . GLN C 1 97  ? -10.686 23.092  31.421  1.00 41.83  ? 143  GLN C CD  1 
ATOM   2506 O OE1 . GLN C 1 97  ? -10.169 21.981  31.573  1.00 42.56  ? 143  GLN C OE1 1 
ATOM   2507 N NE2 . GLN C 1 97  ? -11.223 23.776  32.427  1.00 43.42  ? 143  GLN C NE2 1 
ATOM   2508 N N   . ASP C 1 98  ? -8.262  22.052  26.478  1.00 29.84  ? 144  ASP C N   1 
ATOM   2509 C CA  . ASP C 1 98  ? -7.899  21.122  25.396  1.00 28.53  ? 144  ASP C CA  1 
ATOM   2510 C C   . ASP C 1 98  ? -6.481  20.581  25.595  1.00 27.15  ? 144  ASP C C   1 
ATOM   2511 O O   . ASP C 1 98  ? -6.238  19.382  25.433  1.00 26.19  ? 144  ASP C O   1 
ATOM   2512 C CB  . ASP C 1 98  ? -8.027  21.777  24.014  1.00 29.46  ? 144  ASP C CB  1 
ATOM   2513 C CG  . ASP C 1 98  ? -9.470  21.794  23.485  1.00 31.46  ? 144  ASP C CG  1 
ATOM   2514 O OD1 . ASP C 1 98  ? -10.353 21.081  24.026  1.00 31.91  ? 144  ASP C OD1 1 
ATOM   2515 O OD2 . ASP C 1 98  ? -9.707  22.515  22.493  1.00 33.88  ? 144  ASP C OD2 1 
ATOM   2516 N N   . PHE C 1 99  ? -5.543  21.457  25.943  1.00 26.58  ? 145  PHE C N   1 
ATOM   2517 C CA  . PHE C 1 99  ? -4.211  20.993  26.327  1.00 26.50  ? 145  PHE C CA  1 
ATOM   2518 C C   . PHE C 1 99  ? -4.305  19.992  27.473  1.00 25.79  ? 145  PHE C C   1 
ATOM   2519 O O   . PHE C 1 99  ? -3.730  18.912  27.400  1.00 25.49  ? 145  PHE C O   1 
ATOM   2520 C CB  . PHE C 1 99  ? -3.291  22.158  26.708  1.00 26.55  ? 145  PHE C CB  1 
ATOM   2521 C CG  . PHE C 1 99  ? -2.542  22.746  25.544  1.00 29.30  ? 145  PHE C CG  1 
ATOM   2522 C CD1 . PHE C 1 99  ? -1.495  22.048  24.957  1.00 29.89  ? 145  PHE C CD1 1 
ATOM   2523 C CD2 . PHE C 1 99  ? -2.865  24.003  25.049  1.00 31.29  ? 145  PHE C CD2 1 
ATOM   2524 C CE1 . PHE C 1 99  ? -0.789  22.589  23.888  1.00 30.70  ? 145  PHE C CE1 1 
ATOM   2525 C CE2 . PHE C 1 99  ? -2.157  24.553  23.986  1.00 31.10  ? 145  PHE C CE2 1 
ATOM   2526 C CZ  . PHE C 1 99  ? -1.122  23.842  23.406  1.00 31.30  ? 145  PHE C CZ  1 
ATOM   2527 N N   . ASN C 1 100 ? -5.051  20.346  28.520  1.00 26.82  ? 146  ASN C N   1 
ATOM   2528 C CA  . ASN C 1 100 ? -5.240  19.461  29.665  1.00 26.57  ? 146  ASN C CA  1 
ATOM   2529 C C   . ASN C 1 100 ? -5.791  18.098  29.252  1.00 26.21  ? 146  ASN C C   1 
ATOM   2530 O O   . ASN C 1 100 ? -5.272  17.061  29.677  1.00 26.04  ? 146  ASN C O   1 
ATOM   2531 C CB  . ASN C 1 100 ? -6.165  20.113  30.698  1.00 28.07  ? 146  ASN C CB  1 
ATOM   2532 C CG  . ASN C 1 100 ? -6.423  19.224  31.905  1.00 29.79  ? 146  ASN C CG  1 
ATOM   2533 O OD1 . ASN C 1 100 ? -7.555  18.806  32.154  1.00 31.20  ? 146  ASN C OD1 1 
ATOM   2534 N ND2 . ASN C 1 100 ? -5.376  18.940  32.664  1.00 27.89  ? 146  ASN C ND2 1 
ATOM   2535 N N   . THR C 1 101 ? -6.836  18.103  28.426  1.00 25.76  ? 147  THR C N   1 
ATOM   2536 C CA  . THR C 1 101 ? -7.450  16.863  27.949  1.00 25.81  ? 147  THR C CA  1 
ATOM   2537 C C   . THR C 1 101 ? -6.442  15.980  27.220  1.00 24.66  ? 147  THR C C   1 
ATOM   2538 O O   . THR C 1 101 ? -6.378  14.781  27.458  1.00 25.60  ? 147  THR C O   1 
ATOM   2539 C CB  . THR C 1 101 ? -8.652  17.139  27.019  1.00 26.87  ? 147  THR C CB  1 
ATOM   2540 O OG1 . THR C 1 101 ? -9.650  17.849  27.749  1.00 28.43  ? 147  THR C OG1 1 
ATOM   2541 C CG2 . THR C 1 101 ? -9.252  15.841  26.507  1.00 25.81  ? 147  THR C CG2 1 
ATOM   2542 N N   . MET C 1 102 ? -5.648  16.584  26.347  1.00 24.81  ? 148  MET C N   1 
ATOM   2543 C CA  . MET C 1 102 ? -4.633  15.850  25.608  1.00 24.37  ? 148  MET C CA  1 
ATOM   2544 C C   . MET C 1 102 ? -3.653  15.144  26.551  1.00 23.94  ? 148  MET C C   1 
ATOM   2545 O O   . MET C 1 102 ? -3.373  13.953  26.392  1.00 24.31  ? 148  MET C O   1 
ATOM   2546 C CB  . MET C 1 102 ? -3.871  16.800  24.691  1.00 24.50  ? 148  MET C CB  1 
ATOM   2547 C CG  . MET C 1 102 ? -2.740  16.143  23.942  1.00 25.39  ? 148  MET C CG  1 
ATOM   2548 S SD  . MET C 1 102 ? -1.851  17.336  22.953  1.00 28.45  ? 148  MET C SD  1 
ATOM   2549 C CE  . MET C 1 102 ? -0.836  18.147  24.185  1.00 28.13  ? 148  MET C CE  1 
ATOM   2550 N N   . PHE C 1 103 ? -3.121  15.878  27.523  1.00 23.64  ? 149  PHE C N   1 
ATOM   2551 C CA  . PHE C 1 103 ? -2.165  15.287  28.457  1.00 24.01  ? 149  PHE C CA  1 
ATOM   2552 C C   . PHE C 1 103 ? -2.827  14.238  29.348  1.00 24.36  ? 149  PHE C C   1 
ATOM   2553 O O   . PHE C 1 103 ? -2.277  13.157  29.565  1.00 24.65  ? 149  PHE C O   1 
ATOM   2554 C CB  . PHE C 1 103 ? -1.501  16.359  29.318  1.00 23.72  ? 149  PHE C CB  1 
ATOM   2555 C CG  . PHE C 1 103 ? -0.648  17.323  28.539  1.00 25.37  ? 149  PHE C CG  1 
ATOM   2556 C CD1 . PHE C 1 103 ? 0.348   16.862  27.690  1.00 27.02  ? 149  PHE C CD1 1 
ATOM   2557 C CD2 . PHE C 1 103 ? -0.829  18.695  28.669  1.00 25.76  ? 149  PHE C CD2 1 
ATOM   2558 C CE1 . PHE C 1 103 ? 1.137   17.751  26.977  1.00 28.99  ? 149  PHE C CE1 1 
ATOM   2559 C CE2 . PHE C 1 103 ? -0.043  19.587  27.959  1.00 28.24  ? 149  PHE C CE2 1 
ATOM   2560 C CZ  . PHE C 1 103 ? 0.936   19.118  27.109  1.00 28.26  ? 149  PHE C CZ  1 
ATOM   2561 N N   . THR C 1 104 ? -4.006  14.563  29.859  1.00 25.35  ? 150  THR C N   1 
ATOM   2562 C CA  . THR C 1 104 ? -4.741  13.653  30.733  1.00 26.10  ? 150  THR C CA  1 
ATOM   2563 C C   . THR C 1 104 ? -5.078  12.328  30.045  1.00 27.53  ? 150  THR C C   1 
ATOM   2564 O O   . THR C 1 104 ? -4.904  11.259  30.640  1.00 27.82  ? 150  THR C O   1 
ATOM   2565 C CB  . THR C 1 104 ? -6.009  14.325  31.262  1.00 27.04  ? 150  THR C CB  1 
ATOM   2566 O OG1 . THR C 1 104 ? -5.630  15.405  32.120  1.00 27.44  ? 150  THR C OG1 1 
ATOM   2567 C CG2 . THR C 1 104 ? -6.874  13.335  32.058  1.00 28.49  ? 150  THR C CG2 1 
ATOM   2568 N N   . ASN C 1 105 ? -5.551  12.394  28.800  1.00 27.98  ? 151  ASN C N   1 
ATOM   2569 C CA  . ASN C 1 105 ? -5.790  11.180  28.009  1.00 29.35  ? 151  ASN C CA  1 
ATOM   2570 C C   . ASN C 1 105 ? -4.572  10.272  28.006  1.00 29.42  ? 151  ASN C C   1 
ATOM   2571 O O   . ASN C 1 105 ? -4.683  9.060   28.202  1.00 29.91  ? 151  ASN C O   1 
ATOM   2572 C CB  . ASN C 1 105 ? -6.146  11.517  26.561  1.00 30.08  ? 151  ASN C CB  1 
ATOM   2573 C CG  . ASN C 1 105 ? -7.520  12.134  26.418  1.00 31.27  ? 151  ASN C CG  1 
ATOM   2574 O OD1 . ASN C 1 105 ? -8.334  12.112  27.346  1.00 31.53  ? 151  ASN C OD1 1 
ATOM   2575 N ND2 . ASN C 1 105 ? -7.791  12.689  25.238  1.00 31.96  ? 151  ASN C ND2 1 
ATOM   2576 N N   . CYS C 1 106 ? -3.408  10.873  27.781  1.00 29.07  ? 152  CYS C N   1 
ATOM   2577 C CA  . CYS C 1 106 ? -2.151  10.139  27.723  1.00 30.64  ? 152  CYS C CA  1 
ATOM   2578 C C   . CYS C 1 106 ? -1.839  9.439   29.051  1.00 30.09  ? 152  CYS C C   1 
ATOM   2579 O O   . CYS C 1 106 ? -1.496  8.254   29.069  1.00 31.17  ? 152  CYS C O   1 
ATOM   2580 C CB  . CYS C 1 106 ? -1.019  11.092  27.345  1.00 31.00  ? 152  CYS C CB  1 
ATOM   2581 S SG  . CYS C 1 106 ? 0.573   10.321  27.175  1.00 34.53  ? 152  CYS C SG  1 
ATOM   2582 N N   . TYR C 1 107 ? -1.977  10.168  30.157  1.00 28.84  ? 153  TYR C N   1 
ATOM   2583 C CA  . TYR C 1 107 ? -1.700  9.608   31.480  1.00 29.26  ? 153  TYR C CA  1 
ATOM   2584 C C   . TYR C 1 107 ? -2.665  8.479   31.819  1.00 31.23  ? 153  TYR C C   1 
ATOM   2585 O O   . TYR C 1 107 ? -2.268  7.466   32.390  1.00 33.11  ? 153  TYR C O   1 
ATOM   2586 C CB  . TYR C 1 107 ? -1.796  10.684  32.568  1.00 28.58  ? 153  TYR C CB  1 
ATOM   2587 C CG  . TYR C 1 107 ? -0.863  11.857  32.399  1.00 26.59  ? 153  TYR C CG  1 
ATOM   2588 C CD1 . TYR C 1 107 ? 0.447   11.681  31.948  1.00 28.44  ? 153  TYR C CD1 1 
ATOM   2589 C CD2 . TYR C 1 107 ? -1.279  13.145  32.713  1.00 24.66  ? 153  TYR C CD2 1 
ATOM   2590 C CE1 . TYR C 1 107 ? 1.303   12.757  31.805  1.00 28.56  ? 153  TYR C CE1 1 
ATOM   2591 C CE2 . TYR C 1 107 ? -0.433  14.225  32.581  1.00 26.57  ? 153  TYR C CE2 1 
ATOM   2592 C CZ  . TYR C 1 107 ? 0.859   14.026  32.119  1.00 27.87  ? 153  TYR C CZ  1 
ATOM   2593 O OH  . TYR C 1 107 ? 1.711   15.087  31.964  1.00 31.67  ? 153  TYR C OH  1 
ATOM   2594 N N   . ILE C 1 108 ? -3.930  8.657   31.448  1.00 31.53  ? 154  ILE C N   1 
ATOM   2595 C CA  . ILE C 1 108 ? -4.980  7.710   31.794  1.00 34.20  ? 154  ILE C CA  1 
ATOM   2596 C C   . ILE C 1 108 ? -4.846  6.399   31.017  1.00 35.99  ? 154  ILE C C   1 
ATOM   2597 O O   . ILE C 1 108 ? -4.954  5.324   31.604  1.00 37.66  ? 154  ILE C O   1 
ATOM   2598 C CB  . ILE C 1 108 ? -6.381  8.337   31.564  1.00 34.86  ? 154  ILE C CB  1 
ATOM   2599 C CG1 . ILE C 1 108 ? -6.682  9.365   32.658  1.00 33.67  ? 154  ILE C CG1 1 
ATOM   2600 C CG2 . ILE C 1 108 ? -7.469  7.263   31.512  1.00 38.31  ? 154  ILE C CG2 1 
ATOM   2601 C CD1 . ILE C 1 108 ? -7.934  10.190  32.383  1.00 35.85  ? 154  ILE C CD1 1 
ATOM   2602 N N   . TYR C 1 109 ? -4.595  6.493   29.712  1.00 36.11  ? 155  TYR C N   1 
ATOM   2603 C CA  . TYR C 1 109 ? -4.584  5.313   28.842  1.00 38.31  ? 155  TYR C CA  1 
ATOM   2604 C C   . TYR C 1 109 ? -3.311  4.476   28.966  1.00 39.85  ? 155  TYR C C   1 
ATOM   2605 O O   . TYR C 1 109 ? -3.370  3.245   28.971  1.00 42.13  ? 155  TYR C O   1 
ATOM   2606 C CB  . TYR C 1 109 ? -4.788  5.710   27.373  1.00 37.96  ? 155  TYR C CB  1 
ATOM   2607 C CG  . TYR C 1 109 ? -4.712  4.523   26.433  1.00 39.31  ? 155  TYR C CG  1 
ATOM   2608 C CD1 . TYR C 1 109 ? -5.777  3.637   26.317  1.00 40.93  ? 155  TYR C CD1 1 
ATOM   2609 C CD2 . TYR C 1 109 ? -3.563  4.269   25.692  1.00 39.92  ? 155  TYR C CD2 1 
ATOM   2610 C CE1 . TYR C 1 109 ? -5.706  2.531   25.481  1.00 43.02  ? 155  TYR C CE1 1 
ATOM   2611 C CE2 . TYR C 1 109 ? -3.484  3.168   24.845  1.00 42.98  ? 155  TYR C CE2 1 
ATOM   2612 C CZ  . TYR C 1 109 ? -4.559  2.305   24.743  1.00 44.34  ? 155  TYR C CZ  1 
ATOM   2613 O OH  . TYR C 1 109 ? -4.481  1.213   23.908  1.00 47.14  ? 155  TYR C OH  1 
ATOM   2614 N N   . ASN C 1 110 ? -2.165  5.145   29.047  1.00 38.87  ? 156  ASN C N   1 
ATOM   2615 C CA  . ASN C 1 110 ? -0.874  4.470   28.967  1.00 39.88  ? 156  ASN C CA  1 
ATOM   2616 C C   . ASN C 1 110 ? -0.411  3.895   30.295  1.00 40.79  ? 156  ASN C C   1 
ATOM   2617 O O   . ASN C 1 110 ? -0.907  4.283   31.353  1.00 39.58  ? 156  ASN C O   1 
ATOM   2618 C CB  . ASN C 1 110 ? 0.178   5.428   28.406  1.00 38.49  ? 156  ASN C CB  1 
ATOM   2619 C CG  . ASN C 1 110 ? -0.059  5.748   26.953  1.00 39.44  ? 156  ASN C CG  1 
ATOM   2620 O OD1 . ASN C 1 110 ? 0.302   4.965   26.072  1.00 41.58  ? 156  ASN C OD1 1 
ATOM   2621 N ND2 . ASN C 1 110 ? -0.676  6.899   26.688  1.00 36.35  ? 156  ASN C ND2 1 
ATOM   2622 N N   . LYS C 1 111 ? 0.524   2.950   30.230  1.00 43.28  ? 157  LYS C N   1 
ATOM   2623 C CA  . LYS C 1 111 ? 1.131   2.390   31.444  1.00 44.79  ? 157  LYS C CA  1 
ATOM   2624 C C   . LYS C 1 111 ? 2.052   3.431   32.086  1.00 43.15  ? 157  LYS C C   1 
ATOM   2625 O O   . LYS C 1 111 ? 2.658   4.235   31.376  1.00 41.54  ? 157  LYS C O   1 
ATOM   2626 C CB  . LYS C 1 111 ? 1.906   1.109   31.131  1.00 47.86  ? 157  LYS C CB  1 
ATOM   2627 C CG  . LYS C 1 111 ? 1.027   -0.027  30.625  1.00 52.33  ? 157  LYS C CG  1 
ATOM   2628 C CD  . LYS C 1 111 ? 1.827   -1.293  30.364  1.00 57.48  ? 157  LYS C CD  1 
ATOM   2629 C CE  . LYS C 1 111 ? 0.911   -2.480  30.115  1.00 60.83  ? 157  LYS C CE  1 
ATOM   2630 N NZ  . LYS C 1 111 ? 1.670   -3.747  29.899  1.00 65.91  ? 157  LYS C NZ  1 
ATOM   2631 N N   . PRO C 1 112 ? 2.170   3.417   33.430  1.00 43.60  ? 158  PRO C N   1 
ATOM   2632 C CA  . PRO C 1 112 ? 2.964   4.437   34.127  1.00 42.95  ? 158  PRO C CA  1 
ATOM   2633 C C   . PRO C 1 112 ? 4.424   4.513   33.673  1.00 44.92  ? 158  PRO C C   1 
ATOM   2634 O O   . PRO C 1 112 ? 5.016   5.592   33.684  1.00 44.16  ? 158  PRO C O   1 
ATOM   2635 C CB  . PRO C 1 112 ? 2.905   3.991   35.592  1.00 43.54  ? 158  PRO C CB  1 
ATOM   2636 C CG  . PRO C 1 112 ? 1.717   3.113   35.687  1.00 44.10  ? 158  PRO C CG  1 
ATOM   2637 C CD  . PRO C 1 112 ? 1.611   2.428   34.368  1.00 45.09  ? 158  PRO C CD  1 
ATOM   2638 N N   . THR C 1 113 ? 4.985   3.372   33.284  1.00 47.61  ? 159  THR C N   1 
ATOM   2639 C CA  . THR C 1 113 ? 6.388   3.278   32.894  1.00 50.29  ? 159  THR C CA  1 
ATOM   2640 C C   . THR C 1 113 ? 6.642   3.560   31.409  1.00 51.35  ? 159  THR C C   1 
ATOM   2641 O O   . THR C 1 113 ? 7.792   3.545   30.970  1.00 53.68  ? 159  THR C O   1 
ATOM   2642 C CB  . THR C 1 113 ? 6.935   1.877   33.223  1.00 53.17  ? 159  THR C CB  1 
ATOM   2643 O OG1 . THR C 1 113 ? 6.130   0.889   32.567  1.00 54.11  ? 159  THR C OG1 1 
ATOM   2644 C CG2 . THR C 1 113 ? 6.907   1.634   34.725  0.50 52.87  ? 159  THR C CG2 1 
ATOM   2645 N N   . ASP C 1 114 ? 5.585   3.801   30.634  1.00 50.61  ? 160  ASP C N   1 
ATOM   2646 C CA  . ASP C 1 114 ? 5.733   4.134   29.213  1.00 51.25  ? 160  ASP C CA  1 
ATOM   2647 C C   . ASP C 1 114 ? 6.461   5.469   29.031  1.00 50.26  ? 160  ASP C C   1 
ATOM   2648 O O   . ASP C 1 114 ? 6.228   6.421   29.779  1.00 47.93  ? 160  ASP C O   1 
ATOM   2649 C CB  . ASP C 1 114 ? 4.367   4.213   28.521  1.00 50.32  ? 160  ASP C CB  1 
ATOM   2650 C CG  . ASP C 1 114 ? 3.686   2.861   28.389  1.00 52.73  ? 160  ASP C CG  1 
ATOM   2651 O OD1 . ASP C 1 114 ? 4.329   1.828   28.667  1.00 56.85  ? 160  ASP C OD1 1 
ATOM   2652 O OD2 . ASP C 1 114 ? 2.497   2.832   27.996  1.00 52.65  ? 160  ASP C OD2 1 
ATOM   2653 N N   . ASP C 1 115 ? 7.331   5.528   28.024  1.00 51.83  ? 161  ASP C N   1 
ATOM   2654 C CA  . ASP C 1 115 ? 8.115   6.734   27.727  1.00 51.32  ? 161  ASP C CA  1 
ATOM   2655 C C   . ASP C 1 115 ? 7.229   7.920   27.366  1.00 47.32  ? 161  ASP C C   1 
ATOM   2656 O O   . ASP C 1 115 ? 7.566   9.068   27.665  1.00 45.96  ? 161  ASP C O   1 
ATOM   2657 C CB  . ASP C 1 115 ? 9.075   6.482   26.562  1.00 54.81  ? 161  ASP C CB  1 
ATOM   2658 C CG  . ASP C 1 115 ? 10.071  5.380   26.847  1.00 59.83  ? 161  ASP C CG  1 
ATOM   2659 O OD1 . ASP C 1 115 ? 10.450  5.197   28.026  1.00 62.84  ? 161  ASP C OD1 1 
ATOM   2660 O OD2 . ASP C 1 115 ? 10.482  4.699   25.883  1.00 64.70  ? 161  ASP C OD2 1 
ATOM   2661 N N   . ILE C 1 116 ? 6.114   7.632   26.699  1.00 45.10  ? 162  ILE C N   1 
ATOM   2662 C CA  . ILE C 1 116 ? 5.153   8.655   26.297  1.00 42.85  ? 162  ILE C CA  1 
ATOM   2663 C C   . ILE C 1 116 ? 4.657   9.466   27.505  1.00 39.74  ? 162  ILE C C   1 
ATOM   2664 O O   . ILE C 1 116 ? 4.402   10.661  27.388  1.00 37.47  ? 162  ILE C O   1 
ATOM   2665 C CB  . ILE C 1 116 ? 3.956   8.021   25.525  1.00 43.04  ? 162  ILE C CB  1 
ATOM   2666 C CG1 . ILE C 1 116 ? 3.124   9.088   24.809  1.00 42.93  ? 162  ILE C CG1 1 
ATOM   2667 C CG2 . ILE C 1 116 ? 3.088   7.186   26.452  1.00 44.24  ? 162  ILE C CG2 1 
ATOM   2668 C CD1 . ILE C 1 116 ? 3.837   9.738   23.652  1.00 44.16  ? 162  ILE C CD1 1 
ATOM   2669 N N   . VAL C 1 117 ? 4.553   8.818   28.664  1.00 39.20  ? 163  VAL C N   1 
ATOM   2670 C CA  . VAL C 1 117 ? 4.087   9.484   29.881  1.00 37.44  ? 163  VAL C CA  1 
ATOM   2671 C C   . VAL C 1 117 ? 5.096   10.535  30.344  1.00 37.31  ? 163  VAL C C   1 
ATOM   2672 O O   . VAL C 1 117 ? 4.706   11.638  30.709  1.00 35.69  ? 163  VAL C O   1 
ATOM   2673 C CB  . VAL C 1 117 ? 3.788   8.465   31.009  1.00 37.74  ? 163  VAL C CB  1 
ATOM   2674 C CG1 . VAL C 1 117 ? 3.455   9.174   32.319  1.00 36.59  ? 163  VAL C CG1 1 
ATOM   2675 C CG2 . VAL C 1 117 ? 2.647   7.552   30.592  1.00 37.71  ? 163  VAL C CG2 1 
ATOM   2676 N N   . LEU C 1 118 ? 6.388   10.202  30.300  1.00 39.32  ? 164  LEU C N   1 
ATOM   2677 C CA  . LEU C 1 118 ? 7.437   11.162  30.659  1.00 40.11  ? 164  LEU C CA  1 
ATOM   2678 C C   . LEU C 1 118 ? 7.503   12.319  29.662  1.00 38.63  ? 164  LEU C C   1 
ATOM   2679 O O   . LEU C 1 118 ? 7.777   13.460  30.040  1.00 38.09  ? 164  LEU C O   1 
ATOM   2680 C CB  . LEU C 1 118 ? 8.807   10.474  30.753  1.00 43.23  ? 164  LEU C CB  1 
ATOM   2681 C CG  . LEU C 1 118 ? 9.929   11.299  31.395  1.00 46.77  ? 164  LEU C CG  1 
ATOM   2682 C CD1 . LEU C 1 118 ? 9.628   11.573  32.867  1.00 47.33  ? 164  LEU C CD1 1 
ATOM   2683 C CD2 . LEU C 1 118 ? 11.279  10.599  31.246  1.00 49.91  ? 164  LEU C CD2 1 
ATOM   2684 N N   . MET C 1 119 ? 7.258   12.017  28.390  1.00 38.16  ? 165  MET C N   1 
ATOM   2685 C CA  . MET C 1 119 ? 7.221   13.040  27.344  1.00 37.77  ? 165  MET C CA  1 
ATOM   2686 C C   . MET C 1 119 ? 6.080   14.026  27.580  1.00 35.84  ? 165  MET C C   1 
ATOM   2687 O O   . MET C 1 119 ? 6.274   15.241  27.492  1.00 35.39  ? 165  MET C O   1 
ATOM   2688 C CB  . MET C 1 119 ? 7.076   12.383  25.973  1.00 38.77  ? 165  MET C CB  1 
ATOM   2689 C CG  . MET C 1 119 ? 8.316   11.607  25.565  1.00 41.32  ? 165  MET C CG  1 
ATOM   2690 S SD  . MET C 1 119 ? 8.083   10.568  24.120  1.00 44.59  ? 165  MET C SD  1 
ATOM   2691 C CE  . MET C 1 119 ? 8.125   11.796  22.818  1.00 45.56  ? 165  MET C CE  1 
ATOM   2692 N N   . ALA C 1 120 ? 4.901   13.490  27.884  1.00 34.30  ? 166  ALA C N   1 
ATOM   2693 C CA  . ALA C 1 120 ? 3.738   14.304  28.233  1.00 33.05  ? 166  ALA C CA  1 
ATOM   2694 C C   . ALA C 1 120 ? 4.007   15.166  29.470  1.00 32.84  ? 166  ALA C C   1 
ATOM   2695 O O   . ALA C 1 120 ? 3.656   16.348  29.491  1.00 32.58  ? 166  ALA C O   1 
ATOM   2696 C CB  . ALA C 1 120 ? 2.521   13.417  28.460  1.00 32.26  ? 166  ALA C CB  1 
ATOM   2697 N N   . GLN C 1 121 ? 4.626   14.575  30.493  1.00 33.52  ? 167  GLN C N   1 
ATOM   2698 C CA  . GLN C 1 121 ? 4.969   15.313  31.723  1.00 34.31  ? 167  GLN C CA  1 
ATOM   2699 C C   . GLN C 1 121 ? 5.847   16.528  31.435  1.00 34.39  ? 167  GLN C C   1 
ATOM   2700 O O   . GLN C 1 121 ? 5.620   17.609  31.978  1.00 33.97  ? 167  GLN C O   1 
ATOM   2701 C CB  . GLN C 1 121 ? 5.666   14.405  32.745  1.00 35.61  ? 167  GLN C CB  1 
ATOM   2702 C CG  . GLN C 1 121 ? 4.738   13.447  33.478  1.00 36.67  ? 167  GLN C CG  1 
ATOM   2703 C CD  . GLN C 1 121 ? 5.489   12.517  34.421  1.00 40.35  ? 167  GLN C CD  1 
ATOM   2704 O OE1 . GLN C 1 121 ? 5.883   11.412  34.042  1.00 42.90  ? 167  GLN C OE1 1 
ATOM   2705 N NE2 . GLN C 1 121 ? 5.702   12.968  35.651  1.00 41.91  ? 167  GLN C NE2 1 
ATOM   2706 N N   . THR C 1 122 ? 6.842   16.347  30.575  1.00 35.18  ? 168  THR C N   1 
ATOM   2707 C CA  . THR C 1 122 ? 7.758   17.428  30.220  1.00 36.29  ? 168  THR C CA  1 
ATOM   2708 C C   . THR C 1 122 ? 7.030   18.544  29.486  1.00 34.51  ? 168  THR C C   1 
ATOM   2709 O O   . THR C 1 122 ? 7.244   19.722  29.765  1.00 35.05  ? 168  THR C O   1 
ATOM   2710 C CB  . THR C 1 122 ? 8.915   16.918  29.329  1.00 38.27  ? 168  THR C CB  1 
ATOM   2711 O OG1 . THR C 1 122 ? 9.620   15.874  30.011  1.00 40.40  ? 168  THR C OG1 1 
ATOM   2712 C CG2 . THR C 1 122 ? 9.882   18.051  28.991  1.00 39.90  ? 168  THR C CG2 1 
ATOM   2713 N N   . LEU C 1 123 ? 6.161   18.168  28.554  1.00 32.57  ? 169  LEU C N   1 
ATOM   2714 C CA  . LEU C 1 123 ? 5.421   19.148  27.770  1.00 31.51  ? 169  LEU C CA  1 
ATOM   2715 C C   . LEU C 1 123 ? 4.420   19.907  28.640  1.00 31.12  ? 169  LEU C C   1 
ATOM   2716 O O   . LEU C 1 123 ? 4.270   21.122  28.498  1.00 31.24  ? 169  LEU C O   1 
ATOM   2717 C CB  . LEU C 1 123 ? 4.705   18.473  26.594  1.00 30.51  ? 169  LEU C CB  1 
ATOM   2718 C CG  . LEU C 1 123 ? 5.610   17.876  25.507  1.00 32.31  ? 169  LEU C CG  1 
ATOM   2719 C CD1 . LEU C 1 123 ? 4.781   17.040  24.539  1.00 31.99  ? 169  LEU C CD1 1 
ATOM   2720 C CD2 . LEU C 1 123 ? 6.392   18.964  24.756  1.00 32.16  ? 169  LEU C CD2 1 
ATOM   2721 N N   . GLU C 1 124 ? 3.753   19.199  29.546  1.00 30.69  ? 170  GLU C N   1 
ATOM   2722 C CA  . GLU C 1 124 ? 2.749   19.841  30.393  1.00 31.53  ? 170  GLU C CA  1 
ATOM   2723 C C   . GLU C 1 124 ? 3.373   20.838  31.363  1.00 32.75  ? 170  GLU C C   1 
ATOM   2724 O O   . GLU C 1 124 ? 2.795   21.892  31.616  1.00 33.30  ? 170  GLU C O   1 
ATOM   2725 C CB  . GLU C 1 124 ? 1.904   18.821  31.155  1.00 31.89  ? 170  GLU C CB  1 
ATOM   2726 C CG  . GLU C 1 124 ? 0.739   19.486  31.898  1.00 34.19  ? 170  GLU C CG  1 
ATOM   2727 C CD  . GLU C 1 124 ? -0.433  18.564  32.152  1.00 38.03  ? 170  GLU C CD  1 
ATOM   2728 O OE1 . GLU C 1 124 ? -0.188  17.416  32.570  1.00 40.10  ? 170  GLU C OE1 1 
ATOM   2729 O OE2 . GLU C 1 124 ? -1.599  19.006  31.960  1.00 41.88  ? 170  GLU C OE2 1 
ATOM   2730 N N   . LYS C 1 125 ? 4.545   20.506  31.903  1.00 33.85  ? 171  LYS C N   1 
ATOM   2731 C CA  . LYS C 1 125 ? 5.262   21.417  32.798  1.00 35.74  ? 171  LYS C CA  1 
ATOM   2732 C C   . LYS C 1 125 ? 5.604   22.734  32.100  1.00 36.37  ? 171  LYS C C   1 
ATOM   2733 O O   . LYS C 1 125 ? 5.456   23.805  32.686  1.00 36.29  ? 171  LYS C O   1 
ATOM   2734 C CB  . LYS C 1 125 ? 6.530   20.754  33.355  1.00 37.88  ? 171  LYS C CB  1 
ATOM   2735 C CG  . LYS C 1 125 ? 6.248   19.735  34.461  1.00 39.78  ? 171  LYS C CG  1 
ATOM   2736 C CD  . LYS C 1 125 ? 7.526   19.074  34.958  1.00 43.17  ? 171  LYS C CD  1 
ATOM   2737 C CE  . LYS C 1 125 ? 7.236   18.022  36.019  1.00 43.97  ? 171  LYS C CE  1 
ATOM   2738 N NZ  . LYS C 1 125 ? 6.668   18.612  37.260  1.00 45.07  ? 171  LYS C NZ  1 
ATOM   2739 N N   . ILE C 1 126 ? 6.055   22.647  30.850  1.00 36.65  ? 172  ILE C N   1 
ATOM   2740 C CA  . ILE C 1 126 ? 6.322   23.838  30.036  1.00 38.35  ? 172  ILE C CA  1 
ATOM   2741 C C   . ILE C 1 126 ? 5.034   24.625  29.774  1.00 37.53  ? 172  ILE C C   1 
ATOM   2742 O O   . ILE C 1 126 ? 5.005   25.850  29.916  1.00 37.78  ? 172  ILE C O   1 
ATOM   2743 C CB  . ILE C 1 126 ? 6.971   23.470  28.680  1.00 39.16  ? 172  ILE C CB  1 
ATOM   2744 C CG1 . ILE C 1 126 ? 8.349   22.836  28.895  1.00 42.08  ? 172  ILE C CG1 1 
ATOM   2745 C CG2 . ILE C 1 126 ? 7.098   24.712  27.797  1.00 40.78  ? 172  ILE C CG2 1 
ATOM   2746 C CD1 . ILE C 1 126 ? 8.930   22.213  27.636  1.00 43.84  ? 172  ILE C CD1 1 
ATOM   2747 N N   . PHE C 1 127 ? 3.976   23.913  29.388  1.00 36.28  ? 173  PHE C N   1 
ATOM   2748 C CA  . PHE C 1 127 ? 2.657   24.515  29.190  1.00 36.36  ? 173  PHE C CA  1 
ATOM   2749 C C   . PHE C 1 127 ? 2.237   25.338  30.411  1.00 37.07  ? 173  PHE C C   1 
ATOM   2750 O O   . PHE C 1 127 ? 1.871   26.506  30.286  1.00 37.62  ? 173  PHE C O   1 
ATOM   2751 C CB  . PHE C 1 127 ? 1.617   23.421  28.881  1.00 34.98  ? 173  PHE C CB  1 
ATOM   2752 C CG  . PHE C 1 127 ? 0.187   23.879  28.995  1.00 36.61  ? 173  PHE C CG  1 
ATOM   2753 C CD1 . PHE C 1 127 ? -0.394  24.640  27.989  1.00 37.95  ? 173  PHE C CD1 1 
ATOM   2754 C CD2 . PHE C 1 127 ? -0.584  23.534  30.103  1.00 37.86  ? 173  PHE C CD2 1 
ATOM   2755 C CE1 . PHE C 1 127 ? -1.720  25.063  28.089  1.00 38.19  ? 173  PHE C CE1 1 
ATOM   2756 C CE2 . PHE C 1 127 ? -1.906  23.952  30.210  1.00 39.43  ? 173  PHE C CE2 1 
ATOM   2757 C CZ  . PHE C 1 127 ? -2.474  24.715  29.198  1.00 38.24  ? 173  PHE C CZ  1 
ATOM   2758 N N   . LEU C 1 128 ? 2.310   24.732  31.591  1.00 37.44  ? 174  LEU C N   1 
ATOM   2759 C CA  . LEU C 1 128 ? 1.920   25.418  32.828  1.00 39.04  ? 174  LEU C CA  1 
ATOM   2760 C C   . LEU C 1 128 ? 2.805   26.611  33.149  1.00 40.97  ? 174  LEU C C   1 
ATOM   2761 O O   . LEU C 1 128 ? 2.318   27.642  33.621  1.00 41.77  ? 174  LEU C O   1 
ATOM   2762 C CB  . LEU C 1 128 ? 1.946   24.453  34.007  1.00 39.10  ? 174  LEU C CB  1 
ATOM   2763 C CG  . LEU C 1 128 ? 0.799   23.454  34.038  1.00 39.18  ? 174  LEU C CG  1 
ATOM   2764 C CD1 . LEU C 1 128 ? 1.050   22.481  35.164  1.00 39.09  ? 174  LEU C CD1 1 
ATOM   2765 C CD2 . LEU C 1 128 ? -0.532  24.172  34.210  1.00 40.59  ? 174  LEU C CD2 1 
ATOM   2766 N N   . GLN C 1 129 ? 4.105   26.465  32.908  1.00 42.00  ? 175  GLN C N   1 
ATOM   2767 C CA  . GLN C 1 129 ? 5.050   27.542  33.170  1.00 44.41  ? 175  GLN C CA  1 
ATOM   2768 C C   . GLN C 1 129 ? 4.690   28.753  32.314  1.00 45.10  ? 175  GLN C C   1 
ATOM   2769 O O   . GLN C 1 129 ? 4.639   29.881  32.803  1.00 46.36  ? 175  GLN C O   1 
ATOM   2770 C CB  . GLN C 1 129 ? 6.486   27.084  32.883  1.00 46.06  ? 175  GLN C CB  1 
ATOM   2771 C CG  . GLN C 1 129 ? 7.553   27.872  33.617  1.00 50.55  ? 175  GLN C CG  1 
ATOM   2772 C CD  . GLN C 1 129 ? 7.577   27.595  35.113  1.00 52.59  ? 175  GLN C CD  1 
ATOM   2773 O OE1 . GLN C 1 129 ? 6.923   26.668  35.604  1.00 52.65  ? 175  GLN C OE1 1 
ATOM   2774 N NE2 . GLN C 1 129 ? 8.336   28.401  35.847  1.00 55.49  ? 175  GLN C NE2 1 
ATOM   2775 N N   . LYS C 1 130 ? 4.407   28.505  31.039  1.00 44.33  ? 176  LYS C N   1 
ATOM   2776 C CA  . LYS C 1 130 ? 4.051   29.576  30.119  1.00 45.62  ? 176  LYS C CA  1 
ATOM   2777 C C   . LYS C 1 130 ? 2.659   30.145  30.418  1.00 45.11  ? 176  LYS C C   1 
ATOM   2778 O O   . LYS C 1 130 ? 2.463   31.356  30.333  1.00 46.39  ? 176  LYS C O   1 
ATOM   2779 C CB  . LYS C 1 130 ? 4.162   29.096  28.667  1.00 45.45  ? 176  LYS C CB  1 
ATOM   2780 C CG  . LYS C 1 130 ? 5.581   28.694  28.255  1.00 47.91  ? 176  LYS C CG  1 
ATOM   2781 C CD  . LYS C 1 130 ? 6.491   29.907  28.070  1.00 53.15  ? 176  LYS C CD  1 
ATOM   2782 C CE  . LYS C 1 130 ? 7.963   29.507  27.962  1.00 56.11  ? 176  LYS C CE  1 
ATOM   2783 N NZ  . LYS C 1 130 ? 8.207   28.497  26.894  1.00 56.69  ? 176  LYS C NZ  1 
ATOM   2784 N N   . VAL C 1 131 ? 1.704   29.286  30.782  1.00 43.20  ? 177  VAL C N   1 
ATOM   2785 C CA  . VAL C 1 131 ? 0.365   29.749  31.185  1.00 43.79  ? 177  VAL C CA  1 
ATOM   2786 C C   . VAL C 1 131 ? 0.419   30.722  32.373  1.00 45.91  ? 177  VAL C C   1 
ATOM   2787 O O   . VAL C 1 131 ? -0.364  31.672  32.438  1.00 47.57  ? 177  VAL C O   1 
ATOM   2788 C CB  . VAL C 1 131 ? -0.577  28.564  31.533  1.00 42.21  ? 177  VAL C CB  1 
ATOM   2789 C CG1 . VAL C 1 131 ? -1.788  29.042  32.342  1.00 43.43  ? 177  VAL C CG1 1 
ATOM   2790 C CG2 . VAL C 1 131 ? -1.030  27.861  30.265  1.00 41.22  ? 177  VAL C CG2 1 
ATOM   2791 N N   . ALA C 1 132 ? 1.347   30.484  33.297  1.00 46.62  ? 178  ALA C N   1 
ATOM   2792 C CA  . ALA C 1 132 ? 1.541   31.351  34.462  1.00 49.24  ? 178  ALA C CA  1 
ATOM   2793 C C   . ALA C 1 132 ? 1.880   32.803  34.094  1.00 52.36  ? 178  ALA C C   1 
ATOM   2794 O O   . ALA C 1 132 ? 1.535   33.724  34.837  1.00 53.86  ? 178  ALA C O   1 
ATOM   2795 C CB  . ALA C 1 132 ? 2.622   30.779  35.366  1.00 49.23  ? 178  ALA C CB  1 
ATOM   2796 N N   . SER C 1 133 ? 2.550   33.000  32.956  1.00 53.48  ? 179  SER C N   1 
ATOM   2797 C CA  . SER C 1 133 ? 2.935   34.344  32.494  1.00 57.27  ? 179  SER C CA  1 
ATOM   2798 C C   . SER C 1 133 ? 1.978   34.921  31.446  1.00 58.43  ? 179  SER C C   1 
ATOM   2799 O O   . SER C 1 133 ? 2.294   35.919  30.791  1.00 60.44  ? 179  SER C O   1 
ATOM   2800 C CB  . SER C 1 133 ? 4.359   34.318  31.934  1.00 58.09  ? 179  SER C CB  1 
ATOM   2801 O OG  . SER C 1 133 ? 5.268   33.801  32.888  1.00 58.37  ? 179  SER C OG  1 
ATOM   2802 N N   . MET C 1 134 ? 0.808   34.302  31.296  1.00 57.53  ? 180  MET C N   1 
ATOM   2803 C CA  . MET C 1 134 ? -0.207  34.765  30.353  1.00 58.63  ? 180  MET C CA  1 
ATOM   2804 C C   . MET C 1 134 ? -0.834  36.082  30.833  1.00 62.51  ? 180  MET C C   1 
ATOM   2805 O O   . MET C 1 134 ? -0.990  36.283  32.038  1.00 63.55  ? 180  MET C O   1 
ATOM   2806 C CB  . MET C 1 134 ? -1.290  33.694  30.213  1.00 56.30  ? 180  MET C CB  1 
ATOM   2807 C CG  . MET C 1 134 ? -2.331  33.964  29.145  1.00 56.93  ? 180  MET C CG  1 
ATOM   2808 S SD  . MET C 1 134 ? -3.436  32.555  28.935  1.00 55.05  ? 180  MET C SD  1 
ATOM   2809 C CE  . MET C 1 134 ? -4.176  32.450  30.565  1.00 54.43  ? 180  MET C CE  1 
ATOM   2810 N N   . PRO C 1 135 ? -1.189  36.988  29.898  1.00 65.09  ? 181  PRO C N   1 
ATOM   2811 C CA  . PRO C 1 135 ? -1.886  38.222  30.299  1.00 69.03  ? 181  PRO C CA  1 
ATOM   2812 C C   . PRO C 1 135 ? -3.302  37.972  30.841  1.00 69.69  ? 181  PRO C C   1 
ATOM   2813 O O   . PRO C 1 135 ? -3.859  36.892  30.636  1.00 67.40  ? 181  PRO C O   1 
ATOM   2814 C CB  . PRO C 1 135 ? -1.950  39.039  28.999  1.00 70.29  ? 181  PRO C CB  1 
ATOM   2815 C CG  . PRO C 1 135 ? -0.928  38.440  28.097  1.00 68.27  ? 181  PRO C CG  1 
ATOM   2816 C CD  . PRO C 1 135 ? -0.846  36.994  28.464  1.00 64.64  ? 181  PRO C CD  1 
ATOM   2817 N N   . GLN C 1 136 ? -3.870  38.962  31.529  1.00 73.43  ? 182  GLN C N   1 
ATOM   2818 C CA  . GLN C 1 136 ? -5.248  38.869  32.027  1.00 74.53  ? 182  GLN C CA  1 
ATOM   2819 C C   . GLN C 1 136 ? -6.256  38.872  30.877  1.00 74.40  ? 182  GLN C C   1 
ATOM   2820 O O   . GLN C 1 136 ? -6.535  39.915  30.282  1.00 77.00  ? 182  GLN C O   1 
ATOM   2821 C CB  . GLN C 1 136 ? -5.565  40.020  32.985  1.00 78.95  ? 182  GLN C CB  1 
ATOM   2822 C CG  . GLN C 1 136 ? -4.980  39.855  34.373  1.00 80.03  ? 182  GLN C CG  1 
ATOM   2823 C CD  . GLN C 1 136 ? -5.332  41.009  35.295  1.00 84.77  ? 182  GLN C CD  1 
ATOM   2824 O OE1 . GLN C 1 136 ? -6.466  41.488  35.303  1.00 87.71  ? 182  GLN C OE1 1 
ATOM   2825 N NE2 . GLN C 1 136 ? -4.360  41.458  36.081  1.00 86.35  ? 182  GLN C NE2 1 
HETATM 2826 C C1  . EDO D 2 .   ? 22.394  -7.858  -9.280  1.00 55.93  ? 1187 EDO A C1  1 
HETATM 2827 O O1  . EDO D 2 .   ? 23.144  -8.118  -10.474 1.00 55.55  ? 1187 EDO A O1  1 
HETATM 2828 C C2  . EDO D 2 .   ? 21.286  -6.833  -9.489  1.00 55.71  ? 1187 EDO A C2  1 
HETATM 2829 O O2  . EDO D 2 .   ? 21.571  -5.998  -10.622 1.00 55.24  ? 1187 EDO A O2  1 
HETATM 2830 C C1  . EDO E 2 .   ? 26.033  -2.392  -3.321  1.00 37.54  ? 1188 EDO A C1  1 
HETATM 2831 O O1  . EDO E 2 .   ? 26.464  -2.111  -4.656  1.00 37.02  ? 1188 EDO A O1  1 
HETATM 2832 C C2  . EDO E 2 .   ? 25.188  -1.249  -2.772  1.00 36.39  ? 1188 EDO A C2  1 
HETATM 2833 O O2  . EDO E 2 .   ? 23.969  -1.137  -3.508  1.00 31.85  ? 1188 EDO A O2  1 
HETATM 2834 C C1  . EDO F 2 .   ? 21.569  -4.159  6.953   1.00 70.13  ? 1189 EDO A C1  1 
HETATM 2835 O O1  . EDO F 2 .   ? 20.188  -4.287  7.320   1.00 70.17  ? 1189 EDO A O1  1 
HETATM 2836 C C2  . EDO F 2 .   ? 21.744  -4.472  5.471   1.00 70.10  ? 1189 EDO A C2  1 
HETATM 2837 O O2  . EDO F 2 .   ? 21.167  -3.421  4.685   1.00 69.73  ? 1189 EDO A O2  1 
HETATM 2838 O O3  . A9N G 3 .   ? 20.772  13.346  -11.616 0.80 40.68  ? 1190 A9N A O3  1 
HETATM 2839 S S   . A9N G 3 .   ? 19.432  13.230  -12.115 0.80 41.71  ? 1190 A9N A S   1 
HETATM 2840 O O2  . A9N G 3 .   ? 19.207  12.975  -13.502 0.80 41.99  ? 1190 A9N A O2  1 
HETATM 2841 N N2  . A9N G 3 .   ? 18.669  14.596  -11.738 0.80 41.60  ? 1190 A9N A N2  1 
HETATM 2842 C C13 . A9N G 3 .   ? 18.658  15.107  -10.371 0.80 40.72  ? 1190 A9N A C13 1 
HETATM 2843 C C15 . A9N G 3 .   ? 19.720  16.025  -9.886  0.80 40.32  ? 1190 A9N A C15 1 
HETATM 2844 C C14 . A9N G 3 .   ? 18.552  16.559  -10.092 0.80 40.85  ? 1190 A9N A C14 1 
HETATM 2845 C C11 . A9N G 3 .   ? 18.706  11.894  -11.204 0.80 39.46  ? 1190 A9N A C11 1 
HETATM 2846 C C9  . A9N G 3 .   ? 17.324  11.662  -11.266 0.80 37.87  ? 1190 A9N A C9  1 
HETATM 2847 C C10 . A9N G 3 .   ? 16.377  12.482  -12.069 0.80 38.41  ? 1190 A9N A C10 1 
HETATM 2848 C C8  . A9N G 3 .   ? 16.838  10.598  -10.529 0.80 38.27  ? 1190 A9N A C8  1 
HETATM 2849 C C7  . A9N G 3 .   ? 17.660  9.795   -9.761  0.80 37.37  ? 1190 A9N A C7  1 
HETATM 2850 C C12 . A9N G 3 .   ? 19.534  11.099  -10.443 0.80 38.53  ? 1190 A9N A C12 1 
HETATM 2851 C C6  . A9N G 3 .   ? 19.015  10.046  -9.716  0.80 38.28  ? 1190 A9N A C6  1 
HETATM 2852 C C5  . A9N G 3 .   ? 19.924  9.217   -8.904  0.80 37.52  ? 1190 A9N A C5  1 
HETATM 2853 C C2  . A9N G 3 .   ? 19.812  8.936   -7.526  0.80 38.32  ? 1190 A9N A C2  1 
HETATM 2854 C C1  . A9N G 3 .   ? 18.861  9.301   -6.664  0.80 38.48  ? 1190 A9N A C1  1 
HETATM 2855 C C3  . A9N G 3 .   ? 21.074  8.620   -9.346  0.80 37.81  ? 1190 A9N A C3  1 
HETATM 2856 C C4  . A9N G 3 .   ? 21.745  8.541   -10.650 0.80 38.96  ? 1190 A9N A C4  1 
HETATM 2857 O O1  . A9N G 3 .   ? 21.667  7.981   -8.307  0.80 38.49  ? 1190 A9N A O1  1 
HETATM 2858 N N1  . A9N G 3 .   ? 20.870  8.194   -7.187  0.80 39.90  ? 1190 A9N A N1  1 
HETATM 2859 S S   . SO4 H 4 .   ? 8.063   18.613  -5.123  1.00 88.72  ? 1191 SO4 A S   1 
HETATM 2860 O O1  . SO4 H 4 .   ? 8.483   17.625  -6.114  1.00 88.39  ? 1191 SO4 A O1  1 
HETATM 2861 O O2  . SO4 H 4 .   ? 6.956   19.399  -5.664  1.00 88.95  ? 1191 SO4 A O2  1 
HETATM 2862 O O3  . SO4 H 4 .   ? 7.629   17.935  -3.904  1.00 88.28  ? 1191 SO4 A O3  1 
HETATM 2863 O O4  . SO4 H 4 .   ? 9.180   19.500  -4.807  1.00 88.96  ? 1191 SO4 A O4  1 
HETATM 2864 S S   . SO4 I 4 .   ? 9.064   -3.822  -1.066  1.00 122.03 ? 1192 SO4 A S   1 
HETATM 2865 O O1  . SO4 I 4 .   ? 8.446   -4.739  -0.111  1.00 122.18 ? 1192 SO4 A O1  1 
HETATM 2866 O O2  . SO4 I 4 .   ? 9.723   -2.743  -0.343  1.00 122.12 ? 1192 SO4 A O2  1 
HETATM 2867 O O3  . SO4 I 4 .   ? 10.048  -4.542  -1.869  1.00 122.03 ? 1192 SO4 A O3  1 
HETATM 2868 O O4  . SO4 I 4 .   ? 8.040   -3.256  -1.939  1.00 122.16 ? 1192 SO4 A O4  1 
HETATM 2869 C C1  . EDO J 2 .   ? 42.318  -6.827  6.908   1.00 45.61  ? 1187 EDO B C1  1 
HETATM 2870 O O1  . EDO J 2 .   ? 41.538  -7.655  7.783   1.00 44.46  ? 1187 EDO B O1  1 
HETATM 2871 C C2  . EDO J 2 .   ? 41.619  -5.504  6.634   1.00 45.02  ? 1187 EDO B C2  1 
HETATM 2872 O O2  . EDO J 2 .   ? 42.533  -4.609  5.993   1.00 44.51  ? 1187 EDO B O2  1 
HETATM 2873 C C1  . EDO K 2 .   ? 25.668  17.444  6.963   1.00 52.67  ? 1188 EDO B C1  1 
HETATM 2874 O O1  . EDO K 2 .   ? 25.276  18.277  5.855   1.00 55.18  ? 1188 EDO B O1  1 
HETATM 2875 C C2  . EDO K 2 .   ? 25.718  15.964  6.598   1.00 50.80  ? 1188 EDO B C2  1 
HETATM 2876 O O2  . EDO K 2 .   ? 26.935  15.411  7.097   1.00 49.42  ? 1188 EDO B O2  1 
HETATM 2877 O O3  . A9N L 3 .   ? 42.758  2.371   -0.542  0.80 41.76  ? 1189 A9N B O3  1 
HETATM 2878 S S   . A9N L 3 .   ? 43.928  2.454   0.279   0.80 42.94  ? 1189 A9N B S   1 
HETATM 2879 O O2  . A9N L 3 .   ? 45.204  2.691   -0.328  0.80 43.50  ? 1189 A9N B O2  1 
HETATM 2880 N N2  . A9N L 3 .   ? 44.020  1.066   1.093   0.80 41.82  ? 1189 A9N B N2  1 
HETATM 2881 C C13 . A9N L 3 .   ? 42.869  0.533   1.824   0.80 41.39  ? 1189 A9N B C13 1 
HETATM 2882 C C15 . A9N L 3 .   ? 42.010  -0.523  1.228   0.80 40.77  ? 1189 A9N B C15 1 
HETATM 2883 C C14 . A9N L 3 .   ? 42.787  -0.900  2.202   0.80 41.24  ? 1189 A9N B C14 1 
HETATM 2884 C C11 . A9N L 3 .   ? 43.639  3.773   1.427   0.80 41.19  ? 1189 A9N B C11 1 
HETATM 2885 C C9  . A9N L 3 .   ? 44.531  3.995   2.488   0.80 40.27  ? 1189 A9N B C9  1 
HETATM 2886 C C10 . A9N L 3 .   ? 45.751  3.181   2.738   0.80 40.58  ? 1189 A9N B C10 1 
HETATM 2887 C C8  . A9N L 3 .   ? 44.234  5.043   3.336   0.80 40.25  ? 1189 A9N B C8  1 
HETATM 2888 C C7  . A9N L 3 .   ? 43.118  5.840   3.167   0.80 39.85  ? 1189 A9N B C7  1 
HETATM 2889 C C12 . A9N L 3 .   ? 42.523  4.565   1.247   0.80 40.52  ? 1189 A9N B C12 1 
HETATM 2890 C C6  . A9N L 3 .   ? 42.257  5.605   2.120   0.80 40.30  ? 1189 A9N B C6  1 
HETATM 2891 C C5  . A9N L 3 .   ? 41.049  6.430   1.914   0.80 38.84  ? 1189 A9N B C5  1 
HETATM 2892 C C2  . A9N L 3 .   ? 40.006  6.669   2.838   0.80 39.20  ? 1189 A9N B C2  1 
HETATM 2893 C C1  . A9N L 3 .   ? 39.886  6.269   4.107   0.80 39.44  ? 1189 A9N B C1  1 
HETATM 2894 C C3  . A9N L 3 .   ? 40.701  7.053   0.747   0.80 39.95  ? 1189 A9N B C3  1 
HETATM 2895 C C4  . A9N L 3 .   ? 41.342  7.182   -0.571  0.80 40.93  ? 1189 A9N B C4  1 
HETATM 2896 O O1  . A9N L 3 .   ? 39.501  7.669   0.915   0.80 40.50  ? 1189 A9N B O1  1 
HETATM 2897 N N1  . A9N L 3 .   ? 39.086  7.412   2.218   0.80 40.23  ? 1189 A9N B N1  1 
HETATM 2898 S S   . SO4 M 4 .   ? 40.852  19.893  13.494  1.00 75.61  ? 1190 SO4 B S   1 
HETATM 2899 O O1  . SO4 M 4 .   ? 41.422  21.141  13.997  1.00 75.73  ? 1190 SO4 B O1  1 
HETATM 2900 O O2  . SO4 M 4 .   ? 40.177  20.152  12.225  1.00 75.54  ? 1190 SO4 B O2  1 
HETATM 2901 O O3  . SO4 M 4 .   ? 39.892  19.375  14.468  1.00 74.90  ? 1190 SO4 B O3  1 
HETATM 2902 O O4  . SO4 M 4 .   ? 41.921  18.921  13.284  1.00 75.41  ? 1190 SO4 B O4  1 
HETATM 2903 S S   . DMS N 5 .   ? -0.478  8.109   22.953  1.00 65.15  ? 1183 DMS C S   1 
HETATM 2904 O O   . DMS N 5 .   ? -1.752  7.595   24.115  1.00 64.78  ? 1183 DMS C O   1 
HETATM 2905 C C1  . DMS N 5 .   ? -0.598  9.897   22.662  1.00 64.73  ? 1183 DMS C C1  1 
HETATM 2906 C C2  . DMS N 5 .   ? -0.885  7.484   21.299  1.00 65.24  ? 1183 DMS C C2  1 
HETATM 2907 C C1  . EDO O 2 .   ? -14.254 19.113  21.954  1.00 50.85  ? 1184 EDO C C1  1 
HETATM 2908 O O1  . EDO O 2 .   ? -13.729 19.117  20.623  1.00 51.58  ? 1184 EDO C O1  1 
HETATM 2909 C C2  . EDO O 2 .   ? -13.137 19.431  22.942  1.00 50.10  ? 1184 EDO C C2  1 
HETATM 2910 O O2  . EDO O 2 .   ? -12.653 20.759  22.714  1.00 47.21  ? 1184 EDO C O2  1 
HETATM 2911 S S   . SO4 P 4 .   ? -11.920 25.071  13.274  1.00 52.78  ? 1185 SO4 C S   1 
HETATM 2912 O O1  . SO4 P 4 .   ? -11.680 25.073  11.836  1.00 55.46  ? 1185 SO4 C O1  1 
HETATM 2913 O O2  . SO4 P 4 .   ? -13.345 24.950  13.562  1.00 54.63  ? 1185 SO4 C O2  1 
HETATM 2914 O O3  . SO4 P 4 .   ? -11.201 23.955  13.876  1.00 55.15  ? 1185 SO4 C O3  1 
HETATM 2915 O O4  . SO4 P 4 .   ? -11.439 26.321  13.835  1.00 54.34  ? 1185 SO4 C O4  1 
HETATM 2916 O O   . HOH Q 6 .   ? 9.822   6.070   23.453  1.00 49.48  ? 2001 HOH A O   1 
HETATM 2917 O O   . HOH Q 6 .   ? 16.774  -0.919  16.344  1.00 32.61  ? 2002 HOH A O   1 
HETATM 2918 O O   . HOH Q 6 .   ? 17.366  0.071   18.764  1.00 38.62  ? 2003 HOH A O   1 
HETATM 2919 O O   . HOH Q 6 .   ? 5.075   2.874   11.311  1.00 40.75  ? 2004 HOH A O   1 
HETATM 2920 O O   . HOH Q 6 .   ? 3.065   6.955   4.964   1.00 29.23  ? 2005 HOH A O   1 
HETATM 2921 O O   . HOH Q 6 .   ? 9.372   15.951  10.762  1.00 47.39  ? 2006 HOH A O   1 
HETATM 2922 O O   . HOH Q 6 .   ? 5.601   14.124  4.187   1.00 40.09  ? 2007 HOH A O   1 
HETATM 2923 O O   . HOH Q 6 .   ? 11.143  18.801  5.051   1.00 41.54  ? 2008 HOH A O   1 
HETATM 2924 O O   . HOH Q 6 .   ? 2.624   11.130  -1.375  1.00 47.21  ? 2009 HOH A O   1 
HETATM 2925 O O   . HOH Q 6 .   ? 4.890   15.382  -0.786  1.00 49.51  ? 2010 HOH A O   1 
HETATM 2926 O O   . HOH Q 6 .   ? 8.752   20.472  -2.197  1.00 42.80  ? 2011 HOH A O   1 
HETATM 2927 O O   . HOH Q 6 .   ? 7.399   21.023  1.925   1.00 46.22  ? 2012 HOH A O   1 
HETATM 2928 O O   . HOH Q 6 .   ? 10.885  17.197  -4.004  1.00 23.16  ? 2013 HOH A O   1 
HETATM 2929 O O   . HOH Q 6 .   ? 11.924  21.692  1.331   1.00 20.31  ? 2014 HOH A O   1 
HETATM 2930 O O   . HOH Q 6 .   ? 11.453  20.554  -5.735  1.00 28.31  ? 2015 HOH A O   1 
HETATM 2931 O O   . HOH Q 6 .   ? 9.621   12.065  -8.101  1.00 49.02  ? 2016 HOH A O   1 
HETATM 2932 O O   . HOH Q 6 .   ? 11.509  20.096  -8.911  1.00 53.75  ? 2017 HOH A O   1 
HETATM 2933 O O   . HOH Q 6 .   ? 15.903  7.110   -6.667  1.00 22.29  ? 2018 HOH A O   1 
HETATM 2934 O O   . HOH Q 6 .   ? 7.442   5.476   -5.079  1.00 40.80  ? 2019 HOH A O   1 
HETATM 2935 O O   . HOH Q 6 .   ? 7.911   13.462  -6.941  1.00 45.02  ? 2020 HOH A O   1 
HETATM 2936 O O   . HOH Q 6 .   ? 13.037  10.103  -11.659 1.00 58.82  ? 2021 HOH A O   1 
HETATM 2937 O O   . HOH Q 6 .   ? 6.276   7.032   21.801  1.00 37.73  ? 2022 HOH A O   1 
HETATM 2938 O O   . HOH Q 6 .   ? 11.223  3.972   -10.995 1.00 38.76  ? 2023 HOH A O   1 
HETATM 2939 O O   . HOH Q 6 .   ? 14.475  7.516   -11.843 1.00 32.54  ? 2024 HOH A O   1 
HETATM 2940 O O   . HOH Q 6 .   ? 16.742  1.107   -9.165  1.00 26.36  ? 2025 HOH A O   1 
HETATM 2941 O O   . HOH Q 6 .   ? 16.733  2.811   -6.708  1.00 18.93  ? 2026 HOH A O   1 
HETATM 2942 O O   . HOH Q 6 .   ? 16.355  0.659   -13.320 1.00 26.34  ? 2027 HOH A O   1 
HETATM 2943 O O   . HOH Q 6 .   ? 11.051  2.456   -17.426 1.00 28.35  ? 2028 HOH A O   1 
HETATM 2944 O O   . HOH Q 6 .   ? 13.456  0.918   -16.564 1.00 39.88  ? 2029 HOH A O   1 
HETATM 2945 O O   . HOH Q 6 .   ? 10.551  5.703   -14.313 1.00 38.52  ? 2030 HOH A O   1 
HETATM 2946 O O   . HOH Q 6 .   ? 20.172  1.988   -19.703 1.00 47.15  ? 2031 HOH A O   1 
HETATM 2947 O O   . HOH Q 6 .   ? 5.047   11.251  4.447   1.00 39.65  ? 2032 HOH A O   1 
HETATM 2948 O O   . HOH Q 6 .   ? 10.547  20.888  3.606   1.00 38.82  ? 2033 HOH A O   1 
HETATM 2949 O O   . HOH Q 6 .   ? 12.969  19.195  7.149   1.00 52.69  ? 2034 HOH A O   1 
HETATM 2950 O O   . HOH Q 6 .   ? 14.511  10.152  -20.490 1.00 33.09  ? 2035 HOH A O   1 
HETATM 2951 O O   . HOH Q 6 .   ? 8.017   8.631   -13.967 1.00 48.35  ? 2036 HOH A O   1 
HETATM 2952 O O   . HOH Q 6 .   ? 9.869   11.823  -17.146 1.00 42.38  ? 2037 HOH A O   1 
HETATM 2953 O O   . HOH Q 6 .   ? 20.665  11.059  -16.882 1.00 51.61  ? 2038 HOH A O   1 
HETATM 2954 O O   . HOH Q 6 .   ? 22.792  9.965   -19.180 1.00 46.95  ? 2039 HOH A O   1 
HETATM 2955 O O   . HOH Q 6 .   ? 13.065  20.542  -11.271 1.00 61.94  ? 2040 HOH A O   1 
HETATM 2956 O O   . HOH Q 6 .   ? 22.151  -0.933  -15.450 1.00 36.82  ? 2041 HOH A O   1 
HETATM 2957 O O   . HOH Q 6 .   ? 5.460   10.631  -5.930  1.00 51.71  ? 2042 HOH A O   1 
HETATM 2958 O O   . HOH Q 6 .   ? 12.540  1.107   -12.231 1.00 44.89  ? 2043 HOH A O   1 
HETATM 2959 O O   . HOH Q 6 .   ? 26.614  5.476   -18.007 1.00 62.83  ? 2044 HOH A O   1 
HETATM 2960 O O   . HOH Q 6 .   ? 29.816  4.822   -13.857 1.00 50.68  ? 2045 HOH A O   1 
HETATM 2961 O O   . HOH Q 6 .   ? 15.404  -1.296  -8.708  1.00 37.09  ? 2046 HOH A O   1 
HETATM 2962 O O   . HOH Q 6 .   ? 15.713  -0.467  -15.389 1.00 56.08  ? 2047 HOH A O   1 
HETATM 2963 O O   . HOH Q 6 .   ? 20.047  -0.604  -18.642 1.00 47.82  ? 2048 HOH A O   1 
HETATM 2964 O O   . HOH Q 6 .   ? 30.215  -1.415  -15.259 1.00 60.97  ? 2049 HOH A O   1 
HETATM 2965 O O   . HOH Q 6 .   ? 19.367  3.197   -5.404  1.00 22.96  ? 2050 HOH A O   1 
HETATM 2966 O O   . HOH Q 6 .   ? 21.831  5.918   -6.467  1.00 21.51  ? 2051 HOH A O   1 
HETATM 2967 O O   . HOH Q 6 .   ? 13.774  11.897  -18.550 1.00 38.81  ? 2052 HOH A O   1 
HETATM 2968 O O   . HOH Q 6 .   ? 10.078  14.251  -17.458 1.00 37.33  ? 2053 HOH A O   1 
HETATM 2969 O O   . HOH Q 6 .   ? 20.995  -3.582  -8.928  1.00 27.44  ? 2054 HOH A O   1 
HETATM 2970 O O   . HOH Q 6 .   ? 32.553  3.139   -12.474 1.00 57.45  ? 2055 HOH A O   1 
HETATM 2971 O O   . HOH Q 6 .   ? 30.069  -1.975  -7.083  1.00 47.05  ? 2056 HOH A O   1 
HETATM 2972 O O   . HOH Q 6 .   ? 19.344  -6.334  -5.939  1.00 34.81  ? 2057 HOH A O   1 
HETATM 2973 O O   . HOH Q 6 .   ? 28.161  -7.588  -11.206 1.00 55.96  ? 2058 HOH A O   1 
HETATM 2974 O O   . HOH Q 6 .   ? 14.286  -1.221  -5.946  1.00 33.76  ? 2059 HOH A O   1 
HETATM 2975 O O   . HOH Q 6 .   ? 19.285  -3.290  0.587   1.00 38.53  ? 2060 HOH A O   1 
HETATM 2976 O O   . HOH Q 6 .   ? 24.124  -1.467  1.406   1.00 50.91  ? 2061 HOH A O   1 
HETATM 2977 O O   . HOH Q 6 .   ? 24.772  -6.337  2.422   1.00 52.90  ? 2062 HOH A O   1 
HETATM 2978 O O   . HOH Q 6 .   ? 17.661  -3.443  -2.693  1.00 46.50  ? 2063 HOH A O   1 
HETATM 2979 O O   . HOH Q 6 .   ? 15.028  1.388   -5.166  1.00 20.95  ? 2064 HOH A O   1 
HETATM 2980 O O   . HOH Q 6 .   ? 17.410  6.382   -4.648  1.00 26.51  ? 2065 HOH A O   1 
HETATM 2981 O O   . HOH Q 6 .   ? 0.598   3.842   7.501   1.00 41.65  ? 2066 HOH A O   1 
HETATM 2982 O O   . HOH Q 6 .   ? 8.295   2.468   -5.102  1.00 52.07  ? 2067 HOH A O   1 
HETATM 2983 O O   . HOH Q 6 .   ? 7.846   -1.373  9.421   1.00 33.85  ? 2068 HOH A O   1 
HETATM 2984 O O   . HOH Q 6 .   ? 15.008  -6.048  3.171   1.00 28.58  ? 2069 HOH A O   1 
HETATM 2985 O O   . HOH Q 6 .   ? 15.668  -4.643  -0.913  1.00 34.31  ? 2070 HOH A O   1 
HETATM 2986 O O   . HOH Q 6 .   ? 29.639  17.542  -2.958  1.00 43.06  ? 2071 HOH A O   1 
HETATM 2987 O O   . HOH Q 6 .   ? 28.506  22.299  -7.118  1.00 37.80  ? 2072 HOH A O   1 
HETATM 2988 O O   . HOH Q 6 .   ? 22.231  17.669  -13.222 1.00 54.43  ? 2073 HOH A O   1 
HETATM 2989 O O   . HOH Q 6 .   ? 24.776  21.726  -14.578 1.00 58.99  ? 2074 HOH A O   1 
HETATM 2990 O O   . HOH Q 6 .   ? -0.662  1.612   8.172   1.00 52.14  ? 2075 HOH A O   1 
HETATM 2991 O O   . HOH Q 6 .   ? 21.937  21.393  4.581   1.00 36.59  ? 2076 HOH A O   1 
HETATM 2992 O O   . HOH Q 6 .   ? 26.488  19.738  1.405   1.00 67.75  ? 2077 HOH A O   1 
HETATM 2993 O O   . HOH Q 6 .   ? 6.124   -4.103  2.190   1.00 65.38  ? 2078 HOH A O   1 
HETATM 2994 O O   . HOH Q 6 .   ? 6.596   -6.035  12.001  1.00 44.46  ? 2079 HOH A O   1 
HETATM 2995 O O   . HOH Q 6 .   ? 12.217  -2.141  28.657  1.00 55.79  ? 2080 HOH A O   1 
HETATM 2996 O O   . HOH Q 6 .   ? 19.710  -3.858  11.180  1.00 33.13  ? 2081 HOH A O   1 
HETATM 2997 O O   . HOH Q 6 .   ? 19.621  -1.762  2.967   1.00 32.37  ? 2082 HOH A O   1 
HETATM 2998 O O   . HOH Q 6 .   ? 23.286  0.398   5.189   1.00 25.54  ? 2083 HOH A O   1 
HETATM 2999 O O   . HOH Q 6 .   ? 25.450  7.123   3.787   1.00 35.03  ? 2084 HOH A O   1 
HETATM 3000 O O   . HOH Q 6 .   ? 23.160  7.569   7.121   1.00 39.80  ? 2085 HOH A O   1 
HETATM 3001 O O   . HOH Q 6 .   ? 27.086  1.223   4.292   1.00 36.61  ? 2086 HOH A O   1 
HETATM 3002 O O   . HOH Q 6 .   ? 20.096  6.010   -4.466  1.00 25.87  ? 2087 HOH A O   1 
HETATM 3003 O O   . HOH Q 6 .   ? 25.536  1.057   -0.663  1.00 40.70  ? 2088 HOH A O   1 
HETATM 3004 O O   . HOH Q 6 .   ? 31.568  8.027   -6.519  1.00 25.46  ? 2089 HOH A O   1 
HETATM 3005 O O   . HOH Q 6 .   ? 32.068  7.560   -9.549  1.00 55.57  ? 2090 HOH A O   1 
HETATM 3006 O O   . HOH Q 6 .   ? 31.354  5.422   -10.681 1.00 48.01  ? 2091 HOH A O   1 
HETATM 3007 O O   . HOH Q 6 .   ? 28.286  8.289   -12.778 1.00 47.20  ? 2092 HOH A O   1 
HETATM 3008 O O   . HOH Q 6 .   ? 26.934  10.603  -13.010 1.00 51.38  ? 2093 HOH A O   1 
HETATM 3009 O O   . HOH Q 6 .   ? 23.436  12.260  -11.902 1.00 60.22  ? 2094 HOH A O   1 
HETATM 3010 O O   . HOH Q 6 .   ? 28.213  17.649  -5.844  1.00 41.23  ? 2095 HOH A O   1 
HETATM 3011 O O   . HOH Q 6 .   ? 34.138  12.025  -12.098 1.00 52.23  ? 2096 HOH A O   1 
HETATM 3012 O O   . HOH Q 6 .   ? 27.031  19.978  -7.961  1.00 40.14  ? 2097 HOH A O   1 
HETATM 3013 O O   . HOH Q 6 .   ? 29.143  16.646  -12.600 1.00 35.07  ? 2098 HOH A O   1 
HETATM 3014 O O   . HOH Q 6 .   ? 24.646  17.772  -11.877 1.00 34.14  ? 2099 HOH A O   1 
HETATM 3015 O O   . HOH Q 6 .   ? 23.179  15.175  -10.623 1.00 25.09  ? 2100 HOH A O   1 
HETATM 3016 O O   . HOH Q 6 .   ? 25.557  21.835  -11.333 1.00 38.57  ? 2101 HOH A O   1 
HETATM 3017 O O   . HOH Q 6 .   ? 30.071  15.999  3.940   1.00 30.50  ? 2102 HOH A O   1 
HETATM 3018 O O   . HOH Q 6 .   ? 19.635  20.001  5.364   1.00 32.14  ? 2103 HOH A O   1 
HETATM 3019 O O   . HOH Q 6 .   ? 23.997  20.107  2.191   1.00 56.98  ? 2104 HOH A O   1 
HETATM 3020 O O   . HOH Q 6 .   ? 20.695  22.877  11.081  1.00 50.08  ? 2105 HOH A O   1 
HETATM 3021 O O   . HOH Q 6 .   ? 16.684  18.531  10.948  1.00 42.72  ? 2106 HOH A O   1 
HETATM 3022 O O   . HOH Q 6 .   ? 23.833  19.165  13.607  1.00 30.53  ? 2107 HOH A O   1 
HETATM 3023 O O   . HOH Q 6 .   ? 10.163  17.528  13.029  1.00 50.14  ? 2108 HOH A O   1 
HETATM 3024 O O   . HOH Q 6 .   ? 15.858  18.483  14.617  1.00 53.66  ? 2109 HOH A O   1 
HETATM 3025 O O   . HOH Q 6 .   ? 19.897  7.879   17.927  1.00 33.00  ? 2110 HOH A O   1 
HETATM 3026 O O   . HOH Q 6 .   ? 12.193  12.052  21.111  1.00 39.98  ? 2111 HOH A O   1 
HETATM 3027 O O   . HOH Q 6 .   ? 17.665  14.614  21.650  1.00 39.70  ? 2112 HOH A O   1 
HETATM 3028 O O   . HOH Q 6 .   ? 18.216  6.587   19.865  1.00 32.22  ? 2113 HOH A O   1 
HETATM 3029 O O   . HOH Q 6 .   ? 17.835  0.379   21.353  1.00 37.75  ? 2114 HOH A O   1 
HETATM 3030 O O   . HOH Q 6 .   ? 13.928  -0.616  30.249  1.00 49.04  ? 2115 HOH A O   1 
HETATM 3031 O O   . HOH Q 6 .   ? 13.859  4.090   27.614  1.00 48.49  ? 2116 HOH A O   1 
HETATM 3032 O O   . HOH Q 6 .   ? 14.977  -4.395  18.406  1.00 43.38  ? 2117 HOH A O   1 
HETATM 3033 O O   . HOH Q 6 .   ? 5.151   -10.018 17.788  1.00 52.42  ? 2118 HOH A O   1 
HETATM 3034 O O   . HOH Q 6 .   ? 29.713  -0.949  -4.592  1.00 49.93  ? 2119 HOH A O   1 
HETATM 3035 O O   . HOH Q 6 .   ? 24.586  -5.772  6.897   1.00 60.27  ? 2120 HOH A O   1 
HETATM 3036 O O   . HOH Q 6 .   ? 16.662  15.646  -13.849 1.00 53.09  ? 2121 HOH A O   1 
HETATM 3037 O O   . HOH Q 6 .   ? 9.148   17.028  -9.548  1.00 46.60  ? 2122 HOH A O   1 
HETATM 3038 O O   . HOH Q 6 .   ? 11.224  -7.377  -0.296  1.00 50.72  ? 2123 HOH A O   1 
HETATM 3039 O O   . HOH R 6 .   ? 46.630  -3.424  2.658   1.00 44.65  ? 2001 HOH B O   1 
HETATM 3040 O O   . HOH R 6 .   ? 26.501  7.812   27.779  1.00 45.47  ? 2002 HOH B O   1 
HETATM 3041 O O   . HOH R 6 .   ? 21.719  9.265   29.111  1.00 50.74  ? 2003 HOH B O   1 
HETATM 3042 O O   . HOH R 6 .   ? 18.225  13.680  30.379  1.00 51.73  ? 2004 HOH B O   1 
HETATM 3043 O O   . HOH R 6 .   ? 22.262  16.127  18.742  1.00 34.86  ? 2005 HOH B O   1 
HETATM 3044 O O   . HOH R 6 .   ? 31.378  14.204  25.938  1.00 40.28  ? 2006 HOH B O   1 
HETATM 3045 O O   . HOH R 6 .   ? 33.447  12.519  25.766  1.00 40.81  ? 2007 HOH B O   1 
HETATM 3046 O O   . HOH R 6 .   ? 37.253  4.912   27.431  1.00 66.74  ? 2008 HOH B O   1 
HETATM 3047 O O   . HOH R 6 .   ? 31.439  -0.024  22.281  1.00 46.94  ? 2009 HOH B O   1 
HETATM 3048 O O   . HOH R 6 .   ? 34.396  -3.321  16.617  1.00 45.56  ? 2010 HOH B O   1 
HETATM 3049 O O   . HOH R 6 .   ? 39.724  -5.589  17.448  1.00 56.16  ? 2011 HOH B O   1 
HETATM 3050 O O   . HOH R 6 .   ? 36.868  -6.359  13.722  1.00 24.13  ? 2012 HOH B O   1 
HETATM 3051 O O   . HOH R 6 .   ? 43.036  -4.957  10.465  1.00 47.94  ? 2013 HOH B O   1 
HETATM 3052 O O   . HOH R 6 .   ? 46.248  3.462   10.277  1.00 36.67  ? 2014 HOH B O   1 
HETATM 3053 O O   . HOH R 6 .   ? 41.454  8.594   6.651   1.00 24.34  ? 2015 HOH B O   1 
HETATM 3054 O O   . HOH R 6 .   ? 45.016  7.414   6.547   1.00 34.95  ? 2016 HOH B O   1 
HETATM 3055 O O   . HOH R 6 .   ? 44.976  8.927   14.993  1.00 40.54  ? 2017 HOH B O   1 
HETATM 3056 O O   . HOH R 6 .   ? 47.684  11.224  8.139   1.00 36.74  ? 2018 HOH B O   1 
HETATM 3057 O O   . HOH R 6 .   ? 41.282  12.942  5.680   1.00 26.10  ? 2019 HOH B O   1 
HETATM 3058 O O   . HOH R 6 .   ? 43.152  14.556  4.526   1.00 30.16  ? 2020 HOH B O   1 
HETATM 3059 O O   . HOH R 6 .   ? 46.725  14.745  2.468   1.00 34.02  ? 2021 HOH B O   1 
HETATM 3060 O O   . HOH R 6 .   ? 46.440  7.711   4.346   1.00 40.37  ? 2022 HOH B O   1 
HETATM 3061 O O   . HOH R 6 .   ? 35.832  -5.447  16.050  1.00 43.06  ? 2023 HOH B O   1 
HETATM 3062 O O   . HOH R 6 .   ? 38.465  -8.248  14.599  1.00 46.78  ? 2024 HOH B O   1 
HETATM 3063 O O   . HOH R 6 .   ? 48.666  4.030   -3.431  1.00 60.43  ? 2025 HOH B O   1 
HETATM 3064 O O   . HOH R 6 .   ? 45.349  16.635  -3.398  1.00 29.70  ? 2026 HOH B O   1 
HETATM 3065 O O   . HOH R 6 .   ? 43.630  16.741  5.937   1.00 36.11  ? 2027 HOH B O   1 
HETATM 3066 O O   . HOH R 6 .   ? 38.086  9.704   1.634   1.00 23.68  ? 2028 HOH B O   1 
HETATM 3067 O O   . HOH R 6 .   ? 38.701  12.482  4.357   1.00 22.88  ? 2029 HOH B O   1 
HETATM 3068 O O   . HOH R 6 .   ? 43.756  19.146  4.192   1.00 54.17  ? 2030 HOH B O   1 
HETATM 3069 O O   . HOH R 6 .   ? 40.554  19.281  1.120   1.00 26.91  ? 2031 HOH B O   1 
HETATM 3070 O O   . HOH R 6 .   ? 47.466  17.667  -2.256  1.00 41.49  ? 2032 HOH B O   1 
HETATM 3071 O O   . HOH R 6 .   ? 48.460  19.186  -7.373  1.00 50.76  ? 2033 HOH B O   1 
HETATM 3072 O O   . HOH R 6 .   ? 34.020  17.472  -5.330  1.00 38.60  ? 2034 HOH B O   1 
HETATM 3073 O O   . HOH R 6 .   ? 33.931  17.691  -1.158  1.00 36.78  ? 2035 HOH B O   1 
HETATM 3074 O O   . HOH R 6 .   ? 34.216  16.778  1.395   1.00 29.33  ? 2036 HOH B O   1 
HETATM 3075 O O   . HOH R 6 .   ? 38.893  22.088  3.827   1.00 33.21  ? 2037 HOH B O   1 
HETATM 3076 O O   . HOH R 6 .   ? 40.669  24.006  -5.522  1.00 40.27  ? 2038 HOH B O   1 
HETATM 3077 O O   . HOH R 6 .   ? 40.421  23.984  -1.978  1.00 33.56  ? 2039 HOH B O   1 
HETATM 3078 O O   . HOH R 6 .   ? 42.090  16.737  8.099   1.00 33.87  ? 2040 HOH B O   1 
HETATM 3079 O O   . HOH R 6 .   ? 31.123  17.536  8.605   1.00 28.63  ? 2041 HOH B O   1 
HETATM 3080 O O   . HOH R 6 .   ? 32.104  20.590  3.019   1.00 43.28  ? 2042 HOH B O   1 
HETATM 3081 O O   . HOH R 6 .   ? 28.966  19.523  5.652   1.00 48.44  ? 2043 HOH B O   1 
HETATM 3082 O O   . HOH R 6 .   ? 37.769  19.081  7.157   1.00 37.97  ? 2044 HOH B O   1 
HETATM 3083 O O   . HOH R 6 .   ? 40.767  14.249  7.984   1.00 29.60  ? 2045 HOH B O   1 
HETATM 3084 O O   . HOH R 6 .   ? 38.919  9.379   6.197   1.00 28.16  ? 2046 HOH B O   1 
HETATM 3085 O O   . HOH R 6 .   ? 42.969  11.153  18.119  1.00 52.11  ? 2047 HOH B O   1 
HETATM 3086 O O   . HOH R 6 .   ? 44.052  13.922  13.671  1.00 56.75  ? 2048 HOH B O   1 
HETATM 3087 O O   . HOH R 6 .   ? 43.923  8.230   19.530  1.00 54.81  ? 2049 HOH B O   1 
HETATM 3088 O O   . HOH R 6 .   ? 30.055  15.961  0.002   1.00 61.48  ? 2050 HOH B O   1 
HETATM 3089 O O   . HOH R 6 .   ? 32.312  17.446  22.218  1.00 34.43  ? 2051 HOH B O   1 
HETATM 3090 O O   . HOH R 6 .   ? 33.496  21.844  12.666  1.00 34.06  ? 2052 HOH B O   1 
HETATM 3091 O O   . HOH R 6 .   ? 37.748  22.656  14.314  1.00 46.94  ? 2053 HOH B O   1 
HETATM 3092 O O   . HOH R 6 .   ? 32.839  0.647   -11.498 1.00 41.36  ? 2054 HOH B O   1 
HETATM 3093 O O   . HOH R 6 .   ? 35.611  3.091   -11.620 1.00 59.28  ? 2055 HOH B O   1 
HETATM 3094 O O   . HOH R 6 .   ? 41.143  8.077   24.983  1.00 46.67  ? 2056 HOH B O   1 
HETATM 3095 O O   . HOH R 6 .   ? 28.779  -4.225  1.975   1.00 47.88  ? 2057 HOH B O   1 
HETATM 3096 O O   . HOH R 6 .   ? 39.387  20.584  18.822  1.00 46.31  ? 2058 HOH B O   1 
HETATM 3097 O O   . HOH R 6 .   ? 30.776  19.465  12.685  1.00 42.88  ? 2059 HOH B O   1 
HETATM 3098 O O   . HOH R 6 .   ? 28.864  18.930  8.260   1.00 52.92  ? 2060 HOH B O   1 
HETATM 3099 O O   . HOH R 6 .   ? 27.371  7.778   7.354   1.00 42.35  ? 2061 HOH B O   1 
HETATM 3100 O O   . HOH R 6 .   ? 25.337  8.469   8.214   1.00 44.01  ? 2062 HOH B O   1 
HETATM 3101 O O   . HOH R 6 .   ? 37.208  9.470   4.169   1.00 28.74  ? 2063 HOH B O   1 
HETATM 3102 O O   . HOH R 6 .   ? 27.699  8.283   3.478   1.00 26.84  ? 2064 HOH B O   1 
HETATM 3103 O O   . HOH R 6 .   ? 31.302  14.569  2.002   1.00 42.52  ? 2065 HOH B O   1 
HETATM 3104 O O   . HOH R 6 .   ? 32.799  4.842   -4.922  1.00 24.37  ? 2066 HOH B O   1 
HETATM 3105 O O   . HOH R 6 .   ? 34.248  7.793   -7.760  1.00 62.21  ? 2067 HOH B O   1 
HETATM 3106 O O   . HOH R 6 .   ? 35.509  10.069  -8.350  1.00 52.06  ? 2068 HOH B O   1 
HETATM 3107 O O   . HOH R 6 .   ? 39.637  7.244   -7.649  1.00 52.41  ? 2069 HOH B O   1 
HETATM 3108 O O   . HOH R 6 .   ? 33.696  -1.974  -3.360  1.00 30.71  ? 2070 HOH B O   1 
HETATM 3109 O O   . HOH R 6 .   ? 34.922  0.740   -10.192 1.00 39.99  ? 2071 HOH B O   1 
HETATM 3110 O O   . HOH R 6 .   ? 36.317  -4.465  -3.504  1.00 36.23  ? 2072 HOH B O   1 
HETATM 3111 O O   . HOH R 6 .   ? 38.715  -1.019  -7.986  1.00 41.58  ? 2073 HOH B O   1 
HETATM 3112 O O   . HOH R 6 .   ? 40.623  4.953   -6.178  1.00 55.53  ? 2074 HOH B O   1 
HETATM 3113 O O   . HOH R 6 .   ? 40.845  -2.255  -3.946  1.00 33.15  ? 2075 HOH B O   1 
HETATM 3114 O O   . HOH R 6 .   ? 40.757  0.403   -1.814  1.00 23.30  ? 2076 HOH B O   1 
HETATM 3115 O O   . HOH R 6 .   ? 39.816  -6.514  -4.186  1.00 22.16  ? 2077 HOH B O   1 
HETATM 3116 O O   . HOH R 6 .   ? 43.028  -4.995  -2.649  1.00 43.56  ? 2078 HOH B O   1 
HETATM 3117 O O   . HOH R 6 .   ? 31.086  -2.476  -2.324  1.00 41.46  ? 2079 HOH B O   1 
HETATM 3118 O O   . HOH R 6 .   ? 25.616  0.779   2.011   1.00 42.18  ? 2080 HOH B O   1 
HETATM 3119 O O   . HOH R 6 .   ? 28.954  -4.066  9.224   1.00 40.69  ? 2081 HOH B O   1 
HETATM 3120 O O   . HOH R 6 .   ? 28.923  -4.129  4.465   1.00 46.92  ? 2082 HOH B O   1 
HETATM 3121 O O   . HOH R 6 .   ? 22.259  -0.747  18.978  1.00 41.57  ? 2083 HOH B O   1 
HETATM 3122 O O   . HOH R 6 .   ? 25.862  -4.295  10.809  1.00 52.55  ? 2084 HOH B O   1 
HETATM 3123 O O   . HOH R 6 .   ? 26.333  -3.129  16.081  1.00 45.87  ? 2085 HOH B O   1 
HETATM 3124 O O   . HOH R 6 .   ? 31.442  -3.451  16.925  1.00 54.48  ? 2086 HOH B O   1 
HETATM 3125 O O   . HOH R 6 .   ? 30.094  -3.964  19.194  1.00 68.94  ? 2087 HOH B O   1 
HETATM 3126 O O   . HOH R 6 .   ? 46.836  -0.053  1.509   1.00 33.13  ? 2088 HOH B O   1 
HETATM 3127 O O   . HOH R 6 .   ? 43.588  4.615   -3.954  1.00 60.08  ? 2089 HOH B O   1 
HETATM 3128 O O   . HOH R 6 .   ? 39.774  23.620  12.852  1.00 55.12  ? 2090 HOH B O   1 
HETATM 3129 O O   . HOH S 6 .   ? -8.103  36.380  24.443  1.00 37.18  ? 2001 HOH C O   1 
HETATM 3130 O O   . HOH S 6 .   ? -7.733  38.801  26.772  1.00 42.08  ? 2002 HOH C O   1 
HETATM 3131 O O   . HOH S 6 .   ? -9.280  36.836  32.155  1.00 41.96  ? 2003 HOH C O   1 
HETATM 3132 O O   . HOH S 6 .   ? 0.910   38.073  22.599  1.00 46.41  ? 2004 HOH C O   1 
HETATM 3133 O O   . HOH S 6 .   ? 0.105   28.250  13.772  1.00 30.49  ? 2005 HOH C O   1 
HETATM 3134 O O   . HOH S 6 .   ? 4.648   22.557  11.194  1.00 31.45  ? 2006 HOH C O   1 
HETATM 3135 O O   . HOH S 6 .   ? 8.857   16.498  18.120  1.00 35.68  ? 2007 HOH C O   1 
HETATM 3136 O O   . HOH S 6 .   ? 12.399  20.149  27.832  1.00 38.25  ? 2008 HOH C O   1 
HETATM 3137 O O   . HOH S 6 .   ? 13.135  20.173  22.307  1.00 32.58  ? 2009 HOH C O   1 
HETATM 3138 O O   . HOH S 6 .   ? 4.385   14.239  14.628  1.00 30.40  ? 2010 HOH C O   1 
HETATM 3139 O O   . HOH S 6 .   ? -0.353  9.926   16.741  1.00 33.67  ? 2011 HOH C O   1 
HETATM 3140 O O   . HOH S 6 .   ? 0.667   8.912   18.966  1.00 58.25  ? 2012 HOH C O   1 
HETATM 3141 O O   . HOH S 6 .   ? -1.931  12.361  19.638  1.00 22.92  ? 2013 HOH C O   1 
HETATM 3142 O O   . HOH S 6 .   ? -1.911  17.629  12.666  1.00 40.20  ? 2014 HOH C O   1 
HETATM 3143 O O   . HOH S 6 .   ? 9.850   16.410  15.447  1.00 49.32  ? 2015 HOH C O   1 
HETATM 3144 O O   . HOH S 6 .   ? -3.830  10.749  13.025  1.00 37.08  ? 2016 HOH C O   1 
HETATM 3145 O O   . HOH S 6 .   ? -8.186  10.121  18.357  1.00 25.51  ? 2017 HOH C O   1 
HETATM 3146 O O   . HOH S 6 .   ? -6.321  12.040  19.689  1.00 26.18  ? 2018 HOH C O   1 
HETATM 3147 O O   . HOH S 6 .   ? -8.515  6.814   16.234  1.00 28.68  ? 2019 HOH C O   1 
HETATM 3148 O O   . HOH S 6 .   ? 2.539   27.160  16.194  1.00 41.67  ? 2020 HOH C O   1 
HETATM 3149 O O   . HOH S 6 .   ? 1.286   -2.543  17.528  1.00 39.32  ? 2021 HOH C O   1 
HETATM 3150 O O   . HOH S 6 .   ? 2.022   6.971   20.037  1.00 42.67  ? 2022 HOH C O   1 
HETATM 3151 O O   . HOH S 6 .   ? 2.914   16.989  12.153  1.00 40.48  ? 2023 HOH C O   1 
HETATM 3152 O O   . HOH S 6 .   ? -0.731  20.061  11.862  1.00 48.78  ? 2024 HOH C O   1 
HETATM 3153 O O   . HOH S 6 .   ? -6.188  11.836  22.614  1.00 23.65  ? 2025 HOH C O   1 
HETATM 3154 O O   . HOH S 6 .   ? -3.702  9.644   24.727  1.00 26.86  ? 2026 HOH C O   1 
HETATM 3155 O O   . HOH S 6 .   ? -15.734 7.332   22.355  1.00 45.21  ? 2027 HOH C O   1 
HETATM 3156 O O   . HOH S 6 .   ? -13.108 8.526   21.854  1.00 26.17  ? 2028 HOH C O   1 
HETATM 3157 O O   . HOH S 6 .   ? -15.399 1.551   30.768  1.00 67.51  ? 2029 HOH C O   1 
HETATM 3158 O O   . HOH S 6 .   ? -11.987 10.059  29.100  1.00 32.48  ? 2030 HOH C O   1 
HETATM 3159 O O   . HOH S 6 .   ? -11.103 12.102  27.408  1.00 22.72  ? 2031 HOH C O   1 
HETATM 3160 O O   . HOH S 6 .   ? -10.654 16.388  18.381  1.00 42.57  ? 2032 HOH C O   1 
HETATM 3161 O O   . HOH S 6 .   ? -7.468  14.262  18.885  1.00 25.54  ? 2033 HOH C O   1 
HETATM 3162 O O   . HOH S 6 .   ? -2.987  13.196  21.792  1.00 24.36  ? 2034 HOH C O   1 
HETATM 3163 O O   . HOH S 6 .   ? -4.903  17.530  13.452  1.00 54.23  ? 2035 HOH C O   1 
HETATM 3164 O O   . HOH S 6 .   ? -2.397  22.047  12.400  1.00 42.88  ? 2036 HOH C O   1 
HETATM 3165 O O   . HOH S 6 .   ? -11.656 21.497  15.511  1.00 32.93  ? 2037 HOH C O   1 
HETATM 3166 O O   . HOH S 6 .   ? -8.847  30.565  18.789  1.00 29.63  ? 2038 HOH C O   1 
HETATM 3167 O O   . HOH S 6 .   ? -14.445 22.493  21.955  1.00 44.47  ? 2039 HOH C O   1 
HETATM 3168 O O   . HOH S 6 .   ? -14.442 21.183  16.300  1.00 44.17  ? 2040 HOH C O   1 
HETATM 3169 O O   . HOH S 6 .   ? -5.488  33.480  14.183  1.00 39.24  ? 2041 HOH C O   1 
HETATM 3170 O O   . HOH S 6 .   ? -6.163  32.772  18.190  1.00 43.75  ? 2042 HOH C O   1 
HETATM 3171 O O   . HOH S 6 .   ? -3.137  30.261  9.519   1.00 43.07  ? 2043 HOH C O   1 
HETATM 3172 O O   . HOH S 6 .   ? -9.820  24.286  8.630   1.00 44.41  ? 2044 HOH C O   1 
HETATM 3173 O O   . HOH S 6 .   ? -10.437 32.489  29.983  1.00 38.39  ? 2045 HOH C O   1 
HETATM 3174 O O   . HOH S 6 .   ? -15.824 29.927  27.798  1.00 54.69  ? 2046 HOH C O   1 
HETATM 3175 O O   . HOH S 6 .   ? -11.100 19.373  26.156  1.00 33.79  ? 2047 HOH C O   1 
HETATM 3176 O O   . HOH S 6 .   ? -9.652  19.536  30.537  1.00 24.71  ? 2048 HOH C O   1 
HETATM 3177 O O   . HOH S 6 .   ? -3.392  16.661  32.645  1.00 41.80  ? 2049 HOH C O   1 
HETATM 3178 O O   . HOH S 6 .   ? -3.039  21.230  32.586  1.00 50.64  ? 2050 HOH C O   1 
HETATM 3179 O O   . HOH S 6 .   ? -3.247  12.356  24.275  1.00 29.27  ? 2051 HOH C O   1 
HETATM 3180 O O   . HOH S 6 .   ? -2.924  5.212   33.950  0.50 25.31  ? 2052 HOH C O   1 
HETATM 3181 O O   . HOH S 6 .   ? 0.143   6.117   33.046  1.00 35.72  ? 2053 HOH C O   1 
HETATM 3182 O O   . HOH S 6 .   ? -3.920  2.154   32.150  1.00 40.22  ? 2054 HOH C O   1 
HETATM 3183 O O   . HOH S 6 .   ? -5.310  1.356   29.275  1.00 43.92  ? 2055 HOH C O   1 
HETATM 3184 O O   . HOH S 6 .   ? 4.029   -4.180  31.182  1.00 43.93  ? 2056 HOH C O   1 
HETATM 3185 O O   . HOH S 6 .   ? 6.398   0.747   29.902  1.00 48.31  ? 2057 HOH C O   1 
HETATM 3186 O O   . HOH S 6 .   ? 2.895   -0.708  26.647  1.00 50.96  ? 2058 HOH C O   1 
HETATM 3187 O O   . HOH S 6 .   ? 5.310   4.934   25.103  1.00 38.40  ? 2059 HOH C O   1 
HETATM 3188 O O   . HOH S 6 .   ? 7.933   2.757   26.384  1.00 45.07  ? 2060 HOH C O   1 
HETATM 3189 O O   . HOH S 6 .   ? 3.837   17.136  34.153  1.00 40.81  ? 2061 HOH C O   1 
HETATM 3190 O O   . HOH S 6 .   ? 9.085   23.792  33.024  1.00 53.45  ? 2062 HOH C O   1 
HETATM 3191 O O   . HOH S 6 .   ? 7.598   26.572  38.439  1.00 32.06  ? 2063 HOH C O   1 
HETATM 3192 O O   . HOH S 6 .   ? 11.417  28.371  33.838  1.00 53.05  ? 2064 HOH C O   1 
HETATM 3193 O O   . HOH S 6 .   ? 10.469  28.583  25.448  1.00 52.42  ? 2065 HOH C O   1 
HETATM 3194 O O   . HOH S 6 .   ? -2.521  34.288  34.022  0.50 43.74  ? 2066 HOH C O   1 
HETATM 3195 O O   . HOH S 6 .   ? -14.953 26.042  11.670  1.00 40.52  ? 2067 HOH C O   1 
HETATM 3196 O O   . HOH S 6 .   ? -15.415 23.101  14.574  1.00 33.61  ? 2068 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 29  ? 0.7743 0.7250 0.9203 -0.0642 0.3553  0.0848  75  VAL A N   
2    C CA  . VAL A 29  ? 0.7580 0.7267 0.8919 -0.0479 0.3484  0.0771  75  VAL A CA  
3    C C   . VAL A 29  ? 0.7842 0.7233 0.8532 -0.0315 0.3563  0.0870  75  VAL A C   
4    O O   . VAL A 29  ? 0.8281 0.7467 0.8741 -0.0325 0.3828  0.1001  75  VAL A O   
5    C CB  . VAL A 29  ? 0.7594 0.7629 0.9372 -0.0515 0.3674  0.0711  75  VAL A CB  
6    C CG1 . VAL A 29  ? 0.7518 0.7701 0.9154 -0.0335 0.3596  0.0625  75  VAL A CG1 
7    C CG2 . VAL A 29  ? 0.7335 0.7687 0.9778 -0.0672 0.3585  0.0601  75  VAL A CG2 
8    N N   . THR A 30  ? 0.7537 0.6901 0.7935 -0.0167 0.3332  0.0807  76  THR A N   
9    C CA  . THR A 30  ? 0.7738 0.6865 0.7542 0.0005  0.3358  0.0861  76  THR A CA  
10   C C   . THR A 30  ? 0.7483 0.6796 0.7262 0.0136  0.3254  0.0738  76  THR A C   
11   O O   . THR A 30  ? 0.7124 0.6716 0.7307 0.0104  0.3124  0.0620  76  THR A O   
12   C CB  . THR A 30  ? 0.7799 0.6642 0.7191 0.0071  0.3152  0.0907  76  THR A CB  
13   O OG1 . THR A 30  ? 0.7328 0.6317 0.6832 0.0105  0.2849  0.0784  76  THR A OG1 
14   C CG2 . THR A 30  ? 0.7929 0.6583 0.7383 -0.0053 0.3201  0.1007  76  THR A CG2 
15   N N   . ASN A 31  ? 0.7663 0.6796 0.6944 0.0291  0.3304  0.0764  77  ASN A N   
16   C CA  . ASN A 31  ? 0.7468 0.6710 0.6649 0.0430  0.3207  0.0644  77  ASN A CA  
17   C C   . ASN A 31  ? 0.6947 0.6237 0.6159 0.0459  0.2865  0.0540  77  ASN A C   
18   O O   . ASN A 31  ? 0.6685 0.6169 0.6110 0.0494  0.2757  0.0422  77  ASN A O   
19   C CB  . ASN A 31  ? 0.7991 0.6985 0.6574 0.0593  0.3323  0.0691  77  ASN A CB  
20   C CG  . ASN A 31  ? 0.8308 0.6975 0.6391 0.0653  0.3203  0.0775  77  ASN A CG  
21   O OD1 . ASN A 31  ? 0.8217 0.6794 0.6377 0.0556  0.3154  0.0851  77  ASN A OD1 
22   N ND2 . ASN A 31  ? 0.8790 0.7276 0.6358 0.0822  0.3146  0.0752  77  ASN A ND2 
23   N N   . GLN A 32  ? 0.6715 0.5821 0.5715 0.0450  0.2705  0.0587  78  GLN A N   
24   C CA  . GLN A 32  ? 0.6311 0.5458 0.5347 0.0464  0.2402  0.0504  78  GLN A CA  
25   C C   . GLN A 32  ? 0.5679 0.5076 0.5241 0.0341  0.2306  0.0442  78  GLN A C   
26   O O   . GLN A 32  ? 0.5425 0.4959 0.5133 0.0364  0.2131  0.0343  78  GLN A O   
27   C CB  . GLN A 32  ? 0.6428 0.5344 0.5151 0.0484  0.2280  0.0574  78  GLN A CB  
28   C CG  . GLN A 32  ? 0.7026 0.5689 0.5186 0.0632  0.2301  0.0617  78  GLN A CG  
29   C CD  . GLN A 32  ? 0.7391 0.5861 0.5282 0.0669  0.2141  0.0671  78  GLN A CD  
30   O OE1 . GLN A 32  ? 0.7516 0.5944 0.5547 0.0582  0.2145  0.0738  78  GLN A OE1 
31   N NE2 . GLN A 32  ? 0.7564 0.5921 0.5080 0.0803  0.1993  0.0630  78  GLN A NE2 
32   N N   . LEU A 33  ? 0.5528 0.4966 0.5357 0.0214  0.2417  0.0500  79  LEU A N   
33   C CA  . LEU A 33  ? 0.5132 0.4804 0.5456 0.0098  0.2331  0.0436  79  LEU A CA  
34   C C   . LEU A 33  ? 0.5019 0.4966 0.5670 0.0117  0.2361  0.0340  79  LEU A C   
35   O O   . LEU A 33  ? 0.4574 0.4697 0.5491 0.0103  0.2186  0.0254  79  LEU A O   
36   C CB  . LEU A 33  ? 0.5208 0.4853 0.5753 -0.0045 0.2466  0.0507  79  LEU A CB  
37   C CG  . LEU A 33  ? 0.5288 0.4696 0.5624 -0.0074 0.2368  0.0574  79  LEU A CG  
38   C CD1 . LEU A 33  ? 0.5521 0.4811 0.5978 -0.0202 0.2549  0.0663  79  LEU A CD1 
39   C CD2 . LEU A 33  ? 0.4900 0.4419 0.5410 -0.0096 0.2106  0.0487  79  LEU A CD2 
40   N N   . GLN A 34  ? 0.5257 0.5234 0.5873 0.0160  0.2589  0.0360  80  GLN A N   
41   C CA  . GLN A 34  ? 0.5298 0.5522 0.6181 0.0213  0.2630  0.0266  80  GLN A CA  
42   C C   . GLN A 34  ? 0.5063 0.5272 0.5777 0.0338  0.2419  0.0176  80  GLN A C   
43   O O   . GLN A 34  ? 0.4921 0.5331 0.5935 0.0354  0.2308  0.0085  80  GLN A O   
44   C CB  . GLN A 34  ? 0.5761 0.5986 0.6552 0.0262  0.2930  0.0307  80  GLN A CB  
45   C CG  . GLN A 34  ? 0.6252 0.6635 0.7442 0.0124  0.3160  0.0356  80  GLN A CG  
46   C CD  . GLN A 34  ? 0.6383 0.7139 0.8177 0.0069  0.3097  0.0245  80  GLN A CD  
47   O OE1 . GLN A 34  ? 0.6575 0.7529 0.8529 0.0160  0.3154  0.0168  80  GLN A OE1 
48   N NE2 . GLN A 34  ? 0.6338 0.7184 0.8459 -0.0066 0.2968  0.0230  80  GLN A NE2 
49   N N   . TYR A 35  ? 0.5129 0.5091 0.5367 0.0427  0.2359  0.0200  81  TYR A N   
50   C CA  . TYR A 35  ? 0.4998 0.4908 0.5062 0.0527  0.2155  0.0115  81  TYR A CA  
51   C C   . TYR A 35  ? 0.4707 0.4694 0.4987 0.0459  0.1913  0.0080  81  TYR A C   
52   O O   . TYR A 35  ? 0.4485 0.4569 0.4909 0.0497  0.1783  -0.0001 81  TYR A O   
53   C CB  . TYR A 35  ? 0.5242 0.4879 0.4777 0.0616  0.2119  0.0144  81  TYR A CB  
54   C CG  . TYR A 35  ? 0.5092 0.4660 0.4454 0.0703  0.1908  0.0050  81  TYR A CG  
55   C CD1 . TYR A 35  ? 0.5366 0.4923 0.4619 0.0818  0.1943  -0.0036 81  TYR A CD1 
56   C CD2 . TYR A 35  ? 0.4906 0.4416 0.4224 0.0667  0.1681  0.0041  81  TYR A CD2 
57   C CE1 . TYR A 35  ? 0.5350 0.4816 0.4453 0.0886  0.1750  -0.0128 81  TYR A CE1 
58   C CE2 . TYR A 35  ? 0.4853 0.4298 0.4043 0.0727  0.1499  -0.0044 81  TYR A CE2 
59   C CZ  . TYR A 35  ? 0.5231 0.4643 0.4314 0.0831  0.1529  -0.0129 81  TYR A CZ  
60   O OH  . TYR A 35  ? 0.5321 0.4643 0.4288 0.0879  0.1349  -0.0220 81  TYR A OH  
61   N N   . LEU A 36  ? 0.4729 0.4656 0.5016 0.0366  0.1863  0.0145  82  LEU A N   
62   C CA  . LEU A 36  ? 0.4508 0.4496 0.4964 0.0306  0.1653  0.0117  82  LEU A CA  
63   C C   . LEU A 36  ? 0.4390 0.4626 0.5287 0.0260  0.1624  0.0057  82  LEU A C   
64   O O   . LEU A 36  ? 0.4208 0.4507 0.5208 0.0267  0.1446  0.0007  82  LEU A O   
65   C CB  . LEU A 36  ? 0.4528 0.4405 0.4913 0.0227  0.1629  0.0192  82  LEU A CB  
66   C CG  . LEU A 36  ? 0.4688 0.4334 0.4648 0.0289  0.1583  0.0240  82  LEU A CG  
67   C CD1 . LEU A 36  ? 0.4756 0.4282 0.4659 0.0226  0.1600  0.0322  82  LEU A CD1 
68   C CD2 . LEU A 36  ? 0.4689 0.4322 0.4544 0.0339  0.1369  0.0180  82  LEU A CD2 
69   N N   . HIS A 37  ? 0.4528 0.4907 0.5685 0.0217  0.1800  0.0063  83  HIS A N   
70   C CA  . HIS A 37  ? 0.4453 0.5098 0.6060 0.0181  0.1770  -0.0004 83  HIS A CA  
71   C C   . HIS A 37  ? 0.4352 0.5109 0.6028 0.0301  0.1749  -0.0083 83  HIS A C   
72   O O   . HIS A 37  ? 0.4117 0.4970 0.5949 0.0331  0.1578  -0.0143 83  HIS A O   
73   C CB  . HIS A 37  ? 0.4623 0.5407 0.6536 0.0082  0.1970  0.0021  83  HIS A CB  
74   C CG  . HIS A 37  ? 0.4757 0.5819 0.7164 0.0016  0.1896  -0.0053 83  HIS A CG  
75   N ND1 . HIS A 37  ? 0.4986 0.6211 0.7761 -0.0100 0.2039  -0.0052 83  HIS A ND1 
76   C CD2 . HIS A 37  ? 0.4730 0.5930 0.7319 0.0052  0.1687  -0.0132 83  HIS A CD2 
77   C CE1 . HIS A 37  ? 0.4975 0.6447 0.8151 -0.0129 0.1904  -0.0142 83  HIS A CE1 
78   N NE2 . HIS A 37  ? 0.4759 0.6211 0.7809 -0.0030 0.1689  -0.0187 83  HIS A NE2 
79   N N   . LYS A 38  ? 0.4579 0.5304 0.6117 0.0380  0.1926  -0.0081 84  LYS A N   
80   C CA  . LYS A 38  ? 0.4574 0.5402 0.6190 0.0506  0.1936  -0.0163 84  LYS A CA  
81   C C   . LYS A 38  ? 0.4449 0.5097 0.5767 0.0610  0.1761  -0.0207 84  LYS A C   
82   O O   . LYS A 38  ? 0.4414 0.5136 0.5851 0.0701  0.1693  -0.0282 84  LYS A O   
83   C CB  . LYS A 38  ? 0.4938 0.5791 0.6496 0.0564  0.2205  -0.0154 84  LYS A CB  
84   C CG  . LYS A 38  ? 0.5186 0.6280 0.7149 0.0470  0.2406  -0.0132 84  LYS A CG  
85   C CD  . LYS A 38  ? 0.5740 0.6949 0.7757 0.0564  0.2655  -0.0158 84  LYS A CD  
86   C CE  . LYS A 38  ? 0.6062 0.7484 0.8450 0.0449  0.2905  -0.0115 84  LYS A CE  
87   N NZ  . LYS A 38  ? 0.5890 0.7542 0.8774 0.0311  0.2786  -0.0141 84  LYS A NZ  
88   N N   . VAL A 39  ? 0.4473 0.4883 0.5420 0.0597  0.1686  -0.0164 85  VAL A N   
89   C CA  . VAL A 39  ? 0.4414 0.4646 0.5088 0.0678  0.1529  -0.0210 85  VAL A CA  
90   C C   . VAL A 39  ? 0.4212 0.4390 0.4888 0.0610  0.1311  -0.0195 85  VAL A C   
91   O O   . VAL A 39  ? 0.4153 0.4328 0.4895 0.0645  0.1170  -0.0241 85  VAL A O   
92   C CB  . VAL A 39  ? 0.4648 0.4658 0.4884 0.0740  0.1599  -0.0198 85  VAL A CB  
93   C CG1 . VAL A 39  ? 0.4720 0.4553 0.4713 0.0804  0.1420  -0.0261 85  VAL A CG1 
94   C CG2 . VAL A 39  ? 0.4916 0.4967 0.5111 0.0828  0.1831  -0.0217 85  VAL A CG2 
95   N N   . VAL A 40  ? 0.4042 0.4168 0.4638 0.0521  0.1295  -0.0126 86  VAL A N   
96   C CA  . VAL A 40  ? 0.3904 0.3977 0.4473 0.0464  0.1110  -0.0109 86  VAL A CA  
97   C C   . VAL A 40  ? 0.3760 0.3998 0.4651 0.0413  0.1027  -0.0119 86  VAL A C   
98   O O   . VAL A 40  ? 0.3754 0.3981 0.4674 0.0433  0.0885  -0.0145 86  VAL A O   
99   C CB  . VAL A 40  ? 0.3827 0.3791 0.4205 0.0406  0.1115  -0.0040 86  VAL A CB  
100  C CG1 . VAL A 40  ? 0.3617 0.3556 0.3991 0.0355  0.0938  -0.0030 86  VAL A CG1 
101  C CG2 . VAL A 40  ? 0.4130 0.3922 0.4152 0.0477  0.1168  -0.0035 86  VAL A CG2 
102  N N   . MET A 41  ? 0.3738 0.4119 0.4866 0.0348  0.1112  -0.0101 87  MET A N   
103  C CA  . MET A 41  ? 0.3660 0.4204 0.5087 0.0306  0.1015  -0.0125 87  MET A CA  
104  C C   . MET A 41  ? 0.3764 0.4427 0.5375 0.0393  0.0964  -0.0190 87  MET A C   
105  O O   . MET A 41  ? 0.3697 0.4394 0.5391 0.0406  0.0813  -0.0209 87  MET A O   
106  C CB  . MET A 41  ? 0.3676 0.4353 0.5352 0.0213  0.1111  -0.0112 87  MET A CB  
107  C CG  . MET A 41  ? 0.3742 0.4592 0.5723 0.0175  0.0986  -0.0157 87  MET A CG  
108  S SD  . MET A 41  ? 0.4063 0.4795 0.5866 0.0159  0.0777  -0.0139 87  MET A SD  
109  C CE  . MET A 41  ? 0.4156 0.4782 0.5864 0.0052  0.0852  -0.0084 87  MET A CE  
110  N N   . LYS A 42  ? 0.4020 0.4736 0.5677 0.0464  0.1094  -0.0223 88  LYS A N   
111  C CA  . LYS A 42  ? 0.4190 0.5009 0.6015 0.0570  0.1051  -0.0290 88  LYS A CA  
112  C C   . LYS A 42  ? 0.4138 0.4775 0.5753 0.0634  0.0887  -0.0299 88  LYS A C   
113  O O   . LYS A 42  ? 0.4186 0.4875 0.5935 0.0683  0.0762  -0.0325 88  LYS A O   
114  C CB  . LYS A 42  ? 0.4451 0.5322 0.6297 0.0653  0.1235  -0.0326 88  LYS A CB  
115  C CG  . LYS A 42  ? 0.4906 0.5905 0.6963 0.0781  0.1201  -0.0403 88  LYS A CG  
116  C CD  . LYS A 42  ? 0.5551 0.6541 0.7534 0.0890  0.1376  -0.0447 88  LYS A CD  
117  C CE  . LYS A 42  ? 0.6028 0.6712 0.7563 0.0947  0.1356  -0.0449 88  LYS A CE  
118  N NZ  . LYS A 42  ? 0.6305 0.6808 0.7701 0.0975  0.1138  -0.0462 88  LYS A NZ  
119  N N   . ALA A 43  ? 0.4124 0.4543 0.5412 0.0634  0.0887  -0.0279 89  ALA A N   
120  C CA  . ALA A 43  ? 0.4148 0.4376 0.5243 0.0672  0.0747  -0.0289 89  ALA A CA  
121  C C   . ALA A 43  ? 0.3963 0.4174 0.5081 0.0602  0.0598  -0.0244 89  ALA A C   
122  O O   . ALA A 43  ? 0.4049 0.4195 0.5172 0.0643  0.0484  -0.0249 89  ALA A O   
123  C CB  . ALA A 43  ? 0.4252 0.4279 0.5024 0.0673  0.0773  -0.0289 89  ALA A CB  
124  N N   . LEU A 44  ? 0.3769 0.4022 0.4884 0.0504  0.0607  -0.0196 90  LEU A N   
125  C CA  . LEU A 44  ? 0.3656 0.3890 0.4761 0.0443  0.0484  -0.0156 90  LEU A CA  
126  C C   . LEU A 44  ? 0.3478 0.3861 0.4813 0.0455  0.0410  -0.0167 90  LEU A C   
127  O O   . LEU A 44  ? 0.3391 0.3719 0.4682 0.0464  0.0291  -0.0147 90  LEU A O   
128  C CB  . LEU A 44  ? 0.3673 0.3892 0.4689 0.0352  0.0517  -0.0111 90  LEU A CB  
129  C CG  . LEU A 44  ? 0.4042 0.4114 0.4806 0.0345  0.0548  -0.0096 90  LEU A CG  
130  C CD1 . LEU A 44  ? 0.4200 0.4259 0.4894 0.0272  0.0544  -0.0048 90  LEU A CD1 
131  C CD2 . LEU A 44  ? 0.4191 0.4124 0.4816 0.0373  0.0456  -0.0111 90  LEU A CD2 
132  N N   . TRP A 45  ? 0.3362 0.3932 0.4939 0.0454  0.0481  -0.0200 91  TRP A N   
133  C CA  . TRP A 45  ? 0.3249 0.3995 0.5079 0.0463  0.0398  -0.0231 91  TRP A CA  
134  C C   . TRP A 45  ? 0.3326 0.4065 0.5195 0.0579  0.0284  -0.0256 91  TRP A C   
135  O O   . TRP A 45  ? 0.3293 0.4060 0.5198 0.0598  0.0152  -0.0252 91  TRP A O   
136  C CB  . TRP A 45  ? 0.3245 0.4211 0.5376 0.0436  0.0510  -0.0274 91  TRP A CB  
137  C CG  . TRP A 45  ? 0.3263 0.4434 0.5686 0.0430  0.0411  -0.0323 91  TRP A CG  
138  C CD1 . TRP A 45  ? 0.3325 0.4694 0.6031 0.0513  0.0369  -0.0388 91  TRP A CD1 
139  C CD2 . TRP A 45  ? 0.3302 0.4505 0.5766 0.0344  0.0330  -0.0322 91  TRP A CD2 
140  N NE1 . TRP A 45  ? 0.3293 0.4823 0.6217 0.0481  0.0253  -0.0432 91  TRP A NE1 
141  C CE2 . TRP A 45  ? 0.3343 0.4764 0.6111 0.0376  0.0228  -0.0395 91  TRP A CE2 
142  C CE3 . TRP A 45  ? 0.3347 0.4416 0.5619 0.0254  0.0326  -0.0276 91  TRP A CE3 
143  C CZ2 . TRP A 45  ? 0.3387 0.4881 0.6254 0.0314  0.0118  -0.0429 91  TRP A CZ2 
144  C CZ3 . TRP A 45  ? 0.3400 0.4534 0.5767 0.0198  0.0232  -0.0306 91  TRP A CZ3 
145  C CH2 . TRP A 45  ? 0.3319 0.4657 0.5973 0.0225  0.0127  -0.0385 91  TRP A CH2 
146  N N   . LYS A 46  ? 0.3455 0.4138 0.5293 0.0668  0.0337  -0.0281 92  LYS A N   
147  C CA  . LYS A 46  ? 0.3656 0.4304 0.5526 0.0797  0.0241  -0.0306 92  LYS A CA  
148  C C   . LYS A 46  ? 0.3666 0.4033 0.5247 0.0816  0.0150  -0.0256 92  LYS A C   
149  O O   . LYS A 46  ? 0.3840 0.4116 0.5402 0.0922  0.0068  -0.0262 92  LYS A O   
150  C CB  . LYS A 46  ? 0.3921 0.4641 0.5914 0.0898  0.0347  -0.0370 92  LYS A CB  
151  C CG  . LYS A 46  ? 0.4400 0.4910 0.6135 0.0910  0.0439  -0.0371 92  LYS A CG  
152  C CD  . LYS A 46  ? 0.4826 0.5434 0.6679 0.1009  0.0575  -0.0440 92  LYS A CD  
153  C CE  . LYS A 46  ? 0.5207 0.5577 0.6762 0.1044  0.0641  -0.0458 92  LYS A CE  
154  N NZ  . LYS A 46  ? 0.5700 0.6158 0.7334 0.1152  0.0791  -0.0529 92  LYS A NZ  
155  N N   . HIS A 47  ? 0.3459 0.3687 0.4829 0.0714  0.0166  -0.0207 93  HIS A N   
156  C CA  . HIS A 47  ? 0.3482 0.3459 0.4614 0.0706  0.0102  -0.0162 93  HIS A CA  
157  C C   . HIS A 47  ? 0.3369 0.3292 0.4464 0.0723  -0.0023 -0.0109 93  HIS A C   
158  O O   . HIS A 47  ? 0.3227 0.3289 0.4406 0.0696  -0.0064 -0.0097 93  HIS A O   
159  C CB  . HIS A 47  ? 0.3470 0.3366 0.4436 0.0593  0.0148  -0.0132 93  HIS A CB  
160  C CG  . HIS A 47  ? 0.3654 0.3315 0.4425 0.0574  0.0108  -0.0111 93  HIS A CG  
161  N ND1 . HIS A 47  ? 0.3570 0.3115 0.4252 0.0534  0.0031  -0.0047 93  HIS A ND1 
162  C CD2 . HIS A 47  ? 0.3815 0.3331 0.4467 0.0584  0.0136  -0.0151 93  HIS A CD2 
163  C CE1 . HIS A 47  ? 0.4040 0.3389 0.4592 0.0506  0.0019  -0.0046 93  HIS A CE1 
164  N NE2 . HIS A 47  ? 0.3885 0.3210 0.4416 0.0538  0.0069  -0.0116 93  HIS A NE2 
165  N N   . GLN A 48  ? 0.3488 0.3188 0.4439 0.0770  -0.0081 -0.0077 94  GLN A N   
166  C CA  . GLN A 48  ? 0.3687 0.3291 0.4553 0.0803  -0.0188 -0.0011 94  GLN A CA  
167  C C   . GLN A 48  ? 0.3471 0.3075 0.4225 0.0692  -0.0198 0.0056  94  GLN A C   
168  O O   . GLN A 48  ? 0.3652 0.3242 0.4346 0.0723  -0.0275 0.0103  94  GLN A O   
169  C CB  . GLN A 48  ? 0.4042 0.3355 0.4752 0.0862  -0.0227 0.0024  94  GLN A CB  
170  C CG  . GLN A 48  ? 0.4332 0.3450 0.4890 0.0752  -0.0176 0.0046  94  GLN A CG  
171  C CD  . GLN A 48  ? 0.5180 0.3984 0.5578 0.0772  -0.0222 0.0105  94  GLN A CD  
172  O OE1 . GLN A 48  ? 0.5594 0.4305 0.5917 0.0827  -0.0287 0.0179  94  GLN A OE1 
173  N NE2 . GLN A 48  ? 0.5309 0.3929 0.5640 0.0729  -0.0192 0.0073  94  GLN A NE2 
174  N N   . PHE A 49  ? 0.3306 0.2923 0.4019 0.0580  -0.0123 0.0058  95  PHE A N   
175  C CA  . PHE A 49  ? 0.3201 0.2835 0.3827 0.0484  -0.0118 0.0111  95  PHE A CA  
176  C C   . PHE A 49  ? 0.3038 0.2889 0.3782 0.0445  -0.0093 0.0076  95  PHE A C   
177  O O   . PHE A 49  ? 0.2879 0.2755 0.3559 0.0374  -0.0081 0.0105  95  PHE A O   
178  C CB  . PHE A 49  ? 0.3259 0.2783 0.3783 0.0388  -0.0065 0.0131  95  PHE A CB  
179  C CG  . PHE A 49  ? 0.3520 0.2808 0.3930 0.0385  -0.0087 0.0172  95  PHE A CG  
180  C CD1 . PHE A 49  ? 0.3872 0.3018 0.4217 0.0461  -0.0145 0.0220  95  PHE A CD1 
181  C CD2 . PHE A 49  ? 0.3663 0.2858 0.4029 0.0303  -0.0054 0.0163  95  PHE A CD2 
182  C CE1 . PHE A 49  ? 0.4155 0.3046 0.4391 0.0445  -0.0153 0.0266  95  PHE A CE1 
183  C CE2 . PHE A 49  ? 0.3947 0.2915 0.4235 0.0278  -0.0072 0.0194  95  PHE A CE2 
184  C CZ  . PHE A 49  ? 0.4159 0.2961 0.4379 0.0344  -0.0113 0.0250  95  PHE A CZ  
185  N N   . ALA A 50  ? 0.2973 0.2975 0.3898 0.0489  -0.0076 0.0011  96  ALA A N   
186  C CA  . ALA A 50  ? 0.2837 0.3019 0.3896 0.0436  -0.0035 -0.0025 96  ALA A CA  
187  C C   . ALA A 50  ? 0.2863 0.3143 0.3971 0.0441  -0.0120 -0.0031 96  ALA A C   
188  O O   . ALA A 50  ? 0.2775 0.3137 0.3925 0.0374  -0.0097 -0.0047 96  ALA A O   
189  C CB  . ALA A 50  ? 0.2759 0.3074 0.4018 0.0467  0.0035  -0.0089 96  ALA A CB  
190  N N   . TRP A 51  ? 0.3059 0.3309 0.4140 0.0528  -0.0225 -0.0021 97  TRP A N   
191  C CA  . TRP A 51  ? 0.3150 0.3512 0.4289 0.0559  -0.0331 -0.0051 97  TRP A CA  
192  C C   . TRP A 51  ? 0.3109 0.3461 0.4124 0.0485  -0.0337 -0.0034 97  TRP A C   
193  O O   . TRP A 51  ? 0.3137 0.3623 0.4272 0.0470  -0.0384 -0.0097 97  TRP A O   
194  C CB  . TRP A 51  ? 0.3480 0.3769 0.4539 0.0686  -0.0456 -0.0029 97  TRP A CB  
195  C CG  . TRP A 51  ? 0.3762 0.3805 0.4523 0.0696  -0.0463 0.0073  97  TRP A CG  
196  C CD1 . TRP A 51  ? 0.3941 0.3794 0.4598 0.0711  -0.0421 0.0127  97  TRP A CD1 
197  C CD2 . TRP A 51  ? 0.3882 0.3833 0.4413 0.0686  -0.0503 0.0133  97  TRP A CD2 
198  N NE1 . TRP A 51  ? 0.4108 0.3761 0.4510 0.0696  -0.0426 0.0224  97  TRP A NE1 
199  C CE2 . TRP A 51  ? 0.4190 0.3904 0.4501 0.0685  -0.0467 0.0234  97  TRP A CE2 
200  C CE3 . TRP A 51  ? 0.4142 0.4180 0.4626 0.0677  -0.0560 0.0106  97  TRP A CE3 
201  C CZ2 . TRP A 51  ? 0.4536 0.4113 0.4590 0.0675  -0.0468 0.0321  97  TRP A CZ2 
202  C CZ3 . TRP A 51  ? 0.4447 0.4342 0.4645 0.0682  -0.0570 0.0183  97  TRP A CZ3 
203  C CH2 . TRP A 51  ? 0.4729 0.4403 0.4719 0.0680  -0.0514 0.0296  97  TRP A CH2 
204  N N   . PRO A 52  ? 0.3104 0.3306 0.3901 0.0438  -0.0287 0.0040  98  PRO A N   
205  C CA  . PRO A 52  ? 0.3163 0.3371 0.3856 0.0381  -0.0279 0.0047  98  PRO A CA  
206  C C   . PRO A 52  ? 0.3032 0.3341 0.3862 0.0300  -0.0207 -0.0004 98  PRO A C   
207  O O   . PRO A 52  ? 0.3014 0.3344 0.3800 0.0268  -0.0217 -0.0024 98  PRO A O   
208  C CB  . PRO A 52  ? 0.3234 0.3288 0.3721 0.0347  -0.0220 0.0136  98  PRO A CB  
209  C CG  . PRO A 52  ? 0.3303 0.3236 0.3753 0.0395  -0.0232 0.0178  98  PRO A CG  
210  C CD  . PRO A 52  ? 0.3230 0.3265 0.3892 0.0427  -0.0234 0.0108  98  PRO A CD  
211  N N   . PHE A 53  ? 0.2925 0.3275 0.3895 0.0276  -0.0131 -0.0023 99  PHE A N   
212  C CA  . PHE A 53  ? 0.2931 0.3329 0.3989 0.0203  -0.0043 -0.0048 99  PHE A CA  
213  C C   . PHE A 53  ? 0.2916 0.3461 0.4232 0.0192  -0.0029 -0.0118 99  PHE A C   
214  O O   . PHE A 53  ? 0.2825 0.3391 0.4218 0.0129  0.0058  -0.0130 99  PHE A O   
215  C CB  . PHE A 53  ? 0.2841 0.3162 0.3830 0.0182  0.0051  -0.0010 99  PHE A CB  
216  C CG  . PHE A 53  ? 0.3064 0.3267 0.3861 0.0177  0.0043  0.0048  99  PHE A CG  
217  C CD1 . PHE A 53  ? 0.3315 0.3493 0.4016 0.0132  0.0070  0.0073  99  PHE A CD1 
218  C CD2 . PHE A 53  ? 0.3020 0.3136 0.3752 0.0216  0.0012  0.0078  99  PHE A CD2 
219  C CE1 . PHE A 53  ? 0.3212 0.3315 0.3784 0.0118  0.0072  0.0123  99  PHE A CE1 
220  C CE2 . PHE A 53  ? 0.3254 0.3263 0.3844 0.0191  0.0014  0.0132  99  PHE A CE2 
221  C CZ  . PHE A 53  ? 0.3079 0.3100 0.3606 0.0137  0.0047  0.0153  99  PHE A CZ  
222  N N   . ARG A 54  ? 0.3070 0.3714 0.4527 0.0253  -0.0112 -0.0161 100 ARG A N   
223  C CA  . ARG A 54  ? 0.3108 0.3932 0.4872 0.0239  -0.0093 -0.0235 100 ARG A CA  
224  C C   . ARG A 54  ? 0.3092 0.4007 0.4993 0.0177  -0.0142 -0.0301 100 ARG A C   
225  O O   . ARG A 54  ? 0.3069 0.4134 0.5256 0.0133  -0.0109 -0.0364 100 ARG A O   
226  C CB  . ARG A 54  ? 0.3238 0.4164 0.5142 0.0341  -0.0174 -0.0270 100 ARG A CB  
227  C CG  . ARG A 54  ? 0.3497 0.4349 0.5344 0.0399  -0.0105 -0.0232 100 ARG A CG  
228  C CD  . ARG A 54  ? 0.3763 0.4754 0.5826 0.0503  -0.0162 -0.0285 100 ARG A CD  
229  N NE  . ARG A 54  ? 0.4047 0.4930 0.6018 0.0578  -0.0113 -0.0257 100 ARG A NE  
230  C CZ  . ARG A 54  ? 0.4378 0.5172 0.6264 0.0693  -0.0207 -0.0241 100 ARG A CZ  
231  N NH1 . ARG A 54  ? 0.4567 0.5372 0.6428 0.0760  -0.0361 -0.0242 100 ARG A NH1 
232  N NH2 . ARG A 54  ? 0.4523 0.5195 0.6329 0.0750  -0.0150 -0.0226 100 ARG A NH2 
233  N N   . GLN A 55  ? 0.3120 0.3943 0.4826 0.0172  -0.0215 -0.0292 101 GLN A N   
234  C CA  . GLN A 55  ? 0.3267 0.4137 0.5059 0.0120  -0.0277 -0.0367 101 GLN A CA  
235  C C   . GLN A 55  ? 0.3199 0.3908 0.4721 0.0096  -0.0260 -0.0328 101 GLN A C   
236  O O   . GLN A 55  ? 0.3129 0.3729 0.4414 0.0134  -0.0239 -0.0250 101 GLN A O   
237  C CB  . GLN A 55  ? 0.3482 0.4460 0.5348 0.0193  -0.0457 -0.0444 101 GLN A CB  
238  C CG  . GLN A 55  ? 0.4018 0.4879 0.5572 0.0297  -0.0554 -0.0388 101 GLN A CG  
239  C CD  . GLN A 55  ? 0.4411 0.5230 0.5909 0.0369  -0.0523 -0.0313 101 GLN A CD  
240  O OE1 . GLN A 55  ? 0.4829 0.5772 0.6542 0.0416  -0.0551 -0.0349 101 GLN A OE1 
241  N NE2 . GLN A 55  ? 0.4324 0.4969 0.5550 0.0375  -0.0463 -0.0215 101 GLN A NE2 
242  N N   . PRO A 56  ? 0.3213 0.3911 0.4788 0.0032  -0.0265 -0.0387 102 PRO A N   
243  C CA  . PRO A 56  ? 0.3323 0.3876 0.4654 0.0026  -0.0247 -0.0361 102 PRO A CA  
244  C C   . PRO A 56  ? 0.3433 0.3931 0.4499 0.0113  -0.0335 -0.0334 102 PRO A C   
245  O O   . PRO A 56  ? 0.3525 0.4081 0.4590 0.0175  -0.0457 -0.0371 102 PRO A O   
246  C CB  . PRO A 56  ? 0.3406 0.3963 0.4866 -0.0037 -0.0287 -0.0461 102 PRO A CB  
247  C CG  . PRO A 56  ? 0.3428 0.4112 0.5228 -0.0106 -0.0248 -0.0505 102 PRO A CG  
248  C CD  . PRO A 56  ? 0.3254 0.4066 0.5135 -0.0040 -0.0283 -0.0485 102 PRO A CD  
249  N N   . VAL A 57  ? 0.3414 0.3803 0.4259 0.0121  -0.0268 -0.0266 103 VAL A N   
250  C CA  . VAL A 57  ? 0.3541 0.3868 0.4125 0.0190  -0.0316 -0.0232 103 VAL A CA  
251  C C   . VAL A 57  ? 0.3664 0.3991 0.4190 0.0222  -0.0432 -0.0330 103 VAL A C   
252  O O   . VAL A 57  ? 0.3759 0.4060 0.4331 0.0180  -0.0425 -0.0398 103 VAL A O   
253  C CB  . VAL A 57  ? 0.3482 0.3726 0.3895 0.0181  -0.0212 -0.0161 103 VAL A CB  
254  C CG1 . VAL A 57  ? 0.3702 0.3892 0.3857 0.0247  -0.0237 -0.0125 103 VAL A CG1 
255  C CG2 . VAL A 57  ? 0.3423 0.3666 0.3888 0.0152  -0.0122 -0.0081 103 VAL A CG2 
256  N N   . ASP A 58  ? 0.3811 0.4151 0.4227 0.0302  -0.0547 -0.0342 104 ASP A N   
257  C CA  . ASP A 58  ? 0.4089 0.4418 0.4390 0.0354  -0.0678 -0.0439 104 ASP A CA  
258  C C   . ASP A 58  ? 0.4183 0.4390 0.4118 0.0423  -0.0648 -0.0380 104 ASP A C   
259  O O   . ASP A 58  ? 0.4220 0.4383 0.3957 0.0500  -0.0673 -0.0306 104 ASP A O   
260  C CB  . ASP A 58  ? 0.4225 0.4646 0.4610 0.0420  -0.0840 -0.0495 104 ASP A CB  
261  C CG  . ASP A 58  ? 0.4558 0.4977 0.4835 0.0478  -0.1007 -0.0620 104 ASP A CG  
262  O OD1 . ASP A 58  ? 0.4611 0.4921 0.4646 0.0496  -0.0991 -0.0640 104 ASP A OD1 
263  O OD2 . ASP A 58  ? 0.4621 0.5155 0.5056 0.0515  -0.1162 -0.0706 104 ASP A OD2 
264  N N   . ALA A 59  ? 0.4204 0.4351 0.4051 0.0401  -0.0584 -0.0408 105 ALA A N   
265  C CA  . ALA A 59  ? 0.4381 0.4437 0.3915 0.0461  -0.0515 -0.0352 105 ALA A CA  
266  C C   . ALA A 59  ? 0.4654 0.4653 0.3893 0.0571  -0.0628 -0.0389 105 ALA A C   
267  O O   . ALA A 59  ? 0.4843 0.4771 0.3802 0.0634  -0.0566 -0.0300 105 ALA A O   
268  C CB  . ALA A 59  ? 0.4372 0.4387 0.3904 0.0429  -0.0431 -0.0394 105 ALA A CB  
269  N N   . VAL A 60  ? 0.4788 0.4816 0.4088 0.0595  -0.0793 -0.0520 106 VAL A N   
270  C CA  . VAL A 60  ? 0.5093 0.5066 0.4101 0.0715  -0.0936 -0.0573 106 VAL A CA  
271  C C   . VAL A 60  ? 0.5194 0.5161 0.4093 0.0786  -0.0977 -0.0465 106 VAL A C   
272  O O   . VAL A 60  ? 0.5385 0.5241 0.3925 0.0881  -0.0957 -0.0382 106 VAL A O   
273  C CB  . VAL A 60  ? 0.5191 0.5220 0.4349 0.0714  -0.1130 -0.0760 106 VAL A CB  
274  C CG1 . VAL A 60  ? 0.5555 0.5527 0.4384 0.0856  -0.1306 -0.0825 106 VAL A CG1 
275  C CG2 . VAL A 60  ? 0.5288 0.5276 0.4541 0.0640  -0.1087 -0.0867 106 VAL A CG2 
276  N N   . LYS A 61  ? 0.5027 0.5101 0.4233 0.0744  -0.1022 -0.0461 107 LYS A N   
277  C CA  . LYS A 61  ? 0.5162 0.5222 0.4312 0.0814  -0.1065 -0.0365 107 LYS A CA  
278  C C   . LYS A 61  ? 0.5131 0.5063 0.4060 0.0817  -0.0898 -0.0188 107 LYS A C   
279  O O   . LYS A 61  ? 0.5285 0.5101 0.3932 0.0914  -0.0924 -0.0099 107 LYS A O   
280  C CB  . LYS A 61  ? 0.5021 0.5228 0.4584 0.0752  -0.1090 -0.0392 107 LYS A CB  
281  C CG  . LYS A 61  ? 0.5293 0.5498 0.4850 0.0838  -0.1161 -0.0323 107 LYS A CG  
282  C CD  . LYS A 61  ? 0.5349 0.5715 0.5331 0.0775  -0.1156 -0.0360 107 LYS A CD  
283  C CE  . LYS A 61  ? 0.5716 0.6050 0.5687 0.0860  -0.1185 -0.0274 107 LYS A CE  
284  N NZ  . LYS A 61  ? 0.5850 0.6349 0.6229 0.0812  -0.1163 -0.0315 107 LYS A NZ  
285  N N   . LEU A 62  ? 0.4936 0.4884 0.3998 0.0711  -0.0730 -0.0138 108 LEU A N   
286  C CA  . LEU A 62  ? 0.5005 0.4866 0.3947 0.0686  -0.0572 0.0014  108 LEU A CA  
287  C C   . LEU A 62  ? 0.5309 0.5080 0.3936 0.0717  -0.0470 0.0064  108 LEU A C   
288  O O   . LEU A 62  ? 0.5502 0.5207 0.4024 0.0695  -0.0334 0.0191  108 LEU A O   
289  C CB  . LEU A 62  ? 0.4728 0.4664 0.3966 0.0567  -0.0455 0.0036  108 LEU A CB  
290  C CG  . LEU A 62  ? 0.4685 0.4707 0.4224 0.0535  -0.0513 0.0001  108 LEU A CG  
291  C CD1 . LEU A 62  ? 0.4631 0.4701 0.4389 0.0432  -0.0391 0.0024  108 LEU A CD1 
292  C CD2 . LEU A 62  ? 0.4936 0.4890 0.4403 0.0606  -0.0573 0.0072  108 LEU A CD2 
293  N N   . GLY A 63  ? 0.5390 0.5161 0.3880 0.0767  -0.0531 -0.0040 109 GLY A N   
294  C CA  . GLY A 63  ? 0.5709 0.5404 0.3891 0.0814  -0.0428 -0.0009 109 GLY A CA  
295  C C   . GLY A 63  ? 0.5541 0.5294 0.3861 0.0726  -0.0247 0.0031  109 GLY A C   
296  O O   . GLY A 63  ? 0.5631 0.5349 0.3803 0.0727  -0.0099 0.0139  109 GLY A O   
297  N N   . LEU A 64  ? 0.5302 0.5143 0.3910 0.0653  -0.0258 -0.0056 110 LEU A N   
298  C CA  . LEU A 64  ? 0.5096 0.4999 0.3868 0.0579  -0.0115 -0.0028 110 LEU A CA  
299  C C   . LEU A 64  ? 0.5124 0.5032 0.3907 0.0595  -0.0125 -0.0150 110 LEU A C   
300  O O   . LEU A 64  ? 0.4944 0.4887 0.3965 0.0534  -0.0149 -0.0212 110 LEU A O   
301  C CB  . LEU A 64  ? 0.4805 0.4775 0.3894 0.0484  -0.0111 -0.0002 110 LEU A CB  
302  C CG  . LEU A 64  ? 0.4758 0.4705 0.3871 0.0468  -0.0117 0.0098  110 LEU A CG  
303  C CD1 . LEU A 64  ? 0.4537 0.4547 0.3948 0.0389  -0.0120 0.0093  110 LEU A CD1 
304  C CD2 . LEU A 64  ? 0.4999 0.4904 0.3970 0.0462  0.0013  0.0225  110 LEU A CD2 
305  N N   . PRO A 65  ? 0.5453 0.5305 0.3957 0.0682  -0.0099 -0.0182 111 PRO A N   
306  C CA  . PRO A 65  ? 0.5556 0.5373 0.4028 0.0716  -0.0129 -0.0317 111 PRO A CA  
307  C C   . PRO A 65  ? 0.5307 0.5172 0.3992 0.0665  -0.0028 -0.0324 111 PRO A C   
308  O O   . PRO A 65  ? 0.5362 0.5174 0.4095 0.0672  -0.0071 -0.0437 111 PRO A O   
309  C CB  . PRO A 65  ? 0.5927 0.5677 0.4021 0.0833  -0.0081 -0.0320 111 PRO A CB  
310  C CG  . PRO A 65  ? 0.6015 0.5794 0.4016 0.0828  0.0049  -0.0155 111 PRO A CG  
311  C CD  . PRO A 65  ? 0.5742 0.5543 0.3932 0.0755  -0.0022 -0.0089 111 PRO A CD  
312  N N   . ASP A 66  ? 0.5033 0.4984 0.3838 0.0619  0.0096  -0.0209 112 ASP A N   
313  C CA  . ASP A 66  ? 0.4831 0.4838 0.3827 0.0587  0.0179  -0.0208 112 ASP A CA  
314  C C   . ASP A 66  ? 0.4373 0.4406 0.3645 0.0493  0.0144  -0.0190 112 ASP A C   
315  O O   . ASP A 66  ? 0.4180 0.4242 0.3594 0.0474  0.0197  -0.0184 112 ASP A O   
316  C CB  . ASP A 66  ? 0.4968 0.5078 0.3951 0.0599  0.0332  -0.0110 112 ASP A CB  
317  C CG  . ASP A 66  ? 0.5065 0.5232 0.4125 0.0528  0.0367  0.0013  112 ASP A CG  
318  O OD1 . ASP A 66  ? 0.5302 0.5411 0.4352 0.0499  0.0276  0.0027  112 ASP A OD1 
319  O OD2 . ASP A 66  ? 0.5464 0.5733 0.4607 0.0502  0.0484  0.0088  112 ASP A OD2 
320  N N   . TYR A 67  ? 0.4138 0.4161 0.3477 0.0448  0.0058  -0.0181 113 TYR A N   
321  C CA  . TYR A 67  ? 0.3788 0.3845 0.3366 0.0367  0.0050  -0.0151 113 TYR A CA  
322  C C   . TYR A 67  ? 0.3661 0.3676 0.3374 0.0341  0.0052  -0.0213 113 TYR A C   
323  O O   . TYR A 67  ? 0.3287 0.3327 0.3118 0.0310  0.0111  -0.0167 113 TYR A O   
324  C CB  . TYR A 67  ? 0.3722 0.3779 0.3364 0.0338  -0.0046 -0.0157 113 TYR A CB  
325  C CG  . TYR A 67  ? 0.3560 0.3656 0.3426 0.0266  -0.0027 -0.0119 113 TYR A CG  
326  C CD1 . TYR A 67  ? 0.3287 0.3422 0.3186 0.0241  0.0033  -0.0024 113 TYR A CD1 
327  C CD2 . TYR A 67  ? 0.3376 0.3461 0.3414 0.0220  -0.0059 -0.0180 113 TYR A CD2 
328  C CE1 . TYR A 67  ? 0.3148 0.3305 0.3215 0.0188  0.0049  0.0000  113 TYR A CE1 
329  C CE2 . TYR A 67  ? 0.3346 0.3459 0.3555 0.0164  -0.0023 -0.0142 113 TYR A CE2 
330  C CZ  . TYR A 67  ? 0.3247 0.3394 0.3454 0.0157  0.0026  -0.0057 113 TYR A CZ  
331  O OH  . TYR A 67  ? 0.3271 0.3432 0.3611 0.0115  0.0058  -0.0031 113 TYR A OH  
332  N N   . HIS A 68  ? 0.3784 0.3717 0.3464 0.0357  -0.0018 -0.0319 114 HIS A N   
333  C CA  . HIS A 68  ? 0.3831 0.3680 0.3633 0.0324  -0.0015 -0.0375 114 HIS A CA  
334  C C   . HIS A 68  ? 0.3959 0.3752 0.3680 0.0385  0.0057  -0.0384 114 HIS A C   
335  O O   . HIS A 68  ? 0.3985 0.3687 0.3790 0.0369  0.0078  -0.0402 114 HIS A O   
336  C CB  . HIS A 68  ? 0.3939 0.3715 0.3783 0.0298  -0.0124 -0.0493 114 HIS A CB  
337  C CG  . HIS A 68  ? 0.3900 0.3755 0.3898 0.0238  -0.0193 -0.0490 114 HIS A CG  
338  N ND1 . HIS A 68  ? 0.3909 0.3796 0.4126 0.0158  -0.0154 -0.0447 114 HIS A ND1 
339  C CD2 . HIS A 68  ? 0.4097 0.4011 0.4054 0.0260  -0.0295 -0.0522 114 HIS A CD2 
340  C CE1 . HIS A 68  ? 0.3883 0.3860 0.4214 0.0132  -0.0223 -0.0459 114 HIS A CE1 
341  N NE2 . HIS A 68  ? 0.3906 0.3900 0.4088 0.0196  -0.0318 -0.0504 114 HIS A NE2 
342  N N   . LYS A 69  ? 0.4044 0.3890 0.3603 0.0462  0.0103  -0.0367 115 LYS A N   
343  C CA  . LYS A 69  ? 0.4213 0.4063 0.3729 0.0534  0.0187  -0.0362 115 LYS A CA  
344  C C   . LYS A 69  ? 0.3977 0.3928 0.3644 0.0506  0.0254  -0.0265 115 LYS A C   
345  O O   . LYS A 69  ? 0.4019 0.3949 0.3729 0.0549  0.0292  -0.0266 115 LYS A O   
346  C CB  . LYS A 69  ? 0.4469 0.4381 0.3791 0.0620  0.0242  -0.0364 115 LYS A CB  
347  C CG  . LYS A 69  ? 0.5172 0.4994 0.4277 0.0669  0.0171  -0.0455 115 LYS A CG  
348  C CD  . LYS A 69  ? 0.5544 0.5214 0.4572 0.0728  0.0133  -0.0585 115 LYS A CD  
349  C CE  . LYS A 69  ? 0.5951 0.5531 0.4739 0.0785  0.0045  -0.0694 115 LYS A CE  
350  N NZ  . LYS A 69  ? 0.6348 0.5963 0.4872 0.0904  0.0132  -0.0691 115 LYS A NZ  
351  N N   . ILE A 70  ? 0.3728 0.3776 0.3464 0.0444  0.0258  -0.0187 116 ILE A N   
352  C CA  . ILE A 70  ? 0.3470 0.3622 0.3336 0.0416  0.0305  -0.0106 116 ILE A CA  
353  C C   . ILE A 70  ? 0.3397 0.3489 0.3383 0.0354  0.0271  -0.0090 116 ILE A C   
354  O O   . ILE A 70  ? 0.3398 0.3494 0.3449 0.0366  0.0293  -0.0064 116 ILE A O   
355  C CB  . ILE A 70  ? 0.3518 0.3787 0.3380 0.0383  0.0338  -0.0033 116 ILE A CB  
356  C CG1 . ILE A 70  ? 0.3793 0.4132 0.3540 0.0446  0.0412  -0.0029 116 ILE A CG1 
357  C CG2 . ILE A 70  ? 0.3138 0.3499 0.3153 0.0337  0.0361  0.0032  116 ILE A CG2 
358  C CD1 . ILE A 70  ? 0.4127 0.4526 0.3822 0.0411  0.0453  0.0047  116 ILE A CD1 
359  N N   . ILE A 71  ? 0.3249 0.3293 0.3258 0.0299  0.0218  -0.0107 117 ILE A N   
360  C CA  . ILE A 71  ? 0.3207 0.3206 0.3332 0.0238  0.0205  -0.0092 117 ILE A CA  
361  C C   . ILE A 71  ? 0.3502 0.3364 0.3653 0.0222  0.0185  -0.0158 117 ILE A C   
362  O O   . ILE A 71  ? 0.3579 0.3412 0.3741 0.0199  0.0129  -0.0223 117 ILE A O   
363  C CB  . ILE A 71  ? 0.3028 0.3081 0.3207 0.0187  0.0170  -0.0070 117 ILE A CB  
364  C CG1 . ILE A 71  ? 0.2896 0.3044 0.3052 0.0189  0.0195  -0.0001 117 ILE A CG1 
365  C CG2 . ILE A 71  ? 0.3009 0.3028 0.3313 0.0132  0.0175  -0.0062 117 ILE A CG2 
366  C CD1 . ILE A 71  ? 0.2707 0.2893 0.2919 0.0185  0.0238  0.0045  117 ILE A CD1 
367  N N   . LYS A 72  ? 0.3637 0.3407 0.3801 0.0235  0.0225  -0.0141 118 LYS A N   
368  C CA  . LYS A 72  ? 0.3924 0.3523 0.4101 0.0220  0.0224  -0.0193 118 LYS A CA  
369  C C   . LYS A 72  ? 0.3807 0.3350 0.4110 0.0131  0.0244  -0.0175 118 LYS A C   
370  O O   . LYS A 72  ? 0.3963 0.3378 0.4325 0.0085  0.0243  -0.0225 118 LYS A O   
371  C CB  . LYS A 72  ? 0.4146 0.3638 0.4242 0.0297  0.0264  -0.0177 118 LYS A CB  
372  C CG  . LYS A 72  ? 0.4566 0.4128 0.4565 0.0393  0.0261  -0.0206 118 LYS A CG  
373  C CD  . LYS A 72  ? 0.4981 0.4531 0.4919 0.0395  0.0215  -0.0296 118 LYS A CD  
374  C CE  . LYS A 72  ? 0.5466 0.4985 0.5280 0.0503  0.0230  -0.0350 118 LYS A CE  
375  N NZ  . LYS A 72  ? 0.5781 0.5256 0.5495 0.0511  0.0175  -0.0450 118 LYS A NZ  
376  N N   . GLN A 73  ? 0.3567 0.3202 0.3918 0.0106  0.0269  -0.0110 119 GLN A N   
377  C CA  . GLN A 73  ? 0.3645 0.3257 0.4116 0.0031  0.0308  -0.0089 119 GLN A CA  
378  C C   . GLN A 73  ? 0.3390 0.3161 0.3946 0.0003  0.0278  -0.0086 119 GLN A C   
379  O O   . GLN A 73  ? 0.3339 0.3163 0.3876 0.0014  0.0306  -0.0028 119 GLN A O   
380  C CB  . GLN A 73  ? 0.3846 0.3367 0.4251 0.0051  0.0384  -0.0009 119 GLN A CB  
381  C CG  . GLN A 73  ? 0.4455 0.3794 0.4752 0.0101  0.0410  0.0000  119 GLN A CG  
382  C CD  . GLN A 73  ? 0.4932 0.4186 0.5113 0.0153  0.0462  0.0085  119 GLN A CD  
383  O OE1 . GLN A 73  ? 0.5287 0.4546 0.5477 0.0121  0.0511  0.0133  119 GLN A OE1 
384  N NE2 . GLN A 73  ? 0.5492 0.4670 0.5553 0.0247  0.0448  0.0098  119 GLN A NE2 
385  N N   . PRO A 74  ? 0.3266 0.3102 0.3902 -0.0021 0.0208  -0.0154 120 PRO A N   
386  C CA  . PRO A 74  ? 0.3011 0.2981 0.3722 -0.0030 0.0170  -0.0149 120 PRO A CA  
387  C C   . PRO A 74  ? 0.2900 0.2897 0.3762 -0.0081 0.0231  -0.0126 120 PRO A C   
388  O O   . PRO A 74  ? 0.2763 0.2693 0.3727 -0.0136 0.0286  -0.0140 120 PRO A O   
389  C CB  . PRO A 74  ? 0.3163 0.3175 0.3926 -0.0035 0.0070  -0.0239 120 PRO A CB  
390  C CG  . PRO A 74  ? 0.3581 0.3486 0.4225 -0.0009 0.0053  -0.0285 120 PRO A CG  
391  C CD  . PRO A 74  ? 0.3478 0.3259 0.4117 -0.0027 0.0147  -0.0244 120 PRO A CD  
392  N N   . MET A 75  ? 0.2651 0.2732 0.3523 -0.0063 0.0232  -0.0090 121 MET A N   
393  C CA  . MET A 75  ? 0.2731 0.2853 0.3736 -0.0093 0.0296  -0.0076 121 MET A CA  
394  C C   . MET A 75  ? 0.2687 0.2919 0.3736 -0.0061 0.0244  -0.0079 121 MET A C   
395  O O   . MET A 75  ? 0.2650 0.2887 0.3577 -0.0017 0.0187  -0.0058 121 MET A O   
396  C CB  . MET A 75  ? 0.2772 0.2800 0.3665 -0.0084 0.0395  -0.0007 121 MET A CB  
397  C CG  . MET A 75  ? 0.2872 0.2915 0.3866 -0.0111 0.0494  0.0012  121 MET A CG  
398  S SD  . MET A 75  ? 0.3271 0.3349 0.4531 -0.0201 0.0552  -0.0037 121 MET A SD  
399  C CE  . MET A 75  ? 0.3250 0.3131 0.4409 -0.0233 0.0583  -0.0022 121 MET A CE  
400  N N   . ASP A 76  ? 0.2652 0.2969 0.3887 -0.0081 0.0271  -0.0103 122 ASP A N   
401  C CA  . ASP A 76  ? 0.2593 0.3010 0.3898 -0.0037 0.0218  -0.0116 122 ASP A CA  
402  C C   . ASP A 76  ? 0.2559 0.3043 0.4032 -0.0051 0.0312  -0.0120 122 ASP A C   
403  O O   . ASP A 76  ? 0.2585 0.3054 0.4146 -0.0107 0.0410  -0.0119 122 ASP A O   
404  C CB  . ASP A 76  ? 0.2581 0.3088 0.3985 -0.0022 0.0094  -0.0182 122 ASP A CB  
405  C CG  . ASP A 76  ? 0.2769 0.3370 0.4434 -0.0083 0.0096  -0.0257 122 ASP A CG  
406  O OD1 . ASP A 76  ? 0.3087 0.3623 0.4754 -0.0139 0.0109  -0.0281 122 ASP A OD1 
407  O OD2 . ASP A 76  ? 0.2768 0.3511 0.4657 -0.0076 0.0088  -0.0295 122 ASP A OD2 
408  N N   A MET A 77  ? 0.2598 0.3145 0.4109 0.0005  0.0292  -0.0123 123 MET A N   
409  N N   B MET A 77  ? 0.2563 0.3108 0.4069 0.0007  0.0290  -0.0122 123 MET A N   
410  C CA  A MET A 77  ? 0.2685 0.3298 0.4333 0.0013  0.0395  -0.0129 123 MET A CA  
411  C CA  B MET A 77  ? 0.2620 0.3239 0.4270 0.0018  0.0385  -0.0131 123 MET A CA  
412  C C   A MET A 77  ? 0.2693 0.3482 0.4669 -0.0024 0.0413  -0.0194 123 MET A C   
413  C C   B MET A 77  ? 0.2664 0.3443 0.4631 -0.0030 0.0415  -0.0192 123 MET A C   
414  O O   A MET A 77  ? 0.2708 0.3558 0.4823 -0.0042 0.0541  -0.0194 123 MET A O   
415  O O   B MET A 77  ? 0.2715 0.3531 0.4801 -0.0065 0.0554  -0.0185 123 MET A O   
416  C CB  A MET A 77  ? 0.2716 0.3319 0.4290 0.0097  0.0367  -0.0119 123 MET A CB  
417  C CB  B MET A 77  ? 0.2607 0.3254 0.4243 0.0105  0.0329  -0.0137 123 MET A CB  
418  C CG  A MET A 77  ? 0.2960 0.3418 0.4299 0.0113  0.0432  -0.0069 123 MET A CG  
419  C CG  B MET A 77  ? 0.2657 0.3155 0.4040 0.0143  0.0337  -0.0087 123 MET A CG  
420  S SD  A MET A 77  ? 0.3249 0.3649 0.4489 0.0201  0.0381  -0.0071 123 MET A SD  
421  S SD  B MET A 77  ? 0.2673 0.3177 0.4078 0.0242  0.0300  -0.0106 123 MET A SD  
422  C CE  A MET A 77  ? 0.2184 0.2582 0.3419 0.0240  0.0232  -0.0071 123 MET A CE  
423  C CE  B MET A 77  ? 0.2479 0.2786 0.3595 0.0251  0.0258  -0.0054 123 MET A CE  
424  N N   . GLY A 78  ? 0.2720 0.3598 0.4824 -0.0032 0.0286  -0.0253 124 GLY A N   
425  C CA  . GLY A 78  ? 0.2752 0.3819 0.5211 -0.0082 0.0279  -0.0334 124 GLY A CA  
426  C C   . GLY A 78  ? 0.2862 0.3884 0.5417 -0.0199 0.0401  -0.0330 124 GLY A C   
427  O O   . GLY A 78  ? 0.2877 0.4017 0.5705 -0.0258 0.0513  -0.0352 124 GLY A O   
428  N N   . THR A 79  ? 0.2866 0.3709 0.5196 -0.0229 0.0386  -0.0297 125 THR A N   
429  C CA  . THR A 79  ? 0.2973 0.3694 0.5308 -0.0325 0.0500  -0.0273 125 THR A CA  
430  C C   . THR A 79  ? 0.3146 0.3798 0.5417 -0.0333 0.0693  -0.0191 125 THR A C   
431  O O   . THR A 79  ? 0.3202 0.3870 0.5658 -0.0416 0.0828  -0.0185 125 THR A O   
432  C CB  . THR A 79  ? 0.3067 0.3596 0.5121 -0.0315 0.0441  -0.0248 125 THR A CB  
433  O OG1 . THR A 79  ? 0.3089 0.3672 0.5187 -0.0307 0.0278  -0.0332 125 THR A OG1 
434  C CG2 . THR A 79  ? 0.3060 0.3415 0.5073 -0.0393 0.0559  -0.0211 125 THR A CG2 
435  N N   . ILE A 80  ? 0.3215 0.3788 0.5226 -0.0249 0.0707  -0.0130 126 ILE A N   
436  C CA  . ILE A 80  ? 0.3341 0.3830 0.5227 -0.0233 0.0870  -0.0060 126 ILE A CA  
437  C C   . ILE A 80  ? 0.3420 0.4081 0.5569 -0.0241 0.0980  -0.0086 126 ILE A C   
438  O O   . ILE A 80  ? 0.3430 0.4053 0.5610 -0.0283 0.1158  -0.0043 126 ILE A O   
439  C CB  . ILE A 80  ? 0.3329 0.3716 0.4903 -0.0138 0.0832  -0.0015 126 ILE A CB  
440  C CG1 . ILE A 80  ? 0.3298 0.3541 0.4641 -0.0130 0.0749  0.0014  126 ILE A CG1 
441  C CG2 . ILE A 80  ? 0.3298 0.3597 0.4721 -0.0107 0.0986  0.0041  126 ILE A CG2 
442  C CD1 . ILE A 80  ? 0.3243 0.3424 0.4345 -0.0053 0.0686  0.0041  126 ILE A CD1 
443  N N   . LYS A 81  ? 0.3416 0.4261 0.5747 -0.0192 0.0880  -0.0153 127 LYS A N   
444  C CA  . LYS A 81  ? 0.3436 0.4487 0.6062 -0.0180 0.0964  -0.0195 127 LYS A CA  
445  C C   . LYS A 81  ? 0.3515 0.4690 0.6492 -0.0302 0.1054  -0.0229 127 LYS A C   
446  O O   . LYS A 81  ? 0.3484 0.4706 0.6589 -0.0341 0.1249  -0.0203 127 LYS A O   
447  C CB  . LYS A 81  ? 0.3385 0.4598 0.6142 -0.0092 0.0800  -0.0266 127 LYS A CB  
448  C CG  . LYS A 81  ? 0.3485 0.4931 0.6557 -0.0049 0.0868  -0.0319 127 LYS A CG  
449  C CD  . LYS A 81  ? 0.3482 0.5019 0.6587 0.0074  0.0699  -0.0370 127 LYS A CD  
450  C CE  . LYS A 81  ? 0.3672 0.5482 0.7155 0.0127  0.0741  -0.0441 127 LYS A CE  
451  N NZ  . LYS A 81  ? 0.3566 0.5622 0.7474 0.0043  0.0694  -0.0522 127 LYS A NZ  
452  N N   . ARG A 82  ? 0.3520 0.4737 0.6643 -0.0365 0.0918  -0.0290 128 ARG A N   
453  C CA  . ARG A 82  ? 0.3780 0.5088 0.7245 -0.0502 0.0975  -0.0337 128 ARG A CA  
454  C C   . ARG A 82  ? 0.3900 0.5003 0.7245 -0.0591 0.1189  -0.0242 128 ARG A C   
455  O O   . ARG A 82  ? 0.3925 0.5116 0.7548 -0.0685 0.1358  -0.0239 128 ARG A O   
456  C CB  . ARG A 82  ? 0.3832 0.5134 0.7351 -0.0541 0.0773  -0.0418 128 ARG A CB  
457  C CG  . ARG A 82  ? 0.4509 0.5912 0.8416 -0.0688 0.0790  -0.0496 128 ARG A CG  
458  C CD  . ARG A 82  ? 0.4906 0.6413 0.8948 -0.0687 0.0541  -0.0625 128 ARG A CD  
459  N NE  . ARG A 82  ? 0.5361 0.6639 0.9006 -0.0632 0.0413  -0.0605 128 ARG A NE  
460  C CZ  . ARG A 82  ? 0.5645 0.6910 0.9035 -0.0502 0.0267  -0.0600 128 ARG A CZ  
461  N NH1 . ARG A 82  ? 0.5686 0.7123 0.9145 -0.0402 0.0210  -0.0611 128 ARG A NH1 
462  N NH2 . ARG A 82  ? 0.5822 0.6888 0.8881 -0.0468 0.0186  -0.0579 128 ARG A NH2 
463  N N   . ARG A 83  ? 0.3853 0.4685 0.6787 -0.0555 0.1186  -0.0161 129 ARG A N   
464  C CA  . ARG A 83  ? 0.4045 0.4640 0.6793 -0.0610 0.1370  -0.0059 129 ARG A CA  
465  C C   . ARG A 83  ? 0.4141 0.4737 0.6833 -0.0582 0.1590  0.0016  129 ARG A C   
466  O O   . ARG A 83  ? 0.4304 0.4799 0.7031 -0.0665 0.1786  0.0082  129 ARG A O   
467  C CB  . ARG A 83  ? 0.4043 0.4377 0.6365 -0.0547 0.1294  0.0003  129 ARG A CB  
468  C CG  . ARG A 83  ? 0.4042 0.4293 0.6387 -0.0600 0.1160  -0.0047 129 ARG A CG  
469  C CD  . ARG A 83  ? 0.4086 0.4126 0.6043 -0.0519 0.1081  0.0004  129 ARG A CD  
470  N NE  . ARG A 83  ? 0.4157 0.4130 0.6134 -0.0553 0.0954  -0.0057 129 ARG A NE  
471  C CZ  . ARG A 83  ? 0.4354 0.4146 0.6059 -0.0501 0.0894  -0.0029 129 ARG A CZ  
472  N NH1 . ARG A 83  ? 0.4302 0.3972 0.5707 -0.0415 0.0934  0.0059  129 ARG A NH1 
473  N NH2 . ARG A 83  ? 0.4498 0.4238 0.6238 -0.0528 0.0788  -0.0099 129 ARG A NH2 
474  N N   . LEU A 84  ? 0.4052 0.4736 0.6633 -0.0462 0.1562  0.0008  130 LEU A N   
475  C CA  . LEU A 84  ? 0.4209 0.4911 0.6729 -0.0414 0.1762  0.0057  130 LEU A CA  
476  C C   . LEU A 84  ? 0.4324 0.5286 0.7306 -0.0489 0.1904  0.0011  130 LEU A C   
477  O O   . LEU A 84  ? 0.4525 0.5462 0.7521 -0.0522 0.2145  0.0075  130 LEU A O   
478  C CB  . LEU A 84  ? 0.4114 0.4843 0.6426 -0.0265 0.1674  0.0036  130 LEU A CB  
479  C CG  . LEU A 84  ? 0.3952 0.4433 0.5799 -0.0185 0.1590  0.0091  130 LEU A CG  
480  C CD1 . LEU A 84  ? 0.3845 0.4380 0.5590 -0.0070 0.1454  0.0042  130 LEU A CD1 
481  C CD2 . LEU A 84  ? 0.4129 0.4399 0.5661 -0.0163 0.1775  0.0189  130 LEU A CD2 
482  N N   . GLU A 85  ? 0.4186 0.5407 0.7546 -0.0510 0.1756  -0.0100 131 GLU A N   
483  C CA  . GLU A 85  ? 0.4188 0.5714 0.8066 -0.0583 0.1857  -0.0167 131 GLU A CA  
484  C C   . GLU A 85  ? 0.4403 0.5891 0.8521 -0.0765 0.2006  -0.0141 131 GLU A C   
485  O O   . GLU A 85  ? 0.4499 0.6157 0.8949 -0.0841 0.2211  -0.0140 131 GLU A O   
486  C CB  . GLU A 85  ? 0.3971 0.5769 0.8177 -0.0550 0.1620  -0.0299 131 GLU A CB  
487  C CG  . GLU A 85  ? 0.4030 0.5899 0.8095 -0.0374 0.1504  -0.0329 131 GLU A CG  
488  C CD  . GLU A 85  ? 0.3973 0.5994 0.8194 -0.0321 0.1229  -0.0431 131 GLU A CD  
489  O OE1 . GLU A 85  ? 0.4172 0.6222 0.8549 -0.0412 0.1106  -0.0483 131 GLU A OE1 
490  O OE2 . GLU A 85  ? 0.3907 0.5996 0.8070 -0.0181 0.1133  -0.0459 131 GLU A OE2 
491  N N   . ASN A 86  ? 0.4503 0.5765 0.8463 -0.0836 0.1912  -0.0121 132 ASN A N   
492  C CA  . ASN A 86  ? 0.4723 0.5901 0.8900 -0.1016 0.2026  -0.0105 132 ASN A CA  
493  C C   . ASN A 86  ? 0.4919 0.5746 0.8737 -0.1049 0.2248  0.0050  132 ASN A C   
494  O O   . ASN A 86  ? 0.5120 0.5779 0.9016 -0.1187 0.2325  0.0082  132 ASN A O   
495  C CB  . ASN A 86  ? 0.4734 0.5862 0.8979 -0.1074 0.1786  -0.0194 132 ASN A CB  
496  C CG  . ASN A 86  ? 0.4746 0.6212 0.9364 -0.1053 0.1568  -0.0350 132 ASN A CG  
497  O OD1 . ASN A 86  ? 0.4936 0.6712 0.9983 -0.1082 0.1626  -0.0414 132 ASN A OD1 
498  N ND2 . ASN A 86  ? 0.5051 0.6459 0.9502 -0.0992 0.1315  -0.0412 132 ASN A ND2 
499  N N   . ASN A 87  ? 0.4949 0.5650 0.8366 -0.0918 0.2343  0.0143  133 ASN A N   
500  C CA  . ASN A 87  ? 0.5233 0.5589 0.8237 -0.0912 0.2536  0.0295  133 ASN A CA  
501  C C   . ASN A 87  ? 0.5298 0.5337 0.8055 -0.0948 0.2435  0.0338  133 ASN A C   
502  O O   . ASN A 87  ? 0.5583 0.5366 0.8239 -0.1031 0.2600  0.0438  133 ASN A O   
503  C CB  . ASN A 87  ? 0.5531 0.5912 0.8759 -0.1027 0.2853  0.0366  133 ASN A CB  
504  C CG  . ASN A 87  ? 0.5495 0.6165 0.8900 -0.0960 0.2987  0.0337  133 ASN A CG  
505  O OD1 . ASN A 87  ? 0.5431 0.6166 0.8623 -0.0800 0.2883  0.0305  133 ASN A OD1 
506  N ND2 . ASN A 87  ? 0.5773 0.6616 0.9582 -0.1084 0.3225  0.0346  133 ASN A ND2 
507  N N   . TYR A 88  ? 0.5074 0.5122 0.7725 -0.0879 0.2172  0.0265  134 TYR A N   
508  C CA  . TYR A 88  ? 0.5109 0.4888 0.7531 -0.0888 0.2057  0.0286  134 TYR A CA  
509  C C   . TYR A 88  ? 0.5262 0.4728 0.7156 -0.0778 0.2123  0.0419  134 TYR A C   
510  O O   . TYR A 88  ? 0.5511 0.4685 0.7224 -0.0812 0.2182  0.0497  134 TYR A O   
511  C CB  . TYR A 88  ? 0.4878 0.4784 0.7331 -0.0831 0.1775  0.0171  134 TYR A CB  
512  C CG  . TYR A 88  ? 0.5113 0.4771 0.7315 -0.0812 0.1649  0.0181  134 TYR A CG  
513  C CD1 . TYR A 88  ? 0.5535 0.5096 0.7920 -0.0929 0.1617  0.0132  134 TYR A CD1 
514  C CD2 . TYR A 88  ? 0.5294 0.4821 0.7094 -0.0674 0.1559  0.0229  134 TYR A CD2 
515  C CE1 . TYR A 88  ? 0.5673 0.5001 0.7822 -0.0895 0.1506  0.0132  134 TYR A CE1 
516  C CE2 . TYR A 88  ? 0.5398 0.4725 0.6993 -0.0644 0.1452  0.0233  134 TYR A CE2 
517  C CZ  . TYR A 88  ? 0.5707 0.4930 0.7466 -0.0747 0.1430  0.0186  134 TYR A CZ  
518  O OH  . TYR A 88  ? 0.6109 0.5129 0.7660 -0.0702 0.1330  0.0182  134 TYR A OH  
519  N N   . TYR A 89  ? 0.5149 0.4668 0.6795 -0.0641 0.2103  0.0438  135 TYR A N   
520  C CA  . TYR A 89  ? 0.5328 0.4586 0.6472 -0.0516 0.2111  0.0536  135 TYR A CA  
521  C C   . TYR A 89  ? 0.5881 0.4917 0.6812 -0.0523 0.2369  0.0671  135 TYR A C   
522  O O   . TYR A 89  ? 0.5871 0.5024 0.6979 -0.0573 0.2561  0.0687  135 TYR A O   
523  C CB  . TYR A 89  ? 0.5068 0.4449 0.6030 -0.0376 0.1997  0.0498  135 TYR A CB  
524  C CG  . TYR A 89  ? 0.4557 0.4112 0.5652 -0.0354 0.1755  0.0389  135 TYR A CG  
525  C CD1 . TYR A 89  ? 0.4375 0.3816 0.5337 -0.0333 0.1598  0.0381  135 TYR A CD1 
526  C CD2 . TYR A 89  ? 0.4252 0.4076 0.5591 -0.0341 0.1691  0.0300  135 TYR A CD2 
527  C CE1 . TYR A 89  ? 0.4182 0.3772 0.5239 -0.0310 0.1399  0.0293  135 TYR A CE1 
528  C CE2 . TYR A 89  ? 0.4019 0.3970 0.5439 -0.0313 0.1479  0.0217  135 TYR A CE2 
529  C CZ  . TYR A 89  ? 0.3924 0.3757 0.5197 -0.0302 0.1342  0.0218  135 TYR A CZ  
530  O OH  . TYR A 89  ? 0.3707 0.3656 0.5036 -0.0274 0.1155  0.0146  135 TYR A OH  
531  N N   . TRP A 90  ? 0.6301 0.5017 0.6839 -0.0460 0.2374  0.0770  136 TRP A N   
532  C CA  . TRP A 90  ? 0.6914 0.5355 0.7134 -0.0433 0.2600  0.0917  136 TRP A CA  
533  C C   . TRP A 90  ? 0.6956 0.5326 0.6720 -0.0251 0.2579  0.0958  136 TRP A C   
534  O O   . TRP A 90  ? 0.7333 0.5553 0.6835 -0.0205 0.2779  0.1059  136 TRP A O   
535  C CB  . TRP A 90  ? 0.7350 0.5445 0.7405 -0.0467 0.2621  0.1008  136 TRP A CB  
536  C CG  . TRP A 90  ? 0.7854 0.5965 0.8338 -0.0660 0.2680  0.0973  136 TRP A CG  
537  C CD1 . TRP A 90  ? 0.8002 0.6396 0.8983 -0.0806 0.2754  0.0892  136 TRP A CD1 
538  C CD2 . TRP A 90  ? 0.8447 0.6271 0.8908 -0.0725 0.2665  0.1010  136 TRP A CD2 
539  N NE1 . TRP A 90  ? 0.8177 0.6486 0.9454 -0.0967 0.2775  0.0868  136 TRP A NE1 
540  C CE2 . TRP A 90  ? 0.8529 0.6473 0.9485 -0.0923 0.2726  0.0940  136 TRP A CE2 
541  C CE3 . TRP A 90  ? 0.8825 0.6301 0.8904 -0.0628 0.2598  0.1088  136 TRP A CE3 
542  C CZ2 . TRP A 90  ? 0.8843 0.6548 0.9909 -0.1035 0.2723  0.0941  136 TRP A CZ2 
543  C CZ3 . TRP A 90  ? 0.9153 0.6388 0.9333 -0.0727 0.2603  0.1096  136 TRP A CZ3 
544  C CH2 . TRP A 90  ? 0.9103 0.6441 0.9765 -0.0933 0.2666  0.1021  136 TRP A CH2 
545  N N   . ALA A 91  ? 0.6508 0.4983 0.6181 -0.0151 0.2340  0.0875  137 ALA A N   
546  C CA  . ALA A 91  ? 0.6484 0.4919 0.5773 0.0011  0.2275  0.0880  137 ALA A CA  
547  C C   . ALA A 91  ? 0.5961 0.4673 0.5416 0.0047  0.2075  0.0746  137 ALA A C   
548  O O   . ALA A 91  ? 0.5671 0.4542 0.5430 -0.0023 0.1940  0.0667  137 ALA A O   
549  C CB  . ALA A 91  ? 0.6755 0.4915 0.5635 0.0121  0.2179  0.0952  137 ALA A CB  
550  N N   . ALA A 92  ? 0.5851 0.4592 0.5080 0.0160  0.2056  0.0721  138 ALA A N   
551  C CA  . ALA A 92  ? 0.5454 0.4407 0.4798 0.0200  0.1877  0.0603  138 ALA A CA  
552  C C   . ALA A 92  ? 0.5155 0.4103 0.4454 0.0228  0.1641  0.0565  138 ALA A C   
553  O O   . ALA A 92  ? 0.4684 0.3817 0.4219 0.0196  0.1501  0.0480  138 ALA A O   
554  C CB  . ALA A 92  ? 0.5681 0.4606 0.4743 0.0320  0.1908  0.0584  138 ALA A CB  
555  N N   . SER A 93  ? 0.5436 0.4174 0.4429 0.0295  0.1604  0.0632  139 SER A N   
556  C CA  . SER A 93  ? 0.5420 0.4165 0.4379 0.0331  0.1397  0.0600  139 SER A CA  
557  C C   . SER A 93  ? 0.5131 0.3989 0.4423 0.0227  0.1331  0.0562  139 SER A C   
558  O O   . SER A 93  ? 0.4949 0.3921 0.4327 0.0237  0.1166  0.0500  139 SER A O   
559  C CB  . SER A 93  ? 0.5812 0.4307 0.4407 0.0431  0.1385  0.0685  139 SER A CB  
560  O OG  . SER A 93  ? 0.6192 0.4497 0.4769 0.0380  0.1535  0.0783  139 SER A OG  
561  N N   . GLU A 94  ? 0.5175 0.3997 0.4652 0.0127  0.1464  0.0595  140 GLU A N   
562  C CA  . GLU A 94  ? 0.4978 0.3888 0.4757 0.0029  0.1400  0.0546  140 GLU A CA  
563  C C   . GLU A 94  ? 0.4565 0.3747 0.4628 -0.0011 0.1303  0.0443  140 GLU A C   
564  O O   . GLU A 94  ? 0.4269 0.3543 0.4452 -0.0026 0.1163  0.0385  140 GLU A O   
565  C CB  . GLU A 94  ? 0.5238 0.4050 0.5176 -0.0082 0.1565  0.0592  140 GLU A CB  
566  C CG  . GLU A 94  ? 0.5833 0.4326 0.5488 -0.0051 0.1673  0.0709  140 GLU A CG  
567  C CD  . GLU A 94  ? 0.6239 0.4620 0.6069 -0.0182 0.1863  0.0761  140 GLU A CD  
568  O OE1 . GLU A 94  ? 0.6219 0.4799 0.6391 -0.0290 0.1932  0.0706  140 GLU A OE1 
569  O OE2 . GLU A 94  ? 0.6708 0.4795 0.6342 -0.0175 0.1945  0.0857  140 GLU A OE2 
570  N N   . CYS A 95  ? 0.4484 0.3781 0.4637 -0.0017 0.1386  0.0424  141 CYS A N   
571  C CA  . CYS A 95  ? 0.4187 0.3716 0.4574 -0.0030 0.1297  0.0334  141 CYS A CA  
572  C C   . CYS A 95  ? 0.4002 0.3562 0.4238 0.0051  0.1136  0.0299  141 CYS A C   
573  O O   . CYS A 95  ? 0.3844 0.3531 0.4229 0.0035  0.1009  0.0241  141 CYS A O   
574  C CB  . CYS A 95  ? 0.4239 0.3866 0.4730 -0.0030 0.1436  0.0325  141 CYS A CB  
575  S SG  . CYS A 95  ? 0.3923 0.3796 0.4647 -0.0007 0.1331  0.0223  141 CYS A SG  
576  N N   . MET A 96  ? 0.4081 0.3516 0.4016 0.0137  0.1139  0.0333  142 MET A N   
577  C CA  . MET A 96  ? 0.3981 0.3439 0.3787 0.0202  0.0987  0.0295  142 MET A CA  
578  C C   . MET A 96  ? 0.3798 0.3274 0.3644 0.0187  0.0859  0.0288  142 MET A C   
579  O O   . MET A 96  ? 0.3545 0.3122 0.3456 0.0189  0.0739  0.0241  142 MET A O   
580  C CB  . MET A 96  ? 0.4248 0.3563 0.3720 0.0299  0.1002  0.0323  142 MET A CB  
581  C CG  . MET A 96  ? 0.4635 0.3942 0.4028 0.0337  0.1111  0.0310  142 MET A CG  
582  S SD  . MET A 96  ? 0.5424 0.4512 0.4360 0.0459  0.1163  0.0358  142 MET A SD  
583  C CE  . MET A 96  ? 0.5056 0.4161 0.3867 0.0522  0.0922  0.0291  142 MET A CE  
584  N N   . GLN A 97  ? 0.3899 0.3263 0.3701 0.0174  0.0896  0.0337  143 GLN A N   
585  C CA  . GLN A 97  ? 0.3777 0.3154 0.3618 0.0171  0.0792  0.0325  143 GLN A CA  
586  C C   . GLN A 97  ? 0.3461 0.2984 0.3563 0.0098  0.0742  0.0268  143 GLN A C   
587  O O   . GLN A 97  ? 0.3380 0.2979 0.3516 0.0107  0.0637  0.0237  143 GLN A O   
588  C CB  . GLN A 97  ? 0.4033 0.3224 0.3759 0.0185  0.0848  0.0386  143 GLN A CB  
589  C CG  . GLN A 97  ? 0.4524 0.3541 0.3939 0.0284  0.0877  0.0453  143 GLN A CG  
590  C CD  . GLN A 97  ? 0.4797 0.3861 0.4080 0.0377  0.0732  0.0428  143 GLN A CD  
591  O OE1 . GLN A 97  ? 0.4743 0.3970 0.4176 0.0360  0.0625  0.0369  143 GLN A OE1 
592  N NE2 . GLN A 97  ? 0.5095 0.4020 0.4099 0.0479  0.0728  0.0474  143 GLN A NE2 
593  N N   . ASP A 98  ? 0.3454 0.3026 0.3739 0.0030  0.0818  0.0253  144 ASP A N   
594  C CA  . ASP A 98  ? 0.3208 0.2925 0.3730 -0.0025 0.0752  0.0190  144 ASP A CA  
595  C C   . ASP A 98  ? 0.2989 0.2833 0.3535 0.0006  0.0660  0.0153  144 ASP A C   
596  O O   . ASP A 98  ? 0.2867 0.2780 0.3463 0.0002  0.0562  0.0123  144 ASP A O   
597  C CB  . ASP A 98  ? 0.3230 0.3001 0.3980 -0.0101 0.0842  0.0170  144 ASP A CB  
598  C CG  . ASP A 98  ? 0.3558 0.3215 0.4368 -0.0166 0.0895  0.0181  144 ASP A CG  
599  O OD1 . ASP A 98  ? 0.3669 0.3205 0.4342 -0.0141 0.0850  0.0197  144 ASP A OD1 
600  O OD2 . ASP A 98  ? 0.3833 0.3523 0.4846 -0.0243 0.0985  0.0169  144 ASP A OD2 
601  N N   . PHE A 99  ? 0.3016 0.2869 0.3505 0.0041  0.0697  0.0157  145 PHE A N   
602  C CA  . PHE A 99  ? 0.3035 0.2958 0.3519 0.0072  0.0612  0.0127  145 PHE A CA  
603  C C   . PHE A 99  ? 0.3026 0.2930 0.3395 0.0093  0.0514  0.0133  145 PHE A C   
604  O O   . PHE A 99  ? 0.2899 0.2869 0.3329 0.0083  0.0435  0.0115  145 PHE A O   
605  C CB  . PHE A 99  ? 0.3199 0.3089 0.3587 0.0120  0.0666  0.0123  145 PHE A CB  
606  C CG  . PHE A 99  ? 0.3235 0.3213 0.3794 0.0115  0.0731  0.0093  145 PHE A CG  
607  C CD1 . PHE A 99  ? 0.3451 0.3526 0.4152 0.0122  0.0653  0.0050  145 PHE A CD1 
608  C CD2 . PHE A 99  ? 0.3504 0.3466 0.4083 0.0111  0.0876  0.0110  145 PHE A CD2 
609  C CE1 . PHE A 99  ? 0.3336 0.3511 0.4215 0.0136  0.0701  0.0016  145 PHE A CE1 
610  C CE2 . PHE A 99  ? 0.3439 0.3519 0.4216 0.0112  0.0944  0.0076  145 PHE A CE2 
611  C CZ  . PHE A 99  ? 0.3328 0.3524 0.4266 0.0131  0.0848  0.0023  145 PHE A CZ  
612  N N   . ASN A 100 ? 0.3118 0.2933 0.3324 0.0126  0.0524  0.0164  146 ASN A N   
613  C CA  . ASN A 100 ? 0.3147 0.2975 0.3278 0.0151  0.0436  0.0164  146 ASN A CA  
614  C C   . ASN A 100 ? 0.3009 0.2895 0.3233 0.0125  0.0394  0.0159  146 ASN A C   
615  O O   . ASN A 100 ? 0.2944 0.2904 0.3197 0.0121  0.0329  0.0148  146 ASN A O   
616  C CB  . ASN A 100 ? 0.3428 0.3154 0.3373 0.0210  0.0449  0.0194  146 ASN A CB  
617  C CG  . ASN A 100 ? 0.3574 0.3349 0.3480 0.0244  0.0350  0.0183  146 ASN A CG  
618  O OD1 . ASN A 100 ? 0.3596 0.3424 0.3500 0.0249  0.0285  0.0151  146 ASN A OD1 
619  N ND2 . ASN A 100 ? 0.3464 0.3223 0.3356 0.0269  0.0340  0.0203  146 ASN A ND2 
620  N N   . THR A 101 ? 0.2952 0.2794 0.3215 0.0106  0.0440  0.0166  147 THR A N   
621  C CA  . THR A 101 ? 0.2938 0.2813 0.3268 0.0089  0.0404  0.0147  147 THR A CA  
622  C C   . THR A 101 ? 0.2712 0.2692 0.3147 0.0060  0.0352  0.0116  147 THR A C   
623  O O   . THR A 101 ? 0.2631 0.2661 0.3056 0.0069  0.0304  0.0109  147 THR A O   
624  C CB  . THR A 101 ? 0.2952 0.2736 0.3321 0.0061  0.0460  0.0145  147 THR A CB  
625  O OG1 . THR A 101 ? 0.3319 0.2969 0.3549 0.0102  0.0503  0.0188  147 THR A OG1 
626  C CG2 . THR A 101 ? 0.3067 0.2875 0.3496 0.0046  0.0411  0.0102  147 THR A CG2 
627  N N   . MET A 102 ? 0.2693 0.2705 0.3220 0.0037  0.0368  0.0101  148 MET A N   
628  C CA  . MET A 102 ? 0.2710 0.2802 0.3314 0.0030  0.0308  0.0078  148 MET A CA  
629  C C   . MET A 102 ? 0.2696 0.2804 0.3224 0.0048  0.0263  0.0099  148 MET A C   
630  O O   . MET A 102 ? 0.2785 0.2923 0.3301 0.0049  0.0220  0.0103  148 MET A O   
631  C CB  . MET A 102 ? 0.2668 0.2799 0.3389 0.0024  0.0332  0.0057  148 MET A CB  
632  C CG  . MET A 102 ? 0.2619 0.2816 0.3408 0.0040  0.0260  0.0037  148 MET A CG  
633  S SD  . MET A 102 ? 0.3004 0.3267 0.3955 0.0054  0.0297  0.0006  148 MET A SD  
634  C CE  . MET A 102 ? 0.3223 0.3403 0.4038 0.0088  0.0339  0.0033  148 MET A CE  
635  N N   . PHE A 103 ? 0.2737 0.2814 0.3208 0.0060  0.0278  0.0113  149 PHE A N   
636  C CA  . PHE A 103 ? 0.2751 0.2838 0.3186 0.0058  0.0235  0.0124  149 PHE A CA  
637  C C   . PHE A 103 ? 0.2647 0.2773 0.3053 0.0056  0.0220  0.0139  149 PHE A C   
638  O O   . PHE A 103 ? 0.2572 0.2737 0.2992 0.0037  0.0199  0.0155  149 PHE A O   
639  C CB  . PHE A 103 ? 0.2901 0.2939 0.3283 0.0072  0.0239  0.0113  149 PHE A CB  
640  C CG  . PHE A 103 ? 0.3053 0.3060 0.3465 0.0087  0.0263  0.0093  149 PHE A CG  
641  C CD1 . PHE A 103 ? 0.3061 0.3077 0.3541 0.0086  0.0232  0.0089  149 PHE A CD1 
642  C CD2 . PHE A 103 ? 0.3294 0.3258 0.3653 0.0116  0.0320  0.0081  149 PHE A CD2 
643  C CE1 . PHE A 103 ? 0.3349 0.3351 0.3875 0.0117  0.0251  0.0064  149 PHE A CE1 
644  C CE2 . PHE A 103 ? 0.3298 0.3253 0.3698 0.0139  0.0358  0.0057  149 PHE A CE2 
645  C CZ  . PHE A 103 ? 0.3135 0.3119 0.3634 0.0142  0.0319  0.0044  149 PHE A CZ  
646  N N   . THR A 104 ? 0.2654 0.2767 0.3018 0.0080  0.0239  0.0139  150 THR A N   
647  C CA  . THR A 104 ? 0.2672 0.2838 0.3026 0.0098  0.0226  0.0145  150 THR A CA  
648  C C   . THR A 104 ? 0.2558 0.2765 0.2934 0.0092  0.0231  0.0145  150 THR A C   
649  O O   . THR A 104 ? 0.2445 0.2728 0.2838 0.0091  0.0229  0.0155  150 THR A O   
650  C CB  . THR A 104 ? 0.2799 0.2914 0.3083 0.0148  0.0239  0.0148  150 THR A CB  
651  O OG1 . THR A 104 ? 0.2927 0.3006 0.3149 0.0166  0.0223  0.0147  150 THR A OG1 
652  C CG2 . THR A 104 ? 0.2916 0.3100 0.3210 0.0185  0.0222  0.0147  150 THR A CG2 
653  N N   . ASN A 105 ? 0.2641 0.2802 0.3020 0.0089  0.0241  0.0129  151 ASN A N   
654  C CA  . ASN A 105 ? 0.2650 0.2831 0.3016 0.0094  0.0230  0.0114  151 ASN A CA  
655  C C   . ASN A 105 ? 0.2560 0.2785 0.2913 0.0079  0.0213  0.0139  151 ASN A C   
656  O O   . ASN A 105 ? 0.2544 0.2807 0.2851 0.0093  0.0224  0.0149  151 ASN A O   
657  C CB  . ASN A 105 ? 0.2562 0.2697 0.2961 0.0082  0.0217  0.0076  151 ASN A CB  
658  C CG  . ASN A 105 ? 0.2922 0.2981 0.3326 0.0086  0.0246  0.0054  151 ASN A CG  
659  O OD1 . ASN A 105 ? 0.2880 0.2908 0.3230 0.0118  0.0269  0.0068  151 ASN A OD1 
660  N ND2 . ASN A 105 ? 0.2724 0.2750 0.3206 0.0054  0.0244  0.0018  151 ASN A ND2 
661  N N   . CYS A 106 ? 0.2537 0.2743 0.2921 0.0057  0.0196  0.0152  152 CYS A N   
662  C CA  . CYS A 106 ? 0.2553 0.2755 0.2912 0.0044  0.0182  0.0187  152 CYS A CA  
663  C C   . CYS A 106 ? 0.2461 0.2708 0.2823 0.0019  0.0213  0.0222  152 CYS A C   
664  O O   . CYS A 106 ? 0.2604 0.2867 0.2920 0.0014  0.0237  0.0257  152 CYS A O   
665  C CB  . CYS A 106 ? 0.2690 0.2841 0.3087 0.0037  0.0159  0.0186  152 CYS A CB  
666  S SG  . CYS A 106 ? 0.3124 0.3211 0.3474 0.0031  0.0137  0.0236  152 CYS A SG  
667  N N   . TYR A 107 ? 0.2334 0.2610 0.2754 0.0006  0.0214  0.0210  153 TYR A N   
668  C CA  . TYR A 107 ? 0.2229 0.2584 0.2709 -0.0026 0.0230  0.0227  153 TYR A CA  
669  C C   . TYR A 107 ? 0.2328 0.2784 0.2815 -0.0001 0.0271  0.0231  153 TYR A C   
670  O O   . TYR A 107 ? 0.2224 0.2754 0.2759 -0.0032 0.0312  0.0261  153 TYR A O   
671  C CB  . TYR A 107 ? 0.2192 0.2565 0.2724 -0.0028 0.0196  0.0196  153 TYR A CB  
672  C CG  . TYR A 107 ? 0.2282 0.2553 0.2789 -0.0038 0.0164  0.0179  153 TYR A CG  
673  C CD1 . TYR A 107 ? 0.2691 0.2886 0.3197 -0.0072 0.0160  0.0200  153 TYR A CD1 
674  C CD2 . TYR A 107 ? 0.2540 0.2774 0.3005 -0.0002 0.0145  0.0146  153 TYR A CD2 
675  C CE1 . TYR A 107 ? 0.2664 0.2764 0.3148 -0.0065 0.0134  0.0176  153 TYR A CE1 
676  C CE2 . TYR A 107 ? 0.2620 0.2765 0.3049 0.0001  0.0129  0.0125  153 TYR A CE2 
677  C CZ  . TYR A 107 ? 0.2758 0.2842 0.3207 -0.0029 0.0123  0.0135  153 TYR A CZ  
678  O OH  . TYR A 107 ? 0.2938 0.2929 0.3352 -0.0012 0.0111  0.0106  153 TYR A OH  
679  N N   . ILE A 108 ? 0.2463 0.2912 0.2907 0.0055  0.0270  0.0201  154 ILE A N   
680  C CA  . ILE A 108 ? 0.2435 0.2962 0.2873 0.0099  0.0307  0.0192  154 ILE A CA  
681  C C   . ILE A 108 ? 0.2583 0.3102 0.2933 0.0106  0.0347  0.0210  154 ILE A C   
682  O O   . ILE A 108 ? 0.2506 0.3118 0.2867 0.0114  0.0407  0.0228  154 ILE A O   
683  C CB  . ILE A 108 ? 0.2537 0.3008 0.2932 0.0161  0.0292  0.0152  154 ILE A CB  
684  C CG1 . ILE A 108 ? 0.2397 0.2886 0.2842 0.0180  0.0262  0.0145  154 ILE A CG1 
685  C CG2 . ILE A 108 ? 0.2641 0.3148 0.2997 0.0221  0.0327  0.0131  154 ILE A CG2 
686  C CD1 . ILE A 108 ? 0.2786 0.3160 0.3157 0.0235  0.0254  0.0128  154 ILE A CD1 
687  N N   . TYR A 109 ? 0.2656 0.3072 0.2915 0.0108  0.0315  0.0205  155 TYR A N   
688  C CA  . TYR A 109 ? 0.2793 0.3180 0.2921 0.0136  0.0330  0.0211  155 TYR A CA  
689  C C   . TYR A 109 ? 0.2869 0.3256 0.2955 0.0102  0.0371  0.0283  155 TYR A C   
690  O O   . TYR A 109 ? 0.2675 0.3088 0.2666 0.0124  0.0435  0.0312  155 TYR A O   
691  C CB  . TYR A 109 ? 0.2893 0.3185 0.2955 0.0156  0.0260  0.0170  155 TYR A CB  
692  C CG  . TYR A 109 ? 0.3121 0.3378 0.3014 0.0201  0.0254  0.0168  155 TYR A CG  
693  C CD1 . TYR A 109 ? 0.3096 0.3365 0.2894 0.0255  0.0283  0.0127  155 TYR A CD1 
694  C CD2 . TYR A 109 ? 0.3170 0.3369 0.2972 0.0203  0.0222  0.0208  155 TYR A CD2 
695  C CE1 . TYR A 109 ? 0.3492 0.3718 0.3093 0.0310  0.0279  0.0120  155 TYR A CE1 
696  C CE2 . TYR A 109 ? 0.3515 0.3667 0.3115 0.0260  0.0212  0.0212  155 TYR A CE2 
697  C CZ  . TYR A 109 ? 0.3549 0.3717 0.3041 0.0312  0.0242  0.0165  155 TYR A CZ  
698  O OH  . TYR A 109 ? 0.4220 0.4329 0.3471 0.0382  0.0232  0.0161  155 TYR A OH  
699  N N   . ASN A 110 ? 0.2900 0.3240 0.3042 0.0052  0.0344  0.0315  156 ASN A N   
700  C CA  . ASN A 110 ? 0.3190 0.3467 0.3267 0.0020  0.0374  0.0389  156 ASN A CA  
701  C C   . ASN A 110 ? 0.3446 0.3801 0.3627 -0.0046 0.0457  0.0438  156 ASN A C   
702  O O   . ASN A 110 ? 0.3338 0.3810 0.3676 -0.0069 0.0464  0.0405  156 ASN A O   
703  C CB  . ASN A 110 ? 0.3149 0.3316 0.3235 0.0007  0.0305  0.0395  156 ASN A CB  
704  C CG  . ASN A 110 ? 0.3117 0.3231 0.3120 0.0069  0.0230  0.0354  156 ASN A CG  
705  O OD1 . ASN A 110 ? 0.3300 0.3362 0.3149 0.0116  0.0217  0.0376  156 ASN A OD1 
706  N ND2 . ASN A 110 ? 0.2962 0.3095 0.3067 0.0073  0.0182  0.0293  156 ASN A ND2 
707  N N   . LYS A 111 ? 0.3997 0.4284 0.4091 -0.0074 0.0519  0.0519  157 LYS A N   
708  C CA  . LYS A 111 ? 0.4257 0.4609 0.4476 -0.0160 0.0612  0.0575  157 LYS A CA  
709  C C   . LYS A 111 ? 0.4171 0.4475 0.4546 -0.0240 0.0560  0.0566  157 LYS A C   
710  O O   . LYS A 111 ? 0.4161 0.4325 0.4471 -0.0223 0.0482  0.0557  157 LYS A O   
711  C CB  . LYS A 111 ? 0.4661 0.4910 0.4709 -0.0170 0.0710  0.0679  157 LYS A CB  
712  C CG  . LYS A 111 ? 0.5177 0.5463 0.5032 -0.0083 0.0772  0.0686  157 LYS A CG  
713  C CD  . LYS A 111 ? 0.5752 0.5881 0.5355 -0.0069 0.0852  0.0796  157 LYS A CD  
714  C CE  . LYS A 111 ? 0.6125 0.6250 0.5465 0.0044  0.0882  0.0784  157 LYS A CE  
715  N NZ  . LYS A 111 ? 0.6778 0.6726 0.5817 0.0075  0.0956  0.0900  157 LYS A NZ  
716  N N   . PRO A 112 ? 0.4155 0.4583 0.4744 -0.0322 0.0597  0.0558  158 PRO A N   
717  C CA  . PRO A 112 ? 0.4165 0.4546 0.4900 -0.0400 0.0536  0.0531  158 PRO A CA  
718  C C   . PRO A 112 ? 0.4318 0.4460 0.4950 -0.0435 0.0525  0.0589  158 PRO A C   
719  O O   . PRO A 112 ? 0.4284 0.4327 0.4943 -0.0443 0.0440  0.0544  158 PRO A O   
720  C CB  . PRO A 112 ? 0.4205 0.4761 0.5183 -0.0496 0.0604  0.0534  158 PRO A CB  
721  C CG  . PRO A 112 ? 0.4107 0.4858 0.5103 -0.0434 0.0666  0.0522  158 PRO A CG  
722  C CD  . PRO A 112 ? 0.4151 0.4785 0.4871 -0.0343 0.0695  0.0564  158 PRO A CD  
723  N N   . THR A 113 ? 0.4468 0.4506 0.4962 -0.0443 0.0613  0.0690  159 THR A N   
724  C CA  . THR A 113 ? 0.4740 0.4524 0.5120 -0.0472 0.0617  0.0766  159 THR A CA  
725  C C   . THR A 113 ? 0.4739 0.4359 0.4880 -0.0355 0.0542  0.0779  159 THR A C   
726  O O   . THR A 113 ? 0.4961 0.4357 0.4983 -0.0350 0.0532  0.0845  159 THR A O   
727  C CB  . THR A 113 ? 0.5020 0.4750 0.5351 -0.0540 0.0765  0.0888  159 THR A CB  
728  O OG1 . THR A 113 ? 0.5106 0.4919 0.5268 -0.0458 0.0832  0.0921  159 THR A OG1 
729  C CG2 . THR A 113 ? 0.5116 0.5002 0.5745 -0.0681 0.0839  0.0876  159 THR A CG2 
730  N N   . ASP A 114 ? 0.4432 0.4158 0.4517 -0.0261 0.0485  0.0715  160 ASP A N   
731  C CA  . ASP A 114 ? 0.4379 0.4000 0.4294 -0.0154 0.0401  0.0706  160 ASP A CA  
732  C C   . ASP A 114 ? 0.4195 0.3726 0.4183 -0.0142 0.0308  0.0655  160 ASP A C   
733  O O   . ASP A 114 ? 0.3907 0.3520 0.4056 -0.0181 0.0284  0.0583  160 ASP A O   
734  C CB  . ASP A 114 ? 0.4277 0.4045 0.4160 -0.0078 0.0366  0.0636  160 ASP A CB  
735  C CG  . ASP A 114 ? 0.4648 0.4463 0.4386 -0.0049 0.0445  0.0679  160 ASP A CG  
736  O OD1 . ASP A 114 ? 0.5006 0.4710 0.4600 -0.0060 0.0518  0.0778  160 ASP A OD1 
737  O OD2 . ASP A 114 ? 0.4761 0.4706 0.4510 -0.0010 0.0440  0.0614  160 ASP A OD2 
738  N N   . ASP A 115 ? 0.4220 0.3581 0.4076 -0.0074 0.0256  0.0690  161 ASP A N   
739  C CA  . ASP A 115 ? 0.4142 0.3414 0.4058 -0.0041 0.0176  0.0640  161 ASP A CA  
740  C C   . ASP A 115 ? 0.3671 0.3104 0.3702 0.0000  0.0120  0.0531  161 ASP A C   
741  O O   . ASP A 115 ? 0.3415 0.2831 0.3543 -0.0003 0.0091  0.0473  161 ASP A O   
742  C CB  . ASP A 115 ? 0.4424 0.3513 0.4178 0.0056  0.0120  0.0693  161 ASP A CB  
743  C CG  . ASP A 115 ? 0.5140 0.3992 0.4762 0.0019  0.0176  0.0812  161 ASP A CG  
744  O OD1 . ASP A 115 ? 0.5451 0.4276 0.5155 -0.0101 0.0258  0.0843  161 ASP A OD1 
745  O OD2 . ASP A 115 ? 0.5967 0.4653 0.5406 0.0112  0.0135  0.0875  161 ASP A OD2 
746  N N   . ILE A 116 ? 0.3433 0.3001 0.3440 0.0041  0.0112  0.0503  162 ILE A N   
747  C CA  . ILE A 116 ? 0.3294 0.2995 0.3411 0.0068  0.0075  0.0412  162 ILE A CA  
748  C C   . ILE A 116 ? 0.3052 0.2823 0.3292 0.0006  0.0107  0.0367  162 ILE A C   
749  O O   . ILE A 116 ? 0.2936 0.2740 0.3251 0.0025  0.0087  0.0306  162 ILE A O   
750  C CB  . ILE A 116 ? 0.3241 0.3051 0.3313 0.0106  0.0064  0.0387  162 ILE A CB  
751  C CG1 . ILE A 116 ? 0.3272 0.3179 0.3463 0.0133  0.0024  0.0301  162 ILE A CG1 
752  C CG2 . ILE A 116 ? 0.3242 0.3130 0.3297 0.0058  0.0135  0.0403  162 ILE A CG2 
753  C CD1 . ILE A 116 ? 0.3639 0.3520 0.3873 0.0197  -0.0046 0.0275  162 ILE A CD1 
754  N N   . VAL A 117 ? 0.3022 0.2820 0.3282 -0.0062 0.0158  0.0396  163 VAL A N   
755  C CA  . VAL A 117 ? 0.2962 0.2834 0.3331 -0.0111 0.0167  0.0349  163 VAL A CA  
756  C C   . VAL A 117 ? 0.3005 0.2769 0.3411 -0.0126 0.0131  0.0316  163 VAL A C   
757  O O   . VAL A 117 ? 0.2930 0.2729 0.3374 -0.0111 0.0110  0.0253  163 VAL A O   
758  C CB  . VAL A 117 ? 0.3000 0.2955 0.3422 -0.0178 0.0222  0.0382  163 VAL A CB  
759  C CG1 . VAL A 117 ? 0.3270 0.3290 0.3819 -0.0227 0.0203  0.0329  163 VAL A CG1 
760  C CG2 . VAL A 117 ? 0.3091 0.3167 0.3476 -0.0142 0.0256  0.0385  163 VAL A CG2 
761  N N   . LEU A 118 ? 0.3186 0.2798 0.3556 -0.0144 0.0128  0.0361  164 LEU A N   
762  C CA  . LEU A 118 ? 0.3423 0.2891 0.3806 -0.0146 0.0091  0.0325  164 LEU A CA  
763  C C   . LEU A 118 ? 0.3287 0.2746 0.3650 -0.0052 0.0056  0.0271  164 LEU A C   
764  O O   . LEU A 118 ? 0.3276 0.2705 0.3660 -0.0036 0.0037  0.0204  164 LEU A O   
765  C CB  . LEU A 118 ? 0.3836 0.3105 0.4162 -0.0172 0.0100  0.0398  164 LEU A CB  
766  C CG  . LEU A 118 ? 0.4622 0.3698 0.4961 -0.0189 0.0064  0.0364  164 LEU A CG  
767  C CD1 . LEU A 118 ? 0.4925 0.4054 0.5378 -0.0278 0.0052  0.0293  164 LEU A CD1 
768  C CD2 . LEU A 118 ? 0.5026 0.3876 0.5290 -0.0217 0.0086  0.0459  164 LEU A CD2 
769  N N   . MET A 119 ? 0.3238 0.2730 0.3564 0.0014  0.0048  0.0296  165 MET A N   
770  C CA  . MET A 119 ? 0.3204 0.2731 0.3562 0.0098  0.0024  0.0245  165 MET A CA  
771  C C   . MET A 119 ? 0.3009 0.2674 0.3429 0.0093  0.0052  0.0184  165 MET A C   
772  O O   . MET A 119 ? 0.3044 0.2703 0.3493 0.0131  0.0060  0.0130  165 MET A O   
773  C CB  . MET A 119 ? 0.3252 0.2813 0.3581 0.0160  -0.0008 0.0276  165 MET A CB  
774  C CG  . MET A 119 ? 0.3534 0.2923 0.3758 0.0193  -0.0040 0.0345  165 MET A CG  
775  S SD  . MET A 119 ? 0.3737 0.3160 0.3872 0.0278  -0.0098 0.0382  165 MET A SD  
776  C CE  . MET A 119 ? 0.4010 0.3489 0.4272 0.0392  -0.0170 0.0306  165 MET A CE  
777  N N   . ALA A 120 ? 0.2865 0.2636 0.3288 0.0055  0.0075  0.0197  166 ALA A N   
778  C CA  . ALA A 120 ? 0.2837 0.2701 0.3288 0.0052  0.0105  0.0156  166 ALA A CA  
779  C C   . ALA A 120 ? 0.2838 0.2655 0.3268 0.0038  0.0106  0.0118  166 ALA A C   
780  O O   . ALA A 120 ? 0.2860 0.2683 0.3277 0.0072  0.0128  0.0078  166 ALA A O   
781  C CB  . ALA A 120 ? 0.2618 0.2574 0.3063 0.0023  0.0122  0.0178  166 ALA A CB  
782  N N   . GLN A 121 ? 0.2986 0.2753 0.3411 -0.0014 0.0082  0.0129  167 GLN A N   
783  C CA  . GLN A 121 ? 0.3178 0.2894 0.3584 -0.0030 0.0056  0.0077  167 GLN A CA  
784  C C   . GLN A 121 ? 0.3230 0.2828 0.3590 0.0023  0.0046  0.0027  167 GLN A C   
785  O O   . GLN A 121 ? 0.3272 0.2851 0.3570 0.0054  0.0043  -0.0031 167 GLN A O   
786  C CB  . GLN A 121 ? 0.3392 0.3078 0.3850 -0.0112 0.0028  0.0091  167 GLN A CB  
787  C CG  . GLN A 121 ? 0.3507 0.3340 0.4028 -0.0155 0.0034  0.0103  167 GLN A CG  
788  C CD  . GLN A 121 ? 0.3893 0.3779 0.4398 -0.0135 -0.0008 0.0036  167 GLN A CD  
789  O OE1 . GLN A 121 ? 0.4049 0.3989 0.4492 -0.0076 0.0008  0.0029  167 GLN A OE1 
790  N NE2 . GLN A 121 ? 0.3735 0.3588 0.4285 -0.0182 -0.0067 -0.0016 167 GLN A NE2 
791  N N   . THR A 122 ? 0.3202 0.2711 0.3574 0.0046  0.0041  0.0048  168 THR A N   
792  C CA  . THR A 122 ? 0.3286 0.2682 0.3626 0.0113  0.0035  -0.0002 168 THR A CA  
793  C C   . THR A 122 ? 0.3199 0.2689 0.3539 0.0183  0.0088  -0.0037 168 THR A C   
794  O O   . THR A 122 ? 0.3332 0.2773 0.3608 0.0229  0.0106  -0.0098 168 THR A O   
795  C CB  . THR A 122 ? 0.3387 0.2676 0.3742 0.0148  0.0015  0.0036  168 THR A CB  
796  O OG1 . THR A 122 ? 0.3573 0.2741 0.3913 0.0074  -0.0012 0.0082  168 THR A OG1 
797  C CG2 . THR A 122 ? 0.3426 0.2603 0.3759 0.0236  0.0010  -0.0026 168 THR A CG2 
798  N N   . LEU A 123 ? 0.3115 0.2735 0.3523 0.0188  0.0118  0.0000  169 LEU A N   
799  C CA  . LEU A 123 ? 0.3126 0.2844 0.3573 0.0231  0.0183  -0.0024 169 LEU A CA  
800  C C   . LEU A 123 ? 0.3165 0.2897 0.3521 0.0217  0.0223  -0.0039 169 LEU A C   
801  O O   . LEU A 123 ? 0.3086 0.2814 0.3398 0.0263  0.0287  -0.0070 169 LEU A O   
802  C CB  . LEU A 123 ? 0.3002 0.2845 0.3559 0.0221  0.0189  0.0009  169 LEU A CB  
803  C CG  . LEU A 123 ? 0.3165 0.3004 0.3792 0.0259  0.0135  0.0023  169 LEU A CG  
804  C CD1 . LEU A 123 ? 0.2909 0.2857 0.3600 0.0240  0.0113  0.0048  169 LEU A CD1 
805  C CD2 . LEU A 123 ? 0.3215 0.3073 0.3930 0.0341  0.0157  -0.0025 169 LEU A CD2 
806  N N   . GLU A 124 ? 0.3182 0.2931 0.3501 0.0163  0.0190  -0.0014 170 GLU A N   
807  C CA  . GLU A 124 ? 0.3397 0.3153 0.3615 0.0168  0.0210  -0.0023 170 GLU A CA  
808  C C   . GLU A 124 ? 0.3503 0.3156 0.3589 0.0204  0.0186  -0.0083 170 GLU A C   
809  O O   . GLU A 124 ? 0.3523 0.3153 0.3482 0.0249  0.0225  -0.0098 170 GLU A O   
810  C CB  . GLU A 124 ? 0.3415 0.3233 0.3646 0.0120  0.0173  0.0009  170 GLU A CB  
811  C CG  . GLU A 124 ? 0.3731 0.3565 0.3868 0.0147  0.0198  0.0015  170 GLU A CG  
812  C CD  . GLU A 124 ? 0.3941 0.3854 0.4119 0.0120  0.0179  0.0049  170 GLU A CD  
813  O OE1 . GLU A 124 ? 0.3793 0.3755 0.4051 0.0076  0.0133  0.0056  170 GLU A OE1 
814  O OE2 . GLU A 124 ? 0.4199 0.4112 0.4322 0.0147  0.0217  0.0070  170 GLU A OE2 
815  N N   . LYS A 125 ? 0.3614 0.3183 0.3712 0.0188  0.0122  -0.0117 171 LYS A N   
816  C CA  . LYS A 125 ? 0.3796 0.3243 0.3768 0.0226  0.0087  -0.0195 171 LYS A CA  
817  C C   . LYS A 125 ? 0.3843 0.3251 0.3728 0.0316  0.0171  -0.0226 171 LYS A C   
818  O O   . LYS A 125 ? 0.3948 0.3298 0.3660 0.0370  0.0186  -0.0271 171 LYS A O   
819  C CB  . LYS A 125 ? 0.3991 0.3322 0.4011 0.0189  0.0016  -0.0226 171 LYS A CB  
820  C CG  . LYS A 125 ? 0.4417 0.3598 0.4303 0.0230  -0.0032 -0.0327 171 LYS A CG  
821  C CD  . LYS A 125 ? 0.4779 0.3808 0.4721 0.0181  -0.0104 -0.0362 171 LYS A CD  
822  C CE  . LYS A 125 ? 0.5365 0.4226 0.5158 0.0231  -0.0158 -0.0482 171 LYS A CE  
823  N NZ  . LYS A 125 ? 0.5683 0.4348 0.5524 0.0188  -0.0222 -0.0524 171 LYS A NZ  
824  N N   A ILE A 126 ? 0.3752 0.3197 0.3755 0.0339  0.0225  -0.0205 172 ILE A N   
825  N N   B ILE A 126 ? 0.3784 0.3229 0.3787 0.0339  0.0225  -0.0205 172 ILE A N   
826  C CA  A ILE A 126 ? 0.3801 0.3252 0.3783 0.0422  0.0324  -0.0233 172 ILE A CA  
827  C CA  B ILE A 126 ? 0.3859 0.3309 0.3840 0.0422  0.0324  -0.0233 172 ILE A CA  
828  C C   A ILE A 126 ? 0.3793 0.3322 0.3719 0.0431  0.0425  -0.0199 172 ILE A C   
829  C C   B ILE A 126 ? 0.3824 0.3353 0.3749 0.0431  0.0425  -0.0199 172 ILE A C   
830  O O   A ILE A 126 ? 0.3957 0.3439 0.3740 0.0497  0.0506  -0.0228 172 ILE A O   
831  O O   B ILE A 126 ? 0.3987 0.3469 0.3768 0.0497  0.0505  -0.0228 172 ILE A O   
832  C CB  A ILE A 126 ? 0.3693 0.3213 0.3868 0.0443  0.0345  -0.0217 172 ILE A CB  
833  C CB  B ILE A 126 ? 0.3790 0.3312 0.3965 0.0444  0.0347  -0.0217 172 ILE A CB  
834  C CG1 A ILE A 126 ? 0.3746 0.3134 0.3932 0.0460  0.0259  -0.0246 172 ILE A CG1 
835  C CG1 B ILE A 126 ? 0.3909 0.3309 0.4108 0.0448  0.0254  -0.0236 172 ILE A CG1 
836  C CG2 A ILE A 126 ? 0.3779 0.3372 0.3999 0.0520  0.0466  -0.0242 172 ILE A CG2 
837  C CG2 B ILE A 126 ? 0.3911 0.3484 0.4116 0.0529  0.0462  -0.0251 172 ILE A CG2 
838  C CD1 A ILE A 126 ? 0.3529 0.2971 0.3883 0.0484  0.0242  -0.0214 172 ILE A CD1 
839  C CD1 B ILE A 126 ? 0.4179 0.3405 0.4237 0.0507  0.0233  -0.0319 172 ILE A CD1 
840  N N   . PHE A 127 ? 0.3596 0.3222 0.3613 0.0368  0.0426  -0.0135 173 PHE A N   
841  C CA  . PHE A 127 ? 0.3630 0.3293 0.3589 0.0365  0.0515  -0.0091 173 PHE A CA  
842  C C   . PHE A 127 ? 0.3787 0.3338 0.3482 0.0411  0.0510  -0.0109 173 PHE A C   
843  O O   . PHE A 127 ? 0.3863 0.3368 0.3417 0.0465  0.0617  -0.0102 173 PHE A O   
844  C CB  . PHE A 127 ? 0.3441 0.3184 0.3508 0.0294  0.0482  -0.0035 173 PHE A CB  
845  C CG  . PHE A 127 ? 0.3607 0.3340 0.3592 0.0289  0.0554  0.0013  173 PHE A CG  
846  C CD1 . PHE A 127 ? 0.3658 0.3424 0.3714 0.0285  0.0682  0.0038  173 PHE A CD1 
847  C CD2 . PHE A 127 ? 0.3840 0.3528 0.3692 0.0289  0.0495  0.0032  173 PHE A CD2 
848  C CE1 . PHE A 127 ? 0.3728 0.3444 0.3697 0.0275  0.0759  0.0093  173 PHE A CE1 
849  C CE2 . PHE A 127 ? 0.4086 0.3731 0.3841 0.0299  0.0559  0.0084  173 PHE A CE2 
850  C CZ  . PHE A 127 ? 0.3935 0.3574 0.3735 0.0289  0.0695  0.0119  173 PHE A CZ  
851  N N   . LEU A 128 ? 0.3756 0.3263 0.3382 0.0394  0.0384  -0.0136 174 LEU A N   
852  C CA  . LEU A 128 ? 0.4092 0.3510 0.3476 0.0444  0.0339  -0.0165 174 LEU A CA  
853  C C   . LEU A 128 ? 0.4437 0.3734 0.3628 0.0528  0.0361  -0.0240 174 LEU A C   
854  O O   . LEU A 128 ? 0.4589 0.3805 0.3530 0.0602  0.0406  -0.0244 174 LEU A O   
855  C CB  . LEU A 128 ? 0.4081 0.3521 0.3502 0.0396  0.0189  -0.0191 174 LEU A CB  
856  C CG  . LEU A 128 ? 0.4014 0.3566 0.3565 0.0340  0.0171  -0.0124 174 LEU A CG  
857  C CD1 . LEU A 128 ? 0.4272 0.3880 0.3933 0.0281  0.0046  -0.0153 174 LEU A CD1 
858  C CD2 . LEU A 128 ? 0.4214 0.3741 0.3599 0.0394  0.0208  -0.0080 174 LEU A CD2 
859  N N   . GLN A 129 ? 0.4449 0.3715 0.3731 0.0526  0.0331  -0.0299 175 GLN A N   
860  C CA  . GLN A 129 ? 0.4899 0.4040 0.4008 0.0615  0.0354  -0.0384 175 GLN A CA  
861  C C   . GLN A 129 ? 0.5004 0.4157 0.4021 0.0690  0.0534  -0.0355 175 GLN A C   
862  O O   . GLN A 129 ? 0.5214 0.4260 0.3955 0.0778  0.0579  -0.0391 175 GLN A O   
863  C CB  . GLN A 129 ? 0.5002 0.4096 0.4253 0.0606  0.0304  -0.0440 175 GLN A CB  
864  C CG  . GLN A 129 ? 0.5433 0.4448 0.4701 0.0544  0.0140  -0.0494 175 GLN A CG  
865  C CD  . GLN A 129 ? 0.5785 0.4705 0.5171 0.0532  0.0098  -0.0536 175 GLN A CD  
866  O OE1 . GLN A 129 ? 0.5987 0.4957 0.5527 0.0542  0.0160  -0.0491 175 GLN A OE1 
867  N NE2 . GLN A 129 ? 0.6222 0.4994 0.5541 0.0514  -0.0019 -0.0624 175 GLN A NE2 
868  N N   . LYS A 130 ? 0.4836 0.4120 0.4084 0.0653  0.0636  -0.0291 176 LYS A N   
869  C CA  . LYS A 130 ? 0.5063 0.4392 0.4300 0.0700  0.0825  -0.0257 176 LYS A CA  
870  C C   . LYS A 130 ? 0.5189 0.4474 0.4222 0.0705  0.0905  -0.0185 176 LYS A C   
871  O O   . LYS A 130 ? 0.5365 0.4579 0.4187 0.0781  0.1041  -0.0179 176 LYS A O   
872  C CB  . LYS A 130 ? 0.4866 0.4371 0.4449 0.0645  0.0889  -0.0218 176 LYS A CB  
873  C CG  . LYS A 130 ? 0.5045 0.4584 0.4817 0.0666  0.0824  -0.0277 176 LYS A CG  
874  C CD  . LYS A 130 ? 0.5327 0.4798 0.4999 0.0780  0.0893  -0.0357 176 LYS A CD  
875  C CE  . LYS A 130 ? 0.5445 0.4952 0.5330 0.0812  0.0835  -0.0404 176 LYS A CE  
876  N NZ  . LYS A 130 ? 0.5600 0.4998 0.5361 0.0935  0.0873  -0.0498 176 LYS A NZ  
877  N N   . VAL A 131 ? 0.5011 0.4322 0.4085 0.0636  0.0828  -0.0128 177 VAL A N   
878  C CA  . VAL A 131 ? 0.5179 0.4421 0.4056 0.0649  0.0890  -0.0051 177 VAL A CA  
879  C C   . VAL A 131 ? 0.5497 0.4573 0.3979 0.0754  0.0853  -0.0085 177 VAL A C   
880  O O   . VAL A 131 ? 0.5708 0.4682 0.3944 0.0809  0.0963  -0.0023 177 VAL A O   
881  C CB  . VAL A 131 ? 0.4994 0.4292 0.3997 0.0570  0.0798  0.0004  177 VAL A CB  
882  C CG1 . VAL A 131 ? 0.5366 0.4547 0.4107 0.0614  0.0815  0.0069  177 VAL A CG1 
883  C CG2 . VAL A 131 ? 0.4903 0.4333 0.4222 0.0483  0.0872  0.0048  177 VAL A CG2 
884  N N   . ALA A 132 ? 0.5531 0.4564 0.3944 0.0782  0.0698  -0.0184 178 ALA A N   
885  C CA  . ALA A 132 ? 0.5923 0.4801 0.3964 0.0890  0.0636  -0.0249 178 ALA A CA  
886  C C   . ALA A 132 ? 0.6301 0.5073 0.4082 0.0997  0.0816  -0.0254 178 ALA A C   
887  O O   . ALA A 132 ? 0.6670 0.5294 0.4068 0.1101  0.0815  -0.0265 178 ALA A O   
888  C CB  . ALA A 132 ? 0.5905 0.4760 0.3982 0.0883  0.0449  -0.0374 178 ALA A CB  
889  N N   . SER A 133 ? 0.6250 0.5105 0.4235 0.0980  0.0966  -0.0249 179 SER A N   
890  C CA  . SER A 133 ? 0.6638 0.5429 0.4432 0.1079  0.1166  -0.0256 179 SER A CA  
891  C C   . SER A 133 ? 0.6652 0.5512 0.4541 0.1043  0.1403  -0.0132 179 SER A C   
892  O O   . SER A 133 ? 0.6707 0.5574 0.4550 0.1100  0.1605  -0.0128 179 SER A O   
893  C CB  . SER A 133 ? 0.6580 0.5417 0.4536 0.1110  0.1173  -0.0360 179 SER A CB  
894  O OG  . SER A 133 ? 0.6967 0.5680 0.4765 0.1156  0.0983  -0.0483 179 SER A OG  
895  N N   . MET A 134 ? 0.6497 0.5406 0.4525 0.0949  0.1388  -0.0035 180 MET A N   
896  C CA  . MET A 134 ? 0.6679 0.5624 0.4805 0.0895  0.1600  0.0082  180 MET A CA  
897  C C   . MET A 134 ? 0.7266 0.6011 0.4948 0.0994  0.1754  0.0152  180 MET A C   
898  O O   . MET A 134 ? 0.7337 0.5914 0.4639 0.1084  0.1636  0.0135  180 MET A O   
899  C CB  . MET A 134 ? 0.6480 0.5478 0.4812 0.0783  0.1518  0.0154  180 MET A CB  
900  C CG  . MET A 134 ? 0.6563 0.5593 0.5057 0.0701  0.1715  0.0263  180 MET A CG  
901  S SD  . MET A 134 ? 0.6574 0.5647 0.5304 0.0580  0.1599  0.0320  180 MET A SD  
902  C CE  . MET A 134 ? 0.6584 0.5463 0.4902 0.0674  0.1426  0.0334  180 MET A CE  
903  N N   . PRO A 135 ? 0.7703 0.6465 0.5428 0.0978  0.2020  0.0231  181 PRO A N   
904  C CA  . PRO A 135 ? 0.8400 0.6946 0.5686 0.1062  0.2199  0.0328  181 PRO A CA  
905  C C   . PRO A 135 ? 0.8727 0.7090 0.5753 0.1069  0.2094  0.0418  181 PRO A C   
906  O O   . PRO A 135 ? 0.8395 0.6828 0.5692 0.0961  0.2008  0.0457  181 PRO A O   
907  C CB  . PRO A 135 ? 0.8397 0.7045 0.5948 0.0976  0.2492  0.0416  181 PRO A CB  
908  C CG  . PRO A 135 ? 0.7978 0.6896 0.5991 0.0927  0.2478  0.0312  181 PRO A CG  
909  C CD  . PRO A 135 ? 0.7511 0.6496 0.5683 0.0895  0.2173  0.0224  181 PRO A CD  
910  N N   . GLN A 136 ? 0.9482 0.7608 0.5973 0.1210  0.2094  0.0445  182 GLN A N   
911  C CA  . GLN A 136 ? 0.9926 0.7877 0.6129 0.1259  0.1938  0.0504  182 GLN A CA  
912  C C   . GLN A 136 ? 1.0336 0.8138 0.6466 0.1215  0.2109  0.0681  182 GLN A C   
913  O O   . GLN A 136 ? 1.0231 0.8007 0.6445 0.1172  0.1981  0.0726  182 GLN A O   
914  C CB  . GLN A 136 ? 1.0386 0.8141 0.6030 0.1445  0.1829  0.0448  182 GLN A CB  
915  C CG  . GLN A 136 ? 1.1045 0.8585 0.6215 0.1566  0.2079  0.0526  182 GLN A CG  
916  C CD  . GLN A 136 ? 1.1484 0.8891 0.6172 0.1748  0.1963  0.0408  182 GLN A CD  
917  O OE1 . GLN A 136 ? 1.1307 0.8831 0.6123 0.1759  0.1878  0.0254  182 GLN A OE1 
918  N NE2 . GLN A 136 ? 1.2062 0.9200 0.6175 0.1898  0.1953  0.0477  182 GLN A NE2 
919  N N   . GLU A 137 ? 1.0884 0.8580 0.6864 0.1226  0.2405  0.0780  183 GLU A N   
920  C CA  . GLU A 137 ? 1.1322 0.8832 0.7211 0.1177  0.2600  0.0959  183 GLU A CA  
921  C C   . GLU A 137 ? 1.1127 0.8821 0.7553 0.0989  0.2804  0.0998  183 GLU A C   
922  O O   . GLU A 137 ? 1.1157 0.8989 0.7748 0.0961  0.3000  0.0971  183 GLU A O   
923  C CB  . GLU A 137 ? 1.2029 0.9246 0.7323 0.1319  0.2811  0.1068  183 GLU A CB  
924  C CG  . GLU A 137 ? 1.2565 0.9534 0.7276 0.1509  0.2607  0.1071  183 GLU A CG  
925  C CD  . GLU A 137 ? 1.3429 1.0085 0.7499 0.1665  0.2817  0.1185  183 GLU A CD  
926  O OE1 . GLU A 137 ? 1.3862 1.0331 0.7833 0.1621  0.3079  0.1364  183 GLU A OE1 
927  O OE2 . GLU A 137 ? 1.3836 1.0417 0.7488 0.1834  0.2721  0.1094  183 GLU A OE2 
928  N N   . GLU A 138 ? 1.0951 0.8652 0.7653 0.0867  0.2752  0.1053  184 GLU A N   
929  C CA  . GLU A 138 ? 1.0741 0.8614 0.7973 0.0679  0.2906  0.1075  184 GLU A CA  
930  C C   . GLU A 138 ? 1.1250 0.8964 0.8379 0.0635  0.3258  0.1224  184 GLU A C   
931  O O   . GLU A 138 ? 1.1632 0.9040 0.8441 0.0657  0.3343  0.1367  184 GLU A O   
932  C CB  . GLU A 138 ? 1.0405 0.8289 0.7905 0.0574  0.2744  0.1083  184 GLU A CB  
933  C CG  . GLU A 138 ? 0.9966 0.8079 0.8063 0.0382  0.2822  0.1054  184 GLU A CG  
934  C CD  . GLU A 138 ? 0.9412 0.7663 0.7819 0.0314  0.2567  0.0970  184 GLU A CD  
935  O OE1 . GLU A 138 ? 0.9383 0.7459 0.7590 0.0356  0.2430  0.1009  184 GLU A OE1 
936  O OE2 . GLU A 138 ? 0.8685 0.7220 0.7526 0.0229  0.2504  0.0865  184 GLU A OE2 
937  N N   . GLN A 139 ? 1.1309 0.9228 0.8714 0.0578  0.3465  0.1191  185 GLN A N   
938  C CA  . GLN A 139 ? 1.1728 0.9562 0.9142 0.0509  0.3831  0.1322  185 GLN A CA  
939  C C   . GLN A 139 ? 1.1428 0.9556 0.9545 0.0298  0.3926  0.1285  185 GLN A C   
940  O O   . GLN A 139 ? 1.1037 0.9500 0.9558 0.0271  0.3842  0.1143  185 GLN A O   
941  C CB  . GLN A 139 ? 1.2071 0.9909 0.9189 0.0640  0.4028  0.1312  185 GLN A CB  
942  N N   . GLU A 140 ? 1.1627 0.9617 0.9886 0.0154  0.4090  0.1407  186 GLU A N   
943  C CA  . GLU A 140 ? 1.1365 0.9615 1.0300 -0.0060 0.4169  0.1368  186 GLU A CA  
944  C C   . GLU A 140 ? 1.1382 0.9925 1.0649 -0.0101 0.4424  0.1329  186 GLU A C   
945  O O   . GLU A 140 ? 1.1822 1.0256 1.0757 -0.0009 0.4670  0.1407  186 GLU A O   
946  C CB  . GLU A 140 ? 1.1664 0.9647 1.0629 -0.0204 0.4318  0.1514  186 GLU A CB  
947  C CG  . GLU A 140 ? 1.1392 0.9618 1.1062 -0.0436 0.4346  0.1455  186 GLU A CG  
948  C CD  . GLU A 140 ? 1.1760 0.9680 1.1450 -0.0586 0.4499  0.1595  186 GLU A CD  
949  O OE1 . GLU A 140 ? 1.2284 0.9827 1.1487 -0.0528 0.4697  0.1770  186 GLU A OE1 
950  O OE2 . GLU A 140 ? 1.1548 0.9587 1.1728 -0.0758 0.4418  0.1529  186 GLU A OE2 
951  N N   . PRO B 26  ? 1.1051 0.6636 0.6990 0.0533  -0.0211 -0.1098 72  PRO B N   
952  C CA  . PRO B 26  ? 1.0518 0.6494 0.6899 0.0406  -0.0245 -0.0988 72  PRO B CA  
953  C C   . PRO B 26  ? 1.0131 0.6458 0.6667 0.0497  -0.0125 -0.0863 72  PRO B C   
954  O O   . PRO B 26  ? 0.9780 0.6332 0.6609 0.0513  -0.0027 -0.0757 72  PRO B O   
955  C CB  . PRO B 26  ? 1.0560 0.6558 0.6961 0.0237  -0.0460 -0.1065 72  PRO B CB  
956  C CG  . PRO B 26  ? 1.1178 0.6746 0.7211 0.0227  -0.0559 -0.1223 72  PRO B CG  
957  C CD  . PRO B 26  ? 1.1462 0.6789 0.7131 0.0440  -0.0402 -0.1244 72  PRO B CD  
958  N N   . GLY B 27  ? 1.0218 0.6569 0.6540 0.0554  -0.0138 -0.0877 73  GLY B N   
959  C CA  . GLY B 27  ? 0.9913 0.6534 0.6323 0.0640  -0.0011 -0.0763 73  GLY B CA  
960  C C   . GLY B 27  ? 1.0237 0.6696 0.6232 0.0752  0.0024  -0.0803 73  GLY B C   
961  O O   . GLY B 27  ? 1.0670 0.6792 0.6292 0.0800  -0.0017 -0.0921 73  GLY B O   
962  N N   . ARG B 28  ? 1.0022 0.6694 0.6056 0.0794  0.0102  -0.0704 74  ARG B N   
963  C CA  . ARG B 28  ? 1.0363 0.6885 0.5984 0.0903  0.0160  -0.0716 74  ARG B CA  
964  C C   . ARG B 28  ? 1.0047 0.6816 0.5775 0.0887  0.0184  -0.0596 74  ARG B C   
965  O O   . ARG B 28  ? 0.9577 0.6634 0.5708 0.0803  0.0172  -0.0510 74  ARG B O   
966  C CB  . ARG B 28  ? 1.0645 0.7041 0.6079 0.1071  0.0390  -0.0715 74  ARG B CB  
967  C CG  . ARG B 28  ? 1.0294 0.7005 0.6115 0.1111  0.0583  -0.0588 74  ARG B CG  
968  C CD  . ARG B 28  ? 1.0624 0.7227 0.6399 0.1255  0.0755  -0.0617 74  ARG B CD  
969  N NE  . ARG B 28  ? 1.0345 0.7284 0.6554 0.1280  0.0895  -0.0503 74  ARG B NE  
970  C CZ  . ARG B 28  ? 1.0362 0.7473 0.6643 0.1388  0.1110  -0.0426 74  ARG B CZ  
971  N NH1 . ARG B 28  ? 1.0750 0.7722 0.6674 0.1494  0.1245  -0.0437 74  ARG B NH1 
972  N NH2 . ARG B 28  ? 0.9993 0.7426 0.6713 0.1388  0.1192  -0.0335 74  ARG B NH2 
973  N N   . VAL B 29  ? 1.0298 0.6920 0.5631 0.0972  0.0220  -0.0591 75  VAL B N   
974  C CA  . VAL B 29  ? 1.0077 0.6865 0.5439 0.0973  0.0267  -0.0469 75  VAL B CA  
975  C C   . VAL B 29  ? 0.9936 0.6809 0.5312 0.1073  0.0552  -0.0366 75  VAL B C   
976  O O   . VAL B 29  ? 1.0369 0.7038 0.5403 0.1197  0.0693  -0.0403 75  VAL B O   
977  C CB  . VAL B 29  ? 1.0537 0.7099 0.5430 0.1009  0.0136  -0.0506 75  VAL B CB  
978  C CG1 . VAL B 29  ? 1.0437 0.7152 0.5382 0.1000  0.0161  -0.0369 75  VAL B CG1 
979  C CG2 . VAL B 29  ? 1.0636 0.7103 0.5501 0.0918  -0.0154 -0.0634 75  VAL B CG2 
980  N N   . THR B 30  ? 0.9298 0.6477 0.5079 0.1019  0.0637  -0.0244 76  THR B N   
981  C CA  . THR B 30  ? 0.9099 0.6413 0.4966 0.1086  0.0897  -0.0137 76  THR B CA  
982  C C   . THR B 30  ? 0.8836 0.6277 0.4769 0.1033  0.0925  -0.0008 76  THR B C   
983  O O   . THR B 30  ? 0.8566 0.6058 0.4600 0.0944  0.0744  0.0003  76  THR B O   
984  C CB  . THR B 30  ? 0.8660 0.6231 0.4996 0.1074  0.0996  -0.0110 76  THR B CB  
985  O OG1 . THR B 30  ? 0.8203 0.6036 0.4955 0.0951  0.0905  -0.0043 76  THR B OG1 
986  C CG2 . THR B 30  ? 0.8674 0.6106 0.4988 0.1106  0.0924  -0.0229 76  THR B CG2 
987  N N   . ASN B 31  ? 0.8807 0.6294 0.4691 0.1088  0.1162  0.0089  77  ASN B N   
988  C CA  . ASN B 31  ? 0.8644 0.6242 0.4626 0.1028  0.1226  0.0226  77  ASN B CA  
989  C C   . ASN B 31  ? 0.8005 0.5896 0.4519 0.0902  0.1137  0.0271  77  ASN B C   
990  O O   . ASN B 31  ? 0.7864 0.5773 0.4422 0.0831  0.1038  0.0330  77  ASN B O   
991  C CB  . ASN B 31  ? 0.8889 0.6532 0.4822 0.1090  0.1530  0.0324  77  ASN B CB  
992  C CG  . ASN B 31  ? 0.8674 0.6590 0.5035 0.1104  0.1687  0.0326  77  ASN B CG  
993  O OD1 . ASN B 31  ? 0.8640 0.6590 0.5141 0.1129  0.1601  0.0229  77  ASN B OD1 
994  N ND2 . ASN B 31  ? 0.8646 0.6757 0.5227 0.1088  0.1912  0.0439  77  ASN B ND2 
995  N N   . GLN B 32  ? 0.7559 0.5653 0.4444 0.0887  0.1165  0.0240  78  GLN B N   
996  C CA  . GLN B 32  ? 0.7038 0.5394 0.4396 0.0779  0.1087  0.0274  78  GLN B CA  
997  C C   . GLN B 32  ? 0.6776 0.5092 0.4159 0.0709  0.0838  0.0213  78  GLN B C   
998  O O   . GLN B 32  ? 0.6499 0.4928 0.4081 0.0628  0.0757  0.0262  78  GLN B O   
999  C CB  . GLN B 32  ? 0.6827 0.5382 0.4522 0.0801  0.1163  0.0251  78  GLN B CB  
1000 C CG  . GLN B 32  ? 0.7013 0.5716 0.4834 0.0855  0.1409  0.0322  78  GLN B CG  
1001 C CD  . GLN B 32  ? 0.6976 0.5921 0.5189 0.0880  0.1451  0.0305  78  GLN B CD  
1002 O OE1 . GLN B 32  ? 0.7242 0.6145 0.5492 0.0902  0.1333  0.0227  78  GLN B OE1 
1003 N NE2 . GLN B 32  ? 0.7006 0.6201 0.5518 0.0874  0.1615  0.0382  78  GLN B NE2 
1004 N N   . LEU B 33  ? 0.6781 0.4936 0.3974 0.0740  0.0722  0.0104  79  LEU B N   
1005 C CA  . LEU B 33  ? 0.6643 0.4773 0.3873 0.0669  0.0494  0.0040  79  LEU B CA  
1006 C C   . LEU B 33  ? 0.6751 0.4792 0.3777 0.0656  0.0382  0.0070  79  LEU B C   
1007 O O   . LEU B 33  ? 0.6465 0.4609 0.3679 0.0586  0.0236  0.0071  79  LEU B O   
1008 C CB  . LEU B 33  ? 0.6786 0.4738 0.3844 0.0693  0.0402  -0.0085 79  LEU B CB  
1009 C CG  . LEU B 33  ? 0.6534 0.4573 0.3848 0.0689  0.0450  -0.0115 79  LEU B CG  
1010 C CD1 . LEU B 33  ? 0.6754 0.4541 0.3822 0.0731  0.0402  -0.0233 79  LEU B CD1 
1011 C CD2 . LEU B 33  ? 0.6056 0.4300 0.3748 0.0582  0.0346  -0.0097 79  LEU B CD2 
1012 N N   A GLN B 34  ? 0.7121 0.4965 0.3755 0.0734  0.0457  0.0095  80  GLN B N   
1013 N N   B GLN B 34  ? 0.7131 0.4977 0.3767 0.0734  0.0457  0.0096  80  GLN B N   
1014 C CA  A GLN B 34  ? 0.7353 0.5082 0.3744 0.0746  0.0371  0.0146  80  GLN B CA  
1015 C CA  B GLN B 34  ? 0.7366 0.5099 0.3765 0.0743  0.0364  0.0144  80  GLN B CA  
1016 C C   A GLN B 34  ? 0.7034 0.4928 0.3698 0.0687  0.0420  0.0265  80  GLN B C   
1017 C C   B GLN B 34  ? 0.7052 0.4942 0.3709 0.0688  0.0421  0.0267  80  GLN B C   
1018 O O   A GLN B 34  ? 0.6957 0.4856 0.3645 0.0662  0.0272  0.0285  80  GLN B O   
1019 O O   B GLN B 34  ? 0.6989 0.4877 0.3656 0.0665  0.0278  0.0290  80  GLN B O   
1020 C CB  A GLN B 34  ? 0.7946 0.5414 0.3831 0.0851  0.0488  0.0171  80  GLN B CB  
1021 C CB  B GLN B 34  ? 0.7989 0.5448 0.3866 0.0849  0.0458  0.0158  80  GLN B CB  
1022 C CG  A GLN B 34  ? 0.8488 0.5703 0.3963 0.0917  0.0357  0.0044  80  GLN B CG  
1023 C CG  B GLN B 34  ? 0.8530 0.5757 0.4043 0.0906  0.0322  0.0022  80  GLN B CG  
1024 C CD  A GLN B 34  ? 0.9100 0.6023 0.4003 0.1024  0.0416  0.0077  80  GLN B CD  
1025 C CD  B GLN B 34  ? 0.8708 0.5880 0.4131 0.0878  0.0040  -0.0035 80  GLN B CD  
1026 O OE1 A GLN B 34  ? 0.9296 0.6202 0.4107 0.1049  0.0590  0.0206  80  GLN B OE1 
1027 O OE1 B GLN B 34  ? 0.9158 0.6095 0.4170 0.0936  -0.0085 -0.0114 80  GLN B OE1 
1028 N NE2 A GLN B 34  ? 0.9586 0.6263 0.4085 0.1082  0.0269  -0.0040 80  GLN B NE2 
1029 N NE2 B GLN B 34  ? 0.8435 0.5829 0.4244 0.0796  -0.0065 0.0001  80  GLN B NE2 
1030 N N   . TYR B 35  ? 0.6858 0.4885 0.3732 0.0669  0.0622  0.0339  81  TYR B N   
1031 C CA  . TYR B 35  ? 0.6612 0.4789 0.3771 0.0597  0.0677  0.0443  81  TYR B CA  
1032 C C   . TYR B 35  ? 0.6182 0.4548 0.3716 0.0518  0.0519  0.0402  81  TYR B C   
1033 O O   . TYR B 35  ? 0.6135 0.4517 0.3749 0.0481  0.0435  0.0445  81  TYR B O   
1034 C CB  . TYR B 35  ? 0.6573 0.4890 0.3932 0.0582  0.0913  0.0510  81  TYR B CB  
1035 C CG  . TYR B 35  ? 0.6470 0.4929 0.4128 0.0491  0.0969  0.0608  81  TYR B CG  
1036 C CD1 . TYR B 35  ? 0.6840 0.5169 0.4325 0.0479  0.1078  0.0722  81  TYR B CD1 
1037 C CD2 . TYR B 35  ? 0.6087 0.4780 0.4175 0.0414  0.0913  0.0586  81  TYR B CD2 
1038 C CE1 . TYR B 35  ? 0.6832 0.5257 0.4588 0.0381  0.1125  0.0806  81  TYR B CE1 
1039 C CE2 . TYR B 35  ? 0.6059 0.4856 0.4403 0.0326  0.0949  0.0661  81  TYR B CE2 
1040 C CZ  . TYR B 35  ? 0.6287 0.4948 0.4475 0.0304  0.1053  0.0768  81  TYR B CZ  
1041 O OH  . TYR B 35  ? 0.6232 0.4966 0.4672 0.0203  0.1085  0.0837  81  TYR B OH  
1042 N N   . LEU B 36  ? 0.5879 0.4366 0.3619 0.0501  0.0487  0.0323  82  LEU B N   
1043 C CA  . LEU B 36  ? 0.5641 0.4292 0.3700 0.0432  0.0354  0.0284  82  LEU B CA  
1044 C C   . LEU B 36  ? 0.5669 0.4254 0.3632 0.0426  0.0158  0.0240  82  LEU B C   
1045 O O   . LEU B 36  ? 0.5425 0.4125 0.3606 0.0381  0.0073  0.0249  82  LEU B O   
1046 C CB  . LEU B 36  ? 0.5480 0.4214 0.3700 0.0426  0.0357  0.0211  82  LEU B CB  
1047 C CG  . LEU B 36  ? 0.5516 0.4385 0.3937 0.0435  0.0519  0.0249  82  LEU B CG  
1048 C CD1 . LEU B 36  ? 0.5685 0.4556 0.4152 0.0467  0.0519  0.0178  82  LEU B CD1 
1049 C CD2 . LEU B 36  ? 0.5436 0.4504 0.4193 0.0363  0.0521  0.0304  82  LEU B CD2 
1050 N N   . HIS B 37  ? 0.6058 0.4465 0.3697 0.0479  0.0085  0.0188  83  HIS B N   
1051 C CA  . HIS B 37  ? 0.6238 0.4601 0.3793 0.0482  -0.0120 0.0137  83  HIS B CA  
1052 C C   . HIS B 37  ? 0.6427 0.4725 0.3860 0.0517  -0.0157 0.0220  83  HIS B C   
1053 O O   . HIS B 37  ? 0.6233 0.4638 0.3860 0.0495  -0.0267 0.0227  83  HIS B O   
1054 C CB  . HIS B 37  ? 0.6631 0.4803 0.3850 0.0528  -0.0200 0.0047  83  HIS B CB  
1055 C CG  . HIS B 37  ? 0.6980 0.5155 0.4185 0.0513  -0.0434 -0.0033 83  HIS B CG  
1056 N ND1 . HIS B 37  ? 0.7550 0.5568 0.4497 0.0531  -0.0553 -0.0136 83  HIS B ND1 
1057 C CD2 . HIS B 37  ? 0.6917 0.5249 0.4358 0.0480  -0.0573 -0.0032 83  HIS B CD2 
1058 C CE1 . HIS B 37  ? 0.7577 0.5675 0.4624 0.0502  -0.0764 -0.0192 83  HIS B CE1 
1059 N NE2 . HIS B 37  ? 0.7110 0.5409 0.4464 0.0478  -0.0773 -0.0128 83  HIS B NE2 
1060 N N   . LYS B 38  ? 0.6788 0.4896 0.3889 0.0578  -0.0053 0.0289  84  LYS B N   
1061 C CA  . LYS B 38  ? 0.7176 0.5138 0.4048 0.0631  -0.0102 0.0370  84  LYS B CA  
1062 C C   . LYS B 38  ? 0.6998 0.5008 0.4052 0.0592  0.0014  0.0485  84  LYS B C   
1063 O O   . LYS B 38  ? 0.7100 0.5027 0.4082 0.0621  -0.0064 0.0543  84  LYS B O   
1064 C CB  . LYS B 38  ? 0.7771 0.5459 0.4132 0.0719  -0.0043 0.0396  84  LYS B CB  
1065 C CG  . LYS B 38  ? 0.8336 0.5923 0.4453 0.0761  -0.0169 0.0270  84  LYS B CG  
1066 C CD  . LYS B 38  ? 0.8661 0.6274 0.4790 0.0771  -0.0449 0.0194  84  LYS B CD  
1067 C CE  . LYS B 38  ? 0.9046 0.6551 0.4948 0.0791  -0.0584 0.0058  84  LYS B CE  
1068 N NZ  . LYS B 38  ? 0.9416 0.6896 0.5212 0.0825  -0.0861 -0.0002 84  LYS B NZ  
1069 N N   . VAL B 39  ? 0.6779 0.4915 0.4071 0.0529  0.0188  0.0515  85  VAL B N   
1070 C CA  . VAL B 39  ? 0.6704 0.4887 0.4194 0.0471  0.0294  0.0613  85  VAL B CA  
1071 C C   . VAL B 39  ? 0.6242 0.4658 0.4165 0.0397  0.0233  0.0568  85  VAL B C   
1072 O O   . VAL B 39  ? 0.6214 0.4634 0.4245 0.0384  0.0150  0.0589  85  VAL B O   
1073 C CB  . VAL B 39  ? 0.6802 0.4975 0.4271 0.0446  0.0536  0.0688  85  VAL B CB  
1074 C CG1 . VAL B 39  ? 0.6750 0.4990 0.4477 0.0358  0.0630  0.0777  85  VAL B CG1 
1075 C CG2 . VAL B 39  ? 0.7404 0.5317 0.4398 0.0525  0.0621  0.0748  85  VAL B CG2 
1076 N N   . VAL B 40  ? 0.5974 0.4562 0.4116 0.0361  0.0273  0.0507  86  VAL B N   
1077 C CA  . VAL B 40  ? 0.5579 0.4370 0.4093 0.0295  0.0237  0.0473  86  VAL B CA  
1078 C C   . VAL B 40  ? 0.5440 0.4284 0.4036 0.0302  0.0057  0.0404  86  VAL B C   
1079 O O   . VAL B 40  ? 0.5273 0.4162 0.4021 0.0283  0.0005  0.0418  86  VAL B O   
1080 C CB  . VAL B 40  ? 0.5380 0.4321 0.4077 0.0271  0.0314  0.0429  86  VAL B CB  
1081 C CG1 . VAL B 40  ? 0.5087 0.4212 0.4118 0.0212  0.0266  0.0399  86  VAL B CG1 
1082 C CG2 . VAL B 40  ? 0.5460 0.4404 0.4141 0.0270  0.0501  0.0494  86  VAL B CG2 
1083 N N   . MET B 41  ? 0.5452 0.4289 0.3954 0.0330  -0.0032 0.0328  87  MET B N   
1084 C CA  . MET B 41  ? 0.5410 0.4339 0.4040 0.0324  -0.0191 0.0259  87  MET B CA  
1085 C C   . MET B 41  ? 0.5621 0.4485 0.4168 0.0375  -0.0302 0.0288  87  MET B C   
1086 O O   . MET B 41  ? 0.5425 0.4408 0.4180 0.0369  -0.0382 0.0265  87  MET B O   
1087 C CB  . MET B 41  ? 0.5500 0.4413 0.4039 0.0327  -0.0266 0.0171  87  MET B CB  
1088 C CG  . MET B 41  ? 0.5645 0.4684 0.4360 0.0301  -0.0419 0.0098  87  MET B CG  
1089 S SD  . MET B 41  ? 0.5667 0.4927 0.4771 0.0232  -0.0387 0.0086  87  MET B SD  
1090 C CE  . MET B 41  ? 0.5654 0.4919 0.4793 0.0176  -0.0346 0.0024  87  MET B CE  
1091 N N   . LYS B 42  ? 0.6009 0.4677 0.4240 0.0437  -0.0302 0.0340  88  LYS B N   
1092 C CA  . LYS B 42  ? 0.6351 0.4924 0.4465 0.0506  -0.0414 0.0379  88  LYS B CA  
1093 C C   . LYS B 42  ? 0.6244 0.4831 0.4534 0.0488  -0.0363 0.0443  88  LYS B C   
1094 O O   . LYS B 42  ? 0.6224 0.4852 0.4620 0.0529  -0.0473 0.0431  88  LYS B O   
1095 C CB  . LYS B 42  ? 0.6904 0.5220 0.4588 0.0582  -0.0407 0.0438  88  LYS B CB  
1096 C CG  . LYS B 42  ? 0.7459 0.5651 0.4978 0.0677  -0.0554 0.0477  88  LYS B CG  
1097 C CD  . LYS B 42  ? 0.8225 0.6147 0.5260 0.0765  -0.0578 0.0524  88  LYS B CD  
1098 C CE  . LYS B 42  ? 0.8527 0.6469 0.5423 0.0807  -0.0755 0.0416  88  LYS B CE  
1099 N NZ  . LYS B 42  ? 0.9092 0.6754 0.5483 0.0918  -0.0832 0.0457  88  LYS B NZ  
1100 N N   . ALA B 43  ? 0.6186 0.4745 0.4523 0.0427  -0.0199 0.0502  89  ALA B N   
1101 C CA  . ALA B 43  ? 0.6080 0.4631 0.4583 0.0387  -0.0148 0.0552  89  ALA B CA  
1102 C C   . ALA B 43  ? 0.5678 0.4433 0.4505 0.0356  -0.0208 0.0477  89  ALA B C   
1103 O O   . ALA B 43  ? 0.5747 0.4477 0.4657 0.0378  -0.0260 0.0483  89  ALA B O   
1104 C CB  . ALA B 43  ? 0.6128 0.4652 0.4659 0.0310  0.0031  0.0616  89  ALA B CB  
1105 N N   . LEU B 44  ? 0.5221 0.4151 0.4205 0.0311  -0.0194 0.0409  90  LEU B N   
1106 C CA  . LEU B 44  ? 0.4893 0.4003 0.4145 0.0283  -0.0237 0.0343  90  LEU B CA  
1107 C C   . LEU B 44  ? 0.4735 0.3915 0.4033 0.0342  -0.0374 0.0291  90  LEU B C   
1108 O O   . LEU B 44  ? 0.4540 0.3789 0.3996 0.0359  -0.0408 0.0271  90  LEU B O   
1109 C CB  . LEU B 44  ? 0.4749 0.3994 0.4115 0.0229  -0.0188 0.0295  90  LEU B CB  
1110 C CG  . LEU B 44  ? 0.4938 0.4187 0.4345 0.0177  -0.0061 0.0333  90  LEU B CG  
1111 C CD1 . LEU B 44  ? 0.4811 0.4169 0.4297 0.0154  -0.0031 0.0286  90  LEU B CD1 
1112 C CD2 . LEU B 44  ? 0.4895 0.4172 0.4464 0.0135  -0.0037 0.0352  90  LEU B CD2 
1113 N N   . TRP B 45  ? 0.4727 0.3895 0.3896 0.0377  -0.0453 0.0264  91  TRP B N   
1114 C CA  . TRP B 45  ? 0.4615 0.3901 0.3878 0.0421  -0.0596 0.0203  91  TRP B CA  
1115 C C   . TRP B 45  ? 0.4565 0.3817 0.3844 0.0509  -0.0671 0.0230  91  TRP B C   
1116 O O   . TRP B 45  ? 0.4319 0.3736 0.3817 0.0535  -0.0735 0.0182  91  TRP B O   
1117 C CB  . TRP B 45  ? 0.4873 0.4106 0.3944 0.0445  -0.0689 0.0172  91  TRP B CB  
1118 C CG  . TRP B 45  ? 0.4740 0.4147 0.3975 0.0458  -0.0838 0.0094  91  TRP B CG  
1119 C CD1 . TRP B 45  ? 0.4949 0.4409 0.4228 0.0544  -0.0975 0.0087  91  TRP B CD1 
1120 C CD2 . TRP B 45  ? 0.4753 0.4311 0.4152 0.0379  -0.0866 0.0012  91  TRP B CD2 
1121 N NE1 . TRP B 45  ? 0.4826 0.4499 0.4321 0.0518  -0.1086 0.0002  91  TRP B NE1 
1122 C CE2 . TRP B 45  ? 0.4641 0.4366 0.4208 0.0407  -0.1017 -0.0043 91  TRP B CE2 
1123 C CE3 . TRP B 45  ? 0.4591 0.4152 0.4015 0.0289  -0.0777 -0.0017 91  TRP B CE3 
1124 C CZ2 . TRP B 45  ? 0.4605 0.4504 0.4381 0.0326  -0.1074 -0.0125 91  TRP B CZ2 
1125 C CZ3 . TRP B 45  ? 0.4567 0.4258 0.4156 0.0219  -0.0835 -0.0094 91  TRP B CZ3 
1126 C CH2 . TRP B 45  ? 0.4562 0.4422 0.4332 0.0226  -0.0978 -0.0147 91  TRP B CH2 
1127 N N   . LYS B 46  ? 0.4775 0.3802 0.3816 0.0558  -0.0653 0.0311  92  LYS B N   
1128 C CA  . LYS B 46  ? 0.5084 0.4006 0.4073 0.0661  -0.0729 0.0351  92  LYS B CA  
1129 C C   . LYS B 46  ? 0.4810 0.3712 0.3953 0.0649  -0.0659 0.0366  92  LYS B C   
1130 O O   . LYS B 46  ? 0.4952 0.3767 0.4082 0.0741  -0.0719 0.0386  92  LYS B O   
1131 C CB  . LYS B 46  ? 0.5589 0.4222 0.4211 0.0718  -0.0730 0.0445  92  LYS B CB  
1132 C CG  . LYS B 46  ? 0.6419 0.5015 0.4856 0.0826  -0.0898 0.0434  92  LYS B CG  
1133 C CD  . LYS B 46  ? 0.6599 0.5351 0.5061 0.0784  -0.0962 0.0348  92  LYS B CD  
1134 C CE  . LYS B 46  ? 0.6987 0.5727 0.5302 0.0891  -0.1167 0.0320  92  LYS B CE  
1135 N NZ  . LYS B 46  ? 0.7839 0.6264 0.5738 0.0993  -0.1192 0.0419  92  LYS B NZ  
1136 N N   . HIS B 47  ? 0.4497 0.3462 0.3767 0.0544  -0.0543 0.0352  93  HIS B N   
1137 C CA  . HIS B 47  ? 0.4321 0.3249 0.3711 0.0520  -0.0483 0.0354  93  HIS B CA  
1138 C C   . HIS B 47  ? 0.4203 0.3278 0.3792 0.0587  -0.0550 0.0285  93  HIS B C   
1139 O O   . HIS B 47  ? 0.4024 0.3318 0.3759 0.0597  -0.0598 0.0223  93  HIS B O   
1140 C CB  . HIS B 47  ? 0.4121 0.3121 0.3614 0.0399  -0.0371 0.0342  93  HIS B CB  
1141 C CG  . HIS B 47  ? 0.4256 0.3157 0.3807 0.0356  -0.0316 0.0355  93  HIS B CG  
1142 N ND1 . HIS B 47  ? 0.4138 0.3110 0.3839 0.0371  -0.0335 0.0292  93  HIS B ND1 
1143 C CD2 . HIS B 47  ? 0.4407 0.3134 0.3882 0.0295  -0.0245 0.0420  93  HIS B CD2 
1144 C CE1 . HIS B 47  ? 0.4501 0.3331 0.4198 0.0322  -0.0294 0.0308  93  HIS B CE1 
1145 N NE2 . HIS B 47  ? 0.4436 0.3125 0.4018 0.0267  -0.0240 0.0386  93  HIS B NE2 
1146 N N   . GLN B 48  ? 0.4180 0.3126 0.3774 0.0633  -0.0544 0.0294  94  GLN B N   
1147 C CA  . GLN B 48  ? 0.4200 0.3264 0.3965 0.0720  -0.0588 0.0228  94  GLN B CA  
1148 C C   . GLN B 48  ? 0.3835 0.3130 0.3810 0.0656  -0.0531 0.0152  94  GLN B C   
1149 O O   . GLN B 48  ? 0.3829 0.3291 0.3967 0.0722  -0.0553 0.0094  94  GLN B O   
1150 C CB  . GLN B 48  ? 0.4512 0.3335 0.4201 0.0783  -0.0582 0.0248  94  GLN B CB  
1151 C CG  . GLN B 48  ? 0.4723 0.3413 0.4393 0.0669  -0.0489 0.0250  94  GLN B CG  
1152 C CD  . GLN B 48  ? 0.5430 0.3926 0.5078 0.0729  -0.0491 0.0225  94  GLN B CD  
1153 O OE1 . GLN B 48  ? 0.5658 0.4214 0.5382 0.0853  -0.0533 0.0173  94  GLN B OE1 
1154 N NE2 . GLN B 48  ? 0.5718 0.3979 0.5272 0.0640  -0.0444 0.0258  94  GLN B NE2 
1155 N N   . PHE B 49  ? 0.3714 0.3016 0.3684 0.0537  -0.0453 0.0156  95  PHE B N   
1156 C CA  . PHE B 49  ? 0.3520 0.3003 0.3638 0.0478  -0.0399 0.0098  95  PHE B CA  
1157 C C   . PHE B 49  ? 0.3454 0.3116 0.3636 0.0423  -0.0399 0.0085  95  PHE B C   
1158 O O   . PHE B 49  ? 0.3345 0.3130 0.3622 0.0368  -0.0348 0.0050  95  PHE B O   
1159 C CB  . PHE B 49  ? 0.3480 0.2871 0.3563 0.0388  -0.0332 0.0104  95  PHE B CB  
1160 C CG  . PHE B 49  ? 0.3756 0.2969 0.3795 0.0413  -0.0330 0.0093  95  PHE B CG  
1161 C CD1 . PHE B 49  ? 0.3985 0.3140 0.4027 0.0527  -0.0367 0.0066  95  PHE B CD1 
1162 C CD2 . PHE B 49  ? 0.3953 0.3060 0.3963 0.0323  -0.0295 0.0101  95  PHE B CD2 
1163 C CE1 . PHE B 49  ? 0.4234 0.3181 0.4209 0.0550  -0.0366 0.0047  95  PHE B CE1 
1164 C CE2 . PHE B 49  ? 0.4201 0.3120 0.4165 0.0329  -0.0303 0.0079  95  PHE B CE2 
1165 C CZ  . PHE B 49  ? 0.4289 0.3108 0.4217 0.0443  -0.0337 0.0051  95  PHE B CZ  
1166 N N   . ALA B 50  ? 0.3496 0.3144 0.3599 0.0439  -0.0457 0.0111  96  ALA B N   
1167 C CA  . ALA B 50  ? 0.3454 0.3217 0.3579 0.0381  -0.0465 0.0093  96  ALA B CA  
1168 C C   . ALA B 50  ? 0.3353 0.3338 0.3672 0.0391  -0.0512 0.0033  96  ALA B C   
1169 O O   . ALA B 50  ? 0.3339 0.3415 0.3711 0.0318  -0.0496 0.0008  96  ALA B O   
1170 C CB  . ALA B 50  ? 0.3631 0.3263 0.3555 0.0395  -0.0511 0.0135  96  ALA B CB  
1171 N N   . TRP B 51  ? 0.3387 0.3457 0.3824 0.0479  -0.0563 0.0011  97  TRP B N   
1172 C CA  . TRP B 51  ? 0.3398 0.3716 0.4062 0.0490  -0.0615 -0.0043 97  TRP B CA  
1173 C C   . TRP B 51  ? 0.3242 0.3724 0.4071 0.0391  -0.0526 -0.0079 97  TRP B C   
1174 O O   . TRP B 51  ? 0.3178 0.3812 0.4139 0.0338  -0.0564 -0.0111 97  TRP B O   
1175 C CB  . TRP B 51  ? 0.3531 0.3942 0.4331 0.0619  -0.0666 -0.0061 97  TRP B CB  
1176 C CG  . TRP B 51  ? 0.3660 0.4042 0.4501 0.0663  -0.0571 -0.0072 97  TRP B CG  
1177 C CD1 . TRP B 51  ? 0.3885 0.4034 0.4559 0.0717  -0.0552 -0.0043 97  TRP B CD1 
1178 C CD2 . TRP B 51  ? 0.3657 0.4231 0.4698 0.0655  -0.0480 -0.0119 97  TRP B CD2 
1179 N NE1 . TRP B 51  ? 0.3951 0.4124 0.4696 0.0748  -0.0468 -0.0080 97  TRP B NE1 
1180 C CE2 . TRP B 51  ? 0.3792 0.4226 0.4750 0.0717  -0.0416 -0.0124 97  TRP B CE2 
1181 C CE3 . TRP B 51  ? 0.3816 0.4650 0.5087 0.0593  -0.0438 -0.0155 97  TRP B CE3 
1182 C CZ2 . TRP B 51  ? 0.3931 0.4472 0.4997 0.0737  -0.0312 -0.0168 97  TRP B CZ2 
1183 C CZ3 . TRP B 51  ? 0.3786 0.4737 0.5182 0.0605  -0.0318 -0.0186 97  TRP B CZ3 
1184 C CH2 . TRP B 51  ? 0.3761 0.4565 0.5039 0.0684  -0.0256 -0.0194 97  TRP B CH2 
1185 N N   . PRO B 52  ? 0.3120 0.3553 0.3924 0.0361  -0.0414 -0.0073 98  PRO B N   
1186 C CA  . PRO B 52  ? 0.3019 0.3567 0.3927 0.0271  -0.0329 -0.0093 98  PRO B CA  
1187 C C   . PRO B 52  ? 0.2916 0.3393 0.3728 0.0172  -0.0325 -0.0079 98  PRO B C   
1188 O O   . PRO B 52  ? 0.2916 0.3468 0.3809 0.0095  -0.0270 -0.0091 98  PRO B O   
1189 C CB  . PRO B 52  ? 0.2957 0.3426 0.3797 0.0284  -0.0231 -0.0088 98  PRO B CB  
1190 C CG  . PRO B 52  ? 0.2993 0.3355 0.3769 0.0386  -0.0270 -0.0085 98  PRO B CG  
1191 C CD  . PRO B 52  ? 0.3186 0.3453 0.3866 0.0400  -0.0366 -0.0052 98  PRO B CD  
1192 N N   . PHE B 53  ? 0.3051 0.3369 0.3682 0.0178  -0.0371 -0.0051 99  PHE B N   
1193 C CA  . PHE B 53  ? 0.3139 0.3356 0.3646 0.0108  -0.0352 -0.0038 99  PHE B CA  
1194 C C   . PHE B 53  ? 0.3344 0.3545 0.3799 0.0093  -0.0444 -0.0059 99  PHE B C   
1195 O O   . PHE B 53  ? 0.3431 0.3533 0.3769 0.0046  -0.0429 -0.0059 99  PHE B O   
1196 C CB  . PHE B 53  ? 0.3238 0.3292 0.3576 0.0124  -0.0312 0.0007  99  PHE B CB  
1197 C CG  . PHE B 53  ? 0.3260 0.3310 0.3628 0.0126  -0.0243 0.0017  99  PHE B CG  
1198 C CD1 . PHE B 53  ? 0.3399 0.3452 0.3766 0.0078  -0.0178 0.0018  99  PHE B CD1 
1199 C CD2 . PHE B 53  ? 0.3358 0.3377 0.3731 0.0184  -0.0253 0.0020  99  PHE B CD2 
1200 C CE1 . PHE B 53  ? 0.3441 0.3481 0.3807 0.0086  -0.0135 0.0019  99  PHE B CE1 
1201 C CE2 . PHE B 53  ? 0.3351 0.3343 0.3727 0.0184  -0.0204 0.0014  99  PHE B CE2 
1202 C CZ  . PHE B 53  ? 0.3380 0.3391 0.3749 0.0135  -0.0150 0.0012  99  PHE B CZ  
1203 N N   . ARG B 54  ? 0.3409 0.3695 0.3935 0.0144  -0.0546 -0.0081 100 ARG B N   
1204 C CA  . ARG B 54  ? 0.3649 0.3902 0.4089 0.0143  -0.0664 -0.0107 100 ARG B CA  
1205 C C   . ARG B 54  ? 0.3798 0.4167 0.4385 0.0048  -0.0702 -0.0167 100 ARG B C   
1206 O O   . ARG B 54  ? 0.4027 0.4342 0.4521 0.0029  -0.0806 -0.0204 100 ARG B O   
1207 C CB  . ARG B 54  ? 0.3743 0.4040 0.4196 0.0245  -0.0784 -0.0108 100 ARG B CB  
1208 C CG  . ARG B 54  ? 0.3839 0.3941 0.4067 0.0330  -0.0771 -0.0043 100 ARG B CG  
1209 C CD  . ARG B 54  ? 0.4001 0.4140 0.4258 0.0446  -0.0885 -0.0038 100 ARG B CD  
1210 N NE  . ARG B 54  ? 0.4040 0.3967 0.4094 0.0522  -0.0855 0.0033  100 ARG B NE  
1211 C CZ  . ARG B 54  ? 0.3980 0.3895 0.4069 0.0629  -0.0899 0.0052  100 ARG B CZ  
1212 N NH1 . ARG B 54  ? 0.3862 0.3998 0.4202 0.0688  -0.0970 0.0003  100 ARG B NH1 
1213 N NH2 . ARG B 54  ? 0.4151 0.3829 0.4036 0.0678  -0.0864 0.0121  100 ARG B NH2 
1214 N N   . GLN B 55  ? 0.3775 0.4289 0.4580 -0.0015 -0.0620 -0.0179 101 GLN B N   
1215 C CA  . GLN B 55  ? 0.3901 0.4525 0.4879 -0.0128 -0.0634 -0.0227 101 GLN B CA  
1216 C C   . GLN B 55  ? 0.3837 0.4455 0.4870 -0.0201 -0.0480 -0.0201 101 GLN B C   
1217 O O   . GLN B 55  ? 0.3640 0.4241 0.4639 -0.0150 -0.0386 -0.0161 101 GLN B O   
1218 C CB  . GLN B 55  ? 0.3898 0.4796 0.5179 -0.0122 -0.0723 -0.0272 101 GLN B CB  
1219 C CG  . GLN B 55  ? 0.3832 0.4912 0.5312 -0.0054 -0.0643 -0.0252 101 GLN B CG  
1220 C CD  . GLN B 55  ? 0.3930 0.4905 0.5249 0.0088  -0.0662 -0.0215 101 GLN B CD  
1221 O OE1 . GLN B 55  ? 0.4342 0.5270 0.5565 0.0164  -0.0792 -0.0218 101 GLN B OE1 
1222 N NE2 . GLN B 55  ? 0.3707 0.4621 0.4973 0.0121  -0.0538 -0.0179 101 GLN B NE2 
1223 N N   . PRO B 56  ? 0.4027 0.4633 0.5123 -0.0319 -0.0459 -0.0225 102 PRO B N   
1224 C CA  . PRO B 56  ? 0.4099 0.4665 0.5208 -0.0382 -0.0313 -0.0189 102 PRO B CA  
1225 C C   . PRO B 56  ? 0.4232 0.4994 0.5537 -0.0359 -0.0219 -0.0170 102 PRO B C   
1226 O O   . PRO B 56  ? 0.4264 0.5254 0.5806 -0.0343 -0.0262 -0.0201 102 PRO B O   
1227 C CB  . PRO B 56  ? 0.4187 0.4727 0.5379 -0.0522 -0.0326 -0.0224 102 PRO B CB  
1228 C CG  . PRO B 56  ? 0.4255 0.4722 0.5356 -0.0521 -0.0480 -0.0280 102 PRO B CG  
1229 C CD  . PRO B 56  ? 0.4227 0.4817 0.5350 -0.0402 -0.0574 -0.0286 102 PRO B CD  
1230 N N   . VAL B 57  ? 0.4387 0.5060 0.5583 -0.0345 -0.0095 -0.0123 103 VAL B N   
1231 C CA  . VAL B 57  ? 0.4494 0.5308 0.5815 -0.0324 0.0017  -0.0106 103 VAL B CA  
1232 C C   . VAL B 57  ? 0.4700 0.5689 0.6277 -0.0436 0.0077  -0.0120 103 VAL B C   
1233 O O   . VAL B 57  ? 0.4816 0.5702 0.6367 -0.0550 0.0107  -0.0109 103 VAL B O   
1234 C CB  . VAL B 57  ? 0.4522 0.5167 0.5628 -0.0302 0.0126  -0.0056 103 VAL B CB  
1235 C CG1 . VAL B 57  ? 0.4501 0.5264 0.5693 -0.0287 0.0256  -0.0042 103 VAL B CG1 
1236 C CG2 . VAL B 57  ? 0.4437 0.4953 0.5349 -0.0204 0.0072  -0.0046 103 VAL B CG2 
1237 N N   . ASP B 58  ? 0.4772 0.6025 0.6610 -0.0402 0.0097  -0.0144 104 ASP B N   
1238 C CA  . ASP B 58  ? 0.4906 0.6383 0.7047 -0.0508 0.0179  -0.0153 104 ASP B CA  
1239 C C   . ASP B 58  ? 0.4915 0.6423 0.7037 -0.0482 0.0374  -0.0109 104 ASP B C   
1240 O O   . ASP B 58  ? 0.4803 0.6468 0.7021 -0.0374 0.0417  -0.0123 104 ASP B O   
1241 C CB  . ASP B 58  ? 0.4932 0.6721 0.7413 -0.0479 0.0072  -0.0211 104 ASP B CB  
1242 C CG  . ASP B 58  ? 0.5146 0.7190 0.7997 -0.0625 0.0121  -0.0232 104 ASP B CG  
1243 O OD1 . ASP B 58  ? 0.5257 0.7352 0.8184 -0.0691 0.0310  -0.0191 104 ASP B OD1 
1244 O OD2 . ASP B 58  ? 0.5313 0.7507 0.8380 -0.0678 -0.0031 -0.0288 104 ASP B OD2 
1245 N N   . ALA B 59  ? 0.5029 0.6354 0.6989 -0.0571 0.0489  -0.0057 105 ALA B N   
1246 C CA  . ALA B 59  ? 0.5130 0.6424 0.6987 -0.0549 0.0677  -0.0007 105 ALA B CA  
1247 C C   . ALA B 59  ? 0.5155 0.6760 0.7347 -0.0581 0.0812  -0.0015 105 ALA B C   
1248 O O   . ALA B 59  ? 0.5177 0.6834 0.7321 -0.0495 0.0946  -0.0001 105 ALA B O   
1249 C CB  . ALA B 59  ? 0.5311 0.6329 0.6921 -0.0640 0.0759  0.0059  105 ALA B CB  
1250 N N   . VAL B 60  ? 0.5203 0.7019 0.7736 -0.0704 0.0775  -0.0042 106 VAL B N   
1251 C CA  . VAL B 60  ? 0.5294 0.7469 0.8229 -0.0746 0.0897  -0.0054 106 VAL B CA  
1252 C C   . VAL B 60  ? 0.5215 0.7646 0.8330 -0.0573 0.0841  -0.0110 106 VAL B C   
1253 O O   . VAL B 60  ? 0.5232 0.7808 0.8419 -0.0490 0.0999  -0.0103 106 VAL B O   
1254 C CB  . VAL B 60  ? 0.5331 0.7688 0.8628 -0.0934 0.0839  -0.0081 106 VAL B CB  
1255 C CG1 . VAL B 60  ? 0.5383 0.8166 0.9158 -0.0979 0.0972  -0.0094 106 VAL B CG1 
1256 C CG2 . VAL B 60  ? 0.5559 0.7619 0.8664 -0.1105 0.0900  -0.0026 106 VAL B CG2 
1257 N N   . LYS B 61  ? 0.5195 0.7651 0.8348 -0.0508 0.0622  -0.0164 107 LYS B N   
1258 C CA  . LYS B 61  ? 0.5214 0.7868 0.8511 -0.0333 0.0542  -0.0213 107 LYS B CA  
1259 C C   . LYS B 61  ? 0.5246 0.7731 0.8248 -0.0169 0.0630  -0.0197 107 LYS B C   
1260 O O   . LYS B 61  ? 0.5299 0.7972 0.8450 -0.0041 0.0698  -0.0223 107 LYS B O   
1261 C CB  . LYS B 61  ? 0.5214 0.7820 0.8482 -0.0290 0.0288  -0.0255 107 LYS B CB  
1262 C CG  . LYS B 61  ? 0.5372 0.8194 0.8829 -0.0117 0.0182  -0.0301 107 LYS B CG  
1263 C CD  . LYS B 61  ? 0.5448 0.8087 0.8698 -0.0041 -0.0043 -0.0318 107 LYS B CD  
1264 C CE  . LYS B 61  ? 0.5543 0.8277 0.8851 0.0164  -0.0123 -0.0342 107 LYS B CE  
1265 N NZ  . LYS B 61  ? 0.5512 0.8667 0.9290 0.0204  -0.0167 -0.0389 107 LYS B NZ  
1266 N N   . LEU B 62  ? 0.5214 0.7347 0.7809 -0.0171 0.0624  -0.0161 108 LEU B N   
1267 C CA  . LEU B 62  ? 0.5260 0.7195 0.7548 -0.0037 0.0679  -0.0154 108 LEU B CA  
1268 C C   . LEU B 62  ? 0.5332 0.7223 0.7496 -0.0047 0.0900  -0.0118 108 LEU B C   
1269 O O   . LEU B 62  ? 0.5415 0.7162 0.7334 0.0068  0.0952  -0.0125 108 LEU B O   
1270 C CB  . LEU B 62  ? 0.5278 0.6886 0.7215 -0.0034 0.0561  -0.0135 108 LEU B CB  
1271 C CG  . LEU B 62  ? 0.5303 0.6879 0.7252 0.0001  0.0360  -0.0160 108 LEU B CG  
1272 C CD1 . LEU B 62  ? 0.5368 0.6640 0.6990 -0.0017 0.0292  -0.0132 108 LEU B CD1 
1273 C CD2 . LEU B 62  ? 0.5397 0.7058 0.7417 0.0159  0.0303  -0.0199 108 LEU B CD2 
1274 N N   . GLY B 63  ? 0.5321 0.7311 0.7628 -0.0187 0.1028  -0.0079 109 GLY B N   
1275 C CA  . GLY B 63  ? 0.5431 0.7366 0.7598 -0.0204 0.1257  -0.0031 109 GLY B CA  
1276 C C   . GLY B 63  ? 0.5467 0.7023 0.7166 -0.0204 0.1268  0.0019  109 GLY B C   
1277 O O   . GLY B 63  ? 0.5607 0.7037 0.7044 -0.0116 0.1380  0.0029  109 GLY B O   
1278 N N   . LEU B 64  ? 0.5333 0.6707 0.6922 -0.0295 0.1147  0.0044  110 LEU B N   
1279 C CA  . LEU B 64  ? 0.5337 0.6372 0.6521 -0.0291 0.1129  0.0091  110 LEU B CA  
1280 C C   . LEU B 64  ? 0.5397 0.6307 0.6535 -0.0443 0.1207  0.0162  110 LEU B C   
1281 O O   . LEU B 64  ? 0.5398 0.6186 0.6512 -0.0513 0.1090  0.0169  110 LEU B O   
1282 C CB  . LEU B 64  ? 0.5170 0.6077 0.6249 -0.0242 0.0920  0.0059  110 LEU B CB  
1283 C CG  . LEU B 64  ? 0.5064 0.6046 0.6175 -0.0105 0.0828  -0.0004 110 LEU B CG  
1284 C CD1 . LEU B 64  ? 0.4778 0.5650 0.5825 -0.0089 0.0641  -0.0022 110 LEU B CD1 
1285 C CD2 . LEU B 64  ? 0.5227 0.6084 0.6076 0.0004  0.0904  -0.0011 110 LEU B CD2 
1286 N N   . PRO B 65  ? 0.5542 0.6455 0.6644 -0.0491 0.1415  0.0219  111 PRO B N   
1287 C CA  . PRO B 65  ? 0.5620 0.6406 0.6704 -0.0651 0.1508  0.0295  111 PRO B CA  
1288 C C   . PRO B 65  ? 0.5622 0.6028 0.6310 -0.0648 0.1447  0.0352  111 PRO B C   
1289 O O   . PRO B 65  ? 0.5684 0.5940 0.6354 -0.0774 0.1469  0.0404  111 PRO B O   
1290 C CB  . PRO B 65  ? 0.5909 0.6778 0.7004 -0.0676 0.1766  0.0349  111 PRO B CB  
1291 C CG  . PRO B 65  ? 0.5981 0.6867 0.6890 -0.0493 0.1798  0.0312  111 PRO B CG  
1292 C CD  . PRO B 65  ? 0.5660 0.6660 0.6700 -0.0394 0.1584  0.0218  111 PRO B CD  
1293 N N   . ASP B 66  ? 0.5437 0.5690 0.5825 -0.0505 0.1365  0.0340  112 ASP B N   
1294 C CA  . ASP B 66  ? 0.5437 0.5370 0.5475 -0.0475 0.1290  0.0388  112 ASP B CA  
1295 C C   . ASP B 66  ? 0.5035 0.4932 0.5115 -0.0453 0.1081  0.0341  112 ASP B C   
1296 O O   . ASP B 66  ? 0.4901 0.4571 0.4742 -0.0415 0.1005  0.0371  112 ASP B O   
1297 C CB  . ASP B 66  ? 0.5650 0.5437 0.5332 -0.0338 0.1315  0.0402  112 ASP B CB  
1298 C CG  . ASP B 66  ? 0.5666 0.5582 0.5389 -0.0216 0.1203  0.0312  112 ASP B CG  
1299 O OD1 . ASP B 66  ? 0.5474 0.5617 0.5508 -0.0226 0.1146  0.0249  112 ASP B OD1 
1300 O OD2 . ASP B 66  ? 0.6093 0.5866 0.5526 -0.0109 0.1164  0.0305  112 ASP B OD2 
1301 N N   . TYR B 67  ? 0.4673 0.4793 0.5049 -0.0466 0.0992  0.0269  113 TYR B N   
1302 C CA  . TYR B 67  ? 0.4370 0.4461 0.4755 -0.0426 0.0811  0.0224  113 TYR B CA  
1303 C C   . TYR B 67  ? 0.4452 0.4333 0.4736 -0.0490 0.0760  0.0256  113 TYR B C   
1304 O O   . TYR B 67  ? 0.4331 0.4061 0.4434 -0.0421 0.0669  0.0261  113 TYR B O   
1305 C CB  . TYR B 67  ? 0.4080 0.4417 0.4769 -0.0431 0.0726  0.0152  113 TYR B CB  
1306 C CG  . TYR B 67  ? 0.3871 0.4147 0.4508 -0.0375 0.0561  0.0117  113 TYR B CG  
1307 C CD1 . TYR B 67  ? 0.3660 0.3910 0.4176 -0.0262 0.0501  0.0099  113 TYR B CD1 
1308 C CD2 . TYR B 67  ? 0.3744 0.3963 0.4428 -0.0441 0.0475  0.0104  113 TYR B CD2 
1309 C CE1 . TYR B 67  ? 0.3481 0.3676 0.3956 -0.0222 0.0375  0.0078  113 TYR B CE1 
1310 C CE2 . TYR B 67  ? 0.3582 0.3737 0.4193 -0.0384 0.0350  0.0079  113 TYR B CE2 
1311 C CZ  . TYR B 67  ? 0.3509 0.3661 0.4026 -0.0278 0.0309  0.0072  113 TYR B CZ  
1312 O OH  . TYR B 67  ? 0.3368 0.3462 0.3824 -0.0233 0.0209  0.0057  113 TYR B OH  
1313 N N   . HIS B 68  ? 0.4560 0.4430 0.4970 -0.0623 0.0821  0.0275  114 HIS B N   
1314 C CA  . HIS B 68  ? 0.4739 0.4381 0.5052 -0.0687 0.0770  0.0293  114 HIS B CA  
1315 C C   . HIS B 68  ? 0.4984 0.4326 0.4987 -0.0672 0.0848  0.0382  114 HIS B C   
1316 O O   . HIS B 68  ? 0.5050 0.4162 0.4919 -0.0682 0.0798  0.0399  114 HIS B O   
1317 C CB  . HIS B 68  ? 0.4771 0.4498 0.5346 -0.0845 0.0776  0.0264  114 HIS B CB  
1318 C CG  . HIS B 68  ? 0.4631 0.4598 0.5456 -0.0840 0.0646  0.0174  114 HIS B CG  
1319 N ND1 . HIS B 68  ? 0.4683 0.4572 0.5434 -0.0787 0.0496  0.0127  114 HIS B ND1 
1320 C CD2 . HIS B 68  ? 0.4481 0.4757 0.5609 -0.0861 0.0644  0.0127  114 HIS B CD2 
1321 C CE1 . HIS B 68  ? 0.4503 0.4619 0.5473 -0.0783 0.0402  0.0059  114 HIS B CE1 
1322 N NE2 . HIS B 68  ? 0.4485 0.4844 0.5696 -0.0823 0.0480  0.0057  114 HIS B NE2 
1323 N N   . LYS B 69  ? 0.5139 0.4465 0.5004 -0.0633 0.0966  0.0436  115 LYS B N   
1324 C CA  . LYS B 69  ? 0.5455 0.4487 0.4970 -0.0582 0.1019  0.0523  115 LYS B CA  
1325 C C   . LYS B 69  ? 0.5326 0.4287 0.4643 -0.0425 0.0886  0.0509  115 LYS B C   
1326 O O   . LYS B 69  ? 0.5523 0.4238 0.4583 -0.0365 0.0861  0.0565  115 LYS B O   
1327 C CB  . LYS B 69  ? 0.5772 0.4798 0.5171 -0.0592 0.1197  0.0587  115 LYS B CB  
1328 C CG  . LYS B 69  ? 0.6093 0.5160 0.5678 -0.0763 0.1359  0.0625  115 LYS B CG  
1329 C CD  . LYS B 69  ? 0.6583 0.5628 0.6020 -0.0765 0.1565  0.0700  115 LYS B CD  
1330 C CE  . LYS B 69  ? 0.6833 0.5914 0.6473 -0.0955 0.1747  0.0752  115 LYS B CE  
1331 N NZ  . LYS B 69  ? 0.6683 0.6125 0.6812 -0.1056 0.1710  0.0661  115 LYS B NZ  
1332 N N   . ILE B 70  ? 0.4969 0.4147 0.4420 -0.0358 0.0800  0.0434  116 ILE B N   
1333 C CA  . ILE B 70  ? 0.4750 0.3904 0.4074 -0.0231 0.0674  0.0412  116 ILE B CA  
1334 C C   . ILE B 70  ? 0.4456 0.3643 0.3907 -0.0222 0.0548  0.0366  116 ILE B C   
1335 O O   . ILE B 70  ? 0.4551 0.3626 0.3878 -0.0146 0.0470  0.0379  116 ILE B O   
1336 C CB  . ILE B 70  ? 0.4670 0.3997 0.4027 -0.0164 0.0663  0.0361  116 ILE B CB  
1337 C CG1 . ILE B 70  ? 0.5088 0.4336 0.4231 -0.0139 0.0786  0.0406  116 ILE B CG1 
1338 C CG2 . ILE B 70  ? 0.4396 0.3728 0.3695 -0.0064 0.0519  0.0325  116 ILE B CG2 
1339 C CD1 . ILE B 70  ? 0.5315 0.4723 0.4502 -0.0088 0.0815  0.0348  116 ILE B CD1 
1340 N N   . ILE B 71  ? 0.4157 0.3502 0.3848 -0.0290 0.0530  0.0312  117 ILE B N   
1341 C CA  . ILE B 71  ? 0.4009 0.3374 0.3790 -0.0281 0.0423  0.0267  117 ILE B CA  
1342 C C   . ILE B 71  ? 0.4270 0.3504 0.4073 -0.0374 0.0437  0.0271  117 ILE B C   
1343 O O   . ILE B 71  ? 0.4305 0.3628 0.4277 -0.0479 0.0467  0.0246  117 ILE B O   
1344 C CB  . ILE B 71  ? 0.3744 0.3337 0.3728 -0.0278 0.0369  0.0202  117 ILE B CB  
1345 C CG1 . ILE B 71  ? 0.3572 0.3244 0.3512 -0.0186 0.0346  0.0191  117 ILE B CG1 
1346 C CG2 . ILE B 71  ? 0.3633 0.3222 0.3671 -0.0274 0.0275  0.0163  117 ILE B CG2 
1347 C CD1 . ILE B 71  ? 0.3623 0.3199 0.3420 -0.0104 0.0279  0.0207  117 ILE B CD1 
1348 N N   . LYS B 72  ? 0.4506 0.3530 0.4145 -0.0331 0.0409  0.0297  118 LYS B N   
1349 C CA  . LYS B 72  ? 0.4900 0.3719 0.4495 -0.0408 0.0425  0.0303  118 LYS B CA  
1350 C C   . LYS B 72  ? 0.4712 0.3539 0.4378 -0.0414 0.0336  0.0232  118 LYS B C   
1351 O O   . LYS B 72  ? 0.4889 0.3566 0.4546 -0.0495 0.0333  0.0210  118 LYS B O   
1352 C CB  . LYS B 72  ? 0.5293 0.3834 0.4637 -0.0341 0.0450  0.0373  118 LYS B CB  
1353 C CG  . LYS B 72  ? 0.5841 0.4304 0.5046 -0.0342 0.0545  0.0453  118 LYS B CG  
1354 C CD  . LYS B 72  ? 0.6295 0.4740 0.5589 -0.0501 0.0657  0.0473  118 LYS B CD  
1355 C CE  . LYS B 72  ? 0.6797 0.5073 0.5885 -0.0507 0.0777  0.0571  118 LYS B CE  
1356 N NZ  . LYS B 72  ? 0.7085 0.5431 0.6325 -0.0669 0.0909  0.0588  118 LYS B NZ  
1357 N N   . GLN B 73  ? 0.4402 0.3381 0.4119 -0.0331 0.0266  0.0196  119 GLN B N   
1358 C CA  . GLN B 73  ? 0.4369 0.3364 0.4124 -0.0326 0.0191  0.0132  119 GLN B CA  
1359 C C   . GLN B 73  ? 0.3982 0.3226 0.3897 -0.0322 0.0144  0.0092  119 GLN B C   
1360 O O   . GLN B 73  ? 0.3693 0.3012 0.3595 -0.0237 0.0110  0.0090  119 GLN B O   
1361 C CB  . GLN B 73  ? 0.4522 0.3404 0.4139 -0.0209 0.0167  0.0139  119 GLN B CB  
1362 C CG  . GLN B 73  ? 0.5034 0.3868 0.4624 -0.0198 0.0115  0.0077  119 GLN B CG  
1363 C CD  . GLN B 73  ? 0.5430 0.4240 0.4936 -0.0070 0.0111  0.0084  119 GLN B CD  
1364 O OE1 . GLN B 73  ? 0.5623 0.4457 0.5111 -0.0040 0.0083  0.0044  119 GLN B OE1 
1365 N NE2 . GLN B 73  ? 0.5774 0.4542 0.5228 0.0010  0.0140  0.0137  119 GLN B NE2 
1366 N N   . PRO B 74  ? 0.3945 0.3316 0.4022 -0.0415 0.0141  0.0064  120 PRO B N   
1367 C CA  . PRO B 74  ? 0.3716 0.3307 0.3940 -0.0396 0.0087  0.0028  120 PRO B CA  
1368 C C   . PRO B 74  ? 0.3690 0.3251 0.3853 -0.0350 -0.0002 -0.0014 120 PRO B C   
1369 O O   . PRO B 74  ? 0.3775 0.3178 0.3839 -0.0374 -0.0032 -0.0042 120 PRO B O   
1370 C CB  . PRO B 74  ? 0.3790 0.3511 0.4215 -0.0506 0.0093  -0.0001 120 PRO B CB  
1371 C CG  . PRO B 74  ? 0.4063 0.3653 0.4451 -0.0588 0.0188  0.0040  120 PRO B CG  
1372 C CD  . PRO B 74  ? 0.4116 0.3441 0.4269 -0.0542 0.0186  0.0064  120 PRO B CD  
1373 N N   . MET B 75  ? 0.3455 0.3135 0.3648 -0.0280 -0.0037 -0.0016 121 MET B N   
1374 C CA  . MET B 75  ? 0.3463 0.3112 0.3578 -0.0234 -0.0107 -0.0042 121 MET B CA  
1375 C C   . MET B 75  ? 0.3414 0.3221 0.3623 -0.0195 -0.0153 -0.0047 121 MET B C   
1376 O O   . MET B 75  ? 0.3268 0.3175 0.3560 -0.0172 -0.0118 -0.0024 121 MET B O   
1377 C CB  . MET B 75  ? 0.3477 0.3009 0.3439 -0.0158 -0.0072 -0.0012 121 MET B CB  
1378 C CG  . MET B 75  ? 0.3730 0.3182 0.3562 -0.0112 -0.0111 -0.0034 121 MET B CG  
1379 S SD  . MET B 75  ? 0.4092 0.3417 0.3833 -0.0168 -0.0187 -0.0107 121 MET B SD  
1380 C CE  . MET B 75  ? 0.4191 0.3338 0.3879 -0.0215 -0.0129 -0.0107 121 MET B CE  
1381 N N   . ASP B 76  ? 0.3553 0.3352 0.3719 -0.0178 -0.0235 -0.0079 122 ASP B N   
1382 C CA  . ASP B 76  ? 0.3386 0.3292 0.3606 -0.0127 -0.0294 -0.0080 122 ASP B CA  
1383 C C   . ASP B 76  ? 0.3442 0.3235 0.3480 -0.0079 -0.0357 -0.0088 122 ASP B C   
1384 O O   . ASP B 76  ? 0.3515 0.3174 0.3411 -0.0094 -0.0366 -0.0111 122 ASP B O   
1385 C CB  . ASP B 76  ? 0.3375 0.3453 0.3802 -0.0167 -0.0349 -0.0118 122 ASP B CB  
1386 C CG  . ASP B 76  ? 0.3571 0.3628 0.4004 -0.0231 -0.0440 -0.0175 122 ASP B CG  
1387 O OD1 . ASP B 76  ? 0.3577 0.3558 0.4009 -0.0314 -0.0405 -0.0191 122 ASP B OD1 
1388 O OD2 . ASP B 76  ? 0.3728 0.3822 0.4150 -0.0198 -0.0554 -0.0206 122 ASP B OD2 
1389 N N   A MET B 77  ? 0.3476 0.3299 0.3491 -0.0015 -0.0398 -0.0067 123 MET B N   
1390 N N   B MET B 77  ? 0.3461 0.3286 0.3480 -0.0015 -0.0397 -0.0067 123 MET B N   
1391 C CA  A MET B 77  ? 0.3675 0.3367 0.3474 0.0038  -0.0443 -0.0060 123 MET B CA  
1392 C CA  B MET B 77  ? 0.3651 0.3352 0.3459 0.0041  -0.0446 -0.0059 123 MET B CA  
1393 C C   A MET B 77  ? 0.3818 0.3486 0.3554 0.0025  -0.0567 -0.0121 123 MET B C   
1394 C C   B MET B 77  ? 0.3800 0.3469 0.3539 0.0022  -0.0564 -0.0121 123 MET B C   
1395 O O   A MET B 77  ? 0.3961 0.3472 0.3457 0.0057  -0.0595 -0.0130 123 MET B O   
1396 O O   B MET B 77  ? 0.3927 0.3435 0.3429 0.0049  -0.0584 -0.0132 123 MET B O   
1397 C CB  A MET B 77  ? 0.3726 0.3420 0.3497 0.0108  -0.0450 -0.0010 123 MET B CB  
1398 C CB  B MET B 77  ? 0.3693 0.3415 0.3496 0.0110  -0.0472 -0.0018 123 MET B CB  
1399 C CG  A MET B 77  ? 0.3768 0.3446 0.3563 0.0113  -0.0341 0.0043  123 MET B CG  
1400 C CG  B MET B 77  ? 0.3682 0.3401 0.3525 0.0123  -0.0374 0.0037  123 MET B CG  
1401 S SD  A MET B 77  ? 0.4129 0.3697 0.3790 0.0175  -0.0326 0.0111  123 MET B SD  
1402 S SD  B MET B 77  ? 0.3897 0.3593 0.3730 0.0195  -0.0410 0.0079  123 MET B SD  
1403 C CE  A MET B 77  ? 0.3991 0.3623 0.3724 0.0230  -0.0448 0.0093  123 MET B CE  
1404 C CE  B MET B 77  ? 0.3789 0.3434 0.3635 0.0174  -0.0293 0.0130  123 MET B CE  
1405 N N   . GLY B 78  ? 0.3772 0.3599 0.3721 -0.0023 -0.0641 -0.0167 124 GLY B N   
1406 C CA  . GLY B 78  ? 0.3965 0.3800 0.3904 -0.0055 -0.0781 -0.0239 124 GLY B CA  
1407 C C   . GLY B 78  ? 0.4149 0.3821 0.3956 -0.0125 -0.0769 -0.0285 124 GLY B C   
1408 O O   . GLY B 78  ? 0.4519 0.4051 0.4119 -0.0114 -0.0862 -0.0334 124 GLY B O   
1409 N N   . THR B 79  ? 0.4008 0.3674 0.3908 -0.0188 -0.0657 -0.0271 125 THR B N   
1410 C CA  . THR B 79  ? 0.4192 0.3666 0.3955 -0.0241 -0.0624 -0.0304 125 THR B CA  
1411 C C   . THR B 79  ? 0.4275 0.3538 0.3730 -0.0152 -0.0574 -0.0284 125 THR B C   
1412 O O   . THR B 79  ? 0.4431 0.3504 0.3674 -0.0151 -0.0613 -0.0339 125 THR B O   
1413 C CB  . THR B 79  ? 0.4039 0.3533 0.3941 -0.0303 -0.0504 -0.0270 125 THR B CB  
1414 O OG1 . THR B 79  ? 0.4178 0.3868 0.4361 -0.0390 -0.0526 -0.0286 125 THR B OG1 
1415 C CG2 . THR B 79  ? 0.4327 0.3583 0.4067 -0.0341 -0.0467 -0.0297 125 THR B CG2 
1416 N N   . ILE B 80  ? 0.4140 0.3438 0.3575 -0.0078 -0.0484 -0.0211 126 ILE B N   
1417 C CA  . ILE B 80  ? 0.4263 0.3406 0.3455 0.0004  -0.0411 -0.0181 126 ILE B CA  
1418 C C   . ILE B 80  ? 0.4660 0.3690 0.3605 0.0057  -0.0498 -0.0208 126 ILE B C   
1419 O O   . ILE B 80  ? 0.4867 0.3706 0.3552 0.0099  -0.0472 -0.0233 126 ILE B O   
1420 C CB  . ILE B 80  ? 0.4112 0.3344 0.3379 0.0051  -0.0309 -0.0097 126 ILE B CB  
1421 C CG1 . ILE B 80  ? 0.3847 0.3150 0.3286 0.0018  -0.0228 -0.0073 126 ILE B CG1 
1422 C CG2 . ILE B 80  ? 0.4172 0.3279 0.3219 0.0128  -0.0228 -0.0061 126 ILE B CG2 
1423 C CD1 . ILE B 80  ? 0.3707 0.3114 0.3250 0.0048  -0.0158 -0.0006 126 ILE B CD1 
1424 N N   . LYS B 81  ? 0.4813 0.3948 0.3821 0.0069  -0.0600 -0.0204 127 LYS B N   
1425 C CA  . LYS B 81  ? 0.5232 0.4257 0.3988 0.0131  -0.0706 -0.0223 127 LYS B CA  
1426 C C   . LYS B 81  ? 0.5595 0.4489 0.4199 0.0095  -0.0822 -0.0326 127 LYS B C   
1427 O O   . LYS B 81  ? 0.5921 0.4607 0.4188 0.0154  -0.0842 -0.0350 127 LYS B O   
1428 C CB  . LYS B 81  ? 0.5168 0.4345 0.4060 0.0157  -0.0813 -0.0202 127 LYS B CB  
1429 C CG  . LYS B 81  ? 0.5648 0.4705 0.4264 0.0239  -0.0942 -0.0210 127 LYS B CG  
1430 C CD  . LYS B 81  ? 0.5787 0.4980 0.4539 0.0292  -0.1029 -0.0170 127 LYS B CD  
1431 C CE  . LYS B 81  ? 0.6295 0.5410 0.4828 0.0366  -0.1218 -0.0200 127 LYS B CE  
1432 N NZ  . LYS B 81  ? 0.6393 0.5598 0.5035 0.0301  -0.1389 -0.0316 127 LYS B NZ  
1433 N N   . ARG B 82  ? 0.5609 0.4613 0.4454 -0.0007 -0.0893 -0.0388 128 ARG B N   
1434 C CA  . ARG B 82  ? 0.5918 0.4795 0.4660 -0.0072 -0.1013 -0.0496 128 ARG B CA  
1435 C C   . ARG B 82  ? 0.6008 0.4617 0.4487 -0.0056 -0.0912 -0.0521 128 ARG B C   
1436 O O   . ARG B 82  ? 0.6216 0.4609 0.4408 -0.0040 -0.0994 -0.0601 128 ARG B O   
1437 C CB  . ARG B 82  ? 0.5937 0.4999 0.5040 -0.0207 -0.1074 -0.0543 128 ARG B CB  
1438 C CG  . ARG B 82  ? 0.6743 0.5676 0.5785 -0.0303 -0.1209 -0.0662 128 ARG B CG  
1439 C CD  . ARG B 82  ? 0.7131 0.6305 0.6575 -0.0444 -0.1295 -0.0705 128 ARG B CD  
1440 N NE  . ARG B 82  ? 0.7289 0.6563 0.6990 -0.0517 -0.1132 -0.0645 128 ARG B NE  
1441 C CZ  . ARG B 82  ? 0.7361 0.6894 0.7340 -0.0506 -0.1056 -0.0572 128 ARG B CZ  
1442 N NH1 . ARG B 82  ? 0.7513 0.7240 0.7583 -0.0424 -0.1124 -0.0549 128 ARG B NH1 
1443 N NH2 . ARG B 82  ? 0.7348 0.6920 0.7489 -0.0569 -0.0909 -0.0523 128 ARG B NH2 
1444 N N   . ARG B 83  ? 0.5747 0.4364 0.4312 -0.0050 -0.0742 -0.0458 129 ARG B N   
1445 C CA  . ARG B 83  ? 0.5888 0.4273 0.4232 -0.0007 -0.0631 -0.0471 129 ARG B CA  
1446 C C   . ARG B 83  ? 0.6113 0.4341 0.4112 0.0118  -0.0577 -0.0455 129 ARG B C   
1447 O O   . ARG B 83  ? 0.6384 0.4367 0.4093 0.0162  -0.0561 -0.0515 129 ARG B O   
1448 C CB  . ARG B 83  ? 0.5642 0.4105 0.4178 -0.0011 -0.0478 -0.0399 129 ARG B CB  
1449 C CG  . ARG B 83  ? 0.5596 0.4086 0.4347 -0.0128 -0.0498 -0.0425 129 ARG B CG  
1450 C CD  . ARG B 83  ? 0.5396 0.3965 0.4312 -0.0120 -0.0365 -0.0346 129 ARG B CD  
1451 N NE  . ARG B 83  ? 0.5310 0.3909 0.4419 -0.0236 -0.0377 -0.0356 129 ARG B NE  
1452 C CZ  . ARG B 83  ? 0.5334 0.3937 0.4541 -0.0246 -0.0281 -0.0299 129 ARG B CZ  
1453 N NH1 . ARG B 83  ? 0.4995 0.3602 0.4159 -0.0145 -0.0181 -0.0236 129 ARG B NH1 
1454 N NH2 . ARG B 83  ? 0.5571 0.4180 0.4925 -0.0361 -0.0285 -0.0304 129 ARG B NH2 
1455 N N   . LEU B 84  ? 0.6009 0.4360 0.4025 0.0176  -0.0541 -0.0372 130 LEU B N   
1456 C CA  . LEU B 84  ? 0.6310 0.4518 0.3997 0.0285  -0.0479 -0.0339 130 LEU B CA  
1457 C C   . LEU B 84  ? 0.6789 0.4809 0.4147 0.0311  -0.0635 -0.0424 130 LEU B C   
1458 O O   . LEU B 84  ? 0.7137 0.4924 0.4129 0.0390  -0.0587 -0.0453 130 LEU B O   
1459 C CB  . LEU B 84  ? 0.6081 0.4441 0.3870 0.0319  -0.0423 -0.0229 130 LEU B CB  
1460 C CG  . LEU B 84  ? 0.5841 0.4346 0.3875 0.0314  -0.0257 -0.0147 130 LEU B CG  
1461 C CD1 . LEU B 84  ? 0.5499 0.4160 0.3698 0.0310  -0.0248 -0.0060 130 LEU B CD1 
1462 C CD2 . LEU B 84  ? 0.5952 0.4338 0.3801 0.0390  -0.0088 -0.0121 130 LEU B CD2 
1463 N N   . GLU B 85  ? 0.6885 0.5014 0.4377 0.0250  -0.0825 -0.0468 131 GLU B N   
1464 C CA  . GLU B 85  ? 0.7369 0.5356 0.4587 0.0269  -0.1020 -0.0555 131 GLU B CA  
1465 C C   . GLU B 85  ? 0.7749 0.5517 0.4794 0.0221  -0.1092 -0.0687 131 GLU B C   
1466 O O   . GLU B 85  ? 0.8153 0.5691 0.4812 0.0273  -0.1196 -0.0763 131 GLU B O   
1467 C CB  . GLU B 85  ? 0.7247 0.5467 0.4738 0.0217  -0.1209 -0.0567 131 GLU B CB  
1468 C CG  . GLU B 85  ? 0.7265 0.5608 0.4797 0.0296  -0.1184 -0.0455 131 GLU B CG  
1469 C CD  . GLU B 85  ? 0.7279 0.5899 0.5175 0.0254  -0.1327 -0.0457 131 GLU B CD  
1470 O OE1 . GLU B 85  ? 0.7467 0.6219 0.5615 0.0153  -0.1443 -0.0543 131 GLU B OE1 
1471 O OE2 . GLU B 85  ? 0.7453 0.6158 0.5393 0.0323  -0.1315 -0.0370 131 GLU B OE2 
1472 N N   . ASN B 86  ? 0.7659 0.5469 0.4957 0.0125  -0.1038 -0.0714 132 ASN B N   
1473 C CA  . ASN B 86  ? 0.7996 0.5569 0.5152 0.0066  -0.1097 -0.0836 132 ASN B CA  
1474 C C   . ASN B 86  ? 0.8122 0.5447 0.5028 0.0150  -0.0910 -0.0833 132 ASN B C   
1475 O O   . ASN B 86  ? 0.8274 0.5389 0.5100 0.0106  -0.0919 -0.0919 132 ASN B O   
1476 C CB  . ASN B 86  ? 0.7860 0.5586 0.5423 -0.0098 -0.1157 -0.0869 132 ASN B CB  
1477 C CG  . ASN B 86  ? 0.7980 0.5945 0.5795 -0.0183 -0.1361 -0.0904 132 ASN B CG  
1478 O OD1 . ASN B 86  ? 0.8485 0.6397 0.6095 -0.0145 -0.1532 -0.0964 132 ASN B OD1 
1479 N ND2 . ASN B 86  ? 0.7807 0.6040 0.6062 -0.0290 -0.1343 -0.0866 132 ASN B ND2 
1480 N N   . ASN B 87  ? 0.8059 0.5409 0.4855 0.0271  -0.0738 -0.0734 133 ASN B N   
1481 C CA  . ASN B 87  ? 0.8184 0.5355 0.4783 0.0373  -0.0543 -0.0720 133 ASN B CA  
1482 C C   . ASN B 87  ? 0.7915 0.5082 0.4747 0.0320  -0.0467 -0.0727 133 ASN B C   
1483 O O   . ASN B 87  ? 0.8158 0.5070 0.4787 0.0368  -0.0410 -0.0791 133 ASN B O   
1484 C CB  . ASN B 87  ? 0.8837 0.5658 0.4925 0.0461  -0.0575 -0.0824 133 ASN B CB  
1485 C CG  . ASN B 87  ? 0.9215 0.6003 0.5004 0.0536  -0.0637 -0.0803 133 ASN B CG  
1486 O OD1 . ASN B 87  ? 0.9985 0.6526 0.5391 0.0565  -0.0770 -0.0906 133 ASN B OD1 
1487 N ND2 . ASN B 87  ? 0.8975 0.5984 0.4914 0.0566  -0.0548 -0.0671 133 ASN B ND2 
1488 N N   . TYR B 88  ? 0.7404 0.4834 0.4641 0.0230  -0.0466 -0.0659 134 TYR B N   
1489 C CA  . TYR B 88  ? 0.7165 0.4596 0.4619 0.0177  -0.0402 -0.0647 134 TYR B CA  
1490 C C   . TYR B 88  ? 0.6955 0.4402 0.4418 0.0295  -0.0205 -0.0570 134 TYR B C   
1491 O O   . TYR B 88  ? 0.7058 0.4352 0.4500 0.0320  -0.0141 -0.0588 134 TYR B O   
1492 C CB  . TYR B 88  ? 0.6856 0.4563 0.4707 0.0053  -0.0457 -0.0597 134 TYR B CB  
1493 C CG  . TYR B 88  ? 0.6825 0.4535 0.4878 0.0002  -0.0380 -0.0563 134 TYR B CG  
1494 C CD1 . TYR B 88  ? 0.7328 0.4833 0.5358 -0.0091 -0.0435 -0.0635 134 TYR B CD1 
1495 C CD2 . TYR B 88  ? 0.6672 0.4568 0.4921 0.0047  -0.0258 -0.0458 134 TYR B CD2 
1496 C CE1 . TYR B 88  ? 0.7371 0.4843 0.5548 -0.0132 -0.0358 -0.0591 134 TYR B CE1 
1497 C CE2 . TYR B 88  ? 0.6833 0.4712 0.5227 0.0014  -0.0198 -0.0422 134 TYR B CE2 
1498 C CZ  . TYR B 88  ? 0.7103 0.4760 0.5447 -0.0071 -0.0243 -0.0483 134 TYR B CZ  
1499 O OH  . TYR B 88  ? 0.7398 0.5002 0.5846 -0.0098 -0.0178 -0.0435 134 TYR B OH  
1500 N N   . TYR B 89  ? 0.6673 0.4301 0.4177 0.0367  -0.0115 -0.0482 135 TYR B N   
1501 C CA  . TYR B 89  ? 0.6510 0.4227 0.4103 0.0465  0.0062  -0.0404 135 TYR B CA  
1502 C C   . TYR B 89  ? 0.6961 0.4460 0.4236 0.0604  0.0177  -0.0442 135 TYR B C   
1503 O O   . TYR B 89  ? 0.7175 0.4528 0.4142 0.0646  0.0156  -0.0485 135 TYR B O   
1504 C CB  . TYR B 89  ? 0.6150 0.4141 0.3933 0.0468  0.0116  -0.0299 135 TYR B CB  
1505 C CG  . TYR B 89  ? 0.5752 0.3961 0.3847 0.0356  0.0029  -0.0261 135 TYR B CG  
1506 C CD1 . TYR B 89  ? 0.5401 0.3697 0.3736 0.0315  0.0047  -0.0237 135 TYR B CD1 
1507 C CD2 . TYR B 89  ? 0.5486 0.3800 0.3615 0.0307  -0.0066 -0.0246 135 TYR B CD2 
1508 C CE1 . TYR B 89  ? 0.5194 0.3678 0.3786 0.0223  -0.0015 -0.0204 135 TYR B CE1 
1509 C CE2 . TYR B 89  ? 0.5105 0.3617 0.3517 0.0222  -0.0131 -0.0217 135 TYR B CE2 
1510 C CZ  . TYR B 89  ? 0.4954 0.3552 0.3592 0.0179  -0.0098 -0.0197 135 TYR B CZ  
1511 O OH  . TYR B 89  ? 0.4739 0.3520 0.3625 0.0104  -0.0145 -0.0170 135 TYR B OH  
1512 N N   . TRP B 90  ? 0.7071 0.4545 0.4411 0.0686  0.0297  -0.0425 136 TRP B N   
1513 C CA  . TRP B 90  ? 0.7515 0.4834 0.4611 0.0843  0.0442  -0.0449 136 TRP B CA  
1514 C C   . TRP B 90  ? 0.7269 0.4844 0.4504 0.0920  0.0606  -0.0346 136 TRP B C   
1515 O O   . TRP B 90  ? 0.7574 0.5067 0.4578 0.1031  0.0734  -0.0351 136 TRP B O   
1516 C CB  . TRP B 90  ? 0.7761 0.4916 0.4863 0.0912  0.0487  -0.0487 136 TRP B CB  
1517 C CG  . TRP B 90  ? 0.8783 0.5710 0.5581 0.1082  0.0617  -0.0544 136 TRP B CG  
1518 C CD1 . TRP B 90  ? 0.9466 0.6038 0.5847 0.1122  0.0579  -0.0660 136 TRP B CD1 
1519 C CD2 . TRP B 90  ? 0.9193 0.6237 0.6081 0.1244  0.0807  -0.0493 136 TRP B CD2 
1520 N NE1 . TRP B 90  ? 1.0023 0.6464 0.6202 0.1308  0.0749  -0.0686 136 TRP B NE1 
1521 C CE2 . TRP B 90  ? 0.9826 0.6571 0.6333 0.1387  0.0896  -0.0581 136 TRP B CE2 
1522 C CE3 . TRP B 90  ? 0.9084 0.6465 0.6347 0.1284  0.0905  -0.0388 136 TRP B CE3 
1523 C CZ2 . TRP B 90  ? 1.0187 0.6980 0.6697 0.1577  0.1097  -0.0562 136 TRP B CZ2 
1524 C CZ3 . TRP B 90  ? 0.9318 0.6766 0.6611 0.1461  0.1087  -0.0370 136 TRP B CZ3 
1525 C CH2 . TRP B 90  ? 0.9839 0.7003 0.6768 0.1610  0.1191  -0.0453 136 TRP B CH2 
1526 N N   . ALA B 91  ? 0.6761 0.4634 0.4364 0.0856  0.0607  -0.0256 137 ALA B N   
1527 C CA  . ALA B 91  ? 0.6513 0.4648 0.4311 0.0899  0.0749  -0.0158 137 ALA B CA  
1528 C C   . ALA B 91  ? 0.6084 0.4460 0.4146 0.0777  0.0676  -0.0085 137 ALA B C   
1529 O O   . ALA B 91  ? 0.5821 0.4232 0.4026 0.0683  0.0546  -0.0096 137 ALA B O   
1530 C CB  . ALA B 91  ? 0.6444 0.4702 0.4463 0.0995  0.0859  -0.0131 137 ALA B CB  
1531 N N   . ALA B 92  ? 0.5905 0.4430 0.4025 0.0781  0.0772  -0.0009 138 ALA B N   
1532 C CA  . ALA B 92  ? 0.5588 0.4309 0.3933 0.0677  0.0718  0.0060  138 ALA B CA  
1533 C C   . ALA B 92  ? 0.5210 0.4131 0.3911 0.0625  0.0666  0.0083  138 ALA B C   
1534 O O   . ALA B 92  ? 0.5030 0.4018 0.3851 0.0532  0.0553  0.0092  138 ALA B O   
1535 C CB  . ALA B 92  ? 0.5592 0.4421 0.3960 0.0694  0.0864  0.0145  138 ALA B CB  
1536 N N   . SER B 93  ? 0.5180 0.4191 0.4033 0.0697  0.0747  0.0091  139 SER B N   
1537 C CA  . SER B 93  ? 0.4880 0.4061 0.4029 0.0669  0.0693  0.0113  139 SER B CA  
1538 C C   . SER B 93  ? 0.4767 0.3832 0.3877 0.0600  0.0549  0.0069  139 SER B C   
1539 O O   . SER B 93  ? 0.4541 0.3733 0.3840 0.0532  0.0478  0.0095  139 SER B O   
1540 C CB  . SER B 93  ? 0.4991 0.4241 0.4255 0.0787  0.0781  0.0115  139 SER B CB  
1541 O OG  . SER B 93  ? 0.5217 0.4214 0.4240 0.0868  0.0783  0.0049  139 SER B OG  
1542 N N   . GLU B 94  ? 0.4967 0.3786 0.3826 0.0614  0.0511  0.0001  140 GLU B N   
1543 C CA  . GLU B 94  ? 0.4963 0.3665 0.3794 0.0532  0.0388  -0.0041 140 GLU B CA  
1544 C C   . GLU B 94  ? 0.4761 0.3558 0.3665 0.0419  0.0292  -0.0030 140 GLU B C   
1545 O O   . GLU B 94  ? 0.4405 0.3264 0.3448 0.0344  0.0222  -0.0025 140 GLU B O   
1546 C CB  . GLU B 94  ? 0.5368 0.3776 0.3914 0.0555  0.0361  -0.0125 140 GLU B CB  
1547 C CG  . GLU B 94  ? 0.5842 0.4100 0.4289 0.0679  0.0447  -0.0148 140 GLU B CG  
1548 C CD  . GLU B 94  ? 0.6549 0.4473 0.4676 0.0701  0.0418  -0.0245 140 GLU B CD  
1549 O OE1 . GLU B 94  ? 0.6773 0.4600 0.4759 0.0615  0.0322  -0.0297 140 GLU B OE1 
1550 O OE2 . GLU B 94  ? 0.7004 0.4754 0.5018 0.0810  0.0482  -0.0275 140 GLU B OE2 
1551 N N   . CYS B 95  ? 0.4793 0.3591 0.3585 0.0418  0.0297  -0.0025 141 CYS B N   
1552 C CA  . CYS B 95  ? 0.4652 0.3538 0.3507 0.0338  0.0210  -0.0010 141 CYS B CA  
1553 C C   . CYS B 95  ? 0.4316 0.3420 0.3436 0.0305  0.0228  0.0056  141 CYS B C   
1554 O O   . CYS B 95  ? 0.4036 0.3219 0.3284 0.0239  0.0150  0.0057  141 CYS B O   
1555 C CB  . CYS B 95  ? 0.4931 0.3732 0.3562 0.0368  0.0217  -0.0008 141 CYS B CB  
1556 S SG  . CYS B 95  ? 0.4925 0.3818 0.3617 0.0306  0.0115  0.0023  141 CYS B SG  
1557 N N   . MET B 96  ? 0.4220 0.3422 0.3429 0.0352  0.0331  0.0106  142 MET B N   
1558 C CA  . MET B 96  ? 0.4024 0.3423 0.3487 0.0318  0.0340  0.0158  142 MET B CA  
1559 C C   . MET B 96  ? 0.3856 0.3311 0.3463 0.0295  0.0280  0.0145  142 MET B C   
1560 O O   . MET B 96  ? 0.3634 0.3196 0.3383 0.0243  0.0232  0.0162  142 MET B O   
1561 C CB  . MET B 96  ? 0.4059 0.3569 0.3622 0.0368  0.0460  0.0205  142 MET B CB  
1562 C CG  . MET B 96  ? 0.4470 0.3941 0.3911 0.0371  0.0539  0.0242  142 MET B CG  
1563 S SD  . MET B 96  ? 0.4779 0.4341 0.4277 0.0449  0.0724  0.0284  142 MET B SD  
1564 C CE  . MET B 96  ? 0.4451 0.4299 0.4359 0.0395  0.0723  0.0328  142 MET B CE  
1565 N N   A GLN B 97  ? 0.3982 0.3337 0.3523 0.0340  0.0288  0.0117  143 GLN B N   
1566 N N   B GLN B 97  ? 0.3908 0.3264 0.3449 0.0340  0.0288  0.0117  143 GLN B N   
1567 C CA  A GLN B 97  ? 0.3941 0.3293 0.3555 0.0323  0.0239  0.0114  143 GLN B CA  
1568 C CA  B GLN B 97  ? 0.3804 0.3159 0.3420 0.0322  0.0239  0.0114  143 GLN B CA  
1569 C C   A GLN B 97  ? 0.3759 0.3089 0.3370 0.0231  0.0160  0.0093  143 GLN B C   
1570 C C   B GLN B 97  ? 0.3688 0.3015 0.3298 0.0231  0.0160  0.0093  143 GLN B C   
1571 O O   A GLN B 97  ? 0.3629 0.3039 0.3349 0.0196  0.0129  0.0110  143 GLN B O   
1572 O O   B GLN B 97  ? 0.3566 0.2967 0.3281 0.0197  0.0129  0.0109  143 GLN B O   
1573 C CB  A GLN B 97  ? 0.4185 0.3361 0.3674 0.0384  0.0260  0.0087  143 GLN B CB  
1574 C CB  B GLN B 97  ? 0.3955 0.3144 0.3454 0.0389  0.0265  0.0090  143 GLN B CB  
1575 C CG  A GLN B 97  ? 0.4540 0.3718 0.4018 0.0502  0.0347  0.0096  143 GLN B CG  
1576 C CG  B GLN B 97  ? 0.3943 0.3207 0.3525 0.0498  0.0331  0.0118  143 GLN B CG  
1577 C CD  A GLN B 97  ? 0.4581 0.3989 0.4291 0.0543  0.0371  0.0146  143 GLN B CD  
1578 C CD  B GLN B 97  ? 0.4130 0.3187 0.3563 0.0584  0.0358  0.0090  143 GLN B CD  
1579 O OE1 A GLN B 97  ? 0.4533 0.4074 0.4383 0.0481  0.0315  0.0171  143 GLN B OE1 
1580 O OE1 B GLN B 97  ? 0.4402 0.3335 0.3683 0.0642  0.0415  0.0055  143 GLN B OE1 
1581 N NE2 A GLN B 97  ? 0.4899 0.4359 0.4657 0.0653  0.0451  0.0156  143 GLN B NE2 
1582 N NE2 B GLN B 97  ? 0.4045 0.3036 0.3491 0.0598  0.0319  0.0106  143 GLN B NE2 
1583 N N   . ASP B 98  ? 0.3823 0.3051 0.3308 0.0198  0.0126  0.0053  144 ASP B N   
1584 C CA  . ASP B 98  ? 0.3732 0.2978 0.3255 0.0115  0.0050  0.0028  144 ASP B CA  
1585 C C   . ASP B 98  ? 0.3383 0.2791 0.3038 0.0092  0.0028  0.0058  144 ASP B C   
1586 O O   . ASP B 98  ? 0.3209 0.2690 0.2971 0.0046  -0.0001 0.0058  144 ASP B O   
1587 C CB  . ASP B 98  ? 0.3928 0.3050 0.3304 0.0090  -0.0005 -0.0029 144 ASP B CB  
1588 C CG  . ASP B 98  ? 0.4381 0.3319 0.3653 0.0070  -0.0015 -0.0076 144 ASP B CG  
1589 O OD1 . ASP B 98  ? 0.4234 0.3131 0.3543 0.0079  0.0028  -0.0054 144 ASP B OD1 
1590 O OD2 . ASP B 98  ? 0.4522 0.3337 0.3663 0.0044  -0.0073 -0.0137 144 ASP B OD2 
1591 N N   . PHE B 99  ? 0.3250 0.2695 0.2887 0.0124  0.0053  0.0084  145 PHE B N   
1592 C CA  . PHE B 99  ? 0.3236 0.2795 0.2988 0.0105  0.0038  0.0115  145 PHE B CA  
1593 C C   . PHE B 99  ? 0.3130 0.2787 0.3028 0.0096  0.0049  0.0134  145 PHE B C   
1594 O O   . PHE B 99  ? 0.3257 0.2975 0.3234 0.0067  0.0013  0.0130  145 PHE B O   
1595 C CB  . PHE B 99  ? 0.3357 0.2912 0.3063 0.0133  0.0086  0.0155  145 PHE B CB  
1596 C CG  . PHE B 99  ? 0.3714 0.3182 0.3270 0.0141  0.0048  0.0150  145 PHE B CG  
1597 C CD1 . PHE B 99  ? 0.3951 0.3450 0.3549 0.0124  -0.0019 0.0154  145 PHE B CD1 
1598 C CD2 . PHE B 99  ? 0.4040 0.3385 0.3392 0.0182  0.0077  0.0142  145 PHE B CD2 
1599 C CE1 . PHE B 99  ? 0.4110 0.3524 0.3559 0.0148  -0.0072 0.0155  145 PHE B CE1 
1600 C CE2 . PHE B 99  ? 0.4508 0.3756 0.3683 0.0200  0.0027  0.0140  145 PHE B CE2 
1601 C CZ  . PHE B 99  ? 0.4299 0.3586 0.3528 0.0184  -0.0054 0.0150  145 PHE B CZ  
1602 N N   . ASN B 100 ? 0.3155 0.2822 0.3075 0.0132  0.0094  0.0150  146 ASN B N   
1603 C CA  . ASN B 100 ? 0.3159 0.2911 0.3193 0.0135  0.0084  0.0165  146 ASN B CA  
1604 C C   . ASN B 100 ? 0.3077 0.2793 0.3090 0.0109  0.0050  0.0148  146 ASN B C   
1605 O O   . ASN B 100 ? 0.2805 0.2579 0.2874 0.0093  0.0025  0.0151  146 ASN B O   
1606 C CB  . ASN B 100 ? 0.3276 0.3059 0.3350 0.0196  0.0124  0.0184  146 ASN B CB  
1607 C CG  . ASN B 100 ? 0.3453 0.3320 0.3627 0.0210  0.0086  0.0196  146 ASN B CG  
1608 O OD1 . ASN B 100 ? 0.3650 0.3635 0.3951 0.0193  0.0065  0.0206  146 ASN B OD1 
1609 N ND2 . ASN B 100 ? 0.3498 0.3285 0.3599 0.0239  0.0071  0.0195  146 ASN B ND2 
1610 N N   . THR B 101 ? 0.3160 0.2764 0.3080 0.0102  0.0057  0.0131  147 THR B N   
1611 C CA  . THR B 101 ? 0.3152 0.2712 0.3056 0.0061  0.0048  0.0124  147 THR B CA  
1612 C C   . THR B 101 ? 0.3069 0.2717 0.3046 0.0010  0.0023  0.0109  147 THR B C   
1613 O O   . THR B 101 ? 0.3121 0.2802 0.3125 -0.0006 0.0031  0.0116  147 THR B O   
1614 C CB  . THR B 101 ? 0.3312 0.2718 0.3115 0.0039  0.0058  0.0103  147 THR B CB  
1615 O OG1 . THR B 101 ? 0.3427 0.2732 0.3152 0.0108  0.0087  0.0118  147 THR B OG1 
1616 C CG2 . THR B 101 ? 0.3220 0.2584 0.3029 -0.0028 0.0066  0.0105  147 THR B CG2 
1617 N N   . MET B 102 ? 0.3011 0.2690 0.3006 -0.0003 -0.0005 0.0087  148 MET B N   
1618 C CA  . MET B 102 ? 0.3001 0.2771 0.3079 -0.0027 -0.0034 0.0071  148 MET B CA  
1619 C C   . MET B 102 ? 0.2763 0.2601 0.2894 -0.0005 -0.0029 0.0086  148 MET B C   
1620 O O   . MET B 102 ? 0.2650 0.2537 0.2826 -0.0016 -0.0021 0.0076  148 MET B O   
1621 C CB  . MET B 102 ? 0.3053 0.2824 0.3110 -0.0019 -0.0080 0.0055  148 MET B CB  
1622 C CG  . MET B 102 ? 0.3257 0.3121 0.3405 -0.0017 -0.0120 0.0041  148 MET B CG  
1623 S SD  . MET B 102 ? 0.3507 0.3337 0.3583 0.0016  -0.0190 0.0035  148 MET B SD  
1624 C CE  . MET B 102 ? 0.3872 0.3623 0.3854 0.0054  -0.0142 0.0087  148 MET B CE  
1625 N N   . PHE B 103 ? 0.2850 0.2686 0.2976 0.0022  -0.0030 0.0106  149 PHE B N   
1626 C CA  . PHE B 103 ? 0.2842 0.2721 0.3016 0.0031  -0.0042 0.0109  149 PHE B CA  
1627 C C   . PHE B 103 ? 0.2799 0.2680 0.2953 0.0039  -0.0036 0.0110  149 PHE B C   
1628 O O   . PHE B 103 ? 0.2763 0.2658 0.2914 0.0041  -0.0046 0.0093  149 PHE B O   
1629 C CB  . PHE B 103 ? 0.2961 0.2845 0.3163 0.0037  -0.0041 0.0132  149 PHE B CB  
1630 C CG  . PHE B 103 ? 0.3291 0.3139 0.3468 0.0036  -0.0041 0.0143  149 PHE B CG  
1631 C CD1 . PHE B 103 ? 0.3461 0.3296 0.3640 0.0040  -0.0075 0.0129  149 PHE B CD1 
1632 C CD2 . PHE B 103 ? 0.3337 0.3154 0.3469 0.0046  -0.0004 0.0171  149 PHE B CD2 
1633 C CE1 . PHE B 103 ? 0.3558 0.3335 0.3683 0.0053  -0.0087 0.0147  149 PHE B CE1 
1634 C CE2 . PHE B 103 ? 0.3606 0.3360 0.3665 0.0052  -0.0003 0.0189  149 PHE B CE2 
1635 C CZ  . PHE B 103 ? 0.3414 0.3141 0.3464 0.0056  -0.0052 0.0181  149 PHE B CZ  
1636 N N   . THR B 104 ? 0.2782 0.2628 0.2896 0.0055  -0.0021 0.0130  150 THR B N   
1637 C CA  . THR B 104 ? 0.2697 0.2519 0.2757 0.0078  -0.0026 0.0141  150 THR B CA  
1638 C C   . THR B 104 ? 0.2794 0.2577 0.2788 0.0056  0.0005  0.0136  150 THR B C   
1639 O O   . THR B 104 ? 0.2788 0.2563 0.2723 0.0072  0.0000  0.0134  150 THR B O   
1640 C CB  . THR B 104 ? 0.2845 0.2618 0.2869 0.0119  -0.0016 0.0168  150 THR B CB  
1641 O OG1 . THR B 104 ? 0.2922 0.2769 0.3038 0.0142  -0.0025 0.0174  150 THR B OG1 
1642 C CG2 . THR B 104 ? 0.2969 0.2700 0.2911 0.0160  -0.0038 0.0189  150 THR B CG2 
1643 N N   . ASN B 105 ? 0.2901 0.2662 0.2906 0.0017  0.0039  0.0132  151 ASN B N   
1644 C CA  . ASN B 105 ? 0.2871 0.2632 0.2869 -0.0022 0.0087  0.0129  151 ASN B CA  
1645 C C   . ASN B 105 ? 0.2807 0.2652 0.2845 -0.0008 0.0088  0.0103  151 ASN B C   
1646 O O   . ASN B 105 ? 0.2913 0.2747 0.2892 -0.0006 0.0137  0.0108  151 ASN B O   
1647 C CB  . ASN B 105 ? 0.2830 0.2607 0.2904 -0.0080 0.0098  0.0111  151 ASN B CB  
1648 C CG  . ASN B 105 ? 0.3123 0.2770 0.3125 -0.0104 0.0110  0.0127  151 ASN B CG  
1649 O OD1 . ASN B 105 ? 0.3171 0.2710 0.3064 -0.0071 0.0125  0.0160  151 ASN B OD1 
1650 N ND2 . ASN B 105 ? 0.3076 0.2719 0.3131 -0.0157 0.0094  0.0097  151 ASN B ND2 
1651 N N   . CYS B 106 ? 0.2799 0.2705 0.2916 0.0005  0.0044  0.0078  152 CYS B N   
1652 C CA  . CYS B 106 ? 0.2899 0.2854 0.3048 0.0030  0.0041  0.0047  152 CYS B CA  
1653 C C   . CYS B 106 ? 0.2978 0.2882 0.3021 0.0064  0.0029  0.0040  152 CYS B C   
1654 O O   . CYS B 106 ? 0.3099 0.2999 0.3085 0.0086  0.0067  0.0020  152 CYS B O   
1655 C CB  . CYS B 106 ? 0.2916 0.2896 0.3138 0.0043  -0.0011 0.0033  152 CYS B CB  
1656 S SG  . CYS B 106 ? 0.3122 0.3123 0.3376 0.0090  -0.0020 -0.0007 152 CYS B SG  
1657 N N   . TYR B 107 ? 0.2944 0.2813 0.2958 0.0071  -0.0022 0.0054  153 TYR B N   
1658 C CA  . TYR B 107 ? 0.3021 0.2849 0.2945 0.0099  -0.0068 0.0039  153 TYR B CA  
1659 C C   . TYR B 107 ? 0.3253 0.3018 0.3021 0.0122  -0.0035 0.0058  153 TYR B C   
1660 O O   . TYR B 107 ? 0.3291 0.3006 0.2933 0.0153  -0.0047 0.0032  153 TYR B O   
1661 C CB  . TYR B 107 ? 0.2980 0.2830 0.2965 0.0097  -0.0134 0.0051  153 TYR B CB  
1662 C CG  . TYR B 107 ? 0.2763 0.2651 0.2876 0.0068  -0.0149 0.0048  153 TYR B CG  
1663 C CD1 . TYR B 107 ? 0.2906 0.2770 0.3038 0.0061  -0.0159 0.0016  153 TYR B CD1 
1664 C CD2 . TYR B 107 ? 0.2754 0.2683 0.2950 0.0058  -0.0145 0.0080  153 TYR B CD2 
1665 C CE1 . TYR B 107 ? 0.2861 0.2723 0.3076 0.0036  -0.0168 0.0026  153 TYR B CE1 
1666 C CE2 . TYR B 107 ? 0.2773 0.2718 0.3054 0.0031  -0.0140 0.0089  153 TYR B CE2 
1667 C CZ  . TYR B 107 ? 0.2801 0.2703 0.3084 0.0017  -0.0154 0.0066  153 TYR B CZ  
1668 O OH  . TYR B 107 ? 0.3168 0.3048 0.3503 -0.0008 -0.0145 0.0087  153 TYR B OH  
1669 N N   . ILE B 108 ? 0.3353 0.3090 0.3102 0.0110  0.0007  0.0102  154 ILE B N   
1670 C CA  . ILE B 108 ? 0.3633 0.3271 0.3210 0.0129  0.0048  0.0139  154 ILE B CA  
1671 C C   . ILE B 108 ? 0.3649 0.3274 0.3159 0.0114  0.0145  0.0135  154 ILE B C   
1672 O O   . ILE B 108 ? 0.3934 0.3474 0.3253 0.0150  0.0171  0.0145  154 ILE B O   
1673 C CB  . ILE B 108 ? 0.3727 0.3302 0.3302 0.0114  0.0073  0.0189  154 ILE B CB  
1674 C CG1 . ILE B 108 ? 0.4056 0.3636 0.3654 0.0162  -0.0010 0.0199  154 ILE B CG1 
1675 C CG2 . ILE B 108 ? 0.4253 0.3694 0.3651 0.0113  0.0146  0.0238  154 ILE B CG2 
1676 C CD1 . ILE B 108 ? 0.4510 0.4020 0.4114 0.0165  0.0014  0.0234  154 ILE B CD1 
1677 N N   . TYR B 109 ? 0.3491 0.3207 0.3156 0.0068  0.0200  0.0120  155 TYR B N   
1678 C CA  . TYR B 109 ? 0.3571 0.3324 0.3237 0.0051  0.0310  0.0118  155 TYR B CA  
1679 C C   . TYR B 109 ? 0.3525 0.3315 0.3157 0.0106  0.0320  0.0066  155 TYR B C   
1680 O O   . TYR B 109 ? 0.3522 0.3273 0.3018 0.0131  0.0408  0.0069  155 TYR B O   
1681 C CB  . TYR B 109 ? 0.3582 0.3453 0.3466 -0.0016 0.0349  0.0114  155 TYR B CB  
1682 C CG  . TYR B 109 ? 0.3673 0.3634 0.3623 -0.0038 0.0470  0.0111  155 TYR B CG  
1683 C CD1 . TYR B 109 ? 0.4004 0.3895 0.3863 -0.0084 0.0583  0.0164  155 TYR B CD1 
1684 C CD2 . TYR B 109 ? 0.3834 0.3943 0.3932 -0.0005 0.0481  0.0061  155 TYR B CD2 
1685 C CE1 . TYR B 109 ? 0.4211 0.4206 0.4150 -0.0110 0.0719  0.0167  155 TYR B CE1 
1686 C CE2 . TYR B 109 ? 0.3970 0.4195 0.4159 -0.0013 0.0606  0.0057  155 TYR B CE2 
1687 C CZ  . TYR B 109 ? 0.4186 0.4367 0.4306 -0.0071 0.0731  0.0110  155 TYR B CZ  
1688 O OH  . TYR B 109 ? 0.4473 0.4791 0.4706 -0.0086 0.0879  0.0111  155 TYR B OH  
1689 N N   . ASN B 110 ? 0.3435 0.3278 0.3171 0.0128  0.0241  0.0019  156 ASN B N   
1690 C CA  . ASN B 110 ? 0.3514 0.3376 0.3241 0.0183  0.0254  -0.0039 156 ASN B CA  
1691 C C   . ASN B 110 ? 0.3758 0.3490 0.3268 0.0236  0.0202  -0.0073 156 ASN B C   
1692 O O   . ASN B 110 ? 0.3760 0.3418 0.3175 0.0229  0.0123  -0.0056 156 ASN B O   
1693 C CB  . ASN B 110 ? 0.3357 0.3294 0.3268 0.0186  0.0192  -0.0069 156 ASN B CB  
1694 C CG  . ASN B 110 ? 0.3339 0.3414 0.3450 0.0149  0.0231  -0.0052 156 ASN B CG  
1695 O OD1 . ASN B 110 ? 0.3360 0.3538 0.3560 0.0165  0.0311  -0.0067 156 ASN B OD1 
1696 N ND2 . ASN B 110 ? 0.2901 0.2986 0.3086 0.0101  0.0175  -0.0025 156 ASN B ND2 
1697 N N   . LYS B 111 ? 0.3966 0.3668 0.3393 0.0295  0.0242  -0.0128 157 LYS B N   
1698 C CA  . LYS B 111 ? 0.4209 0.3763 0.3414 0.0345  0.0171  -0.0182 157 LYS B CA  
1699 C C   . LYS B 111 ? 0.3972 0.3503 0.3279 0.0323  0.0034  -0.0216 157 LYS B C   
1700 O O   . LYS B 111 ? 0.3581 0.3180 0.3077 0.0307  0.0029  -0.0217 157 LYS B O   
1701 C CB  . LYS B 111 ? 0.4521 0.4025 0.3598 0.0424  0.0254  -0.0245 157 LYS B CB  
1702 C CG  . LYS B 111 ? 0.5118 0.4655 0.4099 0.0447  0.0421  -0.0210 157 LYS B CG  
1703 C CD  . LYS B 111 ? 0.5700 0.5178 0.4530 0.0544  0.0508  -0.0281 157 LYS B CD  
1704 C CE  . LYS B 111 ? 0.6138 0.5690 0.4927 0.0561  0.0711  -0.0240 157 LYS B CE  
1705 N NZ  . LYS B 111 ? 0.6095 0.5888 0.5246 0.0506  0.0793  -0.0199 157 LYS B NZ  
1706 N N   . PRO B 112 ? 0.4050 0.3483 0.3233 0.0318  -0.0080 -0.0241 158 PRO B N   
1707 C CA  . PRO B 112 ? 0.3970 0.3386 0.3269 0.0277  -0.0200 -0.0270 158 PRO B CA  
1708 C C   . PRO B 112 ? 0.4002 0.3357 0.3353 0.0294  -0.0202 -0.0326 158 PRO B C   
1709 O O   . PRO B 112 ? 0.3967 0.3332 0.3474 0.0248  -0.0252 -0.0317 158 PRO B O   
1710 C CB  . PRO B 112 ? 0.4205 0.3521 0.3327 0.0284  -0.0315 -0.0312 158 PRO B CB  
1711 C CG  . PRO B 112 ? 0.4390 0.3709 0.3356 0.0316  -0.0270 -0.0261 158 PRO B CG  
1712 C CD  . PRO B 112 ? 0.4269 0.3610 0.3204 0.0347  -0.0107 -0.0237 158 PRO B CD  
1713 N N   . THR B 113 ? 0.4151 0.3429 0.3358 0.0369  -0.0138 -0.0380 159 THR B N   
1714 C CA  . THR B 113 ? 0.4407 0.3590 0.3626 0.0413  -0.0141 -0.0442 159 THR B CA  
1715 C C   . THR B 113 ? 0.4226 0.3527 0.3636 0.0444  -0.0056 -0.0409 159 THR B C   
1716 O O   . THR B 113 ? 0.4337 0.3557 0.3777 0.0491  -0.0068 -0.0449 159 THR B O   
1717 C CB  . THR B 113 ? 0.4777 0.3803 0.3732 0.0501  -0.0114 -0.0530 159 THR B CB  
1718 O OG1 . THR B 113 ? 0.5059 0.4164 0.3915 0.0551  0.0018  -0.0503 159 THR B OG1 
1719 C CG2 . THR B 113 ? 0.5175 0.4044 0.3939 0.0471  -0.0249 -0.0588 159 THR B CG2 
1720 N N   . ASP B 114 ? 0.3993 0.3470 0.3527 0.0421  0.0017  -0.0341 160 ASP B N   
1721 C CA  . ASP B 114 ? 0.3854 0.3473 0.3588 0.0446  0.0077  -0.0316 160 ASP B CA  
1722 C C   . ASP B 114 ? 0.3658 0.3253 0.3522 0.0417  -0.0008 -0.0294 160 ASP B C   
1723 O O   . ASP B 114 ? 0.3506 0.3070 0.3384 0.0342  -0.0075 -0.0260 160 ASP B O   
1724 C CB  . ASP B 114 ? 0.3847 0.3640 0.3689 0.0397  0.0148  -0.0252 160 ASP B CB  
1725 C CG  . ASP B 114 ? 0.4331 0.4163 0.4074 0.0426  0.0272  -0.0255 160 ASP B CG  
1726 O OD1 . ASP B 114 ? 0.4714 0.4493 0.4350 0.0509  0.0330  -0.0311 160 ASP B OD1 
1727 O OD2 . ASP B 114 ? 0.4802 0.4705 0.4566 0.0367  0.0323  -0.0199 160 ASP B OD2 
1728 N N   . ASP B 115 ? 0.3605 0.3220 0.3564 0.0486  0.0003  -0.0308 161 ASP B N   
1729 C CA  . ASP B 115 ? 0.3550 0.3119 0.3596 0.0475  -0.0068 -0.0276 161 ASP B CA  
1730 C C   . ASP B 115 ? 0.3283 0.2964 0.3430 0.0392  -0.0087 -0.0205 161 ASP B C   
1731 O O   . ASP B 115 ? 0.3174 0.2775 0.3320 0.0345  -0.0143 -0.0170 161 ASP B O   
1732 C CB  . ASP B 115 ? 0.3658 0.3265 0.3797 0.0583  -0.0054 -0.0293 161 ASP B CB  
1733 C CG  . ASP B 115 ? 0.4034 0.3479 0.4058 0.0686  -0.0041 -0.0367 161 ASP B CG  
1734 O OD1 . ASP B 115 ? 0.4313 0.3602 0.4168 0.0666  -0.0050 -0.0414 161 ASP B OD1 
1735 O OD2 . ASP B 115 ? 0.4138 0.3606 0.4239 0.0796  -0.0031 -0.0384 161 ASP B OD2 
1736 N N   . ILE B 116 ? 0.3218 0.3069 0.3446 0.0372  -0.0033 -0.0184 162 ILE B N   
1737 C CA  . ILE B 116 ? 0.3111 0.3044 0.3412 0.0302  -0.0052 -0.0130 162 ILE B CA  
1738 C C   . ILE B 116 ? 0.3068 0.2915 0.3291 0.0231  -0.0086 -0.0101 162 ILE B C   
1739 O O   . ILE B 116 ? 0.2850 0.2690 0.3101 0.0193  -0.0117 -0.0060 162 ILE B O   
1740 C CB  . ILE B 116 ? 0.3059 0.3156 0.3448 0.0275  0.0015  -0.0120 162 ILE B CB  
1741 C CG1 . ILE B 116 ? 0.3055 0.3212 0.3519 0.0218  -0.0020 -0.0081 162 ILE B CG1 
1742 C CG2 . ILE B 116 ? 0.2847 0.2915 0.3123 0.0245  0.0074  -0.0119 162 ILE B CG2 
1743 C CD1 . ILE B 116 ? 0.3189 0.3381 0.3740 0.0258  -0.0085 -0.0080 162 ILE B CD1 
1744 N N   . VAL B 117 ? 0.3188 0.2972 0.3310 0.0222  -0.0083 -0.0125 163 VAL B N   
1745 C CA  . VAL B 117 ? 0.3147 0.2882 0.3231 0.0166  -0.0129 -0.0105 163 VAL B CA  
1746 C C   . VAL B 117 ? 0.3214 0.2861 0.3332 0.0139  -0.0183 -0.0096 163 VAL B C   
1747 O O   . VAL B 117 ? 0.3036 0.2705 0.3206 0.0089  -0.0195 -0.0052 163 VAL B O   
1748 C CB  . VAL B 117 ? 0.3340 0.3020 0.3297 0.0174  -0.0141 -0.0142 163 VAL B CB  
1749 C CG1 . VAL B 117 ? 0.3408 0.3059 0.3369 0.0123  -0.0216 -0.0134 163 VAL B CG1 
1750 C CG2 . VAL B 117 ? 0.3533 0.3277 0.3431 0.0187  -0.0073 -0.0125 163 VAL B CG2 
1751 N N   . LEU B 118 ? 0.3388 0.2923 0.3470 0.0176  -0.0203 -0.0133 164 LEU B N   
1752 C CA  . LEU B 118 ? 0.3569 0.2976 0.3665 0.0145  -0.0244 -0.0118 164 LEU B CA  
1753 C C   . LEU B 118 ? 0.3460 0.2895 0.3611 0.0145  -0.0228 -0.0053 164 LEU B C   
1754 O O   . LEU B 118 ? 0.3273 0.2659 0.3443 0.0089  -0.0234 -0.0006 164 LEU B O   
1755 C CB  . LEU B 118 ? 0.3869 0.3112 0.3888 0.0201  -0.0265 -0.0175 164 LEU B CB  
1756 C CG  . LEU B 118 ? 0.4524 0.3571 0.4526 0.0162  -0.0308 -0.0166 164 LEU B CG  
1757 C CD1 . LEU B 118 ? 0.4789 0.3830 0.4840 0.0046  -0.0344 -0.0156 164 LEU B CD1 
1758 C CD2 . LEU B 118 ? 0.4928 0.3781 0.4821 0.0232  -0.0330 -0.0240 164 LEU B CD2 
1759 N N   . MET B 119 ? 0.3357 0.2876 0.3530 0.0207  -0.0208 -0.0052 165 MET B N   
1760 C CA  . MET B 119 ? 0.3338 0.2883 0.3534 0.0220  -0.0215 -0.0002 165 MET B CA  
1761 C C   . MET B 119 ? 0.3243 0.2860 0.3453 0.0154  -0.0195 0.0041  165 MET B C   
1762 O O   . MET B 119 ? 0.3338 0.2896 0.3514 0.0135  -0.0196 0.0090  165 MET B O   
1763 C CB  . MET B 119 ? 0.3307 0.2967 0.3563 0.0293  -0.0214 -0.0025 165 MET B CB  
1764 C CG  . MET B 119 ? 0.3535 0.3125 0.3786 0.0386  -0.0229 -0.0063 165 MET B CG  
1765 S SD  . MET B 119 ? 0.3407 0.3207 0.3797 0.0473  -0.0204 -0.0106 165 MET B SD  
1766 C CE  . MET B 119 ? 0.3775 0.3639 0.4227 0.0508  -0.0279 -0.0065 165 MET B CE  
1767 N N   . ALA B 120 ? 0.3090 0.2809 0.3326 0.0129  -0.0170 0.0025  166 ALA B N   
1768 C CA  . ALA B 120 ? 0.3098 0.2866 0.3340 0.0083  -0.0149 0.0059  166 ALA B CA  
1769 C C   . ALA B 120 ? 0.3134 0.2851 0.3385 0.0037  -0.0148 0.0087  166 ALA B C   
1770 O O   . ALA B 120 ? 0.3248 0.2962 0.3495 0.0018  -0.0123 0.0130  166 ALA B O   
1771 C CB  . ALA B 120 ? 0.2940 0.2787 0.3188 0.0074  -0.0125 0.0041  166 ALA B CB  
1772 N N   . GLN B 121 ? 0.3250 0.2929 0.3516 0.0018  -0.0173 0.0059  167 GLN B N   
1773 C CA  . GLN B 121 ? 0.3368 0.3026 0.3695 -0.0043 -0.0181 0.0078  167 GLN B CA  
1774 C C   . GLN B 121 ? 0.3482 0.3047 0.3801 -0.0066 -0.0154 0.0131  167 GLN B C   
1775 O O   . GLN B 121 ? 0.3382 0.2981 0.3756 -0.0111 -0.0113 0.0177  167 GLN B O   
1776 C CB  . GLN B 121 ? 0.3484 0.3086 0.3815 -0.0065 -0.0238 0.0023  167 GLN B CB  
1777 C CG  . GLN B 121 ? 0.3656 0.3340 0.3971 -0.0051 -0.0269 -0.0016 167 GLN B CG  
1778 C CD  . GLN B 121 ? 0.4157 0.3756 0.4418 -0.0059 -0.0339 -0.0084 167 GLN B CD  
1779 O OE1 . GLN B 121 ? 0.4483 0.3967 0.4651 -0.0021 -0.0343 -0.0127 167 GLN B OE1 
1780 N NE2 . GLN B 121 ? 0.4206 0.3861 0.4521 -0.0098 -0.0400 -0.0102 167 GLN B NE2 
1781 N N   . THR B 122 ? 0.3583 0.3027 0.3826 -0.0026 -0.0170 0.0128  168 THR B N   
1782 C CA  . THR B 122 ? 0.3663 0.2970 0.3847 -0.0033 -0.0149 0.0188  168 THR B CA  
1783 C C   . THR B 122 ? 0.3584 0.2937 0.3715 -0.0017 -0.0104 0.0242  168 THR B C   
1784 O O   . THR B 122 ? 0.3587 0.2890 0.3698 -0.0058 -0.0049 0.0303  168 THR B O   
1785 C CB  . THR B 122 ? 0.3751 0.2916 0.3847 0.0039  -0.0190 0.0172  168 THR B CB  
1786 O OG1 . THR B 122 ? 0.3786 0.2879 0.3900 0.0034  -0.0226 0.0110  168 THR B OG1 
1787 C CG2 . THR B 122 ? 0.3840 0.2818 0.3835 0.0041  -0.0174 0.0245  168 THR B CG2 
1788 N N   . LEU B 123 ? 0.3469 0.2908 0.3573 0.0038  -0.0123 0.0217  169 LEU B N   
1789 C CA  . LEU B 123 ? 0.3517 0.2977 0.3542 0.0057  -0.0100 0.0248  169 LEU B CA  
1790 C C   . LEU B 123 ? 0.3486 0.3021 0.3554 0.0013  -0.0035 0.0269  169 LEU B C   
1791 O O   . LEU B 123 ? 0.3555 0.3046 0.3541 0.0014  0.0019  0.0315  169 LEU B O   
1792 C CB  . LEU B 123 ? 0.3484 0.3029 0.3507 0.0105  -0.0146 0.0203  169 LEU B CB  
1793 C CG  . LEU B 123 ? 0.3603 0.3118 0.3613 0.0170  -0.0210 0.0184  169 LEU B CG  
1794 C CD1 . LEU B 123 ? 0.3694 0.3354 0.3785 0.0193  -0.0244 0.0131  169 LEU B CD1 
1795 C CD2 . LEU B 123 ? 0.3904 0.3287 0.3768 0.0212  -0.0236 0.0234  169 LEU B CD2 
1796 N N   . GLU B 124 ? 0.3363 0.3005 0.3546 -0.0012 -0.0038 0.0235  170 GLU B N   
1797 C CA  . GLU B 124 ? 0.3397 0.3133 0.3651 -0.0034 0.0012  0.0249  170 GLU B CA  
1798 C C   . GLU B 124 ? 0.3460 0.3188 0.3783 -0.0085 0.0071  0.0300  170 GLU B C   
1799 O O   . GLU B 124 ? 0.3177 0.2950 0.3509 -0.0083 0.0147  0.0335  170 GLU B O   
1800 C CB  . GLU B 124 ? 0.3319 0.3151 0.3664 -0.0038 -0.0026 0.0205  170 GLU B CB  
1801 C CG  . GLU B 124 ? 0.3701 0.3636 0.4120 -0.0033 0.0006  0.0215  170 GLU B CG  
1802 C CD  . GLU B 124 ? 0.3719 0.3712 0.4171 -0.0019 -0.0047 0.0177  170 GLU B CD  
1803 O OE1 . GLU B 124 ? 0.3724 0.3718 0.4216 -0.0042 -0.0101 0.0150  170 GLU B OE1 
1804 O OE2 . GLU B 124 ? 0.3797 0.3808 0.4209 0.0019  -0.0035 0.0176  170 GLU B OE2 
1805 N N   . LYS B 125 ? 0.3600 0.3262 0.3971 -0.0133 0.0046  0.0302  171 LYS B N   
1806 C CA  . LYS B 125 ? 0.3848 0.3489 0.4304 -0.0206 0.0108  0.0355  171 LYS B CA  
1807 C C   . LYS B 125 ? 0.4014 0.3539 0.4320 -0.0191 0.0194  0.0429  171 LYS B C   
1808 O O   . LYS B 125 ? 0.4186 0.3757 0.4545 -0.0227 0.0296  0.0483  171 LYS B O   
1809 C CB  . LYS B 125 ? 0.4085 0.3623 0.4593 -0.0267 0.0053  0.0337  171 LYS B CB  
1810 C CG  . LYS B 125 ? 0.4457 0.4108 0.5120 -0.0305 -0.0022 0.0270  171 LYS B CG  
1811 C CD  . LYS B 125 ? 0.4927 0.4422 0.5544 -0.0324 -0.0103 0.0219  171 LYS B CD  
1812 C CE  . LYS B 125 ? 0.5195 0.4746 0.5967 -0.0404 -0.0172 0.0166  171 LYS B CE  
1813 N NZ  . LYS B 125 ? 0.5195 0.4969 0.6090 -0.0393 -0.0201 0.0141  171 LYS B NZ  
1814 N N   . ILE B 126 ? 0.4106 0.3488 0.4221 -0.0131 0.0156  0.0432  172 ILE B N   
1815 C CA  . ILE B 126 ? 0.4357 0.3604 0.4269 -0.0096 0.0215  0.0499  172 ILE B CA  
1816 C C   . ILE B 126 ? 0.4250 0.3584 0.4104 -0.0057 0.0275  0.0500  172 ILE B C   
1817 O O   . ILE B 126 ? 0.4378 0.3666 0.4143 -0.0060 0.0383  0.0560  172 ILE B O   
1818 C CB  . ILE B 126 ? 0.4547 0.3650 0.4276 -0.0020 0.0127  0.0490  172 ILE B CB  
1819 C CG1 . ILE B 126 ? 0.4792 0.3758 0.4539 -0.0037 0.0080  0.0495  172 ILE B CG1 
1820 C CG2 . ILE B 126 ? 0.4822 0.3783 0.4301 0.0031  0.0167  0.0552  172 ILE B CG2 
1821 C CD1 . ILE B 126 ? 0.5087 0.3974 0.4726 0.0058  -0.0021 0.0467  172 ILE B CD1 
1822 N N   . PHE B 127 ? 0.4018 0.3460 0.3909 -0.0019 0.0216  0.0432  173 PHE B N   
1823 C CA  . PHE B 127 ? 0.4003 0.3501 0.3836 0.0022  0.0264  0.0419  173 PHE B CA  
1824 C C   . PHE B 127 ? 0.4048 0.3642 0.3999 -0.0006 0.0385  0.0458  173 PHE B C   
1825 O O   . PHE B 127 ? 0.4192 0.3742 0.4017 0.0027  0.0483  0.0493  173 PHE B O   
1826 C CB  . PHE B 127 ? 0.3777 0.3369 0.3678 0.0043  0.0189  0.0346  173 PHE B CB  
1827 C CG  . PHE B 127 ? 0.3928 0.3556 0.3789 0.0081  0.0235  0.0328  173 PHE B CG  
1828 C CD1 . PHE B 127 ? 0.4216 0.3735 0.3867 0.0128  0.0233  0.0312  173 PHE B CD1 
1829 C CD2 . PHE B 127 ? 0.3988 0.3744 0.4011 0.0079  0.0269  0.0320  173 PHE B CD2 
1830 C CE1 . PHE B 127 ? 0.4261 0.3774 0.3852 0.0168  0.0276  0.0286  173 PHE B CE1 
1831 C CE2 . PHE B 127 ? 0.4150 0.3914 0.4127 0.0131  0.0313  0.0302  173 PHE B CE2 
1832 C CZ  . PHE B 127 ? 0.4243 0.3872 0.3997 0.0175  0.0322  0.0284  173 PHE B CZ  
1833 N N   . LEU B 128 ? 0.3908 0.3639 0.4103 -0.0062 0.0379  0.0450  174 LEU B N   
1834 C CA  . LEU B 128 ? 0.4056 0.3936 0.4435 -0.0089 0.0482  0.0482  174 LEU B CA  
1835 C C   . LEU B 128 ? 0.4242 0.4059 0.4600 -0.0140 0.0607  0.0565  174 LEU B C   
1836 O O   . LEU B 128 ? 0.4333 0.4228 0.4725 -0.0124 0.0739  0.0603  174 LEU B O   
1837 C CB  . LEU B 128 ? 0.4022 0.4070 0.4675 -0.0141 0.0416  0.0448  174 LEU B CB  
1838 C CG  . LEU B 128 ? 0.4041 0.4176 0.4723 -0.0081 0.0336  0.0386  174 LEU B CG  
1839 C CD1 . LEU B 128 ? 0.4063 0.4316 0.4950 -0.0128 0.0245  0.0352  174 LEU B CD1 
1840 C CD2 . LEU B 128 ? 0.4123 0.4349 0.4824 -0.0009 0.0418  0.0393  174 LEU B CD2 
1841 N N   A GLN B 129 ? 0.4385 0.4053 0.4682 -0.0196 0.0577  0.0596  175 GLN B N   
1842 N N   B GLN B 129 ? 0.4351 0.4018 0.4646 -0.0195 0.0578  0.0597  175 GLN B N   
1843 C CA  A GLN B 129 ? 0.4709 0.4258 0.4941 -0.0251 0.0698  0.0689  175 GLN B CA  
1844 C CA  B GLN B 129 ? 0.4647 0.4197 0.4881 -0.0252 0.0700  0.0689  175 GLN B CA  
1845 C C   A GLN B 129 ? 0.4934 0.4360 0.4875 -0.0172 0.0801  0.0736  175 GLN B C   
1846 C C   B GLN B 129 ? 0.4901 0.4327 0.4841 -0.0172 0.0801  0.0736  175 GLN B C   
1847 O O   A GLN B 129 ? 0.5112 0.4561 0.5056 -0.0191 0.0963  0.0804  175 GLN B O   
1848 O O   B GLN B 129 ? 0.5083 0.4528 0.5023 -0.0191 0.0964  0.0805  175 GLN B O   
1849 C CB  A GLN B 129 ? 0.4869 0.4206 0.5006 -0.0294 0.0625  0.0709  175 GLN B CB  
1850 C CB  B GLN B 129 ? 0.4769 0.4110 0.4916 -0.0299 0.0630  0.0711  175 GLN B CB  
1851 C CG  A GLN B 129 ? 0.5023 0.4406 0.5419 -0.0417 0.0607  0.0708  175 GLN B CG  
1852 C CG  B GLN B 129 ? 0.4696 0.4106 0.5095 -0.0389 0.0545  0.0667  175 GLN B CG  
1853 C CD  A GLN B 129 ? 0.5239 0.4367 0.5509 -0.0443 0.0535  0.0721  175 GLN B CD  
1854 C CD  B GLN B 129 ? 0.4764 0.4279 0.5424 -0.0518 0.0643  0.0714  175 GLN B CD  
1855 O OE1 A GLN B 129 ? 0.5529 0.4477 0.5539 -0.0355 0.0487  0.0729  175 GLN B OE1 
1856 O OE1 B GLN B 129 ? 0.4443 0.4139 0.5379 -0.0580 0.0583  0.0660  175 GLN B OE1 
1857 N NE2 A GLN B 129 ? 0.5446 0.4553 0.5903 -0.0559 0.0519  0.0718  175 GLN B NE2 
1858 N NE2 B GLN B 129 ? 0.4825 0.4228 0.5399 -0.0560 0.0792  0.0815  175 GLN B NE2 
1859 N N   . LYS B 130 ? 0.4969 0.4272 0.4661 -0.0083 0.0705  0.0696  176 LYS B N   
1860 C CA  . LYS B 130 ? 0.5337 0.4494 0.4705 0.0001  0.0764  0.0721  176 LYS B CA  
1861 C C   . LYS B 130 ? 0.5302 0.4586 0.4690 0.0055  0.0856  0.0691  176 LYS B C   
1862 O O   . LYS B 130 ? 0.5431 0.4634 0.4624 0.0097  0.0991  0.0737  176 LYS B O   
1863 C CB  . LYS B 130 ? 0.5421 0.4439 0.4561 0.0072  0.0607  0.0671  176 LYS B CB  
1864 C CG  . LYS B 130 ? 0.5913 0.4780 0.4992 0.0056  0.0518  0.0703  176 LYS B CG  
1865 C CD  . LYS B 130 ? 0.6583 0.5238 0.5457 0.0041  0.0626  0.0816  176 LYS B CD  
1866 C CE  . LYS B 130 ? 0.7098 0.5553 0.5854 0.0056  0.0523  0.0846  176 LYS B CE  
1867 N NZ  . LYS B 130 ? 0.7441 0.5820 0.5984 0.0166  0.0371  0.0798  176 LYS B NZ  
1868 N N   . VAL B 131 ? 0.4982 0.4445 0.4583 0.0063  0.0789  0.0616  177 VAL B N   
1869 C CA  . VAL B 131 ? 0.5003 0.4576 0.4642 0.0127  0.0870  0.0586  177 VAL B CA  
1870 C C   . VAL B 131 ? 0.5026 0.4742 0.4843 0.0102  0.1055  0.0650  177 VAL B C   
1871 O O   . VAL B 131 ? 0.5164 0.4896 0.4896 0.0178  0.1181  0.0654  177 VAL B O   
1872 C CB  . VAL B 131 ? 0.4716 0.4433 0.4550 0.0141  0.0758  0.0507  177 VAL B CB  
1873 C CG1 . VAL B 131 ? 0.4959 0.4820 0.4917 0.0203  0.0852  0.0491  177 VAL B CG1 
1874 C CG2 . VAL B 131 ? 0.4836 0.4414 0.4464 0.0182  0.0627  0.0442  177 VAL B CG2 
1875 N N   . ALA B 132 ? 0.4926 0.4742 0.4993 -0.0004 0.1075  0.0698  178 ALA B N   
1876 C CA  . ALA B 132 ? 0.4996 0.4981 0.5295 -0.0055 0.1252  0.0764  178 ALA B CA  
1877 C C   . ALA B 132 ? 0.5367 0.5206 0.5398 -0.0021 0.1448  0.0844  178 ALA B C   
1878 O O   . ALA B 132 ? 0.5452 0.5446 0.5624 -0.0011 0.1630  0.0884  178 ALA B O   
1879 C CB  . ALA B 132 ? 0.4893 0.4953 0.5471 -0.0200 0.1220  0.0799  178 ALA B CB  
1880 N N   . SER B 133 ? 0.5591 0.5137 0.5232 0.0007  0.1410  0.0868  179 SER B N   
1881 C CA  . SER B 133 ? 0.6026 0.5373 0.5321 0.0051  0.1579  0.0948  179 SER B CA  
1882 C C   . SER B 133 ? 0.6276 0.5479 0.5199 0.0196  0.1571  0.0890  179 SER B C   
1883 O O   . SER B 133 ? 0.6517 0.5490 0.5050 0.0251  0.1660  0.0938  179 SER B O   
1884 C CB  . SER B 133 ? 0.6227 0.5308 0.5293 -0.0005 0.1540  0.1024  179 SER B CB  
1885 O OG  . SER B 133 ? 0.6274 0.5439 0.5644 -0.0146 0.1583  0.1086  179 SER B OG  
1886 N N   . MET B 134 ? 0.6167 0.5477 0.5185 0.0255  0.1461  0.0785  180 MET B N   
1887 C CA  . MET B 134 ? 0.6472 0.5635 0.5163 0.0380  0.1443  0.0715  180 MET B CA  
1888 C C   . MET B 134 ? 0.6817 0.6020 0.5440 0.0458  0.1679  0.0742  180 MET B C   
1889 O O   . MET B 134 ? 0.6670 0.6127 0.5647 0.0427  0.1813  0.0778  180 MET B O   
1890 C CB  . MET B 134 ? 0.6200 0.5458 0.5042 0.0407  0.1279  0.0606  180 MET B CB  
1891 C CG  . MET B 134 ? 0.6486 0.5564 0.5004 0.0515  0.1232  0.0519  180 MET B CG  
1892 S SD  . MET B 134 ? 0.6498 0.5632 0.5169 0.0517  0.1034  0.0408  180 MET B SD  
1893 C CE  . MET B 134 ? 0.6283 0.5714 0.5383 0.0528  0.1133  0.0419  180 MET B CE  
1894 N N   . PRO B 135 ? 0.7399 0.6358 0.5570 0.0564  0.1731  0.0722  181 PRO B N   
1895 C CA  . PRO B 135 ? 0.7820 0.6795 0.5881 0.0666  0.1964  0.0732  181 PRO B CA  
1896 C C   . PRO B 135 ? 0.7724 0.6955 0.6136 0.0719  0.1998  0.0667  181 PRO B C   
1897 O O   . PRO B 135 ? 0.7432 0.6671 0.5917 0.0736  0.1817  0.0576  181 PRO B O   
1898 C CB  . PRO B 135 ? 0.8227 0.6860 0.5720 0.0778  0.1915  0.0671  181 PRO B CB  
1899 C CG  . PRO B 135 ? 0.8230 0.6671 0.5511 0.0715  0.1738  0.0697  181 PRO B CG  
1900 C CD  . PRO B 135 ? 0.7660 0.6311 0.5384 0.0595  0.1588  0.0699  181 PRO B CD  
1901 N N   . GLN B 136 ? 0.7951 0.7391 0.6580 0.0750  0.2232  0.0718  182 GLN B N   
1902 C CA  . GLN B 136 ? 0.7859 0.7607 0.6918 0.0796  0.2260  0.0676  182 GLN B CA  
1903 C C   . GLN B 136 ? 0.8101 0.7735 0.6956 0.0966  0.2260  0.0572  182 GLN B C   
1904 O O   . GLN B 136 ? 0.7826 0.7581 0.6915 0.1002  0.2146  0.0507  182 GLN B O   
1905 C CB  . GLN B 136 ? 0.7878 0.7943 0.7318 0.0765  0.2503  0.0765  182 GLN B CB  
1906 C CG  . GLN B 136 ? 0.8417 0.8422 0.7617 0.0880  0.2796  0.0804  182 GLN B CG  
1907 C CD  . GLN B 136 ? 0.8502 0.8912 0.8196 0.0879  0.3030  0.0864  182 GLN B CD  
1908 O OE1 . GLN B 136 ? 0.8241 0.8986 0.8457 0.0831  0.2948  0.0850  182 GLN B OE1 
1909 N NE2 . GLN B 136 ? 0.8897 0.9284 0.8425 0.0937  0.3324  0.0930  182 GLN B NE2 
1910 N N   . GLU B 137 ? 0.8667 0.8042 0.7060 0.1073  0.2387  0.0557  183 GLU B N   
1911 C CA  . GLU B 137 ? 0.8994 0.8205 0.7135 0.1241  0.2404  0.0451  183 GLU B CA  
1912 C C   . GLU B 137 ? 0.9237 0.8070 0.6912 0.1246  0.2193  0.0363  183 GLU B C   
1913 O O   . GLU B 137 ? 0.9558 0.8159 0.6851 0.1219  0.2182  0.0388  183 GLU B O   
1914 C CB  . GLU B 137 ? 0.9401 0.8571 0.7325 0.1374  0.2701  0.0477  183 GLU B CB  
1915 N N   . GLU B 138 ? 0.9165 0.7936 0.6878 0.1277  0.2022  0.0263  184 GLU B N   
1916 C CA  . GLU B 138 ? 0.9357 0.7798 0.6688 0.1268  0.1816  0.0168  184 GLU B CA  
1917 C C   . GLU B 138 ? 0.9968 0.8087 0.6783 0.1414  0.1913  0.0093  184 GLU B C   
1918 O O   . GLU B 138 ? 1.0132 0.8238 0.6941 0.1549  0.2035  0.0043  184 GLU B O   
1919 C CB  . GLU B 138 ? 0.9060 0.7528 0.6606 0.1241  0.1625  0.0094  184 GLU B CB  
1920 C CG  . GLU B 138 ? 0.9078 0.7271 0.6340 0.1181  0.1394  0.0009  184 GLU B CG  
1921 C CD  . GLU B 138 ? 0.8643 0.6955 0.6219 0.1070  0.1201  -0.0004 184 GLU B CD  
1922 O OE1 . GLU B 138 ? 0.8376 0.6855 0.6262 0.1093  0.1222  0.0004  184 GLU B OE1 
1923 O OE2 . GLU B 138 ? 0.8286 0.6528 0.5794 0.0968  0.1031  -0.0019 184 GLU B OE2 
1924 N N   . GLN B 139 ? 1.0355 0.8205 0.6724 0.1397  0.1851  0.0082  185 GLN B N   
1925 C CA  . GLN B 139 ? 1.0972 0.8478 0.6777 0.1532  0.1927  0.0007  185 GLN B CA  
1926 C C   . GLN B 139 ? 1.1241 0.8426 0.6658 0.1491  0.1665  -0.0094 185 GLN B C   
1927 O O   . GLN B 139 ? 1.1122 0.8309 0.6517 0.1385  0.1517  -0.0050 185 GLN B O   
1928 C CB  . GLN B 139 ? 1.1300 0.8785 0.6870 0.1576  0.2163  0.0110  185 GLN B CB  
1929 N N   . GLU B 140 ? 1.1631 0.8543 0.6756 0.1579  0.1603  -0.0232 186 GLU B N   
1930 C CA  . GLU B 140 ? 1.1948 0.8547 0.6702 0.1540  0.1350  -0.0347 186 GLU B CA  
1931 C C   . GLU B 140 ? 1.2506 0.8827 0.6676 0.1610  0.1382  -0.0350 186 GLU B C   
1932 O O   . GLU B 140 ? 1.2579 0.8816 0.6581 0.1535  0.1193  -0.0345 186 GLU B O   
1933 C CB  . GLU B 140 ? 1.2196 0.8564 0.6829 0.1601  0.1278  -0.0498 186 GLU B CB  
1934 C CG  . GLU B 140 ? 1.2576 0.8635 0.6886 0.1536  0.0999  -0.0633 186 GLU B CG  
1935 C CD  . GLU B 140 ? 1.2837 0.8682 0.7121 0.1553  0.0913  -0.0772 186 GLU B CD  
1936 O OE1 . GLU B 140 ? 1.2717 0.8663 0.7259 0.1618  0.1050  -0.0756 186 GLU B OE1 
1937 O OE2 . GLU B 140 ? 1.3219 0.8785 0.7226 0.1499  0.0698  -0.0897 186 GLU B OE2 
1938 N N   . ASN C 31  ? 1.2506 0.5937 0.6809 0.0218  -0.1598 0.0425  77  ASN C N   
1939 C CA  . ASN C 31  ? 1.2182 0.5886 0.6648 0.0661  -0.1472 0.0268  77  ASN C CA  
1940 C C   . ASN C 31  ? 1.1118 0.5769 0.6282 0.0545  -0.1270 0.0231  77  ASN C C   
1941 O O   . ASN C 31  ? 1.0675 0.5707 0.6152 0.0154  -0.1236 0.0308  77  ASN C O   
1942 C CB  . ASN C 31  ? 1.2271 0.6052 0.6743 0.1140  -0.1422 0.0263  77  ASN C CB  
1943 C CG  . ASN C 31  ? 1.1649 0.6234 0.6702 0.1074  -0.1294 0.0357  77  ASN C CG  
1944 O OD1 . ASN C 31  ? 1.1206 0.6325 0.6668 0.0730  -0.1202 0.0400  77  ASN C OD1 
1945 N ND2 . ASN C 31  ? 1.1828 0.6487 0.6892 0.1425  -0.1297 0.0391  77  ASN C ND2 
1946 N N   . GLN C 32  ? 1.0709 0.5732 0.6094 0.0897  -0.1133 0.0125  78  GLN C N   
1947 C CA  . GLN C 32  ? 0.9852 0.5660 0.5810 0.0820  -0.0963 0.0084  78  GLN C CA  
1948 C C   . GLN C 32  ? 0.8998 0.5541 0.5522 0.0630  -0.0844 0.0169  78  GLN C C   
1949 O O   . GLN C 32  ? 0.8482 0.5425 0.5332 0.0355  -0.0783 0.0182  78  GLN C O   
1950 C CB  . GLN C 32  ? 0.9769 0.5836 0.5824 0.1245  -0.0835 -0.0013 78  GLN C CB  
1951 C CG  . GLN C 32  ? 1.0587 0.5992 0.6080 0.1447  -0.0909 -0.0127 78  GLN C CG  
1952 C CD  . GLN C 32  ? 1.0516 0.6310 0.6155 0.1827  -0.0735 -0.0210 78  GLN C CD  
1953 O OE1 . GLN C 32  ? 1.0487 0.6749 0.6406 0.2127  -0.0610 -0.0175 78  GLN C OE1 
1954 N NE2 . GLN C 32  ? 1.0661 0.6283 0.6105 0.1801  -0.0733 -0.0303 78  GLN C NE2 
1955 N N   . LEU C 33  ? 0.8858 0.5558 0.5468 0.0798  -0.0821 0.0226  79  LEU C N   
1956 C CA  . LEU C 33  ? 0.8256 0.5560 0.5300 0.0647  -0.0727 0.0295  79  LEU C CA  
1957 C C   . LEU C 33  ? 0.8321 0.5508 0.5289 0.0261  -0.0766 0.0386  79  LEU C C   
1958 O O   . LEU C 33  ? 0.7835 0.5513 0.5147 0.0063  -0.0657 0.0408  79  LEU C O   
1959 C CB  . LEU C 33  ? 0.8276 0.5743 0.5386 0.0911  -0.0733 0.0346  79  LEU C CB  
1960 C CG  . LEU C 33  ? 0.7928 0.5886 0.5355 0.1229  -0.0636 0.0303  79  LEU C CG  
1961 C CD1 . LEU C 33  ? 0.8095 0.6205 0.5578 0.1477  -0.0685 0.0387  79  LEU C CD1 
1962 C CD2 . LEU C 33  ? 0.7186 0.5788 0.5091 0.1062  -0.0507 0.0281  79  LEU C CD2 
1963 N N   . GLN C 34  ? 0.8981 0.5506 0.5472 0.0163  -0.0917 0.0447  80  GLN C N   
1964 C CA  . GLN C 34  ? 0.9161 0.5571 0.5549 -0.0239 -0.0955 0.0566  80  GLN C CA  
1965 C C   . GLN C 34  ? 0.8797 0.5486 0.5425 -0.0522 -0.0906 0.0555  80  GLN C C   
1966 O O   . GLN C 34  ? 0.8477 0.5576 0.5362 -0.0792 -0.0814 0.0635  80  GLN C O   
1967 C CB  . GLN C 34  ? 1.0101 0.5656 0.5870 -0.0315 -0.1161 0.0646  80  GLN C CB  
1968 C CG  . GLN C 34  ? 1.0573 0.6057 0.6216 -0.0672 -0.1186 0.0814  80  GLN C CG  
1969 C CD  . GLN C 34  ? 1.0787 0.6282 0.6354 -0.0515 -0.1180 0.0875  80  GLN C CD  
1970 O OE1 . GLN C 34  ? 1.1646 0.6503 0.6746 -0.0386 -0.1343 0.0923  80  GLN C OE1 
1971 N NE2 . GLN C 34  ? 1.0328 0.6500 0.6311 -0.0520 -0.1012 0.0873  80  GLN C NE2 
1972 N N   . TYR C 35  ? 0.8843 0.5319 0.5374 -0.0435 -0.0967 0.0459  81  TYR C N   
1973 C CA  . TYR C 35  ? 0.8570 0.5321 0.5339 -0.0663 -0.0950 0.0444  81  TYR C CA  
1974 C C   . TYR C 35  ? 0.7734 0.5304 0.5093 -0.0613 -0.0749 0.0403  81  TYR C C   
1975 O O   . TYR C 35  ? 0.7460 0.5451 0.5123 -0.0858 -0.0684 0.0462  81  TYR C O   
1976 C CB  . TYR C 35  ? 0.8969 0.5238 0.5416 -0.0532 -0.1073 0.0336  81  TYR C CB  
1977 C CG  . TYR C 35  ? 0.8729 0.5255 0.5395 -0.0747 -0.1091 0.0320  81  TYR C CG  
1978 C CD1 . TYR C 35  ? 0.9193 0.5428 0.5670 -0.1132 -0.1268 0.0416  81  TYR C CD1 
1979 C CD2 . TYR C 35  ? 0.8063 0.5120 0.5116 -0.0582 -0.0955 0.0227  81  TYR C CD2 
1980 C CE1 . TYR C 35  ? 0.8995 0.5512 0.5703 -0.1331 -0.1311 0.0419  81  TYR C CE1 
1981 C CE2 . TYR C 35  ? 0.7931 0.5214 0.5174 -0.0761 -0.0991 0.0221  81  TYR C CE2 
1982 C CZ  . TYR C 35  ? 0.8408 0.5440 0.5493 -0.1126 -0.1172 0.0316  81  TYR C CZ  
1983 O OH  . TYR C 35  ? 0.8357 0.5656 0.5659 -0.1305 -0.1233 0.0327  81  TYR C OH  
1984 N N   . LEU C 36  ? 0.7401 0.5194 0.4912 -0.0295 -0.0656 0.0314  82  LEU C N   
1985 C CA  . LEU C 36  ? 0.6711 0.5173 0.4701 -0.0247 -0.0494 0.0278  82  LEU C CA  
1986 C C   . LEU C 36  ? 0.6481 0.5271 0.4653 -0.0408 -0.0402 0.0359  82  LEU C C   
1987 O O   . LEU C 36  ? 0.6113 0.5364 0.4611 -0.0485 -0.0289 0.0350  82  LEU C O   
1988 C CB  . LEU C 36  ? 0.6488 0.5109 0.4574 0.0080  -0.0438 0.0208  82  LEU C CB  
1989 C CG  . LEU C 36  ? 0.6568 0.5078 0.4577 0.0273  -0.0449 0.0118  82  LEU C CG  
1990 C CD1 . LEU C 36  ? 0.6454 0.5191 0.4572 0.0585  -0.0380 0.0094  82  LEU C CD1 
1991 C CD2 . LEU C 36  ? 0.6364 0.5181 0.4630 0.0142  -0.0402 0.0079  82  LEU C CD2 
1992 N N   . HIS C 37  ? 0.6824 0.5342 0.4741 -0.0438 -0.0450 0.0435  83  HIS C N   
1993 C CA  . HIS C 37  ? 0.6779 0.5535 0.4763 -0.0593 -0.0361 0.0517  83  HIS C CA  
1994 C C   . HIS C 37  ? 0.6951 0.5785 0.4955 -0.0916 -0.0338 0.0619  83  HIS C C   
1995 O O   . HIS C 37  ? 0.6517 0.5835 0.4811 -0.1005 -0.0194 0.0634  83  HIS C O   
1996 C CB  . HIS C 37  ? 0.7129 0.5554 0.4798 -0.0523 -0.0435 0.0581  83  HIS C CB  
1997 C CG  . HIS C 37  ? 0.7087 0.5739 0.4769 -0.0632 -0.0339 0.0647  83  HIS C CG  
1998 N ND1 . HIS C 37  ? 0.7557 0.5897 0.4906 -0.0670 -0.0409 0.0743  83  HIS C ND1 
1999 C CD2 . HIS C 37  ? 0.6792 0.5902 0.4719 -0.0691 -0.0181 0.0626  83  HIS C CD2 
2000 C CE1 . HIS C 37  ? 0.7421 0.6027 0.4797 -0.0761 -0.0292 0.0777  83  HIS C CE1 
2001 N NE2 . HIS C 37  ? 0.6928 0.5990 0.4642 -0.0761 -0.0148 0.0701  83  HIS C NE2 
2002 N N   . LYS C 38  ? 0.7609 0.5965 0.5295 -0.1085 -0.0487 0.0697  84  LYS C N   
2003 C CA  . LYS C 38  ? 0.7999 0.6420 0.5675 -0.1453 -0.0495 0.0847  84  LYS C CA  
2004 C C   . LYS C 38  ? 0.7810 0.6614 0.5826 -0.1602 -0.0479 0.0847  84  LYS C C   
2005 O O   . LYS C 38  ? 0.7807 0.7028 0.6046 -0.1854 -0.0398 0.0973  84  LYS C O   
2006 C CB  . LYS C 38  ? 0.8802 0.6498 0.5962 -0.1631 -0.0704 0.0951  84  LYS C CB  
2007 C CG  . LYS C 38  ? 0.9335 0.6682 0.6145 -0.1569 -0.0729 0.1015  84  LYS C CG  
2008 C CD  . LYS C 38  ? 1.0310 0.6863 0.6558 -0.1761 -0.0957 0.1131  84  LYS C CD  
2009 C CE  . LYS C 38  ? 1.0852 0.7127 0.6766 -0.1795 -0.0974 0.1249  84  LYS C CE  
2010 N NZ  . LYS C 38  ? 1.0739 0.7066 0.6678 -0.1401 -0.0930 0.1141  84  LYS C NZ  
2011 N N   . VAL C 39  ? 0.7715 0.6404 0.5767 -0.1444 -0.0555 0.0722  85  VAL C N   
2012 C CA  . VAL C 39  ? 0.7546 0.6536 0.5877 -0.1579 -0.0583 0.0724  85  VAL C CA  
2013 C C   . VAL C 39  ? 0.6884 0.6425 0.5638 -0.1351 -0.0426 0.0611  85  VAL C C   
2014 O O   . VAL C 39  ? 0.6607 0.6713 0.5741 -0.1437 -0.0316 0.0660  85  VAL C O   
2015 C CB  . VAL C 39  ? 0.7990 0.6380 0.5974 -0.1605 -0.0811 0.0673  85  VAL C CB  
2016 C CG1 . VAL C 39  ? 0.7854 0.6566 0.6121 -0.1755 -0.0867 0.0683  85  VAL C CG1 
2017 C CG2 . VAL C 39  ? 0.8699 0.6420 0.6182 -0.1850 -0.1005 0.0789  85  VAL C CG2 
2018 N N   . VAL C 40  ? 0.6708 0.6090 0.5388 -0.1056 -0.0417 0.0473  86  VAL C N   
2019 C CA  . VAL C 40  ? 0.6163 0.5960 0.5172 -0.0869 -0.0308 0.0375  86  VAL C CA  
2020 C C   . VAL C 40  ? 0.5780 0.6028 0.5042 -0.0819 -0.0128 0.0387  86  VAL C C   
2021 O O   . VAL C 40  ? 0.5495 0.6177 0.5067 -0.0836 -0.0039 0.0391  86  VAL C O   
2022 C CB  . VAL C 40  ? 0.6161 0.5719 0.5028 -0.0592 -0.0335 0.0256  86  VAL C CB  
2023 C CG1 . VAL C 40  ? 0.5736 0.5697 0.4917 -0.0451 -0.0239 0.0182  86  VAL C CG1 
2024 C CG2 . VAL C 40  ? 0.6604 0.5650 0.5130 -0.0599 -0.0500 0.0226  86  VAL C CG2 
2025 N N   . MET C 41  ? 0.5838 0.5953 0.4931 -0.0746 -0.0088 0.0393  87  MET C N   
2026 C CA  . MET C 41  ? 0.5668 0.6100 0.4888 -0.0684 0.0063  0.0386  87  MET C CA  
2027 C C   . MET C 41  ? 0.5753 0.6505 0.5090 -0.0862 0.0179  0.0487  87  MET C C   
2028 O O   . MET C 41  ? 0.5516 0.6629 0.5043 -0.0783 0.0321  0.0459  87  MET C O   
2029 C CB  . MET C 41  ? 0.5800 0.5995 0.4777 -0.0583 0.0046  0.0381  87  MET C CB  
2030 C CG  . MET C 41  ? 0.5817 0.6234 0.4823 -0.0527 0.0169  0.0360  87  MET C CG  
2031 S SD  . MET C 41  ? 0.5607 0.6326 0.4884 -0.0369 0.0239  0.0245  87  MET C SD  
2032 C CE  . MET C 41  ? 0.5454 0.5995 0.4656 -0.0220 0.0122  0.0199  87  MET C CE  
2033 N N   . LYS C 42  ? 0.6178 0.6797 0.5382 -0.1095 0.0122  0.0614  88  LYS C N   
2034 C CA  . LYS C 42  ? 0.6361 0.7381 0.5714 -0.1290 0.0248  0.0748  88  LYS C CA  
2035 C C   . LYS C 42  ? 0.6048 0.7590 0.5827 -0.1307 0.0303  0.0760  88  LYS C C   
2036 O O   . LYS C 42  ? 0.6007 0.8047 0.6011 -0.1287 0.0484  0.0810  88  LYS C O   
2037 C CB  . LYS C 42  ? 0.6909 0.7668 0.6024 -0.1594 0.0148  0.0915  88  LYS C CB  
2038 C CG  . LYS C 42  ? 0.7463 0.7992 0.6240 -0.1620 0.0202  0.0976  88  LYS C CG  
2039 C CD  . LYS C 42  ? 0.8179 0.8412 0.6682 -0.1950 0.0093  0.1164  88  LYS C CD  
2040 C CE  . LYS C 42  ? 0.8558 0.8561 0.6698 -0.1971 0.0150  0.1236  88  LYS C CE  
2041 N NZ  . LYS C 42  ? 0.9359 0.8929 0.7142 -0.2291 0.0004  0.1422  88  LYS C NZ  
2042 N N   . ALA C 43  ? 0.5929 0.7351 0.5790 -0.1317 0.0148  0.0715  89  ALA C N   
2043 C CA  . ALA C 43  ? 0.5615 0.7495 0.5867 -0.1315 0.0158  0.0724  89  ALA C CA  
2044 C C   . ALA C 43  ? 0.5187 0.7318 0.5624 -0.1012 0.0292  0.0593  89  ALA C C   
2045 O O   . ALA C 43  ? 0.5049 0.7676 0.5812 -0.0954 0.0391  0.0624  89  ALA C O   
2046 C CB  . ALA C 43  ? 0.5727 0.7310 0.5916 -0.1409 -0.0068 0.0703  89  ALA C CB  
2047 N N   . LEU C 44  ? 0.4981 0.6769 0.5203 -0.0820 0.0284  0.0462  90  LEU C N   
2048 C CA  . LEU C 44  ? 0.4680 0.6596 0.5004 -0.0574 0.0368  0.0347  90  LEU C CA  
2049 C C   . LEU C 44  ? 0.4616 0.6681 0.4876 -0.0467 0.0548  0.0335  90  LEU C C   
2050 O O   . LEU C 44  ? 0.4478 0.6786 0.4876 -0.0304 0.0651  0.0289  90  LEU C O   
2051 C CB  . LEU C 44  ? 0.4683 0.6227 0.4830 -0.0449 0.0270  0.0239  90  LEU C CB  
2052 C CG  . LEU C 44  ? 0.4808 0.6192 0.4965 -0.0480 0.0122  0.0220  90  LEU C CG  
2053 C CD1 . LEU C 44  ? 0.4741 0.5847 0.4733 -0.0333 0.0073  0.0135  90  LEU C CD1 
2054 C CD2 . LEU C 44  ? 0.4806 0.6496 0.5242 -0.0462 0.0111  0.0221  90  LEU C CD2 
2055 N N   . TRP C 45  ? 0.4768 0.6637 0.4766 -0.0544 0.0577  0.0376  91  TRP C N   
2056 C CA  . TRP C 45  ? 0.4837 0.6733 0.4653 -0.0443 0.0730  0.0353  91  TRP C CA  
2057 C C   . TRP C 45  ? 0.4872 0.7252 0.4872 -0.0406 0.0929  0.0414  91  TRP C C   
2058 O O   . TRP C 45  ? 0.4918 0.7357 0.4822 -0.0205 0.1064  0.0339  91  TRP C O   
2059 C CB  . TRP C 45  ? 0.5057 0.6650 0.4540 -0.0564 0.0701  0.0413  91  TRP C CB  
2060 C CG  . TRP C 45  ? 0.5056 0.6585 0.4259 -0.0471 0.0825  0.0383  91  TRP C CG  
2061 C CD1 . TRP C 45  ? 0.5295 0.6995 0.4366 -0.0533 0.0993  0.0471  91  TRP C CD1 
2062 C CD2 . TRP C 45  ? 0.4936 0.6193 0.3912 -0.0316 0.0783  0.0265  91  TRP C CD2 
2063 N NE1 . TRP C 45  ? 0.5399 0.6895 0.4123 -0.0401 0.1059  0.0395  91  TRP C NE1 
2064 C CE2 . TRP C 45  ? 0.5305 0.6512 0.3965 -0.0282 0.0914  0.0270  91  TRP C CE2 
2065 C CE3 . TRP C 45  ? 0.4745 0.5803 0.3739 -0.0223 0.0641  0.0171  91  TRP C CE3 
2066 C CZ2 . TRP C 45  ? 0.5440 0.6342 0.3767 -0.0168 0.0875  0.0172  91  TRP C CZ2 
2067 C CZ3 . TRP C 45  ? 0.4766 0.5587 0.3491 -0.0136 0.0604  0.0098  91  TRP C CZ3 
2068 C CH2 . TRP C 45  ? 0.5182 0.5896 0.3562 -0.0114 0.0705  0.0093  91  TRP C CH2 
2069 N N   . LYS C 46  ? 0.4922 0.7645 0.5169 -0.0598 0.0941  0.0559  92  LYS C N   
2070 C CA  . LYS C 46  ? 0.5025 0.8345 0.5519 -0.0580 0.1146  0.0664  92  LYS C CA  
2071 C C   . LYS C 46  ? 0.4732 0.8493 0.5659 -0.0459 0.1148  0.0660  92  LYS C C   
2072 O O   . LYS C 46  ? 0.4784 0.9140 0.5999 -0.0408 0.1314  0.0760  92  LYS C O   
2073 C CB  . LYS C 46  ? 0.5301 0.8832 0.5838 -0.0905 0.1162  0.0874  92  LYS C CB  
2074 C CG  . LYS C 46  ? 0.5395 0.8983 0.6176 -0.1176 0.0953  0.0983  92  LYS C CG  
2075 C CD  . LYS C 46  ? 0.5821 0.9487 0.6544 -0.1545 0.0932  0.1202  92  LYS C CD  
2076 C CE  . LYS C 46  ? 0.5941 0.9489 0.6779 -0.1841 0.0670  0.1297  92  LYS C CE  
2077 N NZ  . LYS C 46  ? 0.6423 0.9914 0.7121 -0.2244 0.0603  0.1519  92  LYS C NZ  
2078 N N   . HIS C 47  ? 0.4461 0.7964 0.5437 -0.0402 0.0968  0.0558  93  HIS C N   
2079 C CA  . HIS C 47  ? 0.4221 0.8065 0.5558 -0.0280 0.0933  0.0551  93  HIS C CA  
2080 C C   . HIS C 47  ? 0.4200 0.8216 0.5541 0.0066  0.1116  0.0462  93  HIS C C   
2081 O O   . HIS C 47  ? 0.4325 0.7972 0.5301 0.0214  0.1187  0.0346  93  HIS C O   
2082 C CB  . HIS C 47  ? 0.4071 0.7515 0.5353 -0.0287 0.0711  0.0455  93  HIS C CB  
2083 C CG  . HIS C 47  ? 0.3919 0.7673 0.5549 -0.0262 0.0613  0.0490  93  HIS C CG  
2084 N ND1 . HIS C 47  ? 0.3740 0.7644 0.5500 0.0013  0.0660  0.0420  93  HIS C ND1 
2085 C CD2 . HIS C 47  ? 0.3914 0.7804 0.5743 -0.0481 0.0444  0.0589  93  HIS C CD2 
2086 C CE1 . HIS C 47  ? 0.3693 0.7860 0.5753 -0.0029 0.0531  0.0483  93  HIS C CE1 
2087 N NE2 . HIS C 47  ? 0.3703 0.7872 0.5809 -0.0338 0.0393  0.0585  93  HIS C NE2 
2088 N N   . GLN C 48  ? 0.4121 0.8668 0.5843 0.0201  0.1174  0.0520  94  GLN C N   
2089 C CA  . GLN C 48  ? 0.4237 0.8937 0.5934 0.0581  0.1356  0.0441  94  GLN C CA  
2090 C C   . GLN C 48  ? 0.4166 0.8264 0.5548 0.0798  0.1255  0.0248  94  GLN C C   
2091 O O   . GLN C 48  ? 0.4395 0.8321 0.5518 0.1089  0.1379  0.0143  94  GLN C O   
2092 C CB  . GLN C 48  ? 0.4263 0.9722 0.6484 0.0709  0.1427  0.0566  94  GLN C CB  
2093 C CG  . GLN C 48  ? 0.4208 0.9731 0.6730 0.0678  0.1195  0.0581  94  GLN C CG  
2094 C CD  . GLN C 48  ? 0.4405 1.0673 0.7424 0.0894  0.1266  0.0692  94  GLN C CD  
2095 O OE1 . GLN C 48  ? 0.4611 1.1052 0.7600 0.1274  0.1465  0.0641  94  GLN C OE1 
2096 N NE2 . GLN C 48  ? 0.4388 1.1082 0.7842 0.0667  0.1090  0.0846  94  GLN C NE2 
2097 N N   . PHE C 49  ? 0.3861 0.7618 0.5224 0.0651  0.1029  0.0210  95  PHE C N   
2098 C CA  . PHE C 49  ? 0.3805 0.7029 0.4894 0.0789  0.0916  0.0066  95  PHE C CA  
2099 C C   . PHE C 49  ? 0.3750 0.6429 0.4423 0.0688  0.0870  -0.0015 95  PHE C C   
2100 O O   . PHE C 49  ? 0.3625 0.5890 0.4078 0.0747  0.0765  -0.0107 95  PHE C O   
2101 C CB  . PHE C 49  ? 0.3614 0.6799 0.4894 0.0703  0.0712  0.0082  95  PHE C CB  
2102 C CG  . PHE C 49  ? 0.3783 0.7426 0.5442 0.0835  0.0697  0.0150  95  PHE C CG  
2103 C CD1 . PHE C 49  ? 0.3920 0.7880 0.5686 0.1130  0.0858  0.0153  95  PHE C CD1 
2104 C CD2 . PHE C 49  ? 0.3675 0.7409 0.5553 0.0688  0.0510  0.0211  95  PHE C CD2 
2105 C CE1 . PHE C 49  ? 0.4007 0.8439 0.6162 0.1278  0.0829  0.0233  95  PHE C CE1 
2106 C CE2 . PHE C 49  ? 0.3746 0.7915 0.5983 0.0798  0.0460  0.0290  95  PHE C CE2 
2107 C CZ  . PHE C 49  ? 0.3790 0.8339 0.6197 0.1096  0.0617  0.0308  95  PHE C CZ  
2108 N N   . ALA C 50  ? 0.3630 0.6326 0.4199 0.0528  0.0934  0.0036  96  ALA C N   
2109 C CA  . ALA C 50  ? 0.3674 0.5911 0.3901 0.0420  0.0859  -0.0014 96  ALA C CA  
2110 C C   . ALA C 50  ? 0.3892 0.5774 0.3715 0.0582  0.0910  -0.0121 96  ALA C C   
2111 O O   . ALA C 50  ? 0.3994 0.5481 0.3570 0.0523  0.0788  -0.0173 96  ALA C O   
2112 C CB  . ALA C 50  ? 0.3710 0.6022 0.3913 0.0203  0.0885  0.0085  96  ALA C CB  
2113 N N   . TRP C 51  ? 0.4066 0.6086 0.3807 0.0792  0.1083  -0.0148 97  TRP C N   
2114 C CA  . TRP C 51  ? 0.4419 0.6047 0.3663 0.0936  0.1150  -0.0249 97  TRP C CA  
2115 C C   . TRP C 51  ? 0.4564 0.5606 0.3471 0.0958  0.0965  -0.0358 97  TRP C C   
2116 O O   . TRP C 51  ? 0.4822 0.5479 0.3334 0.0890  0.0908  -0.0399 97  TRP C O   
2117 C CB  . TRP C 51  ? 0.4639 0.6500 0.3818 0.1231  0.1384  -0.0274 97  TRP C CB  
2118 C CG  . TRP C 51  ? 0.4465 0.6398 0.3797 0.1493  0.1380  -0.0324 97  TRP C CG  
2119 C CD1 . TRP C 51  ? 0.4099 0.6591 0.3950 0.1548  0.1414  -0.0235 97  TRP C CD1 
2120 C CD2 . TRP C 51  ? 0.4640 0.6026 0.3567 0.1731  0.1313  -0.0465 97  TRP C CD2 
2121 N NE1 . TRP C 51  ? 0.4183 0.6528 0.3994 0.1831  0.1378  -0.0312 97  TRP C NE1 
2122 C CE2 . TRP C 51  ? 0.4538 0.6173 0.3764 0.1948  0.1317  -0.0457 97  TRP C CE2 
2123 C CE3 . TRP C 51  ? 0.5154 0.5826 0.3467 0.1761  0.1220  -0.0589 97  TRP C CE3 
2124 C CZ2 . TRP C 51  ? 0.5026 0.6174 0.3926 0.2213  0.1241  -0.0571 97  TRP C CZ2 
2125 C CZ3 . TRP C 51  ? 0.5595 0.5768 0.3571 0.1993  0.1135  -0.0702 97  TRP C CZ3 
2126 C CH2 . TRP C 51  ? 0.5504 0.5896 0.3761 0.2227  0.1152  -0.0695 97  TRP C CH2 
2127 N N   . PRO C 52  ? 0.4460 0.5433 0.3512 0.1021  0.0851  -0.0386 98  PRO C N   
2128 C CA  . PRO C 52  ? 0.4772 0.5198 0.3490 0.0983  0.0666  -0.0457 98  PRO C CA  
2129 C C   . PRO C 52  ? 0.4594 0.4941 0.3355 0.0708  0.0508  -0.0400 98  PRO C C   
2130 O O   . PRO C 52  ? 0.4893 0.4857 0.3383 0.0626  0.0356  -0.0426 98  PRO C O   
2131 C CB  . PRO C 52  ? 0.4708 0.5119 0.3589 0.1096  0.0589  -0.0472 98  PRO C CB  
2132 C CG  . PRO C 52  ? 0.4436 0.5402 0.3732 0.1233  0.0738  -0.0419 98  PRO C CG  
2133 C CD  . PRO C 52  ? 0.4131 0.5474 0.3625 0.1066  0.0839  -0.0335 98  PRO C CD  
2134 N N   . PHE C 53  ? 0.4259 0.4958 0.3337 0.0573  0.0537  -0.0314 99  PHE C N   
2135 C CA  . PHE C 53  ? 0.4110 0.4780 0.3260 0.0377  0.0406  -0.0257 99  PHE C CA  
2136 C C   . PHE C 53  ? 0.4272 0.4905 0.3265 0.0276  0.0424  -0.0218 99  PHE C C   
2137 O O   . PHE C 53  ? 0.4187 0.4799 0.3224 0.0156  0.0316  -0.0166 99  PHE C O   
2138 C CB  . PHE C 53  ? 0.3728 0.4693 0.3258 0.0317  0.0388  -0.0196 99  PHE C CB  
2139 C CG  . PHE C 53  ? 0.3811 0.4813 0.3491 0.0399  0.0347  -0.0217 99  PHE C CG  
2140 C CD1 . PHE C 53  ? 0.3766 0.4598 0.3412 0.0350  0.0217  -0.0215 99  PHE C CD1 
2141 C CD2 . PHE C 53  ? 0.3893 0.5138 0.3760 0.0517  0.0434  -0.0217 99  PHE C CD2 
2142 C CE1 . PHE C 53  ? 0.3829 0.4654 0.3566 0.0416  0.0172  -0.0222 99  PHE C CE1 
2143 C CE2 . PHE C 53  ? 0.3809 0.5070 0.3797 0.0603  0.0375  -0.0227 99  PHE C CE2 
2144 C CZ  . PHE C 53  ? 0.3814 0.4826 0.3708 0.0550  0.0242  -0.0234 99  PHE C CZ  
2145 N N   . ARG C 54  ? 0.4564 0.5192 0.3354 0.0342  0.0561  -0.0235 100 ARG C N   
2146 C CA  . ARG C 54  ? 0.4857 0.5445 0.3470 0.0238  0.0585  -0.0182 100 ARG C CA  
2147 C C   . ARG C 54  ? 0.5212 0.5416 0.3435 0.0184  0.0451  -0.0208 100 ARG C C   
2148 O O   . ARG C 54  ? 0.5365 0.5502 0.3432 0.0090  0.0424  -0.0153 100 ARG C O   
2149 C CB  . ARG C 54  ? 0.5136 0.5907 0.3663 0.0312  0.0802  -0.0166 100 ARG C CB  
2150 C CG  . ARG C 54  ? 0.5103 0.6337 0.4049 0.0282  0.0908  -0.0082 100 ARG C CG  
2151 C CD  . ARG C 54  ? 0.5747 0.7240 0.4628 0.0289  0.1121  -0.0013 100 ARG C CD  
2152 N NE  . ARG C 54  ? 0.5848 0.7859 0.5166 0.0265  0.1219  0.0080  100 ARG C NE  
2153 C CZ  . ARG C 54  ? 0.6116 0.8525 0.5570 0.0422  0.1421  0.0102  100 ARG C CZ  
2154 N NH1 . ARG C 54  ? 0.6544 0.8838 0.5667 0.0659  0.1575  0.0016  100 ARG C NH1 
2155 N NH2 . ARG C 54  ? 0.6075 0.9008 0.5986 0.0351  0.1464  0.0218  100 ARG C NH2 
2156 N N   . GLN C 55  ? 0.5487 0.5413 0.3526 0.0226  0.0346  -0.0279 101 GLN C N   
2157 C CA  . GLN C 55  ? 0.5978 0.5544 0.3664 0.0126  0.0165  -0.0285 101 GLN C CA  
2158 C C   . GLN C 55  ? 0.5924 0.5374 0.3692 0.0058  -0.0019 -0.0284 101 GLN C C   
2159 O O   . GLN C 55  ? 0.5549 0.5076 0.3506 0.0136  0.0018  -0.0313 101 GLN C O   
2160 C CB  . GLN C 55  ? 0.6762 0.5940 0.3880 0.0218  0.0223  -0.0374 101 GLN C CB  
2161 C CG  . GLN C 55  ? 0.7456 0.6414 0.4365 0.0422  0.0307  -0.0492 101 GLN C CG  
2162 C CD  . GLN C 55  ? 0.8503 0.7060 0.4784 0.0570  0.0405  -0.0591 101 GLN C CD  
2163 O OE1 . GLN C 55  ? 0.9036 0.7605 0.5106 0.0535  0.0484  -0.0562 101 GLN C OE1 
2164 N NE2 . GLN C 55  ? 0.9343 0.7495 0.5265 0.0750  0.0400  -0.0710 101 GLN C NE2 
2165 N N   . PRO C 56  ? 0.6140 0.5435 0.3776 -0.0104 -0.0227 -0.0229 102 PRO C N   
2166 C CA  . PRO C 56  ? 0.6191 0.5412 0.3896 -0.0220 -0.0411 -0.0192 102 PRO C CA  
2167 C C   . PRO C 56  ? 0.6676 0.5484 0.4063 -0.0144 -0.0430 -0.0294 102 PRO C C   
2168 O O   . PRO C 56  ? 0.7141 0.5573 0.4077 -0.0024 -0.0371 -0.0400 102 PRO C O   
2169 C CB  . PRO C 56  ? 0.6488 0.5571 0.3994 -0.0410 -0.0634 -0.0114 102 PRO C CB  
2170 C CG  . PRO C 56  ? 0.6345 0.5611 0.3901 -0.0382 -0.0562 -0.0075 102 PRO C CG  
2171 C CD  . PRO C 56  ? 0.6326 0.5560 0.3776 -0.0206 -0.0316 -0.0170 102 PRO C CD  
2172 N N   . VAL C 57  ? 0.6599 0.5450 0.4181 -0.0196 -0.0507 -0.0259 103 VAL C N   
2173 C CA  . VAL C 57  ? 0.7163 0.5540 0.4401 -0.0140 -0.0573 -0.0337 103 VAL C CA  
2174 C C   . VAL C 57  ? 0.7993 0.5804 0.4673 -0.0300 -0.0802 -0.0349 103 VAL C C   
2175 O O   . VAL C 57  ? 0.8032 0.5921 0.4790 -0.0562 -0.1006 -0.0226 103 VAL C O   
2176 C CB  . VAL C 57  ? 0.6889 0.5403 0.4418 -0.0218 -0.0645 -0.0263 103 VAL C CB  
2177 C CG1 . VAL C 57  ? 0.7393 0.5316 0.4493 -0.0165 -0.0746 -0.0335 103 VAL C CG1 
2178 C CG2 . VAL C 57  ? 0.6229 0.5248 0.4251 -0.0076 -0.0452 -0.0253 103 VAL C CG2 
2179 N N   . ASP C 58  ? 0.8754 0.6013 0.4862 -0.0134 -0.0769 -0.0491 104 ASP C N   
2180 C CA  . ASP C 58  ? 0.9655 0.6210 0.5089 -0.0270 -0.1009 -0.0530 104 ASP C CA  
2181 C C   . ASP C 58  ? 1.0185 0.6194 0.5303 -0.0263 -0.1148 -0.0572 104 ASP C C   
2182 O O   . ASP C 58  ? 1.0647 0.6248 0.5400 0.0029  -0.1035 -0.0718 104 ASP C O   
2183 C CB  . ASP C 58  ? 1.0216 0.6395 0.5088 -0.0074 -0.0893 -0.0669 104 ASP C CB  
2184 C CG  . ASP C 58  ? 1.1076 0.6587 0.5258 -0.0279 -0.1176 -0.0685 104 ASP C CG  
2185 O OD1 . ASP C 58  ? 1.1611 0.6589 0.5448 -0.0452 -0.1443 -0.0675 104 ASP C OD1 
2186 O OD2 . ASP C 58  ? 1.1415 0.6904 0.5368 -0.0288 -0.1150 -0.0697 104 ASP C OD2 
2187 N N   . ALA C 59  ? 1.0177 0.6206 0.5447 -0.0578 -0.1390 -0.0429 105 ALA C N   
2188 C CA  . ALA C 59  ? 1.0678 0.6212 0.5687 -0.0639 -0.1552 -0.0424 105 ALA C CA  
2189 C C   . ALA C 59  ? 1.1855 0.6342 0.5932 -0.0591 -0.1732 -0.0562 105 ALA C C   
2190 O O   . ALA C 59  ? 1.2310 0.6251 0.6039 -0.0458 -0.1778 -0.0633 105 ALA C O   
2191 C CB  . ALA C 59  ? 1.0429 0.6253 0.5780 -0.1045 -0.1779 -0.0204 105 ALA C CB  
2192 N N   . VAL C 60  ? 1.2443 0.6598 0.6066 -0.0686 -0.1845 -0.0603 106 VAL C N   
2193 C CA  . VAL C 60  ? 1.3738 0.6809 0.6358 -0.0631 -0.2025 -0.0753 106 VAL C CA  
2194 C C   . VAL C 60  ? 1.4180 0.6967 0.6439 -0.0100 -0.1719 -0.0980 106 VAL C C   
2195 O O   . VAL C 60  ? 1.4924 0.6969 0.6610 0.0117  -0.1761 -0.1105 106 VAL C O   
2196 C CB  . VAL C 60  ? 1.4193 0.6988 0.6394 -0.0901 -0.2254 -0.0724 106 VAL C CB  
2197 C CG1 . VAL C 60  ? 1.5524 0.7070 0.6577 -0.0868 -0.2482 -0.0885 106 VAL C CG1 
2198 C CG2 . VAL C 60  ? 1.3803 0.7048 0.6472 -0.1408 -0.2543 -0.0468 106 VAL C CG2 
2199 N N   . LYS C 61  ? 1.3807 0.7200 0.6402 0.0111  -0.1413 -0.1017 107 LYS C N   
2200 C CA  . LYS C 61  ? 1.4152 0.7484 0.6522 0.0606  -0.1080 -0.1192 107 LYS C CA  
2201 C C   . LYS C 61  ? 1.3897 0.7482 0.6650 0.0895  -0.0906 -0.1214 107 LYS C C   
2202 O O   . LYS C 61  ? 1.4542 0.7644 0.6823 0.1282  -0.0798 -0.1365 107 LYS C O   
2203 C CB  . LYS C 61  ? 1.3615 0.7667 0.6374 0.0689  -0.0800 -0.1170 107 LYS C CB  
2204 C CG  . LYS C 61  ? 1.4211 0.7930 0.6452 0.0511  -0.0928 -0.1180 107 LYS C CG  
2205 C CD  . LYS C 61  ? 1.3755 0.8162 0.6368 0.0587  -0.0652 -0.1140 107 LYS C CD  
2206 C CE  . LYS C 61  ? 1.4408 0.8419 0.6422 0.0437  -0.0783 -0.1154 107 LYS C CE  
2207 N NZ  . LYS C 61  ? 1.4012 0.8627 0.6321 0.0498  -0.0524 -0.1100 107 LYS C NZ  
2208 N N   . LEU C 62  ? 1.3024 0.7347 0.6599 0.0727  -0.0886 -0.1063 108 LEU C N   
2209 C CA  . LEU C 62  ? 1.2717 0.7327 0.6699 0.0953  -0.0757 -0.1058 108 LEU C CA  
2210 C C   . LEU C 62  ? 1.3316 0.7202 0.6895 0.0901  -0.1015 -0.1062 108 LEU C C   
2211 O O   . LEU C 62  ? 1.3276 0.7215 0.7023 0.1138  -0.0939 -0.1078 108 LEU C O   
2212 C CB  . LEU C 62  ? 1.1632 0.7207 0.6542 0.0784  -0.0661 -0.0901 108 LEU C CB  
2213 C CG  . LEU C 62  ? 1.1138 0.7439 0.6493 0.0878  -0.0388 -0.0888 108 LEU C CG  
2214 C CD1 . LEU C 62  ? 1.0289 0.7350 0.6407 0.0652  -0.0371 -0.0735 108 LEU C CD1 
2215 C CD2 . LEU C 62  ? 1.1251 0.7745 0.6655 0.1305  -0.0102 -0.0985 108 LEU C CD2 
2216 N N   . GLY C 63  ? 1.3927 0.7136 0.6971 0.0573  -0.1340 -0.1030 109 GLY C N   
2217 C CA  . GLY C 63  ? 1.4590 0.7010 0.7161 0.0452  -0.1630 -0.1011 109 GLY C CA  
2218 C C   . GLY C 63  ? 1.3863 0.6809 0.7089 0.0180  -0.1708 -0.0816 109 GLY C C   
2219 O O   . GLY C 63  ? 1.4010 0.6771 0.7234 0.0331  -0.1718 -0.0816 109 GLY C O   
2220 N N   . LEU C 64  ? 1.3119 0.6719 0.6882 -0.0199 -0.1760 -0.0647 110 LEU C N   
2221 C CA  . LEU C 64  ? 1.2386 0.6587 0.6789 -0.0459 -0.1799 -0.0449 110 LEU C CA  
2222 C C   . LEU C 64  ? 1.2417 0.6584 0.6790 -0.0985 -0.2101 -0.0257 110 LEU C C   
2223 O O   . LEU C 64  ? 1.1753 0.6685 0.6700 -0.1185 -0.2055 -0.0122 110 LEU C O   
2224 C CB  . LEU C 64  ? 1.1337 0.6580 0.6565 -0.0339 -0.1502 -0.0412 110 LEU C CB  
2225 C CG  . LEU C 64  ? 1.1092 0.6582 0.6501 0.0118  -0.1201 -0.0554 110 LEU C CG  
2226 C CD1 . LEU C 64  ? 1.0095 0.6529 0.6240 0.0132  -0.0974 -0.0494 110 LEU C CD1 
2227 C CD2 . LEU C 64  ? 1.1350 0.6605 0.6714 0.0311  -0.1208 -0.0571 110 LEU C CD2 
2228 N N   . PRO C 65  ? 1.3219 0.6497 0.6917 -0.1211 -0.2423 -0.0230 111 PRO C N   
2229 C CA  . PRO C 65  ? 1.3341 0.6566 0.6970 -0.1755 -0.2750 -0.0026 111 PRO C CA  
2230 C C   . PRO C 65  ? 1.2348 0.6507 0.6776 -0.2074 -0.2739 0.0241  111 PRO C C   
2231 O O   . PRO C 65  ? 1.2225 0.6735 0.6860 -0.2463 -0.2914 0.0428  111 PRO C O   
2232 C CB  . PRO C 65  ? 1.4566 0.6594 0.7305 -0.1907 -0.3086 -0.0044 111 PRO C CB  
2233 C CG  . PRO C 65  ? 1.4840 0.6461 0.7353 -0.1440 -0.2914 -0.0216 111 PRO C CG  
2234 C CD  . PRO C 65  ? 1.4182 0.6434 0.7119 -0.0971 -0.2517 -0.0380 111 PRO C CD  
2235 N N   . ASP C 66  ? 1.1623 0.6196 0.6482 -0.1899 -0.2537 0.0265  112 ASP C N   
2236 C CA  . ASP C 66  ? 1.0781 0.6188 0.6317 -0.2151 -0.2495 0.0504  112 ASP C CA  
2237 C C   . ASP C 66  ? 0.9502 0.5925 0.5797 -0.1941 -0.2175 0.0498  112 ASP C C   
2238 O O   . ASP C 66  ? 0.8895 0.6024 0.5731 -0.2067 -0.2092 0.0669  112 ASP C O   
2239 C CB  . ASP C 66  ? 1.1047 0.6195 0.6493 -0.2154 -0.2522 0.0567  112 ASP C CB  
2240 C CG  . ASP C 66  ? 1.0981 0.6056 0.6454 -0.1654 -0.2274 0.0366  112 ASP C CG  
2241 O OD1 . ASP C 66  ? 1.0958 0.6028 0.6395 -0.1310 -0.2103 0.0166  112 ASP C OD1 
2242 O OD2 . ASP C 66  ? 1.1275 0.6314 0.6802 -0.1618 -0.2258 0.0426  112 ASP C OD2 
2243 N N   . TYR C 67  ? 0.9061 0.5532 0.5353 -0.1626 -0.1996 0.0310  113 TYR C N   
2244 C CA  . TYR C 67  ? 0.7979 0.5273 0.4899 -0.1413 -0.1708 0.0291  113 TYR C CA  
2245 C C   . TYR C 67  ? 0.7351 0.5401 0.4790 -0.1664 -0.1727 0.0492  113 TYR C C   
2246 O O   . TYR C 67  ? 0.6612 0.5292 0.4553 -0.1623 -0.1571 0.0580  113 TYR C O   
2247 C CB  . TYR C 67  ? 0.7874 0.5082 0.4666 -0.1107 -0.1544 0.0093  113 TYR C CB  
2248 C CG  . TYR C 67  ? 0.7018 0.4966 0.4392 -0.0907 -0.1272 0.0078  113 TYR C CG  
2249 C CD1 . TYR C 67  ? 0.6556 0.4684 0.4156 -0.0666 -0.1087 0.0017  113 TYR C CD1 
2250 C CD2 . TYR C 67  ? 0.6497 0.4934 0.4172 -0.0971 -0.1229 0.0138  113 TYR C CD2 
2251 C CE1 . TYR C 67  ? 0.5901 0.4627 0.3972 -0.0523 -0.0877 0.0010  113 TYR C CE1 
2252 C CE2 . TYR C 67  ? 0.5758 0.4762 0.3887 -0.0798 -0.1008 0.0126  113 TYR C CE2 
2253 C CZ  . TYR C 67  ? 0.5567 0.4693 0.3875 -0.0589 -0.0837 0.0059  113 TYR C CZ  
2254 O OH  . TYR C 67  ? 0.4828 0.4432 0.3520 -0.0450 -0.0654 0.0050  113 TYR C OH  
2255 N N   . HIS C 68  ? 0.7581 0.5562 0.4876 -0.1908 -0.1926 0.0569  114 HIS C N   
2256 C CA  . HIS C 68  ? 0.7145 0.5901 0.4960 -0.2098 -0.1947 0.0767  114 HIS C CA  
2257 C C   . HIS C 68  ? 0.7249 0.6347 0.5307 -0.2451 -0.2089 0.1032  114 HIS C C   
2258 O O   . HIS C 68  ? 0.6866 0.6734 0.5433 -0.2572 -0.2069 0.1222  114 HIS C O   
2259 C CB  . HIS C 68  ? 0.7401 0.6027 0.5011 -0.2207 -0.2110 0.0761  114 HIS C CB  
2260 C CG  . HIS C 68  ? 0.7177 0.5639 0.4633 -0.1871 -0.1927 0.0543  114 HIS C CG  
2261 N ND1 . HIS C 68  ? 0.6378 0.5431 0.4295 -0.1628 -0.1674 0.0514  114 HIS C ND1 
2262 C CD2 . HIS C 68  ? 0.7639 0.5402 0.4501 -0.1737 -0.1952 0.0352  114 HIS C CD2 
2263 C CE1 . HIS C 68  ? 0.6461 0.5225 0.4112 -0.1400 -0.1559 0.0336  114 HIS C CE1 
2264 N NE2 . HIS C 68  ? 0.7157 0.5175 0.4180 -0.1445 -0.1706 0.0234  114 HIS C NE2 
2265 N N   . LYS C 69  ? 0.7824 0.6362 0.5510 -0.2606 -0.2229 0.1057  115 LYS C N   
2266 C CA  . LYS C 69  ? 0.7952 0.6817 0.5861 -0.2922 -0.2314 0.1313  115 LYS C CA  
2267 C C   . LYS C 69  ? 0.7381 0.6794 0.5726 -0.2682 -0.2014 0.1318  115 LYS C C   
2268 O O   . LYS C 69  ? 0.7196 0.7264 0.5948 -0.2849 -0.1964 0.1541  115 LYS C O   
2269 C CB  . LYS C 69  ? 0.8849 0.6814 0.6126 -0.3177 -0.2587 0.1341  115 LYS C CB  
2270 C CG  . LYS C 69  ? 0.9767 0.7111 0.6527 -0.3493 -0.2943 0.1370  115 LYS C CG  
2271 C CD  . LYS C 69  ? 1.0785 0.7170 0.6867 -0.3767 -0.3238 0.1416  115 LYS C CD  
2272 C CE  . LYS C 69  ? 1.1794 0.7448 0.7262 -0.4098 -0.3626 0.1434  115 LYS C CE  
2273 N NZ  . LYS C 69  ? 1.2994 0.7519 0.7663 -0.4329 -0.3934 0.1445  115 LYS C NZ  
2274 N N   . ILE C 70  ? 0.7144 0.6298 0.5386 -0.2295 -0.1819 0.1082  116 ILE C N   
2275 C CA  . ILE C 70  ? 0.6712 0.6254 0.5268 -0.2065 -0.1570 0.1061  116 ILE C CA  
2276 C C   . ILE C 70  ? 0.6049 0.6273 0.5078 -0.1819 -0.1331 0.1012  116 ILE C C   
2277 O O   . ILE C 70  ? 0.5738 0.6565 0.5146 -0.1788 -0.1183 0.1122  116 ILE C O   
2278 C CB  . ILE C 70  ? 0.6897 0.5817 0.5105 -0.1796 -0.1518 0.0859  116 ILE C CB  
2279 C CG1 . ILE C 70  ? 0.7719 0.5913 0.5422 -0.2010 -0.1759 0.0921  116 ILE C CG1 
2280 C CG2 . ILE C 70  ? 0.6438 0.5767 0.4970 -0.1556 -0.1282 0.0827  116 ILE C CG2 
2281 C CD1 . ILE C 70  ? 0.8126 0.5642 0.5431 -0.1712 -0.1745 0.0722  116 ILE C CD1 
2282 N N   . ILE C 71  ? 0.5907 0.5986 0.4857 -0.1641 -0.1297 0.0849  117 ILE C N   
2283 C CA  . ILE C 71  ? 0.5375 0.5953 0.4678 -0.1406 -0.1097 0.0789  117 ILE C CA  
2284 C C   . ILE C 71  ? 0.5333 0.6373 0.4884 -0.1547 -0.1172 0.0931  117 ILE C C   
2285 O O   . ILE C 71  ? 0.5642 0.6414 0.4968 -0.1679 -0.1346 0.0926  117 ILE C O   
2286 C CB  . ILE C 71  ? 0.5351 0.5568 0.4447 -0.1143 -0.1006 0.0560  117 ILE C CB  
2287 C CG1 . ILE C 71  ? 0.5420 0.5311 0.4364 -0.0962 -0.0922 0.0438  117 ILE C CG1 
2288 C CG2 . ILE C 71  ? 0.4815 0.5473 0.4218 -0.0955 -0.0840 0.0521  117 ILE C CG2 
2289 C CD1 . ILE C 71  ? 0.5129 0.5402 0.4371 -0.0885 -0.0785 0.0491  117 ILE C CD1 
2290 N N   . LYS C 72  ? 0.4984 0.6705 0.4970 -0.1492 -0.1044 0.1056  118 LYS C N   
2291 C CA  . LYS C 72  ? 0.4954 0.7234 0.5251 -0.1605 -0.1114 0.1233  118 LYS C CA  
2292 C C   . LYS C 72  ? 0.4652 0.7057 0.5044 -0.1373 -0.1041 0.1137  118 LYS C C   
2293 O O   . LYS C 72  ? 0.4611 0.7224 0.5096 -0.1480 -0.1181 0.1239  118 LYS C O   
2294 C CB  . LYS C 72  ? 0.4856 0.7856 0.5567 -0.1635 -0.1005 0.1441  118 LYS C CB  
2295 C CG  . LYS C 72  ? 0.5384 0.8347 0.6023 -0.1951 -0.1111 0.1610  118 LYS C CG  
2296 C CD  . LYS C 72  ? 0.6064 0.8857 0.6559 -0.2355 -0.1425 0.1762  118 LYS C CD  
2297 C CE  . LYS C 72  ? 0.6615 0.9374 0.7030 -0.2713 -0.1549 0.1966  118 LYS C CE  
2298 N NZ  . LYS C 72  ? 0.6907 0.8932 0.6887 -0.2652 -0.1530 0.1809  118 LYS C NZ  
2299 N N   . GLN C 73  ? 0.4301 0.6577 0.4661 -0.1080 -0.0847 0.0961  119 GLN C N   
2300 C CA  . GLN C 73  ? 0.4169 0.6467 0.4551 -0.0876 -0.0782 0.0870  119 GLN C CA  
2301 C C   . GLN C 73  ? 0.4130 0.5884 0.4196 -0.0747 -0.0715 0.0654  119 GLN C C   
2302 O O   . GLN C 73  ? 0.3894 0.5618 0.3992 -0.0563 -0.0554 0.0553  119 GLN C O   
2303 C CB  . GLN C 73  ? 0.3902 0.6684 0.4599 -0.0640 -0.0608 0.0910  119 GLN C CB  
2304 C CG  . GLN C 73  ? 0.4139 0.6882 0.4817 -0.0431 -0.0561 0.0832  119 GLN C CG  
2305 C CD  . GLN C 73  ? 0.4644 0.7406 0.5290 -0.0546 -0.0741 0.0906  119 GLN C CD  
2306 O OE1 . GLN C 73  ? 0.4818 0.8038 0.5721 -0.0632 -0.0841 0.1089  119 GLN C OE1 
2307 N NE2 . GLN C 73  ? 0.4840 0.7135 0.5172 -0.0550 -0.0782 0.0779  119 GLN C NE2 
2308 N N   . PRO C 74  ? 0.4322 0.5655 0.4064 -0.0847 -0.0841 0.0591  120 PRO C N   
2309 C CA  . PRO C 74  ? 0.4326 0.5237 0.3787 -0.0703 -0.0752 0.0408  120 PRO C CA  
2310 C C   . PRO C 74  ? 0.4014 0.5089 0.3598 -0.0512 -0.0611 0.0358  120 PRO C C   
2311 O O   . PRO C 74  ? 0.3851 0.5202 0.3594 -0.0499 -0.0645 0.0446  120 PRO C O   
2312 C CB  . PRO C 74  ? 0.4810 0.5303 0.3879 -0.0840 -0.0923 0.0382  120 PRO C CB  
2313 C CG  . PRO C 74  ? 0.5103 0.5667 0.4196 -0.1106 -0.1135 0.0537  120 PRO C CG  
2314 C CD  . PRO C 74  ? 0.4662 0.5893 0.4256 -0.1103 -0.1079 0.0696  120 PRO C CD  
2315 N N   . MET C 75  ? 0.3822 0.4728 0.3329 -0.0371 -0.0468 0.0232  121 MET C N   
2316 C CA  . MET C 75  ? 0.3695 0.4666 0.3249 -0.0240 -0.0357 0.0191  121 MET C CA  
2317 C C   . MET C 75  ? 0.3773 0.4515 0.3167 -0.0160 -0.0242 0.0071  121 MET C C   
2318 O O   . MET C 75  ? 0.3850 0.4483 0.3209 -0.0133 -0.0212 0.0015  121 MET C O   
2319 C CB  . MET C 75  ? 0.3390 0.4659 0.3218 -0.0140 -0.0281 0.0234  121 MET C CB  
2320 C CG  . MET C 75  ? 0.3344 0.4607 0.3168 -0.0027 -0.0212 0.0214  121 MET C CG  
2321 S SD  . MET C 75  ? 0.3616 0.4836 0.3317 -0.0043 -0.0304 0.0275  121 MET C SD  
2322 C CE  . MET C 75  ? 0.3469 0.5068 0.3409 -0.0072 -0.0425 0.0422  121 MET C CE  
2323 N N   . ASP C 76  ? 0.3836 0.4531 0.3138 -0.0118 -0.0181 0.0049  122 ASP C N   
2324 C CA  . ASP C 76  ? 0.3857 0.4437 0.3035 -0.0054 -0.0055 -0.0031 122 ASP C CA  
2325 C C   . ASP C 76  ? 0.3882 0.4544 0.3100 -0.0040 0.0017  -0.0002 122 ASP C C   
2326 O O   . ASP C 76  ? 0.3829 0.4517 0.3058 -0.0062 -0.0052 0.0063  122 ASP C O   
2327 C CB  . ASP C 76  ? 0.4236 0.4525 0.3056 -0.0067 -0.0076 -0.0083 122 ASP C CB  
2328 C CG  . ASP C 76  ? 0.4583 0.4773 0.3201 -0.0140 -0.0157 -0.0036 122 ASP C CG  
2329 O OD1 . ASP C 76  ? 0.4626 0.4837 0.3268 -0.0234 -0.0318 0.0034  122 ASP C OD1 
2330 O OD2 . ASP C 76  ? 0.4628 0.4753 0.3077 -0.0113 -0.0063 -0.0050 122 ASP C OD2 
2331 N N   . MET C 77  ? 0.3950 0.4654 0.3183 -0.0007 0.0144  -0.0034 123 MET C N   
2332 C CA  . MET C 77  ? 0.4065 0.4817 0.3309 -0.0044 0.0200  0.0014  123 MET C CA  
2333 C C   . MET C 77  ? 0.4118 0.4710 0.3087 -0.0093 0.0186  0.0052  123 MET C C   
2334 O O   . MET C 77  ? 0.4183 0.4731 0.3118 -0.0139 0.0161  0.0116  123 MET C O   
2335 C CB  . MET C 77  ? 0.4163 0.5079 0.3520 -0.0036 0.0332  0.0005  123 MET C CB  
2336 C CG  . MET C 77  ? 0.4544 0.5611 0.4168 -0.0031 0.0313  0.0006  123 MET C CG  
2337 S SD  . MET C 77  ? 0.5218 0.6559 0.5021 -0.0080 0.0426  0.0051  123 MET C SD  
2338 C CE  . MET C 77  ? 0.5425 0.6884 0.5204 0.0076  0.0556  -0.0012 123 MET C CE  
2339 N N   . GLY C 78  ? 0.4287 0.4733 0.3005 -0.0081 0.0189  0.0011  124 GLY C N   
2340 C CA  . GLY C 78  ? 0.4573 0.4828 0.2967 -0.0132 0.0157  0.0046  124 GLY C CA  
2341 C C   . GLY C 78  ? 0.4487 0.4696 0.2900 -0.0173 -0.0017 0.0121  124 GLY C C   
2342 O O   . GLY C 78  ? 0.4649 0.4772 0.2934 -0.0208 -0.0046 0.0191  124 GLY C O   
2343 N N   . THR C 79  ? 0.4302 0.4593 0.2884 -0.0164 -0.0132 0.0122  125 THR C N   
2344 C CA  . THR C 79  ? 0.4201 0.4580 0.2895 -0.0166 -0.0285 0.0211  125 THR C CA  
2345 C C   . THR C 79  ? 0.4033 0.4497 0.2894 -0.0092 -0.0252 0.0254  125 THR C C   
2346 O O   . THR C 79  ? 0.4098 0.4499 0.2883 -0.0062 -0.0334 0.0327  125 THR C O   
2347 C CB  . THR C 79  ? 0.4046 0.4594 0.2944 -0.0186 -0.0381 0.0226  125 THR C CB  
2348 O OG1 . THR C 79  ? 0.4052 0.4399 0.2698 -0.0281 -0.0462 0.0192  125 THR C OG1 
2349 C CG2 . THR C 79  ? 0.4124 0.4907 0.3225 -0.0160 -0.0512 0.0342  125 THR C CG2 
2350 N N   . ILE C 80  ? 0.3756 0.4308 0.2794 -0.0056 -0.0151 0.0208  126 ILE C N   
2351 C CA  . ILE C 80  ? 0.3738 0.4273 0.2853 0.0008  -0.0141 0.0233  126 ILE C CA  
2352 C C   . ILE C 80  ? 0.4013 0.4318 0.2893 -0.0051 -0.0127 0.0273  126 ILE C C   
2353 O O   . ILE C 80  ? 0.4106 0.4254 0.2890 0.0003  -0.0201 0.0327  126 ILE C O   
2354 C CB  . ILE C 80  ? 0.3503 0.4134 0.2798 0.0024  -0.0061 0.0176  126 ILE C CB  
2355 C CG1 . ILE C 80  ? 0.3354 0.4186 0.2848 0.0077  -0.0083 0.0160  126 ILE C CG1 
2356 C CG2 . ILE C 80  ? 0.3709 0.4200 0.2966 0.0067  -0.0075 0.0193  126 ILE C CG2 
2357 C CD1 . ILE C 80  ? 0.3200 0.4106 0.2831 0.0083  -0.0018 0.0105  126 ILE C CD1 
2358 N N   . LYS C 81  ? 0.4121 0.4401 0.2886 -0.0150 -0.0029 0.0256  127 LYS C N   
2359 C CA  . LYS C 81  ? 0.4442 0.4551 0.2977 -0.0249 0.0006  0.0319  127 LYS C CA  
2360 C C   . LYS C 81  ? 0.4776 0.4669 0.3044 -0.0244 -0.0109 0.0388  127 LYS C C   
2361 O O   . LYS C 81  ? 0.4918 0.4588 0.3022 -0.0267 -0.0171 0.0463  127 LYS C O   
2362 C CB  . LYS C 81  ? 0.4534 0.4760 0.3016 -0.0324 0.0165  0.0298  127 LYS C CB  
2363 C CG  . LYS C 81  ? 0.4949 0.5082 0.3210 -0.0458 0.0235  0.0391  127 LYS C CG  
2364 C CD  . LYS C 81  ? 0.5167 0.5571 0.3498 -0.0500 0.0434  0.0385  127 LYS C CD  
2365 C CE  . LYS C 81  ? 0.5587 0.5961 0.3664 -0.0641 0.0534  0.0498  127 LYS C CE  
2366 N NZ  . LYS C 81  ? 0.6077 0.6200 0.3750 -0.0614 0.0512  0.0497  127 LYS C NZ  
2367 N N   . ARG C 82  ? 0.4824 0.4745 0.3017 -0.0224 -0.0164 0.0370  128 ARG C N   
2368 C CA  . ARG C 82  ? 0.5280 0.5030 0.3238 -0.0222 -0.0310 0.0444  128 ARG C CA  
2369 C C   . ARG C 82  ? 0.5157 0.4910 0.3250 -0.0096 -0.0446 0.0508  128 ARG C C   
2370 O O   . ARG C 82  ? 0.5483 0.5011 0.3364 -0.0075 -0.0541 0.0591  128 ARG C O   
2371 C CB  . ARG C 82  ? 0.5441 0.5225 0.3315 -0.0243 -0.0390 0.0415  128 ARG C CB  
2372 C CG  . ARG C 82  ? 0.6356 0.5953 0.3936 -0.0275 -0.0560 0.0500  128 ARG C CG  
2373 C CD  . ARG C 82  ? 0.6788 0.6400 0.4289 -0.0329 -0.0702 0.0486  128 ARG C CD  
2374 N NE  . ARG C 82  ? 0.6881 0.6808 0.4789 -0.0287 -0.0791 0.0501  128 ARG C NE  
2375 C CZ  . ARG C 82  ? 0.6987 0.7003 0.4999 -0.0338 -0.0785 0.0437  128 ARG C CZ  
2376 N NH1 . ARG C 82  ? 0.7328 0.7106 0.5052 -0.0394 -0.0700 0.0333  128 ARG C NH1 
2377 N NH2 . ARG C 82  ? 0.6833 0.7168 0.5217 -0.0320 -0.0862 0.0486  128 ARG C NH2 
2378 N N   . ARG C 83  ? 0.4773 0.4766 0.3189 0.0006  -0.0448 0.0473  129 ARG C N   
2379 C CA  . ARG C 83  ? 0.4733 0.4785 0.3285 0.0183  -0.0539 0.0526  129 ARG C CA  
2380 C C   . ARG C 83  ? 0.5036 0.4764 0.3409 0.0242  -0.0531 0.0540  129 ARG C C   
2381 O O   . ARG C 83  ? 0.5336 0.4896 0.3587 0.0384  -0.0641 0.0608  129 ARG C O   
2382 C CB  . ARG C 83  ? 0.4344 0.4737 0.3245 0.0270  -0.0502 0.0488  129 ARG C CB  
2383 C CG  . ARG C 83  ? 0.4389 0.5074 0.3451 0.0215  -0.0582 0.0525  129 ARG C CG  
2384 C CD  . ARG C 83  ? 0.4173 0.5196 0.3558 0.0253  -0.0534 0.0509  129 ARG C CD  
2385 N NE  . ARG C 83  ? 0.4329 0.5624 0.3858 0.0162  -0.0653 0.0583  129 ARG C NE  
2386 C CZ  . ARG C 83  ? 0.4217 0.5876 0.4039 0.0161  -0.0656 0.0630  129 ARG C CZ  
2387 N NH1 . ARG C 83  ? 0.4088 0.5877 0.4072 0.0275  -0.0529 0.0595  129 ARG C NH1 
2388 N NH2 . ARG C 83  ? 0.4363 0.6242 0.4287 0.0019  -0.0799 0.0723  129 ARG C NH2 
2389 N N   . LEU C 84  ? 0.4987 0.4609 0.3325 0.0130  -0.0421 0.0486  130 LEU C N   
2390 C CA  . LEU C 84  ? 0.5328 0.4574 0.3436 0.0108  -0.0443 0.0512  130 LEU C CA  
2391 C C   . LEU C 84  ? 0.5784 0.4701 0.3535 0.0004  -0.0511 0.0609  130 LEU C C   
2392 O O   . LEU C 84  ? 0.6157 0.4692 0.3652 0.0081  -0.0625 0.0667  130 LEU C O   
2393 C CB  . LEU C 84  ? 0.5245 0.4527 0.3435 -0.0045 -0.0334 0.0462  130 LEU C CB  
2394 C CG  . LEU C 84  ? 0.4909 0.4385 0.3355 0.0062  -0.0296 0.0377  130 LEU C CG  
2395 C CD1 . LEU C 84  ? 0.4678 0.4289 0.3258 -0.0103 -0.0202 0.0339  130 LEU C CD1 
2396 C CD2 . LEU C 84  ? 0.5052 0.4227 0.3346 0.0240  -0.0384 0.0369  130 LEU C CD2 
2397 N N   . GLU C 85  ? 0.5754 0.4778 0.3438 -0.0154 -0.0444 0.0626  131 GLU C N   
2398 C CA  . GLU C 85  ? 0.6263 0.5001 0.3574 -0.0271 -0.0489 0.0726  131 GLU C CA  
2399 C C   . GLU C 85  ? 0.6460 0.5024 0.3613 -0.0116 -0.0676 0.0796  131 GLU C C   
2400 O O   . GLU C 85  ? 0.6910 0.5085 0.3715 -0.0145 -0.0775 0.0894  131 GLU C O   
2401 C CB  . GLU C 85  ? 0.6300 0.5219 0.3545 -0.0413 -0.0361 0.0711  131 GLU C CB  
2402 C CG  . GLU C 85  ? 0.6355 0.5459 0.3710 -0.0561 -0.0168 0.0686  131 GLU C CG  
2403 C CD  . GLU C 85  ? 0.6555 0.5880 0.3872 -0.0602 -0.0014 0.0637  131 GLU C CD  
2404 O OE1 . GLU C 85  ? 0.6779 0.6065 0.3960 -0.0536 -0.0076 0.0605  131 GLU C OE1 
2405 O OE2 . GLU C 85  ? 0.6492 0.6026 0.3899 -0.0692 0.0161  0.0636  131 GLU C OE2 
2406 N N   . ASN C 86  ? 0.6126 0.4993 0.3542 0.0040  -0.0736 0.0764  132 ASN C N   
2407 C CA  . ASN C 86  ? 0.6384 0.5234 0.3745 0.0188  -0.0923 0.0849  132 ASN C CA  
2408 C C   . ASN C 86  ? 0.6311 0.5168 0.3821 0.0471  -0.1011 0.0872  132 ASN C C   
2409 O O   . ASN C 86  ? 0.6292 0.5277 0.3871 0.0644  -0.1157 0.0952  132 ASN C O   
2410 C CB  . ASN C 86  ? 0.6229 0.5444 0.3777 0.0152  -0.0964 0.0837  132 ASN C CB  
2411 C CG  . ASN C 86  ? 0.6778 0.5878 0.4043 -0.0067 -0.0905 0.0814  132 ASN C CG  
2412 O OD1 . ASN C 86  ? 0.7439 0.6277 0.4416 -0.0189 -0.0804 0.0822  132 ASN C OD1 
2413 N ND2 . ASN C 86  ? 0.7072 0.6359 0.4388 -0.0119 -0.0968 0.0794  132 ASN C ND2 
2414 N N   . ASN C 87  ? 0.6272 0.4995 0.3809 0.0531  -0.0926 0.0807  133 ASN C N   
2415 C CA  . ASN C 87  ? 0.6439 0.5082 0.4018 0.0838  -0.0981 0.0805  133 ASN C CA  
2416 C C   . ASN C 87  ? 0.6002 0.5223 0.4020 0.1051  -0.0973 0.0805  133 ASN C C   
2417 O O   . ASN C 87  ? 0.6115 0.5396 0.4185 0.1357  -0.1045 0.0857  133 ASN C O   
2418 C CB  . ASN C 87  ? 0.7135 0.5289 0.4327 0.0988  -0.1150 0.0904  133 ASN C CB  
2419 C CG  . ASN C 87  ? 0.7754 0.5302 0.4481 0.0753  -0.1169 0.0931  133 ASN C CG  
2420 O OD1 . ASN C 87  ? 0.7976 0.5330 0.4629 0.0621  -0.1086 0.0869  133 ASN C OD1 
2421 N ND2 . ASN C 87  ? 0.8284 0.5542 0.4689 0.0679  -0.1292 0.1044  133 ASN C ND2 
2422 N N   . TYR C 88  ? 0.5500 0.5150 0.3825 0.0896  -0.0882 0.0760  134 TYR C N   
2423 C CA  . TYR C 88  ? 0.5238 0.5470 0.3985 0.1012  -0.0881 0.0789  134 TYR C CA  
2424 C C   . TYR C 88  ? 0.5209 0.5592 0.4127 0.1274  -0.0787 0.0750  134 TYR C C   
2425 O O   . TYR C 88  ? 0.5085 0.5875 0.4262 0.1505  -0.0814 0.0828  134 TYR C O   
2426 C CB  . TYR C 88  ? 0.4930 0.5438 0.3861 0.0752  -0.0819 0.0744  134 TYR C CB  
2427 C CG  . TYR C 88  ? 0.4635 0.5706 0.3982 0.0791  -0.0806 0.0776  134 TYR C CG  
2428 C CD1 . TYR C 88  ? 0.4619 0.5853 0.4150 0.0841  -0.0664 0.0706  134 TYR C CD1 
2429 C CD2 . TYR C 88  ? 0.4812 0.6248 0.4351 0.0743  -0.0950 0.0894  134 TYR C CD2 
2430 C CE1 . TYR C 88  ? 0.4369 0.6120 0.4260 0.0846  -0.0646 0.0759  134 TYR C CE1 
2431 C CE2 . TYR C 88  ? 0.4638 0.6614 0.4565 0.0725  -0.0949 0.0957  134 TYR C CE2 
2432 C CZ  . TYR C 88  ? 0.4502 0.6634 0.4600 0.0775  -0.0787 0.0891  134 TYR C CZ  
2433 O OH  . TYR C 88  ? 0.4664 0.7335 0.5126 0.0731  -0.0783 0.0977  134 TYR C OH  
2434 N N   . TYR C 89  ? 0.5345 0.5428 0.4110 0.1236  -0.0679 0.0639  135 TYR C N   
2435 C CA  . TYR C 89  ? 0.5376 0.5556 0.4232 0.1456  -0.0578 0.0581  135 TYR C CA  
2436 C C   . TYR C 89  ? 0.5960 0.5805 0.4551 0.1812  -0.0626 0.0593  135 TYR C C   
2437 O O   . TYR C 89  ? 0.6395 0.5695 0.4608 0.1819  -0.0733 0.0608  135 TYR C O   
2438 C CB  . TYR C 89  ? 0.5234 0.5173 0.3981 0.1278  -0.0481 0.0463  135 TYR C CB  
2439 C CG  . TYR C 89  ? 0.4715 0.4975 0.3715 0.1005  -0.0413 0.0435  135 TYR C CG  
2440 C CD1 . TYR C 89  ? 0.4399 0.5164 0.3743 0.1023  -0.0356 0.0451  135 TYR C CD1 
2441 C CD2 . TYR C 89  ? 0.4771 0.4820 0.3642 0.0741  -0.0404 0.0403  135 TYR C CD2 
2442 C CE1 . TYR C 89  ? 0.4088 0.5041 0.3589 0.0792  -0.0317 0.0422  135 TYR C CE1 
2443 C CE2 . TYR C 89  ? 0.4523 0.4821 0.3580 0.0551  -0.0338 0.0369  135 TYR C CE2 
2444 C CZ  . TYR C 89  ? 0.4248 0.4947 0.3593 0.0581  -0.0307 0.0371  135 TYR C CZ  
2445 O OH  . TYR C 89  ? 0.3961 0.4803 0.3418 0.0410  -0.0264 0.0333  135 TYR C OH  
2446 N N   . TRP C 90  ? 0.6101 0.6251 0.4857 0.2114  -0.0541 0.0590  136 TRP C N   
2447 C CA  . TRP C 90  ? 0.6728 0.6543 0.5188 0.2532  -0.0550 0.0574  136 TRP C CA  
2448 C C   . TRP C 90  ? 0.7157 0.6478 0.5263 0.2588  -0.0471 0.0430  136 TRP C C   
2449 O O   . TRP C 90  ? 0.7795 0.6468 0.5414 0.2824  -0.0530 0.0379  136 TRP C O   
2450 C CB  . TRP C 90  ? 0.6657 0.7166 0.5500 0.2886  -0.0483 0.0673  136 TRP C CB  
2451 C CG  . TRP C 90  ? 0.6696 0.7415 0.5663 0.3041  -0.0624 0.0819  136 TRP C CG  
2452 C CD1 . TRP C 90  ? 0.6664 0.7244 0.5586 0.2787  -0.0788 0.0887  136 TRP C CD1 
2453 C CD2 . TRP C 90  ? 0.6732 0.7881 0.5895 0.3497  -0.0618 0.0930  136 TRP C CD2 
2454 N NE1 . TRP C 90  ? 0.6774 0.7627 0.5834 0.3040  -0.0912 0.1033  136 TRP C NE1 
2455 C CE2 . TRP C 90  ? 0.6845 0.8084 0.6089 0.3485  -0.0811 0.1068  136 TRP C CE2 
2456 C CE3 . TRP C 90  ? 0.6816 0.8301 0.6083 0.3936  -0.0459 0.0933  136 TRP C CE3 
2457 C CZ2 . TRP C 90  ? 0.6813 0.8505 0.6289 0.3891  -0.0869 0.1217  136 TRP C CZ2 
2458 C CZ3 . TRP C 90  ? 0.6885 0.8845 0.6386 0.4362  -0.0485 0.1079  136 TRP C CZ3 
2459 C CH2 . TRP C 90  ? 0.6938 0.9015 0.6566 0.4337  -0.0699 0.1224  136 TRP C CH2 
2460 N N   . ALA C 91  ? 0.6760 0.6346 0.5069 0.2379  -0.0358 0.0369  137 ALA C N   
2461 C CA  . ALA C 91  ? 0.7103 0.6267 0.5097 0.2390  -0.0303 0.0241  137 ALA C CA  
2462 C C   . ALA C 91  ? 0.6726 0.5900 0.4828 0.1962  -0.0294 0.0194  137 ALA C C   
2463 O O   . ALA C 91  ? 0.6146 0.5787 0.4627 0.1731  -0.0271 0.0247  137 ALA C O   
2464 C CB  . ALA C 91  ? 0.7131 0.6681 0.5251 0.2703  -0.0146 0.0221  137 ALA C CB  
2465 N N   . ALA C 92  ? 0.7088 0.5720 0.4825 0.1868  -0.0328 0.0099  138 ALA C N   
2466 C CA  . ALA C 92  ? 0.6794 0.5478 0.4647 0.1516  -0.0315 0.0059  138 ALA C CA  
2467 C C   . ALA C 92  ? 0.6247 0.5548 0.4503 0.1512  -0.0181 0.0053  138 ALA C C   
2468 O O   . ALA C 92  ? 0.5923 0.5517 0.4462 0.1249  -0.0159 0.0066  138 ALA C O   
2469 C CB  . ALA C 92  ? 0.7335 0.5367 0.4726 0.1452  -0.0399 -0.0026 138 ALA C CB  
2470 N N   . SER C 93  ? 0.6256 0.5737 0.4509 0.1817  -0.0088 0.0042  139 SER C N   
2471 C CA  . SER C 93  ? 0.5761 0.5817 0.4357 0.1813  0.0041  0.0063  139 SER C CA  
2472 C C   . SER C 93  ? 0.5110 0.5740 0.4185 0.1610  0.0049  0.0161  139 SER C C   
2473 O O   . SER C 93  ? 0.4660 0.5548 0.3949 0.1416  0.0088  0.0162  139 SER C O   
2474 C CB  . SER C 93  ? 0.6031 0.6292 0.4575 0.2205  0.0162  0.0078  139 SER C CB  
2475 O OG  . SER C 93  ? 0.5946 0.6513 0.4669 0.2422  0.0164  0.0180  139 SER C OG  
2476 N N   . GLU C 94  ? 0.5111 0.5872 0.4298 0.1653  -0.0010 0.0243  140 GLU C N   
2477 C CA  . GLU C 94  ? 0.4706 0.5939 0.4266 0.1464  -0.0036 0.0338  140 GLU C CA  
2478 C C   . GLU C 94  ? 0.4420 0.5488 0.3977 0.1134  -0.0080 0.0292  140 GLU C C   
2479 O O   . GLU C 94  ? 0.4006 0.5365 0.3790 0.0958  -0.0064 0.0313  140 GLU C O   
2480 C CB  . GLU C 94  ? 0.4977 0.6314 0.4590 0.1583  -0.0125 0.0437  140 GLU C CB  
2481 C CG  . GLU C 94  ? 0.5388 0.7023 0.5085 0.1955  -0.0075 0.0511  140 GLU C CG  
2482 C CD  . GLU C 94  ? 0.6042 0.7693 0.5740 0.2108  -0.0192 0.0607  140 GLU C CD  
2483 O OE1 . GLU C 94  ? 0.6277 0.7943 0.6048 0.1872  -0.0310 0.0658  140 GLU C OE1 
2484 O OE2 . GLU C 94  ? 0.6570 0.8193 0.6159 0.2484  -0.0169 0.0630  140 GLU C OE2 
2485 N N   . CYS C 95  ? 0.4566 0.5161 0.3844 0.1058  -0.0135 0.0239  141 CYS C N   
2486 C CA  . CYS C 95  ? 0.4420 0.4896 0.3690 0.0782  -0.0147 0.0204  141 CYS C CA  
2487 C C   . CYS C 95  ? 0.4126 0.4675 0.3483 0.0691  -0.0085 0.0139  141 CYS C C   
2488 O O   . CYS C 95  ? 0.3784 0.4505 0.3301 0.0529  -0.0062 0.0132  141 CYS C O   
2489 C CB  . CYS C 95  ? 0.4696 0.4693 0.3653 0.0713  -0.0213 0.0193  141 CYS C CB  
2490 S SG  . CYS C 95  ? 0.4842 0.4787 0.3812 0.0398  -0.0195 0.0180  141 CYS C SG  
2491 N N   . MET C 96  ? 0.4362 0.4744 0.3570 0.0819  -0.0066 0.0092  142 MET C N   
2492 C CA  . MET C 96  ? 0.4195 0.4627 0.3448 0.0751  -0.0028 0.0040  142 MET C CA  
2493 C C   . MET C 96  ? 0.3818 0.4693 0.3356 0.0742  0.0037  0.0078  142 MET C C   
2494 O O   . MET C 96  ? 0.3529 0.4492 0.3181 0.0600  0.0045  0.0059  142 MET C O   
2495 C CB  . MET C 96  ? 0.4693 0.4811 0.3645 0.0914  -0.0033 -0.0018 142 MET C CB  
2496 C CG  . MET C 96  ? 0.5209 0.4784 0.3815 0.0847  -0.0140 -0.0056 142 MET C CG  
2497 S SD  . MET C 96  ? 0.6062 0.5107 0.4156 0.1117  -0.0173 -0.0130 142 MET C SD  
2498 C CE  . MET C 96  ? 0.5938 0.5131 0.4051 0.1118  -0.0113 -0.0184 142 MET C CE  
2499 N N   . GLN C 97  ? 0.3833 0.4991 0.3487 0.0889  0.0072  0.0148  143 GLN C N   
2500 C CA  . GLN C 97  ? 0.3604 0.5194 0.3525 0.0831  0.0111  0.0221  143 GLN C CA  
2501 C C   . GLN C 97  ? 0.3220 0.4882 0.3280 0.0606  0.0049  0.0243  143 GLN C C   
2502 O O   . GLN C 97  ? 0.2959 0.4760 0.3128 0.0484  0.0051  0.0261  143 GLN C O   
2503 C CB  . GLN C 97  ? 0.3756 0.5730 0.3824 0.1013  0.0154  0.0328  143 GLN C CB  
2504 C CG  . GLN C 97  ? 0.4434 0.6371 0.4332 0.1298  0.0252  0.0306  143 GLN C CG  
2505 C CD  . GLN C 97  ? 0.4640 0.6720 0.4534 0.1293  0.0348  0.0304  143 GLN C CD  
2506 O OE1 . GLN C 97  ? 0.4676 0.6818 0.4678 0.1066  0.0324  0.0311  143 GLN C OE1 
2507 N NE2 . GLN C 97  ? 0.4896 0.6987 0.4614 0.1566  0.0457  0.0293  143 GLN C NE2 
2508 N N   . ASP C 98  ? 0.3277 0.4788 0.3271 0.0559  -0.0010 0.0239  144 ASP C N   
2509 C CA  . ASP C 98  ? 0.3106 0.4604 0.3130 0.0376  -0.0061 0.0241  144 ASP C CA  
2510 C C   . ASP C 98  ? 0.3009 0.4331 0.2977 0.0275  -0.0028 0.0156  144 ASP C C   
2511 O O   . ASP C 98  ? 0.2862 0.4218 0.2870 0.0177  -0.0040 0.0147  144 ASP C O   
2512 C CB  . ASP C 98  ? 0.3308 0.4670 0.3217 0.0363  -0.0122 0.0263  144 ASP C CB  
2513 C CG  . ASP C 98  ? 0.3437 0.5057 0.3461 0.0410  -0.0199 0.0374  144 ASP C CG  
2514 O OD1 . ASP C 98  ? 0.3312 0.5270 0.3542 0.0402  -0.0207 0.0449  144 ASP C OD1 
2515 O OD2 . ASP C 98  ? 0.3821 0.5321 0.3732 0.0439  -0.0263 0.0404  144 ASP C OD2 
2516 N N   . PHE C 99  ? 0.3036 0.4162 0.2899 0.0300  -0.0003 0.0103  145 PHE C N   
2517 C CA  . PHE C 99  ? 0.3041 0.4108 0.2922 0.0221  0.0021  0.0048  145 PHE C CA  
2518 C C   . PHE C 99  ? 0.2878 0.4067 0.2855 0.0231  0.0031  0.0042  145 PHE C C   
2519 O O   . PHE C 99  ? 0.2813 0.4028 0.2844 0.0172  0.0031  0.0024  145 PHE C O   
2520 C CB  . PHE C 99  ? 0.3151 0.4019 0.2919 0.0209  0.0010  0.0022  145 PHE C CB  
2521 C CG  . PHE C 99  ? 0.3558 0.4321 0.3253 0.0110  0.0009  0.0038  145 PHE C CG  
2522 C CD1 . PHE C 99  ? 0.3562 0.4445 0.3351 0.0019  0.0057  0.0032  145 PHE C CD1 
2523 C CD2 . PHE C 99  ? 0.3947 0.4487 0.3455 0.0123  -0.0033 0.0068  145 PHE C CD2 
2524 C CE1 . PHE C 99  ? 0.3700 0.4545 0.3421 -0.0076 0.0085  0.0066  145 PHE C CE1 
2525 C CE2 . PHE C 99  ? 0.3988 0.4426 0.3401 0.0001  -0.0032 0.0105  145 PHE C CE2 
2526 C CZ  . PHE C 99  ? 0.3913 0.4534 0.3444 -0.0108 0.0038  0.0110  145 PHE C CZ  
2527 N N   . ASN C 100 ? 0.2995 0.4239 0.2955 0.0326  0.0044  0.0062  146 ASN C N   
2528 C CA  . ASN C 100 ? 0.2908 0.4267 0.2919 0.0327  0.0060  0.0078  146 ASN C CA  
2529 C C   . ASN C 100 ? 0.2776 0.4286 0.2897 0.0231  0.0036  0.0134  146 ASN C C   
2530 O O   . ASN C 100 ? 0.2768 0.4234 0.2893 0.0167  0.0015  0.0125  146 ASN C O   
2531 C CB  . ASN C 100 ? 0.3095 0.4531 0.3039 0.0470  0.0109  0.0106  146 ASN C CB  
2532 C CG  . ASN C 100 ? 0.3261 0.4832 0.3224 0.0459  0.0141  0.0144  146 ASN C CG  
2533 O OD1 . ASN C 100 ? 0.3314 0.5166 0.3375 0.0478  0.0185  0.0237  146 ASN C OD1 
2534 N ND2 . ASN C 100 ? 0.3107 0.4507 0.2984 0.0416  0.0111  0.0092  146 ASN C ND2 
2535 N N   . THR C 101 ? 0.2651 0.4304 0.2833 0.0213  0.0014  0.0200  147 THR C N   
2536 C CA  . THR C 101 ? 0.2609 0.4351 0.2845 0.0078  -0.0053 0.0267  147 THR C CA  
2537 C C   . THR C 101 ? 0.2591 0.4067 0.2711 -0.0005 -0.0096 0.0195  147 THR C C   
2538 O O   . THR C 101 ? 0.2756 0.4144 0.2827 -0.0089 -0.0146 0.0208  147 THR C O   
2539 C CB  . THR C 101 ? 0.2653 0.4588 0.2969 0.0054  -0.0106 0.0357  147 THR C CB  
2540 O OG1 . THR C 101 ? 0.2700 0.4951 0.3152 0.0177  -0.0049 0.0439  147 THR C OG1 
2541 C CG2 . THR C 101 ? 0.2505 0.4474 0.2829 -0.0139 -0.0219 0.0435  147 THR C CG2 
2542 N N   . MET C 102 ? 0.2682 0.4016 0.2729 0.0033  -0.0072 0.0124  148 MET C N   
2543 C CA  . MET C 102 ? 0.2735 0.3864 0.2662 0.0011  -0.0072 0.0053  148 MET C CA  
2544 C C   . MET C 102 ? 0.2692 0.3764 0.2641 0.0047  -0.0054 0.0012  148 MET C C   
2545 O O   . MET C 102 ? 0.2829 0.3735 0.2671 0.0035  -0.0093 -0.0011 148 MET C O   
2546 C CB  . MET C 102 ? 0.2785 0.3862 0.2661 0.0047  -0.0014 0.0010  148 MET C CB  
2547 C CG  . MET C 102 ? 0.2978 0.3925 0.2746 0.0068  0.0032  -0.0055 148 MET C CG  
2548 S SD  . MET C 102 ? 0.3367 0.4342 0.3100 0.0075  0.0123  -0.0064 148 MET C SD  
2549 C CE  . MET C 102 ? 0.3207 0.4336 0.3146 0.0084  0.0155  -0.0056 148 MET C CE  
2550 N N   . PHE C 103 ? 0.2592 0.3752 0.2637 0.0099  -0.0015 0.0002  149 PHE C N   
2551 C CA  . PHE C 103 ? 0.2638 0.3768 0.2715 0.0133  -0.0022 -0.0023 149 PHE C CA  
2552 C C   . PHE C 103 ? 0.2710 0.3800 0.2745 0.0095  -0.0078 0.0025  149 PHE C C   
2553 O O   . PHE C 103 ? 0.2815 0.3763 0.2787 0.0109  -0.0120 0.0011  149 PHE C O   
2554 C CB  . PHE C 103 ? 0.2558 0.3754 0.2701 0.0162  -0.0006 -0.0034 149 PHE C CB  
2555 C CG  . PHE C 103 ? 0.2745 0.3969 0.2925 0.0151  0.0028  -0.0056 149 PHE C CG  
2556 C CD1 . PHE C 103 ? 0.2919 0.4193 0.3152 0.0167  0.0068  -0.0077 149 PHE C CD1 
2557 C CD2 . PHE C 103 ? 0.2824 0.4008 0.2955 0.0132  0.0024  -0.0047 149 PHE C CD2 
2558 C CE1 . PHE C 103 ? 0.3125 0.4485 0.3406 0.0128  0.0113  -0.0066 149 PHE C CE1 
2559 C CE2 . PHE C 103 ? 0.3138 0.4317 0.3275 0.0076  0.0037  -0.0041 149 PHE C CE2 
2560 C CZ  . PHE C 103 ? 0.3066 0.4370 0.3300 0.0056  0.0088  -0.0040 149 PHE C CZ  
2561 N N   . THR C 104 ? 0.2783 0.4005 0.2842 0.0056  -0.0074 0.0095  150 THR C N   
2562 C CA  . THR C 104 ? 0.2880 0.4129 0.2908 -0.0016 -0.0113 0.0177  150 THR C CA  
2563 C C   . THR C 104 ? 0.3155 0.4228 0.3075 -0.0133 -0.0207 0.0211  150 THR C C   
2564 O O   . THR C 104 ? 0.3286 0.4186 0.3097 -0.0182 -0.0272 0.0240  150 THR C O   
2565 C CB  . THR C 104 ? 0.2882 0.4407 0.2987 -0.0016 -0.0061 0.0266  150 THR C CB  
2566 O OG1 . THR C 104 ? 0.2931 0.4480 0.3014 0.0109  0.0007  0.0220  150 THR C OG1 
2567 C CG2 . THR C 104 ? 0.3031 0.4666 0.3127 -0.0133 -0.0088 0.0392  150 THR C CG2 
2568 N N   . ASN C 105 ? 0.3227 0.4280 0.3122 -0.0182 -0.0236 0.0209  151 ASN C N   
2569 C CA  . ASN C 105 ? 0.3561 0.4332 0.3257 -0.0297 -0.0354 0.0221  151 ASN C CA  
2570 C C   . ASN C 105 ? 0.3755 0.4166 0.3259 -0.0205 -0.0376 0.0127  151 ASN C C   
2571 O O   . ASN C 105 ? 0.3985 0.4095 0.3283 -0.0282 -0.0486 0.0155  151 ASN C O   
2572 C CB  . ASN C 105 ? 0.3690 0.4419 0.3319 -0.0326 -0.0382 0.0198  151 ASN C CB  
2573 C CG  . ASN C 105 ? 0.3670 0.4738 0.3472 -0.0425 -0.0410 0.0318  151 ASN C CG  
2574 O OD1 . ASN C 105 ? 0.3556 0.4905 0.3519 -0.0489 -0.0407 0.0434  151 ASN C OD1 
2575 N ND2 . ASN C 105 ? 0.3770 0.4839 0.3536 -0.0425 -0.0433 0.0303  151 ASN C ND2 
2576 N N   . CYS C 106 ? 0.3676 0.4125 0.3247 -0.0040 -0.0279 0.0029  152 CYS C N   
2577 C CA  . CYS C 106 ? 0.3988 0.4209 0.3445 0.0106  -0.0274 -0.0053 152 CYS C CA  
2578 C C   . CYS C 106 ? 0.3945 0.4089 0.3398 0.0123  -0.0332 -0.0016 152 CYS C C   
2579 O O   . CYS C 106 ? 0.4274 0.4069 0.3502 0.0172  -0.0414 -0.0035 152 CYS C O   
2580 C CB  . CYS C 106 ? 0.3904 0.4344 0.3531 0.0245  -0.0149 -0.0119 152 CYS C CB  
2581 S SG  . CYS C 106 ? 0.4400 0.4738 0.3984 0.0469  -0.0108 -0.0196 152 CYS C SG  
2582 N N   . TYR C 107 ? 0.3636 0.4046 0.3276 0.0094  -0.0300 0.0035  153 TYR C N   
2583 C CA  . TYR C 107 ? 0.3723 0.4064 0.3330 0.0101  -0.0357 0.0080  153 TYR C CA  
2584 C C   . TYR C 107 ? 0.4122 0.4225 0.3519 -0.0055 -0.0465 0.0175  153 TYR C C   
2585 O O   . TYR C 107 ? 0.4513 0.4331 0.3737 -0.0036 -0.0557 0.0195  153 TYR C O   
2586 C CB  . TYR C 107 ? 0.3492 0.4114 0.3253 0.0092  -0.0302 0.0113  153 TYR C CB  
2587 C CG  . TYR C 107 ? 0.3122 0.3930 0.3052 0.0188  -0.0236 0.0044  153 TYR C CG  
2588 C CD1 . TYR C 107 ? 0.3331 0.4136 0.3338 0.0302  -0.0237 -0.0014 153 TYR C CD1 
2589 C CD2 . TYR C 107 ? 0.2796 0.3781 0.2793 0.0165  -0.0179 0.0050  153 TYR C CD2 
2590 C CE1 . TYR C 107 ? 0.3217 0.4236 0.3399 0.0335  -0.0192 -0.0041 153 TYR C CE1 
2591 C CE2 . TYR C 107 ? 0.2974 0.4053 0.3070 0.0206  -0.0154 0.0003  153 TYR C CE2 
2592 C CZ  . TYR C 107 ? 0.3088 0.4207 0.3295 0.0263  -0.0165 -0.0032 153 TYR C CZ  
2593 O OH  . TYR C 107 ? 0.3482 0.4740 0.3810 0.0252  -0.0154 -0.0045 153 TYR C OH  
2594 N N   . ILE C 108 ? 0.4111 0.4342 0.3528 -0.0220 -0.0467 0.0251  154 ILE C N   
2595 C CA  . ILE C 108 ? 0.4538 0.4648 0.3808 -0.0435 -0.0575 0.0386  154 ILE C CA  
2596 C C   . ILE C 108 ? 0.5055 0.4629 0.3990 -0.0493 -0.0729 0.0363  154 ILE C C   
2597 O O   . ILE C 108 ? 0.5452 0.4701 0.4155 -0.0596 -0.0852 0.0438  154 ILE C O   
2598 C CB  . ILE C 108 ? 0.4428 0.4937 0.3881 -0.0591 -0.0538 0.0498  154 ILE C CB  
2599 C CG1 . ILE C 108 ? 0.4063 0.5002 0.3729 -0.0525 -0.0399 0.0546  154 ILE C CG1 
2600 C CG2 . ILE C 108 ? 0.4947 0.5346 0.4262 -0.0871 -0.0683 0.0658  154 ILE C CG2 
2601 C CD1 . ILE C 108 ? 0.4115 0.5508 0.4000 -0.0576 -0.0328 0.0638  154 ILE C CD1 
2602 N N   . TYR C 109 ? 0.5147 0.4573 0.3999 -0.0421 -0.0728 0.0260  155 TYR C N   
2603 C CA  . TYR C 109 ? 0.5759 0.4601 0.4197 -0.0466 -0.0879 0.0222  155 TYR C CA  
2604 C C   . TYR C 109 ? 0.6189 0.4580 0.4372 -0.0226 -0.0905 0.0114  155 TYR C C   
2605 O O   . TYR C 109 ? 0.6804 0.4620 0.4584 -0.0278 -0.1069 0.0129  155 TYR C O   
2606 C CB  . TYR C 109 ? 0.5750 0.4558 0.4116 -0.0458 -0.0865 0.0146  155 TYR C CB  
2607 C CG  . TYR C 109 ? 0.6329 0.4442 0.4166 -0.0475 -0.1024 0.0080  155 TYR C CG  
2608 C CD1 . TYR C 109 ? 0.6742 0.4514 0.4295 -0.0778 -0.1246 0.0195  155 TYR C CD1 
2609 C CD2 . TYR C 109 ? 0.6598 0.4381 0.4189 -0.0186 -0.0957 -0.0088 155 TYR C CD2 
2610 C CE1 . TYR C 109 ? 0.7459 0.4466 0.4423 -0.0803 -0.1425 0.0126  155 TYR C CE1 
2611 C CE2 . TYR C 109 ? 0.7421 0.4478 0.4431 -0.0156 -0.1097 -0.0167 155 TYR C CE2 
2612 C CZ  . TYR C 109 ? 0.7857 0.4472 0.4519 -0.0469 -0.1345 -0.0069 155 TYR C CZ  
2613 O OH  . TYR C 109 ? 0.8716 0.4493 0.4704 -0.0448 -0.1516 -0.0157 155 TYR C OH  
2614 N N   . ASN C 110 ? 0.5904 0.4552 0.4313 0.0035  -0.0756 0.0016  156 ASN C N   
2615 C CA  . ASN C 110 ? 0.6189 0.4535 0.4430 0.0321  -0.0753 -0.0086 156 ASN C CA  
2616 C C   . ASN C 110 ? 0.6338 0.4586 0.4574 0.0374  -0.0829 -0.0027 156 ASN C C   
2617 O O   . ASN C 110 ? 0.6032 0.4551 0.4455 0.0213  -0.0836 0.0079  156 ASN C O   
2618 C CB  . ASN C 110 ? 0.5783 0.4532 0.4310 0.0552  -0.0567 -0.0183 156 ASN C CB  
2619 C CG  . ASN C 110 ? 0.5962 0.4662 0.4363 0.0554  -0.0501 -0.0256 156 ASN C CG  
2620 O OD1 . ASN C 110 ? 0.6499 0.4769 0.4532 0.0706  -0.0519 -0.0346 156 ASN C OD1 
2621 N ND2 . ASN C 110 ? 0.5354 0.4450 0.4008 0.0404  -0.0429 -0.0218 156 ASN C ND2 
2622 N N   . LYS C 111 ? 0.6875 0.4713 0.4858 0.0622  -0.0888 -0.0094 157 LYS C N   
2623 C CA  . LYS C 111 ? 0.7108 0.4835 0.5075 0.0722  -0.0975 -0.0040 157 LYS C CA  
2624 C C   . LYS C 111 ? 0.6527 0.4886 0.4982 0.0857  -0.0851 -0.0042 157 LYS C C   
2625 O O   . LYS C 111 ? 0.6108 0.4848 0.4828 0.0987  -0.0705 -0.0116 157 LYS C O   
2626 C CB  . LYS C 111 ? 0.7847 0.4943 0.5394 0.1002  -0.1079 -0.0113 157 LYS C CB  
2627 C CG  . LYS C 111 ? 0.8875 0.5184 0.5823 0.0840  -0.1261 -0.0103 157 LYS C CG  
2628 C CD  . LYS C 111 ? 0.9943 0.5514 0.6384 0.1165  -0.1375 -0.0190 157 LYS C CD  
2629 C CE  . LYS C 111 ? 1.0895 0.5559 0.6658 0.0938  -0.1620 -0.0152 157 LYS C CE  
2630 N NZ  . LYS C 111 ? 1.2025 0.5830 0.7188 0.1283  -0.1754 -0.0245 157 LYS C NZ  
2631 N N   . PRO C 112 ? 0.6527 0.4974 0.5065 0.0804  -0.0925 0.0049  158 PRO C N   
2632 C CA  . PRO C 112 ? 0.6127 0.5119 0.5072 0.0876  -0.0853 0.0058  158 PRO C CA  
2633 C C   . PRO C 112 ? 0.6226 0.5449 0.5394 0.1192  -0.0798 -0.0013 158 PRO C C   
2634 O O   . PRO C 112 ? 0.5829 0.5575 0.5374 0.1206  -0.0705 -0.0018 158 PRO C O   
2635 C CB  . PRO C 112 ? 0.6293 0.5134 0.5118 0.0802  -0.0991 0.0164  158 PRO C CB  
2636 C CG  . PRO C 112 ? 0.6645 0.5023 0.5088 0.0584  -0.1085 0.0239  158 PRO C CG  
2637 C CD  . PRO C 112 ? 0.6974 0.4975 0.5182 0.0660  -0.1096 0.0157  158 PRO C CD  
2638 N N   . THR C 113 ? 0.6779 0.5610 0.5699 0.1444  -0.0858 -0.0056 159 THR C N   
2639 C CA  . THR C 113 ? 0.6962 0.6051 0.6096 0.1800  -0.0795 -0.0104 159 THR C CA  
2640 C C   . THR C 113 ? 0.7034 0.6270 0.6206 0.1942  -0.0611 -0.0205 159 THR C C   
2641 O O   . THR C 113 ? 0.7155 0.6704 0.6536 0.2246  -0.0514 -0.0234 159 THR C O   
2642 C CB  . THR C 113 ? 0.7608 0.6179 0.6415 0.2083  -0.0943 -0.0104 159 THR C CB  
2643 O OG1 . THR C 113 ? 0.8164 0.5989 0.6405 0.2057  -0.1007 -0.0160 159 THR C OG1 
2644 C CG2 . THR C 113 ? 0.7608 0.6086 0.6395 0.1973  -0.1126 0.0012  159 THR C CG2 
2645 N N   . ASP C 114 ? 0.7071 0.6114 0.6044 0.1730  -0.0561 -0.0246 160 ASP C N   
2646 C CA  . ASP C 114 ? 0.7124 0.6272 0.6076 0.1830  -0.0392 -0.0336 160 ASP C CA  
2647 C C   . ASP C 114 ? 0.6566 0.6482 0.6050 0.1823  -0.0228 -0.0308 160 ASP C C   
2648 O O   . ASP C 114 ? 0.6059 0.6316 0.5835 0.1592  -0.0252 -0.0236 160 ASP C O   
2649 C CB  . ASP C 114 ? 0.7219 0.6031 0.5869 0.1557  -0.0414 -0.0360 160 ASP C CB  
2650 C CG  . ASP C 114 ? 0.7990 0.5994 0.6051 0.1537  -0.0585 -0.0386 160 ASP C CG  
2651 O OD1 . ASP C 114 ? 0.8724 0.6340 0.6537 0.1790  -0.0668 -0.0411 160 ASP C OD1 
2652 O OD2 . ASP C 114 ? 0.8144 0.5885 0.5976 0.1261  -0.0655 -0.0369 160 ASP C OD2 
2653 N N   . ASP C 115 ? 0.6658 0.6813 0.6220 0.2072  -0.0063 -0.0360 161 ASP C N   
2654 C CA  . ASP C 115 ? 0.6187 0.7077 0.6236 0.2049  0.0094  -0.0310 161 ASP C CA  
2655 C C   . ASP C 115 ? 0.5622 0.6629 0.5728 0.1714  0.0138  -0.0295 161 ASP C C   
2656 O O   . ASP C 115 ? 0.5162 0.6657 0.5643 0.1559  0.0171  -0.0222 161 ASP C O   
2657 C CB  . ASP C 115 ? 0.6557 0.7660 0.6608 0.2377  0.0295  -0.0358 161 ASP C CB  
2658 C CG  . ASP C 115 ? 0.7213 0.8277 0.7243 0.2788  0.0278  -0.0369 161 ASP C CG  
2659 O OD1 . ASP C 115 ? 0.7477 0.8667 0.7732 0.2800  0.0129  -0.0293 161 ASP C OD1 
2660 O OD2 . ASP C 115 ? 0.7980 0.8867 0.7734 0.3123  0.0412  -0.0455 161 ASP C OD2 
2661 N N   . ILE C 116 ? 0.5631 0.6163 0.5342 0.1606  0.0119  -0.0359 162 ILE C N   
2662 C CA  . ILE C 116 ? 0.5320 0.5916 0.5046 0.1324  0.0142  -0.0342 162 ILE C CA  
2663 C C   . ILE C 116 ? 0.4783 0.5567 0.4751 0.1085  0.0045  -0.0262 162 ILE C C   
2664 O O   . ILE C 116 ? 0.4353 0.5393 0.4492 0.0920  0.0091  -0.0228 162 ILE C O   
2665 C CB  . ILE C 116 ? 0.5689 0.5722 0.4943 0.1238  0.0079  -0.0403 162 ILE C CB  
2666 C CG1 . ILE C 116 ? 0.5623 0.5783 0.4904 0.1018  0.0126  -0.0385 162 ILE C CG1 
2667 C CG2 . ILE C 116 ? 0.6042 0.5671 0.5096 0.1116  -0.0111 -0.0372 162 ILE C CG2 
2668 C CD1 . ILE C 116 ? 0.5675 0.6096 0.5006 0.1114  0.0306  -0.0411 162 ILE C CD1 
2669 N N   . VAL C 117 ? 0.4782 0.5398 0.4714 0.1085  -0.0088 -0.0231 163 VAL C N   
2670 C CA  . VAL C 117 ? 0.4469 0.5210 0.4545 0.0892  -0.0170 -0.0161 163 VAL C CA  
2671 C C   . VAL C 117 ? 0.4175 0.5386 0.4615 0.0884  -0.0142 -0.0118 163 VAL C C   
2672 O O   . VAL C 117 ? 0.3895 0.5241 0.4424 0.0711  -0.0146 -0.0088 163 VAL C O   
2673 C CB  . VAL C 117 ? 0.4672 0.5099 0.4569 0.0891  -0.0318 -0.0125 163 VAL C CB  
2674 C CG1 . VAL C 117 ? 0.4437 0.5015 0.4448 0.0730  -0.0379 -0.0056 163 VAL C CG1 
2675 C CG2 . VAL C 117 ? 0.4948 0.4905 0.4476 0.0806  -0.0377 -0.0136 163 VAL C CG2 
2676 N N   . LEU C 118 ? 0.4283 0.5738 0.4917 0.1076  -0.0122 -0.0105 164 LEU C N   
2677 C CA  . LEU C 118 ? 0.4091 0.6047 0.5103 0.1032  -0.0120 -0.0035 164 LEU C CA  
2678 C C   . LEU C 118 ? 0.3774 0.5994 0.4911 0.0911  0.0009  -0.0026 164 LEU C C   
2679 O O   . LEU C 118 ? 0.3566 0.6022 0.4886 0.0731  -0.0028 0.0035  164 LEU C O   
2680 C CB  . LEU C 118 ? 0.4306 0.6563 0.5555 0.1283  -0.0124 0.0003  164 LEU C CB  
2681 C CG  . LEU C 118 ? 0.4431 0.7237 0.6105 0.1204  -0.0190 0.0114  164 LEU C CG  
2682 C CD1 . LEU C 118 ? 0.4579 0.7215 0.6189 0.1034  -0.0391 0.0151  164 LEU C CD1 
2683 C CD2 . LEU C 118 ? 0.4586 0.7816 0.6561 0.1492  -0.0162 0.0170  164 LEU C CD2 
2684 N N   . MET C 119 ? 0.3799 0.5918 0.4781 0.1001  0.0144  -0.0083 165 MET C N   
2685 C CA  . MET C 119 ? 0.3675 0.5976 0.4700 0.0884  0.0268  -0.0069 165 MET C CA  
2686 C C   . MET C 119 ? 0.3541 0.5636 0.4440 0.0642  0.0206  -0.0068 165 MET C C   
2687 O O   . MET C 119 ? 0.3382 0.5662 0.4402 0.0482  0.0215  -0.0015 165 MET C O   
2688 C CB  . MET C 119 ? 0.3939 0.6074 0.4717 0.1044  0.0409  -0.0142 165 MET C CB  
2689 C CG  . MET C 119 ? 0.4134 0.6535 0.5030 0.1337  0.0523  -0.0142 165 MET C CG  
2690 S SD  . MET C 119 ? 0.4835 0.6843 0.5264 0.1592  0.0664  -0.0263 165 MET C SD  
2691 C CE  . MET C 119 ? 0.4853 0.7148 0.5308 0.1439  0.0845  -0.0222 165 MET C CE  
2692 N N   . ALA C 120 ? 0.3558 0.5271 0.4205 0.0622  0.0137  -0.0115 166 ALA C N   
2693 C CA  . ALA C 120 ? 0.3483 0.5047 0.4027 0.0451  0.0086  -0.0106 166 ALA C CA  
2694 C C   . ALA C 120 ? 0.3378 0.5051 0.4049 0.0351  -0.0002 -0.0061 166 ALA C C   
2695 O O   . ALA C 120 ? 0.3358 0.5020 0.4002 0.0232  -0.0008 -0.0045 166 ALA C O   
2696 C CB  . ALA C 120 ? 0.3566 0.4811 0.3880 0.0446  0.0026  -0.0130 166 ALA C CB  
2697 N N   . GLN C 121 ? 0.3422 0.5139 0.4174 0.0408  -0.0085 -0.0042 167 GLN C N   
2698 C CA  . GLN C 121 ? 0.3486 0.5255 0.4295 0.0311  -0.0197 -0.0002 167 GLN C CA  
2699 C C   . GLN C 121 ? 0.3356 0.5369 0.4341 0.0191  -0.0202 0.0047  167 GLN C C   
2700 O O   . GLN C 121 ? 0.3379 0.5270 0.4259 0.0055  -0.0275 0.0058  167 GLN C O   
2701 C CB  . GLN C 121 ? 0.3617 0.5420 0.4493 0.0400  -0.0303 0.0024  167 GLN C CB  
2702 C CG  . GLN C 121 ? 0.3937 0.5425 0.4571 0.0440  -0.0350 0.0007  167 GLN C CG  
2703 C CD  . GLN C 121 ? 0.4397 0.5873 0.5060 0.0537  -0.0469 0.0043  167 GLN C CD  
2704 O OE1 . GLN C 121 ? 0.4730 0.6165 0.5406 0.0697  -0.0464 0.0036  167 GLN C OE1 
2705 N NE2 . GLN C 121 ? 0.4612 0.6075 0.5238 0.0457  -0.0588 0.0081  167 GLN C NE2 
2706 N N   . THR C 122 ? 0.3269 0.5609 0.4489 0.0242  -0.0125 0.0083  168 THR C N   
2707 C CA  . THR C 122 ? 0.3241 0.5885 0.4663 0.0089  -0.0127 0.0168  168 THR C CA  
2708 C C   . THR C 122 ? 0.3145 0.5591 0.4378 -0.0052 -0.0078 0.0157  168 THR C C   
2709 O O   . THR C 122 ? 0.3240 0.5638 0.4439 -0.0244 -0.0168 0.0209  168 THR C O   
2710 C CB  . THR C 122 ? 0.3230 0.6352 0.4959 0.0203  -0.0005 0.0226  168 THR C CB  
2711 O OG1 . THR C 122 ? 0.3379 0.6684 0.5287 0.0380  -0.0062 0.0241  168 THR C OG1 
2712 C CG2 . THR C 122 ? 0.3223 0.6738 0.5199 -0.0008 -0.0011 0.0355  168 THR C CG2 
2713 N N   . LEU C 123 ? 0.3008 0.5289 0.4077 0.0038  0.0039  0.0095  169 LEU C N   
2714 C CA  . LEU C 123 ? 0.3000 0.5091 0.3882 -0.0064 0.0078  0.0092  169 LEU C CA  
2715 C C   . LEU C 123 ? 0.3142 0.4885 0.3797 -0.0124 -0.0028 0.0062  169 LEU C C   
2716 O O   . LEU C 123 ? 0.3253 0.4839 0.3777 -0.0245 -0.0070 0.0088  169 LEU C O   
2717 C CB  . LEU C 123 ? 0.2951 0.4944 0.3695 0.0048  0.0199  0.0038  169 LEU C CB  
2718 C CG  . LEU C 123 ? 0.3053 0.5317 0.3905 0.0142  0.0341  0.0054  169 LEU C CG  
2719 C CD1 . LEU C 123 ? 0.3176 0.5201 0.3776 0.0262  0.0414  -0.0024 169 LEU C CD1 
2720 C CD2 . LEU C 123 ? 0.2917 0.5432 0.3870 -0.0009 0.0407  0.0152  169 LEU C CD2 
2721 N N   . GLU C 124 ? 0.3158 0.4767 0.3736 -0.0030 -0.0069 0.0013  170 GLU C N   
2722 C CA  . GLU C 124 ? 0.3434 0.4763 0.3784 -0.0036 -0.0130 -0.0014 170 GLU C CA  
2723 C C   . GLU C 124 ? 0.3656 0.4866 0.3922 -0.0145 -0.0257 0.0007  170 GLU C C   
2724 O O   . GLU C 124 ? 0.3905 0.4828 0.3920 -0.0169 -0.0299 -0.0011 170 GLU C O   
2725 C CB  . GLU C 124 ? 0.3523 0.4787 0.3808 0.0068  -0.0128 -0.0044 170 GLU C CB  
2726 C CG  . GLU C 124 ? 0.3959 0.5016 0.4016 0.0101  -0.0140 -0.0060 170 GLU C CG  
2727 C CD  . GLU C 124 ? 0.4447 0.5531 0.4472 0.0176  -0.0092 -0.0053 170 GLU C CD  
2728 O OE1 . GLU C 124 ? 0.4673 0.5807 0.4756 0.0183  -0.0112 -0.0041 170 GLU C OE1 
2729 O OE2 . GLU C 124 ? 0.4970 0.6032 0.4910 0.0222  -0.0045 -0.0043 170 GLU C OE2 
2730 N N   . LYS C 125 ? 0.3670 0.5075 0.4117 -0.0200 -0.0335 0.0047  171 LYS C N   
2731 C CA  . LYS C 125 ? 0.3976 0.5266 0.4336 -0.0350 -0.0500 0.0082  171 LYS C CA  
2732 C C   . LYS C 125 ? 0.4112 0.5306 0.4400 -0.0530 -0.0538 0.0133  171 LYS C C   
2733 O O   . LYS C 125 ? 0.4333 0.5144 0.4310 -0.0627 -0.0665 0.0122  171 LYS C O   
2734 C CB  . LYS C 125 ? 0.4044 0.5662 0.4687 -0.0387 -0.0593 0.0146  171 LYS C CB  
2735 C CG  . LYS C 125 ? 0.4332 0.5875 0.4909 -0.0253 -0.0636 0.0107  171 LYS C CG  
2736 C CD  . LYS C 125 ? 0.4553 0.6428 0.5420 -0.0261 -0.0745 0.0181  171 LYS C CD  
2737 C CE  . LYS C 125 ? 0.4736 0.6482 0.5490 -0.0129 -0.0799 0.0154  171 LYS C CE  
2738 N NZ  . LYS C 125 ? 0.5142 0.6484 0.5499 -0.0191 -0.0913 0.0117  171 LYS C NZ  
2739 N N   . ILE C 126 ? 0.3970 0.5465 0.4490 -0.0571 -0.0430 0.0190  172 ILE C N   
2740 C CA  . ILE C 126 ? 0.4243 0.5649 0.4678 -0.0759 -0.0449 0.0260  172 ILE C CA  
2741 C C   . ILE C 126 ? 0.4431 0.5352 0.4479 -0.0695 -0.0435 0.0192  172 ILE C C   
2742 O O   . ILE C 126 ? 0.4686 0.5226 0.4445 -0.0827 -0.0554 0.0213  172 ILE C O   
2743 C CB  . ILE C 126 ? 0.4098 0.5952 0.4828 -0.0783 -0.0293 0.0337  172 ILE C CB  
2744 C CG1 . ILE C 126 ? 0.4144 0.6553 0.5290 -0.0822 -0.0300 0.0429  172 ILE C CG1 
2745 C CG2 . ILE C 126 ? 0.4399 0.6113 0.4981 -0.0991 -0.0305 0.0423  172 ILE C CG2 
2746 C CD1 . ILE C 126 ? 0.4115 0.7005 0.5537 -0.0743 -0.0095 0.0484  172 ILE C CD1 
2747 N N   . PHE C 127 ? 0.4275 0.5201 0.4309 -0.0492 -0.0306 0.0121  173 PHE C N   
2748 C CA  . PHE C 127 ? 0.4502 0.5075 0.4240 -0.0383 -0.0288 0.0069  173 PHE C CA  
2749 C C   . PHE C 127 ? 0.4846 0.4995 0.4246 -0.0348 -0.0409 0.0021  173 PHE C C   
2750 O O   . PHE C 127 ? 0.5154 0.4903 0.4236 -0.0362 -0.0475 0.0018  173 PHE C O   
2751 C CB  . PHE C 127 ? 0.4246 0.4971 0.4075 -0.0196 -0.0167 0.0020  173 PHE C CB  
2752 C CG  . PHE C 127 ? 0.4607 0.5093 0.4210 -0.0052 -0.0157 -0.0016 173 PHE C CG  
2753 C CD1 . PHE C 127 ? 0.4870 0.5209 0.4342 -0.0038 -0.0145 0.0007  173 PHE C CD1 
2754 C CD2 . PHE C 127 ? 0.4802 0.5250 0.4333 0.0084  -0.0153 -0.0058 173 PHE C CD2 
2755 C CE1 . PHE C 127 ? 0.5005 0.5192 0.4313 0.0132  -0.0138 -0.0011 173 PHE C CE1 
2756 C CE2 . PHE C 127 ? 0.5091 0.5427 0.4465 0.0246  -0.0120 -0.0070 173 PHE C CE2 
2757 C CZ  . PHE C 127 ? 0.5007 0.5230 0.4290 0.0282  -0.0116 -0.0047 173 PHE C CZ  
2758 N N   . LEU C 128 ? 0.4875 0.5063 0.4289 -0.0288 -0.0443 -0.0018 174 LEU C N   
2759 C CA  . LEU C 128 ? 0.5346 0.5112 0.4374 -0.0227 -0.0543 -0.0075 174 LEU C CA  
2760 C C   . LEU C 128 ? 0.5803 0.5198 0.4567 -0.0433 -0.0735 -0.0047 174 LEU C C   
2761 O O   . LEU C 128 ? 0.6238 0.5095 0.4537 -0.0377 -0.0817 -0.0099 174 LEU C O   
2762 C CB  . LEU C 128 ? 0.5295 0.5189 0.4374 -0.0152 -0.0546 -0.0105 174 LEU C CB  
2763 C CG  . LEU C 128 ? 0.5201 0.5303 0.4382 0.0043  -0.0391 -0.0129 174 LEU C CG  
2764 C CD1 . LEU C 128 ? 0.5141 0.5350 0.4362 0.0064  -0.0418 -0.0132 174 LEU C CD1 
2765 C CD2 . LEU C 128 ? 0.5562 0.5416 0.4443 0.0229  -0.0326 -0.0171 174 LEU C CD2 
2766 N N   . GLN C 129 ? 0.5745 0.5422 0.4789 -0.0668 -0.0814 0.0043  175 GLN C N   
2767 C CA  . GLN C 129 ? 0.6213 0.5603 0.5057 -0.0940 -0.1028 0.0108  175 GLN C CA  
2768 C C   . GLN C 129 ? 0.6538 0.5518 0.5079 -0.1009 -0.1054 0.0130  175 GLN C C   
2769 O O   . GLN C 129 ? 0.7073 0.5425 0.5117 -0.1087 -0.1230 0.0109  175 GLN C O   
2770 C CB  . GLN C 129 ? 0.6076 0.6027 0.5398 -0.1177 -0.1077 0.0241  175 GLN C CB  
2771 C CG  . GLN C 129 ? 0.6752 0.6516 0.5937 -0.1484 -0.1350 0.0326  175 GLN C CG  
2772 C CD  . GLN C 129 ? 0.7158 0.6696 0.6126 -0.1426 -0.1497 0.0255  175 GLN C CD  
2773 O OE1 . GLN C 129 ? 0.7122 0.6754 0.6127 -0.1164 -0.1373 0.0163  175 GLN C OE1 
2774 N NE2 . GLN C 129 ? 0.7722 0.6935 0.6428 -0.1695 -0.1779 0.0310  175 GLN C NE2 
2775 N N   . LYS C 130 ? 0.6265 0.5533 0.5044 -0.0967 -0.0891 0.0168  176 LYS C N   
2776 C CA  . LYS C 130 ? 0.6644 0.5544 0.5145 -0.1026 -0.0912 0.0205  176 LYS C CA  
2777 C C   . LYS C 130 ? 0.6909 0.5270 0.4960 -0.0742 -0.0902 0.0092  176 LYS C C   
2778 O O   . LYS C 130 ? 0.7426 0.5183 0.5017 -0.0780 -0.1029 0.0095  176 LYS C O   
2779 C CB  . LYS C 130 ? 0.6351 0.5717 0.5201 -0.1057 -0.0741 0.0282  176 LYS C CB  
2780 C CG  . LYS C 130 ? 0.6337 0.6259 0.5607 -0.1310 -0.0725 0.0414  176 LYS C CG  
2781 C CD  . LYS C 130 ? 0.7132 0.6830 0.6233 -0.1672 -0.0902 0.0557  176 LYS C CD  
2782 C CE  . LYS C 130 ? 0.7127 0.7485 0.6707 -0.1927 -0.0906 0.0712  176 LYS C CE  
2783 N NZ  . LYS C 130 ? 0.6829 0.7861 0.6848 -0.1814 -0.0647 0.0750  176 LYS C NZ  
2784 N N   . VAL C 131 ? 0.6556 0.5133 0.4726 -0.0456 -0.0757 0.0004  177 VAL C N   
2785 C CA  . VAL C 131 ? 0.6874 0.5077 0.4686 -0.0150 -0.0722 -0.0086 177 VAL C CA  
2786 C C   . VAL C 131 ? 0.7556 0.5090 0.4799 -0.0115 -0.0886 -0.0157 177 VAL C C   
2787 O O   . VAL C 131 ? 0.8095 0.5098 0.4881 0.0081  -0.0918 -0.0209 177 VAL C O   
2788 C CB  . VAL C 131 ? 0.6438 0.5081 0.4520 0.0097  -0.0546 -0.0135 177 VAL C CB  
2789 C CG1 . VAL C 131 ? 0.6818 0.5150 0.4535 0.0413  -0.0509 -0.0214 177 VAL C CG1 
2790 C CG2 . VAL C 131 ? 0.6041 0.5127 0.4492 0.0121  -0.0413 -0.0084 177 VAL C CG2 
2791 N N   . ALA C 132 ? 0.7647 0.5180 0.4887 -0.0289 -0.1000 -0.0159 178 ALA C N   
2792 C CA  . ALA C 132 ? 0.8407 0.5253 0.5048 -0.0300 -0.1191 -0.0228 178 ALA C CA  
2793 C C   . ALA C 132 ? 0.9212 0.5335 0.5346 -0.0473 -0.1401 -0.0198 178 ALA C C   
2794 O O   . ALA C 132 ? 0.9882 0.5236 0.5345 -0.0349 -0.1529 -0.0288 178 ALA C O   
2795 C CB  . ALA C 132 ? 0.8293 0.5333 0.5081 -0.0520 -0.1313 -0.0203 178 ALA C CB  
2796 N N   . SER C 133 ? 0.9194 0.5524 0.5600 -0.0753 -0.1436 -0.0068 179 SER C N   
2797 C CA  . SER C 133 ? 1.0053 0.5711 0.5995 -0.0983 -0.1647 -0.0001 179 SER C CA  
2798 C C   . SER C 133 ? 1.0338 0.5755 0.6108 -0.0782 -0.1558 0.0000  179 SER C C   
2799 O O   . SER C 133 ? 1.0855 0.5796 0.6313 -0.0991 -0.1709 0.0087  179 SER C O   
2800 C CB  . SER C 133 ? 0.9909 0.5943 0.6218 -0.1465 -0.1760 0.0180  179 SER C CB  
2801 O OG  . SER C 133 ? 0.9793 0.6092 0.6295 -0.1646 -0.1868 0.0198  179 SER C OG  
2802 N N   . MET C 134 ? 1.0051 0.5792 0.6016 -0.0395 -0.1333 -0.0078 180 MET C N   
2803 C CA  . MET C 134 ? 1.0282 0.5868 0.6127 -0.0163 -0.1255 -0.0071 180 MET C CA  
2804 C C   . MET C 134 ? 1.1361 0.5973 0.6415 0.0067  -0.1402 -0.0154 180 MET C C   
2805 O O   . MET C 134 ? 1.1754 0.5974 0.6417 0.0230  -0.1454 -0.0269 180 MET C O   
2806 C CB  . MET C 134 ? 0.9620 0.5864 0.5908 0.0167  -0.1004 -0.0117 180 MET C CB  
2807 C CG  . MET C 134 ? 0.9686 0.5955 0.5988 0.0386  -0.0926 -0.0084 180 MET C CG  
2808 S SD  . MET C 134 ? 0.8957 0.6101 0.5861 0.0647  -0.0675 -0.0094 180 MET C SD  
2809 C CE  . MET C 134 ? 0.8982 0.6030 0.5668 0.0988  -0.0608 -0.0216 180 MET C CE  
2810 N N   . PRO C 135 ? 1.1934 0.6104 0.6692 0.0100  -0.1474 -0.0099 181 PRO C N   
2811 C CA  . PRO C 135 ? 1.3023 0.6218 0.6988 0.0397  -0.1607 -0.0185 181 PRO C CA  
2812 C C   . PRO C 135 ? 1.3067 0.6407 0.7004 0.0979  -0.1414 -0.0308 181 PRO C C   
2813 O O   . PRO C 135 ? 1.2277 0.6489 0.6844 0.1114  -0.1189 -0.0294 181 PRO C O   
2814 C CB  . PRO C 135 ? 1.3361 0.6204 0.7141 0.0293  -0.1707 -0.0067 181 PRO C CB  
2815 C CG  . PRO C 135 ? 1.2705 0.6186 0.7049 -0.0181 -0.1679 0.0089  181 PRO C CG  
2816 C CD  . PRO C 135 ? 1.1688 0.6135 0.6737 -0.0153 -0.1462 0.0051  181 PRO C CD  
2817 N N   . GLN C 136 ? 1.4073 0.6561 0.7265 0.1319  -0.1504 -0.0419 182 GLN C N   
2818 C CA  . GLN C 136 ? 1.4186 0.6818 0.7315 0.1916  -0.1307 -0.0517 182 GLN C CA  
2819 C C   . GLN C 136 ? 1.3930 0.6952 0.7385 0.2168  -0.1199 -0.0431 182 GLN C C   
2820 O O   . GLN C 136 ? 1.4637 0.6991 0.7628 0.2297  -0.1338 -0.0407 182 GLN C O   
2821 C CB  . GLN C 136 ? 1.5432 0.6971 0.7593 0.2260  -0.1431 -0.0661 182 GLN C CB  
2822 C CG  . GLN C 136 ? 1.5778 0.7032 0.7598 0.2177  -0.1478 -0.0777 182 GLN C CG  
2823 C CD  . GLN C 136 ? 1.7127 0.7203 0.7877 0.2551  -0.1602 -0.0937 182 GLN C CD  
2824 O OE1 . GLN C 136 ? 1.7665 0.7536 0.8123 0.3114  -0.1481 -0.0999 182 GLN C OE1 
2825 N NE2 . GLN C 136 ? 1.7795 0.7082 0.7933 0.2252  -0.1853 -0.1001 182 GLN C NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   47  ?   ?   ?   A . n 
A 1 2   SER 2   48  ?   ?   ?   A . n 
A 1 3   SER 3   49  ?   ?   ?   A . n 
A 1 4   HIS 4   50  ?   ?   ?   A . n 
A 1 5   HIS 5   51  ?   ?   ?   A . n 
A 1 6   HIS 6   52  ?   ?   ?   A . n 
A 1 7   HIS 7   53  ?   ?   ?   A . n 
A 1 8   HIS 8   54  ?   ?   ?   A . n 
A 1 9   HIS 9   55  ?   ?   ?   A . n 
A 1 10  SER 10  56  ?   ?   ?   A . n 
A 1 11  SER 11  57  ?   ?   ?   A . n 
A 1 12  GLY 12  58  ?   ?   ?   A . n 
A 1 13  LEU 13  59  ?   ?   ?   A . n 
A 1 14  VAL 14  60  ?   ?   ?   A . n 
A 1 15  PRO 15  61  ?   ?   ?   A . n 
A 1 16  ARG 16  62  ?   ?   ?   A . n 
A 1 17  GLY 17  63  ?   ?   ?   A . n 
A 1 18  SER 18  64  ?   ?   ?   A . n 
A 1 19  HIS 19  65  ?   ?   ?   A . n 
A 1 20  MET 20  66  ?   ?   ?   A . n 
A 1 21  SER 21  67  ?   ?   ?   A . n 
A 1 22  ASN 22  68  ?   ?   ?   A . n 
A 1 23  PRO 23  69  ?   ?   ?   A . n 
A 1 24  LYS 24  70  ?   ?   ?   A . n 
A 1 25  LYS 25  71  ?   ?   ?   A . n 
A 1 26  PRO 26  72  ?   ?   ?   A . n 
A 1 27  GLY 27  73  ?   ?   ?   A . n 
A 1 28  ARG 28  74  ?   ?   ?   A . n 
A 1 29  VAL 29  75  75  VAL VAL A . n 
A 1 30  THR 30  76  76  THR THR A . n 
A 1 31  ASN 31  77  77  ASN ASN A . n 
A 1 32  GLN 32  78  78  GLN GLN A . n 
A 1 33  LEU 33  79  79  LEU LEU A . n 
A 1 34  GLN 34  80  80  GLN GLN A . n 
A 1 35  TYR 35  81  81  TYR TYR A . n 
A 1 36  LEU 36  82  82  LEU LEU A . n 
A 1 37  HIS 37  83  83  HIS HIS A . n 
A 1 38  LYS 38  84  84  LYS LYS A . n 
A 1 39  VAL 39  85  85  VAL VAL A . n 
A 1 40  VAL 40  86  86  VAL VAL A . n 
A 1 41  MET 41  87  87  MET MET A . n 
A 1 42  LYS 42  88  88  LYS LYS A . n 
A 1 43  ALA 43  89  89  ALA ALA A . n 
A 1 44  LEU 44  90  90  LEU LEU A . n 
A 1 45  TRP 45  91  91  TRP TRP A . n 
A 1 46  LYS 46  92  92  LYS LYS A . n 
A 1 47  HIS 47  93  93  HIS HIS A . n 
A 1 48  GLN 48  94  94  GLN GLN A . n 
A 1 49  PHE 49  95  95  PHE PHE A . n 
A 1 50  ALA 50  96  96  ALA ALA A . n 
A 1 51  TRP 51  97  97  TRP TRP A . n 
A 1 52  PRO 52  98  98  PRO PRO A . n 
A 1 53  PHE 53  99  99  PHE PHE A . n 
A 1 54  ARG 54  100 100 ARG ARG A . n 
A 1 55  GLN 55  101 101 GLN GLN A . n 
A 1 56  PRO 56  102 102 PRO PRO A . n 
A 1 57  VAL 57  103 103 VAL VAL A . n 
A 1 58  ASP 58  104 104 ASP ASP A . n 
A 1 59  ALA 59  105 105 ALA ALA A . n 
A 1 60  VAL 60  106 106 VAL VAL A . n 
A 1 61  LYS 61  107 107 LYS LYS A . n 
A 1 62  LEU 62  108 108 LEU LEU A . n 
A 1 63  GLY 63  109 109 GLY GLY A . n 
A 1 64  LEU 64  110 110 LEU LEU A . n 
A 1 65  PRO 65  111 111 PRO PRO A . n 
A 1 66  ASP 66  112 112 ASP ASP A . n 
A 1 67  TYR 67  113 113 TYR TYR A . n 
A 1 68  HIS 68  114 114 HIS HIS A . n 
A 1 69  LYS 69  115 115 LYS LYS A . n 
A 1 70  ILE 70  116 116 ILE ILE A . n 
A 1 71  ILE 71  117 117 ILE ILE A . n 
A 1 72  LYS 72  118 118 LYS LYS A . n 
A 1 73  GLN 73  119 119 GLN GLN A . n 
A 1 74  PRO 74  120 120 PRO PRO A . n 
A 1 75  MET 75  121 121 MET MET A . n 
A 1 76  ASP 76  122 122 ASP ASP A . n 
A 1 77  MET 77  123 123 MET MET A . n 
A 1 78  GLY 78  124 124 GLY GLY A . n 
A 1 79  THR 79  125 125 THR THR A . n 
A 1 80  ILE 80  126 126 ILE ILE A . n 
A 1 81  LYS 81  127 127 LYS LYS A . n 
A 1 82  ARG 82  128 128 ARG ARG A . n 
A 1 83  ARG 83  129 129 ARG ARG A . n 
A 1 84  LEU 84  130 130 LEU LEU A . n 
A 1 85  GLU 85  131 131 GLU GLU A . n 
A 1 86  ASN 86  132 132 ASN ASN A . n 
A 1 87  ASN 87  133 133 ASN ASN A . n 
A 1 88  TYR 88  134 134 TYR TYR A . n 
A 1 89  TYR 89  135 135 TYR TYR A . n 
A 1 90  TRP 90  136 136 TRP TRP A . n 
A 1 91  ALA 91  137 137 ALA ALA A . n 
A 1 92  ALA 92  138 138 ALA ALA A . n 
A 1 93  SER 93  139 139 SER SER A . n 
A 1 94  GLU 94  140 140 GLU GLU A . n 
A 1 95  CYS 95  141 141 CYS CYS A . n 
A 1 96  MET 96  142 142 MET MET A . n 
A 1 97  GLN 97  143 143 GLN GLN A . n 
A 1 98  ASP 98  144 144 ASP ASP A . n 
A 1 99  PHE 99  145 145 PHE PHE A . n 
A 1 100 ASN 100 146 146 ASN ASN A . n 
A 1 101 THR 101 147 147 THR THR A . n 
A 1 102 MET 102 148 148 MET MET A . n 
A 1 103 PHE 103 149 149 PHE PHE A . n 
A 1 104 THR 104 150 150 THR THR A . n 
A 1 105 ASN 105 151 151 ASN ASN A . n 
A 1 106 CYS 106 152 152 CYS CYS A . n 
A 1 107 TYR 107 153 153 TYR TYR A . n 
A 1 108 ILE 108 154 154 ILE ILE A . n 
A 1 109 TYR 109 155 155 TYR TYR A . n 
A 1 110 ASN 110 156 156 ASN ASN A . n 
A 1 111 LYS 111 157 157 LYS LYS A . n 
A 1 112 PRO 112 158 158 PRO PRO A . n 
A 1 113 THR 113 159 159 THR THR A . n 
A 1 114 ASP 114 160 160 ASP ASP A . n 
A 1 115 ASP 115 161 161 ASP ASP A . n 
A 1 116 ILE 116 162 162 ILE ILE A . n 
A 1 117 VAL 117 163 163 VAL VAL A . n 
A 1 118 LEU 118 164 164 LEU LEU A . n 
A 1 119 MET 119 165 165 MET MET A . n 
A 1 120 ALA 120 166 166 ALA ALA A . n 
A 1 121 GLN 121 167 167 GLN GLN A . n 
A 1 122 THR 122 168 168 THR THR A . n 
A 1 123 LEU 123 169 169 LEU LEU A . n 
A 1 124 GLU 124 170 170 GLU GLU A . n 
A 1 125 LYS 125 171 171 LYS LYS A . n 
A 1 126 ILE 126 172 172 ILE ILE A . n 
A 1 127 PHE 127 173 173 PHE PHE A . n 
A 1 128 LEU 128 174 174 LEU LEU A . n 
A 1 129 GLN 129 175 175 GLN GLN A . n 
A 1 130 LYS 130 176 176 LYS LYS A . n 
A 1 131 VAL 131 177 177 VAL VAL A . n 
A 1 132 ALA 132 178 178 ALA ALA A . n 
A 1 133 SER 133 179 179 SER SER A . n 
A 1 134 MET 134 180 180 MET MET A . n 
A 1 135 PRO 135 181 181 PRO PRO A . n 
A 1 136 GLN 136 182 182 GLN GLN A . n 
A 1 137 GLU 137 183 183 GLU GLU A . n 
A 1 138 GLU 138 184 184 GLU GLU A . n 
A 1 139 GLN 139 185 185 GLN GLN A . n 
A 1 140 GLU 140 186 186 GLU GLU A . n 
A 1 141 LEU 141 187 ?   ?   ?   A . n 
A 1 142 VAL 142 188 ?   ?   ?   A . n 
A 1 143 VAL 143 189 ?   ?   ?   A . n 
A 1 144 THR 144 190 ?   ?   ?   A . n 
A 1 145 ILE 145 191 ?   ?   ?   A . n 
A 1 146 PRO 146 192 ?   ?   ?   A . n 
A 1 147 LYS 147 193 ?   ?   ?   A . n 
A 1 148 ASN 148 194 ?   ?   ?   A . n 
A 1 149 SER 149 195 ?   ?   ?   A . n 
A 1 150 HIS 150 196 ?   ?   ?   A . n 
A 1 151 LYS 151 197 ?   ?   ?   A . n 
A 1 152 LYS 152 198 ?   ?   ?   A . n 
A 1 153 GLY 153 199 ?   ?   ?   A . n 
A 1 154 ALA 154 200 ?   ?   ?   A . n 
B 1 1   GLY 1   47  ?   ?   ?   B . n 
B 1 2   SER 2   48  ?   ?   ?   B . n 
B 1 3   SER 3   49  ?   ?   ?   B . n 
B 1 4   HIS 4   50  ?   ?   ?   B . n 
B 1 5   HIS 5   51  ?   ?   ?   B . n 
B 1 6   HIS 6   52  ?   ?   ?   B . n 
B 1 7   HIS 7   53  ?   ?   ?   B . n 
B 1 8   HIS 8   54  ?   ?   ?   B . n 
B 1 9   HIS 9   55  ?   ?   ?   B . n 
B 1 10  SER 10  56  ?   ?   ?   B . n 
B 1 11  SER 11  57  ?   ?   ?   B . n 
B 1 12  GLY 12  58  ?   ?   ?   B . n 
B 1 13  LEU 13  59  ?   ?   ?   B . n 
B 1 14  VAL 14  60  ?   ?   ?   B . n 
B 1 15  PRO 15  61  ?   ?   ?   B . n 
B 1 16  ARG 16  62  ?   ?   ?   B . n 
B 1 17  GLY 17  63  ?   ?   ?   B . n 
B 1 18  SER 18  64  ?   ?   ?   B . n 
B 1 19  HIS 19  65  ?   ?   ?   B . n 
B 1 20  MET 20  66  ?   ?   ?   B . n 
B 1 21  SER 21  67  ?   ?   ?   B . n 
B 1 22  ASN 22  68  ?   ?   ?   B . n 
B 1 23  PRO 23  69  ?   ?   ?   B . n 
B 1 24  LYS 24  70  ?   ?   ?   B . n 
B 1 25  LYS 25  71  ?   ?   ?   B . n 
B 1 26  PRO 26  72  72  PRO PRO B . n 
B 1 27  GLY 27  73  73  GLY GLY B . n 
B 1 28  ARG 28  74  74  ARG ARG B . n 
B 1 29  VAL 29  75  75  VAL VAL B . n 
B 1 30  THR 30  76  76  THR THR B . n 
B 1 31  ASN 31  77  77  ASN ASN B . n 
B 1 32  GLN 32  78  78  GLN GLN B . n 
B 1 33  LEU 33  79  79  LEU LEU B . n 
B 1 34  GLN 34  80  80  GLN GLN B . n 
B 1 35  TYR 35  81  81  TYR TYR B . n 
B 1 36  LEU 36  82  82  LEU LEU B . n 
B 1 37  HIS 37  83  83  HIS HIS B . n 
B 1 38  LYS 38  84  84  LYS LYS B . n 
B 1 39  VAL 39  85  85  VAL VAL B . n 
B 1 40  VAL 40  86  86  VAL VAL B . n 
B 1 41  MET 41  87  87  MET MET B . n 
B 1 42  LYS 42  88  88  LYS LYS B . n 
B 1 43  ALA 43  89  89  ALA ALA B . n 
B 1 44  LEU 44  90  90  LEU LEU B . n 
B 1 45  TRP 45  91  91  TRP TRP B . n 
B 1 46  LYS 46  92  92  LYS LYS B . n 
B 1 47  HIS 47  93  93  HIS HIS B . n 
B 1 48  GLN 48  94  94  GLN GLN B . n 
B 1 49  PHE 49  95  95  PHE PHE B . n 
B 1 50  ALA 50  96  96  ALA ALA B . n 
B 1 51  TRP 51  97  97  TRP TRP B . n 
B 1 52  PRO 52  98  98  PRO PRO B . n 
B 1 53  PHE 53  99  99  PHE PHE B . n 
B 1 54  ARG 54  100 100 ARG ARG B . n 
B 1 55  GLN 55  101 101 GLN GLN B . n 
B 1 56  PRO 56  102 102 PRO PRO B . n 
B 1 57  VAL 57  103 103 VAL VAL B . n 
B 1 58  ASP 58  104 104 ASP ASP B . n 
B 1 59  ALA 59  105 105 ALA ALA B . n 
B 1 60  VAL 60  106 106 VAL VAL B . n 
B 1 61  LYS 61  107 107 LYS LYS B . n 
B 1 62  LEU 62  108 108 LEU LEU B . n 
B 1 63  GLY 63  109 109 GLY GLY B . n 
B 1 64  LEU 64  110 110 LEU LEU B . n 
B 1 65  PRO 65  111 111 PRO PRO B . n 
B 1 66  ASP 66  112 112 ASP ASP B . n 
B 1 67  TYR 67  113 113 TYR TYR B . n 
B 1 68  HIS 68  114 114 HIS HIS B . n 
B 1 69  LYS 69  115 115 LYS LYS B . n 
B 1 70  ILE 70  116 116 ILE ILE B . n 
B 1 71  ILE 71  117 117 ILE ILE B . n 
B 1 72  LYS 72  118 118 LYS LYS B . n 
B 1 73  GLN 73  119 119 GLN GLN B . n 
B 1 74  PRO 74  120 120 PRO PRO B . n 
B 1 75  MET 75  121 121 MET MET B . n 
B 1 76  ASP 76  122 122 ASP ASP B . n 
B 1 77  MET 77  123 123 MET MET B . n 
B 1 78  GLY 78  124 124 GLY GLY B . n 
B 1 79  THR 79  125 125 THR THR B . n 
B 1 80  ILE 80  126 126 ILE ILE B . n 
B 1 81  LYS 81  127 127 LYS LYS B . n 
B 1 82  ARG 82  128 128 ARG ARG B . n 
B 1 83  ARG 83  129 129 ARG ARG B . n 
B 1 84  LEU 84  130 130 LEU LEU B . n 
B 1 85  GLU 85  131 131 GLU GLU B . n 
B 1 86  ASN 86  132 132 ASN ASN B . n 
B 1 87  ASN 87  133 133 ASN ASN B . n 
B 1 88  TYR 88  134 134 TYR TYR B . n 
B 1 89  TYR 89  135 135 TYR TYR B . n 
B 1 90  TRP 90  136 136 TRP TRP B . n 
B 1 91  ALA 91  137 137 ALA ALA B . n 
B 1 92  ALA 92  138 138 ALA ALA B . n 
B 1 93  SER 93  139 139 SER SER B . n 
B 1 94  GLU 94  140 140 GLU GLU B . n 
B 1 95  CYS 95  141 141 CYS CYS B . n 
B 1 96  MET 96  142 142 MET MET B . n 
B 1 97  GLN 97  143 143 GLN GLN B . n 
B 1 98  ASP 98  144 144 ASP ASP B . n 
B 1 99  PHE 99  145 145 PHE PHE B . n 
B 1 100 ASN 100 146 146 ASN ASN B . n 
B 1 101 THR 101 147 147 THR THR B . n 
B 1 102 MET 102 148 148 MET MET B . n 
B 1 103 PHE 103 149 149 PHE PHE B . n 
B 1 104 THR 104 150 150 THR THR B . n 
B 1 105 ASN 105 151 151 ASN ASN B . n 
B 1 106 CYS 106 152 152 CYS CYS B . n 
B 1 107 TYR 107 153 153 TYR TYR B . n 
B 1 108 ILE 108 154 154 ILE ILE B . n 
B 1 109 TYR 109 155 155 TYR TYR B . n 
B 1 110 ASN 110 156 156 ASN ASN B . n 
B 1 111 LYS 111 157 157 LYS LYS B . n 
B 1 112 PRO 112 158 158 PRO PRO B . n 
B 1 113 THR 113 159 159 THR THR B . n 
B 1 114 ASP 114 160 160 ASP ASP B . n 
B 1 115 ASP 115 161 161 ASP ASP B . n 
B 1 116 ILE 116 162 162 ILE ILE B . n 
B 1 117 VAL 117 163 163 VAL VAL B . n 
B 1 118 LEU 118 164 164 LEU LEU B . n 
B 1 119 MET 119 165 165 MET MET B . n 
B 1 120 ALA 120 166 166 ALA ALA B . n 
B 1 121 GLN 121 167 167 GLN GLN B . n 
B 1 122 THR 122 168 168 THR THR B . n 
B 1 123 LEU 123 169 169 LEU LEU B . n 
B 1 124 GLU 124 170 170 GLU GLU B . n 
B 1 125 LYS 125 171 171 LYS LYS B . n 
B 1 126 ILE 126 172 172 ILE ILE B . n 
B 1 127 PHE 127 173 173 PHE PHE B . n 
B 1 128 LEU 128 174 174 LEU LEU B . n 
B 1 129 GLN 129 175 175 GLN GLN B . n 
B 1 130 LYS 130 176 176 LYS LYS B . n 
B 1 131 VAL 131 177 177 VAL VAL B . n 
B 1 132 ALA 132 178 178 ALA ALA B . n 
B 1 133 SER 133 179 179 SER SER B . n 
B 1 134 MET 134 180 180 MET MET B . n 
B 1 135 PRO 135 181 181 PRO PRO B . n 
B 1 136 GLN 136 182 182 GLN GLN B . n 
B 1 137 GLU 137 183 183 GLU GLU B . n 
B 1 138 GLU 138 184 184 GLU GLU B . n 
B 1 139 GLN 139 185 185 GLN GLN B . n 
B 1 140 GLU 140 186 186 GLU GLU B . n 
B 1 141 LEU 141 187 ?   ?   ?   B . n 
B 1 142 VAL 142 188 ?   ?   ?   B . n 
B 1 143 VAL 143 189 ?   ?   ?   B . n 
B 1 144 THR 144 190 ?   ?   ?   B . n 
B 1 145 ILE 145 191 ?   ?   ?   B . n 
B 1 146 PRO 146 192 ?   ?   ?   B . n 
B 1 147 LYS 147 193 ?   ?   ?   B . n 
B 1 148 ASN 148 194 ?   ?   ?   B . n 
B 1 149 SER 149 195 ?   ?   ?   B . n 
B 1 150 HIS 150 196 ?   ?   ?   B . n 
B 1 151 LYS 151 197 ?   ?   ?   B . n 
B 1 152 LYS 152 198 ?   ?   ?   B . n 
B 1 153 GLY 153 199 ?   ?   ?   B . n 
B 1 154 ALA 154 200 ?   ?   ?   B . n 
C 1 1   GLY 1   47  ?   ?   ?   C . n 
C 1 2   SER 2   48  ?   ?   ?   C . n 
C 1 3   SER 3   49  ?   ?   ?   C . n 
C 1 4   HIS 4   50  ?   ?   ?   C . n 
C 1 5   HIS 5   51  ?   ?   ?   C . n 
C 1 6   HIS 6   52  ?   ?   ?   C . n 
C 1 7   HIS 7   53  ?   ?   ?   C . n 
C 1 8   HIS 8   54  ?   ?   ?   C . n 
C 1 9   HIS 9   55  ?   ?   ?   C . n 
C 1 10  SER 10  56  ?   ?   ?   C . n 
C 1 11  SER 11  57  ?   ?   ?   C . n 
C 1 12  GLY 12  58  ?   ?   ?   C . n 
C 1 13  LEU 13  59  ?   ?   ?   C . n 
C 1 14  VAL 14  60  ?   ?   ?   C . n 
C 1 15  PRO 15  61  ?   ?   ?   C . n 
C 1 16  ARG 16  62  ?   ?   ?   C . n 
C 1 17  GLY 17  63  ?   ?   ?   C . n 
C 1 18  SER 18  64  ?   ?   ?   C . n 
C 1 19  HIS 19  65  ?   ?   ?   C . n 
C 1 20  MET 20  66  ?   ?   ?   C . n 
C 1 21  SER 21  67  ?   ?   ?   C . n 
C 1 22  ASN 22  68  ?   ?   ?   C . n 
C 1 23  PRO 23  69  ?   ?   ?   C . n 
C 1 24  LYS 24  70  ?   ?   ?   C . n 
C 1 25  LYS 25  71  ?   ?   ?   C . n 
C 1 26  PRO 26  72  ?   ?   ?   C . n 
C 1 27  GLY 27  73  ?   ?   ?   C . n 
C 1 28  ARG 28  74  ?   ?   ?   C . n 
C 1 29  VAL 29  75  ?   ?   ?   C . n 
C 1 30  THR 30  76  ?   ?   ?   C . n 
C 1 31  ASN 31  77  77  ASN ASN C . n 
C 1 32  GLN 32  78  78  GLN GLN C . n 
C 1 33  LEU 33  79  79  LEU LEU C . n 
C 1 34  GLN 34  80  80  GLN GLN C . n 
C 1 35  TYR 35  81  81  TYR TYR C . n 
C 1 36  LEU 36  82  82  LEU LEU C . n 
C 1 37  HIS 37  83  83  HIS HIS C . n 
C 1 38  LYS 38  84  84  LYS LYS C . n 
C 1 39  VAL 39  85  85  VAL VAL C . n 
C 1 40  VAL 40  86  86  VAL VAL C . n 
C 1 41  MET 41  87  87  MET MET C . n 
C 1 42  LYS 42  88  88  LYS LYS C . n 
C 1 43  ALA 43  89  89  ALA ALA C . n 
C 1 44  LEU 44  90  90  LEU LEU C . n 
C 1 45  TRP 45  91  91  TRP TRP C . n 
C 1 46  LYS 46  92  92  LYS LYS C . n 
C 1 47  HIS 47  93  93  HIS HIS C . n 
C 1 48  GLN 48  94  94  GLN GLN C . n 
C 1 49  PHE 49  95  95  PHE PHE C . n 
C 1 50  ALA 50  96  96  ALA ALA C . n 
C 1 51  TRP 51  97  97  TRP TRP C . n 
C 1 52  PRO 52  98  98  PRO PRO C . n 
C 1 53  PHE 53  99  99  PHE PHE C . n 
C 1 54  ARG 54  100 100 ARG ARG C . n 
C 1 55  GLN 55  101 101 GLN GLN C . n 
C 1 56  PRO 56  102 102 PRO PRO C . n 
C 1 57  VAL 57  103 103 VAL VAL C . n 
C 1 58  ASP 58  104 104 ASP ASP C . n 
C 1 59  ALA 59  105 105 ALA ALA C . n 
C 1 60  VAL 60  106 106 VAL VAL C . n 
C 1 61  LYS 61  107 107 LYS LYS C . n 
C 1 62  LEU 62  108 108 LEU LEU C . n 
C 1 63  GLY 63  109 109 GLY GLY C . n 
C 1 64  LEU 64  110 110 LEU LEU C . n 
C 1 65  PRO 65  111 111 PRO PRO C . n 
C 1 66  ASP 66  112 112 ASP ASP C . n 
C 1 67  TYR 67  113 113 TYR TYR C . n 
C 1 68  HIS 68  114 114 HIS HIS C . n 
C 1 69  LYS 69  115 115 LYS LYS C . n 
C 1 70  ILE 70  116 116 ILE ILE C . n 
C 1 71  ILE 71  117 117 ILE ILE C . n 
C 1 72  LYS 72  118 118 LYS LYS C . n 
C 1 73  GLN 73  119 119 GLN GLN C . n 
C 1 74  PRO 74  120 120 PRO PRO C . n 
C 1 75  MET 75  121 121 MET MET C . n 
C 1 76  ASP 76  122 122 ASP ASP C . n 
C 1 77  MET 77  123 123 MET MET C . n 
C 1 78  GLY 78  124 124 GLY GLY C . n 
C 1 79  THR 79  125 125 THR THR C . n 
C 1 80  ILE 80  126 126 ILE ILE C . n 
C 1 81  LYS 81  127 127 LYS LYS C . n 
C 1 82  ARG 82  128 128 ARG ARG C . n 
C 1 83  ARG 83  129 129 ARG ARG C . n 
C 1 84  LEU 84  130 130 LEU LEU C . n 
C 1 85  GLU 85  131 131 GLU GLU C . n 
C 1 86  ASN 86  132 132 ASN ASN C . n 
C 1 87  ASN 87  133 133 ASN ASN C . n 
C 1 88  TYR 88  134 134 TYR TYR C . n 
C 1 89  TYR 89  135 135 TYR TYR C . n 
C 1 90  TRP 90  136 136 TRP TRP C . n 
C 1 91  ALA 91  137 137 ALA ALA C . n 
C 1 92  ALA 92  138 138 ALA ALA C . n 
C 1 93  SER 93  139 139 SER SER C . n 
C 1 94  GLU 94  140 140 GLU GLU C . n 
C 1 95  CYS 95  141 141 CYS CYS C . n 
C 1 96  MET 96  142 142 MET MET C . n 
C 1 97  GLN 97  143 143 GLN GLN C . n 
C 1 98  ASP 98  144 144 ASP ASP C . n 
C 1 99  PHE 99  145 145 PHE PHE C . n 
C 1 100 ASN 100 146 146 ASN ASN C . n 
C 1 101 THR 101 147 147 THR THR C . n 
C 1 102 MET 102 148 148 MET MET C . n 
C 1 103 PHE 103 149 149 PHE PHE C . n 
C 1 104 THR 104 150 150 THR THR C . n 
C 1 105 ASN 105 151 151 ASN ASN C . n 
C 1 106 CYS 106 152 152 CYS CYS C . n 
C 1 107 TYR 107 153 153 TYR TYR C . n 
C 1 108 ILE 108 154 154 ILE ILE C . n 
C 1 109 TYR 109 155 155 TYR TYR C . n 
C 1 110 ASN 110 156 156 ASN ASN C . n 
C 1 111 LYS 111 157 157 LYS LYS C . n 
C 1 112 PRO 112 158 158 PRO PRO C . n 
C 1 113 THR 113 159 159 THR THR C . n 
C 1 114 ASP 114 160 160 ASP ASP C . n 
C 1 115 ASP 115 161 161 ASP ASP C . n 
C 1 116 ILE 116 162 162 ILE ILE C . n 
C 1 117 VAL 117 163 163 VAL VAL C . n 
C 1 118 LEU 118 164 164 LEU LEU C . n 
C 1 119 MET 119 165 165 MET MET C . n 
C 1 120 ALA 120 166 166 ALA ALA C . n 
C 1 121 GLN 121 167 167 GLN GLN C . n 
C 1 122 THR 122 168 168 THR THR C . n 
C 1 123 LEU 123 169 169 LEU LEU C . n 
C 1 124 GLU 124 170 170 GLU GLU C . n 
C 1 125 LYS 125 171 171 LYS LYS C . n 
C 1 126 ILE 126 172 172 ILE ILE C . n 
C 1 127 PHE 127 173 173 PHE PHE C . n 
C 1 128 LEU 128 174 174 LEU LEU C . n 
C 1 129 GLN 129 175 175 GLN GLN C . n 
C 1 130 LYS 130 176 176 LYS LYS C . n 
C 1 131 VAL 131 177 177 VAL VAL C . n 
C 1 132 ALA 132 178 178 ALA ALA C . n 
C 1 133 SER 133 179 179 SER SER C . n 
C 1 134 MET 134 180 180 MET MET C . n 
C 1 135 PRO 135 181 181 PRO PRO C . n 
C 1 136 GLN 136 182 182 GLN GLN C . n 
C 1 137 GLU 137 183 ?   ?   ?   C . n 
C 1 138 GLU 138 184 ?   ?   ?   C . n 
C 1 139 GLN 139 185 ?   ?   ?   C . n 
C 1 140 GLU 140 186 ?   ?   ?   C . n 
C 1 141 LEU 141 187 ?   ?   ?   C . n 
C 1 142 VAL 142 188 ?   ?   ?   C . n 
C 1 143 VAL 143 189 ?   ?   ?   C . n 
C 1 144 THR 144 190 ?   ?   ?   C . n 
C 1 145 ILE 145 191 ?   ?   ?   C . n 
C 1 146 PRO 146 192 ?   ?   ?   C . n 
C 1 147 LYS 147 193 ?   ?   ?   C . n 
C 1 148 ASN 148 194 ?   ?   ?   C . n 
C 1 149 SER 149 195 ?   ?   ?   C . n 
C 1 150 HIS 150 196 ?   ?   ?   C . n 
C 1 151 LYS 151 197 ?   ?   ?   C . n 
C 1 152 LYS 152 198 ?   ?   ?   C . n 
C 1 153 GLY 153 199 ?   ?   ?   C . n 
C 1 154 ALA 154 200 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 EDO 1   1187 1187 EDO EDO A . 
E 2 EDO 1   1188 1188 EDO EDO A . 
F 2 EDO 1   1189 1189 EDO EDO A . 
G 3 A9N 1   1190 1190 A9N A9N A . 
H 4 SO4 1   1191 1191 SO4 SO4 A . 
I 4 SO4 1   1192 1192 SO4 SO4 A . 
J 2 EDO 1   1187 1187 EDO EDO B . 
K 2 EDO 1   1188 1188 EDO EDO B . 
L 3 A9N 1   1189 1189 A9N A9N B . 
M 4 SO4 1   1190 1190 SO4 SO4 B . 
N 5 DMS 1   1183 1183 DMS DMS C . 
O 2 EDO 1   1184 1184 EDO EDO C . 
P 4 SO4 1   1185 1185 SO4 SO4 C . 
Q 6 HOH 1   2001 2001 HOH HOH A . 
Q 6 HOH 2   2002 2002 HOH HOH A . 
Q 6 HOH 3   2003 2003 HOH HOH A . 
Q 6 HOH 4   2004 2004 HOH HOH A . 
Q 6 HOH 5   2005 2005 HOH HOH A . 
Q 6 HOH 6   2006 2006 HOH HOH A . 
Q 6 HOH 7   2007 2007 HOH HOH A . 
Q 6 HOH 8   2008 2008 HOH HOH A . 
Q 6 HOH 9   2009 2009 HOH HOH A . 
Q 6 HOH 10  2010 2010 HOH HOH A . 
Q 6 HOH 11  2011 2011 HOH HOH A . 
Q 6 HOH 12  2012 2012 HOH HOH A . 
Q 6 HOH 13  2013 2013 HOH HOH A . 
Q 6 HOH 14  2014 2014 HOH HOH A . 
Q 6 HOH 15  2015 2015 HOH HOH A . 
Q 6 HOH 16  2016 2016 HOH HOH A . 
Q 6 HOH 17  2017 2017 HOH HOH A . 
Q 6 HOH 18  2018 2018 HOH HOH A . 
Q 6 HOH 19  2019 2019 HOH HOH A . 
Q 6 HOH 20  2020 2020 HOH HOH A . 
Q 6 HOH 21  2021 2021 HOH HOH A . 
Q 6 HOH 22  2022 2022 HOH HOH A . 
Q 6 HOH 23  2023 2023 HOH HOH A . 
Q 6 HOH 24  2024 2024 HOH HOH A . 
Q 6 HOH 25  2025 2025 HOH HOH A . 
Q 6 HOH 26  2026 2026 HOH HOH A . 
Q 6 HOH 27  2027 2027 HOH HOH A . 
Q 6 HOH 28  2028 2028 HOH HOH A . 
Q 6 HOH 29  2029 2029 HOH HOH A . 
Q 6 HOH 30  2030 2030 HOH HOH A . 
Q 6 HOH 31  2031 2031 HOH HOH A . 
Q 6 HOH 32  2032 2032 HOH HOH A . 
Q 6 HOH 33  2033 2033 HOH HOH A . 
Q 6 HOH 34  2034 2034 HOH HOH A . 
Q 6 HOH 35  2035 2035 HOH HOH A . 
Q 6 HOH 36  2036 2036 HOH HOH A . 
Q 6 HOH 37  2037 2037 HOH HOH A . 
Q 6 HOH 38  2038 2038 HOH HOH A . 
Q 6 HOH 39  2039 2039 HOH HOH A . 
Q 6 HOH 40  2040 2040 HOH HOH A . 
Q 6 HOH 41  2041 2041 HOH HOH A . 
Q 6 HOH 42  2042 2042 HOH HOH A . 
Q 6 HOH 43  2043 2043 HOH HOH A . 
Q 6 HOH 44  2044 2044 HOH HOH A . 
Q 6 HOH 45  2045 2045 HOH HOH A . 
Q 6 HOH 46  2046 2046 HOH HOH A . 
Q 6 HOH 47  2047 2047 HOH HOH A . 
Q 6 HOH 48  2048 2048 HOH HOH A . 
Q 6 HOH 49  2049 2049 HOH HOH A . 
Q 6 HOH 50  2050 2050 HOH HOH A . 
Q 6 HOH 51  2051 2051 HOH HOH A . 
Q 6 HOH 52  2052 2052 HOH HOH A . 
Q 6 HOH 53  2053 2053 HOH HOH A . 
Q 6 HOH 54  2054 2054 HOH HOH A . 
Q 6 HOH 55  2055 2055 HOH HOH A . 
Q 6 HOH 56  2056 2056 HOH HOH A . 
Q 6 HOH 57  2057 2057 HOH HOH A . 
Q 6 HOH 58  2058 2058 HOH HOH A . 
Q 6 HOH 59  2059 2059 HOH HOH A . 
Q 6 HOH 60  2060 2060 HOH HOH A . 
Q 6 HOH 61  2061 2061 HOH HOH A . 
Q 6 HOH 62  2062 2062 HOH HOH A . 
Q 6 HOH 63  2063 2063 HOH HOH A . 
Q 6 HOH 64  2064 2064 HOH HOH A . 
Q 6 HOH 65  2065 2065 HOH HOH A . 
Q 6 HOH 66  2066 2066 HOH HOH A . 
Q 6 HOH 67  2067 2067 HOH HOH A . 
Q 6 HOH 68  2068 2068 HOH HOH A . 
Q 6 HOH 69  2069 2069 HOH HOH A . 
Q 6 HOH 70  2070 2070 HOH HOH A . 
Q 6 HOH 71  2071 2071 HOH HOH A . 
Q 6 HOH 72  2072 2072 HOH HOH A . 
Q 6 HOH 73  2073 2073 HOH HOH A . 
Q 6 HOH 74  2074 2074 HOH HOH A . 
Q 6 HOH 75  2075 2075 HOH HOH A . 
Q 6 HOH 76  2076 2076 HOH HOH A . 
Q 6 HOH 77  2077 2077 HOH HOH A . 
Q 6 HOH 78  2078 2078 HOH HOH A . 
Q 6 HOH 79  2079 2079 HOH HOH A . 
Q 6 HOH 80  2080 2080 HOH HOH A . 
Q 6 HOH 81  2081 2081 HOH HOH A . 
Q 6 HOH 82  2082 2082 HOH HOH A . 
Q 6 HOH 83  2083 2083 HOH HOH A . 
Q 6 HOH 84  2084 2084 HOH HOH A . 
Q 6 HOH 85  2085 2085 HOH HOH A . 
Q 6 HOH 86  2086 2086 HOH HOH A . 
Q 6 HOH 87  2087 2087 HOH HOH A . 
Q 6 HOH 88  2088 2088 HOH HOH A . 
Q 6 HOH 89  2089 2089 HOH HOH A . 
Q 6 HOH 90  2090 2090 HOH HOH A . 
Q 6 HOH 91  2091 2091 HOH HOH A . 
Q 6 HOH 92  2092 2092 HOH HOH A . 
Q 6 HOH 93  2093 2093 HOH HOH A . 
Q 6 HOH 94  2094 2094 HOH HOH A . 
Q 6 HOH 95  2095 2095 HOH HOH A . 
Q 6 HOH 96  2096 2096 HOH HOH A . 
Q 6 HOH 97  2097 2097 HOH HOH A . 
Q 6 HOH 98  2098 2098 HOH HOH A . 
Q 6 HOH 99  2099 2099 HOH HOH A . 
Q 6 HOH 100 2100 2100 HOH HOH A . 
Q 6 HOH 101 2101 2101 HOH HOH A . 
Q 6 HOH 102 2102 2102 HOH HOH A . 
Q 6 HOH 103 2103 2103 HOH HOH A . 
Q 6 HOH 104 2104 2104 HOH HOH A . 
Q 6 HOH 105 2105 2105 HOH HOH A . 
Q 6 HOH 106 2106 2106 HOH HOH A . 
Q 6 HOH 107 2107 2107 HOH HOH A . 
Q 6 HOH 108 2108 2108 HOH HOH A . 
Q 6 HOH 109 2109 2109 HOH HOH A . 
Q 6 HOH 110 2110 2110 HOH HOH A . 
Q 6 HOH 111 2111 2111 HOH HOH A . 
Q 6 HOH 112 2112 2112 HOH HOH A . 
Q 6 HOH 113 2113 2113 HOH HOH A . 
Q 6 HOH 114 2114 2114 HOH HOH A . 
Q 6 HOH 115 2115 2115 HOH HOH A . 
Q 6 HOH 116 2116 2116 HOH HOH A . 
Q 6 HOH 117 2117 2117 HOH HOH A . 
Q 6 HOH 118 2118 2118 HOH HOH A . 
Q 6 HOH 119 2119 2119 HOH HOH A . 
Q 6 HOH 120 2120 2120 HOH HOH A . 
Q 6 HOH 121 2121 2121 HOH HOH A . 
Q 6 HOH 122 2122 2122 HOH HOH A . 
Q 6 HOH 123 2123 2123 HOH HOH A . 
R 6 HOH 1   2001 2001 HOH HOH B . 
R 6 HOH 2   2002 2002 HOH HOH B . 
R 6 HOH 3   2003 2003 HOH HOH B . 
R 6 HOH 4   2004 2004 HOH HOH B . 
R 6 HOH 5   2005 2005 HOH HOH B . 
R 6 HOH 6   2006 2006 HOH HOH B . 
R 6 HOH 7   2007 2007 HOH HOH B . 
R 6 HOH 8   2008 2008 HOH HOH B . 
R 6 HOH 9   2009 2009 HOH HOH B . 
R 6 HOH 10  2010 2010 HOH HOH B . 
R 6 HOH 11  2011 2011 HOH HOH B . 
R 6 HOH 12  2012 2012 HOH HOH B . 
R 6 HOH 13  2013 2013 HOH HOH B . 
R 6 HOH 14  2014 2014 HOH HOH B . 
R 6 HOH 15  2015 2015 HOH HOH B . 
R 6 HOH 16  2016 2016 HOH HOH B . 
R 6 HOH 17  2017 2017 HOH HOH B . 
R 6 HOH 18  2018 2018 HOH HOH B . 
R 6 HOH 19  2019 2019 HOH HOH B . 
R 6 HOH 20  2020 2020 HOH HOH B . 
R 6 HOH 21  2021 2021 HOH HOH B . 
R 6 HOH 22  2022 2022 HOH HOH B . 
R 6 HOH 23  2023 2023 HOH HOH B . 
R 6 HOH 24  2024 2024 HOH HOH B . 
R 6 HOH 25  2025 2025 HOH HOH B . 
R 6 HOH 26  2026 2026 HOH HOH B . 
R 6 HOH 27  2027 2027 HOH HOH B . 
R 6 HOH 28  2028 2028 HOH HOH B . 
R 6 HOH 29  2029 2029 HOH HOH B . 
R 6 HOH 30  2030 2030 HOH HOH B . 
R 6 HOH 31  2031 2031 HOH HOH B . 
R 6 HOH 32  2032 2032 HOH HOH B . 
R 6 HOH 33  2033 2033 HOH HOH B . 
R 6 HOH 34  2034 2034 HOH HOH B . 
R 6 HOH 35  2035 2035 HOH HOH B . 
R 6 HOH 36  2036 2036 HOH HOH B . 
R 6 HOH 37  2037 2037 HOH HOH B . 
R 6 HOH 38  2038 2038 HOH HOH B . 
R 6 HOH 39  2039 2039 HOH HOH B . 
R 6 HOH 40  2040 2040 HOH HOH B . 
R 6 HOH 41  2041 2041 HOH HOH B . 
R 6 HOH 42  2042 2042 HOH HOH B . 
R 6 HOH 43  2043 2043 HOH HOH B . 
R 6 HOH 44  2044 2044 HOH HOH B . 
R 6 HOH 45  2045 2045 HOH HOH B . 
R 6 HOH 46  2046 2046 HOH HOH B . 
R 6 HOH 47  2047 2047 HOH HOH B . 
R 6 HOH 48  2048 2048 HOH HOH B . 
R 6 HOH 49  2049 2049 HOH HOH B . 
R 6 HOH 50  2050 2050 HOH HOH B . 
R 6 HOH 51  2051 2051 HOH HOH B . 
R 6 HOH 52  2052 2052 HOH HOH B . 
R 6 HOH 53  2053 2053 HOH HOH B . 
R 6 HOH 54  2054 2054 HOH HOH B . 
R 6 HOH 55  2055 2055 HOH HOH B . 
R 6 HOH 56  2056 2056 HOH HOH B . 
R 6 HOH 57  2057 2057 HOH HOH B . 
R 6 HOH 58  2058 2058 HOH HOH B . 
R 6 HOH 59  2059 2059 HOH HOH B . 
R 6 HOH 60  2060 2060 HOH HOH B . 
R 6 HOH 61  2061 2061 HOH HOH B . 
R 6 HOH 62  2062 2062 HOH HOH B . 
R 6 HOH 63  2063 2063 HOH HOH B . 
R 6 HOH 64  2064 2064 HOH HOH B . 
R 6 HOH 65  2065 2065 HOH HOH B . 
R 6 HOH 66  2066 2066 HOH HOH B . 
R 6 HOH 67  2067 2067 HOH HOH B . 
R 6 HOH 68  2068 2068 HOH HOH B . 
R 6 HOH 69  2069 2069 HOH HOH B . 
R 6 HOH 70  2070 2070 HOH HOH B . 
R 6 HOH 71  2071 2071 HOH HOH B . 
R 6 HOH 72  2072 2072 HOH HOH B . 
R 6 HOH 73  2073 2073 HOH HOH B . 
R 6 HOH 74  2074 2074 HOH HOH B . 
R 6 HOH 75  2075 2075 HOH HOH B . 
R 6 HOH 76  2076 2076 HOH HOH B . 
R 6 HOH 77  2077 2077 HOH HOH B . 
R 6 HOH 78  2078 2078 HOH HOH B . 
R 6 HOH 79  2079 2079 HOH HOH B . 
R 6 HOH 80  2080 2080 HOH HOH B . 
R 6 HOH 81  2081 2081 HOH HOH B . 
R 6 HOH 82  2082 2082 HOH HOH B . 
R 6 HOH 83  2083 2083 HOH HOH B . 
R 6 HOH 84  2084 2084 HOH HOH B . 
R 6 HOH 85  2085 2085 HOH HOH B . 
R 6 HOH 86  2086 2086 HOH HOH B . 
R 6 HOH 87  2087 2087 HOH HOH B . 
R 6 HOH 88  2088 2088 HOH HOH B . 
R 6 HOH 89  2089 2089 HOH HOH B . 
R 6 HOH 90  2090 2090 HOH HOH B . 
S 6 HOH 1   2001 2001 HOH HOH C . 
S 6 HOH 2   2002 2002 HOH HOH C . 
S 6 HOH 3   2003 2003 HOH HOH C . 
S 6 HOH 4   2004 2004 HOH HOH C . 
S 6 HOH 5   2005 2005 HOH HOH C . 
S 6 HOH 6   2006 2006 HOH HOH C . 
S 6 HOH 7   2007 2007 HOH HOH C . 
S 6 HOH 8   2008 2008 HOH HOH C . 
S 6 HOH 9   2009 2009 HOH HOH C . 
S 6 HOH 10  2010 2010 HOH HOH C . 
S 6 HOH 11  2011 2011 HOH HOH C . 
S 6 HOH 12  2012 2012 HOH HOH C . 
S 6 HOH 13  2013 2013 HOH HOH C . 
S 6 HOH 14  2014 2014 HOH HOH C . 
S 6 HOH 15  2015 2015 HOH HOH C . 
S 6 HOH 16  2016 2016 HOH HOH C . 
S 6 HOH 17  2017 2017 HOH HOH C . 
S 6 HOH 18  2018 2018 HOH HOH C . 
S 6 HOH 19  2019 2019 HOH HOH C . 
S 6 HOH 20  2020 2020 HOH HOH C . 
S 6 HOH 21  2021 2021 HOH HOH C . 
S 6 HOH 22  2022 2022 HOH HOH C . 
S 6 HOH 23  2023 2023 HOH HOH C . 
S 6 HOH 24  2024 2024 HOH HOH C . 
S 6 HOH 25  2025 2025 HOH HOH C . 
S 6 HOH 26  2026 2026 HOH HOH C . 
S 6 HOH 27  2027 2027 HOH HOH C . 
S 6 HOH 28  2028 2028 HOH HOH C . 
S 6 HOH 29  2029 2029 HOH HOH C . 
S 6 HOH 30  2030 2030 HOH HOH C . 
S 6 HOH 31  2031 2031 HOH HOH C . 
S 6 HOH 32  2032 2032 HOH HOH C . 
S 6 HOH 33  2033 2033 HOH HOH C . 
S 6 HOH 34  2034 2034 HOH HOH C . 
S 6 HOH 35  2035 2035 HOH HOH C . 
S 6 HOH 36  2036 2036 HOH HOH C . 
S 6 HOH 37  2037 2037 HOH HOH C . 
S 6 HOH 38  2038 2038 HOH HOH C . 
S 6 HOH 39  2039 2039 HOH HOH C . 
S 6 HOH 40  2040 2040 HOH HOH C . 
S 6 HOH 41  2041 2041 HOH HOH C . 
S 6 HOH 42  2042 2042 HOH HOH C . 
S 6 HOH 43  2043 2043 HOH HOH C . 
S 6 HOH 44  2044 2044 HOH HOH C . 
S 6 HOH 45  2045 2045 HOH HOH C . 
S 6 HOH 46  2046 2046 HOH HOH C . 
S 6 HOH 47  2047 2047 HOH HOH C . 
S 6 HOH 48  2048 2048 HOH HOH C . 
S 6 HOH 49  2049 2049 HOH HOH C . 
S 6 HOH 50  2050 2050 HOH HOH C . 
S 6 HOH 51  2051 2051 HOH HOH C . 
S 6 HOH 52  2052 2052 HOH HOH C . 
S 6 HOH 53  2053 2053 HOH HOH C . 
S 6 HOH 54  2054 2054 HOH HOH C . 
S 6 HOH 55  2055 2055 HOH HOH C . 
S 6 HOH 56  2056 2056 HOH HOH C . 
S 6 HOH 57  2057 2057 HOH HOH C . 
S 6 HOH 58  2058 2058 HOH HOH C . 
S 6 HOH 59  2059 2059 HOH HOH C . 
S 6 HOH 60  2060 2060 HOH HOH C . 
S 6 HOH 61  2061 2061 HOH HOH C . 
S 6 HOH 62  2062 2062 HOH HOH C . 
S 6 HOH 63  2063 2063 HOH HOH C . 
S 6 HOH 64  2064 2064 HOH HOH C . 
S 6 HOH 65  2065 2065 HOH HOH C . 
S 6 HOH 66  2066 2066 HOH HOH C . 
S 6 HOH 67  2067 2067 HOH HOH C . 
S 6 HOH 68  2068 2068 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,D,E,F,G,H,I,J,K,L,M,Q,R 
2 1,2 C,N,O,P,S                   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3500  ? 
1 MORE         -30.2 ? 
1 'SSA (A^2)'  11840 ? 
2 'ABSA (A^2)' 3480  ? 
2 MORE         -26.7 ? 
2 'SSA (A^2)'  11500 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -5.8901907507 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 67.8708886705 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    C 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2052 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   S 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-02-08 
2 'Structure model' 1 1 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'          
2 2 'Structure model' 'Experimental preparation' 
3 2 'Structure model' Other                      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' exptl_crystal_grow   
2 2 'Structure model' pdbx_database_proc   
3 2 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_exptl_crystal_grow.temp'                    
2 2 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 16.2428 6.8042  1.7371  0.0210 0.0400 0.1101 0.0052 0.0458  0.0031  1.6354 2.5274 1.9941 -0.7734 
-0.0255 0.4380  -0.0830 -0.0408 -0.0778 0.1620  -0.0252 0.3853  0.0311  -0.1821 0.1082  
'X-RAY DIFFRACTION' 2 ? refined 34.3601 9.2147  11.1760 0.0581 0.0212 0.0390 0.0051 -0.0146 0.0061  1.3366 2.6900 2.2997 -0.5108 
0.0060  0.1041  -0.0226 -0.1241 0.0145  0.3141  0.0890  -0.1070 -0.0923 0.0944  -0.0665 
'X-RAY DIFFRACTION' 3 ? refined -2.0789 18.8237 23.6294 0.0301 0.1347 0.0133 0.0057 0.0108  -0.0019 1.5855 3.4304 5.7756 -0.0832 
1.3682  -1.5627 -0.0364 0.1349  0.0080  -0.2856 0.0772  -0.0925 -0.0140 0.0797  -0.0408 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 75 ? ? A 186 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 72 ? ? B 186 ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 77 ? ? C 182 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.5.0109 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             A 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SD 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_2              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             A 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_3              123 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             A 
_pdbx_validate_rmsd_angle.angle_value                113.55 
_pdbx_validate_rmsd_angle.angle_target_value         100.20 
_pdbx_validate_rmsd_angle.angle_deviation            13.35 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL B 85  ? ? -104.07 -61.25 
2 1 LEU B 110 ? ? -117.38 77.71  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 185 ? CG  ? A GLN 139 CG  
2  1 Y 1 A GLN 185 ? CD  ? A GLN 139 CD  
3  1 Y 1 A GLN 185 ? OE1 ? A GLN 139 OE1 
4  1 Y 1 A GLN 185 ? NE2 ? A GLN 139 NE2 
5  1 Y 1 B GLU 183 ? CG  ? B GLU 137 CG  
6  1 Y 1 B GLU 183 ? CD  ? B GLU 137 CD  
7  1 Y 1 B GLU 183 ? OE1 ? B GLU 137 OE1 
8  1 Y 1 B GLU 183 ? OE2 ? B GLU 137 OE2 
9  1 Y 1 B GLN 185 ? CG  ? B GLN 139 CG  
10 1 Y 1 B GLN 185 ? CD  ? B GLN 139 CD  
11 1 Y 1 B GLN 185 ? OE1 ? B GLN 139 OE1 
12 1 Y 1 B GLN 185 ? NE2 ? B GLN 139 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 47  ? A GLY 1   
2   1 Y 1 A SER 48  ? A SER 2   
3   1 Y 1 A SER 49  ? A SER 3   
4   1 Y 1 A HIS 50  ? A HIS 4   
5   1 Y 1 A HIS 51  ? A HIS 5   
6   1 Y 1 A HIS 52  ? A HIS 6   
7   1 Y 1 A HIS 53  ? A HIS 7   
8   1 Y 1 A HIS 54  ? A HIS 8   
9   1 Y 1 A HIS 55  ? A HIS 9   
10  1 Y 1 A SER 56  ? A SER 10  
11  1 Y 1 A SER 57  ? A SER 11  
12  1 Y 1 A GLY 58  ? A GLY 12  
13  1 Y 1 A LEU 59  ? A LEU 13  
14  1 Y 1 A VAL 60  ? A VAL 14  
15  1 Y 1 A PRO 61  ? A PRO 15  
16  1 Y 1 A ARG 62  ? A ARG 16  
17  1 Y 1 A GLY 63  ? A GLY 17  
18  1 Y 1 A SER 64  ? A SER 18  
19  1 Y 1 A HIS 65  ? A HIS 19  
20  1 Y 1 A MET 66  ? A MET 20  
21  1 Y 1 A SER 67  ? A SER 21  
22  1 Y 1 A ASN 68  ? A ASN 22  
23  1 Y 1 A PRO 69  ? A PRO 23  
24  1 Y 1 A LYS 70  ? A LYS 24  
25  1 Y 1 A LYS 71  ? A LYS 25  
26  1 Y 1 A PRO 72  ? A PRO 26  
27  1 Y 1 A GLY 73  ? A GLY 27  
28  1 Y 1 A ARG 74  ? A ARG 28  
29  1 Y 1 A LEU 187 ? A LEU 141 
30  1 Y 1 A VAL 188 ? A VAL 142 
31  1 Y 1 A VAL 189 ? A VAL 143 
32  1 Y 1 A THR 190 ? A THR 144 
33  1 Y 1 A ILE 191 ? A ILE 145 
34  1 Y 1 A PRO 192 ? A PRO 146 
35  1 Y 1 A LYS 193 ? A LYS 147 
36  1 Y 1 A ASN 194 ? A ASN 148 
37  1 Y 1 A SER 195 ? A SER 149 
38  1 Y 1 A HIS 196 ? A HIS 150 
39  1 Y 1 A LYS 197 ? A LYS 151 
40  1 Y 1 A LYS 198 ? A LYS 152 
41  1 Y 1 A GLY 199 ? A GLY 153 
42  1 Y 1 A ALA 200 ? A ALA 154 
43  1 Y 1 B GLY 47  ? B GLY 1   
44  1 Y 1 B SER 48  ? B SER 2   
45  1 Y 1 B SER 49  ? B SER 3   
46  1 Y 1 B HIS 50  ? B HIS 4   
47  1 Y 1 B HIS 51  ? B HIS 5   
48  1 Y 1 B HIS 52  ? B HIS 6   
49  1 Y 1 B HIS 53  ? B HIS 7   
50  1 Y 1 B HIS 54  ? B HIS 8   
51  1 Y 1 B HIS 55  ? B HIS 9   
52  1 Y 1 B SER 56  ? B SER 10  
53  1 Y 1 B SER 57  ? B SER 11  
54  1 Y 1 B GLY 58  ? B GLY 12  
55  1 Y 1 B LEU 59  ? B LEU 13  
56  1 Y 1 B VAL 60  ? B VAL 14  
57  1 Y 1 B PRO 61  ? B PRO 15  
58  1 Y 1 B ARG 62  ? B ARG 16  
59  1 Y 1 B GLY 63  ? B GLY 17  
60  1 Y 1 B SER 64  ? B SER 18  
61  1 Y 1 B HIS 65  ? B HIS 19  
62  1 Y 1 B MET 66  ? B MET 20  
63  1 Y 1 B SER 67  ? B SER 21  
64  1 Y 1 B ASN 68  ? B ASN 22  
65  1 Y 1 B PRO 69  ? B PRO 23  
66  1 Y 1 B LYS 70  ? B LYS 24  
67  1 Y 1 B LYS 71  ? B LYS 25  
68  1 Y 1 B LEU 187 ? B LEU 141 
69  1 Y 1 B VAL 188 ? B VAL 142 
70  1 Y 1 B VAL 189 ? B VAL 143 
71  1 Y 1 B THR 190 ? B THR 144 
72  1 Y 1 B ILE 191 ? B ILE 145 
73  1 Y 1 B PRO 192 ? B PRO 146 
74  1 Y 1 B LYS 193 ? B LYS 147 
75  1 Y 1 B ASN 194 ? B ASN 148 
76  1 Y 1 B SER 195 ? B SER 149 
77  1 Y 1 B HIS 196 ? B HIS 150 
78  1 Y 1 B LYS 197 ? B LYS 151 
79  1 Y 1 B LYS 198 ? B LYS 152 
80  1 Y 1 B GLY 199 ? B GLY 153 
81  1 Y 1 B ALA 200 ? B ALA 154 
82  1 Y 1 C GLY 47  ? C GLY 1   
83  1 Y 1 C SER 48  ? C SER 2   
84  1 Y 1 C SER 49  ? C SER 3   
85  1 Y 1 C HIS 50  ? C HIS 4   
86  1 Y 1 C HIS 51  ? C HIS 5   
87  1 Y 1 C HIS 52  ? C HIS 6   
88  1 Y 1 C HIS 53  ? C HIS 7   
89  1 Y 1 C HIS 54  ? C HIS 8   
90  1 Y 1 C HIS 55  ? C HIS 9   
91  1 Y 1 C SER 56  ? C SER 10  
92  1 Y 1 C SER 57  ? C SER 11  
93  1 Y 1 C GLY 58  ? C GLY 12  
94  1 Y 1 C LEU 59  ? C LEU 13  
95  1 Y 1 C VAL 60  ? C VAL 14  
96  1 Y 1 C PRO 61  ? C PRO 15  
97  1 Y 1 C ARG 62  ? C ARG 16  
98  1 Y 1 C GLY 63  ? C GLY 17  
99  1 Y 1 C SER 64  ? C SER 18  
100 1 Y 1 C HIS 65  ? C HIS 19  
101 1 Y 1 C MET 66  ? C MET 20  
102 1 Y 1 C SER 67  ? C SER 21  
103 1 Y 1 C ASN 68  ? C ASN 22  
104 1 Y 1 C PRO 69  ? C PRO 23  
105 1 Y 1 C LYS 70  ? C LYS 24  
106 1 Y 1 C LYS 71  ? C LYS 25  
107 1 Y 1 C PRO 72  ? C PRO 26  
108 1 Y 1 C GLY 73  ? C GLY 27  
109 1 Y 1 C ARG 74  ? C ARG 28  
110 1 Y 1 C VAL 75  ? C VAL 29  
111 1 Y 1 C THR 76  ? C THR 30  
112 1 Y 1 C GLU 183 ? C GLU 137 
113 1 Y 1 C GLU 184 ? C GLU 138 
114 1 Y 1 C GLN 185 ? C GLN 139 
115 1 Y 1 C GLU 186 ? C GLU 140 
116 1 Y 1 C LEU 187 ? C LEU 141 
117 1 Y 1 C VAL 188 ? C VAL 142 
118 1 Y 1 C VAL 189 ? C VAL 143 
119 1 Y 1 C THR 190 ? C THR 144 
120 1 Y 1 C ILE 191 ? C ILE 145 
121 1 Y 1 C PRO 192 ? C PRO 146 
122 1 Y 1 C LYS 193 ? C LYS 147 
123 1 Y 1 C ASN 194 ? C ASN 148 
124 1 Y 1 C SER 195 ? C SER 149 
125 1 Y 1 C HIS 196 ? C HIS 150 
126 1 Y 1 C LYS 197 ? C LYS 151 
127 1 Y 1 C LYS 198 ? C LYS 152 
128 1 Y 1 C GLY 199 ? C GLY 153 
129 1 Y 1 C ALA 200 ? C ALA 154 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL                                                                       EDO 
3 'N-CYCLOPROP-2-EN-1-YL-5-(3,5-DIMETHYL-1,2-OXAZOL-4-YL)-2-METHYL-BENZENESULFONAMIDE' A9N 
4 'SULFATE ION'                                                                        SO4 
5 'DIMETHYL SULFOXIDE'                                                                 DMS 
6 water                                                                                HOH 
#