data_4AD7
# 
_entry.id   4AD7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4AD7         
PDBE  EBI-50768    
WWPDB D_1290050768 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4ACR 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF N-GLYCOSYLATED, C-TERMINALLY TRUNCATED HUMAN GLYPICAN-1' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4AD7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Svensson, G.' 1 
'Awad, W.'     2 
'Mani, K.'     3 
'Logan, D.T.'  4 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of N-Glycosylated Human Glypican-1 Core Protein: Structure of Two Loops Evolutionarily Conserved in Vertebrate Glypican-1.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                14040 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22351761 
_citation.pdbx_database_id_DOI      10.1074/JBC.M111.322487 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Svensson, G.'  1 ? 
primary 'Awad, W.'      2 ? 
primary 'Hakansson, M.' 3 ? 
primary 'Mani, K.'      4 ? 
primary 'Logan, D.T.'   5 ? 
# 
_cell.entry_id           4AD7 
_cell.length_a           47.250 
_cell.length_b           169.200 
_cell.length_c           151.710 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.96 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4AD7 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man GLYPICAN-1                               58785.254 4   ? ? 'UNP RESIDUES 24-529' 
'N-GLYCOSYLATED AT RESIDUES 79 AND 116' 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   6   ? ? ?                     ? 
3 water       nat water                                    18.015    126 ? ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SECRETED GLYPICAN-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APQLHHHHHHDLYENLYFQGKLDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRS
HAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEE
TLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVP
LGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWL
AEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLC
SEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDA
SDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APQLHHHHHHDLYENLYFQGKLDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRS
HAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEE
TLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVP
LGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWL
AEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLC
SEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDA
SDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKT
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   GLN n 
1 4   LEU n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  ASP n 
1 12  LEU n 
1 13  TYR n 
1 14  GLU n 
1 15  ASN n 
1 16  LEU n 
1 17  TYR n 
1 18  PHE n 
1 19  GLN n 
1 20  GLY n 
1 21  LYS n 
1 22  LEU n 
1 23  ASP n 
1 24  PRO n 
1 25  ALA n 
1 26  SER n 
1 27  LYS n 
1 28  SER n 
1 29  ARG n 
1 30  SER n 
1 31  CYS n 
1 32  GLY n 
1 33  GLU n 
1 34  VAL n 
1 35  ARG n 
1 36  GLN n 
1 37  ILE n 
1 38  TYR n 
1 39  GLY n 
1 40  ALA n 
1 41  LYS n 
1 42  GLY n 
1 43  PHE n 
1 44  SER n 
1 45  LEU n 
1 46  SER n 
1 47  ASP n 
1 48  VAL n 
1 49  PRO n 
1 50  GLN n 
1 51  ALA n 
1 52  GLU n 
1 53  ILE n 
1 54  SER n 
1 55  GLY n 
1 56  GLU n 
1 57  HIS n 
1 58  LEU n 
1 59  ARG n 
1 60  ILE n 
1 61  CYS n 
1 62  PRO n 
1 63  GLN n 
1 64  GLY n 
1 65  TYR n 
1 66  THR n 
1 67  CYS n 
1 68  CYS n 
1 69  THR n 
1 70  SER n 
1 71  GLU n 
1 72  MET n 
1 73  GLU n 
1 74  GLU n 
1 75  ASN n 
1 76  LEU n 
1 77  ALA n 
1 78  ASN n 
1 79  ARG n 
1 80  SER n 
1 81  HIS n 
1 82  ALA n 
1 83  GLU n 
1 84  LEU n 
1 85  GLU n 
1 86  THR n 
1 87  ALA n 
1 88  LEU n 
1 89  ARG n 
1 90  ASP n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  VAL n 
1 95  LEU n 
1 96  GLN n 
1 97  ALA n 
1 98  MET n 
1 99  LEU n 
1 100 ALA n 
1 101 THR n 
1 102 GLN n 
1 103 LEU n 
1 104 ARG n 
1 105 SER n 
1 106 PHE n 
1 107 ASP n 
1 108 ASP n 
1 109 HIS n 
1 110 PHE n 
1 111 GLN n 
1 112 HIS n 
1 113 LEU n 
1 114 LEU n 
1 115 ASN n 
1 116 ASP n 
1 117 SER n 
1 118 GLU n 
1 119 ARG n 
1 120 THR n 
1 121 LEU n 
1 122 GLN n 
1 123 ALA n 
1 124 THR n 
1 125 PHE n 
1 126 PRO n 
1 127 GLY n 
1 128 ALA n 
1 129 PHE n 
1 130 GLY n 
1 131 GLU n 
1 132 LEU n 
1 133 TYR n 
1 134 THR n 
1 135 GLN n 
1 136 ASN n 
1 137 ALA n 
1 138 ARG n 
1 139 ALA n 
1 140 PHE n 
1 141 ARG n 
1 142 ASP n 
1 143 LEU n 
1 144 TYR n 
1 145 SER n 
1 146 GLU n 
1 147 LEU n 
1 148 ARG n 
1 149 LEU n 
1 150 TYR n 
1 151 TYR n 
1 152 ARG n 
1 153 GLY n 
1 154 ALA n 
1 155 ASN n 
1 156 LEU n 
1 157 HIS n 
1 158 LEU n 
1 159 GLU n 
1 160 GLU n 
1 161 THR n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 PHE n 
1 166 TRP n 
1 167 ALA n 
1 168 ARG n 
1 169 LEU n 
1 170 LEU n 
1 171 GLU n 
1 172 ARG n 
1 173 LEU n 
1 174 PHE n 
1 175 LYS n 
1 176 GLN n 
1 177 LEU n 
1 178 HIS n 
1 179 PRO n 
1 180 GLN n 
1 181 LEU n 
1 182 LEU n 
1 183 LEU n 
1 184 PRO n 
1 185 ASP n 
1 186 ASP n 
1 187 TYR n 
1 188 LEU n 
1 189 ASP n 
1 190 CYS n 
1 191 LEU n 
1 192 GLY n 
1 193 LYS n 
1 194 GLN n 
1 195 ALA n 
1 196 GLU n 
1 197 ALA n 
1 198 LEU n 
1 199 ARG n 
1 200 PRO n 
1 201 PHE n 
1 202 GLY n 
1 203 GLU n 
1 204 ALA n 
1 205 PRO n 
1 206 ARG n 
1 207 GLU n 
1 208 LEU n 
1 209 ARG n 
1 210 LEU n 
1 211 ARG n 
1 212 ALA n 
1 213 THR n 
1 214 ARG n 
1 215 ALA n 
1 216 PHE n 
1 217 VAL n 
1 218 ALA n 
1 219 ALA n 
1 220 ARG n 
1 221 SER n 
1 222 PHE n 
1 223 VAL n 
1 224 GLN n 
1 225 GLY n 
1 226 LEU n 
1 227 GLY n 
1 228 VAL n 
1 229 ALA n 
1 230 SER n 
1 231 ASP n 
1 232 VAL n 
1 233 VAL n 
1 234 ARG n 
1 235 LYS n 
1 236 VAL n 
1 237 ALA n 
1 238 GLN n 
1 239 VAL n 
1 240 PRO n 
1 241 LEU n 
1 242 GLY n 
1 243 PRO n 
1 244 GLU n 
1 245 CYS n 
1 246 SER n 
1 247 ARG n 
1 248 ALA n 
1 249 VAL n 
1 250 MET n 
1 251 LYS n 
1 252 LEU n 
1 253 VAL n 
1 254 TYR n 
1 255 CYS n 
1 256 ALA n 
1 257 HIS n 
1 258 CYS n 
1 259 LEU n 
1 260 GLY n 
1 261 VAL n 
1 262 PRO n 
1 263 GLY n 
1 264 ALA n 
1 265 ARG n 
1 266 PRO n 
1 267 CYS n 
1 268 PRO n 
1 269 ASP n 
1 270 TYR n 
1 271 CYS n 
1 272 ARG n 
1 273 ASN n 
1 274 VAL n 
1 275 LEU n 
1 276 LYS n 
1 277 GLY n 
1 278 CYS n 
1 279 LEU n 
1 280 ALA n 
1 281 ASN n 
1 282 GLN n 
1 283 ALA n 
1 284 ASP n 
1 285 LEU n 
1 286 ASP n 
1 287 ALA n 
1 288 GLU n 
1 289 TRP n 
1 290 ARG n 
1 291 ASN n 
1 292 LEU n 
1 293 LEU n 
1 294 ASP n 
1 295 SER n 
1 296 MET n 
1 297 VAL n 
1 298 LEU n 
1 299 ILE n 
1 300 THR n 
1 301 ASP n 
1 302 LYS n 
1 303 PHE n 
1 304 TRP n 
1 305 GLY n 
1 306 THR n 
1 307 SER n 
1 308 GLY n 
1 309 VAL n 
1 310 GLU n 
1 311 SER n 
1 312 VAL n 
1 313 ILE n 
1 314 GLY n 
1 315 SER n 
1 316 VAL n 
1 317 HIS n 
1 318 THR n 
1 319 TRP n 
1 320 LEU n 
1 321 ALA n 
1 322 GLU n 
1 323 ALA n 
1 324 ILE n 
1 325 ASN n 
1 326 ALA n 
1 327 LEU n 
1 328 GLN n 
1 329 ASP n 
1 330 ASN n 
1 331 ARG n 
1 332 ASP n 
1 333 THR n 
1 334 LEU n 
1 335 THR n 
1 336 ALA n 
1 337 LYS n 
1 338 VAL n 
1 339 ILE n 
1 340 GLN n 
1 341 GLY n 
1 342 CYS n 
1 343 GLY n 
1 344 ASN n 
1 345 PRO n 
1 346 LYS n 
1 347 VAL n 
1 348 ASN n 
1 349 PRO n 
1 350 GLN n 
1 351 GLY n 
1 352 PRO n 
1 353 GLY n 
1 354 PRO n 
1 355 GLU n 
1 356 GLU n 
1 357 LYS n 
1 358 ARG n 
1 359 ARG n 
1 360 ARG n 
1 361 GLY n 
1 362 LYS n 
1 363 LEU n 
1 364 ALA n 
1 365 PRO n 
1 366 ARG n 
1 367 GLU n 
1 368 ARG n 
1 369 PRO n 
1 370 PRO n 
1 371 SER n 
1 372 GLY n 
1 373 THR n 
1 374 LEU n 
1 375 GLU n 
1 376 LYS n 
1 377 LEU n 
1 378 VAL n 
1 379 SER n 
1 380 GLU n 
1 381 ALA n 
1 382 LYS n 
1 383 ALA n 
1 384 GLN n 
1 385 LEU n 
1 386 ARG n 
1 387 ASP n 
1 388 VAL n 
1 389 GLN n 
1 390 ASP n 
1 391 PHE n 
1 392 TRP n 
1 393 ILE n 
1 394 SER n 
1 395 LEU n 
1 396 PRO n 
1 397 GLY n 
1 398 THR n 
1 399 LEU n 
1 400 CYS n 
1 401 SER n 
1 402 GLU n 
1 403 LYS n 
1 404 MET n 
1 405 ALA n 
1 406 LEU n 
1 407 SER n 
1 408 THR n 
1 409 ALA n 
1 410 SER n 
1 411 ASP n 
1 412 ASP n 
1 413 ARG n 
1 414 CYS n 
1 415 TRP n 
1 416 ASN n 
1 417 GLY n 
1 418 MET n 
1 419 ALA n 
1 420 ARG n 
1 421 GLY n 
1 422 ARG n 
1 423 TYR n 
1 424 LEU n 
1 425 PRO n 
1 426 GLU n 
1 427 VAL n 
1 428 MET n 
1 429 GLY n 
1 430 ASP n 
1 431 GLY n 
1 432 LEU n 
1 433 ALA n 
1 434 ASN n 
1 435 GLN n 
1 436 ILE n 
1 437 ASN n 
1 438 ASN n 
1 439 PRO n 
1 440 GLU n 
1 441 VAL n 
1 442 GLU n 
1 443 VAL n 
1 444 ASP n 
1 445 ILE n 
1 446 THR n 
1 447 LYS n 
1 448 PRO n 
1 449 ASP n 
1 450 MET n 
1 451 THR n 
1 452 ILE n 
1 453 ARG n 
1 454 GLN n 
1 455 GLN n 
1 456 ILE n 
1 457 MET n 
1 458 GLN n 
1 459 LEU n 
1 460 LYS n 
1 461 ILE n 
1 462 MET n 
1 463 THR n 
1 464 ASN n 
1 465 ARG n 
1 466 LEU n 
1 467 ARG n 
1 468 SER n 
1 469 ALA n 
1 470 TYR n 
1 471 ASN n 
1 472 GLY n 
1 473 ASN n 
1 474 ASP n 
1 475 VAL n 
1 476 ASP n 
1 477 PHE n 
1 478 GLN n 
1 479 ASP n 
1 480 ALA n 
1 481 SER n 
1 482 ASP n 
1 483 ASP n 
1 484 GLY n 
1 485 SER n 
1 486 GLY n 
1 487 SER n 
1 488 GLY n 
1 489 SER n 
1 490 GLY n 
1 491 ASP n 
1 492 GLY n 
1 493 CYS n 
1 494 LEU n 
1 495 ASP n 
1 496 ASP n 
1 497 LEU n 
1 498 CYS n 
1 499 SER n 
1 500 ARG n 
1 501 LYS n 
1 502 VAL n 
1 503 SER n 
1 504 ARG n 
1 505 LYS n 
1 506 SER n 
1 507 SER n 
1 508 SER n 
1 509 SER n 
1 510 ARG n 
1 511 THR n 
1 512 PRO n 
1 513 LEU n 
1 514 THR n 
1 515 HIS n 
1 516 ALA n 
1 517 LEU n 
1 518 PRO n 
1 519 GLY n 
1 520 LEU n 
1 521 SER n 
1 522 GLU n 
1 523 GLN n 
1 524 GLU n 
1 525 GLY n 
1 526 GLN n 
1 527 LYS n 
1 528 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCEP4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GPC1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P35052 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4AD7 A 23 ? 528 ? P35052 24 ? 529 ? 24 529 
2 1 4AD7 B 23 ? 528 ? P35052 24 ? 529 ? 24 529 
3 1 4AD7 C 23 ? 528 ? P35052 24 ? 529 ? 24 529 
4 1 4AD7 D 23 ? 528 ? P35052 24 ? 529 ? 24 529 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4AD7 ALA A 1  ? UNP P35052 ? ? 'expression tag' 2  1  
1 4AD7 PRO A 2  ? UNP P35052 ? ? 'expression tag' 3  2  
1 4AD7 GLN A 3  ? UNP P35052 ? ? 'expression tag' 4  3  
1 4AD7 LEU A 4  ? UNP P35052 ? ? 'expression tag' 5  4  
1 4AD7 HIS A 5  ? UNP P35052 ? ? 'expression tag' 6  5  
1 4AD7 HIS A 6  ? UNP P35052 ? ? 'expression tag' 7  6  
1 4AD7 HIS A 7  ? UNP P35052 ? ? 'expression tag' 8  7  
1 4AD7 HIS A 8  ? UNP P35052 ? ? 'expression tag' 9  8  
1 4AD7 HIS A 9  ? UNP P35052 ? ? 'expression tag' 10 9  
1 4AD7 HIS A 10 ? UNP P35052 ? ? 'expression tag' 11 10 
1 4AD7 ASP A 11 ? UNP P35052 ? ? 'expression tag' 12 11 
1 4AD7 LEU A 12 ? UNP P35052 ? ? 'expression tag' 13 12 
1 4AD7 TYR A 13 ? UNP P35052 ? ? 'expression tag' 14 13 
1 4AD7 GLU A 14 ? UNP P35052 ? ? 'expression tag' 15 14 
1 4AD7 ASN A 15 ? UNP P35052 ? ? 'expression tag' 16 15 
1 4AD7 LEU A 16 ? UNP P35052 ? ? 'expression tag' 17 16 
1 4AD7 TYR A 17 ? UNP P35052 ? ? 'expression tag' 18 17 
1 4AD7 PHE A 18 ? UNP P35052 ? ? 'expression tag' 19 18 
1 4AD7 GLN A 19 ? UNP P35052 ? ? 'expression tag' 20 19 
1 4AD7 GLY A 20 ? UNP P35052 ? ? 'expression tag' 21 20 
1 4AD7 LYS A 21 ? UNP P35052 ? ? 'expression tag' 22 21 
1 4AD7 LEU A 22 ? UNP P35052 ? ? 'expression tag' 23 22 
2 4AD7 ALA B 1  ? UNP P35052 ? ? 'expression tag' 2  23 
2 4AD7 PRO B 2  ? UNP P35052 ? ? 'expression tag' 3  24 
2 4AD7 GLN B 3  ? UNP P35052 ? ? 'expression tag' 4  25 
2 4AD7 LEU B 4  ? UNP P35052 ? ? 'expression tag' 5  26 
2 4AD7 HIS B 5  ? UNP P35052 ? ? 'expression tag' 6  27 
2 4AD7 HIS B 6  ? UNP P35052 ? ? 'expression tag' 7  28 
2 4AD7 HIS B 7  ? UNP P35052 ? ? 'expression tag' 8  29 
2 4AD7 HIS B 8  ? UNP P35052 ? ? 'expression tag' 9  30 
2 4AD7 HIS B 9  ? UNP P35052 ? ? 'expression tag' 10 31 
2 4AD7 HIS B 10 ? UNP P35052 ? ? 'expression tag' 11 32 
2 4AD7 ASP B 11 ? UNP P35052 ? ? 'expression tag' 12 33 
2 4AD7 LEU B 12 ? UNP P35052 ? ? 'expression tag' 13 34 
2 4AD7 TYR B 13 ? UNP P35052 ? ? 'expression tag' 14 35 
2 4AD7 GLU B 14 ? UNP P35052 ? ? 'expression tag' 15 36 
2 4AD7 ASN B 15 ? UNP P35052 ? ? 'expression tag' 16 37 
2 4AD7 LEU B 16 ? UNP P35052 ? ? 'expression tag' 17 38 
2 4AD7 TYR B 17 ? UNP P35052 ? ? 'expression tag' 18 39 
2 4AD7 PHE B 18 ? UNP P35052 ? ? 'expression tag' 19 40 
2 4AD7 GLN B 19 ? UNP P35052 ? ? 'expression tag' 20 41 
2 4AD7 GLY B 20 ? UNP P35052 ? ? 'expression tag' 21 42 
2 4AD7 LYS B 21 ? UNP P35052 ? ? 'expression tag' 22 43 
2 4AD7 LEU B 22 ? UNP P35052 ? ? 'expression tag' 23 44 
3 4AD7 ALA C 1  ? UNP P35052 ? ? 'expression tag' 2  45 
3 4AD7 PRO C 2  ? UNP P35052 ? ? 'expression tag' 3  46 
3 4AD7 GLN C 3  ? UNP P35052 ? ? 'expression tag' 4  47 
3 4AD7 LEU C 4  ? UNP P35052 ? ? 'expression tag' 5  48 
3 4AD7 HIS C 5  ? UNP P35052 ? ? 'expression tag' 6  49 
3 4AD7 HIS C 6  ? UNP P35052 ? ? 'expression tag' 7  50 
3 4AD7 HIS C 7  ? UNP P35052 ? ? 'expression tag' 8  51 
3 4AD7 HIS C 8  ? UNP P35052 ? ? 'expression tag' 9  52 
3 4AD7 HIS C 9  ? UNP P35052 ? ? 'expression tag' 10 53 
3 4AD7 HIS C 10 ? UNP P35052 ? ? 'expression tag' 11 54 
3 4AD7 ASP C 11 ? UNP P35052 ? ? 'expression tag' 12 55 
3 4AD7 LEU C 12 ? UNP P35052 ? ? 'expression tag' 13 56 
3 4AD7 TYR C 13 ? UNP P35052 ? ? 'expression tag' 14 57 
3 4AD7 GLU C 14 ? UNP P35052 ? ? 'expression tag' 15 58 
3 4AD7 ASN C 15 ? UNP P35052 ? ? 'expression tag' 16 59 
3 4AD7 LEU C 16 ? UNP P35052 ? ? 'expression tag' 17 60 
3 4AD7 TYR C 17 ? UNP P35052 ? ? 'expression tag' 18 61 
3 4AD7 PHE C 18 ? UNP P35052 ? ? 'expression tag' 19 62 
3 4AD7 GLN C 19 ? UNP P35052 ? ? 'expression tag' 20 63 
3 4AD7 GLY C 20 ? UNP P35052 ? ? 'expression tag' 21 64 
3 4AD7 LYS C 21 ? UNP P35052 ? ? 'expression tag' 22 65 
3 4AD7 LEU C 22 ? UNP P35052 ? ? 'expression tag' 23 66 
4 4AD7 ALA D 1  ? UNP P35052 ? ? 'expression tag' 2  67 
4 4AD7 PRO D 2  ? UNP P35052 ? ? 'expression tag' 3  68 
4 4AD7 GLN D 3  ? UNP P35052 ? ? 'expression tag' 4  69 
4 4AD7 LEU D 4  ? UNP P35052 ? ? 'expression tag' 5  70 
4 4AD7 HIS D 5  ? UNP P35052 ? ? 'expression tag' 6  71 
4 4AD7 HIS D 6  ? UNP P35052 ? ? 'expression tag' 7  72 
4 4AD7 HIS D 7  ? UNP P35052 ? ? 'expression tag' 8  73 
4 4AD7 HIS D 8  ? UNP P35052 ? ? 'expression tag' 9  74 
4 4AD7 HIS D 9  ? UNP P35052 ? ? 'expression tag' 10 75 
4 4AD7 HIS D 10 ? UNP P35052 ? ? 'expression tag' 11 76 
4 4AD7 ASP D 11 ? UNP P35052 ? ? 'expression tag' 12 77 
4 4AD7 LEU D 12 ? UNP P35052 ? ? 'expression tag' 13 78 
4 4AD7 TYR D 13 ? UNP P35052 ? ? 'expression tag' 14 79 
4 4AD7 GLU D 14 ? UNP P35052 ? ? 'expression tag' 15 80 
4 4AD7 ASN D 15 ? UNP P35052 ? ? 'expression tag' 16 81 
4 4AD7 LEU D 16 ? UNP P35052 ? ? 'expression tag' 17 82 
4 4AD7 TYR D 17 ? UNP P35052 ? ? 'expression tag' 18 83 
4 4AD7 PHE D 18 ? UNP P35052 ? ? 'expression tag' 19 84 
4 4AD7 GLN D 19 ? UNP P35052 ? ? 'expression tag' 20 85 
4 4AD7 GLY D 20 ? UNP P35052 ? ? 'expression tag' 21 86 
4 4AD7 LYS D 21 ? UNP P35052 ? ? 'expression tag' 22 87 
4 4AD7 LEU D 22 ? UNP P35052 ? ? 'expression tag' 23 88 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4AD7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.7 
_exptl_crystal.density_percent_sol   54 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '12-14% PEG 6000, 0.1 M TRIS-HCL, 0.2 M CACL2, PH 8.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2011-07-01 
_diffrn_detector.details                'HORIZONTALLY FOCUSING MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'BENT SI(111) CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0397 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-2' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-2 
_diffrn_source.pdbx_wavelength             1.0397 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4AD7 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.95 
_reflns.number_obs                   49679 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.40 
_reflns.B_iso_Wilson_estimate        52.52 
_reflns.pdbx_redundancy              8.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.95 
_reflns_shell.d_res_low              3.03 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           0.83 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.40 
_reflns_shell.pdbx_redundancy        8.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4AD7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     49590 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.757 
_refine.ls_d_res_high                            2.945 
_refine.ls_percent_reflns_obs                    98.99 
_refine.ls_R_factor_obs                          0.2211 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2180 
_refine.ls_R_factor_R_free                       0.2781 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2530 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -12.5448 
_refine.aniso_B[2][2]                            -13.0487 
_refine.aniso_B[3][3]                            25.5935 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.9784 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.309 
_refine.solvent_model_param_bsol                 40.889 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4ACR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.39 
_refine.pdbx_overall_phase_error                 34.58 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        12544 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         84 
_refine_hist.number_atoms_solvent             126 
_refine_hist.number_atoms_total               12754 
_refine_hist.d_res_high                       2.945 
_refine_hist.d_res_low                        29.757 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 12883 'X-RAY DIFFRACTION' ? 
f_angle_d          0.772  ? ? 17381 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.546 ? ? 4848  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.059  ? ? 1927  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 2280  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.9451 3.0017  2209 0.3189 86.00  0.4226 . . 118 . . 
'X-RAY DIFFRACTION' . 3.0017 3.0629  2610 0.2875 100.00 0.3437 . . 159 . . 
'X-RAY DIFFRACTION' . 3.0629 3.1294  2676 0.2564 100.00 0.2961 . . 146 . . 
'X-RAY DIFFRACTION' . 3.1294 3.2022  2554 0.2438 100.00 0.3041 . . 163 . . 
'X-RAY DIFFRACTION' . 3.2022 3.2821  2608 0.2549 100.00 0.2977 . . 147 . . 
'X-RAY DIFFRACTION' . 3.2821 3.3708  2718 0.2479 100.00 0.3663 . . 125 . . 
'X-RAY DIFFRACTION' . 3.3708 3.4698  2613 0.2392 100.00 0.3079 . . 98  . . 
'X-RAY DIFFRACTION' . 3.4698 3.5816  2673 0.2348 100.00 0.2934 . . 124 . . 
'X-RAY DIFFRACTION' . 3.5816 3.7094  2635 0.2222 100.00 0.2942 . . 135 . . 
'X-RAY DIFFRACTION' . 3.7094 3.8576  2619 0.2093 100.00 0.2573 . . 153 . . 
'X-RAY DIFFRACTION' . 3.8576 4.0328  2647 0.2026 100.00 0.2555 . . 133 . . 
'X-RAY DIFFRACTION' . 4.0328 4.2448  2646 0.1876 100.00 0.2679 . . 139 . . 
'X-RAY DIFFRACTION' . 4.2448 4.5099  2610 0.1847 100.00 0.2530 . . 158 . . 
'X-RAY DIFFRACTION' . 4.5099 4.8568  2638 0.1692 100.00 0.2211 . . 139 . . 
'X-RAY DIFFRACTION' . 4.8568 5.3430  2672 0.1966 100.00 0.2748 . . 140 . . 
'X-RAY DIFFRACTION' . 5.3430 6.1103  2653 0.2198 100.00 0.2865 . . 131 . . 
'X-RAY DIFFRACTION' . 6.1103 7.6764  2644 0.2347 100.00 0.2846 . . 167 . . 
'X-RAY DIFFRACTION' . 7.6764 29.7587 2635 0.2108 99.00  0.2489 . . 155 . . 
# 
_struct.entry_id                  4AD7 
_struct.title                     'Crystal structure of full-length N-glycosylated human glypican-1' 
_struct.pdbx_descriptor           GLYPICAN-1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4AD7 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
'MEMBRANE PROTEIN, PROTEOGLYCAN, GLYCOSAMINOGLYCANS, HEPARAN SULFATE, HELICAL BUNDLE, GLYCOPROTEIN, SUGAR BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  CYS A 31  ? LYS A 41  ? CYS A 32  LYS A 42  1 ? 11 
HELX_P HELX_P2  2  THR A 69  ? PHE A 129 ? THR A 70  PHE A 130 1 ? 61 
HELX_P HELX_P3  3  GLY A 130 ? ARG A 152 ? GLY A 131 ARG A 153 1 ? 23 
HELX_P HELX_P4  4  HIS A 157 ? GLU A 171 ? HIS A 158 GLU A 172 1 ? 15 
HELX_P HELX_P5  5  ARG A 206 ? ALA A 237 ? ARG A 207 ALA A 238 1 ? 32 
HELX_P HELX_P6  6  GLY A 242 ? TYR A 254 ? GLY A 243 TYR A 255 1 ? 13 
HELX_P HELX_P7  7  TYR A 254 ? LEU A 259 ? TYR A 255 LEU A 260 1 ? 6  
HELX_P HELX_P8  8  CYS A 267 ? LEU A 279 ? CYS A 268 LEU A 280 1 ? 13 
HELX_P HELX_P9  9  ASN A 281 ? ASP A 284 ? ASN A 282 ASP A 285 5 ? 4  
HELX_P HELX_P10 10 LEU A 285 ? THR A 300 ? LEU A 286 THR A 301 1 ? 16 
HELX_P HELX_P11 11 ASP A 301 ? TRP A 304 ? ASP A 302 TRP A 305 5 ? 4  
HELX_P HELX_P12 12 GLY A 308 ? SER A 315 ? GLY A 309 SER A 316 1 ? 8  
HELX_P HELX_P13 13 THR A 373 ? GLN A 389 ? THR A 374 GLN A 390 1 ? 17 
HELX_P HELX_P14 14 ASP A 390 ? GLU A 402 ? ASP A 391 GLU A 403 1 ? 13 
HELX_P HELX_P15 15 LEU A 432 ? ILE A 436 ? LEU A 433 ILE A 437 5 ? 5  
HELX_P HELX_P16 16 ASP A 449 ? GLY A 472 ? ASP A 450 GLY A 473 1 ? 24 
HELX_P HELX_P17 17 CYS B 31  ? LYS B 41  ? CYS B 32  LYS B 42  1 ? 11 
HELX_P HELX_P18 18 SER B 44  ? VAL B 48  ? SER B 45  VAL B 49  5 ? 5  
HELX_P HELX_P19 19 THR B 69  ? PHE B 129 ? THR B 70  PHE B 130 1 ? 61 
HELX_P HELX_P20 20 GLY B 130 ? GLN B 135 ? GLY B 131 GLN B 136 1 ? 6  
HELX_P HELX_P21 21 ASN B 136 ? GLY B 153 ? ASN B 137 GLY B 154 1 ? 18 
HELX_P HELX_P22 22 LEU B 158 ? HIS B 178 ? LEU B 159 HIS B 179 1 ? 21 
HELX_P HELX_P23 23 ASP B 185 ? ARG B 199 ? ASP B 186 ARG B 200 1 ? 15 
HELX_P HELX_P24 24 GLU B 203 ? ALA B 237 ? GLU B 204 ALA B 238 1 ? 35 
HELX_P HELX_P25 25 GLY B 242 ? TYR B 254 ? GLY B 243 TYR B 255 1 ? 13 
HELX_P HELX_P26 26 TYR B 254 ? LEU B 259 ? TYR B 255 LEU B 260 1 ? 6  
HELX_P HELX_P27 27 CYS B 267 ? ASP B 284 ? CYS B 268 ASP B 285 1 ? 18 
HELX_P HELX_P28 28 LEU B 285 ? ILE B 299 ? LEU B 286 ILE B 300 1 ? 15 
HELX_P HELX_P29 29 THR B 300 ? TRP B 304 ? THR B 301 TRP B 305 5 ? 5  
HELX_P HELX_P30 30 GLY B 308 ? GLY B 343 ? GLY B 309 GLY B 344 1 ? 36 
HELX_P HELX_P31 31 GLY B 372 ? VAL B 388 ? GLY B 373 VAL B 389 1 ? 17 
HELX_P HELX_P32 32 SER B 394 ? LYS B 403 ? SER B 395 LYS B 404 1 ? 10 
HELX_P HELX_P33 33 LEU B 432 ? ILE B 436 ? LEU B 433 ILE B 437 5 ? 5  
HELX_P HELX_P34 34 ASP B 449 ? ASN B 471 ? ASP B 450 ASN B 472 1 ? 23 
HELX_P HELX_P35 35 CYS C 31  ? LYS C 41  ? CYS C 32  LYS C 42  1 ? 11 
HELX_P HELX_P36 36 THR C 69  ? GLY C 130 ? THR C 70  GLY C 131 1 ? 62 
HELX_P HELX_P37 37 GLY C 130 ? GLN C 135 ? GLY C 131 GLN C 136 1 ? 6  
HELX_P HELX_P38 38 ASN C 136 ? ARG C 152 ? ASN C 137 ARG C 153 1 ? 17 
HELX_P HELX_P39 39 LEU C 158 ? HIS C 178 ? LEU C 159 HIS C 179 1 ? 21 
HELX_P HELX_P40 40 GLU C 203 ? ALA C 237 ? GLU C 204 ALA C 238 1 ? 35 
HELX_P HELX_P41 41 GLY C 242 ? TYR C 254 ? GLY C 243 TYR C 255 1 ? 13 
HELX_P HELX_P42 42 TYR C 254 ? LEU C 259 ? TYR C 255 LEU C 260 1 ? 6  
HELX_P HELX_P43 43 CYS C 267 ? LEU C 279 ? CYS C 268 LEU C 280 1 ? 13 
HELX_P HELX_P44 44 LEU C 279 ? ASP C 284 ? LEU C 280 ASP C 285 1 ? 6  
HELX_P HELX_P45 45 LEU C 285 ? ILE C 299 ? LEU C 286 ILE C 300 1 ? 15 
HELX_P HELX_P46 46 THR C 300 ? PHE C 303 ? THR C 301 PHE C 304 5 ? 4  
HELX_P HELX_P47 47 SER C 315 ? ASN C 330 ? SER C 316 ASN C 331 1 ? 16 
HELX_P HELX_P48 48 GLY C 372 ? GLN C 389 ? GLY C 373 GLN C 390 1 ? 18 
HELX_P HELX_P49 49 ASP C 390 ? LYS C 403 ? ASP C 391 LYS C 404 1 ? 14 
HELX_P HELX_P50 50 LEU C 432 ? ILE C 436 ? LEU C 433 ILE C 437 5 ? 5  
HELX_P HELX_P51 51 ASP C 449 ? GLY C 472 ? ASP C 450 GLY C 473 1 ? 24 
HELX_P HELX_P52 52 CYS D 31  ? ALA D 40  ? CYS D 32  ALA D 41  1 ? 10 
HELX_P HELX_P53 53 THR D 69  ? PHE D 129 ? THR D 70  PHE D 130 1 ? 61 
HELX_P HELX_P54 54 GLY D 130 ? GLN D 135 ? GLY D 131 GLN D 136 1 ? 6  
HELX_P HELX_P55 55 ASN D 136 ? ARG D 152 ? ASN D 137 ARG D 153 1 ? 17 
HELX_P HELX_P56 56 HIS D 157 ? HIS D 178 ? HIS D 158 HIS D 179 1 ? 22 
HELX_P HELX_P57 57 ASP D 185 ? ARG D 199 ? ASP D 186 ARG D 200 1 ? 15 
HELX_P HELX_P58 58 GLU D 203 ? GLN D 238 ? GLU D 204 GLN D 239 1 ? 36 
HELX_P HELX_P59 59 GLY D 242 ? VAL D 253 ? GLY D 243 VAL D 254 1 ? 12 
HELX_P HELX_P60 60 TYR D 254 ? LEU D 259 ? TYR D 255 LEU D 260 1 ? 6  
HELX_P HELX_P61 61 CYS D 267 ? LEU D 279 ? CYS D 268 LEU D 280 1 ? 13 
HELX_P HELX_P62 62 LEU D 279 ? ASP D 284 ? LEU D 280 ASP D 285 1 ? 6  
HELX_P HELX_P63 63 LEU D 285 ? THR D 300 ? LEU D 286 THR D 301 1 ? 16 
HELX_P HELX_P64 64 ASP D 301 ? TRP D 304 ? ASP D 302 TRP D 305 5 ? 4  
HELX_P HELX_P65 65 GLY D 308 ? GLY D 343 ? GLY D 309 GLY D 344 1 ? 36 
HELX_P HELX_P66 66 THR D 373 ? VAL D 388 ? THR D 374 VAL D 389 1 ? 16 
HELX_P HELX_P67 67 SER D 394 ? LYS D 403 ? SER D 395 LYS D 404 1 ? 10 
HELX_P HELX_P68 68 LEU D 432 ? ILE D 436 ? LEU D 433 ILE D 437 5 ? 5  
HELX_P HELX_P69 69 ASP D 449 ? ASN D 471 ? ASP D 450 ASN D 472 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 31  SG  ? ? ? 1_555 A CYS 67  SG ? ? A CYS 32  A CYS 68   1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2  disulf ?   ? A CYS 61  SG  ? ? ? 1_555 A CYS 255 SG ? ? A CYS 62  A CYS 256  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf3  disulf ?   ? A CYS 68  SG  ? ? ? 1_555 A CYS 258 SG ? ? A CYS 69  A CYS 259  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf4  disulf ?   ? A CYS 245 SG  ? ? ? 1_555 A CYS 278 SG ? ? A CYS 246 A CYS 279  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf5  disulf ?   ? A CYS 267 SG  ? ? ? 1_555 A CYS 414 SG ? ? A CYS 268 A CYS 415  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf6  disulf ?   ? A CYS 271 SG  ? ? ? 1_555 A CYS 400 SG ? ? A CYS 272 A CYS 401  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf7  disulf ?   ? B CYS 31  SG  ? ? ? 1_555 B CYS 67  SG ? ? B CYS 32  B CYS 68   1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf8  disulf ?   ? B CYS 61  SG  ? ? ? 1_555 B CYS 255 SG ? ? B CYS 62  B CYS 256  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf9  disulf ?   ? B CYS 68  SG  ? ? ? 1_555 B CYS 258 SG ? ? B CYS 69  B CYS 259  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf10 disulf ?   ? B CYS 190 SG  ? ? ? 1_555 B CYS 342 SG ? ? B CYS 191 B CYS 343  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf11 disulf ?   ? B CYS 245 SG  ? ? ? 1_555 B CYS 278 SG ? ? B CYS 246 B CYS 279  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf12 disulf ?   ? B CYS 267 SG  ? ? ? 1_555 B CYS 414 SG ? ? B CYS 268 B CYS 415  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf13 disulf ?   ? B CYS 271 SG  ? ? ? 1_555 B CYS 400 SG ? ? B CYS 272 B CYS 401  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf14 disulf ?   ? C CYS 31  SG  ? ? ? 1_555 C CYS 67  SG ? ? C CYS 32  C CYS 68   1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf15 disulf ?   ? C CYS 61  SG  ? ? ? 1_555 C CYS 255 SG ? ? C CYS 62  C CYS 256  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf16 disulf ?   ? C CYS 68  SG  ? ? ? 1_555 C CYS 258 SG ? ? C CYS 69  C CYS 259  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf17 disulf ?   ? C CYS 245 SG  ? ? ? 1_555 C CYS 278 SG ? ? C CYS 246 C CYS 279  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf18 disulf ?   ? C CYS 267 SG  ? ? ? 1_555 C CYS 414 SG ? ? C CYS 268 C CYS 415  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf19 disulf ?   ? C CYS 271 SG  ? ? ? 1_555 C CYS 400 SG ? ? C CYS 272 C CYS 401  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf20 disulf ?   ? D CYS 31  SG  ? ? ? 1_555 D CYS 67  SG ? ? D CYS 32  D CYS 68   1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf21 disulf ?   ? D CYS 61  SG  ? ? ? 1_555 D CYS 255 SG ? ? D CYS 62  D CYS 256  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf22 disulf ?   ? D CYS 68  SG  ? ? ? 1_555 D CYS 258 SG ? ? D CYS 69  D CYS 259  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf23 disulf ?   ? D CYS 190 SG  ? ? ? 1_555 D CYS 342 SG ? ? D CYS 191 D CYS 343  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf24 disulf ?   ? D CYS 245 SG  ? ? ? 1_555 D CYS 278 SG ? ? D CYS 246 D CYS 279  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf25 disulf ?   ? D CYS 267 SG  ? ? ? 1_555 D CYS 414 SG ? ? D CYS 268 D CYS 415  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf26 disulf ?   ? D CYS 271 SG  ? ? ? 1_555 D CYS 400 SG ? ? D CYS 272 D CYS 401  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale1  covale one ? A ASN 115 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 116 A NAG 1501 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale2  covale one ? B ASN 78  ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 79  B NAG 1500 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale3  covale one ? B ASN 115 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 116 B NAG 1501 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale4  covale one ? C ASN 115 ND2 ? ? ? 1_555 H NAG .   C1 ? ? C ASN 116 C NAG 1501 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale5  covale one ? D ASN 78  ND2 ? ? ? 1_555 I NAG .   C1 ? ? D ASN 79  D NAG 1500 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale6  covale one ? D ASN 115 ND2 ? ? ? 1_555 J NAG .   C1 ? ? D ASN 116 D NAG 1501 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           204 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            205 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    205 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     206 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
CA ? 2 ? 
DA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 CYS A 414 ? TRP A 415 ? CYS A 415 TRP A 416 
AA 2 ARG A 420 ? GLY A 421 ? ARG A 421 GLY A 422 
CA 1 CYS C 414 ? TRP C 415 ? CYS C 415 TRP C 416 
CA 2 ARG C 420 ? GLY C 421 ? ARG C 421 GLY C 422 
DA 1 CYS D 414 ? TRP D 415 ? CYS D 415 TRP D 416 
DA 2 ARG D 420 ? GLY D 421 ? ARG D 421 GLY D 422 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N CYS A 414 ? N CYS A 415 O GLY A 421 ? O GLY A 422 
CA 1 2 N CYS C 414 ? N CYS C 415 O GLY C 421 ? O GLY C 422 
DA 1 2 N CYS D 414 ? N CYS D 415 O GLY D 421 ? O GLY D 422 
# 
_database_PDB_matrix.entry_id          4AD7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4AD7 
_atom_sites.fract_transf_matrix[1][1]   0.021164 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001837 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005910 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006616 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . SER A 1 28  ? 1.996   -40.457 172.869 1.00 83.69  ? 29   SER A N   1 
ATOM   2     C CA  . SER A 1 28  ? 1.109   -39.301 172.809 1.00 97.94  ? 29   SER A CA  1 
ATOM   3     C C   . SER A 1 28  ? 0.429   -39.049 174.154 1.00 103.10 ? 29   SER A C   1 
ATOM   4     O O   . SER A 1 28  ? 0.330   -39.952 174.985 1.00 115.16 ? 29   SER A O   1 
ATOM   5     C CB  . SER A 1 28  ? 0.061   -39.486 171.708 1.00 98.56  ? 29   SER A CB  1 
ATOM   6     O OG  . SER A 1 28  ? 0.673   -39.631 170.438 1.00 93.81  ? 29   SER A OG  1 
ATOM   7     N N   . ARG A 1 29  ? -0.019  -37.811 174.357 1.00 90.83  ? 30   ARG A N   1 
ATOM   8     C CA  . ARG A 1 29  ? -0.724  -37.394 175.574 1.00 86.80  ? 30   ARG A CA  1 
ATOM   9     C C   . ARG A 1 29  ? 0.087   -37.602 176.853 1.00 95.88  ? 30   ARG A C   1 
ATOM   10    O O   . ARG A 1 29  ? -0.477  -37.696 177.943 1.00 73.84  ? 30   ARG A O   1 
ATOM   11    C CB  . ARG A 1 29  ? -2.077  -38.104 175.704 1.00 86.57  ? 30   ARG A CB  1 
ATOM   12    C CG  . ARG A 1 29  ? -3.086  -37.778 174.614 1.00 76.98  ? 30   ARG A CG  1 
ATOM   13    C CD  . ARG A 1 29  ? -4.450  -38.348 174.974 1.00 76.51  ? 30   ARG A CD  1 
ATOM   14    N NE  . ARG A 1 29  ? -5.439  -38.163 173.916 1.00 89.90  ? 30   ARG A NE  1 
ATOM   15    C CZ  . ARG A 1 29  ? -6.706  -38.551 174.011 1.00 94.14  ? 30   ARG A CZ  1 
ATOM   16    N NH1 . ARG A 1 29  ? -7.135  -39.143 175.118 1.00 91.75  ? 30   ARG A NH1 1 
ATOM   17    N NH2 . ARG A 1 29  ? -7.545  -38.348 173.005 1.00 102.22 ? 30   ARG A NH2 1 
ATOM   18    N N   . SER A 1 30  ? 1.408   -37.654 176.725 1.00 105.19 ? 31   SER A N   1 
ATOM   19    C CA  . SER A 1 30  ? 2.267   -37.882 177.880 1.00 112.40 ? 31   SER A CA  1 
ATOM   20    C C   . SER A 1 30  ? 2.980   -36.603 178.293 1.00 119.59 ? 31   SER A C   1 
ATOM   21    O O   . SER A 1 30  ? 3.427   -35.828 177.448 1.00 123.71 ? 31   SER A O   1 
ATOM   22    C CB  . SER A 1 30  ? 3.286   -38.985 177.586 1.00 115.58 ? 31   SER A CB  1 
ATOM   23    O OG  . SER A 1 30  ? 2.640   -40.228 177.369 1.00 118.29 ? 31   SER A OG  1 
ATOM   24    N N   . CYS A 1 31  ? 3.092   -36.393 179.600 1.00 118.96 ? 32   CYS A N   1 
ATOM   25    C CA  . CYS A 1 31  ? 3.696   -35.179 180.134 1.00 113.49 ? 32   CYS A CA  1 
ATOM   26    C C   . CYS A 1 31  ? 5.186   -35.338 180.413 1.00 109.33 ? 32   CYS A C   1 
ATOM   27    O O   . CYS A 1 31  ? 5.806   -34.441 180.971 1.00 101.76 ? 32   CYS A O   1 
ATOM   28    C CB  . CYS A 1 31  ? 2.968   -34.723 181.400 1.00 108.24 ? 32   CYS A CB  1 
ATOM   29    S SG  . CYS A 1 31  ? 1.416   -33.847 181.096 1.00 94.40  ? 32   CYS A SG  1 
ATOM   30    N N   . GLY A 1 32  ? 5.745   -36.484 180.037 1.00 111.13 ? 33   GLY A N   1 
ATOM   31    C CA  . GLY A 1 32  ? 7.142   -36.789 180.305 1.00 109.37 ? 33   GLY A CA  1 
ATOM   32    C C   . GLY A 1 32  ? 8.149   -35.734 179.871 1.00 103.98 ? 33   GLY A C   1 
ATOM   33    O O   . GLY A 1 32  ? 8.963   -35.277 180.675 1.00 110.70 ? 33   GLY A O   1 
ATOM   34    N N   . GLU A 1 33  ? 8.087   -35.334 178.605 1.00 95.72  ? 34   GLU A N   1 
ATOM   35    C CA  . GLU A 1 33  ? 9.053   -34.387 178.052 1.00 89.67  ? 34   GLU A CA  1 
ATOM   36    C C   . GLU A 1 33  ? 8.919   -32.997 178.673 1.00 98.75  ? 34   GLU A C   1 
ATOM   37    O O   . GLU A 1 33  ? 9.915   -32.366 179.036 1.00 108.34 ? 34   GLU A O   1 
ATOM   38    C CB  . GLU A 1 33  ? 8.917   -34.310 176.530 1.00 86.19  ? 34   GLU A CB  1 
ATOM   39    C CG  . GLU A 1 33  ? 9.898   -33.350 175.876 1.00 103.52 ? 34   GLU A CG  1 
ATOM   40    C CD  . GLU A 1 33  ? 9.876   -33.438 174.362 1.00 113.17 ? 34   GLU A CD  1 
ATOM   41    O OE1 . GLU A 1 33  ? 9.290   -34.407 173.836 1.00 109.61 ? 34   GLU A OE1 1 
ATOM   42    O OE2 . GLU A 1 33  ? 10.444  -32.542 173.699 1.00 111.24 ? 34   GLU A OE2 1 
ATOM   43    N N   . VAL A 1 34  ? 7.679   -32.532 178.794 1.00 97.65  ? 35   VAL A N   1 
ATOM   44    C CA  . VAL A 1 34  ? 7.392   -31.247 179.427 1.00 83.95  ? 35   VAL A CA  1 
ATOM   45    C C   . VAL A 1 34  ? 7.840   -31.252 180.888 1.00 88.05  ? 35   VAL A C   1 
ATOM   46    O O   . VAL A 1 34  ? 8.286   -30.238 181.414 1.00 81.17  ? 35   VAL A O   1 
ATOM   47    C CB  . VAL A 1 34  ? 5.891   -30.888 179.326 1.00 73.18  ? 35   VAL A CB  1 
ATOM   48    C CG1 . VAL A 1 34  ? 5.570   -29.654 180.160 1.00 65.24  ? 35   VAL A CG1 1 
ATOM   49    C CG2 . VAL A 1 34  ? 5.495   -30.668 177.872 1.00 73.60  ? 35   VAL A CG2 1 
ATOM   50    N N   . ARG A 1 35  ? 7.734   -32.410 181.530 1.00 97.72  ? 36   ARG A N   1 
ATOM   51    C CA  . ARG A 1 35  ? 8.186   -32.584 182.903 1.00 101.40 ? 36   ARG A CA  1 
ATOM   52    C C   . ARG A 1 35  ? 9.702   -32.500 182.937 1.00 104.42 ? 36   ARG A C   1 
ATOM   53    O O   . ARG A 1 35  ? 10.289  -31.984 183.886 1.00 108.29 ? 36   ARG A O   1 
ATOM   54    C CB  . ARG A 1 35  ? 7.736   -33.943 183.444 1.00 103.73 ? 36   ARG A CB  1 
ATOM   55    C CG  . ARG A 1 35  ? 8.218   -34.234 184.853 1.00 111.92 ? 36   ARG A CG  1 
ATOM   56    C CD  . ARG A 1 35  ? 8.179   -35.722 185.142 1.00 122.58 ? 36   ARG A CD  1 
ATOM   57    N NE  . ARG A 1 35  ? 8.524   -36.027 186.527 1.00 133.93 ? 36   ARG A NE  1 
ATOM   58    C CZ  . ARG A 1 35  ? 7.631   -36.295 187.475 1.00 144.79 ? 36   ARG A CZ  1 
ATOM   59    N NH1 . ARG A 1 35  ? 6.337   -36.296 187.187 1.00 144.87 ? 36   ARG A NH1 1 
ATOM   60    N NH2 . ARG A 1 35  ? 8.032   -36.565 188.710 1.00 148.86 ? 36   ARG A NH2 1 
ATOM   61    N N   . GLN A 1 36  ? 10.327  -33.018 181.884 1.00 103.18 ? 37   GLN A N   1 
ATOM   62    C CA  . GLN A 1 36  ? 11.781  -33.013 181.755 1.00 106.50 ? 37   GLN A CA  1 
ATOM   63    C C   . GLN A 1 36  ? 12.300  -31.583 181.647 1.00 87.77  ? 37   GLN A C   1 
ATOM   64    O O   . GLN A 1 36  ? 13.220  -31.183 182.365 1.00 75.74  ? 37   GLN A O   1 
ATOM   65    C CB  . GLN A 1 36  ? 12.212  -33.834 180.533 1.00 120.62 ? 37   GLN A CB  1 
ATOM   66    C CG  . GLN A 1 36  ? 13.716  -33.936 180.322 1.00 129.01 ? 37   GLN A CG  1 
ATOM   67    C CD  . GLN A 1 36  ? 14.084  -34.824 179.142 1.00 138.16 ? 37   GLN A CD  1 
ATOM   68    O OE1 . GLN A 1 36  ? 13.215  -35.417 178.502 1.00 137.27 ? 37   GLN A OE1 1 
ATOM   69    N NE2 . GLN A 1 36  ? 15.377  -34.917 178.849 1.00 143.53 ? 37   GLN A NE2 1 
ATOM   70    N N   . ILE A 1 37  ? 11.681  -30.812 180.761 1.00 80.96  ? 38   ILE A N   1 
ATOM   71    C CA  . ILE A 1 37  ? 12.064  -29.422 180.543 1.00 80.80  ? 38   ILE A CA  1 
ATOM   72    C C   . ILE A 1 37  ? 11.745  -28.535 181.753 1.00 79.69  ? 38   ILE A C   1 
ATOM   73    O O   . ILE A 1 37  ? 12.553  -27.688 182.145 1.00 79.72  ? 38   ILE A O   1 
ATOM   74    C CB  . ILE A 1 37  ? 11.368  -28.858 179.286 1.00 76.44  ? 38   ILE A CB  1 
ATOM   75    C CG1 . ILE A 1 37  ? 11.634  -29.763 178.079 1.00 84.20  ? 38   ILE A CG1 1 
ATOM   76    C CG2 . ILE A 1 37  ? 11.827  -27.434 179.002 1.00 59.63  ? 38   ILE A CG2 1 
ATOM   77    C CD1 . ILE A 1 37  ? 10.951  -29.305 176.803 1.00 91.52  ? 38   ILE A CD1 1 
ATOM   78    N N   . TYR A 1 38  ? 10.564  -28.735 182.331 1.00 80.30  ? 39   TYR A N   1 
ATOM   79    C CA  . TYR A 1 38  ? 10.121  -27.982 183.501 1.00 81.91  ? 39   TYR A CA  1 
ATOM   80    C C   . TYR A 1 38  ? 11.008  -28.299 184.700 1.00 97.20  ? 39   TYR A C   1 
ATOM   81    O O   . TYR A 1 38  ? 11.201  -27.461 185.582 1.00 93.20  ? 39   TYR A O   1 
ATOM   82    C CB  . TYR A 1 38  ? 8.658   -28.314 183.810 1.00 81.57  ? 39   TYR A CB  1 
ATOM   83    C CG  . TYR A 1 38  ? 8.056   -27.559 184.976 1.00 81.55  ? 39   TYR A CG  1 
ATOM   84    C CD1 . TYR A 1 38  ? 7.556   -26.272 184.816 1.00 83.13  ? 39   TYR A CD1 1 
ATOM   85    C CD2 . TYR A 1 38  ? 7.966   -28.144 186.233 1.00 85.01  ? 39   TYR A CD2 1 
ATOM   86    C CE1 . TYR A 1 38  ? 6.998   -25.585 185.879 1.00 89.48  ? 39   TYR A CE1 1 
ATOM   87    C CE2 . TYR A 1 38  ? 7.409   -27.466 187.299 1.00 86.35  ? 39   TYR A CE2 1 
ATOM   88    C CZ  . TYR A 1 38  ? 6.927   -26.187 187.117 1.00 89.33  ? 39   TYR A CZ  1 
ATOM   89    O OH  . TYR A 1 38  ? 6.372   -25.508 188.178 1.00 92.29  ? 39   TYR A OH  1 
ATOM   90    N N   . GLY A 1 39  ? 11.548  -29.513 184.721 1.00 113.49 ? 40   GLY A N   1 
ATOM   91    C CA  . GLY A 1 39  ? 12.443  -29.941 185.779 1.00 125.11 ? 40   GLY A CA  1 
ATOM   92    C C   . GLY A 1 39  ? 13.841  -29.389 185.587 1.00 128.03 ? 40   GLY A C   1 
ATOM   93    O O   . GLY A 1 39  ? 14.532  -29.071 186.555 1.00 127.39 ? 40   GLY A O   1 
ATOM   94    N N   . ALA A 1 40  ? 14.259  -29.272 184.329 1.00 127.00 ? 41   ALA A N   1 
ATOM   95    C CA  . ALA A 1 40  ? 15.556  -28.684 184.011 1.00 116.78 ? 41   ALA A CA  1 
ATOM   96    C C   . ALA A 1 40  ? 15.578  -27.184 184.306 1.00 121.70 ? 41   ALA A C   1 
ATOM   97    O O   . ALA A 1 40  ? 16.636  -26.555 184.308 1.00 124.57 ? 41   ALA A O   1 
ATOM   98    C CB  . ALA A 1 40  ? 15.915  -28.949 182.557 1.00 101.97 ? 41   ALA A CB  1 
ATOM   99    N N   . LYS A 1 41  ? 14.399  -26.620 184.552 1.00 124.22 ? 42   LYS A N   1 
ATOM   100   C CA  . LYS A 1 41  ? 14.262  -25.211 184.898 1.00 118.90 ? 42   LYS A CA  1 
ATOM   101   C C   . LYS A 1 41  ? 14.541  -25.002 186.383 1.00 113.84 ? 42   LYS A C   1 
ATOM   102   O O   . LYS A 1 41  ? 14.654  -23.869 186.855 1.00 111.02 ? 42   LYS A O   1 
ATOM   103   C CB  . LYS A 1 41  ? 12.853  -24.720 184.564 1.00 117.73 ? 42   LYS A CB  1 
ATOM   104   C CG  . LYS A 1 41  ? 12.815  -23.451 183.732 1.00 111.30 ? 42   LYS A CG  1 
ATOM   105   C CD  . LYS A 1 41  ? 13.361  -23.694 182.335 1.00 107.80 ? 42   LYS A CD  1 
ATOM   106   C CE  . LYS A 1 41  ? 13.421  -22.402 181.542 1.00 102.34 ? 42   LYS A CE  1 
ATOM   107   N NZ  . LYS A 1 41  ? 13.868  -22.621 180.137 1.00 101.83 ? 42   LYS A NZ  1 
ATOM   108   N N   . GLY A 1 42  ? 14.648  -26.107 187.114 1.00 111.43 ? 43   GLY A N   1 
ATOM   109   C CA  . GLY A 1 42  ? 14.919  -26.060 188.538 1.00 114.77 ? 43   GLY A CA  1 
ATOM   110   C C   . GLY A 1 42  ? 13.659  -26.091 189.381 1.00 126.00 ? 43   GLY A C   1 
ATOM   111   O O   . GLY A 1 42  ? 13.726  -26.169 190.606 1.00 132.60 ? 43   GLY A O   1 
ATOM   112   N N   . PHE A 1 43  ? 12.505  -26.030 188.722 1.00 128.18 ? 44   PHE A N   1 
ATOM   113   C CA  . PHE A 1 43  ? 11.222  -26.025 189.419 1.00 123.15 ? 44   PHE A CA  1 
ATOM   114   C C   . PHE A 1 43  ? 10.883  -27.379 190.037 1.00 117.42 ? 44   PHE A C   1 
ATOM   115   O O   . PHE A 1 43  ? 11.433  -28.408 189.644 1.00 114.35 ? 44   PHE A O   1 
ATOM   116   C CB  . PHE A 1 43  ? 10.096  -25.571 188.488 1.00 117.36 ? 44   PHE A CB  1 
ATOM   117   C CG  . PHE A 1 43  ? 10.079  -24.091 188.238 1.00 111.31 ? 44   PHE A CG  1 
ATOM   118   C CD1 . PHE A 1 43  ? 9.650   -23.215 189.222 1.00 109.59 ? 44   PHE A CD1 1 
ATOM   119   C CD2 . PHE A 1 43  ? 10.486  -23.575 187.019 1.00 109.08 ? 44   PHE A CD2 1 
ATOM   120   C CE1 . PHE A 1 43  ? 9.634   -21.851 188.997 1.00 107.17 ? 44   PHE A CE1 1 
ATOM   121   C CE2 . PHE A 1 43  ? 10.470  -22.212 186.787 1.00 106.20 ? 44   PHE A CE2 1 
ATOM   122   C CZ  . PHE A 1 43  ? 10.043  -21.349 187.777 1.00 104.86 ? 44   PHE A CZ  1 
ATOM   123   N N   . SER A 1 44  ? 9.975   -27.362 191.010 1.00 116.83 ? 45   SER A N   1 
ATOM   124   C CA  . SER A 1 44  ? 9.575   -28.570 191.726 1.00 121.43 ? 45   SER A CA  1 
ATOM   125   C C   . SER A 1 44  ? 8.885   -29.584 190.817 1.00 122.68 ? 45   SER A C   1 
ATOM   126   O O   . SER A 1 44  ? 8.118   -29.218 189.926 1.00 122.99 ? 45   SER A O   1 
ATOM   127   C CB  . SER A 1 44  ? 8.664   -28.214 192.904 1.00 125.51 ? 45   SER A CB  1 
ATOM   128   O OG  . SER A 1 44  ? 7.512   -27.514 192.465 1.00 130.23 ? 45   SER A OG  1 
ATOM   129   N N   . LEU A 1 45  ? 9.161   -30.862 191.059 1.00 124.49 ? 46   LEU A N   1 
ATOM   130   C CA  . LEU A 1 45  ? 8.618   -31.943 190.243 1.00 125.32 ? 46   LEU A CA  1 
ATOM   131   C C   . LEU A 1 45  ? 7.346   -32.544 190.840 1.00 134.77 ? 46   LEU A C   1 
ATOM   132   O O   . LEU A 1 45  ? 6.792   -33.501 190.302 1.00 129.64 ? 46   LEU A O   1 
ATOM   133   C CB  . LEU A 1 45  ? 9.673   -33.034 190.043 1.00 113.84 ? 46   LEU A CB  1 
ATOM   134   C CG  . LEU A 1 45  ? 10.943  -32.604 189.307 1.00 92.20  ? 46   LEU A CG  1 
ATOM   135   C CD1 . LEU A 1 45  ? 11.986  -33.711 189.328 1.00 83.68  ? 46   LEU A CD1 1 
ATOM   136   C CD2 . LEU A 1 45  ? 10.613  -32.204 187.880 1.00 80.85  ? 46   LEU A CD2 1 
ATOM   137   N N   . SER A 1 46  ? 6.897   -31.991 191.962 1.00 142.50 ? 47   SER A N   1 
ATOM   138   C CA  . SER A 1 46  ? 5.675   -32.462 192.607 1.00 142.75 ? 47   SER A CA  1 
ATOM   139   C C   . SER A 1 46  ? 4.425   -31.891 191.943 1.00 137.94 ? 47   SER A C   1 
ATOM   140   O O   . SER A 1 46  ? 3.353   -32.494 191.993 1.00 131.27 ? 47   SER A O   1 
ATOM   141   C CB  . SER A 1 46  ? 5.683   -32.109 194.096 1.00 145.52 ? 47   SER A CB  1 
ATOM   142   O OG  . SER A 1 46  ? 5.668   -30.705 194.289 1.00 144.70 ? 47   SER A OG  1 
ATOM   143   N N   . ASP A 1 47  ? 4.571   -30.725 191.322 1.00 143.01 ? 48   ASP A N   1 
ATOM   144   C CA  . ASP A 1 47  ? 3.433   -30.000 190.764 1.00 146.97 ? 48   ASP A CA  1 
ATOM   145   C C   . ASP A 1 47  ? 3.088   -30.398 189.328 1.00 140.50 ? 48   ASP A C   1 
ATOM   146   O O   . ASP A 1 47  ? 2.162   -29.845 188.735 1.00 145.23 ? 48   ASP A O   1 
ATOM   147   C CB  . ASP A 1 47  ? 3.675   -28.490 190.842 1.00 147.94 ? 48   ASP A CB  1 
ATOM   148   C CG  . ASP A 1 47  ? 3.921   -28.011 192.260 1.00 146.92 ? 48   ASP A CG  1 
ATOM   149   O OD1 . ASP A 1 47  ? 3.413   -28.653 193.204 1.00 145.03 ? 48   ASP A OD1 1 
ATOM   150   O OD2 . ASP A 1 47  ? 4.622   -26.991 192.430 1.00 142.88 ? 48   ASP A OD2 1 
ATOM   151   N N   . VAL A 1 48  ? 3.831   -31.349 188.769 1.00 127.55 ? 49   VAL A N   1 
ATOM   152   C CA  . VAL A 1 48  ? 3.597   -31.771 187.389 1.00 116.04 ? 49   VAL A CA  1 
ATOM   153   C C   . VAL A 1 48  ? 2.705   -33.015 187.291 1.00 111.70 ? 49   VAL A C   1 
ATOM   154   O O   . VAL A 1 48  ? 2.942   -34.016 187.968 1.00 106.19 ? 49   VAL A O   1 
ATOM   155   C CB  . VAL A 1 48  ? 4.927   -31.989 186.620 1.00 95.74  ? 49   VAL A CB  1 
ATOM   156   C CG1 . VAL A 1 48  ? 5.818   -32.981 187.346 1.00 108.15 ? 49   VAL A CG1 1 
ATOM   157   C CG2 . VAL A 1 48  ? 4.659   -32.445 185.193 1.00 84.69  ? 49   VAL A CG2 1 
ATOM   158   N N   . PRO A 1 49  ? 1.657   -32.938 186.456 1.00 109.15 ? 50   PRO A N   1 
ATOM   159   C CA  . PRO A 1 49  ? 0.738   -34.057 186.219 1.00 106.70 ? 50   PRO A CA  1 
ATOM   160   C C   . PRO A 1 49  ? 1.394   -35.184 185.427 1.00 103.36 ? 50   PRO A C   1 
ATOM   161   O O   . PRO A 1 49  ? 2.429   -34.969 184.795 1.00 89.69  ? 50   PRO A O   1 
ATOM   162   C CB  . PRO A 1 49  ? -0.378  -33.421 185.381 1.00 111.19 ? 50   PRO A CB  1 
ATOM   163   C CG  . PRO A 1 49  ? -0.262  -31.952 185.620 1.00 109.91 ? 50   PRO A CG  1 
ATOM   164   C CD  . PRO A 1 49  ? 1.198   -31.704 185.797 1.00 107.49 ? 50   PRO A CD  1 
ATOM   165   N N   . GLN A 1 50  ? 0.795   -36.371 185.465 1.00 111.37 ? 51   GLN A N   1 
ATOM   166   C CA  . GLN A 1 50  ? 1.306   -37.514 184.716 1.00 106.33 ? 51   GLN A CA  1 
ATOM   167   C C   . GLN A 1 50  ? 0.978   -37.411 183.229 1.00 93.79  ? 51   GLN A C   1 
ATOM   168   O O   . GLN A 1 50  ? 1.844   -37.610 182.378 1.00 91.75  ? 51   GLN A O   1 
ATOM   169   C CB  . GLN A 1 50  ? 0.751   -38.823 185.282 1.00 115.65 ? 51   GLN A CB  1 
ATOM   170   C CG  . GLN A 1 50  ? 1.624   -39.476 186.344 1.00 123.61 ? 51   GLN A CG  1 
ATOM   171   C CD  . GLN A 1 50  ? 1.669   -38.690 187.640 1.00 126.86 ? 51   GLN A CD  1 
ATOM   172   O OE1 . GLN A 1 50  ? 2.451   -37.750 187.785 1.00 123.83 ? 51   GLN A OE1 1 
ATOM   173   N NE2 . GLN A 1 50  ? 0.831   -39.078 188.595 1.00 129.77 ? 51   GLN A NE2 1 
ATOM   174   N N   . ALA A 1 51  ? -0.277  -37.099 182.924 1.00 84.76  ? 52   ALA A N   1 
ATOM   175   C CA  . ALA A 1 51  ? -0.715  -36.957 181.540 1.00 80.57  ? 52   ALA A CA  1 
ATOM   176   C C   . ALA A 1 51  ? -1.475  -35.650 181.347 1.00 85.40  ? 52   ALA A C   1 
ATOM   177   O O   . ALA A 1 51  ? -1.586  -34.849 182.273 1.00 96.94  ? 52   ALA A O   1 
ATOM   178   C CB  . ALA A 1 51  ? -1.573  -38.139 181.130 1.00 83.72  ? 52   ALA A CB  1 
ATOM   179   N N   . GLU A 1 52  ? -1.991  -35.437 180.141 1.00 71.64  ? 53   GLU A N   1 
ATOM   180   C CA  . GLU A 1 52  ? -2.694  -34.197 179.822 1.00 83.80  ? 53   GLU A CA  1 
ATOM   181   C C   . GLU A 1 52  ? -3.976  -34.008 180.633 1.00 86.47  ? 53   GLU A C   1 
ATOM   182   O O   . GLU A 1 52  ? -4.765  -34.939 180.795 1.00 92.70  ? 53   GLU A O   1 
ATOM   183   C CB  . GLU A 1 52  ? -2.990  -34.115 178.321 1.00 78.65  ? 53   GLU A CB  1 
ATOM   184   C CG  . GLU A 1 52  ? -1.749  -33.934 177.457 1.00 78.46  ? 53   GLU A CG  1 
ATOM   185   C CD  . GLU A 1 52  ? -2.082  -33.604 176.013 1.00 78.72  ? 53   GLU A CD  1 
ATOM   186   O OE1 . GLU A 1 52  ? -3.262  -33.737 175.629 1.00 75.14  ? 53   GLU A OE1 1 
ATOM   187   O OE2 . GLU A 1 52  ? -1.164  -33.206 175.263 1.00 70.83  ? 53   GLU A OE2 1 
ATOM   188   N N   . ILE A 1 53  ? -4.170  -32.793 181.140 1.00 88.86  ? 54   ILE A N   1 
ATOM   189   C CA  . ILE A 1 53  ? -5.350  -32.448 181.925 1.00 87.91  ? 54   ILE A CA  1 
ATOM   190   C C   . ILE A 1 53  ? -6.171  -31.417 181.150 1.00 83.64  ? 54   ILE A C   1 
ATOM   191   O O   . ILE A 1 53  ? -5.769  -30.984 180.071 1.00 85.39  ? 54   ILE A O   1 
ATOM   192   C CB  . ILE A 1 53  ? -4.946  -31.850 183.295 1.00 99.54  ? 54   ILE A CB  1 
ATOM   193   C CG1 . ILE A 1 53  ? -3.655  -32.493 183.804 1.00 104.06 ? 54   ILE A CG1 1 
ATOM   194   C CG2 . ILE A 1 53  ? -6.052  -32.035 184.329 1.00 111.63 ? 54   ILE A CG2 1 
ATOM   195   C CD1 . ILE A 1 53  ? -3.840  -33.907 184.316 1.00 106.94 ? 54   ILE A CD1 1 
ATOM   196   N N   . SER A 1 54  ? -7.316  -31.024 181.700 1.00 75.62  ? 55   SER A N   1 
ATOM   197   C CA  . SER A 1 54  ? -8.148  -29.993 181.092 1.00 75.61  ? 55   SER A CA  1 
ATOM   198   C C   . SER A 1 54  ? -7.533  -28.614 181.308 1.00 78.69  ? 55   SER A C   1 
ATOM   199   O O   . SER A 1 54  ? -7.051  -28.305 182.398 1.00 80.94  ? 55   SER A O   1 
ATOM   200   C CB  . SER A 1 54  ? -9.563  -30.037 181.673 1.00 74.47  ? 55   SER A CB  1 
ATOM   201   O OG  . SER A 1 54  ? -9.542  -29.847 183.077 1.00 76.35  ? 55   SER A OG  1 
ATOM   202   N N   . GLY A 1 55  ? -7.556  -27.788 180.266 1.00 78.49  ? 56   GLY A N   1 
ATOM   203   C CA  . GLY A 1 55  ? -6.956  -26.467 180.320 1.00 90.08  ? 56   GLY A CA  1 
ATOM   204   C C   . GLY A 1 55  ? -7.944  -25.359 180.628 1.00 101.06 ? 56   GLY A C   1 
ATOM   205   O O   . GLY A 1 55  ? -7.703  -24.193 180.313 1.00 96.45  ? 56   GLY A O   1 
ATOM   206   N N   . GLU A 1 56  ? -9.061  -25.734 181.242 1.00 109.04 ? 57   GLU A N   1 
ATOM   207   C CA  . GLU A 1 56  ? -10.102 -24.793 181.646 1.00 109.77 ? 57   GLU A CA  1 
ATOM   208   C C   . GLU A 1 56  ? -9.558  -23.689 182.554 1.00 103.83 ? 57   GLU A C   1 
ATOM   209   O O   . GLU A 1 56  ? -10.076 -22.572 182.576 1.00 103.77 ? 57   GLU A O   1 
ATOM   210   C CB  . GLU A 1 56  ? -11.219 -25.559 182.365 1.00 122.45 ? 57   GLU A CB  1 
ATOM   211   C CG  . GLU A 1 56  ? -12.266 -24.693 183.046 1.00 131.69 ? 57   GLU A CG  1 
ATOM   212   C CD  . GLU A 1 56  ? -13.139 -25.485 184.001 1.00 138.38 ? 57   GLU A CD  1 
ATOM   213   O OE1 . GLU A 1 56  ? -13.129 -26.731 183.921 1.00 136.39 ? 57   GLU A OE1 1 
ATOM   214   O OE2 . GLU A 1 56  ? -13.828 -24.862 184.836 1.00 141.35 ? 57   GLU A OE2 1 
ATOM   215   N N   . HIS A 1 57  ? -8.492  -24.007 183.281 1.00 101.06 ? 58   HIS A N   1 
ATOM   216   C CA  . HIS A 1 57  ? -7.968  -23.134 184.325 1.00 99.74  ? 58   HIS A CA  1 
ATOM   217   C C   . HIS A 1 57  ? -6.865  -22.185 183.854 1.00 106.11 ? 58   HIS A C   1 
ATOM   218   O O   . HIS A 1 57  ? -6.368  -21.377 184.637 1.00 117.74 ? 58   HIS A O   1 
ATOM   219   C CB  . HIS A 1 57  ? -7.441  -23.984 185.482 1.00 100.11 ? 58   HIS A CB  1 
ATOM   220   C CG  . HIS A 1 57  ? -6.289  -24.862 185.106 1.00 104.76 ? 58   HIS A CG  1 
ATOM   221   N ND1 . HIS A 1 57  ? -6.366  -25.803 184.099 1.00 102.51 ? 58   HIS A ND1 1 
ATOM   222   C CD2 . HIS A 1 57  ? -5.031  -24.944 185.599 1.00 113.02 ? 58   HIS A CD2 1 
ATOM   223   C CE1 . HIS A 1 57  ? -5.205  -26.423 183.989 1.00 106.02 ? 58   HIS A CE1 1 
ATOM   224   N NE2 . HIS A 1 57  ? -4.378  -25.921 184.888 1.00 109.39 ? 58   HIS A NE2 1 
ATOM   225   N N   . LEU A 1 58  ? -6.481  -22.277 182.584 1.00 99.09  ? 59   LEU A N   1 
ATOM   226   C CA  . LEU A 1 58  ? -5.367  -21.477 182.078 1.00 87.28  ? 59   LEU A CA  1 
ATOM   227   C C   . LEU A 1 58  ? -5.772  -20.040 181.757 1.00 90.71  ? 59   LEU A C   1 
ATOM   228   O O   . LEU A 1 58  ? -6.633  -19.801 180.910 1.00 95.01  ? 59   LEU A O   1 
ATOM   229   C CB  . LEU A 1 58  ? -4.750  -22.133 180.841 1.00 74.05  ? 59   LEU A CB  1 
ATOM   230   C CG  . LEU A 1 58  ? -4.096  -23.499 181.049 1.00 71.23  ? 59   LEU A CG  1 
ATOM   231   C CD1 . LEU A 1 58  ? -3.507  -24.011 179.745 1.00 70.76  ? 59   LEU A CD1 1 
ATOM   232   C CD2 . LEU A 1 58  ? -3.031  -23.428 182.133 1.00 62.35  ? 59   LEU A CD2 1 
ATOM   233   N N   . ARG A 1 59  ? -5.144  -19.088 182.441 1.00 91.45  ? 60   ARG A N   1 
ATOM   234   C CA  . ARG A 1 59  ? -5.407  -17.670 182.214 1.00 97.26  ? 60   ARG A CA  1 
ATOM   235   C C   . ARG A 1 59  ? -4.681  -17.119 180.986 1.00 90.96  ? 60   ARG A C   1 
ATOM   236   O O   . ARG A 1 59  ? -5.274  -16.412 180.171 1.00 96.68  ? 60   ARG A O   1 
ATOM   237   C CB  . ARG A 1 59  ? -5.043  -16.848 183.455 1.00 100.98 ? 60   ARG A CB  1 
ATOM   238   C CG  . ARG A 1 59  ? -5.884  -17.167 184.683 1.00 108.86 ? 60   ARG A CG  1 
ATOM   239   C CD  . ARG A 1 59  ? -5.026  -17.722 185.809 1.00 127.70 ? 60   ARG A CD  1 
ATOM   240   N NE  . ARG A 1 59  ? -4.004  -16.771 186.238 1.00 137.70 ? 60   ARG A NE  1 
ATOM   241   C CZ  . ARG A 1 59  ? -3.023  -17.059 187.087 1.00 136.31 ? 60   ARG A CZ  1 
ATOM   242   N NH1 . ARG A 1 59  ? -2.923  -18.278 187.602 1.00 133.91 ? 60   ARG A NH1 1 
ATOM   243   N NH2 . ARG A 1 59  ? -2.138  -16.130 187.420 1.00 131.79 ? 60   ARG A NH2 1 
ATOM   244   N N   . ILE A 1 60  ? -3.398  -17.445 180.858 1.00 78.44  ? 61   ILE A N   1 
ATOM   245   C CA  . ILE A 1 60  ? -2.569  -16.901 179.784 1.00 73.66  ? 61   ILE A CA  1 
ATOM   246   C C   . ILE A 1 60  ? -2.637  -17.736 178.507 1.00 70.82  ? 61   ILE A C   1 
ATOM   247   O O   . ILE A 1 60  ? -3.097  -17.259 177.469 1.00 79.68  ? 61   ILE A O   1 
ATOM   248   C CB  . ILE A 1 60  ? -1.099  -16.763 180.221 1.00 67.13  ? 61   ILE A CB  1 
ATOM   249   C CG1 . ILE A 1 60  ? -0.999  -15.906 181.486 1.00 62.85  ? 61   ILE A CG1 1 
ATOM   250   C CG2 . ILE A 1 60  ? -0.262  -16.167 179.096 1.00 47.44  ? 61   ILE A CG2 1 
ATOM   251   C CD1 . ILE A 1 60  ? 0.281   -16.138 182.278 1.00 51.91  ? 61   ILE A CD1 1 
ATOM   252   N N   . CYS A 1 61  ? -2.158  -18.975 178.586 1.00 54.73  ? 62   CYS A N   1 
ATOM   253   C CA  . CYS A 1 61  ? -2.173  -19.885 177.444 1.00 56.88  ? 62   CYS A CA  1 
ATOM   254   C C   . CYS A 1 61  ? -3.602  -20.166 176.993 1.00 64.51  ? 62   CYS A C   1 
ATOM   255   O O   . CYS A 1 61  ? -4.507  -20.253 177.823 1.00 64.92  ? 62   CYS A O   1 
ATOM   256   C CB  . CYS A 1 61  ? -1.488  -21.206 177.802 1.00 57.11  ? 62   CYS A CB  1 
ATOM   257   S SG  . CYS A 1 61  ? 0.170   -21.041 178.492 1.00 81.13  ? 62   CYS A SG  1 
ATOM   258   N N   . PRO A 1 62  ? -3.808  -20.299 175.672 1.00 61.63  ? 63   PRO A N   1 
ATOM   259   C CA  . PRO A 1 62  ? -5.116  -20.669 175.119 1.00 66.55  ? 63   PRO A CA  1 
ATOM   260   C C   . PRO A 1 62  ? -5.627  -21.954 175.757 1.00 71.79  ? 63   PRO A C   1 
ATOM   261   O O   . PRO A 1 62  ? -4.863  -22.905 175.922 1.00 78.78  ? 63   PRO A O   1 
ATOM   262   C CB  . PRO A 1 62  ? -4.811  -20.899 173.639 1.00 59.70  ? 63   PRO A CB  1 
ATOM   263   C CG  . PRO A 1 62  ? -3.648  -20.008 173.363 1.00 53.70  ? 63   PRO A CG  1 
ATOM   264   C CD  . PRO A 1 62  ? -2.815  -20.045 174.614 1.00 50.90  ? 63   PRO A CD  1 
ATOM   265   N N   . GLN A 1 63  ? -6.906  -21.976 176.110 1.00 73.58  ? 64   GLN A N   1 
ATOM   266   C CA  . GLN A 1 63  ? -7.461  -23.082 176.879 1.00 80.34  ? 64   GLN A CA  1 
ATOM   267   C C   . GLN A 1 63  ? -7.663  -24.336 176.035 1.00 90.71  ? 64   GLN A C   1 
ATOM   268   O O   . GLN A 1 63  ? -8.374  -24.323 175.030 1.00 102.37 ? 64   GLN A O   1 
ATOM   269   C CB  . GLN A 1 63  ? -8.769  -22.659 177.549 1.00 75.38  ? 64   GLN A CB  1 
ATOM   270   C CG  . GLN A 1 63  ? -8.585  -21.577 178.603 1.00 78.80  ? 64   GLN A CG  1 
ATOM   271   C CD  . GLN A 1 63  ? -9.894  -20.947 179.033 1.00 86.24  ? 64   GLN A CD  1 
ATOM   272   O OE1 . GLN A 1 63  ? -10.562 -20.278 178.244 1.00 91.62  ? 64   GLN A OE1 1 
ATOM   273   N NE2 . GLN A 1 63  ? -10.268 -21.157 180.290 1.00 81.01  ? 64   GLN A NE2 1 
ATOM   274   N N   . GLY A 1 64  ? -7.026  -25.418 176.467 1.00 77.72  ? 65   GLY A N   1 
ATOM   275   C CA  . GLY A 1 64  ? -7.072  -26.693 175.777 1.00 69.80  ? 65   GLY A CA  1 
ATOM   276   C C   . GLY A 1 64  ? -6.318  -27.706 176.612 1.00 70.42  ? 65   GLY A C   1 
ATOM   277   O O   . GLY A 1 64  ? -5.716  -27.340 177.619 1.00 73.89  ? 65   GLY A O   1 
ATOM   278   N N   . TYR A 1 65  ? -6.338  -28.971 176.205 1.00 76.36  ? 66   TYR A N   1 
ATOM   279   C CA  . TYR A 1 65  ? -5.684  -30.020 176.985 1.00 76.83  ? 66   TYR A CA  1 
ATOM   280   C C   . TYR A 1 65  ? -4.187  -29.755 177.140 1.00 75.58  ? 66   TYR A C   1 
ATOM   281   O O   . TYR A 1 65  ? -3.471  -29.556 176.158 1.00 67.54  ? 66   TYR A O   1 
ATOM   282   C CB  . TYR A 1 65  ? -5.962  -31.399 176.383 1.00 74.86  ? 66   TYR A CB  1 
ATOM   283   C CG  . TYR A 1 65  ? -7.409  -31.813 176.533 1.00 74.12  ? 66   TYR A CG  1 
ATOM   284   C CD1 . TYR A 1 65  ? -7.876  -32.337 177.731 1.00 72.85  ? 66   TYR A CD1 1 
ATOM   285   C CD2 . TYR A 1 65  ? -8.311  -31.661 175.488 1.00 66.25  ? 66   TYR A CD2 1 
ATOM   286   C CE1 . TYR A 1 65  ? -9.196  -32.708 177.882 1.00 74.04  ? 66   TYR A CE1 1 
ATOM   287   C CE2 . TYR A 1 65  ? -9.637  -32.030 175.630 1.00 72.98  ? 66   TYR A CE2 1 
ATOM   288   C CZ  . TYR A 1 65  ? -10.072 -32.553 176.830 1.00 73.26  ? 66   TYR A CZ  1 
ATOM   289   O OH  . TYR A 1 65  ? -11.388 -32.922 176.982 1.00 74.55  ? 66   TYR A OH  1 
ATOM   290   N N   . THR A 1 66  ? -3.727  -29.750 178.389 1.00 73.12  ? 67   THR A N   1 
ATOM   291   C CA  . THR A 1 66  ? -2.397  -29.250 178.712 1.00 72.95  ? 67   THR A CA  1 
ATOM   292   C C   . THR A 1 66  ? -1.684  -30.061 179.792 1.00 77.31  ? 67   THR A C   1 
ATOM   293   O O   . THR A 1 66  ? -2.311  -30.800 180.551 1.00 82.42  ? 67   THR A O   1 
ATOM   294   C CB  . THR A 1 66  ? -2.469  -27.784 179.182 1.00 82.27  ? 67   THR A CB  1 
ATOM   295   O OG1 . THR A 1 66  ? -1.154  -27.319 179.508 1.00 93.68  ? 67   THR A OG1 1 
ATOM   296   C CG2 . THR A 1 66  ? -3.362  -27.663 180.406 1.00 82.80  ? 67   THR A CG2 1 
ATOM   297   N N   . CYS A 1 67  ? -0.363  -29.914 179.846 1.00 72.56  ? 68   CYS A N   1 
ATOM   298   C CA  . CYS A 1 67  ? 0.445   -30.545 180.884 1.00 77.50  ? 68   CYS A CA  1 
ATOM   299   C C   . CYS A 1 67  ? 0.734   -29.591 182.041 1.00 75.13  ? 68   CYS A C   1 
ATOM   300   O O   . CYS A 1 67  ? 1.413   -29.954 183.001 1.00 78.12  ? 68   CYS A O   1 
ATOM   301   C CB  . CYS A 1 67  ? 1.758   -31.074 180.298 1.00 63.58  ? 68   CYS A CB  1 
ATOM   302   S SG  . CYS A 1 67  ? 1.607   -32.666 179.452 1.00 119.15 ? 68   CYS A SG  1 
ATOM   303   N N   . CYS A 1 68  ? 0.214   -28.372 181.944 1.00 63.13  ? 69   CYS A N   1 
ATOM   304   C CA  . CYS A 1 68  ? 0.524   -27.331 182.919 1.00 68.86  ? 69   CYS A CA  1 
ATOM   305   C C   . CYS A 1 68  ? -0.652  -26.996 183.828 1.00 70.01  ? 69   CYS A C   1 
ATOM   306   O O   . CYS A 1 68  ? -1.774  -26.788 183.361 1.00 71.04  ? 69   CYS A O   1 
ATOM   307   C CB  . CYS A 1 68  ? 0.987   -26.057 182.208 1.00 63.63  ? 69   CYS A CB  1 
ATOM   308   S SG  . CYS A 1 68  ? 2.359   -26.295 181.056 1.00 79.10  ? 69   CYS A SG  1 
ATOM   309   N N   . THR A 1 69  ? -0.388  -26.949 185.129 1.00 72.76  ? 70   THR A N   1 
ATOM   310   C CA  . THR A 1 69  ? -1.363  -26.438 186.081 1.00 85.15  ? 70   THR A CA  1 
ATOM   311   C C   . THR A 1 69  ? -1.226  -24.922 186.120 1.00 93.59  ? 70   THR A C   1 
ATOM   312   O O   . THR A 1 69  ? -0.368  -24.360 185.439 1.00 108.03 ? 70   THR A O   1 
ATOM   313   C CB  . THR A 1 69  ? -1.141  -27.004 187.494 1.00 93.15  ? 70   THR A CB  1 
ATOM   314   O OG1 . THR A 1 69  ? 0.088   -26.499 188.029 1.00 95.82  ? 70   THR A OG1 1 
ATOM   315   C CG2 . THR A 1 69  ? -1.096  -28.526 187.463 1.00 95.66  ? 70   THR A CG2 1 
ATOM   316   N N   . SER A 1 70  ? -2.061  -24.259 186.915 1.00 94.17  ? 71   SER A N   1 
ATOM   317   C CA  . SER A 1 70  ? -1.994  -22.805 187.036 1.00 95.54  ? 71   SER A CA  1 
ATOM   318   C C   . SER A 1 70  ? -0.678  -22.392 187.690 1.00 93.71  ? 71   SER A C   1 
ATOM   319   O O   . SER A 1 70  ? -0.091  -21.364 187.343 1.00 87.23  ? 71   SER A O   1 
ATOM   320   C CB  . SER A 1 70  ? -3.185  -22.270 187.834 1.00 91.25  ? 71   SER A CB  1 
ATOM   321   O OG  . SER A 1 70  ? -3.217  -22.820 189.139 1.00 96.15  ? 71   SER A OG  1 
ATOM   322   N N   . GLU A 1 71  ? -0.224  -23.213 188.632 1.00 95.47  ? 72   GLU A N   1 
ATOM   323   C CA  . GLU A 1 71  ? 1.068   -23.037 189.284 1.00 103.80 ? 72   GLU A CA  1 
ATOM   324   C C   . GLU A 1 71  ? 2.196   -23.019 188.257 1.00 99.49  ? 72   GLU A C   1 
ATOM   325   O O   . GLU A 1 71  ? 3.002   -22.083 188.213 1.00 104.53 ? 72   GLU A O   1 
ATOM   326   C CB  . GLU A 1 71  ? 1.294   -24.172 190.288 1.00 126.15 ? 72   GLU A CB  1 
ATOM   327   C CG  . GLU A 1 71  ? 2.731   -24.333 190.759 1.00 146.64 ? 72   GLU A CG  1 
ATOM   328   C CD  . GLU A 1 71  ? 3.121   -23.330 191.825 1.00 162.55 ? 72   GLU A CD  1 
ATOM   329   O OE1 . GLU A 1 71  ? 2.241   -22.572 192.285 1.00 170.43 ? 72   GLU A OE1 1 
ATOM   330   O OE2 . GLU A 1 71  ? 4.310   -23.302 192.206 1.00 164.15 ? 72   GLU A OE2 1 
ATOM   331   N N   . MET A 1 72  ? 2.240   -24.059 187.429 1.00 97.29  ? 73   MET A N   1 
ATOM   332   C CA  . MET A 1 72  ? 3.246   -24.176 186.381 1.00 100.15 ? 73   MET A CA  1 
ATOM   333   C C   . MET A 1 72  ? 3.148   -23.019 185.394 1.00 93.69  ? 73   MET A C   1 
ATOM   334   O O   . MET A 1 72  ? 4.164   -22.517 184.912 1.00 89.10  ? 73   MET A O   1 
ATOM   335   C CB  . MET A 1 72  ? 3.098   -25.510 185.644 1.00 108.96 ? 73   MET A CB  1 
ATOM   336   C CG  . MET A 1 72  ? 3.324   -26.734 186.516 1.00 116.89 ? 73   MET A CG  1 
ATOM   337   S SD  . MET A 1 72  ? 3.108   -28.283 185.619 1.00 94.05  ? 73   MET A SD  1 
ATOM   338   C CE  . MET A 1 72  ? 4.336   -28.102 184.328 1.00 56.68  ? 73   MET A CE  1 
ATOM   339   N N   . GLU A 1 73  ? 1.921   -22.596 185.101 1.00 84.85  ? 74   GLU A N   1 
ATOM   340   C CA  . GLU A 1 73  ? 1.696   -21.483 184.187 1.00 79.32  ? 74   GLU A CA  1 
ATOM   341   C C   . GLU A 1 73  ? 2.320   -20.195 184.725 1.00 83.98  ? 74   GLU A C   1 
ATOM   342   O O   . GLU A 1 73  ? 3.061   -19.509 184.014 1.00 92.29  ? 74   GLU A O   1 
ATOM   343   C CB  . GLU A 1 73  ? 0.200   -21.285 183.939 1.00 61.05  ? 74   GLU A CB  1 
ATOM   344   C CG  . GLU A 1 73  ? -0.113  -20.364 182.772 1.00 63.39  ? 74   GLU A CG  1 
ATOM   345   C CD  . GLU A 1 73  ? -1.597  -20.097 182.619 1.00 70.42  ? 74   GLU A CD  1 
ATOM   346   O OE1 . GLU A 1 73  ? -2.338  -20.287 183.606 1.00 77.81  ? 74   GLU A OE1 1 
ATOM   347   O OE2 . GLU A 1 73  ? -2.021  -19.700 181.513 1.00 59.24  ? 74   GLU A OE2 1 
ATOM   348   N N   . GLU A 1 74  ? 2.022   -19.880 185.984 1.00 82.72  ? 75   GLU A N   1 
ATOM   349   C CA  . GLU A 1 74  ? 2.587   -18.698 186.631 1.00 80.81  ? 75   GLU A CA  1 
ATOM   350   C C   . GLU A 1 74  ? 4.109   -18.762 186.697 1.00 82.21  ? 75   GLU A C   1 
ATOM   351   O O   . GLU A 1 74  ? 4.792   -17.786 186.380 1.00 74.68  ? 75   GLU A O   1 
ATOM   352   C CB  . GLU A 1 74  ? 2.016   -18.514 188.040 1.00 80.57  ? 75   GLU A CB  1 
ATOM   353   C CG  . GLU A 1 74  ? 0.620   -17.917 188.079 1.00 100.55 ? 75   GLU A CG  1 
ATOM   354   C CD  . GLU A 1 74  ? 0.217   -17.474 189.473 1.00 120.06 ? 75   GLU A CD  1 
ATOM   355   O OE1 . GLU A 1 74  ? 1.031   -17.634 190.407 1.00 122.89 ? 75   GLU A OE1 1 
ATOM   356   O OE2 . GLU A 1 74  ? -0.911  -16.961 189.633 1.00 126.24 ? 75   GLU A OE2 1 
ATOM   357   N N   . ASN A 1 75  ? 4.633   -19.912 187.112 1.00 81.58  ? 76   ASN A N   1 
ATOM   358   C CA  . ASN A 1 75  ? 6.078   -20.100 187.209 1.00 88.77  ? 76   ASN A CA  1 
ATOM   359   C C   . ASN A 1 75  ? 6.790   -19.885 185.875 1.00 88.70  ? 76   ASN A C   1 
ATOM   360   O O   . ASN A 1 75  ? 7.774   -19.143 185.796 1.00 98.64  ? 76   ASN A O   1 
ATOM   361   C CB  . ASN A 1 75  ? 6.401   -21.484 187.772 1.00 104.04 ? 76   ASN A CB  1 
ATOM   362   C CG  . ASN A 1 75  ? 6.022   -21.621 189.234 1.00 118.60 ? 76   ASN A CG  1 
ATOM   363   O OD1 . ASN A 1 75  ? 5.323   -20.772 189.787 1.00 119.90 ? 76   ASN A OD1 1 
ATOM   364   N ND2 . ASN A 1 75  ? 6.480   -22.695 189.867 1.00 124.69 ? 76   ASN A ND2 1 
ATOM   365   N N   . LEU A 1 76  ? 6.282   -20.529 184.828 1.00 84.75  ? 77   LEU A N   1 
ATOM   366   C CA  . LEU A 1 76  ? 6.838   -20.371 183.489 1.00 78.76  ? 77   LEU A CA  1 
ATOM   367   C C   . LEU A 1 76  ? 6.744   -18.922 183.013 1.00 79.49  ? 77   LEU A C   1 
ATOM   368   O O   . LEU A 1 76  ? 7.669   -18.410 182.378 1.00 85.07  ? 77   LEU A O   1 
ATOM   369   C CB  . LEU A 1 76  ? 6.138   -21.303 182.499 1.00 76.54  ? 77   LEU A CB  1 
ATOM   370   C CG  . LEU A 1 76  ? 6.406   -22.799 182.675 1.00 72.71  ? 77   LEU A CG  1 
ATOM   371   C CD1 . LEU A 1 76  ? 5.620   -23.609 181.656 1.00 71.38  ? 77   LEU A CD1 1 
ATOM   372   C CD2 . LEU A 1 76  ? 7.894   -23.094 182.570 1.00 58.27  ? 77   LEU A CD2 1 
ATOM   373   N N   . ALA A 1 77  ? 5.628   -18.267 183.325 1.00 68.52  ? 78   ALA A N   1 
ATOM   374   C CA  . ALA A 1 77  ? 5.449   -16.859 182.975 1.00 69.14  ? 78   ALA A CA  1 
ATOM   375   C C   . ALA A 1 77  ? 6.540   -15.996 183.607 1.00 73.79  ? 78   ALA A C   1 
ATOM   376   O O   . ALA A 1 77  ? 7.224   -15.228 182.916 1.00 74.89  ? 78   ALA A O   1 
ATOM   377   C CB  . ALA A 1 77  ? 4.073   -16.377 183.401 1.00 52.65  ? 78   ALA A CB  1 
ATOM   378   N N   . ASN A 1 78  ? 6.695   -16.137 184.921 1.00 67.57  ? 79   ASN A N   1 
ATOM   379   C CA  . ASN A 1 78  ? 7.746   -15.454 185.667 1.00 62.80  ? 79   ASN A CA  1 
ATOM   380   C C   . ASN A 1 78  ? 9.119   -15.699 185.047 1.00 71.27  ? 79   ASN A C   1 
ATOM   381   O O   . ASN A 1 78  ? 9.914   -14.766 184.876 1.00 76.65  ? 79   ASN A O   1 
ATOM   382   C CB  . ASN A 1 78  ? 7.732   -15.913 187.129 1.00 67.71  ? 79   ASN A CB  1 
ATOM   383   C CG  . ASN A 1 78  ? 8.810   -15.248 187.964 1.00 88.85  ? 79   ASN A CG  1 
ATOM   384   O OD1 . ASN A 1 78  ? 8.609   -14.162 188.507 1.00 100.85 ? 79   ASN A OD1 1 
ATOM   385   N ND2 . ASN A 1 78  ? 9.959   -15.904 188.078 1.00 85.75  ? 79   ASN A ND2 1 
ATOM   386   N N   . ARG A 1 79  ? 9.382   -16.955 184.694 1.00 67.51  ? 80   ARG A N   1 
ATOM   387   C CA  . ARG A 1 79  ? 10.651  -17.327 184.076 1.00 69.37  ? 80   ARG A CA  1 
ATOM   388   C C   . ARG A 1 79  ? 10.894  -16.577 182.767 1.00 75.64  ? 80   ARG A C   1 
ATOM   389   O O   . ARG A 1 79  ? 11.926  -15.924 182.606 1.00 71.27  ? 80   ARG A O   1 
ATOM   390   C CB  . ARG A 1 79  ? 10.723  -18.839 183.847 1.00 66.69  ? 80   ARG A CB  1 
ATOM   391   C CG  . ARG A 1 79  ? 12.041  -19.315 183.253 1.00 76.03  ? 80   ARG A CG  1 
ATOM   392   C CD  . ARG A 1 79  ? 13.230  -18.785 184.044 1.00 95.20  ? 80   ARG A CD  1 
ATOM   393   N NE  . ARG A 1 79  ? 13.154  -19.139 185.459 1.00 108.44 ? 80   ARG A NE  1 
ATOM   394   C CZ  . ARG A 1 79  ? 13.793  -20.166 186.009 1.00 118.52 ? 80   ARG A CZ  1 
ATOM   395   N NH1 . ARG A 1 79  ? 14.566  -20.946 185.265 1.00 119.86 ? 80   ARG A NH1 1 
ATOM   396   N NH2 . ARG A 1 79  ? 13.662  -20.412 187.306 1.00 121.14 ? 80   ARG A NH2 1 
ATOM   397   N N   . SER A 1 80  ? 9.941   -16.667 181.843 1.00 74.73  ? 81   SER A N   1 
ATOM   398   C CA  . SER A 1 80  ? 10.065  -16.009 180.543 1.00 66.75  ? 81   SER A CA  1 
ATOM   399   C C   . SER A 1 80  ? 10.263  -14.500 180.686 1.00 58.82  ? 81   SER A C   1 
ATOM   400   O O   . SER A 1 80  ? 11.112  -13.904 180.006 1.00 57.40  ? 81   SER A O   1 
ATOM   401   C CB  . SER A 1 80  ? 8.840   -16.300 179.671 1.00 65.17  ? 81   SER A CB  1 
ATOM   402   O OG  . SER A 1 80  ? 7.663   -15.751 180.238 1.00 71.00  ? 81   SER A OG  1 
ATOM   403   N N   . HIS A 1 81  ? 9.484   -13.891 181.577 1.00 57.13  ? 82   HIS A N   1 
ATOM   404   C CA  . HIS A 1 81  ? 9.598   -12.458 181.833 1.00 58.77  ? 82   HIS A CA  1 
ATOM   405   C C   . HIS A 1 81  ? 10.997  -12.088 182.323 1.00 62.49  ? 82   HIS A C   1 
ATOM   406   O O   . HIS A 1 81  ? 11.632  -11.168 181.792 1.00 60.29  ? 82   HIS A O   1 
ATOM   407   C CB  . HIS A 1 81  ? 8.546   -12.004 182.846 1.00 59.59  ? 82   HIS A CB  1 
ATOM   408   C CG  . HIS A 1 81  ? 8.608   -10.542 183.163 1.00 73.31  ? 82   HIS A CG  1 
ATOM   409   N ND1 . HIS A 1 81  ? 9.315   -10.043 184.235 1.00 80.60  ? 82   HIS A ND1 1 
ATOM   410   C CD2 . HIS A 1 81  ? 8.059   -9.472  182.542 1.00 76.74  ? 82   HIS A CD2 1 
ATOM   411   C CE1 . HIS A 1 81  ? 9.194   -8.727  184.265 1.00 81.33  ? 82   HIS A CE1 1 
ATOM   412   N NE2 . HIS A 1 81  ? 8.437   -8.356  183.248 1.00 78.96  ? 82   HIS A NE2 1 
ATOM   413   N N   . ALA A 1 82  ? 11.473  -12.815 183.332 1.00 66.59  ? 83   ALA A N   1 
ATOM   414   C CA  . ALA A 1 82  ? 12.805  -12.577 183.883 1.00 66.76  ? 83   ALA A CA  1 
ATOM   415   C C   . ALA A 1 82  ? 13.892  -12.747 182.824 1.00 69.20  ? 83   ALA A C   1 
ATOM   416   O O   . ALA A 1 82  ? 14.882  -12.009 182.807 1.00 77.21  ? 83   ALA A O   1 
ATOM   417   C CB  . ALA A 1 82  ? 13.065  -13.497 185.067 1.00 54.78  ? 83   ALA A CB  1 
ATOM   418   N N   . GLU A 1 83  ? 13.698  -13.719 181.938 1.00 62.73  ? 84   GLU A N   1 
ATOM   419   C CA  . GLU A 1 83  ? 14.656  -13.985 180.869 1.00 61.30  ? 84   GLU A CA  1 
ATOM   420   C C   . GLU A 1 83  ? 14.729  -12.833 179.867 1.00 64.82  ? 84   GLU A C   1 
ATOM   421   O O   . GLU A 1 83  ? 15.825  -12.377 179.512 1.00 76.95  ? 84   GLU A O   1 
ATOM   422   C CB  . GLU A 1 83  ? 14.317  -15.299 180.162 1.00 53.87  ? 84   GLU A CB  1 
ATOM   423   C CG  . GLU A 1 83  ? 14.599  -16.533 181.007 1.00 63.65  ? 84   GLU A CG  1 
ATOM   424   C CD  . GLU A 1 83  ? 13.998  -17.795 180.422 1.00 76.14  ? 84   GLU A CD  1 
ATOM   425   O OE1 . GLU A 1 83  ? 13.144  -17.686 179.517 1.00 72.35  ? 84   GLU A OE1 1 
ATOM   426   O OE2 . GLU A 1 83  ? 14.381  -18.897 180.869 1.00 84.07  ? 84   GLU A OE2 1 
ATOM   427   N N   . LEU A 1 84  ? 13.569  -12.359 179.417 1.00 57.33  ? 85   LEU A N   1 
ATOM   428   C CA  . LEU A 1 84  ? 13.542  -11.216 178.506 1.00 59.68  ? 85   LEU A CA  1 
ATOM   429   C C   . LEU A 1 84  ? 14.178  -9.990  179.161 1.00 67.26  ? 85   LEU A C   1 
ATOM   430   O O   . LEU A 1 84  ? 14.964  -9.268  178.527 1.00 75.84  ? 85   LEU A O   1 
ATOM   431   C CB  . LEU A 1 84  ? 12.117  -10.900 178.051 1.00 58.13  ? 85   LEU A CB  1 
ATOM   432   C CG  . LEU A 1 84  ? 12.002  -9.748  177.048 1.00 53.85  ? 85   LEU A CG  1 
ATOM   433   C CD1 . LEU A 1 84  ? 12.870  -10.011 175.827 1.00 57.93  ? 85   LEU A CD1 1 
ATOM   434   C CD2 . LEU A 1 84  ? 10.557  -9.521  176.637 1.00 39.26  ? 85   LEU A CD2 1 
ATOM   435   N N   . GLU A 1 85  ? 13.841  -9.768  180.432 1.00 61.50  ? 86   GLU A N   1 
ATOM   436   C CA  . GLU A 1 85  ? 14.454  -8.695  181.212 1.00 58.80  ? 86   GLU A CA  1 
ATOM   437   C C   . GLU A 1 85  ? 15.974  -8.783  181.169 1.00 68.48  ? 86   GLU A C   1 
ATOM   438   O O   . GLU A 1 85  ? 16.659  -7.794  180.889 1.00 81.08  ? 86   GLU A O   1 
ATOM   439   C CB  . GLU A 1 85  ? 13.989  -8.748  182.668 1.00 57.02  ? 86   GLU A CB  1 
ATOM   440   C CG  . GLU A 1 85  ? 12.778  -7.892  182.977 1.00 73.13  ? 86   GLU A CG  1 
ATOM   441   C CD  . GLU A 1 85  ? 12.528  -7.776  184.467 1.00 89.66  ? 86   GLU A CD  1 
ATOM   442   O OE1 . GLU A 1 85  ? 13.214  -8.477  185.241 1.00 89.42  ? 86   GLU A OE1 1 
ATOM   443   O OE2 . GLU A 1 85  ? 11.650  -6.981  184.864 1.00 98.25  ? 86   GLU A OE2 1 
ATOM   444   N N   . THR A 1 86  ? 16.489  -9.978  181.444 1.00 61.40  ? 87   THR A N   1 
ATOM   445   C CA  . THR A 1 86  ? 17.926  -10.221 181.437 1.00 49.84  ? 87   THR A CA  1 
ATOM   446   C C   . THR A 1 86  ? 18.557  -9.909  180.081 1.00 56.02  ? 87   THR A C   1 
ATOM   447   O O   . THR A 1 86  ? 19.606  -9.264  180.016 1.00 74.04  ? 87   THR A O   1 
ATOM   448   C CB  . THR A 1 86  ? 18.252  -11.668 181.855 1.00 53.19  ? 87   THR A CB  1 
ATOM   449   O OG1 . THR A 1 86  ? 18.041  -11.811 183.266 1.00 58.89  ? 87   THR A OG1 1 
ATOM   450   C CG2 . THR A 1 86  ? 19.699  -12.012 181.531 1.00 52.48  ? 87   THR A CG2 1 
ATOM   451   N N   . ALA A 1 87  ? 17.917  -10.353 179.002 1.00 46.32  ? 88   ALA A N   1 
ATOM   452   C CA  . ALA A 1 87  ? 18.430  -10.070 177.660 1.00 50.04  ? 88   ALA A CA  1 
ATOM   453   C C   . ALA A 1 87  ? 18.517  -8.564  177.386 1.00 61.17  ? 88   ALA A C   1 
ATOM   454   O O   . ALA A 1 87  ? 19.564  -8.053  176.951 1.00 68.43  ? 88   ALA A O   1 
ATOM   455   C CB  . ALA A 1 87  ? 17.579  -10.760 176.605 1.00 38.79  ? 88   ALA A CB  1 
ATOM   456   N N   . LEU A 1 88  ? 17.417  -7.860  177.648 1.00 62.02  ? 89   LEU A N   1 
ATOM   457   C CA  . LEU A 1 88  ? 17.378  -6.409  177.466 1.00 60.30  ? 89   LEU A CA  1 
ATOM   458   C C   . LEU A 1 88  ? 18.482  -5.713  178.260 1.00 69.26  ? 89   LEU A C   1 
ATOM   459   O O   . LEU A 1 88  ? 19.219  -4.873  177.725 1.00 75.32  ? 89   LEU A O   1 
ATOM   460   C CB  . LEU A 1 88  ? 16.013  -5.851  177.876 1.00 57.70  ? 89   LEU A CB  1 
ATOM   461   C CG  . LEU A 1 88  ? 14.792  -6.236  177.037 1.00 51.48  ? 89   LEU A CG  1 
ATOM   462   C CD1 . LEU A 1 88  ? 13.517  -5.775  177.723 1.00 51.10  ? 89   LEU A CD1 1 
ATOM   463   C CD2 . LEU A 1 88  ? 14.886  -5.655  175.633 1.00 39.35  ? 89   LEU A CD2 1 
ATOM   464   N N   . ARG A 1 89  ? 18.597  -6.075  179.535 1.00 68.50  ? 90   ARG A N   1 
ATOM   465   C CA  . ARG A 1 89  ? 19.591  -5.470  180.414 1.00 71.90  ? 90   ARG A CA  1 
ATOM   466   C C   . ARG A 1 89  ? 21.015  -5.754  179.931 1.00 69.58  ? 90   ARG A C   1 
ATOM   467   O O   . ARG A 1 89  ? 21.903  -4.910  180.067 1.00 71.91  ? 90   ARG A O   1 
ATOM   468   C CB  . ARG A 1 89  ? 19.400  -5.942  181.859 1.00 70.92  ? 90   ARG A CB  1 
ATOM   469   C CG  . ARG A 1 89  ? 19.867  -4.933  182.898 1.00 84.70  ? 90   ARG A CG  1 
ATOM   470   C CD  . ARG A 1 89  ? 19.602  -5.408  184.320 1.00 99.57  ? 90   ARG A CD  1 
ATOM   471   N NE  . ARG A 1 89  ? 18.179  -5.582  184.600 1.00 115.39 ? 90   ARG A NE  1 
ATOM   472   C CZ  . ARG A 1 89  ? 17.606  -6.753  184.861 1.00 118.01 ? 90   ARG A CZ  1 
ATOM   473   N NH1 . ARG A 1 89  ? 18.335  -7.861  184.883 1.00 117.19 ? 90   ARG A NH1 1 
ATOM   474   N NH2 . ARG A 1 89  ? 16.304  -6.817  185.105 1.00 113.05 ? 90   ARG A NH2 1 
ATOM   475   N N   . ASP A 1 90  ? 21.222  -6.939  179.359 1.00 61.27  ? 91   ASP A N   1 
ATOM   476   C CA  . ASP A 1 90  ? 22.516  -7.299  178.784 1.00 62.98  ? 91   ASP A CA  1 
ATOM   477   C C   . ASP A 1 90  ? 22.866  -6.404  177.597 1.00 64.41  ? 91   ASP A C   1 
ATOM   478   O O   . ASP A 1 90  ? 23.988  -5.882  177.509 1.00 62.39  ? 91   ASP A O   1 
ATOM   479   C CB  . ASP A 1 90  ? 22.527  -8.770  178.353 1.00 64.15  ? 91   ASP A CB  1 
ATOM   480   C CG  . ASP A 1 90  ? 22.704  -9.721  179.522 1.00 83.60  ? 91   ASP A CG  1 
ATOM   481   O OD1 . ASP A 1 90  ? 22.486  -9.297  180.677 1.00 92.03  ? 91   ASP A OD1 1 
ATOM   482   O OD2 . ASP A 1 90  ? 23.060  -10.894 179.284 1.00 88.15  ? 91   ASP A OD2 1 
ATOM   483   N N   . SER A 1 91  ? 21.906  -6.228  176.691 1.00 62.70  ? 92   SER A N   1 
ATOM   484   C CA  . SER A 1 91  ? 22.106  -5.341  175.545 1.00 66.49  ? 92   SER A CA  1 
ATOM   485   C C   . SER A 1 91  ? 22.453  -3.928  176.008 1.00 63.44  ? 92   SER A C   1 
ATOM   486   O O   . SER A 1 91  ? 23.402  -3.302  175.507 1.00 53.54  ? 92   SER A O   1 
ATOM   487   C CB  . SER A 1 91  ? 20.858  -5.310  174.661 1.00 69.88  ? 92   SER A CB  1 
ATOM   488   O OG  . SER A 1 91  ? 20.616  -6.576  174.074 1.00 87.74  ? 92   SER A OG  1 
ATOM   489   N N   . SER A 1 92  ? 21.681  -3.439  176.976 1.00 58.53  ? 93   SER A N   1 
ATOM   490   C CA  . SER A 1 92  ? 21.926  -2.124  177.559 1.00 57.52  ? 93   SER A CA  1 
ATOM   491   C C   . SER A 1 92  ? 23.334  -2.013  178.138 1.00 56.88  ? 93   SER A C   1 
ATOM   492   O O   . SER A 1 92  ? 24.012  -1.005  177.945 1.00 74.38  ? 93   SER A O   1 
ATOM   493   C CB  . SER A 1 92  ? 20.887  -1.810  178.636 1.00 59.46  ? 93   SER A CB  1 
ATOM   494   O OG  . SER A 1 92  ? 19.609  -1.595  178.062 1.00 67.85  ? 93   SER A OG  1 
ATOM   495   N N   . ARG A 1 93  ? 23.772  -3.053  178.841 1.00 51.05  ? 94   ARG A N   1 
ATOM   496   C CA  . ARG A 1 93  ? 25.112  -3.071  179.419 1.00 65.20  ? 94   ARG A CA  1 
ATOM   497   C C   . ARG A 1 93  ? 26.203  -2.994  178.351 1.00 60.96  ? 94   ARG A C   1 
ATOM   498   O O   . ARG A 1 93  ? 27.169  -2.239  178.496 1.00 62.51  ? 94   ARG A O   1 
ATOM   499   C CB  . ARG A 1 93  ? 25.301  -4.303  180.309 1.00 72.90  ? 94   ARG A CB  1 
ATOM   500   C CG  . ARG A 1 93  ? 24.717  -4.141  181.707 1.00 87.77  ? 94   ARG A CG  1 
ATOM   501   C CD  . ARG A 1 93  ? 24.280  -5.472  182.299 1.00 106.91 ? 94   ARG A CD  1 
ATOM   502   N NE  . ARG A 1 93  ? 25.363  -6.449  182.335 1.00 121.17 ? 94   ARG A NE  1 
ATOM   503   C CZ  . ARG A 1 93  ? 25.232  -7.688  182.798 1.00 124.41 ? 94   ARG A CZ  1 
ATOM   504   N NH1 . ARG A 1 93  ? 24.061  -8.101  183.265 1.00 123.06 ? 94   ARG A NH1 1 
ATOM   505   N NH2 . ARG A 1 93  ? 26.269  -8.515  182.794 1.00 122.73 ? 94   ARG A NH2 1 
ATOM   506   N N   . VAL A 1 94  ? 26.043  -3.767  177.279 1.00 41.07  ? 95   VAL A N   1 
ATOM   507   C CA  . VAL A 1 94  ? 26.995  -3.721  176.168 1.00 33.33  ? 95   VAL A CA  1 
ATOM   508   C C   . VAL A 1 94  ? 27.088  -2.317  175.563 1.00 43.08  ? 95   VAL A C   1 
ATOM   509   O O   . VAL A 1 94  ? 28.185  -1.746  175.439 1.00 66.13  ? 95   VAL A O   1 
ATOM   510   C CB  . VAL A 1 94  ? 26.629  -4.734  175.063 1.00 40.27  ? 95   VAL A CB  1 
ATOM   511   C CG1 . VAL A 1 94  ? 27.424  -4.458  173.794 1.00 35.59  ? 95   VAL A CG1 1 
ATOM   512   C CG2 . VAL A 1 94  ? 26.864  -6.157  175.550 1.00 28.65  ? 95   VAL A CG2 1 
ATOM   513   N N   . LEU A 1 95  ? 25.931  -1.763  175.203 1.00 41.38  ? 96   LEU A N   1 
ATOM   514   C CA  . LEU A 1 95  ? 25.871  -0.432  174.599 1.00 39.65  ? 96   LEU A CA  1 
ATOM   515   C C   . LEU A 1 95  ? 26.500  0.636   175.499 1.00 49.36  ? 96   LEU A C   1 
ATOM   516   O O   . LEU A 1 95  ? 27.325  1.449   175.049 1.00 48.99  ? 96   LEU A O   1 
ATOM   517   C CB  . LEU A 1 95  ? 24.420  -0.065  174.288 1.00 36.20  ? 96   LEU A CB  1 
ATOM   518   C CG  . LEU A 1 95  ? 24.198  1.166   173.412 1.00 38.28  ? 96   LEU A CG  1 
ATOM   519   C CD1 . LEU A 1 95  ? 24.913  1.003   172.084 1.00 29.48  ? 96   LEU A CD1 1 
ATOM   520   C CD2 . LEU A 1 95  ? 22.716  1.391   173.194 1.00 37.41  ? 96   LEU A CD2 1 
ATOM   521   N N   . GLN A 1 96  ? 26.103  0.620   176.769 1.00 48.60  ? 97   GLN A N   1 
ATOM   522   C CA  . GLN A 1 96  ? 26.653  1.524   177.773 1.00 58.30  ? 97   GLN A CA  1 
ATOM   523   C C   . GLN A 1 96  ? 28.169  1.427   177.845 1.00 72.81  ? 97   GLN A C   1 
ATOM   524   O O   . GLN A 1 96  ? 28.859  2.444   177.827 1.00 80.86  ? 97   GLN A O   1 
ATOM   525   C CB  . GLN A 1 96  ? 26.064  1.226   179.153 1.00 60.92  ? 97   GLN A CB  1 
ATOM   526   C CG  . GLN A 1 96  ? 24.750  1.931   179.448 1.00 72.81  ? 97   GLN A CG  1 
ATOM   527   C CD  . GLN A 1 96  ? 24.195  1.560   180.811 1.00 85.77  ? 97   GLN A CD  1 
ATOM   528   O OE1 . GLN A 1 96  ? 24.889  1.656   181.825 1.00 79.59  ? 97   GLN A OE1 1 
ATOM   529   N NE2 . GLN A 1 96  ? 22.941  1.120   180.840 1.00 94.23  ? 97   GLN A NE2 1 
ATOM   530   N N   . ALA A 1 97  ? 28.680  0.201   177.928 1.00 68.10  ? 98   ALA A N   1 
ATOM   531   C CA  . ALA A 1 97  ? 30.119  -0.020  178.014 1.00 62.93  ? 98   ALA A CA  1 
ATOM   532   C C   . ALA A 1 97  ? 30.845  0.567   176.807 1.00 61.71  ? 98   ALA A C   1 
ATOM   533   O O   . ALA A 1 97  ? 31.882  1.224   176.955 1.00 69.48  ? 98   ALA A O   1 
ATOM   534   C CB  . ALA A 1 97  ? 30.425  -1.503  178.152 1.00 64.29  ? 98   ALA A CB  1 
ATOM   535   N N   . MET A 1 98  ? 30.295  0.337   175.617 1.00 42.24  ? 99   MET A N   1 
ATOM   536   C CA  . MET A 1 98  ? 30.900  0.869   174.397 1.00 31.22  ? 99   MET A CA  1 
ATOM   537   C C   . MET A 1 98  ? 30.960  2.398   174.417 1.00 45.07  ? 99   MET A C   1 
ATOM   538   O O   . MET A 1 98  ? 32.036  2.996   174.247 1.00 54.36  ? 99   MET A O   1 
ATOM   539   C CB  . MET A 1 98  ? 30.144  0.376   173.160 1.00 29.45  ? 99   MET A CB  1 
ATOM   540   C CG  . MET A 1 98  ? 30.775  0.775   171.831 1.00 39.08  ? 99   MET A CG  1 
ATOM   541   S SD  . MET A 1 98  ? 30.279  2.406   171.234 1.00 50.10  ? 99   MET A SD  1 
ATOM   542   C CE  . MET A 1 98  ? 28.525  2.153   170.970 1.00 74.80  ? 99   MET A CE  1 
ATOM   543   N N   . LEU A 1 99  ? 29.804  3.024   174.626 1.00 50.88  ? 100  LEU A N   1 
ATOM   544   C CA  . LEU A 1 99  ? 29.730  4.484   174.655 1.00 48.90  ? 100  LEU A CA  1 
ATOM   545   C C   . LEU A 1 99  ? 30.651  5.086   175.717 1.00 49.73  ? 100  LEU A C   1 
ATOM   546   O O   . LEU A 1 99  ? 31.281  6.120   175.490 1.00 52.90  ? 100  LEU A O   1 
ATOM   547   C CB  . LEU A 1 99  ? 28.288  4.950   174.870 1.00 43.43  ? 100  LEU A CB  1 
ATOM   548   C CG  . LEU A 1 99  ? 27.323  4.691   173.712 1.00 38.83  ? 100  LEU A CG  1 
ATOM   549   C CD1 . LEU A 1 99  ? 25.905  5.070   174.102 1.00 41.35  ? 100  LEU A CD1 1 
ATOM   550   C CD2 . LEU A 1 99  ? 27.760  5.451   172.467 1.00 26.63  ? 100  LEU A CD2 1 
ATOM   551   N N   . ALA A 1 100 ? 30.732  4.426   176.869 1.00 49.07  ? 101  ALA A N   1 
ATOM   552   C CA  . ALA A 1 100 ? 31.599  4.874   177.953 1.00 50.60  ? 101  ALA A CA  1 
ATOM   553   C C   . ALA A 1 100 ? 33.064  4.802   177.541 1.00 63.62  ? 101  ALA A C   1 
ATOM   554   O O   . ALA A 1 100 ? 33.841  5.716   177.824 1.00 75.52  ? 101  ALA A O   1 
ATOM   555   C CB  . ALA A 1 100 ? 31.357  4.047   179.205 1.00 31.36  ? 101  ALA A CB  1 
ATOM   556   N N   . THR A 1 101 ? 33.435  3.711   176.874 1.00 51.56  ? 102  THR A N   1 
ATOM   557   C CA  . THR A 1 101 ? 34.796  3.547   176.368 1.00 53.85  ? 102  THR A CA  1 
ATOM   558   C C   . THR A 1 101 ? 35.167  4.669   175.402 1.00 59.65  ? 102  THR A C   1 
ATOM   559   O O   . THR A 1 101 ? 36.232  5.290   175.528 1.00 58.31  ? 102  THR A O   1 
ATOM   560   C CB  . THR A 1 101 ? 34.982  2.184   175.673 1.00 54.27  ? 102  THR A CB  1 
ATOM   561   O OG1 . THR A 1 101 ? 35.066  1.151   176.663 1.00 58.89  ? 102  THR A OG1 1 
ATOM   562   C CG2 . THR A 1 101 ? 36.254  2.175   174.837 1.00 49.84  ? 102  THR A CG2 1 
ATOM   563   N N   . GLN A 1 102 ? 34.281  4.932   174.445 1.00 55.68  ? 103  GLN A N   1 
ATOM   564   C CA  . GLN A 1 102 ? 34.506  6.008   173.483 1.00 50.77  ? 103  GLN A CA  1 
ATOM   565   C C   . GLN A 1 102 ? 34.660  7.355   174.194 1.00 60.11  ? 103  GLN A C   1 
ATOM   566   O O   . GLN A 1 102 ? 35.569  8.143   173.888 1.00 66.34  ? 103  GLN A O   1 
ATOM   567   C CB  . GLN A 1 102 ? 33.352  6.075   172.483 1.00 48.77  ? 103  GLN A CB  1 
ATOM   568   C CG  . GLN A 1 102 ? 33.795  6.266   171.043 1.00 57.71  ? 103  GLN A CG  1 
ATOM   569   C CD  . GLN A 1 102 ? 34.473  5.033   170.483 1.00 53.49  ? 103  GLN A CD  1 
ATOM   570   O OE1 . GLN A 1 102 ? 34.141  3.909   170.856 1.00 44.41  ? 103  GLN A OE1 1 
ATOM   571   N NE2 . GLN A 1 102 ? 35.434  5.237   169.589 1.00 57.52  ? 103  GLN A NE2 1 
ATOM   572   N N   . LEU A 1 103 ? 33.768  7.599   175.151 1.00 61.34  ? 104  LEU A N   1 
ATOM   573   C CA  . LEU A 1 103 ? 33.774  8.829   175.935 1.00 64.56  ? 104  LEU A CA  1 
ATOM   574   C C   . LEU A 1 103 ? 35.116  9.038   176.620 1.00 64.50  ? 104  LEU A C   1 
ATOM   575   O O   . LEU A 1 103 ? 35.770  10.063  176.423 1.00 68.32  ? 104  LEU A O   1 
ATOM   576   C CB  . LEU A 1 103 ? 32.671  8.788   176.992 1.00 60.83  ? 104  LEU A CB  1 
ATOM   577   C CG  . LEU A 1 103 ? 32.643  9.969   177.965 1.00 59.95  ? 104  LEU A CG  1 
ATOM   578   C CD1 . LEU A 1 103 ? 31.635  11.008  177.514 1.00 68.99  ? 104  LEU A CD1 1 
ATOM   579   C CD2 . LEU A 1 103 ? 32.351  9.509   179.385 1.00 62.34  ? 104  LEU A CD2 1 
ATOM   580   N N   . ARG A 1 104 ? 35.518  8.056   177.420 1.00 61.25  ? 105  ARG A N   1 
ATOM   581   C CA  . ARG A 1 104 ? 36.769  8.122   178.167 1.00 66.26  ? 105  ARG A CA  1 
ATOM   582   C C   . ARG A 1 104 ? 37.960  8.320   177.234 1.00 57.50  ? 105  ARG A C   1 
ATOM   583   O O   . ARG A 1 104 ? 38.868  9.107   177.525 1.00 60.43  ? 105  ARG A O   1 
ATOM   584   C CB  . ARG A 1 104 ? 36.951  6.857   179.007 1.00 74.61  ? 105  ARG A CB  1 
ATOM   585   C CG  . ARG A 1 104 ? 38.132  6.899   179.962 1.00 89.22  ? 105  ARG A CG  1 
ATOM   586   C CD  . ARG A 1 104 ? 38.194  5.635   180.803 1.00 105.75 ? 105  ARG A CD  1 
ATOM   587   N NE  . ARG A 1 104 ? 38.148  4.434   179.974 1.00 113.50 ? 105  ARG A NE  1 
ATOM   588   C CZ  . ARG A 1 104 ? 39.220  3.836   179.463 1.00 108.44 ? 105  ARG A CZ  1 
ATOM   589   N NH1 . ARG A 1 104 ? 40.430  4.326   179.698 1.00 110.76 ? 105  ARG A NH1 1 
ATOM   590   N NH2 . ARG A 1 104 ? 39.082  2.748   178.718 1.00 99.18  ? 105  ARG A NH2 1 
ATOM   591   N N   . SER A 1 105 ? 37.942  7.614   176.106 1.00 44.12  ? 106  SER A N   1 
ATOM   592   C CA  . SER A 1 105 ? 39.013  7.729   175.123 1.00 40.13  ? 106  SER A CA  1 
ATOM   593   C C   . SER A 1 105 ? 39.162  9.158   174.607 1.00 51.78  ? 106  SER A C   1 
ATOM   594   O O   . SER A 1 105 ? 40.232  9.768   174.737 1.00 64.86  ? 106  SER A O   1 
ATOM   595   C CB  . SER A 1 105 ? 38.767  6.776   173.952 1.00 38.76  ? 106  SER A CB  1 
ATOM   596   O OG  . SER A 1 105 ? 38.732  5.430   174.390 1.00 53.89  ? 106  SER A OG  1 
ATOM   597   N N   . PHE A 1 106 ? 38.085  9.697   174.037 1.00 47.55  ? 107  PHE A N   1 
ATOM   598   C CA  . PHE A 1 106 ? 38.134  11.044  173.468 1.00 41.99  ? 107  PHE A CA  1 
ATOM   599   C C   . PHE A 1 106 ? 38.425  12.118  174.513 1.00 53.96  ? 107  PHE A C   1 
ATOM   600   O O   . PHE A 1 106 ? 39.159  13.072  174.245 1.00 65.30  ? 107  PHE A O   1 
ATOM   601   C CB  . PHE A 1 106 ? 36.845  11.368  172.711 1.00 41.78  ? 107  PHE A CB  1 
ATOM   602   C CG  . PHE A 1 106 ? 36.835  10.865  171.297 1.00 35.56  ? 107  PHE A CG  1 
ATOM   603   C CD1 . PHE A 1 106 ? 36.446  9.567   171.011 1.00 34.96  ? 107  PHE A CD1 1 
ATOM   604   C CD2 . PHE A 1 106 ? 37.219  11.691  170.255 1.00 23.37  ? 107  PHE A CD2 1 
ATOM   605   C CE1 . PHE A 1 106 ? 36.440  9.103   169.708 1.00 39.12  ? 107  PHE A CE1 1 
ATOM   606   C CE2 . PHE A 1 106 ? 37.214  11.234  168.952 1.00 39.69  ? 107  PHE A CE2 1 
ATOM   607   C CZ  . PHE A 1 106 ? 36.825  9.938   168.678 1.00 32.80  ? 107  PHE A CZ  1 
ATOM   608   N N   . ASP A 1 107 ? 37.854  11.957  175.703 1.00 55.25  ? 108  ASP A N   1 
ATOM   609   C CA  . ASP A 1 107 ? 38.066  12.910  176.785 1.00 60.41  ? 108  ASP A CA  1 
ATOM   610   C C   . ASP A 1 107 ? 39.538  12.945  177.189 1.00 57.33  ? 108  ASP A C   1 
ATOM   611   O O   . ASP A 1 107 ? 40.156  14.015  177.238 1.00 56.39  ? 108  ASP A O   1 
ATOM   612   C CB  . ASP A 1 107 ? 37.189  12.558  177.988 1.00 64.82  ? 108  ASP A CB  1 
ATOM   613   C CG  . ASP A 1 107 ? 37.174  13.650  179.039 1.00 66.27  ? 108  ASP A CG  1 
ATOM   614   O OD1 . ASP A 1 107 ? 37.348  14.832  178.674 1.00 57.29  ? 108  ASP A OD1 1 
ATOM   615   O OD2 . ASP A 1 107 ? 36.983  13.325  180.229 1.00 64.78  ? 108  ASP A OD2 1 
ATOM   616   N N   . ASP A 1 108 ? 40.098  11.768  177.460 1.00 63.39  ? 109  ASP A N   1 
ATOM   617   C CA  . ASP A 1 108 ? 41.505  11.665  177.837 1.00 60.78  ? 109  ASP A CA  1 
ATOM   618   C C   . ASP A 1 108 ? 42.436  12.194  176.749 1.00 57.47  ? 109  ASP A C   1 
ATOM   619   O O   . ASP A 1 108 ? 43.435  12.850  177.049 1.00 70.52  ? 109  ASP A O   1 
ATOM   620   C CB  . ASP A 1 108 ? 41.876  10.224  178.194 1.00 60.25  ? 109  ASP A CB  1 
ATOM   621   C CG  . ASP A 1 108 ? 41.369  9.812   179.562 1.00 72.70  ? 109  ASP A CG  1 
ATOM   622   O OD1 . ASP A 1 108 ? 41.072  10.706  180.382 1.00 76.16  ? 109  ASP A OD1 1 
ATOM   623   O OD2 . ASP A 1 108 ? 41.274  8.593   179.820 1.00 76.39  ? 109  ASP A OD2 1 
ATOM   624   N N   . HIS A 1 109 ? 42.111  11.915  175.490 1.00 47.09  ? 110  HIS A N   1 
ATOM   625   C CA  . HIS A 1 109 ? 42.947  12.397  174.395 1.00 47.27  ? 110  HIS A CA  1 
ATOM   626   C C   . HIS A 1 109 ? 42.909  13.920  174.279 1.00 56.52  ? 110  HIS A C   1 
ATOM   627   O O   . HIS A 1 109 ? 43.949  14.568  174.116 1.00 61.26  ? 110  HIS A O   1 
ATOM   628   C CB  . HIS A 1 109 ? 42.548  11.757  173.066 1.00 49.11  ? 110  HIS A CB  1 
ATOM   629   C CG  . HIS A 1 109 ? 43.485  12.078  171.945 1.00 62.51  ? 110  HIS A CG  1 
ATOM   630   N ND1 . HIS A 1 109 ? 43.096  12.774  170.822 1.00 67.99  ? 110  HIS A ND1 1 
ATOM   631   C CD2 . HIS A 1 109 ? 44.804  11.811  171.784 1.00 53.99  ? 110  HIS A CD2 1 
ATOM   632   C CE1 . HIS A 1 109 ? 44.131  12.915  170.012 1.00 76.04  ? 110  HIS A CE1 1 
ATOM   633   N NE2 . HIS A 1 109 ? 45.179  12.342  170.575 1.00 65.50  ? 110  HIS A NE2 1 
ATOM   634   N N   . PHE A 1 110 ? 41.707  14.485  174.367 1.00 63.51  ? 111  PHE A N   1 
ATOM   635   C CA  . PHE A 1 110 ? 41.537  15.934  174.311 1.00 60.70  ? 111  PHE A CA  1 
ATOM   636   C C   . PHE A 1 110 ? 42.236  16.628  175.476 1.00 60.75  ? 111  PHE A C   1 
ATOM   637   O O   . PHE A 1 110 ? 42.727  17.749  175.337 1.00 63.48  ? 111  PHE A O   1 
ATOM   638   C CB  . PHE A 1 110 ? 40.054  16.305  174.276 1.00 56.54  ? 111  PHE A CB  1 
ATOM   639   C CG  . PHE A 1 110 ? 39.408  16.088  172.937 1.00 60.67  ? 111  PHE A CG  1 
ATOM   640   C CD1 . PHE A 1 110 ? 40.132  16.267  171.768 1.00 55.06  ? 111  PHE A CD1 1 
ATOM   641   C CD2 . PHE A 1 110 ? 38.081  15.702  172.844 1.00 55.99  ? 111  PHE A CD2 1 
ATOM   642   C CE1 . PHE A 1 110 ? 39.543  16.068  170.530 1.00 45.29  ? 111  PHE A CE1 1 
ATOM   643   C CE2 . PHE A 1 110 ? 37.488  15.499  171.610 1.00 60.57  ? 111  PHE A CE2 1 
ATOM   644   C CZ  . PHE A 1 110 ? 38.220  15.683  170.452 1.00 53.96  ? 111  PHE A CZ  1 
ATOM   645   N N   . GLN A 1 111 ? 42.281  15.957  176.623 1.00 51.68  ? 112  GLN A N   1 
ATOM   646   C CA  . GLN A 1 111 ? 43.043  16.464  177.760 1.00 58.39  ? 112  GLN A CA  1 
ATOM   647   C C   . GLN A 1 111 ? 44.542  16.434  177.458 1.00 75.89  ? 112  GLN A C   1 
ATOM   648   O O   . GLN A 1 111 ? 45.262  17.417  177.686 1.00 78.62  ? 112  GLN A O   1 
ATOM   649   C CB  . GLN A 1 111 ? 42.745  15.638  179.013 1.00 56.96  ? 112  GLN A CB  1 
ATOM   650   C CG  . GLN A 1 111 ? 41.386  15.914  179.642 1.00 66.88  ? 112  GLN A CG  1 
ATOM   651   C CD  . GLN A 1 111 ? 41.393  17.145  180.528 1.00 94.75  ? 112  GLN A CD  1 
ATOM   652   O OE1 . GLN A 1 111 ? 42.428  17.517  181.084 1.00 107.26 ? 112  GLN A OE1 1 
ATOM   653   N NE2 . GLN A 1 111 ? 40.237  17.786  180.664 1.00 95.76  ? 112  GLN A NE2 1 
ATOM   654   N N   . HIS A 1 112 ? 45.001  15.301  176.933 1.00 80.88  ? 113  HIS A N   1 
ATOM   655   C CA  . HIS A 1 112 ? 46.421  15.089  176.666 1.00 71.55  ? 113  HIS A CA  1 
ATOM   656   C C   . HIS A 1 112 ? 47.007  16.028  175.615 1.00 65.89  ? 113  HIS A C   1 
ATOM   657   O O   . HIS A 1 112 ? 48.159  16.438  175.733 1.00 67.97  ? 113  HIS A O   1 
ATOM   658   C CB  . HIS A 1 112 ? 46.691  13.633  176.278 1.00 73.87  ? 113  HIS A CB  1 
ATOM   659   C CG  . HIS A 1 112 ? 46.940  12.735  177.448 1.00 92.21  ? 113  HIS A CG  1 
ATOM   660   N ND1 . HIS A 1 112 ? 45.920  12.169  178.183 1.00 99.42  ? 113  HIS A ND1 1 
ATOM   661   C CD2 . HIS A 1 112 ? 48.093  12.311  178.017 1.00 97.19  ? 113  HIS A CD2 1 
ATOM   662   C CE1 . HIS A 1 112 ? 46.435  11.431  179.150 1.00 105.05 ? 113  HIS A CE1 1 
ATOM   663   N NE2 . HIS A 1 112 ? 47.752  11.500  179.072 1.00 105.32 ? 113  HIS A NE2 1 
ATOM   664   N N   . LEU A 1 113 ? 46.229  16.358  174.588 1.00 68.50  ? 114  LEU A N   1 
ATOM   665   C CA  . LEU A 1 113 ? 46.703  17.279  173.555 1.00 78.03  ? 114  LEU A CA  1 
ATOM   666   C C   . LEU A 1 113 ? 47.073  18.638  174.146 1.00 83.10  ? 114  LEU A C   1 
ATOM   667   O O   . LEU A 1 113 ? 48.142  19.188  173.862 1.00 93.87  ? 114  LEU A O   1 
ATOM   668   C CB  . LEU A 1 113 ? 45.654  17.447  172.455 1.00 91.11  ? 114  LEU A CB  1 
ATOM   669   C CG  . LEU A 1 113 ? 45.981  16.779  171.119 1.00 92.35  ? 114  LEU A CG  1 
ATOM   670   C CD1 . LEU A 1 113 ? 46.394  15.333  171.332 1.00 83.76  ? 114  LEU A CD1 1 
ATOM   671   C CD2 . LEU A 1 113 ? 44.794  16.866  170.171 1.00 90.41  ? 114  LEU A CD2 1 
ATOM   672   N N   . LEU A 1 114 ? 46.186  19.167  174.982 1.00 81.21  ? 115  LEU A N   1 
ATOM   673   C CA  . LEU A 1 114 ? 46.422  20.446  175.635 1.00 68.13  ? 115  LEU A CA  1 
ATOM   674   C C   . LEU A 1 114 ? 47.546  20.356  176.667 1.00 70.07  ? 115  LEU A C   1 
ATOM   675   O O   . LEU A 1 114 ? 48.425  21.222  176.707 1.00 80.91  ? 115  LEU A O   1 
ATOM   676   C CB  . LEU A 1 114 ? 45.136  20.961  176.286 1.00 60.99  ? 115  LEU A CB  1 
ATOM   677   C CG  . LEU A 1 114 ? 45.216  22.352  176.916 1.00 64.68  ? 115  LEU A CG  1 
ATOM   678   C CD1 . LEU A 1 114 ? 45.670  23.377  175.890 1.00 78.30  ? 115  LEU A CD1 1 
ATOM   679   C CD2 . LEU A 1 114 ? 43.876  22.748  177.511 1.00 53.61  ? 115  LEU A CD2 1 
ATOM   680   N N   . ASN A 1 115 ? 47.522  19.311  177.495 1.00 61.25  ? 116  ASN A N   1 
ATOM   681   C CA  . ASN A 1 115 ? 48.569  19.126  178.501 1.00 69.81  ? 116  ASN A CA  1 
ATOM   682   C C   . ASN A 1 115 ? 49.969  19.030  177.889 1.00 81.64  ? 116  ASN A C   1 
ATOM   683   O O   . ASN A 1 115 ? 50.938  19.574  178.430 1.00 78.07  ? 116  ASN A O   1 
ATOM   684   C CB  . ASN A 1 115 ? 48.285  17.902  179.380 1.00 46.19  ? 116  ASN A CB  1 
ATOM   685   C CG  . ASN A 1 115 ? 47.400  18.230  180.570 1.00 68.43  ? 116  ASN A CG  1 
ATOM   686   O OD1 . ASN A 1 115 ? 46.485  19.048  180.470 1.00 80.36  ? 116  ASN A OD1 1 
ATOM   687   N ND2 . ASN A 1 115 ? 47.679  17.598  181.710 1.00 69.23  ? 116  ASN A ND2 1 
ATOM   688   N N   . ASP A 1 116 ? 50.068  18.338  176.759 1.00 94.61  ? 117  ASP A N   1 
ATOM   689   C CA  . ASP A 1 116 ? 51.343  18.197  176.065 1.00 102.09 ? 117  ASP A CA  1 
ATOM   690   C C   . ASP A 1 116 ? 51.696  19.446  175.267 1.00 88.47  ? 117  ASP A C   1 
ATOM   691   O O   . ASP A 1 116 ? 52.869  19.696  174.987 1.00 95.46  ? 117  ASP A O   1 
ATOM   692   C CB  . ASP A 1 116 ? 51.355  16.955  175.171 1.00 109.56 ? 117  ASP A CB  1 
ATOM   693   C CG  . ASP A 1 116 ? 51.954  15.747  175.866 1.00 118.71 ? 117  ASP A CG  1 
ATOM   694   O OD1 . ASP A 1 116 ? 51.729  15.590  177.085 1.00 120.67 ? 117  ASP A OD1 1 
ATOM   695   O OD2 . ASP A 1 116 ? 52.660  14.964  175.197 1.00 122.42 ? 117  ASP A OD2 1 
ATOM   696   N N   . SER A 1 117 ? 50.686  20.227  174.897 1.00 71.10  ? 118  SER A N   1 
ATOM   697   C CA  . SER A 1 117 ? 50.947  21.540  174.322 1.00 75.43  ? 118  SER A CA  1 
ATOM   698   C C   . SER A 1 117 ? 51.609  22.411  175.384 1.00 82.13  ? 118  SER A C   1 
ATOM   699   O O   . SER A 1 117 ? 52.511  23.199  175.089 1.00 89.77  ? 118  SER A O   1 
ATOM   700   C CB  . SER A 1 117 ? 49.656  22.193  173.829 1.00 78.55  ? 118  SER A CB  1 
ATOM   701   O OG  . SER A 1 117 ? 49.914  23.469  173.267 1.00 80.97  ? 118  SER A OG  1 
ATOM   702   N N   . GLU A 1 118 ? 51.161  22.251  176.627 1.00 77.39  ? 119  GLU A N   1 
ATOM   703   C CA  . GLU A 1 118 ? 51.748  22.972  177.751 1.00 66.37  ? 119  GLU A CA  1 
ATOM   704   C C   . GLU A 1 118 ? 53.143  22.460  178.098 1.00 75.00  ? 119  GLU A C   1 
ATOM   705   O O   . GLU A 1 118 ? 54.008  23.236  178.495 1.00 90.42  ? 119  GLU A O   1 
ATOM   706   C CB  . GLU A 1 118 ? 50.840  22.896  178.981 1.00 60.08  ? 119  GLU A CB  1 
ATOM   707   C CG  . GLU A 1 118 ? 51.389  23.623  180.200 1.00 63.28  ? 119  GLU A CG  1 
ATOM   708   C CD  . GLU A 1 118 ? 50.371  23.746  181.313 1.00 75.61  ? 119  GLU A CD  1 
ATOM   709   O OE1 . GLU A 1 118 ? 49.164  23.578  181.037 1.00 86.15  ? 119  GLU A OE1 1 
ATOM   710   O OE2 . GLU A 1 118 ? 50.777  24.010  182.464 1.00 83.06  ? 119  GLU A OE2 1 
ATOM   711   N N   . ARG A 1 119 ? 53.364  21.156  177.957 1.00 74.01  ? 120  ARG A N   1 
ATOM   712   C CA  . ARG A 1 119 ? 54.690  20.599  178.217 1.00 90.64  ? 120  ARG A CA  1 
ATOM   713   C C   . ARG A 1 119 ? 55.702  21.035  177.156 1.00 96.99  ? 120  ARG A C   1 
ATOM   714   O O   . ARG A 1 119 ? 56.856  21.342  177.471 1.00 88.85  ? 120  ARG A O   1 
ATOM   715   C CB  . ARG A 1 119 ? 54.632  19.075  178.334 1.00 103.94 ? 120  ARG A CB  1 
ATOM   716   C CG  . ARG A 1 119 ? 54.048  18.597  179.654 1.00 119.75 ? 120  ARG A CG  1 
ATOM   717   C CD  . ARG A 1 119 ? 54.936  19.005  180.822 1.00 132.31 ? 120  ARG A CD  1 
ATOM   718   N NE  . ARG A 1 119 ? 54.170  19.242  182.043 1.00 141.55 ? 120  ARG A NE  1 
ATOM   719   C CZ  . ARG A 1 119 ? 53.832  18.296  182.913 1.00 145.04 ? 120  ARG A CZ  1 
ATOM   720   N NH1 . ARG A 1 119 ? 54.190  17.037  182.702 1.00 142.41 ? 120  ARG A NH1 1 
ATOM   721   N NH2 . ARG A 1 119 ? 53.133  18.609  183.996 1.00 146.35 ? 120  ARG A NH2 1 
ATOM   722   N N   . THR A 1 120 ? 55.259  21.064  175.903 1.00 97.95  ? 121  THR A N   1 
ATOM   723   C CA  . THR A 1 120 ? 56.065  21.596  174.809 1.00 98.00  ? 121  THR A CA  1 
ATOM   724   C C   . THR A 1 120 ? 56.366  23.069  175.067 1.00 103.64 ? 121  THR A C   1 
ATOM   725   O O   . THR A 1 120 ? 57.494  23.531  174.869 1.00 103.76 ? 121  THR A O   1 
ATOM   726   C CB  . THR A 1 120 ? 55.340  21.445  173.457 1.00 97.16  ? 121  THR A CB  1 
ATOM   727   O OG1 . THR A 1 120 ? 55.260  20.057  173.108 1.00 95.24  ? 121  THR A OG1 1 
ATOM   728   C CG2 . THR A 1 120 ? 56.080  22.193  172.358 1.00 104.24 ? 121  THR A CG2 1 
ATOM   729   N N   . LEU A 1 121 ? 55.340  23.793  175.510 1.00 103.58 ? 122  LEU A N   1 
ATOM   730   C CA  . LEU A 1 121 ? 55.469  25.190  175.915 1.00 106.05 ? 122  LEU A CA  1 
ATOM   731   C C   . LEU A 1 121 ? 56.604  25.358  176.922 1.00 115.88 ? 122  LEU A C   1 
ATOM   732   O O   . LEU A 1 121 ? 57.587  26.052  176.658 1.00 112.48 ? 122  LEU A O   1 
ATOM   733   C CB  . LEU A 1 121 ? 54.145  25.682  176.515 1.00 93.80  ? 122  LEU A CB  1 
ATOM   734   C CG  . LEU A 1 121 ? 53.863  27.172  176.756 1.00 81.41  ? 122  LEU A CG  1 
ATOM   735   C CD1 . LEU A 1 121 ? 54.592  27.723  177.976 1.00 78.97  ? 122  LEU A CD1 1 
ATOM   736   C CD2 . LEU A 1 121 ? 54.193  27.985  175.520 1.00 89.33  ? 122  LEU A CD2 1 
ATOM   737   N N   . GLN A 1 122 ? 56.449  24.719  178.078 1.00 117.93 ? 123  GLN A N   1 
ATOM   738   C CA  . GLN A 1 122 ? 57.419  24.804  179.166 1.00 117.89 ? 123  GLN A CA  1 
ATOM   739   C C   . GLN A 1 122 ? 58.809  24.313  178.768 1.00 115.29 ? 123  GLN A C   1 
ATOM   740   O O   . GLN A 1 122 ? 59.806  24.713  179.365 1.00 107.76 ? 123  GLN A O   1 
ATOM   741   C CB  . GLN A 1 122 ? 56.924  24.015  180.380 1.00 112.96 ? 123  GLN A CB  1 
ATOM   742   C CG  . GLN A 1 122 ? 55.608  24.512  180.954 1.00 106.99 ? 123  GLN A CG  1 
ATOM   743   C CD  . GLN A 1 122 ? 55.087  23.623  182.065 1.00 110.64 ? 123  GLN A CD  1 
ATOM   744   O OE1 . GLN A 1 122 ? 55.753  22.674  182.480 1.00 110.15 ? 123  GLN A OE1 1 
ATOM   745   N NE2 . GLN A 1 122 ? 53.890  23.925  182.551 1.00 114.31 ? 123  GLN A NE2 1 
ATOM   746   N N   . ALA A 1 123 ? 58.873  23.425  177.782 1.00 117.21 ? 124  ALA A N   1 
ATOM   747   C CA  . ALA A 1 123 ? 60.162  22.947  177.294 1.00 111.21 ? 124  ALA A CA  1 
ATOM   748   C C   . ALA A 1 123 ? 60.882  23.983  176.431 1.00 104.83 ? 124  ALA A C   1 
ATOM   749   O O   . ALA A 1 123 ? 62.040  24.316  176.685 1.00 104.77 ? 124  ALA A O   1 
ATOM   750   C CB  . ALA A 1 123 ? 59.991  21.646  176.527 1.00 107.74 ? 124  ALA A CB  1 
ATOM   751   N N   . THR A 1 124 ? 60.193  24.490  175.413 1.00 107.58 ? 125  THR A N   1 
ATOM   752   C CA  . THR A 1 124 ? 60.812  25.400  174.450 1.00 113.10 ? 125  THR A CA  1 
ATOM   753   C C   . THR A 1 124 ? 60.942  26.851  174.920 1.00 124.29 ? 125  THR A C   1 
ATOM   754   O O   . THR A 1 124 ? 62.015  27.443  174.821 1.00 137.74 ? 125  THR A O   1 
ATOM   755   C CB  . THR A 1 124 ? 60.068  25.382  173.097 1.00 115.99 ? 125  THR A CB  1 
ATOM   756   O OG1 . THR A 1 124 ? 58.681  25.673  173.307 1.00 116.78 ? 125  THR A OG1 1 
ATOM   757   C CG2 . THR A 1 124 ? 60.202  24.020  172.432 1.00 117.05 ? 125  THR A CG2 1 
ATOM   758   N N   . PHE A 1 125 ? 59.852  27.406  175.443 1.00 125.06 ? 126  PHE A N   1 
ATOM   759   C CA  . PHE A 1 125 ? 59.758  28.846  175.722 1.00 127.35 ? 126  PHE A CA  1 
ATOM   760   C C   . PHE A 1 125 ? 60.832  29.473  176.634 1.00 137.48 ? 126  PHE A C   1 
ATOM   761   O O   . PHE A 1 125 ? 61.417  30.493  176.268 1.00 138.76 ? 126  PHE A O   1 
ATOM   762   C CB  . PHE A 1 125 ? 58.346  29.220  176.198 1.00 125.81 ? 126  PHE A CB  1 
ATOM   763   C CG  . PHE A 1 125 ? 57.386  29.529  175.077 1.00 123.28 ? 126  PHE A CG  1 
ATOM   764   C CD1 . PHE A 1 125 ? 57.274  28.684  173.984 1.00 119.26 ? 126  PHE A CD1 1 
ATOM   765   C CD2 . PHE A 1 125 ? 56.587  30.662  175.125 1.00 119.48 ? 126  PHE A CD2 1 
ATOM   766   C CE1 . PHE A 1 125 ? 56.389  28.967  172.955 1.00 107.69 ? 126  PHE A CE1 1 
ATOM   767   C CE2 . PHE A 1 125 ? 55.700  30.949  174.100 1.00 109.68 ? 126  PHE A CE2 1 
ATOM   768   C CZ  . PHE A 1 125 ? 55.601  30.101  173.015 1.00 102.81 ? 126  PHE A CZ  1 
ATOM   769   N N   . PRO A 1 126 ? 61.088  28.887  177.822 1.00 142.15 ? 127  PRO A N   1 
ATOM   770   C CA  . PRO A 1 126 ? 62.111  29.515  178.668 1.00 143.67 ? 127  PRO A CA  1 
ATOM   771   C C   . PRO A 1 126 ? 63.496  29.434  178.037 1.00 150.72 ? 127  PRO A C   1 
ATOM   772   O O   . PRO A 1 126 ? 64.278  30.380  178.132 1.00 157.93 ? 127  PRO A O   1 
ATOM   773   C CB  . PRO A 1 126 ? 62.065  28.684  179.954 1.00 139.41 ? 127  PRO A CB  1 
ATOM   774   C CG  . PRO A 1 126 ? 61.539  27.367  179.532 1.00 138.68 ? 127  PRO A CG  1 
ATOM   775   C CD  . PRO A 1 126 ? 60.558  27.654  178.432 1.00 139.95 ? 127  PRO A CD  1 
ATOM   776   N N   . GLY A 1 127 ? 63.787  28.307  177.395 1.00 149.36 ? 128  GLY A N   1 
ATOM   777   C CA  . GLY A 1 127 ? 65.066  28.116  176.740 1.00 151.53 ? 128  GLY A CA  1 
ATOM   778   C C   . GLY A 1 127 ? 65.197  28.960  175.488 1.00 149.36 ? 128  GLY A C   1 
ATOM   779   O O   . GLY A 1 127 ? 66.302  29.345  175.103 1.00 158.04 ? 128  GLY A O   1 
ATOM   780   N N   . ALA A 1 128 ? 64.067  29.250  174.848 1.00 137.45 ? 129  ALA A N   1 
ATOM   781   C CA  . ALA A 1 128 ? 64.076  30.007  173.599 1.00 134.99 ? 129  ALA A CA  1 
ATOM   782   C C   . ALA A 1 128 ? 64.280  31.511  173.781 1.00 142.92 ? 129  ALA A C   1 
ATOM   783   O O   . ALA A 1 128 ? 65.111  32.105  173.100 1.00 154.65 ? 129  ALA A O   1 
ATOM   784   C CB  . ALA A 1 128 ? 62.809  29.735  172.796 1.00 134.50 ? 129  ALA A CB  1 
ATOM   785   N N   . PHE A 1 129 ? 63.532  32.128  174.693 1.00 145.55 ? 130  PHE A N   1 
ATOM   786   C CA  . PHE A 1 129 ? 63.609  33.584  174.846 1.00 153.93 ? 130  PHE A CA  1 
ATOM   787   C C   . PHE A 1 129 ? 63.430  34.165  176.256 1.00 149.15 ? 130  PHE A C   1 
ATOM   788   O O   . PHE A 1 129 ? 63.449  33.441  177.254 1.00 143.60 ? 130  PHE A O   1 
ATOM   789   C CB  . PHE A 1 129 ? 62.740  34.317  173.808 1.00 156.01 ? 130  PHE A CB  1 
ATOM   790   C CG  . PHE A 1 129 ? 61.311  33.847  173.748 1.00 156.86 ? 130  PHE A CG  1 
ATOM   791   C CD1 . PHE A 1 129 ? 60.957  32.752  172.974 1.00 158.80 ? 130  PHE A CD1 1 
ATOM   792   C CD2 . PHE A 1 129 ? 60.317  34.524  174.434 1.00 158.25 ? 130  PHE A CD2 1 
ATOM   793   C CE1 . PHE A 1 129 ? 59.642  32.326  172.907 1.00 158.62 ? 130  PHE A CE1 1 
ATOM   794   C CE2 . PHE A 1 129 ? 59.001  34.105  174.370 1.00 156.54 ? 130  PHE A CE2 1 
ATOM   795   C CZ  . PHE A 1 129 ? 58.663  33.006  173.606 1.00 156.29 ? 130  PHE A CZ  1 
ATOM   796   N N   . GLY A 1 130 ? 63.248  35.482  176.304 1.00 146.83 ? 131  GLY A N   1 
ATOM   797   C CA  . GLY A 1 130 ? 63.500  36.285  177.488 1.00 143.74 ? 131  GLY A CA  1 
ATOM   798   C C   . GLY A 1 130 ? 62.705  36.089  178.766 1.00 127.54 ? 131  GLY A C   1 
ATOM   799   O O   . GLY A 1 130 ? 61.775  35.284  178.840 1.00 109.09 ? 131  GLY A O   1 
ATOM   800   N N   . GLU A 1 131 ? 63.103  36.853  179.783 1.00 133.84 ? 132  GLU A N   1 
ATOM   801   C CA  . GLU A 1 131 ? 62.563  36.751  181.136 1.00 127.95 ? 132  GLU A CA  1 
ATOM   802   C C   . GLU A 1 131 ? 61.089  37.130  181.235 1.00 127.56 ? 132  GLU A C   1 
ATOM   803   O O   . GLU A 1 131 ? 60.457  36.900  182.268 1.00 130.83 ? 132  GLU A O   1 
ATOM   804   C CB  . GLU A 1 131 ? 63.373  37.632  182.090 1.00 129.70 ? 132  GLU A CB  1 
ATOM   805   C CG  . GLU A 1 131 ? 62.872  39.068  182.181 1.00 128.38 ? 132  GLU A CG  1 
ATOM   806   C CD  . GLU A 1 131 ? 63.997  40.082  182.262 1.00 122.81 ? 132  GLU A CD  1 
ATOM   807   O OE1 . GLU A 1 131 ? 65.096  39.796  181.741 1.00 122.68 ? 132  GLU A OE1 1 
ATOM   808   O OE2 . GLU A 1 131 ? 63.781  41.166  182.843 1.00 114.59 ? 132  GLU A OE2 1 
ATOM   809   N N   . LEU A 1 132 ? 60.553  37.732  180.176 1.00 126.54 ? 133  LEU A N   1 
ATOM   810   C CA  . LEU A 1 132 ? 59.131  38.053  180.122 1.00 125.44 ? 133  LEU A CA  1 
ATOM   811   C C   . LEU A 1 132 ? 58.328  36.781  180.347 1.00 112.44 ? 133  LEU A C   1 
ATOM   812   O O   . LEU A 1 132 ? 57.376  36.757  181.136 1.00 105.74 ? 133  LEU A O   1 
ATOM   813   C CB  . LEU A 1 132 ? 58.765  38.672  178.771 1.00 122.64 ? 133  LEU A CB  1 
ATOM   814   C CG  . LEU A 1 132 ? 59.398  40.022  178.428 1.00 119.35 ? 133  LEU A CG  1 
ATOM   815   C CD1 . LEU A 1 132 ? 59.011  40.447  177.022 1.00 105.73 ? 133  LEU A CD1 1 
ATOM   816   C CD2 . LEU A 1 132 ? 58.990  41.080  179.441 1.00 123.43 ? 133  LEU A CD2 1 
ATOM   817   N N   . TYR A 1 133 ? 58.738  35.717  179.663 1.00 106.11 ? 134  TYR A N   1 
ATOM   818   C CA  . TYR A 1 133 ? 58.110  34.419  179.842 1.00 106.59 ? 134  TYR A CA  1 
ATOM   819   C C   . TYR A 1 133 ? 58.237  33.918  181.271 1.00 108.65 ? 134  TYR A C   1 
ATOM   820   O O   . TYR A 1 133 ? 57.238  33.615  181.904 1.00 108.09 ? 134  TYR A O   1 
ATOM   821   C CB  . TYR A 1 133 ? 58.697  33.370  178.900 1.00 114.25 ? 134  TYR A CB  1 
ATOM   822   C CG  . TYR A 1 133 ? 58.292  31.969  179.301 1.00 119.47 ? 134  TYR A CG  1 
ATOM   823   C CD1 . TYR A 1 133 ? 57.022  31.487  179.016 1.00 114.70 ? 134  TYR A CD1 1 
ATOM   824   C CD2 . TYR A 1 133 ? 59.169  31.136  179.985 1.00 122.52 ? 134  TYR A CD2 1 
ATOM   825   C CE1 . TYR A 1 133 ? 56.639  30.214  179.391 1.00 115.87 ? 134  TYR A CE1 1 
ATOM   826   C CE2 . TYR A 1 133 ? 58.793  29.863  180.367 1.00 119.88 ? 134  TYR A CE2 1 
ATOM   827   C CZ  . TYR A 1 133 ? 57.529  29.405  180.064 1.00 117.78 ? 134  TYR A CZ  1 
ATOM   828   O OH  . TYR A 1 133 ? 57.152  28.134  180.438 1.00 115.11 ? 134  TYR A OH  1 
ATOM   829   N N   . THR A 1 134 ? 59.466  33.820  181.771 1.00 106.31 ? 135  THR A N   1 
ATOM   830   C CA  . THR A 1 134 ? 59.703  33.220  183.084 1.00 108.30 ? 135  THR A CA  1 
ATOM   831   C C   . THR A 1 134 ? 59.039  33.995  184.221 1.00 116.91 ? 135  THR A C   1 
ATOM   832   O O   . THR A 1 134 ? 58.752  33.433  185.278 1.00 118.70 ? 135  THR A O   1 
ATOM   833   C CB  . THR A 1 134 ? 61.207  33.030  183.376 1.00 112.74 ? 135  THR A CB  1 
ATOM   834   O OG1 . THR A 1 134 ? 61.912  34.245  183.095 1.00 123.04 ? 135  THR A OG1 1 
ATOM   835   C CG2 . THR A 1 134 ? 61.776  31.911  182.517 1.00 109.43 ? 135  THR A CG2 1 
ATOM   836   N N   . GLN A 1 135 ? 58.804  35.285  184.003 1.00 122.00 ? 136  GLN A N   1 
ATOM   837   C CA  . GLN A 1 135 ? 58.051  36.095  184.953 1.00 127.60 ? 136  GLN A CA  1 
ATOM   838   C C   . GLN A 1 135 ? 56.543  35.891  184.796 1.00 136.91 ? 136  GLN A C   1 
ATOM   839   O O   . GLN A 1 135 ? 55.796  35.949  185.774 1.00 138.89 ? 136  GLN A O   1 
ATOM   840   C CB  . GLN A 1 135 ? 58.410  37.577  184.813 1.00 127.87 ? 136  GLN A CB  1 
ATOM   841   C CG  . GLN A 1 135 ? 59.330  38.110  185.909 1.00 136.98 ? 136  GLN A CG  1 
ATOM   842   C CD  . GLN A 1 135 ? 60.754  37.593  185.799 1.00 135.35 ? 136  GLN A CD  1 
ATOM   843   O OE1 . GLN A 1 135 ? 61.624  38.256  185.233 1.00 130.35 ? 136  GLN A OE1 1 
ATOM   844   N NE2 . GLN A 1 135 ? 61.001  36.409  186.349 1.00 135.18 ? 136  GLN A NE2 1 
ATOM   845   N N   . ASN A 1 136 ? 56.104  35.653  183.562 1.00 141.40 ? 137  ASN A N   1 
ATOM   846   C CA  . ASN A 1 136 ? 54.680  35.472  183.269 1.00 139.97 ? 137  ASN A CA  1 
ATOM   847   C C   . ASN A 1 136 ? 54.204  34.012  183.271 1.00 129.18 ? 137  ASN A C   1 
ATOM   848   O O   . ASN A 1 136 ? 53.068  33.719  182.885 1.00 127.36 ? 137  ASN A O   1 
ATOM   849   C CB  . ASN A 1 136 ? 54.306  36.161  181.953 1.00 146.76 ? 137  ASN A CB  1 
ATOM   850   C CG  . ASN A 1 136 ? 54.646  37.641  181.956 1.00 153.35 ? 137  ASN A CG  1 
ATOM   851   O OD1 . ASN A 1 136 ? 54.895  38.230  183.008 1.00 157.86 ? 137  ASN A OD1 1 
ATOM   852   N ND2 . ASN A 1 136 ? 54.661  38.248  180.775 1.00 152.16 ? 137  ASN A ND2 1 
ATOM   853   N N   . ALA A 1 137 ? 55.087  33.107  183.683 1.00 121.68 ? 138  ALA A N   1 
ATOM   854   C CA  . ALA A 1 137 ? 54.844  31.669  183.595 1.00 111.83 ? 138  ALA A CA  1 
ATOM   855   C C   . ALA A 1 137 ? 53.569  31.244  184.310 1.00 110.75 ? 138  ALA A C   1 
ATOM   856   O O   . ALA A 1 137 ? 52.816  30.407  183.810 1.00 117.58 ? 138  ALA A O   1 
ATOM   857   C CB  . ALA A 1 137 ? 56.038  30.894  184.134 1.00 111.11 ? 138  ALA A CB  1 
ATOM   858   N N   . ARG A 1 138 ? 53.328  31.827  185.479 1.00 111.58 ? 139  ARG A N   1 
ATOM   859   C CA  . ARG A 1 138 ? 52.122  31.520  186.235 1.00 112.50 ? 139  ARG A CA  1 
ATOM   860   C C   . ARG A 1 138 ? 50.887  32.029  185.501 1.00 123.71 ? 139  ARG A C   1 
ATOM   861   O O   . ARG A 1 138 ? 49.826  31.412  185.560 1.00 131.90 ? 139  ARG A O   1 
ATOM   862   C CB  . ARG A 1 138 ? 52.192  32.110  187.645 1.00 109.63 ? 139  ARG A CB  1 
ATOM   863   C CG  . ARG A 1 138 ? 51.067  31.645  188.558 1.00 106.28 ? 139  ARG A CG  1 
ATOM   864   C CD  . ARG A 1 138 ? 51.402  31.873  190.023 1.00 112.03 ? 139  ARG A CD  1 
ATOM   865   N NE  . ARG A 1 138 ? 51.482  33.291  190.359 1.00 122.15 ? 139  ARG A NE  1 
ATOM   866   C CZ  . ARG A 1 138 ? 50.471  33.999  190.851 1.00 122.31 ? 139  ARG A CZ  1 
ATOM   867   N NH1 . ARG A 1 138 ? 49.297  33.420  191.065 1.00 85.43  ? 139  ARG A NH1 1 
ATOM   868   N NH2 . ARG A 1 138 ? 50.634  35.285  191.130 1.00 115.06 ? 139  ARG A NH2 1 
ATOM   869   N N   . ALA A 1 139 ? 51.033  33.148  184.797 1.00 122.40 ? 140  ALA A N   1 
ATOM   870   C CA  . ALA A 1 139 ? 49.932  33.697  184.012 1.00 118.15 ? 140  ALA A CA  1 
ATOM   871   C C   . ALA A 1 139 ? 49.599  32.778  182.841 1.00 113.02 ? 140  ALA A C   1 
ATOM   872   O O   . ALA A 1 139 ? 48.428  32.571  182.519 1.00 111.42 ? 140  ALA A O   1 
ATOM   873   C CB  . ALA A 1 139 ? 50.267  35.096  183.518 1.00 118.62 ? 140  ALA A CB  1 
ATOM   874   N N   . PHE A 1 140 ? 50.633  32.228  182.210 1.00 109.12 ? 141  PHE A N   1 
ATOM   875   C CA  . PHE A 1 140 ? 50.439  31.265  181.128 1.00 103.40 ? 141  PHE A CA  1 
ATOM   876   C C   . PHE A 1 140 ? 49.768  29.991  181.641 1.00 94.30  ? 141  PHE A C   1 
ATOM   877   O O   . PHE A 1 140 ? 48.834  29.472  181.017 1.00 94.15  ? 141  PHE A O   1 
ATOM   878   C CB  . PHE A 1 140 ? 51.775  30.938  180.459 1.00 102.09 ? 141  PHE A CB  1 
ATOM   879   C CG  . PHE A 1 140 ? 52.366  32.090  179.697 1.00 109.67 ? 141  PHE A CG  1 
ATOM   880   C CD1 . PHE A 1 140 ? 51.579  32.848  178.845 1.00 106.86 ? 141  PHE A CD1 1 
ATOM   881   C CD2 . PHE A 1 140 ? 53.702  32.424  179.841 1.00 118.03 ? 141  PHE A CD2 1 
ATOM   882   C CE1 . PHE A 1 140 ? 52.117  33.911  178.143 1.00 110.68 ? 141  PHE A CE1 1 
ATOM   883   C CE2 . PHE A 1 140 ? 54.246  33.488  179.143 1.00 116.02 ? 141  PHE A CE2 1 
ATOM   884   C CZ  . PHE A 1 140 ? 53.452  34.232  178.292 1.00 115.36 ? 141  PHE A CZ  1 
ATOM   885   N N   . ARG A 1 141 ? 50.248  29.499  182.780 1.00 88.46  ? 142  ARG A N   1 
ATOM   886   C CA  . ARG A 1 141 ? 49.648  28.342  183.441 1.00 89.92  ? 142  ARG A CA  1 
ATOM   887   C C   . ARG A 1 141 ? 48.171  28.585  183.730 1.00 98.62  ? 142  ARG A C   1 
ATOM   888   O O   . ARG A 1 141 ? 47.335  27.701  183.534 1.00 98.76  ? 142  ARG A O   1 
ATOM   889   C CB  . ARG A 1 141 ? 50.383  28.035  184.745 1.00 82.45  ? 142  ARG A CB  1 
ATOM   890   C CG  . ARG A 1 141 ? 51.699  27.300  184.569 1.00 87.96  ? 142  ARG A CG  1 
ATOM   891   C CD  . ARG A 1 141 ? 52.603  27.529  185.767 1.00 108.08 ? 142  ARG A CD  1 
ATOM   892   N NE  . ARG A 1 141 ? 51.882  27.402  187.031 1.00 114.28 ? 142  ARG A NE  1 
ATOM   893   C CZ  . ARG A 1 141 ? 52.355  27.811  188.204 1.00 115.19 ? 142  ARG A CZ  1 
ATOM   894   N NH1 . ARG A 1 141 ? 53.551  28.380  188.276 1.00 118.15 ? 142  ARG A NH1 1 
ATOM   895   N NH2 . ARG A 1 141 ? 51.633  27.657  189.306 1.00 111.84 ? 142  ARG A NH2 1 
ATOM   896   N N   . ASP A 1 142 ? 47.860  29.790  184.194 1.00 105.62 ? 143  ASP A N   1 
ATOM   897   C CA  . ASP A 1 142 ? 46.484  30.168  184.483 1.00 108.81 ? 143  ASP A CA  1 
ATOM   898   C C   . ASP A 1 142 ? 45.657  30.221  183.204 1.00 97.34  ? 143  ASP A C   1 
ATOM   899   O O   . ASP A 1 142 ? 44.480  29.869  183.208 1.00 98.46  ? 143  ASP A O   1 
ATOM   900   C CB  . ASP A 1 142 ? 46.433  31.515  185.209 1.00 119.11 ? 143  ASP A CB  1 
ATOM   901   C CG  . ASP A 1 142 ? 47.065  31.458  186.587 1.00 119.55 ? 143  ASP A CG  1 
ATOM   902   O OD1 . ASP A 1 142 ? 47.075  30.367  187.195 1.00 111.84 ? 143  ASP A OD1 1 
ATOM   903   O OD2 . ASP A 1 142 ? 47.558  32.504  187.062 1.00 122.51 ? 143  ASP A OD2 1 
ATOM   904   N N   . LEU A 1 143 ? 46.278  30.661  182.113 1.00 86.38  ? 144  LEU A N   1 
ATOM   905   C CA  . LEU A 1 143 ? 45.622  30.677  180.809 1.00 76.60  ? 144  LEU A CA  1 
ATOM   906   C C   . LEU A 1 143 ? 45.217  29.267  180.395 1.00 86.63  ? 144  LEU A C   1 
ATOM   907   O O   . LEU A 1 143 ? 44.062  29.020  180.027 1.00 90.49  ? 144  LEU A O   1 
ATOM   908   C CB  . LEU A 1 143 ? 46.547  31.281  179.750 1.00 67.68  ? 144  LEU A CB  1 
ATOM   909   C CG  . LEU A 1 143 ? 46.147  31.050  178.290 1.00 64.11  ? 144  LEU A CG  1 
ATOM   910   C CD1 . LEU A 1 143 ? 44.848  31.769  177.962 1.00 58.42  ? 144  LEU A CD1 1 
ATOM   911   C CD2 . LEU A 1 143 ? 47.261  31.481  177.347 1.00 65.01  ? 144  LEU A CD2 1 
ATOM   912   N N   . TYR A 1 144 ? 46.171  28.344  180.463 1.00 83.61  ? 145  TYR A N   1 
ATOM   913   C CA  . TYR A 1 144 ? 45.905  26.955  180.103 1.00 78.96  ? 145  TYR A CA  1 
ATOM   914   C C   . TYR A 1 144 ? 44.863  26.303  181.013 1.00 84.58  ? 145  TYR A C   1 
ATOM   915   O O   . TYR A 1 144 ? 44.001  25.559  180.543 1.00 83.84  ? 145  TYR A O   1 
ATOM   916   C CB  . TYR A 1 144 ? 47.200  26.140  180.092 1.00 77.26  ? 145  TYR A CB  1 
ATOM   917   C CG  . TYR A 1 144 ? 47.892  26.130  178.748 1.00 83.60  ? 145  TYR A CG  1 
ATOM   918   C CD1 . TYR A 1 144 ? 47.168  26.277  177.574 1.00 93.79  ? 145  TYR A CD1 1 
ATOM   919   C CD2 . TYR A 1 144 ? 49.268  25.973  178.653 1.00 79.94  ? 145  TYR A CD2 1 
ATOM   920   C CE1 . TYR A 1 144 ? 47.793  26.267  176.342 1.00 95.32  ? 145  TYR A CE1 1 
ATOM   921   C CE2 . TYR A 1 144 ? 49.902  25.962  177.425 1.00 82.53  ? 145  TYR A CE2 1 
ATOM   922   C CZ  . TYR A 1 144 ? 49.160  26.109  176.273 1.00 85.30  ? 145  TYR A CZ  1 
ATOM   923   O OH  . TYR A 1 144 ? 49.784  26.099  175.047 1.00 81.21  ? 145  TYR A OH  1 
ATOM   924   N N   . SER A 1 145 ? 44.943  26.589  182.310 1.00 84.85  ? 146  SER A N   1 
ATOM   925   C CA  . SER A 1 145 ? 43.975  26.062  183.267 1.00 86.01  ? 146  SER A CA  1 
ATOM   926   C C   . SER A 1 145 ? 42.570  26.580  182.968 1.00 88.04  ? 146  SER A C   1 
ATOM   927   O O   . SER A 1 145 ? 41.591  25.834  183.045 1.00 68.80  ? 146  SER A O   1 
ATOM   928   C CB  . SER A 1 145 ? 44.380  26.421  184.698 1.00 90.94  ? 146  SER A CB  1 
ATOM   929   O OG  . SER A 1 145 ? 45.608  25.809  185.050 1.00 100.25 ? 146  SER A OG  1 
ATOM   930   N N   . GLU A 1 146 ? 42.482  27.863  182.628 1.00 98.84  ? 147  GLU A N   1 
ATOM   931   C CA  . GLU A 1 146 ? 41.214  28.474  182.246 1.00 103.35 ? 147  GLU A CA  1 
ATOM   932   C C   . GLU A 1 146 ? 40.673  27.844  180.969 1.00 91.31  ? 147  GLU A C   1 
ATOM   933   O O   . GLU A 1 146 ? 39.463  27.696  180.808 1.00 86.35  ? 147  GLU A O   1 
ATOM   934   C CB  . GLU A 1 146 ? 41.369  29.987  182.065 1.00 115.37 ? 147  GLU A CB  1 
ATOM   935   C CG  . GLU A 1 146 ? 41.439  30.772  183.369 1.00 123.37 ? 147  GLU A CG  1 
ATOM   936   C CD  . GLU A 1 146 ? 40.102  30.849  184.082 1.00 126.64 ? 147  GLU A CD  1 
ATOM   937   O OE1 . GLU A 1 146 ? 39.106  31.246  183.441 1.00 126.37 ? 147  GLU A OE1 1 
ATOM   938   O OE2 . GLU A 1 146 ? 40.047  30.510  185.283 1.00 126.74 ? 147  GLU A OE2 1 
ATOM   939   N N   . LEU A 1 147 ? 41.572  27.473  180.061 1.00 83.77  ? 148  LEU A N   1 
ATOM   940   C CA  . LEU A 1 147 ? 41.164  26.765  178.853 1.00 71.61  ? 148  LEU A CA  1 
ATOM   941   C C   . LEU A 1 147 ? 40.625  25.380  179.192 1.00 70.35  ? 148  LEU A C   1 
ATOM   942   O O   . LEU A 1 147 ? 39.679  24.902  178.566 1.00 55.44  ? 148  LEU A O   1 
ATOM   943   C CB  . LEU A 1 147 ? 42.320  26.655  177.859 1.00 62.65  ? 148  LEU A CB  1 
ATOM   944   C CG  . LEU A 1 147 ? 42.586  27.902  177.016 1.00 74.81  ? 148  LEU A CG  1 
ATOM   945   C CD1 . LEU A 1 147 ? 43.641  27.613  175.966 1.00 73.94  ? 148  LEU A CD1 1 
ATOM   946   C CD2 . LEU A 1 147 ? 41.299  28.395  176.370 1.00 72.77  ? 148  LEU A CD2 1 
ATOM   947   N N   . ARG A 1 148 ? 41.233  24.739  180.185 1.00 77.23  ? 149  ARG A N   1 
ATOM   948   C CA  . ARG A 1 148 ? 40.754  23.443  180.648 1.00 73.29  ? 149  ARG A CA  1 
ATOM   949   C C   . ARG A 1 148 ? 39.364  23.573  181.260 1.00 77.36  ? 149  ARG A C   1 
ATOM   950   O O   . ARG A 1 148 ? 38.506  22.714  181.057 1.00 77.60  ? 149  ARG A O   1 
ATOM   951   C CB  . ARG A 1 148 ? 41.733  22.819  181.646 1.00 66.48  ? 149  ARG A CB  1 
ATOM   952   C CG  . ARG A 1 148 ? 42.982  22.247  180.994 1.00 59.48  ? 149  ARG A CG  1 
ATOM   953   C CD  . ARG A 1 148 ? 43.743  21.332  181.939 1.00 63.36  ? 149  ARG A CD  1 
ATOM   954   N NE  . ARG A 1 148 ? 44.853  22.015  182.595 1.00 79.71  ? 149  ARG A NE  1 
ATOM   955   C CZ  . ARG A 1 148 ? 46.078  22.101  182.087 1.00 87.33  ? 149  ARG A CZ  1 
ATOM   956   N NH1 . ARG A 1 148 ? 46.352  21.549  180.912 1.00 80.61  ? 149  ARG A NH1 1 
ATOM   957   N NH2 . ARG A 1 148 ? 47.031  22.740  182.752 1.00 97.10  ? 149  ARG A NH2 1 
ATOM   958   N N   . LEU A 1 149 ? 39.146  24.657  181.999 1.00 79.24  ? 150  LEU A N   1 
ATOM   959   C CA  . LEU A 1 149 ? 37.837  24.943  182.575 1.00 65.49  ? 150  LEU A CA  1 
ATOM   960   C C   . LEU A 1 149 ? 36.811  25.207  181.480 1.00 68.23  ? 150  LEU A C   1 
ATOM   961   O O   . LEU A 1 149 ? 35.646  24.829  181.601 1.00 76.37  ? 150  LEU A O   1 
ATOM   962   C CB  . LEU A 1 149 ? 37.918  26.145  183.517 1.00 63.12  ? 150  LEU A CB  1 
ATOM   963   C CG  . LEU A 1 149 ? 38.609  25.906  184.860 1.00 74.14  ? 150  LEU A CG  1 
ATOM   964   C CD1 . LEU A 1 149 ? 38.842  27.222  185.586 1.00 83.78  ? 150  LEU A CD1 1 
ATOM   965   C CD2 . LEU A 1 149 ? 37.784  24.957  185.716 1.00 68.00  ? 150  LEU A CD2 1 
ATOM   966   N N   . TYR A 1 150 ? 37.255  25.862  180.412 1.00 61.34  ? 151  TYR A N   1 
ATOM   967   C CA  . TYR A 1 150 ? 36.403  26.128  179.260 1.00 61.82  ? 151  TYR A CA  1 
ATOM   968   C C   . TYR A 1 150 ? 36.005  24.821  178.583 1.00 69.38  ? 151  TYR A C   1 
ATOM   969   O O   . TYR A 1 150 ? 34.862  24.653  178.157 1.00 61.13  ? 151  TYR A O   1 
ATOM   970   C CB  . TYR A 1 150 ? 37.122  27.047  178.270 1.00 64.12  ? 151  TYR A CB  1 
ATOM   971   C CG  . TYR A 1 150 ? 36.321  27.383  177.033 1.00 75.72  ? 151  TYR A CG  1 
ATOM   972   C CD1 . TYR A 1 150 ? 34.994  27.780  177.128 1.00 79.11  ? 151  TYR A CD1 1 
ATOM   973   C CD2 . TYR A 1 150 ? 36.897  27.322  175.770 1.00 80.98  ? 151  TYR A CD2 1 
ATOM   974   C CE1 . TYR A 1 150 ? 34.259  28.094  176.003 1.00 80.66  ? 151  TYR A CE1 1 
ATOM   975   C CE2 . TYR A 1 150 ? 36.170  27.636  174.638 1.00 81.47  ? 151  TYR A CE2 1 
ATOM   976   C CZ  . TYR A 1 150 ? 34.852  28.021  174.761 1.00 85.43  ? 151  TYR A CZ  1 
ATOM   977   O OH  . TYR A 1 150 ? 34.122  28.336  173.639 1.00 94.13  ? 151  TYR A OH  1 
ATOM   978   N N   . TYR A 1 151 ? 36.956  23.896  178.492 1.00 74.61  ? 152  TYR A N   1 
ATOM   979   C CA  . TYR A 1 151 ? 36.702  22.592  177.890 1.00 60.58  ? 152  TYR A CA  1 
ATOM   980   C C   . TYR A 1 151 ? 35.783  21.738  178.760 1.00 68.65  ? 152  TYR A C   1 
ATOM   981   O O   . TYR A 1 151 ? 34.977  20.964  178.248 1.00 66.34  ? 152  TYR A O   1 
ATOM   982   C CB  . TYR A 1 151 ? 38.016  21.852  177.619 1.00 51.58  ? 152  TYR A CB  1 
ATOM   983   C CG  . TYR A 1 151 ? 37.834  20.386  177.293 1.00 50.55  ? 152  TYR A CG  1 
ATOM   984   C CD1 . TYR A 1 151 ? 37.382  19.982  176.042 1.00 55.75  ? 152  TYR A CD1 1 
ATOM   985   C CD2 . TYR A 1 151 ? 38.111  19.405  178.237 1.00 49.68  ? 152  TYR A CD2 1 
ATOM   986   C CE1 . TYR A 1 151 ? 37.210  18.641  175.742 1.00 49.68  ? 152  TYR A CE1 1 
ATOM   987   C CE2 . TYR A 1 151 ? 37.942  18.064  177.946 1.00 51.69  ? 152  TYR A CE2 1 
ATOM   988   C CZ  . TYR A 1 151 ? 37.492  17.687  176.698 1.00 53.39  ? 152  TYR A CZ  1 
ATOM   989   O OH  . TYR A 1 151 ? 37.325  16.353  176.405 1.00 61.01  ? 152  TYR A OH  1 
ATOM   990   N N   . ARG A 1 152 ? 35.904  21.883  180.076 1.00 73.55  ? 153  ARG A N   1 
ATOM   991   C CA  . ARG A 1 152 ? 35.087  21.105  181.003 1.00 78.28  ? 153  ARG A CA  1 
ATOM   992   C C   . ARG A 1 152 ? 33.646  21.606  181.050 1.00 79.35  ? 153  ARG A C   1 
ATOM   993   O O   . ARG A 1 152 ? 32.760  20.924  181.565 1.00 73.99  ? 153  ARG A O   1 
ATOM   994   C CB  . ARG A 1 152 ? 35.706  21.105  182.405 1.00 86.67  ? 153  ARG A CB  1 
ATOM   995   C CG  . ARG A 1 152 ? 36.991  20.296  182.505 1.00 103.82 ? 153  ARG A CG  1 
ATOM   996   C CD  . ARG A 1 152 ? 37.669  20.452  183.861 1.00 118.62 ? 153  ARG A CD  1 
ATOM   997   N NE  . ARG A 1 152 ? 36.891  19.871  184.952 1.00 124.57 ? 153  ARG A NE  1 
ATOM   998   C CZ  . ARG A 1 152 ? 36.287  20.580  185.901 1.00 126.13 ? 153  ARG A CZ  1 
ATOM   999   N NH1 . ARG A 1 152 ? 36.373  21.903  185.899 1.00 125.93 ? 153  ARG A NH1 1 
ATOM   1000  N NH2 . ARG A 1 152 ? 35.602  19.966  186.856 1.00 125.92 ? 153  ARG A NH2 1 
ATOM   1001  N N   . GLY A 1 153 ? 33.417  22.797  180.506 1.00 83.65  ? 154  GLY A N   1 
ATOM   1002  C CA  . GLY A 1 153 ? 32.089  23.380  180.481 1.00 90.48  ? 154  GLY A CA  1 
ATOM   1003  C C   . GLY A 1 153 ? 31.757  24.130  181.756 1.00 104.68 ? 154  GLY A C   1 
ATOM   1004  O O   . GLY A 1 153 ? 30.598  24.455  182.012 1.00 110.41 ? 154  GLY A O   1 
ATOM   1005  N N   . ALA A 1 154 ? 32.778  24.404  182.561 1.00 111.17 ? 155  ALA A N   1 
ATOM   1006  C CA  . ALA A 1 154 ? 32.594  25.144  183.804 1.00 120.18 ? 155  ALA A CA  1 
ATOM   1007  C C   . ALA A 1 154 ? 32.451  26.638  183.529 1.00 124.99 ? 155  ALA A C   1 
ATOM   1008  O O   . ALA A 1 154 ? 31.815  27.363  184.292 1.00 125.92 ? 155  ALA A O   1 
ATOM   1009  C CB  . ALA A 1 154 ? 33.754  24.884  184.753 1.00 127.08 ? 155  ALA A CB  1 
ATOM   1010  N N   . ASN A 1 155 ? 33.056  27.088  182.435 1.00 130.32 ? 156  ASN A N   1 
ATOM   1011  C CA  . ASN A 1 155 ? 32.985  28.486  182.028 1.00 140.06 ? 156  ASN A CA  1 
ATOM   1012  C C   . ASN A 1 155 ? 32.657  28.577  180.542 1.00 145.04 ? 156  ASN A C   1 
ATOM   1013  O O   . ASN A 1 155 ? 33.418  28.092  179.708 1.00 150.12 ? 156  ASN A O   1 
ATOM   1014  C CB  . ASN A 1 155 ? 34.309  29.188  182.331 1.00 142.57 ? 156  ASN A CB  1 
ATOM   1015  C CG  . ASN A 1 155 ? 34.238  30.686  182.122 1.00 143.48 ? 156  ASN A CG  1 
ATOM   1016  O OD1 . ASN A 1 155 ? 34.547  31.188  181.042 1.00 138.71 ? 156  ASN A OD1 1 
ATOM   1017  N ND2 . ASN A 1 155 ? 33.833  31.411  183.159 1.00 147.99 ? 156  ASN A ND2 1 
ATOM   1018  N N   . LEU A 1 156 ? 31.520  29.182  180.212 1.00 144.67 ? 157  LEU A N   1 
ATOM   1019  C CA  . LEU A 1 156 ? 31.036  29.169  178.833 1.00 144.53 ? 157  LEU A CA  1 
ATOM   1020  C C   . LEU A 1 156 ? 31.406  30.412  178.014 1.00 150.02 ? 157  LEU A C   1 
ATOM   1021  O O   . LEU A 1 156 ? 31.129  30.473  176.816 1.00 149.47 ? 157  LEU A O   1 
ATOM   1022  C CB  . LEU A 1 156 ? 29.521  28.939  178.808 1.00 143.56 ? 157  LEU A CB  1 
ATOM   1023  C CG  . LEU A 1 156 ? 28.932  28.332  177.532 1.00 142.85 ? 157  LEU A CG  1 
ATOM   1024  C CD1 . LEU A 1 156 ? 29.687  27.069  177.146 1.00 138.02 ? 157  LEU A CD1 1 
ATOM   1025  C CD2 . LEU A 1 156 ? 27.449  28.040  177.705 1.00 141.61 ? 157  LEU A CD2 1 
ATOM   1026  N N   . HIS A 1 157 ? 32.034  31.398  178.649 1.00 150.67 ? 158  HIS A N   1 
ATOM   1027  C CA  . HIS A 1 157 ? 32.463  32.593  177.925 1.00 148.09 ? 158  HIS A CA  1 
ATOM   1028  C C   . HIS A 1 157 ? 33.972  32.801  178.022 1.00 138.18 ? 158  HIS A C   1 
ATOM   1029  O O   . HIS A 1 157 ? 34.490  33.159  179.079 1.00 132.95 ? 158  HIS A O   1 
ATOM   1030  C CB  . HIS A 1 157 ? 31.728  33.828  178.449 1.00 157.34 ? 158  HIS A CB  1 
ATOM   1031  C CG  . HIS A 1 157 ? 30.236  33.719  178.378 1.00 163.05 ? 158  HIS A CG  1 
ATOM   1032  N ND1 . HIS A 1 157 ? 29.526  33.971  177.224 1.00 165.87 ? 158  HIS A ND1 1 
ATOM   1033  C CD2 . HIS A 1 157 ? 29.321  33.386  179.318 1.00 164.13 ? 158  HIS A CD2 1 
ATOM   1034  C CE1 . HIS A 1 157 ? 28.237  33.797  177.456 1.00 165.11 ? 158  HIS A CE1 1 
ATOM   1035  N NE2 . HIS A 1 157 ? 28.085  33.442  178.720 1.00 165.64 ? 158  HIS A NE2 1 
ATOM   1036  N N   . LEU A 1 158 ? 34.670  32.591  176.909 1.00 137.02 ? 159  LEU A N   1 
ATOM   1037  C CA  . LEU A 1 158 ? 36.125  32.721  176.886 1.00 140.51 ? 159  LEU A CA  1 
ATOM   1038  C C   . LEU A 1 158 ? 36.605  34.100  176.438 1.00 149.06 ? 159  LEU A C   1 
ATOM   1039  O O   . LEU A 1 158 ? 37.789  34.414  176.555 1.00 150.16 ? 159  LEU A O   1 
ATOM   1040  C CB  . LEU A 1 158 ? 36.754  31.642  175.999 1.00 135.79 ? 159  LEU A CB  1 
ATOM   1041  C CG  . LEU A 1 158 ? 36.868  31.934  174.500 1.00 133.35 ? 159  LEU A CG  1 
ATOM   1042  C CD1 . LEU A 1 158 ? 37.738  30.883  173.829 1.00 130.98 ? 159  LEU A CD1 1 
ATOM   1043  C CD2 . LEU A 1 158 ? 35.499  32.003  173.836 1.00 128.78 ? 159  LEU A CD2 1 
ATOM   1044  N N   . GLU A 1 159 ? 35.689  34.920  175.932 1.00 154.55 ? 160  GLU A N   1 
ATOM   1045  C CA  . GLU A 1 159 ? 36.051  36.242  175.430 1.00 154.38 ? 160  GLU A CA  1 
ATOM   1046  C C   . GLU A 1 159 ? 36.500  37.144  176.571 1.00 148.77 ? 160  GLU A C   1 
ATOM   1047  O O   . GLU A 1 159 ? 37.501  37.854  176.463 1.00 144.49 ? 160  GLU A O   1 
ATOM   1048  C CB  . GLU A 1 159 ? 34.877  36.882  174.683 1.00 155.82 ? 160  GLU A CB  1 
ATOM   1049  C CG  . GLU A 1 159 ? 35.178  38.271  174.136 1.00 158.25 ? 160  GLU A CG  1 
ATOM   1050  C CD  . GLU A 1 159 ? 33.987  38.900  173.439 1.00 157.01 ? 160  GLU A CD  1 
ATOM   1051  O OE1 . GLU A 1 159 ? 32.941  38.228  173.322 1.00 153.99 ? 160  GLU A OE1 1 
ATOM   1052  O OE2 . GLU A 1 159 ? 34.097  40.069  173.010 1.00 157.04 ? 160  GLU A OE2 1 
ATOM   1053  N N   . GLU A 1 160 ? 35.754  37.099  177.668 1.00 147.15 ? 161  GLU A N   1 
ATOM   1054  C CA  . GLU A 1 160 ? 36.054  37.903  178.842 1.00 147.77 ? 161  GLU A CA  1 
ATOM   1055  C C   . GLU A 1 160 ? 37.364  37.459  179.483 1.00 145.48 ? 161  GLU A C   1 
ATOM   1056  O O   . GLU A 1 160 ? 38.230  38.283  179.771 1.00 154.84 ? 161  GLU A O   1 
ATOM   1057  C CB  . GLU A 1 160 ? 34.912  37.801  179.854 1.00 149.27 ? 161  GLU A CB  1 
ATOM   1058  C CG  . GLU A 1 160 ? 33.534  37.989  179.240 1.00 148.91 ? 161  GLU A CG  1 
ATOM   1059  C CD  . GLU A 1 160 ? 32.413  37.690  180.215 1.00 149.39 ? 161  GLU A CD  1 
ATOM   1060  O OE1 . GLU A 1 160 ? 32.485  38.160  181.370 1.00 152.58 ? 161  GLU A OE1 1 
ATOM   1061  O OE2 . GLU A 1 160 ? 31.460  36.981  179.827 1.00 144.83 ? 161  GLU A OE2 1 
ATOM   1062  N N   . THR A 1 161 ? 37.504  36.153  179.698 1.00 132.15 ? 162  THR A N   1 
ATOM   1063  C CA  . THR A 1 161 ? 38.703  35.602  180.323 1.00 128.23 ? 162  THR A CA  1 
ATOM   1064  C C   . THR A 1 161 ? 39.957  35.840  179.484 1.00 131.35 ? 162  THR A C   1 
ATOM   1065  O O   . THR A 1 161 ? 41.031  36.113  180.025 1.00 132.57 ? 162  THR A O   1 
ATOM   1066  C CB  . THR A 1 161 ? 38.556  34.094  180.611 1.00 117.43 ? 162  THR A CB  1 
ATOM   1067  O OG1 . THR A 1 161 ? 38.148  33.413  179.418 1.00 122.32 ? 162  THR A OG1 1 
ATOM   1068  C CG2 . THR A 1 161 ? 37.520  33.861  181.702 1.00 110.72 ? 162  THR A CG2 1 
ATOM   1069  N N   . LEU A 1 162 ? 39.821  35.737  178.165 1.00 129.12 ? 163  LEU A N   1 
ATOM   1070  C CA  . LEU A 1 162 ? 40.940  36.023  177.275 1.00 129.75 ? 163  LEU A CA  1 
ATOM   1071  C C   . LEU A 1 162 ? 41.285  37.506  177.295 1.00 147.28 ? 163  LEU A C   1 
ATOM   1072  O O   . LEU A 1 162 ? 42.455  37.872  177.379 1.00 156.01 ? 163  LEU A O   1 
ATOM   1073  C CB  . LEU A 1 162 ? 40.653  35.564  175.844 1.00 114.59 ? 163  LEU A CB  1 
ATOM   1074  C CG  . LEU A 1 162 ? 40.910  34.084  175.558 1.00 102.90 ? 163  LEU A CG  1 
ATOM   1075  C CD1 . LEU A 1 162 ? 40.737  33.782  174.079 1.00 96.78  ? 163  LEU A CD1 1 
ATOM   1076  C CD2 . LEU A 1 162 ? 42.300  33.687  176.026 1.00 98.15  ? 163  LEU A CD2 1 
ATOM   1077  N N   . ALA A 1 163 ? 40.263  38.355  177.227 1.00 149.47 ? 164  ALA A N   1 
ATOM   1078  C CA  . ALA A 1 163 ? 40.465  39.802  177.260 1.00 155.41 ? 164  ALA A CA  1 
ATOM   1079  C C   . ALA A 1 163 ? 41.148  40.247  178.551 1.00 155.57 ? 164  ALA A C   1 
ATOM   1080  O O   . ALA A 1 163 ? 41.952  41.180  178.550 1.00 148.17 ? 164  ALA A O   1 
ATOM   1081  C CB  . ALA A 1 163 ? 39.141  40.529  177.081 1.00 156.10 ? 164  ALA A CB  1 
ATOM   1082  N N   . GLU A 1 164 ? 40.826  39.570  179.650 1.00 154.21 ? 165  GLU A N   1 
ATOM   1083  C CA  . GLU A 1 164 ? 41.450  39.860  180.937 1.00 147.38 ? 165  GLU A CA  1 
ATOM   1084  C C   . GLU A 1 164 ? 42.864  39.290  181.000 1.00 134.52 ? 165  GLU A C   1 
ATOM   1085  O O   . GLU A 1 164 ? 43.745  39.865  181.646 1.00 132.78 ? 165  GLU A O   1 
ATOM   1086  C CB  . GLU A 1 164 ? 40.599  39.319  182.087 1.00 147.66 ? 165  GLU A CB  1 
ATOM   1087  C CG  . GLU A 1 164 ? 39.246  40.000  182.230 1.00 150.58 ? 165  GLU A CG  1 
ATOM   1088  C CD  . GLU A 1 164 ? 38.416  39.421  183.359 1.00 154.34 ? 165  GLU A CD  1 
ATOM   1089  O OE1 . GLU A 1 164 ? 39.003  39.033  184.391 1.00 159.11 ? 165  GLU A OE1 1 
ATOM   1090  O OE2 . GLU A 1 164 ? 37.177  39.350  183.212 1.00 152.28 ? 165  GLU A OE2 1 
ATOM   1091  N N   . PHE A 1 165 ? 43.076  38.161  180.330 1.00 128.90 ? 166  PHE A N   1 
ATOM   1092  C CA  . PHE A 1 165 ? 44.410  37.583  180.213 1.00 127.89 ? 166  PHE A CA  1 
ATOM   1093  C C   . PHE A 1 165 ? 45.335  38.561  179.502 1.00 129.73 ? 166  PHE A C   1 
ATOM   1094  O O   . PHE A 1 165 ? 46.459  38.801  179.944 1.00 127.42 ? 166  PHE A O   1 
ATOM   1095  C CB  . PHE A 1 165 ? 44.364  36.253  179.457 1.00 120.95 ? 166  PHE A CB  1 
ATOM   1096  C CG  . PHE A 1 165 ? 45.715  35.751  179.024 1.00 123.85 ? 166  PHE A CG  1 
ATOM   1097  C CD1 . PHE A 1 165 ? 46.566  35.139  179.929 1.00 126.27 ? 166  PHE A CD1 1 
ATOM   1098  C CD2 . PHE A 1 165 ? 46.130  35.887  177.708 1.00 124.58 ? 166  PHE A CD2 1 
ATOM   1099  C CE1 . PHE A 1 165 ? 47.808  34.675  179.532 1.00 125.80 ? 166  PHE A CE1 1 
ATOM   1100  C CE2 . PHE A 1 165 ? 47.371  35.426  177.305 1.00 123.28 ? 166  PHE A CE2 1 
ATOM   1101  C CZ  . PHE A 1 165 ? 48.210  34.820  178.218 1.00 122.17 ? 166  PHE A CZ  1 
ATOM   1102  N N   . TRP A 1 166 ? 44.848  39.130  178.403 1.00 134.09 ? 167  TRP A N   1 
ATOM   1103  C CA  . TRP A 1 166 ? 45.604  40.126  177.654 1.00 144.47 ? 167  TRP A CA  1 
ATOM   1104  C C   . TRP A 1 166 ? 45.689  41.439  178.424 1.00 153.35 ? 167  TRP A C   1 
ATOM   1105  O O   . TRP A 1 166 ? 46.615  42.222  178.227 1.00 155.14 ? 167  TRP A O   1 
ATOM   1106  C CB  . TRP A 1 166 ? 44.977  40.368  176.278 1.00 141.88 ? 167  TRP A CB  1 
ATOM   1107  C CG  . TRP A 1 166 ? 44.923  39.148  175.406 1.00 130.93 ? 167  TRP A CG  1 
ATOM   1108  C CD1 . TRP A 1 166 ? 43.805  38.556  174.894 1.00 126.37 ? 167  TRP A CD1 1 
ATOM   1109  C CD2 . TRP A 1 166 ? 46.034  38.369  174.944 1.00 120.80 ? 167  TRP A CD2 1 
ATOM   1110  N NE1 . TRP A 1 166 ? 44.149  37.459  174.144 1.00 122.23 ? 167  TRP A NE1 1 
ATOM   1111  C CE2 . TRP A 1 166 ? 45.513  37.323  174.158 1.00 117.31 ? 167  TRP A CE2 1 
ATOM   1112  C CE3 . TRP A 1 166 ? 47.418  38.456  175.119 1.00 111.07 ? 167  TRP A CE3 1 
ATOM   1113  C CZ2 . TRP A 1 166 ? 46.325  36.371  173.548 1.00 108.01 ? 167  TRP A CZ2 1 
ATOM   1114  C CZ3 . TRP A 1 166 ? 48.223  37.510  174.511 1.00 110.31 ? 167  TRP A CZ3 1 
ATOM   1115  C CH2 . TRP A 1 166 ? 47.675  36.481  173.737 1.00 109.18 ? 167  TRP A CH2 1 
ATOM   1116  N N   . ALA A 1 167 ? 44.717  41.674  179.298 1.00 155.46 ? 168  ALA A N   1 
ATOM   1117  C CA  . ALA A 1 167 ? 44.701  42.877  180.122 1.00 154.62 ? 168  ALA A CA  1 
ATOM   1118  C C   . ALA A 1 167 ? 45.839  42.855  181.133 1.00 148.62 ? 168  ALA A C   1 
ATOM   1119  O O   . ALA A 1 167 ? 46.596  43.820  181.249 1.00 151.70 ? 168  ALA A O   1 
ATOM   1120  C CB  . ALA A 1 167 ? 43.367  43.024  180.832 1.00 157.01 ? 168  ALA A CB  1 
ATOM   1121  N N   . ARG A 1 168 ? 45.955  41.752  181.866 1.00 142.98 ? 169  ARG A N   1 
ATOM   1122  C CA  . ARG A 1 168 ? 47.001  41.619  182.874 1.00 141.83 ? 169  ARG A CA  1 
ATOM   1123  C C   . ARG A 1 168 ? 48.332  41.165  182.276 1.00 136.07 ? 169  ARG A C   1 
ATOM   1124  O O   . ARG A 1 168 ? 49.355  41.152  182.961 1.00 132.89 ? 169  ARG A O   1 
ATOM   1125  C CB  . ARG A 1 168 ? 46.546  40.683  183.996 1.00 139.48 ? 169  ARG A CB  1 
ATOM   1126  C CG  . ARG A 1 168 ? 45.653  41.366  185.021 1.00 142.65 ? 169  ARG A CG  1 
ATOM   1127  C CD  . ARG A 1 168 ? 44.876  40.362  185.852 1.00 144.04 ? 169  ARG A CD  1 
ATOM   1128  N NE  . ARG A 1 168 ? 43.959  39.574  185.034 1.00 146.76 ? 169  ARG A NE  1 
ATOM   1129  C CZ  . ARG A 1 168 ? 43.015  38.779  185.527 1.00 141.17 ? 169  ARG A CZ  1 
ATOM   1130  N NH1 . ARG A 1 168 ? 42.858  38.667  186.839 1.00 144.21 ? 169  ARG A NH1 1 
ATOM   1131  N NH2 . ARG A 1 168 ? 42.225  38.099  184.708 1.00 131.84 ? 169  ARG A NH2 1 
ATOM   1132  N N   . LEU A 1 169 ? 48.317  40.782  181.001 1.00 132.95 ? 170  LEU A N   1 
ATOM   1133  C CA  . LEU A 1 169 ? 49.564  40.563  180.275 1.00 132.94 ? 170  LEU A CA  1 
ATOM   1134  C C   . LEU A 1 169 ? 50.115  41.905  179.805 1.00 140.93 ? 170  LEU A C   1 
ATOM   1135  O O   . LEU A 1 169 ? 51.323  42.137  179.830 1.00 147.80 ? 170  LEU A O   1 
ATOM   1136  C CB  . LEU A 1 169 ? 49.365  39.624  179.085 1.00 132.56 ? 170  LEU A CB  1 
ATOM   1137  C CG  . LEU A 1 169 ? 50.644  39.238  178.338 1.00 133.05 ? 170  LEU A CG  1 
ATOM   1138  C CD1 . LEU A 1 169 ? 51.659  38.639  179.299 1.00 135.59 ? 170  LEU A CD1 1 
ATOM   1139  C CD2 . LEU A 1 169 ? 50.342  38.268  177.211 1.00 128.80 ? 170  LEU A CD2 1 
ATOM   1140  N N   . LEU A 1 170 ? 49.211  42.783  179.377 1.00 139.05 ? 171  LEU A N   1 
ATOM   1141  C CA  . LEU A 1 170 ? 49.572  44.134  178.964 1.00 137.14 ? 171  LEU A CA  1 
ATOM   1142  C C   . LEU A 1 170 ? 50.044  44.952  180.160 1.00 134.32 ? 171  LEU A C   1 
ATOM   1143  O O   . LEU A 1 170 ? 51.012  45.708  180.064 1.00 133.21 ? 171  LEU A O   1 
ATOM   1144  C CB  . LEU A 1 170 ? 48.382  44.824  178.294 1.00 134.81 ? 171  LEU A CB  1 
ATOM   1145  C CG  . LEU A 1 170 ? 48.556  46.298  177.925 1.00 132.46 ? 171  LEU A CG  1 
ATOM   1146  C CD1 . LEU A 1 170 ? 49.688  46.464  176.925 1.00 131.17 ? 171  LEU A CD1 1 
ATOM   1147  C CD2 . LEU A 1 170 ? 47.255  46.866  177.380 1.00 125.64 ? 171  LEU A CD2 1 
ATOM   1148  N N   . GLU A 1 171 ? 49.359  44.792  181.289 1.00 133.78 ? 172  GLU A N   1 
ATOM   1149  C CA  . GLU A 1 171 ? 49.737  45.495  182.509 1.00 137.36 ? 172  GLU A CA  1 
ATOM   1150  C C   . GLU A 1 171 ? 50.980  44.878  183.148 1.00 131.97 ? 172  GLU A C   1 
ATOM   1151  O O   . GLU A 1 171 ? 51.523  45.420  184.108 1.00 136.78 ? 172  GLU A O   1 
ATOM   1152  C CB  . GLU A 1 171 ? 48.572  45.527  183.499 1.00 141.70 ? 172  GLU A CB  1 
ATOM   1153  C CG  . GLU A 1 171 ? 47.398  46.372  183.032 1.00 148.01 ? 172  GLU A CG  1 
ATOM   1154  C CD  . GLU A 1 171 ? 46.262  46.397  184.033 1.00 156.52 ? 172  GLU A CD  1 
ATOM   1155  O OE1 . GLU A 1 171 ? 46.411  45.790  185.114 1.00 161.46 ? 172  GLU A OE1 1 
ATOM   1156  O OE2 . GLU A 1 171 ? 45.222  47.024  183.740 1.00 158.05 ? 172  GLU A OE2 1 
ATOM   1157  N N   . ARG A 1 172 ? 51.419  43.741  182.616 1.00 122.36 ? 173  ARG A N   1 
ATOM   1158  C CA  . ARG A 1 172 ? 52.687  43.142  183.024 1.00 125.95 ? 173  ARG A CA  1 
ATOM   1159  C C   . ARG A 1 172 ? 53.816  43.543  182.078 1.00 129.77 ? 173  ARG A C   1 
ATOM   1160  O O   . ARG A 1 172 ? 54.969  43.154  182.270 1.00 126.32 ? 173  ARG A O   1 
ATOM   1161  C CB  . ARG A 1 172 ? 52.576  41.618  183.094 1.00 121.39 ? 173  ARG A CB  1 
ATOM   1162  C CG  . ARG A 1 172 ? 52.331  41.074  184.493 1.00 124.39 ? 173  ARG A CG  1 
ATOM   1163  C CD  . ARG A 1 172 ? 52.361  39.552  184.512 1.00 123.26 ? 173  ARG A CD  1 
ATOM   1164  N NE  . ARG A 1 172 ? 52.363  39.022  185.873 1.00 120.06 ? 173  ARG A NE  1 
ATOM   1165  C CZ  . ARG A 1 172 ? 53.463  38.802  186.587 1.00 115.69 ? 173  ARG A CZ  1 
ATOM   1166  N NH1 . ARG A 1 172 ? 54.655  39.069  186.071 1.00 122.31 ? 173  ARG A NH1 1 
ATOM   1167  N NH2 . ARG A 1 172 ? 53.373  38.318  187.819 1.00 102.00 ? 173  ARG A NH2 1 
ATOM   1168  N N   . LEU A 1 173 ? 53.475  44.315  181.051 1.00 130.61 ? 174  LEU A N   1 
ATOM   1169  C CA  . LEU A 1 173 ? 54.466  44.805  180.099 1.00 128.70 ? 174  LEU A CA  1 
ATOM   1170  C C   . LEU A 1 173 ? 54.755  46.284  180.327 1.00 132.95 ? 174  LEU A C   1 
ATOM   1171  O O   . LEU A 1 173 ? 55.898  46.673  180.566 1.00 134.86 ? 174  LEU A O   1 
ATOM   1172  C CB  . LEU A 1 173 ? 53.999  44.576  178.659 1.00 124.72 ? 174  LEU A CB  1 
ATOM   1173  C CG  . LEU A 1 173 ? 53.897  43.128  178.174 1.00 115.07 ? 174  LEU A CG  1 
ATOM   1174  C CD1 . LEU A 1 173 ? 53.550  43.083  176.691 1.00 104.58 ? 174  LEU A CD1 1 
ATOM   1175  C CD2 . LEU A 1 173 ? 55.186  42.371  178.452 1.00 114.21 ? 174  LEU A CD2 1 
ATOM   1176  N N   . PHE A 1 201 ? 52.131  39.099  171.469 1.00 80.45  ? 202  PHE A N   1 
ATOM   1177  C CA  . PHE A 1 201 ? 51.104  40.009  171.962 1.00 134.85 ? 202  PHE A CA  1 
ATOM   1178  C C   . PHE A 1 201 ? 51.023  41.256  171.082 1.00 149.66 ? 202  PHE A C   1 
ATOM   1179  O O   . PHE A 1 201 ? 51.160  42.380  171.565 1.00 168.71 ? 202  PHE A O   1 
ATOM   1180  C CB  . PHE A 1 201 ? 51.384  40.399  173.417 1.00 127.10 ? 202  PHE A CB  1 
ATOM   1181  C CG  . PHE A 1 201 ? 50.214  41.041  174.120 1.00 122.53 ? 202  PHE A CG  1 
ATOM   1182  C CD1 . PHE A 1 201 ? 48.968  41.118  173.513 1.00 118.52 ? 202  PHE A CD1 1 
ATOM   1183  C CD2 . PHE A 1 201 ? 50.367  41.573  175.389 1.00 119.12 ? 202  PHE A CD2 1 
ATOM   1184  C CE1 . PHE A 1 201 ? 47.900  41.712  174.162 1.00 117.43 ? 202  PHE A CE1 1 
ATOM   1185  C CE2 . PHE A 1 201 ? 49.303  42.166  176.041 1.00 120.85 ? 202  PHE A CE2 1 
ATOM   1186  C CZ  . PHE A 1 201 ? 48.069  42.236  175.427 1.00 121.70 ? 202  PHE A CZ  1 
ATOM   1187  N N   . GLY A 1 202 ? 50.802  41.050  169.790 1.00 137.65 ? 203  GLY A N   1 
ATOM   1188  C CA  . GLY A 1 202 ? 50.573  42.157  168.880 1.00 128.92 ? 203  GLY A CA  1 
ATOM   1189  C C   . GLY A 1 202 ? 49.082  42.387  168.736 1.00 119.77 ? 203  GLY A C   1 
ATOM   1190  O O   . GLY A 1 202 ? 48.321  42.130  169.669 1.00 101.04 ? 203  GLY A O   1 
ATOM   1191  N N   . GLU A 1 203 ? 48.661  42.873  167.573 1.00 137.07 ? 204  GLU A N   1 
ATOM   1192  C CA  . GLU A 1 203 ? 47.239  42.990  167.271 1.00 143.84 ? 204  GLU A CA  1 
ATOM   1193  C C   . GLU A 1 203 ? 46.672  41.581  167.158 1.00 141.26 ? 204  GLU A C   1 
ATOM   1194  O O   . GLU A 1 203 ? 45.640  41.257  167.746 1.00 125.82 ? 204  GLU A O   1 
ATOM   1195  C CB  . GLU A 1 203 ? 47.017  43.760  165.966 1.00 143.90 ? 204  GLU A CB  1 
ATOM   1196  C CG  . GLU A 1 203 ? 47.516  45.200  165.987 1.00 144.87 ? 204  GLU A CG  1 
ATOM   1197  C CD  . GLU A 1 203 ? 49.013  45.311  165.770 1.00 148.65 ? 204  GLU A CD  1 
ATOM   1198  O OE1 . GLU A 1 203 ? 49.626  44.323  165.314 1.00 147.40 ? 204  GLU A OE1 1 
ATOM   1199  O OE2 . GLU A 1 203 ? 49.577  46.388  166.056 1.00 151.59 ? 204  GLU A OE2 1 
ATOM   1200  N N   . ALA A 1 204 ? 47.367  40.753  166.387 1.00 155.47 ? 205  ALA A N   1 
ATOM   1201  C CA  . ALA A 1 204 ? 47.116  39.321  166.338 1.00 166.64 ? 205  ALA A CA  1 
ATOM   1202  C C   . ALA A 1 204 ? 47.857  38.688  167.517 1.00 174.87 ? 205  ALA A C   1 
ATOM   1203  O O   . ALA A 1 204 ? 48.716  39.334  168.117 1.00 190.46 ? 205  ALA A O   1 
ATOM   1204  C CB  . ALA A 1 204 ? 47.618  38.758  165.012 1.00 168.32 ? 205  ALA A CB  1 
ATOM   1205  N N   . PRO A 1 205 ? 47.542  37.426  167.862 1.00 160.65 ? 206  PRO A N   1 
ATOM   1206  C CA  . PRO A 1 205 ? 46.531  36.503  167.334 1.00 156.94 ? 206  PRO A CA  1 
ATOM   1207  C C   . PRO A 1 205 ? 45.181  36.584  168.045 1.00 162.14 ? 206  PRO A C   1 
ATOM   1208  O O   . PRO A 1 205 ? 44.904  35.753  168.910 1.00 164.90 ? 206  PRO A O   1 
ATOM   1209  C CB  . PRO A 1 205 ? 47.159  35.120  167.572 1.00 151.56 ? 206  PRO A CB  1 
ATOM   1210  C CG  . PRO A 1 205 ? 48.537  35.377  168.145 1.00 151.87 ? 206  PRO A CG  1 
ATOM   1211  C CD  . PRO A 1 205 ? 48.458  36.724  168.770 1.00 155.83 ? 206  PRO A CD  1 
ATOM   1212  N N   . ARG A 1 206 ? 44.358  37.566  167.693 1.00 162.43 ? 207  ARG A N   1 
ATOM   1213  C CA  . ARG A 1 206 ? 42.974  37.591  168.154 1.00 157.36 ? 207  ARG A CA  1 
ATOM   1214  C C   . ARG A 1 206 ? 42.206  36.467  167.466 1.00 155.73 ? 207  ARG A C   1 
ATOM   1215  O O   . ARG A 1 206 ? 41.116  36.087  167.893 1.00 153.38 ? 207  ARG A O   1 
ATOM   1216  C CB  . ARG A 1 206 ? 42.323  38.935  167.834 1.00 158.38 ? 207  ARG A CB  1 
ATOM   1217  C CG  . ARG A 1 206 ? 42.240  39.233  166.348 1.00 163.06 ? 207  ARG A CG  1 
ATOM   1218  C CD  . ARG A 1 206 ? 41.674  40.614  166.086 1.00 170.80 ? 207  ARG A CD  1 
ATOM   1219  N NE  . ARG A 1 206 ? 41.911  41.040  164.710 1.00 174.44 ? 207  ARG A NE  1 
ATOM   1220  C CZ  . ARG A 1 206 ? 43.037  41.610  164.292 1.00 175.80 ? 207  ARG A CZ  1 
ATOM   1221  N NH1 . ARG A 1 206 ? 44.031  41.821  165.145 1.00 171.73 ? 207  ARG A NH1 1 
ATOM   1222  N NH2 . ARG A 1 206 ? 43.171  41.967  163.023 1.00 179.02 ? 207  ARG A NH2 1 
ATOM   1223  N N   . GLU A 1 207 ? 42.789  35.949  166.390 1.00 155.00 ? 208  GLU A N   1 
ATOM   1224  C CA  . GLU A 1 207 ? 42.218  34.839  165.641 1.00 149.76 ? 208  GLU A CA  1 
ATOM   1225  C C   . GLU A 1 207 ? 42.269  33.541  166.443 1.00 146.40 ? 208  GLU A C   1 
ATOM   1226  O O   . GLU A 1 207 ? 41.412  32.667  166.284 1.00 141.23 ? 208  GLU A O   1 
ATOM   1227  C CB  . GLU A 1 207 ? 42.957  34.677  164.311 1.00 145.14 ? 208  GLU A CB  1 
ATOM   1228  C CG  . GLU A 1 207 ? 44.469  34.792  164.430 1.00 141.08 ? 208  GLU A CG  1 
ATOM   1229  C CD  . GLU A 1 207 ? 45.073  35.668  163.349 1.00 145.94 ? 208  GLU A CD  1 
ATOM   1230  O OE1 . GLU A 1 207 ? 44.343  36.039  162.407 1.00 145.12 ? 208  GLU A OE1 1 
ATOM   1231  O OE2 . GLU A 1 207 ? 46.277  35.990  163.444 1.00 147.89 ? 208  GLU A OE2 1 
ATOM   1232  N N   . LEU A 1 208 ? 43.275  33.422  167.306 1.00 143.43 ? 209  LEU A N   1 
ATOM   1233  C CA  . LEU A 1 208 ? 43.399  32.256  168.174 1.00 130.13 ? 209  LEU A CA  1 
ATOM   1234  C C   . LEU A 1 208 ? 42.214  32.148  169.126 1.00 118.93 ? 209  LEU A C   1 
ATOM   1235  O O   . LEU A 1 208 ? 41.848  31.052  169.537 1.00 122.60 ? 209  LEU A O   1 
ATOM   1236  C CB  . LEU A 1 208 ? 44.716  32.280  168.956 1.00 122.58 ? 209  LEU A CB  1 
ATOM   1237  C CG  . LEU A 1 208 ? 45.960  31.788  168.212 1.00 107.85 ? 209  LEU A CG  1 
ATOM   1238  C CD1 . LEU A 1 208 ? 47.156  31.710  169.149 1.00 98.26  ? 209  LEU A CD1 1 
ATOM   1239  C CD2 . LEU A 1 208 ? 45.701  30.441  167.558 1.00 102.79 ? 209  LEU A CD2 1 
ATOM   1240  N N   . ARG A 1 209 ? 41.619  33.286  169.471 1.00 113.84 ? 210  ARG A N   1 
ATOM   1241  C CA  . ARG A 1 209 ? 40.411  33.299  170.290 1.00 125.64 ? 210  ARG A CA  1 
ATOM   1242  C C   . ARG A 1 209 ? 39.286  32.558  169.577 1.00 137.46 ? 210  ARG A C   1 
ATOM   1243  O O   . ARG A 1 209 ? 38.685  31.633  170.128 1.00 141.22 ? 210  ARG A O   1 
ATOM   1244  C CB  . ARG A 1 209 ? 39.973  34.736  170.584 1.00 129.62 ? 210  ARG A CB  1 
ATOM   1245  C CG  . ARG A 1 209 ? 38.638  34.836  171.311 1.00 132.76 ? 210  ARG A CG  1 
ATOM   1246  C CD  . ARG A 1 209 ? 38.156  36.276  171.428 1.00 135.45 ? 210  ARG A CD  1 
ATOM   1247  N NE  . ARG A 1 209 ? 37.847  36.861  170.126 1.00 134.80 ? 210  ARG A NE  1 
ATOM   1248  C CZ  . ARG A 1 209 ? 37.232  38.028  169.957 1.00 130.45 ? 210  ARG A CZ  1 
ATOM   1249  N NH1 . ARG A 1 209 ? 36.851  38.738  171.010 1.00 131.41 ? 210  ARG A NH1 1 
ATOM   1250  N NH2 . ARG A 1 209 ? 36.992  38.482  168.735 1.00 123.69 ? 210  ARG A NH2 1 
ATOM   1251  N N   . LEU A 1 210 ? 39.020  32.968  168.341 1.00 138.82 ? 211  LEU A N   1 
ATOM   1252  C CA  . LEU A 1 210 ? 37.952  32.385  167.539 1.00 133.56 ? 211  LEU A CA  1 
ATOM   1253  C C   . LEU A 1 210 ? 38.207  30.906  167.260 1.00 130.96 ? 211  LEU A C   1 
ATOM   1254  O O   . LEU A 1 210 ? 37.321  30.065  167.442 1.00 137.65 ? 211  LEU A O   1 
ATOM   1255  C CB  . LEU A 1 210 ? 37.803  33.149  166.220 1.00 129.52 ? 211  LEU A CB  1 
ATOM   1256  C CG  . LEU A 1 210 ? 37.770  34.678  166.308 1.00 123.73 ? 211  LEU A CG  1 
ATOM   1257  C CD1 . LEU A 1 210 ? 37.605  35.296  164.927 1.00 110.05 ? 211  LEU A CD1 1 
ATOM   1258  C CD2 . LEU A 1 210 ? 36.669  35.152  167.247 1.00 124.92 ? 211  LEU A CD2 1 
ATOM   1259  N N   . ARG A 1 211 ? 39.425  30.592  166.826 1.00 115.31 ? 212  ARG A N   1 
ATOM   1260  C CA  . ARG A 1 211 ? 39.777  29.219  166.479 1.00 101.72 ? 212  ARG A CA  1 
ATOM   1261  C C   . ARG A 1 211 ? 39.727  28.278  167.685 1.00 86.65  ? 212  ARG A C   1 
ATOM   1262  O O   . ARG A 1 211 ? 39.208  27.162  167.586 1.00 81.69  ? 212  ARG A O   1 
ATOM   1263  C CB  . ARG A 1 211 ? 41.143  29.171  165.788 1.00 109.03 ? 212  ARG A CB  1 
ATOM   1264  C CG  . ARG A 1 211 ? 41.161  29.902  164.451 1.00 121.30 ? 212  ARG A CG  1 
ATOM   1265  C CD  . ARG A 1 211 ? 42.550  29.959  163.830 1.00 136.56 ? 212  ARG A CD  1 
ATOM   1266  N NE  . ARG A 1 211 ? 43.034  28.645  163.414 1.00 142.87 ? 212  ARG A NE  1 
ATOM   1267  C CZ  . ARG A 1 211 ? 44.033  27.997  164.003 1.00 141.53 ? 212  ARG A CZ  1 
ATOM   1268  N NH1 . ARG A 1 211 ? 44.662  28.542  165.035 1.00 143.18 ? 212  ARG A NH1 1 
ATOM   1269  N NH2 . ARG A 1 211 ? 44.409  26.806  163.557 1.00 134.64 ? 212  ARG A NH2 1 
ATOM   1270  N N   . ALA A 1 212 ? 40.250  28.732  168.821 1.00 72.78  ? 213  ALA A N   1 
ATOM   1271  C CA  . ALA A 1 212 ? 40.176  27.946  170.050 1.00 66.21  ? 213  ALA A CA  1 
ATOM   1272  C C   . ALA A 1 212 ? 38.729  27.771  170.484 1.00 84.50  ? 213  ALA A C   1 
ATOM   1273  O O   . ALA A 1 212 ? 38.343  26.705  170.963 1.00 86.30  ? 213  ALA A O   1 
ATOM   1274  C CB  . ALA A 1 212 ? 40.992  28.585  171.160 1.00 49.67  ? 213  ALA A CB  1 
ATOM   1275  N N   . THR A 1 213 ? 37.932  28.822  170.312 1.00 93.24  ? 214  THR A N   1 
ATOM   1276  C CA  . THR A 1 213 ? 36.513  28.755  170.637 1.00 97.55  ? 214  THR A CA  1 
ATOM   1277  C C   . THR A 1 213 ? 35.847  27.635  169.849 1.00 100.37 ? 214  THR A C   1 
ATOM   1278  O O   . THR A 1 213 ? 35.298  26.692  170.429 1.00 98.43  ? 214  THR A O   1 
ATOM   1279  C CB  . THR A 1 213 ? 35.794  30.075  170.304 1.00 94.35  ? 214  THR A CB  1 
ATOM   1280  O OG1 . THR A 1 213 ? 36.521  31.177  170.859 1.00 102.22 ? 214  THR A OG1 1 
ATOM   1281  C CG2 . THR A 1 213 ? 34.380  30.069  170.862 1.00 92.54  ? 214  THR A CG2 1 
ATOM   1282  N N   . ARG A 1 214 ? 35.933  27.724  168.525 1.00 100.50 ? 215  ARG A N   1 
ATOM   1283  C CA  . ARG A 1 214 ? 35.247  26.769  167.659 1.00 103.77 ? 215  ARG A CA  1 
ATOM   1284  C C   . ARG A 1 214 ? 35.821  25.349  167.705 1.00 95.82  ? 215  ARG A C   1 
ATOM   1285  O O   . ARG A 1 214 ? 35.125  24.388  167.378 1.00 94.21  ? 215  ARG A O   1 
ATOM   1286  C CB  . ARG A 1 214 ? 35.152  27.292  166.221 1.00 110.15 ? 215  ARG A CB  1 
ATOM   1287  C CG  . ARG A 1 214 ? 33.953  28.208  165.998 1.00 115.11 ? 215  ARG A CG  1 
ATOM   1288  C CD  . ARG A 1 214 ? 33.738  28.543  164.529 1.00 122.41 ? 215  ARG A CD  1 
ATOM   1289  N NE  . ARG A 1 214 ? 34.541  29.681  164.094 1.00 132.11 ? 215  ARG A NE  1 
ATOM   1290  C CZ  . ARG A 1 214 ? 35.705  29.579  163.462 1.00 132.24 ? 215  ARG A CZ  1 
ATOM   1291  N NH1 . ARG A 1 214 ? 36.208  28.384  163.184 1.00 129.41 ? 215  ARG A NH1 1 
ATOM   1292  N NH2 . ARG A 1 214 ? 36.365  30.672  163.105 1.00 133.79 ? 215  ARG A NH2 1 
ATOM   1293  N N   . ALA A 1 215 ? 37.081  25.215  168.106 1.00 85.09  ? 216  ALA A N   1 
ATOM   1294  C CA  . ALA A 1 215 ? 37.669  23.888  168.281 1.00 73.90  ? 216  ALA A CA  1 
ATOM   1295  C C   . ALA A 1 215 ? 37.217  23.234  169.590 1.00 74.77  ? 216  ALA A C   1 
ATOM   1296  O O   . ALA A 1 215 ? 36.759  22.076  169.617 1.00 85.44  ? 216  ALA A O   1 
ATOM   1297  C CB  . ALA A 1 215 ? 39.183  23.979  168.233 1.00 75.50  ? 216  ALA A CB  1 
ATOM   1298  N N   . PHE A 1 216 ? 37.330  23.996  170.673 1.00 66.19  ? 217  PHE A N   1 
ATOM   1299  C CA  . PHE A 1 216 ? 37.005  23.492  172.000 1.00 61.36  ? 217  PHE A CA  1 
ATOM   1300  C C   . PHE A 1 216 ? 35.515  23.214  172.160 1.00 60.94  ? 217  PHE A C   1 
ATOM   1301  O O   . PHE A 1 216 ? 35.135  22.257  172.839 1.00 65.46  ? 217  PHE A O   1 
ATOM   1302  C CB  . PHE A 1 216 ? 37.507  24.447  173.087 1.00 58.82  ? 217  PHE A CB  1 
ATOM   1303  C CG  . PHE A 1 216 ? 38.958  24.260  173.434 1.00 67.06  ? 217  PHE A CG  1 
ATOM   1304  C CD1 . PHE A 1 216 ? 39.955  24.683  172.569 1.00 84.50  ? 217  PHE A CD1 1 
ATOM   1305  C CD2 . PHE A 1 216 ? 39.327  23.664  174.629 1.00 69.82  ? 217  PHE A CD2 1 
ATOM   1306  C CE1 . PHE A 1 216 ? 41.291  24.515  172.885 1.00 79.97  ? 217  PHE A CE1 1 
ATOM   1307  C CE2 . PHE A 1 216 ? 40.662  23.492  174.952 1.00 77.34  ? 217  PHE A CE2 1 
ATOM   1308  C CZ  . PHE A 1 216 ? 41.645  23.918  174.078 1.00 78.47  ? 217  PHE A CZ  1 
ATOM   1309  N N   . VAL A 1 217 ? 34.669  24.033  171.537 1.00 53.24  ? 218  VAL A N   1 
ATOM   1310  C CA  . VAL A 1 217 ? 33.234  23.758  171.584 1.00 64.84  ? 218  VAL A CA  1 
ATOM   1311  C C   . VAL A 1 217 ? 32.893  22.478  170.826 1.00 65.52  ? 218  VAL A C   1 
ATOM   1312  O O   . VAL A 1 217 ? 31.957  21.772  171.188 1.00 60.05  ? 218  VAL A O   1 
ATOM   1313  C CB  . VAL A 1 217 ? 32.365  24.922  171.052 1.00 73.99  ? 218  VAL A CB  1 
ATOM   1314  C CG1 . VAL A 1 217 ? 32.560  26.167  171.901 1.00 76.23  ? 218  VAL A CG1 1 
ATOM   1315  C CG2 . VAL A 1 217 ? 32.654  25.197  169.583 1.00 80.95  ? 218  VAL A CG2 1 
ATOM   1316  N N   . ALA A 1 218 ? 33.659  22.180  169.780 1.00 68.83  ? 219  ALA A N   1 
ATOM   1317  C CA  . ALA A 1 218 ? 33.444  20.963  169.008 1.00 67.62  ? 219  ALA A CA  1 
ATOM   1318  C C   . ALA A 1 218 ? 33.816  19.747  169.844 1.00 64.43  ? 219  ALA A C   1 
ATOM   1319  O O   . ALA A 1 218 ? 33.032  18.795  169.957 1.00 76.23  ? 219  ALA A O   1 
ATOM   1320  C CB  . ALA A 1 218 ? 34.250  20.996  167.722 1.00 60.37  ? 219  ALA A CB  1 
ATOM   1321  N N   . ALA A 1 219 ? 35.008  19.787  170.436 1.00 43.69  ? 220  ALA A N   1 
ATOM   1322  C CA  . ALA A 1 219 ? 35.446  18.701  171.312 1.00 47.56  ? 220  ALA A CA  1 
ATOM   1323  C C   . ALA A 1 219 ? 34.449  18.465  172.449 1.00 51.46  ? 220  ALA A C   1 
ATOM   1324  O O   . ALA A 1 219 ? 33.982  17.333  172.669 1.00 50.22  ? 220  ALA A O   1 
ATOM   1325  C CB  . ALA A 1 219 ? 36.829  18.995  171.870 1.00 43.63  ? 220  ALA A CB  1 
ATOM   1326  N N   . ARG A 1 220 ? 34.114  19.543  173.155 1.00 56.08  ? 221  ARG A N   1 
ATOM   1327  C CA  . ARG A 1 220 ? 33.195  19.460  174.283 1.00 63.74  ? 221  ARG A CA  1 
ATOM   1328  C C   . ARG A 1 220 ? 31.835  18.933  173.853 1.00 62.19  ? 221  ARG A C   1 
ATOM   1329  O O   . ARG A 1 220 ? 31.222  18.147  174.565 1.00 58.25  ? 221  ARG A O   1 
ATOM   1330  C CB  . ARG A 1 220 ? 33.018  20.821  174.958 1.00 66.62  ? 221  ARG A CB  1 
ATOM   1331  C CG  . ARG A 1 220 ? 32.498  20.714  176.383 1.00 70.23  ? 221  ARG A CG  1 
ATOM   1332  C CD  . ARG A 1 220 ? 31.731  21.949  176.820 1.00 79.45  ? 221  ARG A CD  1 
ATOM   1333  N NE  . ARG A 1 220 ? 32.288  23.182  176.275 1.00 83.75  ? 221  ARG A NE  1 
ATOM   1334  C CZ  . ARG A 1 220 ? 31.575  24.085  175.610 1.00 97.75  ? 221  ARG A CZ  1 
ATOM   1335  N NH1 . ARG A 1 220 ? 30.278  23.893  175.414 1.00 101.57 ? 221  ARG A NH1 1 
ATOM   1336  N NH2 . ARG A 1 220 ? 32.157  25.182  175.145 1.00 103.53 ? 221  ARG A NH2 1 
ATOM   1337  N N   . SER A 1 221 ? 31.368  19.368  172.687 1.00 62.97  ? 222  SER A N   1 
ATOM   1338  C CA  . SER A 1 221 ? 30.071  18.931  172.183 1.00 57.92  ? 222  SER A CA  1 
ATOM   1339  C C   . SER A 1 221 ? 30.072  17.441  171.870 1.00 53.51  ? 222  SER A C   1 
ATOM   1340  O O   . SER A 1 221 ? 29.087  16.747  172.125 1.00 54.70  ? 222  SER A O   1 
ATOM   1341  C CB  . SER A 1 221 ? 29.662  19.733  170.946 1.00 53.06  ? 222  SER A CB  1 
ATOM   1342  O OG  . SER A 1 221 ? 29.515  21.107  171.258 1.00 53.40  ? 222  SER A OG  1 
ATOM   1343  N N   . PHE A 1 222 ? 31.178  16.948  171.319 1.00 41.94  ? 223  PHE A N   1 
ATOM   1344  C CA  . PHE A 1 222 ? 31.289  15.524  171.021 1.00 37.76  ? 223  PHE A CA  1 
ATOM   1345  C C   . PHE A 1 222 ? 31.291  14.684  172.299 1.00 48.82  ? 223  PHE A C   1 
ATOM   1346  O O   . PHE A 1 222 ? 30.537  13.706  172.419 1.00 63.62  ? 223  PHE A O   1 
ATOM   1347  C CB  . PHE A 1 222 ? 32.542  15.239  170.195 1.00 40.16  ? 223  PHE A CB  1 
ATOM   1348  C CG  . PHE A 1 222 ? 32.605  13.840  169.655 1.00 48.54  ? 223  PHE A CG  1 
ATOM   1349  C CD1 . PHE A 1 222 ? 31.860  13.478  168.544 1.00 44.41  ? 223  PHE A CD1 1 
ATOM   1350  C CD2 . PHE A 1 222 ? 33.411  12.886  170.255 1.00 52.33  ? 223  PHE A CD2 1 
ATOM   1351  C CE1 . PHE A 1 222 ? 31.915  12.190  168.043 1.00 50.71  ? 223  PHE A CE1 1 
ATOM   1352  C CE2 . PHE A 1 222 ? 33.472  11.596  169.758 1.00 45.61  ? 223  PHE A CE2 1 
ATOM   1353  C CZ  . PHE A 1 222 ? 32.724  11.248  168.651 1.00 47.72  ? 223  PHE A CZ  1 
ATOM   1354  N N   . VAL A 1 223 ? 32.132  15.071  173.257 1.00 51.80  ? 224  VAL A N   1 
ATOM   1355  C CA  . VAL A 1 223 ? 32.196  14.349  174.528 1.00 49.64  ? 224  VAL A CA  1 
ATOM   1356  C C   . VAL A 1 223 ? 30.845  14.372  175.255 1.00 53.95  ? 224  VAL A C   1 
ATOM   1357  O O   . VAL A 1 223 ? 30.354  13.334  175.719 1.00 54.49  ? 224  VAL A O   1 
ATOM   1358  C CB  . VAL A 1 223 ? 33.304  14.907  175.446 1.00 48.96  ? 224  VAL A CB  1 
ATOM   1359  C CG1 . VAL A 1 223 ? 33.322  14.169  176.775 1.00 45.80  ? 224  VAL A CG1 1 
ATOM   1360  C CG2 . VAL A 1 223 ? 34.658  14.801  174.761 1.00 42.31  ? 224  VAL A CG2 1 
ATOM   1361  N N   . GLN A 1 224 ? 30.247  15.558  175.336 1.00 53.70  ? 225  GLN A N   1 
ATOM   1362  C CA  . GLN A 1 224 ? 28.918  15.729  175.918 1.00 55.18  ? 225  GLN A CA  1 
ATOM   1363  C C   . GLN A 1 224 ? 27.900  14.835  175.229 1.00 62.89  ? 225  GLN A C   1 
ATOM   1364  O O   . GLN A 1 224 ? 27.022  14.272  175.876 1.00 59.14  ? 225  GLN A O   1 
ATOM   1365  C CB  . GLN A 1 224 ? 28.450  17.180  175.803 1.00 53.37  ? 225  GLN A CB  1 
ATOM   1366  C CG  . GLN A 1 224 ? 28.974  18.117  176.873 1.00 58.32  ? 225  GLN A CG  1 
ATOM   1367  C CD  . GLN A 1 224 ? 28.265  19.457  176.851 1.00 71.12  ? 225  GLN A CD  1 
ATOM   1368  O OE1 . GLN A 1 224 ? 27.166  19.580  176.307 1.00 64.21  ? 225  GLN A OE1 1 
ATOM   1369  N NE2 . GLN A 1 224 ? 28.890  20.470  177.439 1.00 74.42  ? 225  GLN A NE2 1 
ATOM   1370  N N   . GLY A 1 225 ? 28.018  14.726  173.910 1.00 66.44  ? 226  GLY A N   1 
ATOM   1371  C CA  . GLY A 1 225 ? 27.128  13.887  173.130 1.00 59.92  ? 226  GLY A CA  1 
ATOM   1372  C C   . GLY A 1 225 ? 27.239  12.430  173.532 1.00 57.87  ? 226  GLY A C   1 
ATOM   1373  O O   . GLY A 1 225 ? 26.226  11.768  173.780 1.00 61.89  ? 226  GLY A O   1 
ATOM   1374  N N   . LEU A 1 226 ? 28.471  11.929  173.598 1.00 49.14  ? 227  LEU A N   1 
ATOM   1375  C CA  . LEU A 1 226 ? 28.695  10.548  174.024 1.00 47.57  ? 227  LEU A CA  1 
ATOM   1376  C C   . LEU A 1 226 ? 28.119  10.299  175.420 1.00 49.74  ? 227  LEU A C   1 
ATOM   1377  O O   . LEU A 1 226 ? 27.415  9.305   175.650 1.00 55.22  ? 227  LEU A O   1 
ATOM   1378  C CB  . LEU A 1 226 ? 30.186  10.202  173.989 1.00 48.81  ? 227  LEU A CB  1 
ATOM   1379  C CG  . LEU A 1 226 ? 30.861  10.268  172.617 1.00 43.36  ? 227  LEU A CG  1 
ATOM   1380  C CD1 . LEU A 1 226 ? 32.319  9.849   172.712 1.00 42.78  ? 227  LEU A CD1 1 
ATOM   1381  C CD2 . LEU A 1 226 ? 30.118  9.407   171.607 1.00 39.39  ? 227  LEU A CD2 1 
ATOM   1382  N N   . GLY A 1 227 ? 28.407  11.214  176.343 1.00 40.71  ? 228  GLY A N   1 
ATOM   1383  C CA  . GLY A 1 227 ? 27.889  11.113  177.697 1.00 51.97  ? 228  GLY A CA  1 
ATOM   1384  C C   . GLY A 1 227 ? 26.370  11.097  177.755 1.00 63.88  ? 228  GLY A C   1 
ATOM   1385  O O   . GLY A 1 227 ? 25.774  10.350  178.534 1.00 78.14  ? 228  GLY A O   1 
ATOM   1386  N N   . VAL A 1 228 ? 25.745  11.917  176.916 1.00 56.55  ? 229  VAL A N   1 
ATOM   1387  C CA  . VAL A 1 228 ? 24.290  12.022  176.869 1.00 52.80  ? 229  VAL A CA  1 
ATOM   1388  C C   . VAL A 1 228 ? 23.647  10.753  176.319 1.00 52.88  ? 229  VAL A C   1 
ATOM   1389  O O   . VAL A 1 228 ? 22.664  10.261  176.876 1.00 51.50  ? 229  VAL A O   1 
ATOM   1390  C CB  . VAL A 1 228 ? 23.834  13.260  176.063 1.00 49.60  ? 229  VAL A CB  1 
ATOM   1391  C CG1 . VAL A 1 228 ? 22.457  13.043  175.451 1.00 53.87  ? 229  VAL A CG1 1 
ATOM   1392  C CG2 . VAL A 1 228 ? 23.839  14.492  176.951 1.00 36.55  ? 229  VAL A CG2 1 
ATOM   1393  N N   . ALA A 1 229 ? 24.203  10.224  175.232 1.00 52.21  ? 230  ALA A N   1 
ATOM   1394  C CA  . ALA A 1 229 ? 23.739  8.950   174.693 1.00 43.52  ? 230  ALA A CA  1 
ATOM   1395  C C   . ALA A 1 229 ? 23.833  7.876   175.770 1.00 41.50  ? 230  ALA A C   1 
ATOM   1396  O O   . ALA A 1 229 ? 22.877  7.126   176.007 1.00 57.85  ? 230  ALA A O   1 
ATOM   1397  C CB  . ALA A 1 229 ? 24.558  8.555   173.479 1.00 34.95  ? 230  ALA A CB  1 
ATOM   1398  N N   . SER A 1 230 ? 24.987  7.825   176.432 1.00 51.55  ? 231  SER A N   1 
ATOM   1399  C CA  . SER A 1 230 ? 25.209  6.877   177.518 1.00 60.58  ? 231  SER A CA  1 
ATOM   1400  C C   . SER A 1 230 ? 24.138  6.993   178.605 1.00 64.71  ? 231  SER A C   1 
ATOM   1401  O O   . SER A 1 230 ? 23.600  5.984   179.068 1.00 69.23  ? 231  SER A O   1 
ATOM   1402  C CB  . SER A 1 230 ? 26.600  7.075   178.124 1.00 56.70  ? 231  SER A CB  1 
ATOM   1403  O OG  . SER A 1 230 ? 26.879  6.085   179.099 1.00 70.49  ? 231  SER A OG  1 
ATOM   1404  N N   . ASP A 1 231 ? 23.827  8.224   178.999 1.00 60.63  ? 232  ASP A N   1 
ATOM   1405  C CA  . ASP A 1 231 ? 22.832  8.462   180.044 1.00 65.16  ? 232  ASP A CA  1 
ATOM   1406  C C   . ASP A 1 231 ? 21.417  8.076   179.621 1.00 66.27  ? 232  ASP A C   1 
ATOM   1407  O O   . ASP A 1 231 ? 20.653  7.524   180.415 1.00 61.45  ? 232  ASP A O   1 
ATOM   1408  C CB  . ASP A 1 231 ? 22.865  9.920   180.502 1.00 74.28  ? 232  ASP A CB  1 
ATOM   1409  C CG  . ASP A 1 231 ? 23.847  10.149  181.629 1.00 87.54  ? 232  ASP A CG  1 
ATOM   1410  O OD1 . ASP A 1 231 ? 24.116  9.188   182.380 1.00 90.21  ? 232  ASP A OD1 1 
ATOM   1411  O OD2 . ASP A 1 231 ? 24.346  11.286  181.767 1.00 97.90  ? 232  ASP A OD2 1 
ATOM   1412  N N   . VAL A 1 232 ? 21.072  8.380   178.375 1.00 58.31  ? 233  VAL A N   1 
ATOM   1413  C CA  . VAL A 1 232 ? 19.781  7.998   177.821 1.00 44.80  ? 233  VAL A CA  1 
ATOM   1414  C C   . VAL A 1 232 ? 19.614  6.487   177.876 1.00 47.63  ? 233  VAL A C   1 
ATOM   1415  O O   . VAL A 1 232 ? 18.599  5.985   178.368 1.00 49.87  ? 233  VAL A O   1 
ATOM   1416  C CB  . VAL A 1 232 ? 19.622  8.486   176.368 1.00 44.73  ? 233  VAL A CB  1 
ATOM   1417  C CG1 . VAL A 1 232 ? 18.459  7.777   175.685 1.00 46.90  ? 233  VAL A CG1 1 
ATOM   1418  C CG2 . VAL A 1 232 ? 19.431  9.994   176.339 1.00 53.28  ? 233  VAL A CG2 1 
ATOM   1419  N N   . VAL A 1 233 ? 20.619  5.768   177.381 1.00 54.38  ? 234  VAL A N   1 
ATOM   1420  C CA  . VAL A 1 233 ? 20.600  4.309   177.449 1.00 50.87  ? 234  VAL A CA  1 
ATOM   1421  C C   . VAL A 1 233 ? 20.456  3.838   178.897 1.00 55.76  ? 234  VAL A C   1 
ATOM   1422  O O   . VAL A 1 233 ? 19.653  2.945   179.193 1.00 58.44  ? 234  VAL A O   1 
ATOM   1423  C CB  . VAL A 1 233 ? 21.868  3.693   176.831 1.00 38.50  ? 234  VAL A CB  1 
ATOM   1424  C CG1 . VAL A 1 233 ? 21.833  2.175   176.948 1.00 39.22  ? 234  VAL A CG1 1 
ATOM   1425  C CG2 . VAL A 1 233 ? 21.999  4.114   175.377 1.00 30.74  ? 234  VAL A CG2 1 
ATOM   1426  N N   . ARG A 1 234 ? 21.219  4.462   179.791 1.00 55.11  ? 235  ARG A N   1 
ATOM   1427  C CA  . ARG A 1 234 ? 21.177  4.140   181.216 1.00 62.50  ? 235  ARG A CA  1 
ATOM   1428  C C   . ARG A 1 234 ? 19.769  4.221   181.797 1.00 62.31  ? 235  ARG A C   1 
ATOM   1429  O O   . ARG A 1 234 ? 19.283  3.265   182.402 1.00 59.16  ? 235  ARG A O   1 
ATOM   1430  C CB  . ARG A 1 234 ? 22.091  5.080   182.006 1.00 74.42  ? 235  ARG A CB  1 
ATOM   1431  C CG  . ARG A 1 234 ? 23.358  4.438   182.545 1.00 84.45  ? 235  ARG A CG  1 
ATOM   1432  C CD  . ARG A 1 234 ? 23.676  4.922   183.958 1.00 87.76  ? 235  ARG A CD  1 
ATOM   1433  N NE  . ARG A 1 234 ? 23.443  6.354   184.128 1.00 93.57  ? 235  ARG A NE  1 
ATOM   1434  C CZ  . ARG A 1 234 ? 22.435  6.870   184.825 1.00 101.55 ? 235  ARG A CZ  1 
ATOM   1435  N NH1 . ARG A 1 234 ? 21.563  6.069   185.423 1.00 104.19 ? 235  ARG A NH1 1 
ATOM   1436  N NH2 . ARG A 1 234 ? 22.297  8.185   184.925 1.00 105.08 ? 235  ARG A NH2 1 
ATOM   1437  N N   . LYS A 1 235 ? 19.121  5.368   181.613 1.00 60.47  ? 236  LYS A N   1 
ATOM   1438  C CA  . LYS A 1 235 ? 17.815  5.611   182.215 1.00 65.98  ? 236  LYS A CA  1 
ATOM   1439  C C   . LYS A 1 235 ? 16.711  4.792   181.553 1.00 70.71  ? 236  LYS A C   1 
ATOM   1440  O O   . LYS A 1 235 ? 15.830  4.264   182.233 1.00 75.74  ? 236  LYS A O   1 
ATOM   1441  C CB  . LYS A 1 235 ? 17.467  7.101   182.176 1.00 69.97  ? 236  LYS A CB  1 
ATOM   1442  C CG  . LYS A 1 235 ? 18.509  8.001   182.827 1.00 78.00  ? 236  LYS A CG  1 
ATOM   1443  C CD  . LYS A 1 235 ? 17.984  9.419   182.991 1.00 89.54  ? 236  LYS A CD  1 
ATOM   1444  C CE  . LYS A 1 235 ? 19.103  10.448  182.901 1.00 97.04  ? 236  LYS A CE  1 
ATOM   1445  N NZ  . LYS A 1 235 ? 20.160  10.236  183.926 1.00 100.81 ? 236  LYS A NZ  1 
ATOM   1446  N N   . VAL A 1 236 ? 16.758  4.690   180.228 1.00 64.82  ? 237  VAL A N   1 
ATOM   1447  C CA  . VAL A 1 236 ? 15.772  3.905   179.490 1.00 51.91  ? 237  VAL A CA  1 
ATOM   1448  C C   . VAL A 1 236 ? 15.850  2.427   179.875 1.00 57.83  ? 237  VAL A C   1 
ATOM   1449  O O   . VAL A 1 236 ? 14.829  1.740   179.943 1.00 64.04  ? 237  VAL A O   1 
ATOM   1450  C CB  . VAL A 1 236 ? 15.941  4.085   177.961 1.00 38.53  ? 237  VAL A CB  1 
ATOM   1451  C CG1 . VAL A 1 236 ? 15.139  3.047   177.188 1.00 19.77  ? 237  VAL A CG1 1 
ATOM   1452  C CG2 . VAL A 1 236 ? 15.533  5.488   177.552 1.00 41.11  ? 237  VAL A CG2 1 
ATOM   1453  N N   . ALA A 1 237 ? 17.061  1.951   180.152 1.00 70.40  ? 238  ALA A N   1 
ATOM   1454  C CA  . ALA A 1 237 ? 17.266  0.554   180.534 1.00 68.83  ? 238  ALA A CA  1 
ATOM   1455  C C   . ALA A 1 237 ? 16.501  0.140   181.794 1.00 64.21  ? 238  ALA A C   1 
ATOM   1456  O O   . ALA A 1 237 ? 16.214  -1.040  181.990 1.00 65.56  ? 238  ALA A O   1 
ATOM   1457  C CB  . ALA A 1 237 ? 18.750  0.264   180.705 1.00 77.31  ? 238  ALA A CB  1 
ATOM   1458  N N   . GLN A 1 238 ? 16.171  1.107   182.645 1.00 66.95  ? 239  GLN A N   1 
ATOM   1459  C CA  . GLN A 1 238 ? 15.503  0.803   183.909 1.00 79.61  ? 239  GLN A CA  1 
ATOM   1460  C C   . GLN A 1 238 ? 13.977  0.813   183.809 1.00 81.13  ? 239  GLN A C   1 
ATOM   1461  O O   . GLN A 1 238 ? 13.280  0.629   184.808 1.00 84.67  ? 239  GLN A O   1 
ATOM   1462  C CB  . GLN A 1 238 ? 15.980  1.747   185.016 1.00 85.06  ? 239  GLN A CB  1 
ATOM   1463  C CG  . GLN A 1 238 ? 17.394  1.458   185.492 1.00 89.69  ? 239  GLN A CG  1 
ATOM   1464  C CD  . GLN A 1 238 ? 17.548  0.046   186.028 1.00 94.93  ? 239  GLN A CD  1 
ATOM   1465  O OE1 . GLN A 1 238 ? 18.007  -0.853  185.322 1.00 93.10  ? 239  GLN A OE1 1 
ATOM   1466  N NE2 . GLN A 1 238 ? 17.163  -0.156  187.283 1.00 96.49  ? 239  GLN A NE2 1 
ATOM   1467  N N   . VAL A 1 239 ? 13.462  1.032   182.604 1.00 65.95  ? 240  VAL A N   1 
ATOM   1468  C CA  . VAL A 1 239 ? 12.022  0.987   182.375 1.00 61.89  ? 240  VAL A CA  1 
ATOM   1469  C C   . VAL A 1 239 ? 11.518  -0.454  182.404 1.00 68.76  ? 240  VAL A C   1 
ATOM   1470  O O   . VAL A 1 239 ? 11.984  -1.293  181.633 1.00 73.46  ? 240  VAL A O   1 
ATOM   1471  C CB  . VAL A 1 239 ? 11.641  1.640   181.034 1.00 51.31  ? 240  VAL A CB  1 
ATOM   1472  C CG1 . VAL A 1 239 ? 10.157  1.462   180.757 1.00 67.13  ? 240  VAL A CG1 1 
ATOM   1473  C CG2 . VAL A 1 239 ? 12.013  3.113   181.042 1.00 43.44  ? 240  VAL A CG2 1 
ATOM   1474  N N   . PRO A 1 240 ? 10.560  -0.743  183.298 1.00 70.02  ? 241  PRO A N   1 
ATOM   1475  C CA  . PRO A 1 240 ? 10.035  -2.100  183.483 1.00 65.64  ? 241  PRO A CA  1 
ATOM   1476  C C   . PRO A 1 240 ? 9.109   -2.529  182.350 1.00 62.27  ? 241  PRO A C   1 
ATOM   1477  O O   . PRO A 1 240 ? 8.547   -1.681  181.654 1.00 59.98  ? 241  PRO A O   1 
ATOM   1478  C CB  . PRO A 1 240 ? 9.242   -1.983  184.785 1.00 65.87  ? 241  PRO A CB  1 
ATOM   1479  C CG  . PRO A 1 240 ? 8.781   -0.570  184.800 1.00 70.97  ? 241  PRO A CG  1 
ATOM   1480  C CD  . PRO A 1 240 ? 9.905   0.226   184.194 1.00 74.43  ? 241  PRO A CD  1 
ATOM   1481  N N   . LEU A 1 241 ? 8.958   -3.838  182.175 1.00 62.96  ? 242  LEU A N   1 
ATOM   1482  C CA  . LEU A 1 241 ? 8.059   -4.390  181.168 1.00 65.38  ? 242  LEU A CA  1 
ATOM   1483  C C   . LEU A 1 241 ? 6.624   -4.426  181.677 1.00 75.18  ? 242  LEU A C   1 
ATOM   1484  O O   . LEU A 1 241 ? 6.384   -4.647  182.864 1.00 83.93  ? 242  LEU A O   1 
ATOM   1485  C CB  . LEU A 1 241 ? 8.500   -5.800  180.773 1.00 53.83  ? 242  LEU A CB  1 
ATOM   1486  C CG  . LEU A 1 241 ? 9.760   -5.914  179.916 1.00 57.45  ? 242  LEU A CG  1 
ATOM   1487  C CD1 . LEU A 1 241 ? 10.041  -7.369  179.578 1.00 57.47  ? 242  LEU A CD1 1 
ATOM   1488  C CD2 . LEU A 1 241 ? 9.617   -5.082  178.651 1.00 61.35  ? 242  LEU A CD2 1 
ATOM   1489  N N   . GLY A 1 242 ? 5.673   -4.211  180.775 1.00 76.12  ? 243  GLY A N   1 
ATOM   1490  C CA  . GLY A 1 242 ? 4.267   -4.226  181.135 1.00 83.37  ? 243  GLY A CA  1 
ATOM   1491  C C   . GLY A 1 242 ? 3.761   -5.619  181.458 1.00 76.11  ? 243  GLY A C   1 
ATOM   1492  O O   . GLY A 1 242 ? 4.336   -6.609  181.007 1.00 75.71  ? 243  GLY A O   1 
ATOM   1493  N N   . PRO A 1 243 ? 2.683   -5.703  182.253 1.00 72.03  ? 244  PRO A N   1 
ATOM   1494  C CA  . PRO A 1 243 ? 2.072   -6.985  182.624 1.00 75.43  ? 244  PRO A CA  1 
ATOM   1495  C C   . PRO A 1 243 ? 1.445   -7.691  181.424 1.00 68.27  ? 244  PRO A C   1 
ATOM   1496  O O   . PRO A 1 243 ? 1.497   -8.921  181.326 1.00 58.41  ? 244  PRO A O   1 
ATOM   1497  C CB  . PRO A 1 243 ? 0.988   -6.578  183.627 1.00 73.83  ? 244  PRO A CB  1 
ATOM   1498  C CG  . PRO A 1 243 ? 0.678   -5.153  183.297 1.00 72.17  ? 244  PRO A CG  1 
ATOM   1499  C CD  . PRO A 1 243 ? 1.983   -4.559  182.863 1.00 76.10  ? 244  PRO A CD  1 
ATOM   1500  N N   . GLU A 1 244 ? 0.858   -6.912  180.520 1.00 64.77  ? 245  GLU A N   1 
ATOM   1501  C CA  . GLU A 1 244 ? 0.297   -7.463  179.295 1.00 69.44  ? 245  GLU A CA  1 
ATOM   1502  C C   . GLU A 1 244 ? 1.427   -7.943  178.389 1.00 75.91  ? 245  GLU A C   1 
ATOM   1503  O O   . GLU A 1 244 ? 1.286   -8.940  177.678 1.00 87.61  ? 245  GLU A O   1 
ATOM   1504  C CB  . GLU A 1 244 ? -0.595  -6.437  178.581 1.00 78.74  ? 245  GLU A CB  1 
ATOM   1505  C CG  . GLU A 1 244 ? 0.126   -5.203  178.045 1.00 107.44 ? 245  GLU A CG  1 
ATOM   1506  C CD  . GLU A 1 244 ? 0.560   -4.243  179.138 1.00 120.99 ? 245  GLU A CD  1 
ATOM   1507  O OE1 . GLU A 1 244 ? -0.066  -4.248  180.219 1.00 127.24 ? 245  GLU A OE1 1 
ATOM   1508  O OE2 . GLU A 1 244 ? 1.529   -3.485  178.918 1.00 116.76 ? 245  GLU A OE2 1 
ATOM   1509  N N   . CYS A 1 245 ? 2.553   -7.238  178.435 1.00 73.56  ? 246  CYS A N   1 
ATOM   1510  C CA  . CYS A 1 245 ? 3.744   -7.647  177.705 1.00 62.29  ? 246  CYS A CA  1 
ATOM   1511  C C   . CYS A 1 245 ? 4.257   -8.965  178.267 1.00 65.28  ? 246  CYS A C   1 
ATOM   1512  O O   . CYS A 1 245 ? 4.718   -9.830  177.526 1.00 73.34  ? 246  CYS A O   1 
ATOM   1513  C CB  . CYS A 1 245 ? 4.831   -6.574  177.801 1.00 40.35  ? 246  CYS A CB  1 
ATOM   1514  S SG  . CYS A 1 245 ? 6.372   -6.995  176.955 1.00 106.83 ? 246  CYS A SG  1 
ATOM   1515  N N   . SER A 1 246 ? 4.164   -9.115  179.584 1.00 59.25  ? 247  SER A N   1 
ATOM   1516  C CA  . SER A 1 246 ? 4.565   -10.350 180.243 1.00 62.70  ? 247  SER A CA  1 
ATOM   1517  C C   . SER A 1 246 ? 3.659   -11.501 179.815 1.00 67.77  ? 247  SER A C   1 
ATOM   1518  O O   . SER A 1 246 ? 4.133   -12.611 179.552 1.00 64.82  ? 247  SER A O   1 
ATOM   1519  C CB  . SER A 1 246 ? 4.537   -10.181 181.763 1.00 60.87  ? 247  SER A CB  1 
ATOM   1520  O OG  . SER A 1 246 ? 4.969   -11.362 182.417 1.00 77.01  ? 247  SER A OG  1 
ATOM   1521  N N   . ARG A 1 247 ? 2.358   -11.227 179.745 1.00 57.43  ? 248  ARG A N   1 
ATOM   1522  C CA  . ARG A 1 247 ? 1.388   -12.194 179.236 1.00 45.29  ? 248  ARG A CA  1 
ATOM   1523  C C   . ARG A 1 247 ? 1.757   -12.653 177.827 1.00 47.83  ? 248  ARG A C   1 
ATOM   1524  O O   . ARG A 1 247 ? 1.928   -13.851 177.574 1.00 54.78  ? 248  ARG A O   1 
ATOM   1525  C CB  . ARG A 1 247 ? -0.015  -11.582 179.220 1.00 59.77  ? 248  ARG A CB  1 
ATOM   1526  C CG  . ARG A 1 247 ? -0.742  -11.599 180.558 1.00 68.32  ? 248  ARG A CG  1 
ATOM   1527  C CD  . ARG A 1 247 ? -2.019  -10.769 180.486 1.00 56.48  ? 248  ARG A CD  1 
ATOM   1528  N NE  . ARG A 1 247 ? -2.996  -11.140 181.507 1.00 86.49  ? 248  ARG A NE  1 
ATOM   1529  C CZ  . ARG A 1 247 ? -4.037  -11.939 181.289 1.00 107.12 ? 248  ARG A CZ  1 
ATOM   1530  N NH1 . ARG A 1 247 ? -4.240  -12.452 180.083 1.00 110.59 ? 248  ARG A NH1 1 
ATOM   1531  N NH2 . ARG A 1 247 ? -4.878  -12.224 182.275 1.00 105.50 ? 248  ARG A NH2 1 
ATOM   1532  N N   . ALA A 1 248 ? 1.881   -11.688 176.919 1.00 53.02  ? 249  ALA A N   1 
ATOM   1533  C CA  . ALA A 1 248 ? 2.214   -11.962 175.524 1.00 56.62  ? 249  ALA A CA  1 
ATOM   1534  C C   . ALA A 1 248 ? 3.520   -12.740 175.385 1.00 64.76  ? 249  ALA A C   1 
ATOM   1535  O O   . ALA A 1 248 ? 3.637   -13.620 174.533 1.00 76.53  ? 249  ALA A O   1 
ATOM   1536  C CB  . ALA A 1 248 ? 2.283   -10.663 174.732 1.00 34.95  ? 249  ALA A CB  1 
ATOM   1537  N N   . VAL A 1 249 ? 4.498   -12.413 176.225 1.00 55.34  ? 250  VAL A N   1 
ATOM   1538  C CA  . VAL A 1 249 ? 5.783   -13.104 176.204 1.00 57.95  ? 250  VAL A CA  1 
ATOM   1539  C C   . VAL A 1 249 ? 5.651   -14.557 176.664 1.00 53.53  ? 250  VAL A C   1 
ATOM   1540  O O   . VAL A 1 249 ? 6.186   -15.466 176.026 1.00 45.89  ? 250  VAL A O   1 
ATOM   1541  C CB  . VAL A 1 249 ? 6.845   -12.357 177.041 1.00 56.56  ? 250  VAL A CB  1 
ATOM   1542  C CG1 . VAL A 1 249 ? 8.013   -13.269 177.374 1.00 60.59  ? 250  VAL A CG1 1 
ATOM   1543  C CG2 . VAL A 1 249 ? 7.325   -11.127 176.292 1.00 48.19  ? 250  VAL A CG2 1 
ATOM   1544  N N   . MET A 1 250 ? 4.933   -14.770 177.764 1.00 54.80  ? 251  MET A N   1 
ATOM   1545  C CA  . MET A 1 250 ? 4.648   -16.122 178.241 1.00 51.38  ? 251  MET A CA  1 
ATOM   1546  C C   . MET A 1 250 ? 3.998   -16.957 177.143 1.00 51.40  ? 251  MET A C   1 
ATOM   1547  O O   . MET A 1 250 ? 4.441   -18.077 176.853 1.00 55.22  ? 251  MET A O   1 
ATOM   1548  C CB  . MET A 1 250 ? 3.729   -16.076 179.464 1.00 48.57  ? 251  MET A CB  1 
ATOM   1549  C CG  . MET A 1 250 ? 3.110   -17.416 179.833 1.00 53.18  ? 251  MET A CG  1 
ATOM   1550  S SD  . MET A 1 250 ? 4.339   -18.704 180.114 1.00 63.28  ? 251  MET A SD  1 
ATOM   1551  C CE  . MET A 1 250 ? 3.284   -20.104 180.472 1.00 82.14  ? 251  MET A CE  1 
ATOM   1552  N N   . LYS A 1 251 ? 2.957   -16.395 176.532 1.00 55.60  ? 252  LYS A N   1 
ATOM   1553  C CA  . LYS A 1 251 ? 2.241   -17.053 175.443 1.00 52.71  ? 252  LYS A CA  1 
ATOM   1554  C C   . LYS A 1 251 ? 3.134   -17.257 174.221 1.00 48.47  ? 252  LYS A C   1 
ATOM   1555  O O   . LYS A 1 251 ? 2.891   -18.140 173.400 1.00 59.10  ? 252  LYS A O   1 
ATOM   1556  C CB  . LYS A 1 251 ? 0.994   -16.241 175.078 1.00 58.39  ? 252  LYS A CB  1 
ATOM   1557  C CG  . LYS A 1 251 ? 0.083   -16.867 174.027 1.00 55.64  ? 252  LYS A CG  1 
ATOM   1558  C CD  . LYS A 1 251 ? -1.288  -16.202 174.044 1.00 64.54  ? 252  LYS A CD  1 
ATOM   1559  C CE  . LYS A 1 251 ? -1.888  -16.096 172.645 1.00 64.22  ? 252  LYS A CE  1 
ATOM   1560  N NZ  . LYS A 1 251 ? -2.129  -17.413 171.993 1.00 75.75  ? 252  LYS A NZ  1 
ATOM   1561  N N   . LEU A 1 252 ? 4.174   -16.439 174.110 1.00 66.15  ? 253  LEU A N   1 
ATOM   1562  C CA  . LEU A 1 252 ? 5.135   -16.563 173.021 1.00 63.49  ? 253  LEU A CA  1 
ATOM   1563  C C   . LEU A 1 252 ? 6.102   -17.721 173.253 1.00 60.57  ? 253  LEU A C   1 
ATOM   1564  O O   . LEU A 1 252 ? 6.495   -18.416 172.313 1.00 66.89  ? 253  LEU A O   1 
ATOM   1565  C CB  . LEU A 1 252 ? 5.921   -15.259 172.865 1.00 57.28  ? 253  LEU A CB  1 
ATOM   1566  C CG  . LEU A 1 252 ? 7.158   -15.301 171.965 1.00 54.64  ? 253  LEU A CG  1 
ATOM   1567  C CD1 . LEU A 1 252 ? 6.760   -15.656 170.545 1.00 51.84  ? 253  LEU A CD1 1 
ATOM   1568  C CD2 . LEU A 1 252 ? 7.912   -13.979 172.005 1.00 47.46  ? 253  LEU A CD2 1 
ATOM   1569  N N   . VAL A 1 253 ? 6.476   -17.932 174.511 1.00 45.36  ? 254  VAL A N   1 
ATOM   1570  C CA  . VAL A 1 253 ? 7.530   -18.890 174.829 1.00 54.73  ? 254  VAL A CA  1 
ATOM   1571  C C   . VAL A 1 253 ? 7.033   -20.237 175.371 1.00 67.46  ? 254  VAL A C   1 
ATOM   1572  O O   . VAL A 1 253 ? 7.182   -21.262 174.707 1.00 85.01  ? 254  VAL A O   1 
ATOM   1573  C CB  . VAL A 1 253 ? 8.578   -18.277 175.785 1.00 56.96  ? 254  VAL A CB  1 
ATOM   1574  C CG1 . VAL A 1 253 ? 9.815   -19.153 175.846 1.00 52.46  ? 254  VAL A CG1 1 
ATOM   1575  C CG2 . VAL A 1 253 ? 8.957   -16.876 175.326 1.00 41.66  ? 254  VAL A CG2 1 
ATOM   1576  N N   . TYR A 1 254 ? 6.455   -20.239 176.570 1.00 61.64  ? 255  TYR A N   1 
ATOM   1577  C CA  . TYR A 1 254 ? 6.186   -21.499 177.266 1.00 71.35  ? 255  TYR A CA  1 
ATOM   1578  C C   . TYR A 1 254 ? 4.792   -22.099 177.056 1.00 80.56  ? 255  TYR A C   1 
ATOM   1579  O O   . TYR A 1 254 ? 4.510   -23.224 177.487 1.00 92.70  ? 255  TYR A O   1 
ATOM   1580  C CB  . TYR A 1 254 ? 6.531   -21.360 178.749 1.00 76.64  ? 255  TYR A CB  1 
ATOM   1581  C CG  . TYR A 1 254 ? 8.000   -21.099 178.977 1.00 81.90  ? 255  TYR A CG  1 
ATOM   1582  C CD1 . TYR A 1 254 ? 8.957   -21.700 178.171 1.00 82.50  ? 255  TYR A CD1 1 
ATOM   1583  C CD2 . TYR A 1 254 ? 8.433   -20.243 179.982 1.00 81.45  ? 255  TYR A CD2 1 
ATOM   1584  C CE1 . TYR A 1 254 ? 10.296  -21.468 178.367 1.00 86.28  ? 255  TYR A CE1 1 
ATOM   1585  C CE2 . TYR A 1 254 ? 9.776   -20.004 180.183 1.00 84.92  ? 255  TYR A CE2 1 
ATOM   1586  C CZ  . TYR A 1 254 ? 10.701  -20.620 179.369 1.00 92.45  ? 255  TYR A CZ  1 
ATOM   1587  O OH  . TYR A 1 254 ? 12.043  -20.390 179.556 1.00 103.70 ? 255  TYR A OH  1 
ATOM   1588  N N   . CYS A 1 255 ? 3.922   -21.357 176.386 1.00 75.08  ? 256  CYS A N   1 
ATOM   1589  C CA  . CYS A 1 255 ? 2.595   -21.868 176.092 1.00 72.02  ? 256  CYS A CA  1 
ATOM   1590  C C   . CYS A 1 255 ? 2.686   -22.968 175.037 1.00 75.12  ? 256  CYS A C   1 
ATOM   1591  O O   . CYS A 1 255 ? 1.822   -23.840 174.961 1.00 77.93  ? 256  CYS A O   1 
ATOM   1592  C CB  . CYS A 1 255 ? 1.673   -20.735 175.646 1.00 60.03  ? 256  CYS A CB  1 
ATOM   1593  S SG  . CYS A 1 255 ? 0.919   -19.852 177.027 1.00 70.85  ? 256  CYS A SG  1 
ATOM   1594  N N   . ALA A 1 256 ? 3.744   -22.930 174.232 1.00 69.19  ? 257  ALA A N   1 
ATOM   1595  C CA  . ALA A 1 256 ? 4.031   -24.011 173.293 1.00 65.15  ? 257  ALA A CA  1 
ATOM   1596  C C   . ALA A 1 256 ? 4.283   -25.308 174.060 1.00 78.61  ? 257  ALA A C   1 
ATOM   1597  O O   . ALA A 1 256 ? 3.824   -26.382 173.664 1.00 78.61  ? 257  ALA A O   1 
ATOM   1598  C CB  . ALA A 1 256 ? 5.236   -23.662 172.424 1.00 49.72  ? 257  ALA A CB  1 
ATOM   1599  N N   . HIS A 1 257 ? 5.030   -25.196 175.154 1.00 76.06  ? 258  HIS A N   1 
ATOM   1600  C CA  . HIS A 1 257 ? 5.296   -26.325 176.034 1.00 69.05  ? 258  HIS A CA  1 
ATOM   1601  C C   . HIS A 1 257 ? 3.997   -26.812 176.675 1.00 74.33  ? 258  HIS A C   1 
ATOM   1602  O O   . HIS A 1 257 ? 3.752   -28.016 176.757 1.00 77.66  ? 258  HIS A O   1 
ATOM   1603  C CB  . HIS A 1 257 ? 6.293   -25.923 177.129 1.00 57.54  ? 258  HIS A CB  1 
ATOM   1604  C CG  . HIS A 1 257 ? 7.635   -25.500 176.611 1.00 73.83  ? 258  HIS A CG  1 
ATOM   1605  N ND1 . HIS A 1 257 ? 7.798   -24.483 175.696 1.00 79.14  ? 258  HIS A ND1 1 
ATOM   1606  C CD2 . HIS A 1 257 ? 8.881   -25.953 176.893 1.00 76.00  ? 258  HIS A CD2 1 
ATOM   1607  C CE1 . HIS A 1 257 ? 9.083   -24.332 175.429 1.00 72.64  ? 258  HIS A CE1 1 
ATOM   1608  N NE2 . HIS A 1 257 ? 9.762   -25.211 176.144 1.00 73.14  ? 258  HIS A NE2 1 
ATOM   1609  N N   . CYS A 1 258 ? 3.171   -25.869 177.124 1.00 70.70  ? 259  CYS A N   1 
ATOM   1610  C CA  . CYS A 1 258 ? 1.922   -26.206 177.804 1.00 63.14  ? 259  CYS A CA  1 
ATOM   1611  C C   . CYS A 1 258 ? 0.892   -26.865 176.885 1.00 70.18  ? 259  CYS A C   1 
ATOM   1612  O O   . CYS A 1 258 ? 0.083   -27.670 177.337 1.00 77.05  ? 259  CYS A O   1 
ATOM   1613  C CB  . CYS A 1 258 ? 1.318   -24.957 178.454 1.00 61.90  ? 259  CYS A CB  1 
ATOM   1614  S SG  . CYS A 1 258 ? 1.974   -24.548 180.091 1.00 72.03  ? 259  CYS A SG  1 
ATOM   1615  N N   . LEU A 1 259 ? 0.921   -26.531 175.600 1.00 70.07  ? 260  LEU A N   1 
ATOM   1616  C CA  . LEU A 1 259 ? -0.083  -27.052 174.675 1.00 67.19  ? 260  LEU A CA  1 
ATOM   1617  C C   . LEU A 1 259 ? 0.316   -28.359 173.992 1.00 75.31  ? 260  LEU A C   1 
ATOM   1618  O O   . LEU A 1 259 ? -0.391  -28.847 173.112 1.00 84.18  ? 260  LEU A O   1 
ATOM   1619  C CB  . LEU A 1 259 ? -0.493  -25.996 173.648 1.00 69.12  ? 260  LEU A CB  1 
ATOM   1620  C CG  . LEU A 1 259 ? -1.472  -24.947 174.182 1.00 72.05  ? 260  LEU A CG  1 
ATOM   1621  C CD1 . LEU A 1 259 ? -1.981  -24.083 173.046 1.00 71.47  ? 260  LEU A CD1 1 
ATOM   1622  C CD2 . LEU A 1 259 ? -2.632  -25.601 174.928 1.00 72.80  ? 260  LEU A CD2 1 
ATOM   1623  N N   . GLY A 1 260 ? 1.456   -28.915 174.388 1.00 80.09  ? 261  GLY A N   1 
ATOM   1624  C CA  . GLY A 1 260 ? 1.848   -30.233 173.924 1.00 85.33  ? 261  GLY A CA  1 
ATOM   1625  C C   . GLY A 1 260 ? 2.894   -30.257 172.826 1.00 82.11  ? 261  GLY A C   1 
ATOM   1626  O O   . GLY A 1 260 ? 3.212   -31.320 172.290 1.00 90.00  ? 261  GLY A O   1 
ATOM   1627  N N   . VAL A 1 261 ? 3.433   -29.091 172.487 1.00 70.03  ? 262  VAL A N   1 
ATOM   1628  C CA  . VAL A 1 261 ? 4.514   -29.010 171.509 1.00 69.97  ? 262  VAL A CA  1 
ATOM   1629  C C   . VAL A 1 261 ? 5.747   -28.325 172.099 1.00 81.58  ? 262  VAL A C   1 
ATOM   1630  O O   . VAL A 1 261 ? 6.069   -27.192 171.740 1.00 87.94  ? 262  VAL A O   1 
ATOM   1631  C CB  . VAL A 1 261 ? 4.068   -28.289 170.214 1.00 58.89  ? 262  VAL A CB  1 
ATOM   1632  C CG1 . VAL A 1 261 ? 3.323   -29.249 169.296 1.00 51.35  ? 262  VAL A CG1 1 
ATOM   1633  C CG2 . VAL A 1 261 ? 3.207   -27.078 170.539 1.00 62.15  ? 262  VAL A CG2 1 
ATOM   1634  N N   . PRO A 1 262 ? 6.449   -29.023 173.004 1.00 81.13  ? 263  PRO A N   1 
ATOM   1635  C CA  . PRO A 1 262 ? 7.564   -28.443 173.760 1.00 80.90  ? 263  PRO A CA  1 
ATOM   1636  C C   . PRO A 1 262 ? 8.791   -28.170 172.896 1.00 81.08  ? 263  PRO A C   1 
ATOM   1637  O O   . PRO A 1 262 ? 9.606   -27.315 173.243 1.00 84.94  ? 263  PRO A O   1 
ATOM   1638  C CB  . PRO A 1 262 ? 7.877   -29.526 174.792 1.00 83.54  ? 263  PRO A CB  1 
ATOM   1639  C CG  . PRO A 1 262 ? 7.482   -30.791 174.124 1.00 75.79  ? 263  PRO A CG  1 
ATOM   1640  C CD  . PRO A 1 262 ? 6.281   -30.459 173.287 1.00 74.12  ? 263  PRO A CD  1 
ATOM   1641  N N   . GLY A 1 263 ? 8.915   -28.887 171.784 1.00 84.01  ? 264  GLY A N   1 
ATOM   1642  C CA  . GLY A 1 263 ? 10.051  -28.719 170.899 1.00 83.20  ? 264  GLY A CA  1 
ATOM   1643  C C   . GLY A 1 263 ? 9.760   -27.779 169.747 1.00 81.71  ? 264  GLY A C   1 
ATOM   1644  O O   . GLY A 1 263 ? 10.545  -27.678 168.804 1.00 78.58  ? 264  GLY A O   1 
ATOM   1645  N N   . ALA A 1 264 ? 8.629   -27.086 169.825 1.00 85.53  ? 265  ALA A N   1 
ATOM   1646  C CA  . ALA A 1 264 ? 8.224   -26.167 168.768 1.00 74.48  ? 265  ALA A CA  1 
ATOM   1647  C C   . ALA A 1 264 ? 8.908   -24.812 168.910 1.00 75.96  ? 265  ALA A C   1 
ATOM   1648  O O   . ALA A 1 264 ? 9.038   -24.277 170.011 1.00 76.37  ? 265  ALA A O   1 
ATOM   1649  C CB  . ALA A 1 264 ? 6.713   -26.002 168.757 1.00 69.88  ? 265  ALA A CB  1 
ATOM   1650  N N   . ARG A 1 265 ? 9.347   -24.268 167.781 1.00 82.24  ? 266  ARG A N   1 
ATOM   1651  C CA  . ARG A 1 265 ? 10.005  -22.968 167.750 1.00 91.58  ? 266  ARG A CA  1 
ATOM   1652  C C   . ARG A 1 265 ? 9.021   -21.854 167.400 1.00 77.39  ? 266  ARG A C   1 
ATOM   1653  O O   . ARG A 1 265 ? 8.238   -21.989 166.462 1.00 61.56  ? 266  ARG A O   1 
ATOM   1654  C CB  . ARG A 1 265 ? 11.174  -22.989 166.762 1.00 106.09 ? 266  ARG A CB  1 
ATOM   1655  C CG  . ARG A 1 265 ? 10.846  -23.620 165.416 1.00 117.35 ? 266  ARG A CG  1 
ATOM   1656  C CD  . ARG A 1 265 ? 12.099  -24.161 164.743 1.00 132.13 ? 266  ARG A CD  1 
ATOM   1657  N NE  . ARG A 1 265 ? 12.785  -25.137 165.587 1.00 142.12 ? 266  ARG A NE  1 
ATOM   1658  C CZ  . ARG A 1 265 ? 13.872  -25.812 165.224 1.00 139.51 ? 266  ARG A CZ  1 
ATOM   1659  N NH1 . ARG A 1 265 ? 14.404  -25.623 164.024 1.00 135.57 ? 266  ARG A NH1 1 
ATOM   1660  N NH2 . ARG A 1 265 ? 14.426  -26.678 166.062 1.00 139.55 ? 266  ARG A NH2 1 
ATOM   1661  N N   . PRO A 1 266 ? 9.043   -20.758 168.175 1.00 69.72  ? 267  PRO A N   1 
ATOM   1662  C CA  . PRO A 1 266 ? 8.194   -19.590 167.915 1.00 59.65  ? 267  PRO A CA  1 
ATOM   1663  C C   . PRO A 1 266 ? 8.443   -19.010 166.526 1.00 53.83  ? 267  PRO A C   1 
ATOM   1664  O O   . PRO A 1 266 ? 9.594   -18.893 166.108 1.00 54.91  ? 267  PRO A O   1 
ATOM   1665  C CB  . PRO A 1 266 ? 8.639   -18.591 168.987 1.00 42.03  ? 267  PRO A CB  1 
ATOM   1666  C CG  . PRO A 1 266 ? 9.170   -19.436 170.087 1.00 51.71  ? 267  PRO A CG  1 
ATOM   1667  C CD  . PRO A 1 266 ? 9.830   -20.602 169.411 1.00 60.90  ? 267  PRO A CD  1 
ATOM   1668  N N   . CYS A 1 267 ? 7.373   -18.658 165.823 1.00 64.97  ? 268  CYS A N   1 
ATOM   1669  C CA  . CYS A 1 267 ? 7.489   -18.086 164.486 1.00 74.06  ? 268  CYS A CA  1 
ATOM   1670  C C   . CYS A 1 267 ? 8.139   -16.705 164.536 1.00 80.40  ? 268  CYS A C   1 
ATOM   1671  O O   . CYS A 1 267 ? 7.885   -15.927 165.457 1.00 86.16  ? 268  CYS A O   1 
ATOM   1672  C CB  . CYS A 1 267 ? 6.115   -18.011 163.817 1.00 79.87  ? 268  CYS A CB  1 
ATOM   1673  S SG  . CYS A 1 267 ? 5.346   -19.625 163.535 1.00 101.06 ? 268  CYS A SG  1 
ATOM   1674  N N   . PRO A 1 268 ? 8.990   -16.403 163.544 1.00 80.85  ? 269  PRO A N   1 
ATOM   1675  C CA  . PRO A 1 268 ? 9.759   -15.154 163.506 1.00 78.90  ? 269  PRO A CA  1 
ATOM   1676  C C   . PRO A 1 268 ? 8.884   -13.902 163.515 1.00 68.71  ? 269  PRO A C   1 
ATOM   1677  O O   . PRO A 1 268 ? 9.155   -12.999 164.302 1.00 70.08  ? 269  PRO A O   1 
ATOM   1678  C CB  . PRO A 1 268 ? 10.521  -15.258 162.182 1.00 82.15  ? 269  PRO A CB  1 
ATOM   1679  C CG  . PRO A 1 268 ? 10.638  -16.722 161.935 1.00 77.46  ? 269  PRO A CG  1 
ATOM   1680  C CD  . PRO A 1 268 ? 9.353   -17.306 162.438 1.00 78.98  ? 269  PRO A CD  1 
ATOM   1681  N N   . ASP A 1 269 ? 7.850   -13.858 162.678 1.00 58.03  ? 270  ASP A N   1 
ATOM   1682  C CA  . ASP A 1 269 ? 6.954   -12.702 162.623 1.00 55.60  ? 270  ASP A CA  1 
ATOM   1683  C C   . ASP A 1 269 ? 6.132   -12.573 163.904 1.00 43.61  ? 270  ASP A C   1 
ATOM   1684  O O   . ASP A 1 269 ? 5.726   -11.474 164.297 1.00 41.41  ? 270  ASP A O   1 
ATOM   1685  C CB  . ASP A 1 269 ? 6.030   -12.793 161.407 1.00 60.13  ? 270  ASP A CB  1 
ATOM   1686  C CG  . ASP A 1 269 ? 6.764   -12.575 160.097 1.00 72.54  ? 270  ASP A CG  1 
ATOM   1687  O OD1 . ASP A 1 269 ? 8.014   -12.572 160.105 1.00 80.83  ? 270  ASP A OD1 1 
ATOM   1688  O OD2 . ASP A 1 269 ? 6.090   -12.408 159.058 1.00 71.52  ? 270  ASP A OD2 1 
ATOM   1689  N N   . TYR A 1 270 ? 5.929   -13.706 164.567 1.00 50.68  ? 271  TYR A N   1 
ATOM   1690  C CA  . TYR A 1 270 ? 5.152   -13.775 165.796 1.00 56.70  ? 271  TYR A CA  1 
ATOM   1691  C C   . TYR A 1 270 ? 5.960   -13.133 166.915 1.00 52.18  ? 271  TYR A C   1 
ATOM   1692  O O   . TYR A 1 270 ? 5.533   -12.136 167.505 1.00 61.00  ? 271  TYR A O   1 
ATOM   1693  C CB  . TYR A 1 270 ? 4.831   -15.236 166.124 1.00 59.62  ? 271  TYR A CB  1 
ATOM   1694  C CG  . TYR A 1 270 ? 4.134   -15.468 167.448 1.00 55.57  ? 271  TYR A CG  1 
ATOM   1695  C CD1 . TYR A 1 270 ? 3.294   -14.509 168.000 1.00 40.15  ? 271  TYR A CD1 1 
ATOM   1696  C CD2 . TYR A 1 270 ? 4.321   -16.653 168.145 1.00 51.81  ? 271  TYR A CD2 1 
ATOM   1697  C CE1 . TYR A 1 270 ? 2.664   -14.724 169.212 1.00 42.48  ? 271  TYR A CE1 1 
ATOM   1698  C CE2 . TYR A 1 270 ? 3.693   -16.878 169.356 1.00 49.27  ? 271  TYR A CE2 1 
ATOM   1699  C CZ  . TYR A 1 270 ? 2.866   -15.911 169.885 1.00 45.83  ? 271  TYR A CZ  1 
ATOM   1700  O OH  . TYR A 1 270 ? 2.240   -16.132 171.090 1.00 45.93  ? 271  TYR A OH  1 
ATOM   1701  N N   . CYS A 1 271 ? 7.119   -13.716 167.210 1.00 53.43  ? 272  CYS A N   1 
ATOM   1702  C CA  . CYS A 1 271 ? 8.048   -13.146 168.183 1.00 55.13  ? 272  CYS A CA  1 
ATOM   1703  C C   . CYS A 1 271 ? 8.341   -11.676 167.882 1.00 58.17  ? 272  CYS A C   1 
ATOM   1704  O O   . CYS A 1 271 ? 8.468   -10.854 168.794 1.00 51.63  ? 272  CYS A O   1 
ATOM   1705  C CB  . CYS A 1 271 ? 9.353   -13.945 168.196 1.00 25.99  ? 272  CYS A CB  1 
ATOM   1706  S SG  . CYS A 1 271 ? 10.639  -13.256 169.261 1.00 77.35  ? 272  CYS A SG  1 
ATOM   1707  N N   . ARG A 1 272 ? 8.440   -11.358 166.594 1.00 57.73  ? 273  ARG A N   1 
ATOM   1708  C CA  . ARG A 1 272 ? 8.707   -9.998  166.146 1.00 55.52  ? 273  ARG A CA  1 
ATOM   1709  C C   . ARG A 1 272 ? 7.597   -9.050  166.588 1.00 51.95  ? 273  ARG A C   1 
ATOM   1710  O O   . ARG A 1 272 ? 7.865   -8.003  167.179 1.00 56.91  ? 273  ARG A O   1 
ATOM   1711  C CB  . ARG A 1 272 ? 8.860   -9.964  164.626 1.00 64.79  ? 273  ARG A CB  1 
ATOM   1712  C CG  . ARG A 1 272 ? 9.782   -8.879  164.106 1.00 80.70  ? 273  ARG A CG  1 
ATOM   1713  C CD  . ARG A 1 272 ? 10.550  -9.371  162.890 1.00 81.44  ? 273  ARG A CD  1 
ATOM   1714  N NE  . ARG A 1 272 ? 11.614  -10.298 163.266 1.00 84.44  ? 273  ARG A NE  1 
ATOM   1715  C CZ  . ARG A 1 272 ? 12.207  -11.140 162.426 1.00 87.61  ? 273  ARG A CZ  1 
ATOM   1716  N NH1 . ARG A 1 272 ? 11.835  -11.185 161.155 1.00 83.58  ? 273  ARG A NH1 1 
ATOM   1717  N NH2 . ARG A 1 272 ? 13.169  -11.944 162.861 1.00 85.20  ? 273  ARG A NH2 1 
ATOM   1718  N N   . ASN A 1 273 ? 6.351   -9.422  166.306 1.00 44.33  ? 274  ASN A N   1 
ATOM   1719  C CA  . ASN A 1 273 ? 5.207   -8.619  166.734 1.00 39.50  ? 274  ASN A CA  1 
ATOM   1720  C C   . ASN A 1 273 ? 5.091   -8.509  168.254 1.00 30.24  ? 274  ASN A C   1 
ATOM   1721  O O   . ASN A 1 273 ? 4.722   -7.456  168.783 1.00 29.91  ? 274  ASN A O   1 
ATOM   1722  C CB  . ASN A 1 273 ? 3.904   -9.155  166.136 1.00 39.57  ? 274  ASN A CB  1 
ATOM   1723  C CG  . ASN A 1 273 ? 3.675   -8.675  164.717 1.00 50.08  ? 274  ASN A CG  1 
ATOM   1724  O OD1 . ASN A 1 273 ? 4.143   -7.604  164.328 1.00 55.31  ? 274  ASN A OD1 1 
ATOM   1725  N ND2 . ASN A 1 273 ? 2.946   -9.462  163.937 1.00 55.31  ? 274  ASN A ND2 1 
ATOM   1726  N N   . VAL A 1 274 ? 5.409   -9.595  168.954 1.00 27.94  ? 275  VAL A N   1 
ATOM   1727  C CA  . VAL A 1 274 ? 5.381   -9.586  170.414 1.00 34.12  ? 275  VAL A CA  1 
ATOM   1728  C C   . VAL A 1 274 ? 6.371   -8.569  170.976 1.00 46.02  ? 275  VAL A C   1 
ATOM   1729  O O   . VAL A 1 274 ? 6.014   -7.725  171.804 1.00 54.23  ? 275  VAL A O   1 
ATOM   1730  C CB  . VAL A 1 274 ? 5.710   -10.973 171.004 1.00 41.72  ? 275  VAL A CB  1 
ATOM   1731  C CG1 . VAL A 1 274 ? 5.844   -10.891 172.519 1.00 43.13  ? 275  VAL A CG1 1 
ATOM   1732  C CG2 . VAL A 1 274 ? 4.649   -11.988 170.616 1.00 34.77  ? 275  VAL A CG2 1 
ATOM   1733  N N   . LEU A 1 275 ? 7.615   -8.651  170.516 1.00 49.94  ? 276  LEU A N   1 
ATOM   1734  C CA  . LEU A 1 275 ? 8.659   -7.758  171.006 1.00 39.86  ? 276  LEU A CA  1 
ATOM   1735  C C   . LEU A 1 275 ? 8.477   -6.315  170.542 1.00 48.12  ? 276  LEU A C   1 
ATOM   1736  O O   . LEU A 1 275 ? 8.912   -5.385  171.218 1.00 60.53  ? 276  LEU A O   1 
ATOM   1737  C CB  . LEU A 1 275 ? 10.048  -8.280  170.634 1.00 36.14  ? 276  LEU A CB  1 
ATOM   1738  C CG  . LEU A 1 275 ? 10.497  -9.508  171.427 1.00 45.79  ? 276  LEU A CG  1 
ATOM   1739  C CD1 . LEU A 1 275 ? 11.953  -9.829  171.138 1.00 47.52  ? 276  LEU A CD1 1 
ATOM   1740  C CD2 . LEU A 1 275 ? 10.270  -9.304  172.920 1.00 32.85  ? 276  LEU A CD2 1 
ATOM   1741  N N   . LYS A 1 276 ? 7.836   -6.126  169.393 1.00 36.77  ? 277  LYS A N   1 
ATOM   1742  C CA  . LYS A 1 276 ? 7.503   -4.778  168.942 1.00 40.03  ? 277  LYS A CA  1 
ATOM   1743  C C   . LYS A 1 276 ? 6.360   -4.216  169.775 1.00 42.53  ? 277  LYS A C   1 
ATOM   1744  O O   . LYS A 1 276 ? 6.201   -3.000  169.897 1.00 42.83  ? 277  LYS A O   1 
ATOM   1745  C CB  . LYS A 1 276 ? 7.151   -4.749  167.453 1.00 25.52  ? 277  LYS A CB  1 
ATOM   1746  C CG  . LYS A 1 276 ? 8.361   -4.827  166.545 1.00 36.95  ? 277  LYS A CG  1 
ATOM   1747  C CD  . LYS A 1 276 ? 8.009   -4.445  165.123 1.00 43.35  ? 277  LYS A CD  1 
ATOM   1748  C CE  . LYS A 1 276 ? 9.257   -4.361  164.263 1.00 47.81  ? 277  LYS A CE  1 
ATOM   1749  N NZ  . LYS A 1 276 ? 8.953   -3.922  162.874 1.00 54.74  ? 277  LYS A NZ  1 
ATOM   1750  N N   . GLY A 1 277 ? 5.564   -5.114  170.347 1.00 46.82  ? 278  GLY A N   1 
ATOM   1751  C CA  . GLY A 1 277 ? 4.513   -4.711  171.258 1.00 49.73  ? 278  GLY A CA  1 
ATOM   1752  C C   . GLY A 1 277 ? 5.089   -4.320  172.606 1.00 47.96  ? 278  GLY A C   1 
ATOM   1753  O O   . GLY A 1 277 ? 4.656   -3.342  173.215 1.00 42.34  ? 278  GLY A O   1 
ATOM   1754  N N   . CYS A 1 278 ? 6.076   -5.082  173.068 1.00 52.49  ? 279  CYS A N   1 
ATOM   1755  C CA  . CYS A 1 278 ? 6.669   -4.852  174.385 1.00 66.97  ? 279  CYS A CA  1 
ATOM   1756  C C   . CYS A 1 278 ? 7.613   -3.650  174.412 1.00 62.81  ? 279  CYS A C   1 
ATOM   1757  O O   . CYS A 1 278 ? 7.611   -2.866  175.360 1.00 67.61  ? 279  CYS A O   1 
ATOM   1758  C CB  . CYS A 1 278 ? 7.411   -6.103  174.857 1.00 70.14  ? 279  CYS A CB  1 
ATOM   1759  S SG  . CYS A 1 278 ? 6.369   -7.567  175.007 1.00 79.30  ? 279  CYS A SG  1 
ATOM   1760  N N   . LEU A 1 279 ? 8.415   -3.520  173.361 1.00 49.40  ? 280  LEU A N   1 
ATOM   1761  C CA  . LEU A 1 279 ? 9.445   -2.486  173.269 1.00 55.50  ? 280  LEU A CA  1 
ATOM   1762  C C   . LEU A 1 279 ? 8.984   -1.218  172.545 1.00 65.72  ? 280  LEU A C   1 
ATOM   1763  O O   . LEU A 1 279 ? 9.795   -0.338  172.236 1.00 65.62  ? 280  LEU A O   1 
ATOM   1764  C CB  . LEU A 1 279 ? 10.723  -3.048  172.642 1.00 53.78  ? 280  LEU A CB  1 
ATOM   1765  C CG  . LEU A 1 279 ? 11.261  -4.280  173.369 1.00 39.49  ? 280  LEU A CG  1 
ATOM   1766  C CD1 . LEU A 1 279 ? 12.565  -4.747  172.745 1.00 47.05  ? 280  LEU A CD1 1 
ATOM   1767  C CD2 . LEU A 1 279 ? 11.436  -3.980  174.852 1.00 16.66  ? 280  LEU A CD2 1 
ATOM   1768  N N   . ALA A 1 280 ? 7.687   -1.151  172.260 1.00 74.38  ? 281  ALA A N   1 
ATOM   1769  C CA  . ALA A 1 280 ? 7.085   -0.044  171.520 1.00 79.12  ? 281  ALA A CA  1 
ATOM   1770  C C   . ALA A 1 280 ? 7.492   1.345   172.016 1.00 70.07  ? 281  ALA A C   1 
ATOM   1771  O O   . ALA A 1 280 ? 7.730   2.247   171.212 1.00 69.48  ? 281  ALA A O   1 
ATOM   1772  C CB  . ALA A 1 280 ? 5.569   -0.181  171.544 1.00 78.91  ? 281  ALA A CB  1 
ATOM   1773  N N   . ASN A 1 281 ? 7.576   1.519   173.331 1.00 53.53  ? 282  ASN A N   1 
ATOM   1774  C CA  . ASN A 1 281 ? 7.994   2.806   173.886 1.00 55.86  ? 282  ASN A CA  1 
ATOM   1775  C C   . ASN A 1 281 ? 9.469   3.107   173.643 1.00 59.16  ? 282  ASN A C   1 
ATOM   1776  O O   . ASN A 1 281 ? 9.843   4.245   173.360 1.00 46.84  ? 282  ASN A O   1 
ATOM   1777  C CB  . ASN A 1 281 ? 7.667   2.896   175.377 1.00 54.83  ? 282  ASN A CB  1 
ATOM   1778  C CG  . ASN A 1 281 ? 6.275   3.437   175.633 1.00 61.73  ? 282  ASN A CG  1 
ATOM   1779  O OD1 . ASN A 1 281 ? 5.770   4.262   174.871 1.00 57.14  ? 282  ASN A OD1 1 
ATOM   1780  N ND2 . ASN A 1 281 ? 5.645   2.973   176.705 1.00 72.46  ? 282  ASN A ND2 1 
ATOM   1781  N N   . GLN A 1 282 ? 10.297  2.075   173.757 1.00 62.66  ? 283  GLN A N   1 
ATOM   1782  C CA  . GLN A 1 282 ? 11.727  2.198   173.524 1.00 37.34  ? 283  GLN A CA  1 
ATOM   1783  C C   . GLN A 1 282 ? 12.008  2.539   172.062 1.00 26.63  ? 283  GLN A C   1 
ATOM   1784  O O   . GLN A 1 282 ? 12.920  3.306   171.761 1.00 51.40  ? 283  GLN A O   1 
ATOM   1785  C CB  . GLN A 1 282 ? 12.432  0.893   173.903 1.00 37.27  ? 283  GLN A CB  1 
ATOM   1786  C CG  . GLN A 1 282 ? 12.431  0.568   175.398 1.00 39.10  ? 283  GLN A CG  1 
ATOM   1787  C CD  . GLN A 1 282 ? 11.103  0.025   175.904 1.00 39.55  ? 283  GLN A CD  1 
ATOM   1788  O OE1 . GLN A 1 282 ? 10.106  0.013   175.184 1.00 51.66  ? 283  GLN A OE1 1 
ATOM   1789  N NE2 . GLN A 1 282 ? 11.087  -0.428  177.153 1.00 32.46  ? 283  GLN A NE2 1 
ATOM   1790  N N   . ALA A 1 283 ? 11.208  1.976   171.160 1.00 26.55  ? 284  ALA A N   1 
ATOM   1791  C CA  . ALA A 1 283 ? 11.371  2.195   169.723 1.00 37.95  ? 284  ALA A CA  1 
ATOM   1792  C C   . ALA A 1 283 ? 11.073  3.635   169.293 1.00 36.55  ? 284  ALA A C   1 
ATOM   1793  O O   . ALA A 1 283 ? 11.392  4.031   168.170 1.00 41.88  ? 284  ALA A O   1 
ATOM   1794  C CB  . ALA A 1 283 ? 10.505  1.219   168.939 1.00 53.66  ? 284  ALA A CB  1 
ATOM   1795  N N   . ASP A 1 284 ? 10.453  4.409   170.179 1.00 40.27  ? 285  ASP A N   1 
ATOM   1796  C CA  . ASP A 1 284 ? 10.130  5.804   169.884 1.00 57.54  ? 285  ASP A CA  1 
ATOM   1797  C C   . ASP A 1 284 ? 11.369  6.695   169.939 1.00 57.71  ? 285  ASP A C   1 
ATOM   1798  O O   . ASP A 1 284 ? 11.361  7.817   169.436 1.00 53.75  ? 285  ASP A O   1 
ATOM   1799  C CB  . ASP A 1 284 ? 9.051   6.326   170.838 1.00 62.81  ? 285  ASP A CB  1 
ATOM   1800  C CG  . ASP A 1 284 ? 7.663   6.295   170.225 1.00 58.69  ? 285  ASP A CG  1 
ATOM   1801  O OD1 . ASP A 1 284 ? 7.492   5.666   169.160 1.00 39.67  ? 285  ASP A OD1 1 
ATOM   1802  O OD2 . ASP A 1 284 ? 6.741   6.901   170.812 1.00 74.09  ? 285  ASP A OD2 1 
ATOM   1803  N N   . LEU A 1 285 ? 12.436  6.180   170.543 1.00 56.62  ? 286  LEU A N   1 
ATOM   1804  C CA  . LEU A 1 285 ? 13.694  6.913   170.665 1.00 44.12  ? 286  LEU A CA  1 
ATOM   1805  C C   . LEU A 1 285 ? 14.470  6.959   169.345 1.00 46.54  ? 286  LEU A C   1 
ATOM   1806  O O   . LEU A 1 285 ? 15.446  7.709   169.213 1.00 37.73  ? 286  LEU A O   1 
ATOM   1807  C CB  . LEU A 1 285 ? 14.566  6.274   171.747 1.00 27.52  ? 286  LEU A CB  1 
ATOM   1808  C CG  . LEU A 1 285 ? 14.114  6.380   173.203 1.00 32.75  ? 286  LEU A CG  1 
ATOM   1809  C CD1 . LEU A 1 285 ? 14.799  5.314   174.035 1.00 41.19  ? 286  LEU A CD1 1 
ATOM   1810  C CD2 . LEU A 1 285 ? 14.426  7.757   173.759 1.00 29.42  ? 286  LEU A CD2 1 
ATOM   1811  N N   . ASP A 1 286 ? 14.019  6.159   168.378 1.00 43.68  ? 287  ASP A N   1 
ATOM   1812  C CA  . ASP A 1 286 ? 14.703  5.971   167.094 1.00 38.59  ? 287  ASP A CA  1 
ATOM   1813  C C   . ASP A 1 286 ? 15.152  7.279   166.436 1.00 28.10  ? 287  ASP A C   1 
ATOM   1814  O O   . ASP A 1 286 ? 16.352  7.544   166.329 1.00 44.03  ? 287  ASP A O   1 
ATOM   1815  C CB  . ASP A 1 286 ? 13.812  5.173   166.128 1.00 24.94  ? 287  ASP A CB  1 
ATOM   1816  C CG  . ASP A 1 286 ? 14.516  4.832   164.822 1.00 39.56  ? 287  ASP A CG  1 
ATOM   1817  O OD1 . ASP A 1 286 ? 15.683  4.394   164.871 1.00 51.29  ? 287  ASP A OD1 1 
ATOM   1818  O OD2 . ASP A 1 286 ? 13.904  5.002   163.745 1.00 40.78  ? 287  ASP A OD2 1 
ATOM   1819  N N   . ALA A 1 287 ? 14.183  8.093   166.026 1.00 36.64  ? 288  ALA A N   1 
ATOM   1820  C CA  . ALA A 1 287 ? 14.433  9.346   165.308 1.00 47.92  ? 288  ALA A CA  1 
ATOM   1821  C C   . ALA A 1 287 ? 15.519  10.215  165.939 1.00 51.64  ? 288  ALA A C   1 
ATOM   1822  O O   . ALA A 1 287 ? 16.549  10.480  165.318 1.00 39.73  ? 288  ALA A O   1 
ATOM   1823  C CB  . ALA A 1 287 ? 13.142  10.136  165.169 1.00 20.56  ? 288  ALA A CB  1 
ATOM   1824  N N   . GLU A 1 288 ? 15.277  10.662  167.168 1.00 56.19  ? 289  GLU A N   1 
ATOM   1825  C CA  . GLU A 1 288 ? 16.217  11.528  167.878 1.00 59.72  ? 289  GLU A CA  1 
ATOM   1826  C C   . GLU A 1 288 ? 17.580  10.882  168.139 1.00 50.95  ? 289  GLU A C   1 
ATOM   1827  O O   . GLU A 1 288 ? 18.608  11.563  168.129 1.00 57.12  ? 289  GLU A O   1 
ATOM   1828  C CB  . GLU A 1 288 ? 15.593  12.041  169.178 1.00 62.25  ? 289  GLU A CB  1 
ATOM   1829  C CG  . GLU A 1 288 ? 14.385  12.926  168.944 1.00 56.76  ? 289  GLU A CG  1 
ATOM   1830  C CD  . GLU A 1 288 ? 14.712  14.107  168.057 1.00 60.46  ? 289  GLU A CD  1 
ATOM   1831  O OE1 . GLU A 1 288 ? 15.817  14.672  168.204 1.00 90.84  ? 289  GLU A OE1 1 
ATOM   1832  O OE2 . GLU A 1 288 ? 13.869  14.466  167.209 1.00 43.05  ? 289  GLU A OE2 1 
ATOM   1833  N N   . TRP A 1 289 ? 17.581  9.573   168.375 1.00 43.08  ? 290  TRP A N   1 
ATOM   1834  C CA  . TRP A 1 289 ? 18.829  8.823   168.503 1.00 37.93  ? 290  TRP A CA  1 
ATOM   1835  C C   . TRP A 1 289 ? 19.651  8.981   167.224 1.00 42.84  ? 290  TRP A C   1 
ATOM   1836  O O   . TRP A 1 289 ? 20.825  9.370   167.265 1.00 51.87  ? 290  TRP A O   1 
ATOM   1837  C CB  . TRP A 1 289 ? 18.538  7.347   168.787 1.00 36.33  ? 290  TRP A CB  1 
ATOM   1838  C CG  . TRP A 1 289 ? 19.756  6.482   168.957 1.00 47.19  ? 290  TRP A CG  1 
ATOM   1839  C CD1 . TRP A 1 289 ? 20.314  5.662   168.020 1.00 55.08  ? 290  TRP A CD1 1 
ATOM   1840  C CD2 . TRP A 1 289 ? 20.554  6.338   170.141 1.00 41.69  ? 290  TRP A CD2 1 
ATOM   1841  N NE1 . TRP A 1 289 ? 21.412  5.021   168.544 1.00 44.27  ? 290  TRP A NE1 1 
ATOM   1842  C CE2 . TRP A 1 289 ? 21.581  5.419   169.845 1.00 39.18  ? 290  TRP A CE2 1 
ATOM   1843  C CE3 . TRP A 1 289 ? 20.502  6.900   171.422 1.00 40.37  ? 290  TRP A CE3 1 
ATOM   1844  C CZ2 . TRP A 1 289 ? 22.547  5.048   170.781 1.00 27.34  ? 290  TRP A CZ2 1 
ATOM   1845  C CZ3 . TRP A 1 289 ? 21.463  6.531   172.350 1.00 47.25  ? 290  TRP A CZ3 1 
ATOM   1846  C CH2 . TRP A 1 289 ? 22.471  5.614   172.024 1.00 33.76  ? 290  TRP A CH2 1 
ATOM   1847  N N   . ARG A 1 290 ? 19.021  8.699   166.088 1.00 29.11  ? 291  ARG A N   1 
ATOM   1848  C CA  . ARG A 1 290 ? 19.682  8.857   164.797 1.00 32.33  ? 291  ARG A CA  1 
ATOM   1849  C C   . ARG A 1 290 ? 20.146  10.294  164.568 1.00 45.84  ? 291  ARG A C   1 
ATOM   1850  O O   . ARG A 1 290 ? 21.233  10.519  164.051 1.00 55.81  ? 291  ARG A O   1 
ATOM   1851  C CB  . ARG A 1 290 ? 18.776  8.386   163.652 1.00 32.67  ? 291  ARG A CB  1 
ATOM   1852  C CG  . ARG A 1 290 ? 18.204  6.996   163.860 1.00 44.20  ? 291  ARG A CG  1 
ATOM   1853  C CD  . ARG A 1 290 ? 18.108  6.221   162.557 1.00 41.60  ? 291  ARG A CD  1 
ATOM   1854  N NE  . ARG A 1 290 ? 17.740  4.827   162.786 1.00 41.72  ? 291  ARG A NE  1 
ATOM   1855  C CZ  . ARG A 1 290 ? 17.931  3.848   161.908 1.00 50.91  ? 291  ARG A CZ  1 
ATOM   1856  N NH1 . ARG A 1 290 ? 18.495  4.105   160.734 1.00 52.56  ? 291  ARG A NH1 1 
ATOM   1857  N NH2 . ARG A 1 290 ? 17.564  2.609   162.205 1.00 54.10  ? 291  ARG A NH2 1 
ATOM   1858  N N   . ASN A 1 291 ? 19.321  11.261  164.961 1.00 38.32  ? 292  ASN A N   1 
ATOM   1859  C CA  . ASN A 1 291 ? 19.687  12.671  164.845 1.00 52.71  ? 292  ASN A CA  1 
ATOM   1860  C C   . ASN A 1 291 ? 20.963  13.010  165.623 1.00 63.59  ? 292  ASN A C   1 
ATOM   1861  O O   . ASN A 1 291 ? 21.899  13.607  165.079 1.00 67.08  ? 292  ASN A O   1 
ATOM   1862  C CB  . ASN A 1 291 ? 18.530  13.574  165.293 1.00 62.59  ? 292  ASN A CB  1 
ATOM   1863  C CG  . ASN A 1 291 ? 17.393  13.620  164.282 1.00 51.39  ? 292  ASN A CG  1 
ATOM   1864  O OD1 . ASN A 1 291 ? 17.606  13.467  163.079 1.00 42.09  ? 292  ASN A OD1 1 
ATOM   1865  N ND2 . ASN A 1 291 ? 16.178  13.839  164.771 1.00 42.42  ? 292  ASN A ND2 1 
ATOM   1866  N N   . LEU A 1 292 ? 20.995  12.611  166.892 1.00 54.02  ? 293  LEU A N   1 
ATOM   1867  C CA  . LEU A 1 292 ? 22.153  12.837  167.750 1.00 42.17  ? 293  LEU A CA  1 
ATOM   1868  C C   . LEU A 1 292 ? 23.408  12.176  167.185 1.00 51.71  ? 293  LEU A C   1 
ATOM   1869  O O   . LEU A 1 292 ? 24.470  12.800  167.118 1.00 54.85  ? 293  LEU A O   1 
ATOM   1870  C CB  . LEU A 1 292 ? 21.888  12.320  169.168 1.00 33.88  ? 293  LEU A CB  1 
ATOM   1871  C CG  . LEU A 1 292 ? 23.103  12.393  170.097 1.00 40.62  ? 293  LEU A CG  1 
ATOM   1872  C CD1 . LEU A 1 292 ? 23.477  13.837  170.348 1.00 46.44  ? 293  LEU A CD1 1 
ATOM   1873  C CD2 . LEU A 1 292 ? 22.864  11.661  171.410 1.00 41.09  ? 293  LEU A CD2 1 
ATOM   1874  N N   . LEU A 1 293 ? 23.280  10.917  166.772 1.00 54.64  ? 294  LEU A N   1 
ATOM   1875  C CA  . LEU A 1 293 ? 24.410  10.201  166.184 1.00 40.81  ? 294  LEU A CA  1 
ATOM   1876  C C   . LEU A 1 293 ? 24.910  10.879  164.910 1.00 44.13  ? 294  LEU A C   1 
ATOM   1877  O O   . LEU A 1 293 ? 26.117  10.968  164.681 1.00 55.08  ? 294  LEU A O   1 
ATOM   1878  C CB  . LEU A 1 293 ? 24.049  8.739   165.909 1.00 42.58  ? 294  LEU A CB  1 
ATOM   1879  C CG  . LEU A 1 293 ? 24.545  7.717   166.939 1.00 48.93  ? 294  LEU A CG  1 
ATOM   1880  C CD1 . LEU A 1 293 ? 24.163  8.117   168.354 1.00 50.22  ? 294  LEU A CD1 1 
ATOM   1881  C CD2 . LEU A 1 293 ? 24.007  6.332   166.621 1.00 57.51  ? 294  LEU A CD2 1 
ATOM   1882  N N   . ASP A 1 294 ? 23.982  11.362  164.091 1.00 47.61  ? 295  ASP A N   1 
ATOM   1883  C CA  . ASP A 1 294 ? 24.339  12.084  162.872 1.00 60.94  ? 295  ASP A CA  1 
ATOM   1884  C C   . ASP A 1 294 ? 25.119  13.354  163.198 1.00 61.13  ? 295  ASP A C   1 
ATOM   1885  O O   . ASP A 1 294 ? 26.136  13.646  162.569 1.00 60.64  ? 295  ASP A O   1 
ATOM   1886  C CB  . ASP A 1 294 ? 23.096  12.435  162.048 1.00 66.09  ? 295  ASP A CB  1 
ATOM   1887  C CG  . ASP A 1 294 ? 22.403  11.212  161.477 1.00 81.92  ? 295  ASP A CG  1 
ATOM   1888  O OD1 . ASP A 1 294 ? 23.094  10.225  161.150 1.00 83.74  ? 295  ASP A OD1 1 
ATOM   1889  O OD2 . ASP A 1 294 ? 21.160  11.238  161.354 1.00 89.64  ? 295  ASP A OD2 1 
ATOM   1890  N N   . SER A 1 295 ? 24.639  14.108  164.182 1.00 57.98  ? 296  SER A N   1 
ATOM   1891  C CA  . SER A 1 295 ? 25.319  15.333  164.595 1.00 57.95  ? 296  SER A CA  1 
ATOM   1892  C C   . SER A 1 295 ? 26.713  15.038  165.142 1.00 58.85  ? 296  SER A C   1 
ATOM   1893  O O   . SER A 1 295 ? 27.658  15.788  164.893 1.00 66.14  ? 296  SER A O   1 
ATOM   1894  C CB  . SER A 1 295 ? 24.495  16.100  165.634 1.00 53.10  ? 296  SER A CB  1 
ATOM   1895  O OG  . SER A 1 295 ? 24.391  15.375  166.846 1.00 58.94  ? 296  SER A OG  1 
ATOM   1896  N N   . MET A 1 296 ? 26.841  13.937  165.876 1.00 46.09  ? 297  MET A N   1 
ATOM   1897  C CA  . MET A 1 296 ? 28.133  13.549  166.431 1.00 48.75  ? 297  MET A CA  1 
ATOM   1898  C C   . MET A 1 296 ? 29.110  13.094  165.351 1.00 54.67  ? 297  MET A C   1 
ATOM   1899  O O   . MET A 1 296 ? 30.318  13.301  165.470 1.00 54.50  ? 297  MET A O   1 
ATOM   1900  C CB  . MET A 1 296 ? 27.966  12.476  167.504 1.00 37.01  ? 297  MET A CB  1 
ATOM   1901  C CG  . MET A 1 296 ? 27.281  12.996  168.748 1.00 33.88  ? 297  MET A CG  1 
ATOM   1902  S SD  . MET A 1 296 ? 27.570  11.953  170.182 1.00 71.15  ? 297  MET A SD  1 
ATOM   1903  C CE  . MET A 1 296 ? 26.711  10.464  169.689 1.00 72.04  ? 297  MET A CE  1 
ATOM   1904  N N   . VAL A 1 297 ? 28.587  12.481  164.294 1.00 44.99  ? 298  VAL A N   1 
ATOM   1905  C CA  . VAL A 1 297 ? 29.415  12.155  163.141 1.00 38.04  ? 298  VAL A CA  1 
ATOM   1906  C C   . VAL A 1 297 ? 29.833  13.443  162.425 1.00 50.11  ? 298  VAL A C   1 
ATOM   1907  O O   . VAL A 1 297 ? 30.962  13.564  161.947 1.00 41.74  ? 298  VAL A O   1 
ATOM   1908  C CB  . VAL A 1 297 ? 28.686  11.188  162.175 1.00 37.02  ? 298  VAL A CB  1 
ATOM   1909  C CG1 . VAL A 1 297 ? 29.340  11.185  160.800 1.00 36.96  ? 298  VAL A CG1 1 
ATOM   1910  C CG2 . VAL A 1 297 ? 28.665  9.783   162.756 1.00 42.36  ? 298  VAL A CG2 1 
ATOM   1911  N N   . LEU A 1 298 ? 28.927  14.415  162.388 1.00 61.12  ? 299  LEU A N   1 
ATOM   1912  C CA  . LEU A 1 298 ? 29.182  15.688  161.713 1.00 53.86  ? 299  LEU A CA  1 
ATOM   1913  C C   . LEU A 1 298 ? 30.248  16.541  162.392 1.00 50.10  ? 299  LEU A C   1 
ATOM   1914  O O   . LEU A 1 298 ? 31.099  17.128  161.724 1.00 51.76  ? 299  LEU A O   1 
ATOM   1915  C CB  . LEU A 1 298 ? 27.892  16.499  161.593 1.00 49.92  ? 299  LEU A CB  1 
ATOM   1916  C CG  . LEU A 1 298 ? 27.040  16.209  160.361 1.00 54.15  ? 299  LEU A CG  1 
ATOM   1917  C CD1 . LEU A 1 298 ? 25.782  17.058  160.381 1.00 70.15  ? 299  LEU A CD1 1 
ATOM   1918  C CD2 . LEU A 1 298 ? 27.849  16.468  159.101 1.00 51.19  ? 299  LEU A CD2 1 
ATOM   1919  N N   . ILE A 1 299 ? 30.194  16.614  163.719 1.00 43.01  ? 300  ILE A N   1 
ATOM   1920  C CA  . ILE A 1 299 ? 31.069  17.515  164.464 1.00 36.77  ? 300  ILE A CA  1 
ATOM   1921  C C   . ILE A 1 299 ? 32.543  17.108  164.382 1.00 62.21  ? 300  ILE A C   1 
ATOM   1922  O O   . ILE A 1 299 ? 33.433  17.921  164.634 1.00 73.20  ? 300  ILE A O   1 
ATOM   1923  C CB  . ILE A 1 299 ? 30.624  17.649  165.937 1.00 30.38  ? 300  ILE A CB  1 
ATOM   1924  C CG1 . ILE A 1 299 ? 31.112  18.974  166.529 1.00 53.39  ? 300  ILE A CG1 1 
ATOM   1925  C CG2 . ILE A 1 299 ? 31.097  16.460  166.754 1.00 42.87  ? 300  ILE A CG2 1 
ATOM   1926  C CD1 . ILE A 1 299 ? 30.529  20.198  165.850 1.00 42.92  ? 300  ILE A CD1 1 
ATOM   1927  N N   . THR A 1 300 ? 32.798  15.857  164.008 1.00 67.43  ? 301  THR A N   1 
ATOM   1928  C CA  . THR A 1 300 ? 34.168  15.371  163.865 1.00 61.42  ? 301  THR A CA  1 
ATOM   1929  C C   . THR A 1 300 ? 34.836  15.906  162.601 1.00 69.94  ? 301  THR A C   1 
ATOM   1930  O O   . THR A 1 300 ? 36.058  15.850  162.466 1.00 86.80  ? 301  THR A O   1 
ATOM   1931  C CB  . THR A 1 300 ? 34.244  13.831  163.864 1.00 57.13  ? 301  THR A CB  1 
ATOM   1932  O OG1 . THR A 1 300 ? 33.460  13.308  162.785 1.00 68.01  ? 301  THR A OG1 1 
ATOM   1933  C CG2 . THR A 1 300 ? 33.738  13.270  165.181 1.00 51.21  ? 301  THR A CG2 1 
ATOM   1934  N N   . ASP A 1 301 ? 34.033  16.417  161.674 1.00 64.26  ? 302  ASP A N   1 
ATOM   1935  C CA  . ASP A 1 301 ? 34.565  17.036  160.465 1.00 68.65  ? 302  ASP A CA  1 
ATOM   1936  C C   . ASP A 1 301 ? 35.354  18.288  160.819 1.00 76.26  ? 302  ASP A C   1 
ATOM   1937  O O   . ASP A 1 301 ? 36.284  18.674  160.110 1.00 79.23  ? 302  ASP A O   1 
ATOM   1938  C CB  . ASP A 1 301 ? 33.439  17.385  159.492 1.00 70.78  ? 302  ASP A CB  1 
ATOM   1939  C CG  . ASP A 1 301 ? 32.899  16.170  158.764 1.00 82.86  ? 302  ASP A CG  1 
ATOM   1940  O OD1 . ASP A 1 301 ? 33.154  15.036  159.222 1.00 90.16  ? 302  ASP A OD1 1 
ATOM   1941  O OD2 . ASP A 1 301 ? 32.217  16.352  157.734 1.00 79.36  ? 302  ASP A OD2 1 
ATOM   1942  N N   . LYS A 1 302 ? 34.981  18.913  161.931 1.00 79.38  ? 303  LYS A N   1 
ATOM   1943  C CA  . LYS A 1 302 ? 35.638  20.131  162.385 1.00 76.85  ? 303  LYS A CA  1 
ATOM   1944  C C   . LYS A 1 302 ? 36.992  19.839  163.020 1.00 88.17  ? 303  LYS A C   1 
ATOM   1945  O O   . LYS A 1 302 ? 37.757  20.756  163.310 1.00 108.10 ? 303  LYS A O   1 
ATOM   1946  C CB  . LYS A 1 302 ? 34.742  20.888  163.367 1.00 65.85  ? 303  LYS A CB  1 
ATOM   1947  C CG  . LYS A 1 302 ? 33.433  21.362  162.759 1.00 57.53  ? 303  LYS A CG  1 
ATOM   1948  C CD  . LYS A 1 302 ? 33.688  22.150  161.483 1.00 59.98  ? 303  LYS A CD  1 
ATOM   1949  C CE  . LYS A 1 302 ? 32.392  22.624  160.850 1.00 65.93  ? 303  LYS A CE  1 
ATOM   1950  N NZ  . LYS A 1 302 ? 32.631  23.303  159.545 1.00 69.78  ? 303  LYS A NZ  1 
ATOM   1951  N N   . PHE A 1 303 ? 37.290  18.559  163.224 1.00 88.87  ? 304  PHE A N   1 
ATOM   1952  C CA  . PHE A 1 303 ? 38.551  18.156  163.842 1.00 101.72 ? 304  PHE A CA  1 
ATOM   1953  C C   . PHE A 1 303 ? 39.740  18.375  162.907 1.00 97.97  ? 304  PHE A C   1 
ATOM   1954  O O   . PHE A 1 303 ? 40.890  18.380  163.348 1.00 85.36  ? 304  PHE A O   1 
ATOM   1955  C CB  . PHE A 1 303 ? 38.513  16.680  164.266 1.00 96.30  ? 304  PHE A CB  1 
ATOM   1956  C CG  . PHE A 1 303 ? 37.578  16.386  165.412 1.00 82.77  ? 304  PHE A CG  1 
ATOM   1957  C CD1 . PHE A 1 303 ? 36.848  17.393  166.021 1.00 75.74  ? 304  PHE A CD1 1 
ATOM   1958  C CD2 . PHE A 1 303 ? 37.444  15.093  165.888 1.00 76.19  ? 304  PHE A CD2 1 
ATOM   1959  C CE1 . PHE A 1 303 ? 35.995  17.114  167.074 1.00 68.04  ? 304  PHE A CE1 1 
ATOM   1960  C CE2 . PHE A 1 303 ? 36.594  14.807  166.941 1.00 69.62  ? 304  PHE A CE2 1 
ATOM   1961  C CZ  . PHE A 1 303 ? 35.870  15.819  167.534 1.00 64.54  ? 304  PHE A CZ  1 
ATOM   1962  N N   . TRP A 1 304 ? 39.462  18.563  161.620 1.00 106.24 ? 305  TRP A N   1 
ATOM   1963  C CA  . TRP A 1 304 ? 40.517  18.573  160.609 1.00 109.82 ? 305  TRP A CA  1 
ATOM   1964  C C   . TRP A 1 304 ? 40.661  19.915  159.898 1.00 119.05 ? 305  TRP A C   1 
ATOM   1965  O O   . TRP A 1 304 ? 39.729  20.717  159.858 1.00 130.94 ? 305  TRP A O   1 
ATOM   1966  C CB  . TRP A 1 304 ? 40.281  17.461  159.583 1.00 104.37 ? 305  TRP A CB  1 
ATOM   1967  C CG  . TRP A 1 304 ? 39.638  16.237  160.164 1.00 92.80  ? 305  TRP A CG  1 
ATOM   1968  C CD1 . TRP A 1 304 ? 38.451  15.680  159.789 1.00 76.51  ? 305  TRP A CD1 1 
ATOM   1969  C CD2 . TRP A 1 304 ? 40.141  15.429  161.236 1.00 90.09  ? 305  TRP A CD2 1 
ATOM   1970  N NE1 . TRP A 1 304 ? 38.187  14.570  160.555 1.00 73.26  ? 305  TRP A NE1 1 
ATOM   1971  C CE2 . TRP A 1 304 ? 39.207  14.395  161.451 1.00 86.06  ? 305  TRP A CE2 1 
ATOM   1972  C CE3 . TRP A 1 304 ? 41.289  15.476  162.033 1.00 89.53  ? 305  TRP A CE3 1 
ATOM   1973  C CZ2 . TRP A 1 304 ? 39.388  13.418  162.428 1.00 87.64  ? 305  TRP A CZ2 1 
ATOM   1974  C CZ3 . TRP A 1 304 ? 41.466  14.506  163.003 1.00 92.46  ? 305  TRP A CZ3 1 
ATOM   1975  C CH2 . TRP A 1 304 ? 40.520  13.491  163.192 1.00 88.28  ? 305  TRP A CH2 1 
ATOM   1976  N N   . GLY A 1 305 ? 41.843  20.146  159.337 1.00 113.31 ? 306  GLY A N   1 
ATOM   1977  C CA  . GLY A 1 305 ? 42.153  21.404  158.684 1.00 116.98 ? 306  GLY A CA  1 
ATOM   1978  C C   . GLY A 1 305 ? 43.080  22.233  159.547 1.00 123.12 ? 306  GLY A C   1 
ATOM   1979  O O   . GLY A 1 305 ? 43.275  21.927  160.724 1.00 126.59 ? 306  GLY A O   1 
ATOM   1980  N N   . THR A 1 306 ? 43.659  23.280  158.967 1.00 120.10 ? 307  THR A N   1 
ATOM   1981  C CA  . THR A 1 306 ? 44.540  24.172  159.713 1.00 115.04 ? 307  THR A CA  1 
ATOM   1982  C C   . THR A 1 306 ? 43.766  24.900  160.807 1.00 116.71 ? 307  THR A C   1 
ATOM   1983  O O   . THR A 1 306 ? 44.330  25.281  161.832 1.00 108.77 ? 307  THR A O   1 
ATOM   1984  C CB  . THR A 1 306 ? 45.227  25.195  158.790 1.00 107.43 ? 307  THR A CB  1 
ATOM   1985  O OG1 . THR A 1 306 ? 44.257  25.767  157.903 1.00 110.96 ? 307  THR A OG1 1 
ATOM   1986  C CG2 . THR A 1 306 ? 46.315  24.518  157.970 1.00 96.10  ? 307  THR A CG2 1 
ATOM   1987  N N   . SER A 1 307 ? 42.470  25.089  160.575 1.00 120.02 ? 308  SER A N   1 
ATOM   1988  C CA  . SER A 1 307 ? 41.575  25.644  161.582 1.00 116.09 ? 308  SER A CA  1 
ATOM   1989  C C   . SER A 1 307 ? 40.869  24.522  162.339 1.00 111.37 ? 308  SER A C   1 
ATOM   1990  O O   . SER A 1 307 ? 40.020  24.772  163.195 1.00 104.16 ? 308  SER A O   1 
ATOM   1991  C CB  . SER A 1 307 ? 40.549  26.576  160.935 1.00 110.64 ? 308  SER A CB  1 
ATOM   1992  O OG  . SER A 1 307 ? 41.183  27.685  160.321 1.00 102.99 ? 308  SER A OG  1 
ATOM   1993  N N   . GLY A 1 308 ? 41.224  23.283  162.009 1.00 114.71 ? 309  GLY A N   1 
ATOM   1994  C CA  . GLY A 1 308 ? 40.625  22.118  162.635 1.00 118.71 ? 309  GLY A CA  1 
ATOM   1995  C C   . GLY A 1 308 ? 40.933  22.004  164.116 1.00 123.84 ? 309  GLY A C   1 
ATOM   1996  O O   . GLY A 1 308 ? 41.923  22.558  164.594 1.00 126.08 ? 309  GLY A O   1 
ATOM   1997  N N   . VAL A 1 309 ? 40.084  21.272  164.833 1.00 118.36 ? 310  VAL A N   1 
ATOM   1998  C CA  . VAL A 1 309 ? 40.184  21.137  166.286 1.00 117.65 ? 310  VAL A CA  1 
ATOM   1999  C C   . VAL A 1 309 ? 41.551  20.643  166.755 1.00 116.01 ? 310  VAL A C   1 
ATOM   2000  O O   . VAL A 1 309 ? 42.122  21.182  167.703 1.00 126.91 ? 310  VAL A O   1 
ATOM   2001  C CB  . VAL A 1 309 ? 39.089  20.200  166.836 1.00 122.07 ? 310  VAL A CB  1 
ATOM   2002  C CG1 . VAL A 1 309 ? 39.237  20.024  168.339 1.00 125.67 ? 310  VAL A CG1 1 
ATOM   2003  C CG2 . VAL A 1 309 ? 37.712  20.741  166.494 1.00 124.42 ? 310  VAL A CG2 1 
ATOM   2004  N N   . GLU A 1 310 ? 42.070  19.620  166.082 1.00 101.04 ? 311  GLU A N   1 
ATOM   2005  C CA  . GLU A 1 310 ? 43.367  19.048  166.424 1.00 84.20  ? 311  GLU A CA  1 
ATOM   2006  C C   . GLU A 1 310 ? 44.473  20.094  166.314 1.00 78.04  ? 311  GLU A C   1 
ATOM   2007  O O   . GLU A 1 310 ? 45.221  20.333  167.268 1.00 59.61  ? 311  GLU A O   1 
ATOM   2008  C CB  . GLU A 1 310 ? 43.671  17.857  165.514 1.00 90.18  ? 311  GLU A CB  1 
ATOM   2009  C CG  . GLU A 1 310 ? 44.920  17.080  165.894 1.00 99.43  ? 311  GLU A CG  1 
ATOM   2010  C CD  . GLU A 1 310 ? 45.174  15.905  164.972 1.00 114.23 ? 311  GLU A CD  1 
ATOM   2011  O OE1 . GLU A 1 310 ? 44.639  15.911  163.843 1.00 111.62 ? 311  GLU A OE1 1 
ATOM   2012  O OE2 . GLU A 1 310 ? 45.904  14.976  165.377 1.00 127.43 ? 311  GLU A OE2 1 
ATOM   2013  N N   . SER A 1 311 ? 44.558  20.723  165.146 1.00 88.38  ? 312  SER A N   1 
ATOM   2014  C CA  . SER A 1 311 ? 45.575  21.734  164.890 1.00 96.42  ? 312  SER A CA  1 
ATOM   2015  C C   . SER A 1 311 ? 45.465  22.920  165.841 1.00 95.58  ? 312  SER A C   1 
ATOM   2016  O O   . SER A 1 311 ? 46.476  23.476  166.252 1.00 106.22 ? 312  SER A O   1 
ATOM   2017  C CB  . SER A 1 311 ? 45.512  22.216  163.439 1.00 104.83 ? 312  SER A CB  1 
ATOM   2018  O OG  . SER A 1 311 ? 46.012  21.232  162.551 1.00 107.69 ? 312  SER A OG  1 
ATOM   2019  N N   . VAL A 1 312 ? 44.240  23.298  166.198 1.00 89.37  ? 313  VAL A N   1 
ATOM   2020  C CA  . VAL A 1 312 ? 44.033  24.436  167.094 1.00 82.90  ? 313  VAL A CA  1 
ATOM   2021  C C   . VAL A 1 312 ? 44.432  24.116  168.535 1.00 79.03  ? 313  VAL A C   1 
ATOM   2022  O O   . VAL A 1 312 ? 45.142  24.891  169.175 1.00 77.56  ? 313  VAL A O   1 
ATOM   2023  C CB  . VAL A 1 312 ? 42.580  24.941  167.061 1.00 80.76  ? 313  VAL A CB  1 
ATOM   2024  C CG1 . VAL A 1 312 ? 42.373  26.004  168.117 1.00 66.21  ? 313  VAL A CG1 1 
ATOM   2025  C CG2 . VAL A 1 312 ? 42.236  25.491  165.688 1.00 86.81  ? 313  VAL A CG2 1 
ATOM   2026  N N   . ILE A 1 313 ? 43.971  22.976  169.042 1.00 84.32  ? 314  ILE A N   1 
ATOM   2027  C CA  . ILE A 1 313 ? 44.329  22.540  170.389 1.00 95.49  ? 314  ILE A CA  1 
ATOM   2028  C C   . ILE A 1 313 ? 45.839  22.311  170.493 1.00 113.75 ? 314  ILE A C   1 
ATOM   2029  O O   . ILE A 1 313 ? 46.435  22.482  171.558 1.00 126.68 ? 314  ILE A O   1 
ATOM   2030  C CB  . ILE A 1 313 ? 43.553  21.265  170.805 1.00 97.80  ? 314  ILE A CB  1 
ATOM   2031  C CG1 . ILE A 1 313 ? 42.050  21.547  170.851 1.00 95.46  ? 314  ILE A CG1 1 
ATOM   2032  C CG2 . ILE A 1 313 ? 44.010  20.759  172.168 1.00 97.70  ? 314  ILE A CG2 1 
ATOM   2033  C CD1 . ILE A 1 313 ? 41.225  20.377  171.351 1.00 83.98  ? 314  ILE A CD1 1 
ATOM   2034  N N   . GLY A 1 314 ? 46.460  21.943  169.377 1.00 114.78 ? 315  GLY A N   1 
ATOM   2035  C CA  . GLY A 1 314 ? 47.900  21.753  169.353 1.00 101.82 ? 315  GLY A CA  1 
ATOM   2036  C C   . GLY A 1 314 ? 48.693  23.041  169.207 1.00 88.90  ? 315  GLY A C   1 
ATOM   2037  O O   . GLY A 1 314 ? 49.846  23.116  169.630 1.00 89.38  ? 315  GLY A O   1 
ATOM   2038  N N   . SER A 1 315 ? 48.071  24.055  168.612 1.00 101.17 ? 316  SER A N   1 
ATOM   2039  C CA  . SER A 1 315 ? 48.748  25.310  168.273 1.00 115.85 ? 316  SER A CA  1 
ATOM   2040  C C   . SER A 1 315 ? 48.604  26.431  169.306 1.00 123.21 ? 316  SER A C   1 
ATOM   2041  O O   . SER A 1 315 ? 49.033  27.559  169.056 1.00 136.30 ? 316  SER A O   1 
ATOM   2042  C CB  . SER A 1 315 ? 48.281  25.818  166.905 1.00 106.34 ? 316  SER A CB  1 
ATOM   2043  O OG  . SER A 1 315 ? 48.753  27.130  166.654 1.00 102.93 ? 316  SER A OG  1 
ATOM   2044  N N   . VAL A 1 316 ? 47.991  26.130  170.448 1.00 114.55 ? 317  VAL A N   1 
ATOM   2045  C CA  . VAL A 1 316 ? 47.694  27.153  171.454 1.00 112.07 ? 317  VAL A CA  1 
ATOM   2046  C C   . VAL A 1 316 ? 48.931  27.931  171.914 1.00 123.90 ? 317  VAL A C   1 
ATOM   2047  O O   . VAL A 1 316 ? 48.829  29.094  172.309 1.00 135.40 ? 317  VAL A O   1 
ATOM   2048  C CB  . VAL A 1 316 ? 46.977  26.555  172.682 1.00 108.02 ? 317  VAL A CB  1 
ATOM   2049  C CG1 . VAL A 1 316 ? 46.314  27.656  173.491 1.00 105.13 ? 317  VAL A CG1 1 
ATOM   2050  C CG2 . VAL A 1 316 ? 45.939  25.539  172.247 1.00 106.20 ? 317  VAL A CG2 1 
ATOM   2051  N N   . HIS A 1 317 ? 50.098  27.295  171.850 1.00 123.56 ? 318  HIS A N   1 
ATOM   2052  C CA  . HIS A 1 317 ? 51.344  27.962  172.220 1.00 113.99 ? 318  HIS A CA  1 
ATOM   2053  C C   . HIS A 1 317 ? 51.786  29.003  171.187 1.00 98.25  ? 318  HIS A C   1 
ATOM   2054  O O   . HIS A 1 317 ? 52.466  29.971  171.527 1.00 102.16 ? 318  HIS A O   1 
ATOM   2055  C CB  . HIS A 1 317 ? 52.463  26.946  172.491 1.00 112.12 ? 318  HIS A CB  1 
ATOM   2056  C CG  . HIS A 1 317 ? 52.557  25.852  171.473 1.00 111.49 ? 318  HIS A CG  1 
ATOM   2057  N ND1 . HIS A 1 317 ? 52.581  26.094  170.116 1.00 108.88 ? 318  HIS A ND1 1 
ATOM   2058  C CD2 . HIS A 1 317 ? 52.644  24.508  171.616 1.00 114.55 ? 318  HIS A CD2 1 
ATOM   2059  C CE1 . HIS A 1 317 ? 52.672  24.947  169.467 1.00 112.27 ? 318  HIS A CE1 1 
ATOM   2060  N NE2 . HIS A 1 317 ? 52.712  23.969  170.354 1.00 115.25 ? 318  HIS A NE2 1 
ATOM   2061  N N   . THR A 1 318 ? 51.391  28.806  169.933 1.00 85.43  ? 319  THR A N   1 
ATOM   2062  C CA  . THR A 1 318 ? 51.723  29.752  168.871 1.00 84.52  ? 319  THR A CA  1 
ATOM   2063  C C   . THR A 1 318 ? 50.732  30.912  168.834 1.00 84.45  ? 319  THR A C   1 
ATOM   2064  O O   . THR A 1 318 ? 50.726  31.766  169.720 1.00 88.47  ? 319  THR A O   1 
ATOM   2065  C CB  . THR A 1 318 ? 51.749  29.076  167.485 1.00 82.49  ? 319  THR A CB  1 
ATOM   2066  O OG1 . THR A 1 318 ? 50.454  28.538  167.188 1.00 89.36  ? 319  THR A OG1 1 
ATOM   2067  C CG2 . THR A 1 318 ? 52.781  27.960  167.449 1.00 72.90  ? 319  THR A CG2 1 
ATOM   2068  N N   . GLY A 1 372 ? 47.474  9.926   162.467 1.00 68.31  ? 373  GLY A N   1 
ATOM   2069  C CA  . GLY A 1 372 ? 47.415  8.937   163.528 1.00 79.53  ? 373  GLY A CA  1 
ATOM   2070  C C   . GLY A 1 372 ? 46.579  9.392   164.708 1.00 83.70  ? 373  GLY A C   1 
ATOM   2071  O O   . GLY A 1 372 ? 46.128  10.537  164.750 1.00 95.16  ? 373  GLY A O   1 
ATOM   2072  N N   . THR A 1 373 ? 46.382  8.491   165.670 1.00 82.14  ? 374  THR A N   1 
ATOM   2073  C CA  . THR A 1 373 ? 45.613  8.787   166.880 1.00 69.80  ? 374  THR A CA  1 
ATOM   2074  C C   . THR A 1 373 ? 44.198  9.279   166.580 1.00 73.10  ? 374  THR A C   1 
ATOM   2075  O O   . THR A 1 373 ? 43.366  8.509   166.109 1.00 83.08  ? 374  THR A O   1 
ATOM   2076  C CB  . THR A 1 373 ? 46.346  9.738   167.841 1.00 63.97  ? 374  THR A CB  1 
ATOM   2077  O OG1 . THR A 1 373 ? 47.753  9.472   167.795 1.00 66.87  ? 374  THR A OG1 1 
ATOM   2078  C CG2 . THR A 1 373 ? 45.849  9.522   169.263 1.00 58.65  ? 374  THR A CG2 1 
ATOM   2079  N N   . LEU A 1 374 ? 43.932  10.550  166.878 1.00 66.31  ? 375  LEU A N   1 
ATOM   2080  C CA  . LEU A 1 374 ? 42.588  11.128  166.792 1.00 66.07  ? 375  LEU A CA  1 
ATOM   2081  C C   . LEU A 1 374 ? 41.843  10.791  165.499 1.00 72.39  ? 375  LEU A C   1 
ATOM   2082  O O   . LEU A 1 374 ? 40.625  10.620  165.510 1.00 85.93  ? 375  LEU A O   1 
ATOM   2083  C CB  . LEU A 1 374 ? 42.664  12.648  166.951 1.00 60.74  ? 375  LEU A CB  1 
ATOM   2084  C CG  . LEU A 1 374 ? 41.365  13.441  166.788 1.00 62.79  ? 375  LEU A CG  1 
ATOM   2085  C CD1 . LEU A 1 374 ? 40.383  13.105  167.900 1.00 64.47  ? 375  LEU A CD1 1 
ATOM   2086  C CD2 . LEU A 1 374 ? 41.645  14.936  166.741 1.00 67.42  ? 375  LEU A CD2 1 
ATOM   2087  N N   . GLU A 1 375 ? 42.573  10.689  164.394 1.00 57.92  ? 376  GLU A N   1 
ATOM   2088  C CA  . GLU A 1 375 ? 41.980  10.261  163.130 1.00 59.71  ? 376  GLU A CA  1 
ATOM   2089  C C   . GLU A 1 375 ? 41.442  8.834   163.255 1.00 68.47  ? 376  GLU A C   1 
ATOM   2090  O O   . GLU A 1 375 ? 40.296  8.551   162.883 1.00 86.32  ? 376  GLU A O   1 
ATOM   2091  C CB  . GLU A 1 375 ? 43.011  10.361  162.002 1.00 62.11  ? 376  GLU A CB  1 
ATOM   2092  C CG  . GLU A 1 375 ? 42.479  10.045  160.613 1.00 66.35  ? 376  GLU A CG  1 
ATOM   2093  C CD  . GLU A 1 375 ? 43.468  10.409  159.519 1.00 84.19  ? 376  GLU A CD  1 
ATOM   2094  O OE1 . GLU A 1 375 ? 44.295  11.321  159.741 1.00 87.23  ? 376  GLU A OE1 1 
ATOM   2095  O OE2 . GLU A 1 375 ? 43.425  9.783   158.439 1.00 88.96  ? 376  GLU A OE2 1 
ATOM   2096  N N   . LYS A 1 376 ? 42.269  7.946   163.801 1.00 54.02  ? 377  LYS A N   1 
ATOM   2097  C CA  . LYS A 1 376 ? 41.894  6.549   164.000 1.00 62.87  ? 377  LYS A CA  1 
ATOM   2098  C C   . LYS A 1 376 ? 40.740  6.419   164.993 1.00 69.70  ? 377  LYS A C   1 
ATOM   2099  O O   . LYS A 1 376 ? 39.805  5.645   164.773 1.00 81.32  ? 377  LYS A O   1 
ATOM   2100  C CB  . LYS A 1 376 ? 43.095  5.739   164.492 1.00 73.45  ? 377  LYS A CB  1 
ATOM   2101  C CG  . LYS A 1 376 ? 44.363  5.926   163.670 1.00 70.16  ? 377  LYS A CG  1 
ATOM   2102  C CD  . LYS A 1 376 ? 45.505  5.080   164.218 1.00 62.48  ? 377  LYS A CD  1 
ATOM   2103  C CE  . LYS A 1 376 ? 46.802  5.335   163.465 1.00 64.71  ? 377  LYS A CE  1 
ATOM   2104  N NZ  . LYS A 1 376 ? 46.670  5.074   162.005 1.00 64.86  ? 377  LYS A NZ  1 
ATOM   2105  N N   . LEU A 1 377 ? 40.819  7.176   166.087 1.00 52.72  ? 378  LEU A N   1 
ATOM   2106  C CA  . LEU A 1 377 ? 39.767  7.196   167.100 1.00 53.37  ? 378  LEU A CA  1 
ATOM   2107  C C   . LEU A 1 377 ? 38.436  7.633   166.501 1.00 61.18  ? 378  LEU A C   1 
ATOM   2108  O O   . LEU A 1 377 ? 37.394  7.042   166.785 1.00 59.97  ? 378  LEU A O   1 
ATOM   2109  C CB  . LEU A 1 377 ? 40.136  8.125   168.262 1.00 40.07  ? 378  LEU A CB  1 
ATOM   2110  C CG  . LEU A 1 377 ? 41.217  7.664   169.240 1.00 44.20  ? 378  LEU A CG  1 
ATOM   2111  C CD1 . LEU A 1 377 ? 41.211  8.541   170.485 1.00 41.44  ? 378  LEU A CD1 1 
ATOM   2112  C CD2 . LEU A 1 377 ? 41.019  6.204   169.606 1.00 52.71  ? 378  LEU A CD2 1 
ATOM   2113  N N   . VAL A 1 378 ? 38.482  8.673   165.675 1.00 57.89  ? 379  VAL A N   1 
ATOM   2114  C CA  . VAL A 1 378 ? 37.290  9.180   165.005 1.00 55.95  ? 379  VAL A CA  1 
ATOM   2115  C C   . VAL A 1 378 ? 36.720  8.149   164.032 1.00 57.59  ? 379  VAL A C   1 
ATOM   2116  O O   . VAL A 1 378 ? 35.503  7.982   163.940 1.00 46.93  ? 379  VAL A O   1 
ATOM   2117  C CB  . VAL A 1 378 ? 37.574  10.516  164.281 1.00 60.06  ? 379  VAL A CB  1 
ATOM   2118  C CG1 . VAL A 1 378 ? 36.523  10.799  163.216 1.00 71.61  ? 379  VAL A CG1 1 
ATOM   2119  C CG2 . VAL A 1 378 ? 37.639  11.652  165.290 1.00 59.99  ? 379  VAL A CG2 1 
ATOM   2120  N N   . SER A 1 379 ? 37.601  7.449   163.322 1.00 59.68  ? 380  SER A N   1 
ATOM   2121  C CA  . SER A 1 379 ? 37.168  6.405   162.394 1.00 56.87  ? 380  SER A CA  1 
ATOM   2122  C C   . SER A 1 379 ? 36.452  5.265   163.127 1.00 52.97  ? 380  SER A C   1 
ATOM   2123  O O   . SER A 1 379 ? 35.359  4.837   162.731 1.00 58.34  ? 380  SER A O   1 
ATOM   2124  C CB  . SER A 1 379 ? 38.361  5.865   161.603 1.00 52.67  ? 380  SER A CB  1 
ATOM   2125  O OG  . SER A 1 379 ? 37.933  5.062   160.515 1.00 60.05  ? 380  SER A OG  1 
ATOM   2126  N N   . GLU A 1 380 ? 37.073  4.787   164.202 1.00 47.29  ? 381  GLU A N   1 
ATOM   2127  C CA  . GLU A 1 380 ? 36.495  3.728   165.025 1.00 51.69  ? 381  GLU A CA  1 
ATOM   2128  C C   . GLU A 1 380 ? 35.161  4.164   165.628 1.00 64.65  ? 381  GLU A C   1 
ATOM   2129  O O   . GLU A 1 380 ? 34.200  3.389   165.679 1.00 68.16  ? 381  GLU A O   1 
ATOM   2130  C CB  . GLU A 1 380 ? 37.469  3.332   166.138 1.00 51.72  ? 381  GLU A CB  1 
ATOM   2131  C CG  . GLU A 1 380 ? 36.946  2.262   167.085 1.00 68.43  ? 381  GLU A CG  1 
ATOM   2132  C CD  . GLU A 1 380 ? 36.949  0.875   166.467 1.00 79.75  ? 381  GLU A CD  1 
ATOM   2133  O OE1 . GLU A 1 380 ? 37.551  0.702   165.386 1.00 87.98  ? 381  GLU A OE1 1 
ATOM   2134  O OE2 . GLU A 1 380 ? 36.351  -0.044  167.065 1.00 75.35  ? 381  GLU A OE2 1 
ATOM   2135  N N   . ALA A 1 381 ? 35.113  5.414   166.080 1.00 55.05  ? 382  ALA A N   1 
ATOM   2136  C CA  . ALA A 1 381 ? 33.899  5.987   166.646 1.00 49.53  ? 382  ALA A CA  1 
ATOM   2137  C C   . ALA A 1 381 ? 32.779  6.001   165.614 1.00 50.36  ? 382  ALA A C   1 
ATOM   2138  O O   . ALA A 1 381 ? 31.645  5.629   165.915 1.00 47.24  ? 382  ALA A O   1 
ATOM   2139  C CB  . ALA A 1 381 ? 34.166  7.392   167.166 1.00 37.01  ? 382  ALA A CB  1 
ATOM   2140  N N   . LYS A 1 382 ? 33.106  6.431   164.398 1.00 43.99  ? 383  LYS A N   1 
ATOM   2141  C CA  . LYS A 1 382 ? 32.153  6.423   163.295 1.00 47.16  ? 383  LYS A CA  1 
ATOM   2142  C C   . LYS A 1 382 ? 31.626  5.015   163.057 1.00 58.67  ? 383  LYS A C   1 
ATOM   2143  O O   . LYS A 1 382 ? 30.425  4.816   162.862 1.00 64.49  ? 383  LYS A O   1 
ATOM   2144  C CB  . LYS A 1 382 ? 32.796  6.957   162.013 1.00 44.44  ? 383  LYS A CB  1 
ATOM   2145  C CG  . LYS A 1 382 ? 32.961  8.467   161.963 1.00 47.98  ? 383  LYS A CG  1 
ATOM   2146  C CD  . LYS A 1 382 ? 33.352  8.915   160.564 1.00 53.36  ? 383  LYS A CD  1 
ATOM   2147  C CE  . LYS A 1 382 ? 33.373  10.429  160.441 1.00 59.67  ? 383  LYS A CE  1 
ATOM   2148  N NZ  . LYS A 1 382 ? 33.542  10.859  159.025 1.00 61.40  ? 383  LYS A NZ  1 
ATOM   2149  N N   . ALA A 1 383 ? 32.534  4.042   163.077 1.00 55.35  ? 384  ALA A N   1 
ATOM   2150  C CA  . ALA A 1 383 ? 32.151  2.644   162.906 1.00 47.36  ? 384  ALA A CA  1 
ATOM   2151  C C   . ALA A 1 383 ? 31.137  2.203   163.962 1.00 47.07  ? 384  ALA A C   1 
ATOM   2152  O O   . ALA A 1 383 ? 30.081  1.658   163.633 1.00 37.07  ? 384  ALA A O   1 
ATOM   2153  C CB  . ALA A 1 383 ? 33.379  1.750   162.942 1.00 40.95  ? 384  ALA A CB  1 
ATOM   2154  N N   . GLN A 1 384 ? 31.462  2.452   165.228 1.00 44.91  ? 385  GLN A N   1 
ATOM   2155  C CA  . GLN A 1 384 ? 30.595  2.064   166.339 1.00 41.56  ? 385  GLN A CA  1 
ATOM   2156  C C   . GLN A 1 384 ? 29.224  2.729   166.267 1.00 57.72  ? 385  GLN A C   1 
ATOM   2157  O O   . GLN A 1 384 ? 28.192  2.075   166.445 1.00 55.98  ? 385  GLN A O   1 
ATOM   2158  C CB  . GLN A 1 384 ? 31.260  2.399   167.674 1.00 38.16  ? 385  GLN A CB  1 
ATOM   2159  C CG  . GLN A 1 384 ? 32.565  1.666   167.917 1.00 49.25  ? 385  GLN A CG  1 
ATOM   2160  C CD  . GLN A 1 384 ? 32.361  0.181   168.128 1.00 55.79  ? 385  GLN A CD  1 
ATOM   2161  O OE1 . GLN A 1 384 ? 31.352  -0.242  168.690 1.00 64.19  ? 385  GLN A OE1 1 
ATOM   2162  N NE2 . GLN A 1 384 ? 33.317  -0.620  167.670 1.00 58.20  ? 385  GLN A NE2 1 
ATOM   2163  N N   . LEU A 1 385 ? 29.218  4.034   166.011 1.00 53.88  ? 386  LEU A N   1 
ATOM   2164  C CA  . LEU A 1 385 ? 27.972  4.787   165.951 1.00 43.44  ? 386  LEU A CA  1 
ATOM   2165  C C   . LEU A 1 385 ? 27.097  4.336   164.784 1.00 48.87  ? 386  LEU A C   1 
ATOM   2166  O O   . LEU A 1 385 ? 25.885  4.190   164.937 1.00 60.65  ? 386  LEU A O   1 
ATOM   2167  C CB  . LEU A 1 385 ? 28.243  6.293   165.889 1.00 32.63  ? 386  LEU A CB  1 
ATOM   2168  C CG  . LEU A 1 385 ? 28.950  6.882   167.115 1.00 27.45  ? 386  LEU A CG  1 
ATOM   2169  C CD1 . LEU A 1 385 ? 29.089  8.392   166.994 1.00 24.50  ? 386  LEU A CD1 1 
ATOM   2170  C CD2 . LEU A 1 385 ? 28.230  6.504   168.405 1.00 19.17  ? 386  LEU A CD2 1 
ATOM   2171  N N   . ARG A 1 386 ? 27.708  4.103   163.624 1.00 37.94  ? 387  ARG A N   1 
ATOM   2172  C CA  . ARG A 1 386 ? 26.962  3.579   162.480 1.00 43.99  ? 387  ARG A CA  1 
ATOM   2173  C C   . ARG A 1 386 ? 26.497  2.148   162.729 1.00 54.49  ? 387  ARG A C   1 
ATOM   2174  O O   . ARG A 1 386 ? 25.552  1.673   162.098 1.00 47.27  ? 387  ARG A O   1 
ATOM   2175  C CB  . ARG A 1 386 ? 27.788  3.644   161.194 1.00 29.05  ? 387  ARG A CB  1 
ATOM   2176  C CG  . ARG A 1 386 ? 27.842  5.017   160.549 1.00 56.22  ? 387  ARG A CG  1 
ATOM   2177  C CD  . ARG A 1 386 ? 28.245  4.909   159.087 1.00 81.55  ? 387  ARG A CD  1 
ATOM   2178  N NE  . ARG A 1 386 ? 29.352  3.977   158.897 1.00 84.85  ? 387  ARG A NE  1 
ATOM   2179  C CZ  . ARG A 1 386 ? 30.635  4.305   159.015 1.00 71.57  ? 387  ARG A CZ  1 
ATOM   2180  N NH1 . ARG A 1 386 ? 30.977  5.548   159.324 1.00 74.45  ? 387  ARG A NH1 1 
ATOM   2181  N NH2 . ARG A 1 386 ? 31.575  3.390   158.825 1.00 60.72  ? 387  ARG A NH2 1 
ATOM   2182  N N   . ASP A 1 387 ? 27.167  1.461   163.647 1.00 51.67  ? 388  ASP A N   1 
ATOM   2183  C CA  . ASP A 1 387 ? 26.757  0.117   164.028 1.00 46.47  ? 388  ASP A CA  1 
ATOM   2184  C C   . ASP A 1 387 ? 25.505  0.167   164.902 1.00 42.33  ? 388  ASP A C   1 
ATOM   2185  O O   . ASP A 1 387 ? 24.558  -0.591  164.688 1.00 53.08  ? 388  ASP A O   1 
ATOM   2186  C CB  . ASP A 1 387 ? 27.889  -0.597  164.768 1.00 54.85  ? 388  ASP A CB  1 
ATOM   2187  C CG  . ASP A 1 387 ? 27.553  -2.036  165.105 1.00 59.18  ? 388  ASP A CG  1 
ATOM   2188  O OD1 . ASP A 1 387 ? 27.021  -2.746  164.226 1.00 50.41  ? 388  ASP A OD1 1 
ATOM   2189  O OD2 . ASP A 1 387 ? 27.819  -2.458  166.251 1.00 64.32  ? 388  ASP A OD2 1 
ATOM   2190  N N   . VAL A 1 388 ? 25.500  1.071   165.878 1.00 36.96  ? 389  VAL A N   1 
ATOM   2191  C CA  . VAL A 1 388 ? 24.398  1.159   166.838 1.00 32.52  ? 389  VAL A CA  1 
ATOM   2192  C C   . VAL A 1 388 ? 23.298  2.164   166.481 1.00 39.02  ? 389  VAL A C   1 
ATOM   2193  O O   . VAL A 1 388 ? 22.401  2.413   167.286 1.00 31.16  ? 389  VAL A O   1 
ATOM   2194  C CB  . VAL A 1 388 ? 24.900  1.440   168.266 1.00 26.88  ? 389  VAL A CB  1 
ATOM   2195  C CG1 . VAL A 1 388 ? 25.870  0.357   168.697 1.00 28.83  ? 389  VAL A CG1 1 
ATOM   2196  C CG2 . VAL A 1 388 ? 25.549  2.816   168.345 1.00 36.33  ? 389  VAL A CG2 1 
ATOM   2197  N N   . GLN A 1 389 ? 23.377  2.760   165.296 1.00 36.13  ? 390  GLN A N   1 
ATOM   2198  C CA  . GLN A 1 389 ? 22.322  3.663   164.842 1.00 31.40  ? 390  GLN A CA  1 
ATOM   2199  C C   . GLN A 1 389 ? 20.979  2.943   164.744 1.00 41.18  ? 390  GLN A C   1 
ATOM   2200  O O   . GLN A 1 389 ? 19.924  3.563   164.866 1.00 48.10  ? 390  GLN A O   1 
ATOM   2201  C CB  . GLN A 1 389 ? 22.676  4.280   163.488 1.00 34.53  ? 390  GLN A CB  1 
ATOM   2202  C CG  . GLN A 1 389 ? 22.858  3.259   162.380 1.00 37.58  ? 390  GLN A CG  1 
ATOM   2203  C CD  . GLN A 1 389 ? 22.844  3.880   160.999 1.00 47.78  ? 390  GLN A CD  1 
ATOM   2204  O OE1 . GLN A 1 389 ? 21.833  4.428   160.562 1.00 63.63  ? 390  GLN A OE1 1 
ATOM   2205  N NE2 . GLN A 1 389 ? 23.970  3.793   160.300 1.00 42.65  ? 390  GLN A NE2 1 
ATOM   2206  N N   . ASP A 1 390 ? 21.027  1.632   164.526 1.00 50.76  ? 391  ASP A N   1 
ATOM   2207  C CA  . ASP A 1 390 ? 19.821  0.828   164.351 1.00 46.52  ? 391  ASP A CA  1 
ATOM   2208  C C   . ASP A 1 390 ? 19.234  0.353   165.680 1.00 43.94  ? 391  ASP A C   1 
ATOM   2209  O O   . ASP A 1 390 ? 18.171  -0.270  165.708 1.00 54.25  ? 391  ASP A O   1 
ATOM   2210  C CB  . ASP A 1 390 ? 20.107  -0.376  163.434 1.00 42.13  ? 391  ASP A CB  1 
ATOM   2211  C CG  . ASP A 1 390 ? 21.340  -1.180  163.867 1.00 72.80  ? 391  ASP A CG  1 
ATOM   2212  O OD1 . ASP A 1 390 ? 21.513  -1.423  165.080 1.00 82.15  ? 391  ASP A OD1 1 
ATOM   2213  O OD2 . ASP A 1 390 ? 22.144  -1.574  162.991 1.00 64.92  ? 391  ASP A OD2 1 
ATOM   2214  N N   . PHE A 1 391 ? 19.918  0.685   166.773 1.00 32.76  ? 392  PHE A N   1 
ATOM   2215  C CA  . PHE A 1 391 ? 19.710  0.038   168.071 1.00 40.58  ? 392  PHE A CA  1 
ATOM   2216  C C   . PHE A 1 391 ? 18.266  -0.073  168.558 1.00 40.36  ? 392  PHE A C   1 
ATOM   2217  O O   . PHE A 1 391 ? 17.805  -1.162  168.902 1.00 58.27  ? 392  PHE A O   1 
ATOM   2218  C CB  . PHE A 1 391 ? 20.550  0.724   169.152 1.00 24.57  ? 392  PHE A CB  1 
ATOM   2219  C CG  . PHE A 1 391 ? 20.452  0.066   170.496 1.00 26.22  ? 392  PHE A CG  1 
ATOM   2220  C CD1 . PHE A 1 391 ? 21.166  -1.089  170.768 1.00 23.30  ? 392  PHE A CD1 1 
ATOM   2221  C CD2 . PHE A 1 391 ? 19.641  0.598   171.484 1.00 27.49  ? 392  PHE A CD2 1 
ATOM   2222  C CE1 . PHE A 1 391 ? 21.075  -1.701  172.001 1.00 30.75  ? 392  PHE A CE1 1 
ATOM   2223  C CE2 . PHE A 1 391 ? 19.544  -0.009  172.719 1.00 23.92  ? 392  PHE A CE2 1 
ATOM   2224  C CZ  . PHE A 1 391 ? 20.264  -1.160  172.979 1.00 35.86  ? 392  PHE A CZ  1 
ATOM   2225  N N   . TRP A 1 392 ? 17.559  1.049   168.597 1.00 36.29  ? 393  TRP A N   1 
ATOM   2226  C CA  . TRP A 1 392 ? 16.235  1.080   169.214 1.00 54.72  ? 393  TRP A CA  1 
ATOM   2227  C C   . TRP A 1 392 ? 15.171  0.242   168.500 1.00 51.38  ? 393  TRP A C   1 
ATOM   2228  O O   . TRP A 1 392 ? 14.284  -0.316  169.145 1.00 55.22  ? 393  TRP A O   1 
ATOM   2229  C CB  . TRP A 1 392 ? 15.767  2.522   169.411 1.00 51.81  ? 393  TRP A CB  1 
ATOM   2230  C CG  . TRP A 1 392 ? 16.630  3.264   170.379 1.00 35.07  ? 393  TRP A CG  1 
ATOM   2231  C CD1 . TRP A 1 392 ? 17.414  4.348   170.118 1.00 39.63  ? 393  TRP A CD1 1 
ATOM   2232  C CD2 . TRP A 1 392 ? 16.817  2.954   171.765 1.00 34.84  ? 393  TRP A CD2 1 
ATOM   2233  N NE1 . TRP A 1 392 ? 18.069  4.742   171.261 1.00 40.28  ? 393  TRP A NE1 1 
ATOM   2234  C CE2 . TRP A 1 392 ? 17.721  3.904   172.283 1.00 39.03  ? 393  TRP A CE2 1 
ATOM   2235  C CE3 . TRP A 1 392 ? 16.305  1.973   172.617 1.00 41.18  ? 393  TRP A CE3 1 
ATOM   2236  C CZ2 . TRP A 1 392 ? 18.121  3.896   173.620 1.00 46.26  ? 393  TRP A CZ2 1 
ATOM   2237  C CZ3 . TRP A 1 392 ? 16.703  1.968   173.941 1.00 46.63  ? 393  TRP A CZ3 1 
ATOM   2238  C CH2 . TRP A 1 392 ? 17.603  2.923   174.430 1.00 49.52  ? 393  TRP A CH2 1 
ATOM   2239  N N   . ILE A 1 393 ? 15.248  0.165   167.176 1.00 44.02  ? 394  ILE A N   1 
ATOM   2240  C CA  . ILE A 1 393 ? 14.329  -0.680  166.422 1.00 45.09  ? 394  ILE A CA  1 
ATOM   2241  C C   . ILE A 1 393 ? 14.880  -2.080  166.145 1.00 47.85  ? 394  ILE A C   1 
ATOM   2242  O O   . ILE A 1 393 ? 14.143  -2.959  165.700 1.00 44.26  ? 394  ILE A O   1 
ATOM   2243  C CB  . ILE A 1 393 ? 13.948  -0.041  165.078 1.00 38.28  ? 394  ILE A CB  1 
ATOM   2244  C CG1 . ILE A 1 393 ? 15.142  -0.069  164.122 1.00 29.35  ? 394  ILE A CG1 1 
ATOM   2245  C CG2 . ILE A 1 393 ? 13.440  1.375   165.287 1.00 33.23  ? 394  ILE A CG2 1 
ATOM   2246  C CD1 . ILE A 1 393 ? 14.828  0.456   162.750 1.00 35.22  ? 394  ILE A CD1 1 
ATOM   2247  N N   . SER A 1 394 ? 16.168  -2.288  166.409 1.00 53.73  ? 395  SER A N   1 
ATOM   2248  C CA  . SER A 1 394 ? 16.817  -3.560  166.079 1.00 52.84  ? 395  SER A CA  1 
ATOM   2249  C C   . SER A 1 394 ? 16.558  -4.667  167.098 1.00 43.29  ? 395  SER A C   1 
ATOM   2250  O O   . SER A 1 394 ? 16.624  -5.849  166.765 1.00 35.07  ? 395  SER A O   1 
ATOM   2251  C CB  . SER A 1 394 ? 18.325  -3.374  165.903 1.00 47.96  ? 395  SER A CB  1 
ATOM   2252  O OG  . SER A 1 394 ? 18.947  -3.099  167.145 1.00 50.20  ? 395  SER A OG  1 
ATOM   2253  N N   . LEU A 1 395 ? 16.283  -4.276  168.339 1.00 48.68  ? 396  LEU A N   1 
ATOM   2254  C CA  . LEU A 1 395 ? 16.084  -5.229  169.433 1.00 55.10  ? 396  LEU A CA  1 
ATOM   2255  C C   . LEU A 1 395 ? 15.108  -6.385  169.156 1.00 64.76  ? 396  LEU A C   1 
ATOM   2256  O O   . LEU A 1 395 ? 15.440  -7.536  169.438 1.00 60.96  ? 396  LEU A O   1 
ATOM   2257  C CB  . LEU A 1 395 ? 15.718  -4.501  170.733 1.00 62.44  ? 396  LEU A CB  1 
ATOM   2258  C CG  . LEU A 1 395 ? 16.867  -3.755  171.413 1.00 66.40  ? 396  LEU A CG  1 
ATOM   2259  C CD1 . LEU A 1 395 ? 16.344  -2.816  172.488 1.00 66.54  ? 396  LEU A CD1 1 
ATOM   2260  C CD2 . LEU A 1 395 ? 17.857  -4.746  172.002 1.00 64.49  ? 396  LEU A CD2 1 
ATOM   2261  N N   . PRO A 1 396 ? 13.908  -6.091  168.610 1.00 74.61  ? 397  PRO A N   1 
ATOM   2262  C CA  . PRO A 1 396 ? 12.999  -7.210  168.330 1.00 71.04  ? 397  PRO A CA  1 
ATOM   2263  C C   . PRO A 1 396 ? 13.587  -8.225  167.351 1.00 69.11  ? 397  PRO A C   1 
ATOM   2264  O O   . PRO A 1 396 ? 13.470  -9.429  167.578 1.00 72.03  ? 397  PRO A O   1 
ATOM   2265  C CB  . PRO A 1 396 ? 11.781  -6.520  167.706 1.00 67.24  ? 397  PRO A CB  1 
ATOM   2266  C CG  . PRO A 1 396 ? 11.810  -5.146  168.255 1.00 72.98  ? 397  PRO A CG  1 
ATOM   2267  C CD  . PRO A 1 396 ? 13.264  -4.793  168.336 1.00 78.73  ? 397  PRO A CD  1 
ATOM   2268  N N   . GLY A 1 397 ? 14.217  -7.745  166.284 1.00 53.32  ? 398  GLY A N   1 
ATOM   2269  C CA  . GLY A 1 397 ? 14.810  -8.630  165.297 1.00 56.24  ? 398  GLY A CA  1 
ATOM   2270  C C   . GLY A 1 397 ? 16.006  -9.392  165.838 1.00 65.54  ? 398  GLY A C   1 
ATOM   2271  O O   . GLY A 1 397 ? 16.247  -10.539 165.463 1.00 70.10  ? 398  GLY A O   1 
ATOM   2272  N N   . THR A 1 398 ? 16.754  -8.749  166.727 1.00 63.09  ? 399  THR A N   1 
ATOM   2273  C CA  . THR A 1 398 ? 17.956  -9.343  167.300 1.00 52.46  ? 399  THR A CA  1 
ATOM   2274  C C   . THR A 1 398 ? 17.633  -10.451 168.301 1.00 54.42  ? 399  THR A C   1 
ATOM   2275  O O   . THR A 1 398 ? 18.176  -11.553 168.215 1.00 62.87  ? 399  THR A O   1 
ATOM   2276  C CB  . THR A 1 398 ? 18.833  -8.274  167.984 1.00 48.38  ? 399  THR A CB  1 
ATOM   2277  O OG1 . THR A 1 398 ? 19.280  -7.323  167.008 1.00 51.57  ? 399  THR A OG1 1 
ATOM   2278  C CG2 . THR A 1 398 ? 20.042  -8.912  168.650 1.00 23.50  ? 399  THR A CG2 1 
ATOM   2279  N N   . LEU A 1 399 ? 16.746  -10.152 169.246 1.00 56.29  ? 400  LEU A N   1 
ATOM   2280  C CA  . LEU A 1 399 ? 16.388  -11.107 170.292 1.00 55.15  ? 400  LEU A CA  1 
ATOM   2281  C C   . LEU A 1 399 ? 15.645  -12.323 169.740 1.00 53.40  ? 400  LEU A C   1 
ATOM   2282  O O   . LEU A 1 399 ? 15.716  -13.411 170.309 1.00 60.94  ? 400  LEU A O   1 
ATOM   2283  C CB  . LEU A 1 399 ? 15.555  -10.429 171.382 1.00 51.26  ? 400  LEU A CB  1 
ATOM   2284  C CG  . LEU A 1 399 ? 16.225  -9.275  172.132 1.00 64.51  ? 400  LEU A CG  1 
ATOM   2285  C CD1 . LEU A 1 399 ? 15.288  -8.702  173.184 1.00 73.98  ? 400  LEU A CD1 1 
ATOM   2286  C CD2 . LEU A 1 399 ? 17.532  -9.727  172.763 1.00 63.49  ? 400  LEU A CD2 1 
ATOM   2287  N N   . CYS A 1 400 ? 14.937  -12.137 168.632 1.00 52.94  ? 401  CYS A N   1 
ATOM   2288  C CA  . CYS A 1 400 ? 14.207  -13.237 168.009 1.00 78.19  ? 401  CYS A CA  1 
ATOM   2289  C C   . CYS A 1 400 ? 15.128  -14.152 167.208 1.00 86.61  ? 401  CYS A C   1 
ATOM   2290  O O   . CYS A 1 400 ? 14.908  -15.361 167.141 1.00 96.49  ? 401  CYS A O   1 
ATOM   2291  C CB  . CYS A 1 400 ? 13.082  -12.707 167.117 1.00 87.51  ? 401  CYS A CB  1 
ATOM   2292  S SG  . CYS A 1 400 ? 11.675  -12.024 168.022 1.00 99.95  ? 401  CYS A SG  1 
ATOM   2293  N N   . SER A 1 401 ? 16.158  -13.570 166.602 1.00 89.08  ? 402  SER A N   1 
ATOM   2294  C CA  . SER A 1 401 ? 17.061  -14.322 165.735 1.00 95.13  ? 402  SER A CA  1 
ATOM   2295  C C   . SER A 1 401 ? 18.131  -15.102 166.495 1.00 102.47 ? 402  SER A C   1 
ATOM   2296  O O   . SER A 1 401 ? 18.734  -16.026 165.948 1.00 101.30 ? 402  SER A O   1 
ATOM   2297  C CB  . SER A 1 401 ? 17.720  -13.391 164.713 1.00 83.82  ? 402  SER A CB  1 
ATOM   2298  O OG  . SER A 1 401 ? 17.347  -13.740 163.392 1.00 70.07  ? 402  SER A OG  1 
ATOM   2299  N N   . GLU A 1 402 ? 18.371  -14.734 167.750 1.00 108.88 ? 403  GLU A N   1 
ATOM   2300  C CA  . GLU A 1 402 ? 19.448  -15.352 168.517 1.00 119.41 ? 403  GLU A CA  1 
ATOM   2301  C C   . GLU A 1 402 ? 18.987  -16.065 169.789 1.00 126.91 ? 403  GLU A C   1 
ATOM   2302  O O   . GLU A 1 402 ? 18.946  -17.294 169.838 1.00 130.19 ? 403  GLU A O   1 
ATOM   2303  C CB  . GLU A 1 402 ? 20.525  -14.315 168.854 1.00 122.05 ? 403  GLU A CB  1 
ATOM   2304  C CG  . GLU A 1 402 ? 21.274  -13.789 167.638 1.00 121.48 ? 403  GLU A CG  1 
ATOM   2305  C CD  . GLU A 1 402 ? 22.298  -12.726 167.991 1.00 111.93 ? 403  GLU A CD  1 
ATOM   2306  O OE1 . GLU A 1 402 ? 22.240  -12.190 169.118 1.00 110.33 ? 403  GLU A OE1 1 
ATOM   2307  O OE2 . GLU A 1 402 ? 23.163  -12.426 167.140 1.00 101.05 ? 403  GLU A OE2 1 
ATOM   2308  N N   . LYS A 1 403 ? 18.637  -15.290 170.811 1.00 128.21 ? 404  LYS A N   1 
ATOM   2309  C CA  . LYS A 1 403 ? 18.356  -15.846 172.133 1.00 133.82 ? 404  LYS A CA  1 
ATOM   2310  C C   . LYS A 1 403 ? 17.004  -16.551 172.243 1.00 138.00 ? 404  LYS A C   1 
ATOM   2311  O O   . LYS A 1 403 ? 16.735  -17.238 173.230 1.00 137.32 ? 404  LYS A O   1 
ATOM   2312  C CB  . LYS A 1 403 ? 18.482  -14.766 173.212 1.00 128.85 ? 404  LYS A CB  1 
ATOM   2313  C CG  . LYS A 1 403 ? 19.905  -14.275 173.430 1.00 129.36 ? 404  LYS A CG  1 
ATOM   2314  C CD  . LYS A 1 403 ? 19.985  -13.307 174.600 1.00 130.04 ? 404  LYS A CD  1 
ATOM   2315  C CE  . LYS A 1 403 ? 21.419  -12.868 174.858 1.00 126.10 ? 404  LYS A CE  1 
ATOM   2316  N NZ  . LYS A 1 403 ? 21.519  -11.935 176.016 1.00 120.29 ? 404  LYS A NZ  1 
ATOM   2317  N N   . MET A 1 404 ? 16.157  -16.382 171.234 1.00 140.43 ? 405  MET A N   1 
ATOM   2318  C CA  . MET A 1 404 ? 14.847  -17.026 171.228 1.00 142.58 ? 405  MET A CA  1 
ATOM   2319  C C   . MET A 1 404 ? 14.603  -17.772 169.920 1.00 139.49 ? 405  MET A C   1 
ATOM   2320  O O   . MET A 1 404 ? 15.403  -18.618 169.519 1.00 136.98 ? 405  MET A O   1 
ATOM   2321  C CB  . MET A 1 404 ? 13.738  -15.999 171.472 1.00 144.33 ? 405  MET A CB  1 
ATOM   2322  C CG  . MET A 1 404 ? 13.802  -15.328 172.837 1.00 144.37 ? 405  MET A CG  1 
ATOM   2323  S SD  . MET A 1 404 ? 12.483  -14.125 173.096 1.00 96.76  ? 405  MET A SD  1 
ATOM   2324  C CE  . MET A 1 404 ? 12.845  -13.578 174.763 1.00 53.72  ? 405  MET A CE  1 
ATOM   2325  N N   . ARG A 1 413 ? 5.382   -25.850 160.926 1.00 92.20  ? 414  ARG A N   1 
ATOM   2326  C CA  . ARG A 1 413 ? 6.814   -25.913 161.196 1.00 96.23  ? 414  ARG A CA  1 
ATOM   2327  C C   . ARG A 1 413 ? 7.178   -25.172 162.479 1.00 81.84  ? 414  ARG A C   1 
ATOM   2328  O O   . ARG A 1 413 ? 8.061   -25.600 163.220 1.00 77.51  ? 414  ARG A O   1 
ATOM   2329  C CB  . ARG A 1 413 ? 7.610   -25.333 160.026 1.00 107.21 ? 414  ARG A CB  1 
ATOM   2330  C CG  . ARG A 1 413 ? 7.422   -26.068 158.711 1.00 119.72 ? 414  ARG A CG  1 
ATOM   2331  C CD  . ARG A 1 413 ? 8.198   -25.384 157.599 1.00 128.97 ? 414  ARG A CD  1 
ATOM   2332  N NE  . ARG A 1 413 ? 8.056   -26.069 156.319 1.00 138.68 ? 414  ARG A NE  1 
ATOM   2333  C CZ  . ARG A 1 413 ? 8.596   -25.642 155.182 1.00 142.42 ? 414  ARG A CZ  1 
ATOM   2334  N NH1 . ARG A 1 413 ? 9.314   -24.527 155.165 1.00 141.51 ? 414  ARG A NH1 1 
ATOM   2335  N NH2 . ARG A 1 413 ? 8.416   -26.327 154.062 1.00 141.32 ? 414  ARG A NH2 1 
ATOM   2336  N N   . CYS A 1 414 ? 6.491   -24.064 162.737 1.00 74.38  ? 415  CYS A N   1 
ATOM   2337  C CA  . CYS A 1 414 ? 6.805   -23.213 163.880 1.00 64.72  ? 415  CYS A CA  1 
ATOM   2338  C C   . CYS A 1 414 ? 5.578   -22.958 164.749 1.00 64.45  ? 415  CYS A C   1 
ATOM   2339  O O   . CYS A 1 414 ? 4.453   -23.213 164.337 1.00 68.01  ? 415  CYS A O   1 
ATOM   2340  C CB  . CYS A 1 414 ? 7.414   -21.886 163.415 1.00 43.42  ? 415  CYS A CB  1 
ATOM   2341  S SG  . CYS A 1 414 ? 6.362   -20.904 162.327 1.00 137.98 ? 415  CYS A SG  1 
ATOM   2342  N N   . TRP A 1 415 ? 5.809   -22.453 165.955 1.00 62.15  ? 416  TRP A N   1 
ATOM   2343  C CA  . TRP A 1 415 ? 4.736   -22.190 166.909 1.00 55.15  ? 416  TRP A CA  1 
ATOM   2344  C C   . TRP A 1 415 ? 4.206   -20.763 166.771 1.00 57.31  ? 416  TRP A C   1 
ATOM   2345  O O   . TRP A 1 415 ? 4.930   -19.802 167.024 1.00 61.93  ? 416  TRP A O   1 
ATOM   2346  C CB  . TRP A 1 415 ? 5.236   -22.449 168.335 1.00 59.96  ? 416  TRP A CB  1 
ATOM   2347  C CG  . TRP A 1 415 ? 4.397   -21.832 169.411 1.00 66.40  ? 416  TRP A CG  1 
ATOM   2348  C CD1 . TRP A 1 415 ? 4.621   -20.643 170.045 1.00 68.06  ? 416  TRP A CD1 1 
ATOM   2349  C CD2 . TRP A 1 415 ? 3.206   -22.378 169.992 1.00 69.06  ? 416  TRP A CD2 1 
ATOM   2350  N NE1 . TRP A 1 415 ? 3.641   -20.413 170.980 1.00 68.71  ? 416  TRP A NE1 1 
ATOM   2351  C CE2 . TRP A 1 415 ? 2.763   -21.462 170.968 1.00 64.75  ? 416  TRP A CE2 1 
ATOM   2352  C CE3 . TRP A 1 415 ? 2.474   -23.549 169.782 1.00 74.75  ? 416  TRP A CE3 1 
ATOM   2353  C CZ2 . TRP A 1 415 ? 1.618   -21.683 171.729 1.00 62.73  ? 416  TRP A CZ2 1 
ATOM   2354  C CZ3 . TRP A 1 415 ? 1.338   -23.764 170.539 1.00 65.17  ? 416  TRP A CZ3 1 
ATOM   2355  C CH2 . TRP A 1 415 ? 0.922   -22.835 171.500 1.00 62.04  ? 416  TRP A CH2 1 
ATOM   2356  N N   . ASN A 1 416 ? 2.945   -20.634 166.363 1.00 59.77  ? 417  ASN A N   1 
ATOM   2357  C CA  . ASN A 1 416 ? 2.331   -19.324 166.132 1.00 54.55  ? 417  ASN A CA  1 
ATOM   2358  C C   . ASN A 1 416 ? 1.503   -18.772 167.295 1.00 62.65  ? 417  ASN A C   1 
ATOM   2359  O O   . ASN A 1 416 ? 0.866   -17.728 167.165 1.00 69.92  ? 417  ASN A O   1 
ATOM   2360  C CB  . ASN A 1 416 ? 1.496   -19.333 164.847 1.00 52.03  ? 417  ASN A CB  1 
ATOM   2361  C CG  . ASN A 1 416 ? 0.415   -20.396 164.859 1.00 59.17  ? 417  ASN A CG  1 
ATOM   2362  O OD1 . ASN A 1 416 ? -0.138  -20.730 165.907 1.00 48.98  ? 417  ASN A OD1 1 
ATOM   2363  N ND2 . ASN A 1 416 ? 0.110   -20.936 163.687 1.00 62.94  ? 417  ASN A ND2 1 
ATOM   2364  N N   . GLY A 1 417 ? 1.491   -19.484 168.417 1.00 62.51  ? 418  GLY A N   1 
ATOM   2365  C CA  . GLY A 1 417 ? 0.755   -19.044 169.590 1.00 59.69  ? 418  GLY A CA  1 
ATOM   2366  C C   . GLY A 1 417 ? -0.546  -19.789 169.835 1.00 65.31  ? 418  GLY A C   1 
ATOM   2367  O O   . GLY A 1 417 ? -1.049  -19.811 170.958 1.00 69.90  ? 418  GLY A O   1 
ATOM   2368  N N   . MET A 1 418 ? -1.091  -20.400 168.788 1.00 61.50  ? 419  MET A N   1 
ATOM   2369  C CA  . MET A 1 418 ? -2.262  -21.262 168.924 1.00 72.33  ? 419  MET A CA  1 
ATOM   2370  C C   . MET A 1 418 ? -1.834  -22.725 168.894 1.00 77.60  ? 419  MET A C   1 
ATOM   2371  O O   . MET A 1 418 ? -2.024  -23.464 169.860 1.00 74.68  ? 419  MET A O   1 
ATOM   2372  C CB  . MET A 1 418 ? -3.290  -20.976 167.827 1.00 80.33  ? 419  MET A CB  1 
ATOM   2373  C CG  . MET A 1 418 ? -4.130  -19.729 168.072 1.00 81.05  ? 419  MET A CG  1 
ATOM   2374  S SD  . MET A 1 418 ? -5.509  -19.569 166.919 1.00 229.35 ? 419  MET A SD  1 
ATOM   2375  C CE  . MET A 1 418 ? -4.642  -19.319 165.371 1.00 50.16  ? 419  MET A CE  1 
ATOM   2376  N N   . ALA A 1 419 ? -1.263  -23.132 167.766 1.00 81.86  ? 420  ALA A N   1 
ATOM   2377  C CA  . ALA A 1 419 ? -0.692  -24.462 167.609 1.00 78.15  ? 420  ALA A CA  1 
ATOM   2378  C C   . ALA A 1 419 ? 0.518   -24.359 166.689 1.00 78.96  ? 420  ALA A C   1 
ATOM   2379  O O   . ALA A 1 419 ? 0.980   -23.258 166.388 1.00 83.16  ? 420  ALA A O   1 
ATOM   2380  C CB  . ALA A 1 419 ? -1.718  -25.414 167.032 1.00 72.41  ? 420  ALA A CB  1 
ATOM   2381  N N   . ARG A 1 420 ? 1.045   -25.499 166.254 1.00 73.36  ? 421  ARG A N   1 
ATOM   2382  C CA  . ARG A 1 420 ? 2.097   -25.491 165.246 1.00 55.52  ? 421  ARG A CA  1 
ATOM   2383  C C   . ARG A 1 420 ? 1.475   -25.176 163.885 1.00 67.80  ? 421  ARG A C   1 
ATOM   2384  O O   . ARG A 1 420 ? 0.349   -25.580 163.599 1.00 79.95  ? 421  ARG A O   1 
ATOM   2385  C CB  . ARG A 1 420 ? 2.839   -26.829 165.204 1.00 67.43  ? 421  ARG A CB  1 
ATOM   2386  C CG  . ARG A 1 420 ? 4.198   -26.743 164.524 1.00 90.40  ? 421  ARG A CG  1 
ATOM   2387  C CD  . ARG A 1 420 ? 4.554   -28.022 163.776 1.00 112.43 ? 421  ARG A CD  1 
ATOM   2388  N NE  . ARG A 1 420 ? 4.729   -29.173 164.658 1.00 122.97 ? 421  ARG A NE  1 
ATOM   2389  C CZ  . ARG A 1 420 ? 5.001   -30.403 164.233 1.00 122.06 ? 421  ARG A CZ  1 
ATOM   2390  N NH1 . ARG A 1 420 ? 5.130   -30.646 162.935 1.00 116.38 ? 421  ARG A NH1 1 
ATOM   2391  N NH2 . ARG A 1 420 ? 5.144   -31.393 165.104 1.00 122.29 ? 421  ARG A NH2 1 
ATOM   2392  N N   . GLY A 1 421 ? 2.206   -24.439 163.058 1.00 69.44  ? 422  GLY A N   1 
ATOM   2393  C CA  . GLY A 1 421 ? 1.708   -23.994 161.770 1.00 75.35  ? 422  GLY A CA  1 
ATOM   2394  C C   . GLY A 1 421 ? 2.318   -22.667 161.366 1.00 80.01  ? 422  GLY A C   1 
ATOM   2395  O O   . GLY A 1 421 ? 3.261   -22.192 161.996 1.00 91.47  ? 422  GLY A O   1 
ATOM   2396  N N   . ARG A 1 422 ? 1.778   -22.069 160.311 1.00 81.90  ? 423  ARG A N   1 
ATOM   2397  C CA  . ARG A 1 422 ? 2.258   -20.780 159.828 1.00 83.56  ? 423  ARG A CA  1 
ATOM   2398  C C   . ARG A 1 422 ? 1.687   -19.626 160.645 1.00 83.77  ? 423  ARG A C   1 
ATOM   2399  O O   . ARG A 1 422 ? 0.574   -19.717 161.166 1.00 91.34  ? 423  ARG A O   1 
ATOM   2400  C CB  . ARG A 1 422 ? 1.898   -20.600 158.354 1.00 91.02  ? 423  ARG A CB  1 
ATOM   2401  C CG  . ARG A 1 422 ? 2.559   -21.606 157.429 1.00 103.87 ? 423  ARG A CG  1 
ATOM   2402  C CD  . ARG A 1 422 ? 2.111   -21.399 155.995 1.00 116.61 ? 423  ARG A CD  1 
ATOM   2403  N NE  . ARG A 1 422 ? 2.314   -20.021 155.559 1.00 122.73 ? 423  ARG A NE  1 
ATOM   2404  C CZ  . ARG A 1 422 ? 1.883   -19.533 154.400 1.00 127.72 ? 423  ARG A CZ  1 
ATOM   2405  N NH1 . ARG A 1 422 ? 1.218   -20.311 153.557 1.00 129.56 ? 423  ARG A NH1 1 
ATOM   2406  N NH2 . ARG A 1 422 ? 2.113   -18.266 154.085 1.00 125.92 ? 423  ARG A NH2 1 
ATOM   2407  N N   . TYR A 1 423 ? 2.460   -18.551 160.768 1.00 75.58  ? 424  TYR A N   1 
ATOM   2408  C CA  . TYR A 1 423 ? 1.966   -17.328 161.388 1.00 78.37  ? 424  TYR A CA  1 
ATOM   2409  C C   . TYR A 1 423 ? 1.518   -16.363 160.296 1.00 75.82  ? 424  TYR A C   1 
ATOM   2410  O O   . TYR A 1 423 ? 2.339   -15.811 159.563 1.00 71.63  ? 424  TYR A O   1 
ATOM   2411  C CB  . TYR A 1 423 ? 3.056   -16.690 162.250 1.00 83.19  ? 424  TYR A CB  1 
ATOM   2412  C CG  . TYR A 1 423 ? 2.630   -15.419 162.951 1.00 81.70  ? 424  TYR A CG  1 
ATOM   2413  C CD1 . TYR A 1 423 ? 1.895   -15.465 164.128 1.00 82.55  ? 424  TYR A CD1 1 
ATOM   2414  C CD2 . TYR A 1 423 ? 2.969   -14.174 162.439 1.00 72.24  ? 424  TYR A CD2 1 
ATOM   2415  C CE1 . TYR A 1 423 ? 1.505   -14.306 164.773 1.00 79.35  ? 424  TYR A CE1 1 
ATOM   2416  C CE2 . TYR A 1 423 ? 2.584   -13.010 163.078 1.00 69.65  ? 424  TYR A CE2 1 
ATOM   2417  C CZ  . TYR A 1 423 ? 1.852   -13.081 164.244 1.00 77.06  ? 424  TYR A CZ  1 
ATOM   2418  O OH  . TYR A 1 423 ? 1.464   -11.925 164.884 1.00 80.10  ? 424  TYR A OH  1 
ATOM   2419  N N   . LEU A 1 424 ? 0.208   -16.167 160.196 1.00 73.06  ? 425  LEU A N   1 
ATOM   2420  C CA  . LEU A 1 424 ? -0.381  -15.332 159.146 1.00 76.33  ? 425  LEU A CA  1 
ATOM   2421  C C   . LEU A 1 424 ? -0.159  -13.807 159.217 1.00 81.08  ? 425  LEU A C   1 
ATOM   2422  O O   . LEU A 1 424 ? 0.213   -13.206 158.209 1.00 84.70  ? 425  LEU A O   1 
ATOM   2423  C CB  . LEU A 1 424 ? -1.868  -15.659 158.956 1.00 77.42  ? 425  LEU A CB  1 
ATOM   2424  C CG  . LEU A 1 424 ? -2.158  -17.032 158.346 1.00 72.96  ? 425  LEU A CG  1 
ATOM   2425  C CD1 . LEU A 1 424 ? -3.626  -17.154 157.963 1.00 72.94  ? 425  LEU A CD1 1 
ATOM   2426  C CD2 . LEU A 1 424 ? -1.259  -17.290 157.144 1.00 56.90  ? 425  LEU A CD2 1 
ATOM   2427  N N   . PRO A 1 425 ? -0.405  -13.176 160.386 1.00 73.06  ? 426  PRO A N   1 
ATOM   2428  C CA  . PRO A 1 425 ? -0.330  -11.708 160.453 1.00 64.02  ? 426  PRO A CA  1 
ATOM   2429  C C   . PRO A 1 425 ? 1.015   -11.133 160.016 1.00 68.82  ? 426  PRO A C   1 
ATOM   2430  O O   . PRO A 1 425 ? 2.060   -11.715 160.304 1.00 73.33  ? 426  PRO A O   1 
ATOM   2431  C CB  . PRO A 1 425 ? -0.549  -11.415 161.940 1.00 55.65  ? 426  PRO A CB  1 
ATOM   2432  C CG  . PRO A 1 425 ? -1.326  -12.570 162.439 1.00 57.18  ? 426  PRO A CG  1 
ATOM   2433  C CD  . PRO A 1 425 ? -0.808  -13.752 161.683 1.00 61.94  ? 426  PRO A CD  1 
ATOM   2434  N N   . GLU A 1 426 ? 0.979   -10.001 159.318 1.00 72.09  ? 427  GLU A N   1 
ATOM   2435  C CA  . GLU A 1 426 ? 2.200   -9.315  158.914 1.00 72.08  ? 427  GLU A CA  1 
ATOM   2436  C C   . GLU A 1 426 ? 2.785   -8.531  160.086 1.00 60.60  ? 427  GLU A C   1 
ATOM   2437  O O   . GLU A 1 426 ? 2.069   -8.163  161.018 1.00 53.09  ? 427  GLU A O   1 
ATOM   2438  C CB  . GLU A 1 426 ? 1.943   -8.393  157.720 1.00 78.08  ? 427  GLU A CB  1 
ATOM   2439  C CG  . GLU A 1 426 ? 1.032   -7.214  158.017 1.00 95.44  ? 427  GLU A CG  1 
ATOM   2440  C CD  . GLU A 1 426 ? 0.847   -6.311  156.813 1.00 101.36 ? 427  GLU A CD  1 
ATOM   2441  O OE1 . GLU A 1 426 ? 0.964   -6.809  155.674 1.00 104.32 ? 427  GLU A OE1 1 
ATOM   2442  O OE2 . GLU A 1 426 ? 0.590   -5.103  157.006 1.00 96.58  ? 427  GLU A OE2 1 
ATOM   2443  N N   . VAL A 1 427 ? 4.091   -8.285  160.036 1.00 52.06  ? 428  VAL A N   1 
ATOM   2444  C CA  . VAL A 1 427 ? 4.788   -7.629  161.136 1.00 52.26  ? 428  VAL A CA  1 
ATOM   2445  C C   . VAL A 1 427 ? 4.405   -6.156  161.266 1.00 55.02  ? 428  VAL A C   1 
ATOM   2446  O O   . VAL A 1 427 ? 4.259   -5.449  160.269 1.00 62.51  ? 428  VAL A O   1 
ATOM   2447  C CB  . VAL A 1 427 ? 6.316   -7.741  160.976 1.00 58.45  ? 428  VAL A CB  1 
ATOM   2448  C CG1 . VAL A 1 427 ? 7.018   -7.355  162.270 1.00 59.55  ? 428  VAL A CG1 1 
ATOM   2449  C CG2 . VAL A 1 427 ? 6.699   -9.151  160.568 1.00 62.52  ? 428  VAL A CG2 1 
ATOM   2450  N N   . MET A 1 428 ? 4.246   -5.704  162.506 1.00 46.77  ? 429  MET A N   1 
ATOM   2451  C CA  . MET A 1 428 ? 3.889   -4.319  162.788 1.00 46.31  ? 429  MET A CA  1 
ATOM   2452  C C   . MET A 1 428 ? 5.052   -3.369  162.536 1.00 60.51  ? 429  MET A C   1 
ATOM   2453  O O   . MET A 1 428 ? 6.208   -3.786  162.483 1.00 74.45  ? 429  MET A O   1 
ATOM   2454  C CB  . MET A 1 428 ? 3.404   -4.178  164.233 1.00 42.12  ? 429  MET A CB  1 
ATOM   2455  C CG  . MET A 1 428 ? 2.192   -5.034  164.583 1.00 51.34  ? 429  MET A CG  1 
ATOM   2456  S SD  . MET A 1 428 ? 0.599   -4.259  164.230 1.00 64.80  ? 429  MET A SD  1 
ATOM   2457  C CE  . MET A 1 428 ? 0.429   -4.538  162.468 1.00 27.84  ? 429  MET A CE  1 
ATOM   2458  N N   . GLY A 1 429 ? 4.733   -2.090  162.368 1.00 58.26  ? 430  GLY A N   1 
ATOM   2459  C CA  . GLY A 1 429 ? 5.748   -1.064  162.229 1.00 48.31  ? 430  GLY A CA  1 
ATOM   2460  C C   . GLY A 1 429 ? 6.363   -0.724  163.572 1.00 45.83  ? 430  GLY A C   1 
ATOM   2461  O O   . GLY A 1 429 ? 5.899   -1.189  164.613 1.00 39.28  ? 430  GLY A O   1 
ATOM   2462  N N   . ASP A 1 430 ? 7.411   0.089   163.552 1.00 58.47  ? 431  ASP A N   1 
ATOM   2463  C CA  . ASP A 1 430 ? 8.112   0.454   164.776 1.00 54.31  ? 431  ASP A CA  1 
ATOM   2464  C C   . ASP A 1 430 ? 7.486   1.675   165.439 1.00 48.69  ? 431  ASP A C   1 
ATOM   2465  O O   . ASP A 1 430 ? 7.002   2.582   164.762 1.00 56.43  ? 431  ASP A O   1 
ATOM   2466  C CB  . ASP A 1 430 ? 9.594   0.697   164.487 1.00 57.26  ? 431  ASP A CB  1 
ATOM   2467  C CG  . ASP A 1 430 ? 10.266  -0.504  163.850 1.00 60.13  ? 431  ASP A CG  1 
ATOM   2468  O OD1 . ASP A 1 430 ? 10.642  -1.439  164.589 1.00 67.34  ? 431  ASP A OD1 1 
ATOM   2469  O OD2 . ASP A 1 430 ? 10.419  -0.515  162.610 1.00 55.32  ? 431  ASP A OD2 1 
ATOM   2470  N N   . GLY A 1 431 ? 7.491   1.689   166.768 1.00 33.77  ? 432  GLY A N   1 
ATOM   2471  C CA  . GLY A 1 431 ? 6.942   2.804   167.518 1.00 46.53  ? 432  GLY A CA  1 
ATOM   2472  C C   . GLY A 1 431 ? 5.644   2.486   168.233 1.00 51.91  ? 432  GLY A C   1 
ATOM   2473  O O   . GLY A 1 431 ? 5.008   1.466   167.968 1.00 61.41  ? 432  GLY A O   1 
ATOM   2474  N N   . LEU A 1 432 ? 5.252   3.371   169.144 1.00 53.09  ? 433  LEU A N   1 
ATOM   2475  C CA  . LEU A 1 432 ? 4.080   3.155   169.985 1.00 53.21  ? 433  LEU A CA  1 
ATOM   2476  C C   . LEU A 1 432 ? 2.776   3.127   169.190 1.00 48.73  ? 433  LEU A C   1 
ATOM   2477  O O   . LEU A 1 432 ? 2.009   2.176   169.283 1.00 37.22  ? 433  LEU A O   1 
ATOM   2478  C CB  . LEU A 1 432 ? 4.013   4.221   171.082 1.00 46.33  ? 433  LEU A CB  1 
ATOM   2479  C CG  . LEU A 1 432 ? 3.030   3.965   172.225 1.00 45.23  ? 433  LEU A CG  1 
ATOM   2480  C CD1 . LEU A 1 432 ? 3.420   2.719   173.003 1.00 40.29  ? 433  LEU A CD1 1 
ATOM   2481  C CD2 . LEU A 1 432 ? 2.955   5.162   173.154 1.00 43.89  ? 433  LEU A CD2 1 
ATOM   2482  N N   . ALA A 1 433 ? 2.540   4.172   168.403 1.00 41.15  ? 434  ALA A N   1 
ATOM   2483  C CA  . ALA A 1 433 ? 1.294   4.326   167.654 1.00 51.59  ? 434  ALA A CA  1 
ATOM   2484  C C   . ALA A 1 433 ? 1.026   3.130   166.735 1.00 53.23  ? 434  ALA A C   1 
ATOM   2485  O O   . ALA A 1 433 ? -0.101  2.619   166.678 1.00 56.48  ? 434  ALA A O   1 
ATOM   2486  C CB  . ALA A 1 433 ? 1.317   5.617   166.851 1.00 27.58  ? 434  ALA A CB  1 
ATOM   2487  N N   . ASN A 1 434 ? 2.064   2.645   166.060 1.00 40.12  ? 435  ASN A N   1 
ATOM   2488  C CA  . ASN A 1 434 ? 1.914   1.512   165.154 1.00 47.55  ? 435  ASN A CA  1 
ATOM   2489  C C   . ASN A 1 434 ? 1.537   0.204   165.859 1.00 56.77  ? 435  ASN A C   1 
ATOM   2490  O O   . ASN A 1 434 ? 1.255   -0.800  165.205 1.00 63.37  ? 435  ASN A O   1 
ATOM   2491  C CB  . ASN A 1 434 ? 3.183   1.328   164.343 1.00 56.73  ? 435  ASN A CB  1 
ATOM   2492  C CG  . ASN A 1 434 ? 3.338   2.379   163.275 1.00 59.22  ? 435  ASN A CG  1 
ATOM   2493  O OD1 . ASN A 1 434 ? 2.359   2.808   162.669 1.00 58.23  ? 435  ASN A OD1 1 
ATOM   2494  N ND2 . ASN A 1 434 ? 4.569   2.811   163.043 1.00 58.41  ? 435  ASN A ND2 1 
ATOM   2495  N N   . GLN A 1 435 ? 1.524   0.218   167.188 1.00 49.42  ? 436  GLN A N   1 
ATOM   2496  C CA  . GLN A 1 435 ? 1.117   -0.962  167.943 1.00 45.69  ? 436  GLN A CA  1 
ATOM   2497  C C   . GLN A 1 435 ? -0.354  -0.927  168.342 1.00 56.01  ? 436  GLN A C   1 
ATOM   2498  O O   . GLN A 1 435 ? -0.824  -1.816  169.054 1.00 65.21  ? 436  GLN A O   1 
ATOM   2499  C CB  . GLN A 1 435 ? 2.001   -1.157  169.172 1.00 33.29  ? 436  GLN A CB  1 
ATOM   2500  C CG  . GLN A 1 435 ? 3.470   -1.208  168.841 1.00 40.07  ? 436  GLN A CG  1 
ATOM   2501  C CD  . GLN A 1 435 ? 3.764   -2.133  167.683 1.00 52.59  ? 436  GLN A CD  1 
ATOM   2502  O OE1 . GLN A 1 435 ? 3.344   -3.290  167.675 1.00 63.86  ? 436  GLN A OE1 1 
ATOM   2503  N NE2 . GLN A 1 435 ? 4.482   -1.625  166.690 1.00 52.99  ? 436  GLN A NE2 1 
ATOM   2504  N N   . ILE A 1 436 ? -1.073  0.097   167.891 1.00 54.38  ? 437  ILE A N   1 
ATOM   2505  C CA  . ILE A 1 436 ? -2.492  0.209   168.199 1.00 53.64  ? 437  ILE A CA  1 
ATOM   2506  C C   . ILE A 1 436 ? -3.285  -1.039  167.778 1.00 64.52  ? 437  ILE A C   1 
ATOM   2507  O O   . ILE A 1 436 ? -4.173  -1.483  168.502 1.00 62.68  ? 437  ILE A O   1 
ATOM   2508  C CB  . ILE A 1 436 ? -3.090  1.489   167.576 1.00 56.69  ? 437  ILE A CB  1 
ATOM   2509  C CG1 . ILE A 1 436 ? -4.531  1.689   168.030 1.00 69.48  ? 437  ILE A CG1 1 
ATOM   2510  C CG2 . ILE A 1 436 ? -3.006  1.467   166.054 1.00 52.98  ? 437  ILE A CG2 1 
ATOM   2511  C CD1 . ILE A 1 436 ? -5.170  2.923   167.468 1.00 36.42  ? 437  ILE A CD1 1 
ATOM   2512  N N   . ASN A 1 437 ? -2.953  -1.594  166.613 1.00 69.12  ? 438  ASN A N   1 
ATOM   2513  C CA  . ASN A 1 437 ? -3.592  -2.803  166.082 1.00 59.79  ? 438  ASN A CA  1 
ATOM   2514  C C   . ASN A 1 437 ? -2.834  -4.102  166.335 1.00 52.21  ? 438  ASN A C   1 
ATOM   2515  O O   . ASN A 1 437 ? -3.184  -5.142  165.776 1.00 53.10  ? 438  ASN A O   1 
ATOM   2516  C CB  . ASN A 1 437 ? -3.898  -2.658  164.591 1.00 60.12  ? 438  ASN A CB  1 
ATOM   2517  C CG  . ASN A 1 437 ? -5.104  -1.782  164.331 1.00 56.49  ? 438  ASN A CG  1 
ATOM   2518  O OD1 . ASN A 1 437 ? -5.963  -1.614  165.198 1.00 59.60  ? 438  ASN A OD1 1 
ATOM   2519  N ND2 . ASN A 1 437 ? -5.180  -1.222  163.130 1.00 48.23  ? 438  ASN A ND2 1 
ATOM   2520  N N   . ASN A 1 438 ? -1.770  -4.025  167.127 1.00 54.83  ? 439  ASN A N   1 
ATOM   2521  C CA  . ASN A 1 438 ? -0.922  -5.184  167.394 1.00 58.03  ? 439  ASN A CA  1 
ATOM   2522  C C   . ASN A 1 438 ? -1.724  -6.381  167.901 1.00 54.96  ? 439  ASN A C   1 
ATOM   2523  O O   . ASN A 1 438 ? -2.357  -6.317  168.955 1.00 47.44  ? 439  ASN A O   1 
ATOM   2524  C CB  . ASN A 1 438 ? 0.161   -4.815  168.412 1.00 58.74  ? 439  ASN A CB  1 
ATOM   2525  C CG  . ASN A 1 438 ? 1.194   -5.911  168.597 1.00 62.13  ? 439  ASN A CG  1 
ATOM   2526  O OD1 . ASN A 1 438 ? 0.952   -6.901  169.290 1.00 73.02  ? 439  ASN A OD1 1 
ATOM   2527  N ND2 . ASN A 1 438 ? 2.361   -5.731  167.989 1.00 52.69  ? 439  ASN A ND2 1 
ATOM   2528  N N   . PRO A 1 439 ? -1.689  -7.485  167.141 1.00 52.75  ? 440  PRO A N   1 
ATOM   2529  C CA  . PRO A 1 439 ? -2.481  -8.687  167.416 1.00 53.65  ? 440  PRO A CA  1 
ATOM   2530  C C   . PRO A 1 439 ? -2.044  -9.436  168.671 1.00 59.47  ? 440  PRO A C   1 
ATOM   2531  O O   . PRO A 1 439 ? -2.891  -9.974  169.383 1.00 77.08  ? 440  PRO A O   1 
ATOM   2532  C CB  . PRO A 1 439 ? -2.241  -9.550  166.174 1.00 44.94  ? 440  PRO A CB  1 
ATOM   2533  C CG  . PRO A 1 439 ? -0.924  -9.103  165.657 1.00 50.43  ? 440  PRO A CG  1 
ATOM   2534  C CD  . PRO A 1 439 ? -0.877  -7.629  165.920 1.00 52.24  ? 440  PRO A CD  1 
ATOM   2535  N N   . GLU A 1 440 ? -0.742  -9.480  168.933 1.00 48.43  ? 441  GLU A N   1 
ATOM   2536  C CA  . GLU A 1 440 ? -0.228  -10.265 170.051 1.00 61.54  ? 441  GLU A CA  1 
ATOM   2537  C C   . GLU A 1 440 ? -0.314  -9.563  171.407 1.00 52.44  ? 441  GLU A C   1 
ATOM   2538  O O   . GLU A 1 440 ? -0.591  -10.198 172.423 1.00 58.96  ? 441  GLU A O   1 
ATOM   2539  C CB  . GLU A 1 440 ? 1.199   -10.745 169.771 1.00 62.47  ? 441  GLU A CB  1 
ATOM   2540  C CG  . GLU A 1 440 ? 1.355   -11.461 168.433 1.00 64.52  ? 441  GLU A CG  1 
ATOM   2541  C CD  . GLU A 1 440 ? 0.265   -12.491 168.176 1.00 70.84  ? 441  GLU A CD  1 
ATOM   2542  O OE1 . GLU A 1 440 ? -0.068  -13.265 169.099 1.00 76.04  ? 441  GLU A OE1 1 
ATOM   2543  O OE2 . GLU A 1 440 ? -0.262  -12.523 167.043 1.00 67.00  ? 441  GLU A OE2 1 
ATOM   2544  N N   . VAL A 1 441 ? -0.069  -8.257  171.421 1.00 47.29  ? 442  VAL A N   1 
ATOM   2545  C CA  . VAL A 1 441 ? -0.120  -7.492  172.664 1.00 51.84  ? 442  VAL A CA  1 
ATOM   2546  C C   . VAL A 1 441 ? -1.001  -6.248  172.516 1.00 54.64  ? 442  VAL A C   1 
ATOM   2547  O O   . VAL A 1 441 ? -1.014  -5.604  171.465 1.00 52.89  ? 442  VAL A O   1 
ATOM   2548  C CB  . VAL A 1 441 ? 1.305   -7.135  173.185 1.00 59.74  ? 442  VAL A CB  1 
ATOM   2549  C CG1 . VAL A 1 441 ? 2.376   -7.672  172.242 1.00 51.44  ? 442  VAL A CG1 1 
ATOM   2550  C CG2 . VAL A 1 441 ? 1.467   -5.636  173.387 1.00 53.13  ? 442  VAL A CG2 1 
ATOM   2551  N N   . GLU A 1 442 ? -1.756  -5.933  173.565 1.00 58.39  ? 443  GLU A N   1 
ATOM   2552  C CA  . GLU A 1 442 ? -2.663  -4.792  173.541 1.00 66.24  ? 443  GLU A CA  1 
ATOM   2553  C C   . GLU A 1 442 ? -1.974  -3.566  174.131 1.00 65.14  ? 443  GLU A C   1 
ATOM   2554  O O   . GLU A 1 442 ? -1.631  -3.542  175.313 1.00 65.77  ? 443  GLU A O   1 
ATOM   2555  C CB  . GLU A 1 442 ? -3.947  -5.111  174.315 1.00 79.01  ? 443  GLU A CB  1 
ATOM   2556  C CG  . GLU A 1 442 ? -5.202  -4.444  173.760 1.00 92.03  ? 443  GLU A CG  1 
ATOM   2557  C CD  . GLU A 1 442 ? -5.714  -5.110  172.492 1.00 99.08  ? 443  GLU A CD  1 
ATOM   2558  O OE1 . GLU A 1 442 ? -5.463  -6.321  172.309 1.00 109.71 ? 443  GLU A OE1 1 
ATOM   2559  O OE2 . GLU A 1 442 ? -6.367  -4.423  171.677 1.00 85.66  ? 443  GLU A OE2 1 
ATOM   2560  N N   . VAL A 1 443 ? -1.767  -2.552  173.297 1.00 63.90  ? 444  VAL A N   1 
ATOM   2561  C CA  . VAL A 1 443 ? -1.039  -1.356  173.709 1.00 63.65  ? 444  VAL A CA  1 
ATOM   2562  C C   . VAL A 1 443 ? -1.949  -0.135  173.793 1.00 63.84  ? 444  VAL A C   1 
ATOM   2563  O O   . VAL A 1 443 ? -2.751  0.114   172.894 1.00 84.05  ? 444  VAL A O   1 
ATOM   2564  C CB  . VAL A 1 443 ? 0.129   -1.049  172.738 1.00 54.57  ? 444  VAL A CB  1 
ATOM   2565  C CG1 . VAL A 1 443 ? 0.696   0.340   172.987 1.00 57.05  ? 444  VAL A CG1 1 
ATOM   2566  C CG2 . VAL A 1 443 ? 1.218   -2.099  172.863 1.00 26.16  ? 444  VAL A CG2 1 
ATOM   2567  N N   . ASP A 1 444 ? -1.820  0.625   174.875 1.00 54.58  ? 445  ASP A N   1 
ATOM   2568  C CA  . ASP A 1 444 ? -2.507  1.901   174.982 1.00 60.77  ? 445  ASP A CA  1 
ATOM   2569  C C   . ASP A 1 444 ? -1.548  2.959   174.453 1.00 55.92  ? 445  ASP A C   1 
ATOM   2570  O O   . ASP A 1 444 ? -0.536  3.262   175.086 1.00 52.18  ? 445  ASP A O   1 
ATOM   2571  C CB  . ASP A 1 444 ? -2.860  2.186   176.443 1.00 71.46  ? 445  ASP A CB  1 
ATOM   2572  C CG  . ASP A 1 444 ? -3.848  3.330   176.599 1.00 77.53  ? 445  ASP A CG  1 
ATOM   2573  O OD1 . ASP A 1 444 ? -3.934  4.182   175.690 1.00 83.76  ? 445  ASP A OD1 1 
ATOM   2574  O OD2 . ASP A 1 444 ? -4.539  3.378   177.639 1.00 70.51  ? 445  ASP A OD2 1 
ATOM   2575  N N   . ILE A 1 445 ? -1.871  3.525   173.294 1.00 43.50  ? 446  ILE A N   1 
ATOM   2576  C CA  . ILE A 1 445 ? -0.964  4.453   172.627 1.00 40.67  ? 446  ILE A CA  1 
ATOM   2577  C C   . ILE A 1 445 ? -1.160  5.869   173.148 1.00 57.88  ? 446  ILE A C   1 
ATOM   2578  O O   . ILE A 1 445 ? -0.378  6.767   172.845 1.00 50.57  ? 446  ILE A O   1 
ATOM   2579  C CB  . ILE A 1 445 ? -1.145  4.431   171.094 1.00 46.06  ? 446  ILE A CB  1 
ATOM   2580  C CG1 . ILE A 1 445 ? -2.419  5.173   170.681 1.00 58.49  ? 446  ILE A CG1 1 
ATOM   2581  C CG2 . ILE A 1 445 ? -1.158  2.999   170.579 1.00 60.19  ? 446  ILE A CG2 1 
ATOM   2582  C CD1 . ILE A 1 445 ? -2.606  5.265   169.178 1.00 33.63  ? 446  ILE A CD1 1 
ATOM   2583  N N   . THR A 1 446 ? -2.210  6.055   173.939 1.00 65.02  ? 447  THR A N   1 
ATOM   2584  C CA  . THR A 1 446 ? -2.492  7.345   174.546 1.00 64.53  ? 447  THR A CA  1 
ATOM   2585  C C   . THR A 1 446 ? -1.613  7.564   175.770 1.00 75.54  ? 447  THR A C   1 
ATOM   2586  O O   . THR A 1 446 ? -1.449  8.693   176.229 1.00 87.68  ? 447  THR A O   1 
ATOM   2587  C CB  . THR A 1 446 ? -3.965  7.468   174.945 1.00 75.33  ? 447  THR A CB  1 
ATOM   2588  O OG1 . THR A 1 446 ? -4.276  6.487   175.939 1.00 75.93  ? 447  THR A OG1 1 
ATOM   2589  C CG2 . THR A 1 446 ? -4.858  7.257   173.735 1.00 85.23  ? 447  THR A CG2 1 
ATOM   2590  N N   . LYS A 1 447 ? -1.059  6.481   176.307 1.00 75.99  ? 448  LYS A N   1 
ATOM   2591  C CA  . LYS A 1 447 ? -0.131  6.593   177.425 1.00 83.26  ? 448  LYS A CA  1 
ATOM   2592  C C   . LYS A 1 447 ? 1.298   6.256   177.001 1.00 88.85  ? 448  LYS A C   1 
ATOM   2593  O O   . LYS A 1 447 ? 1.643   5.084   176.855 1.00 95.76  ? 448  LYS A O   1 
ATOM   2594  C CB  . LYS A 1 447 ? -0.555  5.652   178.556 1.00 80.04  ? 448  LYS A CB  1 
ATOM   2595  C CG  . LYS A 1 447 ? -1.957  5.888   179.091 1.00 91.73  ? 448  LYS A CG  1 
ATOM   2596  C CD  . LYS A 1 447 ? -2.287  4.897   180.196 1.00 98.77  ? 448  LYS A CD  1 
ATOM   2597  C CE  . LYS A 1 447 ? -3.690  5.115   180.732 1.00 108.34 ? 448  LYS A CE  1 
ATOM   2598  N NZ  . LYS A 1 447 ? -4.032  4.141   181.805 1.00 113.19 ? 448  LYS A NZ  1 
ATOM   2599  N N   . PRO A 1 448 ? 2.136   7.291   176.820 1.00 86.20  ? 449  PRO A N   1 
ATOM   2600  C CA  . PRO A 1 448 ? 3.579   7.195   176.577 1.00 71.43  ? 449  PRO A CA  1 
ATOM   2601  C C   . PRO A 1 448 ? 4.316   6.953   177.886 1.00 80.46  ? 449  PRO A C   1 
ATOM   2602  O O   . PRO A 1 448 ? 3.748   7.188   178.954 1.00 81.92  ? 449  PRO A O   1 
ATOM   2603  C CB  . PRO A 1 448 ? 3.940   8.581   176.014 1.00 62.74  ? 449  PRO A CB  1 
ATOM   2604  C CG  . PRO A 1 448 ? 2.631   9.250   175.704 1.00 69.82  ? 449  PRO A CG  1 
ATOM   2605  C CD  . PRO A 1 448 ? 1.665   8.677   176.684 1.00 82.87  ? 449  PRO A CD  1 
ATOM   2606  N N   . ASP A 1 449 ? 5.549   6.462   177.810 1.00 85.17  ? 450  ASP A N   1 
ATOM   2607  C CA  . ASP A 1 449 ? 6.391   6.415   178.996 1.00 81.42  ? 450  ASP A CA  1 
ATOM   2608  C C   . ASP A 1 449 ? 7.125   7.746   179.140 1.00 88.06  ? 450  ASP A C   1 
ATOM   2609  O O   . ASP A 1 449 ? 7.934   8.133   178.284 1.00 89.45  ? 450  ASP A O   1 
ATOM   2610  C CB  . ASP A 1 449 ? 7.369   5.243   178.942 1.00 77.71  ? 450  ASP A CB  1 
ATOM   2611  C CG  . ASP A 1 449 ? 8.111   5.047   180.250 1.00 87.58  ? 450  ASP A CG  1 
ATOM   2612  O OD1 . ASP A 1 449 ? 9.158   5.694   180.434 1.00 99.16  ? 450  ASP A OD1 1 
ATOM   2613  O OD2 . ASP A 1 449 ? 7.654   4.248   181.095 1.00 88.28  ? 450  ASP A OD2 1 
ATOM   2614  N N   . MET A 1 450 ? 6.834   8.439   180.235 1.00 92.24  ? 451  MET A N   1 
ATOM   2615  C CA  . MET A 1 450 ? 7.317   9.797   180.438 1.00 88.29  ? 451  MET A CA  1 
ATOM   2616  C C   . MET A 1 450 ? 8.835   9.864   180.557 1.00 83.39  ? 451  MET A C   1 
ATOM   2617  O O   . MET A 1 450 ? 9.443   10.841  180.134 1.00 103.78 ? 451  MET A O   1 
ATOM   2618  C CB  . MET A 1 450 ? 6.652   10.429  181.661 1.00 88.89  ? 451  MET A CB  1 
ATOM   2619  C CG  . MET A 1 450 ? 5.135   10.527  181.551 1.00 96.54  ? 451  MET A CG  1 
ATOM   2620  S SD  . MET A 1 450 ? 4.573   11.325  180.032 1.00 136.65 ? 451  MET A SD  1 
ATOM   2621  C CE  . MET A 1 450 ? 5.299   12.953  180.212 1.00 74.04  ? 451  MET A CE  1 
ATOM   2622  N N   . THR A 1 451 ? 9.442   8.826   181.125 1.00 62.48  ? 452  THR A N   1 
ATOM   2623  C CA  . THR A 1 451 ? 10.899  8.739   181.194 1.00 59.15  ? 452  THR A CA  1 
ATOM   2624  C C   . THR A 1 451 ? 11.499  8.742   179.789 1.00 54.30  ? 452  THR A C   1 
ATOM   2625  O O   . THR A 1 451 ? 12.416  9.514   179.487 1.00 68.27  ? 452  THR A O   1 
ATOM   2626  C CB  . THR A 1 451 ? 11.356  7.467   181.938 1.00 48.95  ? 452  THR A CB  1 
ATOM   2627  O OG1 . THR A 1 451 ? 10.915  7.522   183.300 1.00 52.83  ? 452  THR A OG1 1 
ATOM   2628  C CG2 . THR A 1 451 ? 12.871  7.339   181.908 1.00 36.50  ? 452  THR A CG2 1 
ATOM   2629  N N   . ILE A 1 452 ? 10.960  7.875   178.936 1.00 33.49  ? 453  ILE A N   1 
ATOM   2630  C CA  . ILE A 1 452 ? 11.376  7.791   177.543 1.00 43.55  ? 453  ILE A CA  1 
ATOM   2631  C C   . ILE A 1 452 ? 11.203  9.129   176.827 1.00 51.59  ? 453  ILE A C   1 
ATOM   2632  O O   . ILE A 1 452 ? 12.093  9.565   176.096 1.00 60.95  ? 453  ILE A O   1 
ATOM   2633  C CB  . ILE A 1 452 ? 10.581  6.710   176.783 1.00 47.63  ? 453  ILE A CB  1 
ATOM   2634  C CG1 . ILE A 1 452 ? 10.603  5.385   177.550 1.00 55.98  ? 453  ILE A CG1 1 
ATOM   2635  C CG2 . ILE A 1 452 ? 11.129  6.539   175.375 1.00 39.29  ? 453  ILE A CG2 1 
ATOM   2636  C CD1 . ILE A 1 452 ? 11.981  4.817   177.753 1.00 69.65  ? 453  ILE A CD1 1 
ATOM   2637  N N   . ARG A 1 453 ? 10.064  9.783   177.043 1.00 55.65  ? 454  ARG A N   1 
ATOM   2638  C CA  . ARG A 1 453 ? 9.815   11.084  176.422 1.00 64.54  ? 454  ARG A CA  1 
ATOM   2639  C C   . ARG A 1 453 ? 10.823  12.141  176.882 1.00 57.30  ? 454  ARG A C   1 
ATOM   2640  O O   . ARG A 1 453 ? 11.300  12.952  176.078 1.00 60.53  ? 454  ARG A O   1 
ATOM   2641  C CB  . ARG A 1 453 ? 8.382   11.540  176.702 1.00 65.47  ? 454  ARG A CB  1 
ATOM   2642  C CG  . ARG A 1 453 ? 7.326   10.624  176.102 1.00 71.94  ? 454  ARG A CG  1 
ATOM   2643  C CD  . ARG A 1 453 ? 6.710   11.217  174.841 1.00 91.20  ? 454  ARG A CD  1 
ATOM   2644  N NE  . ARG A 1 453 ? 5.959   10.220  174.081 1.00 110.26 ? 454  ARG A NE  1 
ATOM   2645  C CZ  . ARG A 1 453 ? 4.931   10.498  173.284 1.00 121.09 ? 454  ARG A CZ  1 
ATOM   2646  N NH1 . ARG A 1 453 ? 4.516   11.750  173.143 1.00 113.13 ? 454  ARG A NH1 1 
ATOM   2647  N NH2 . ARG A 1 453 ? 4.310   9.522   172.634 1.00 125.68 ? 454  ARG A NH2 1 
ATOM   2648  N N   . GLN A 1 454 ? 11.142  12.121  178.175 1.00 40.11  ? 455  GLN A N   1 
ATOM   2649  C CA  . GLN A 1 454 ? 12.163  12.996  178.744 1.00 56.78  ? 455  GLN A CA  1 
ATOM   2650  C C   . GLN A 1 454 ? 13.500  12.784  178.047 1.00 61.02  ? 455  GLN A C   1 
ATOM   2651  O O   . GLN A 1 454 ? 14.174  13.743  177.657 1.00 53.20  ? 455  GLN A O   1 
ATOM   2652  C CB  . GLN A 1 454 ? 12.323  12.728  180.242 1.00 61.35  ? 455  GLN A CB  1 
ATOM   2653  C CG  . GLN A 1 454 ? 11.174  13.227  181.102 1.00 75.29  ? 455  GLN A CG  1 
ATOM   2654  C CD  . GLN A 1 454 ? 11.272  12.736  182.533 1.00 87.95  ? 455  GLN A CD  1 
ATOM   2655  O OE1 . GLN A 1 454 ? 12.362  12.440  183.025 1.00 95.63  ? 455  GLN A OE1 1 
ATOM   2656  N NE2 . GLN A 1 454 ? 10.132  12.636  183.205 1.00 93.53  ? 455  GLN A NE2 1 
ATOM   2657  N N   . GLN A 1 455 ? 13.876  11.517  177.896 1.00 53.01  ? 456  GLN A N   1 
ATOM   2658  C CA  . GLN A 1 455 ? 15.124  11.170  177.227 1.00 50.77  ? 456  GLN A CA  1 
ATOM   2659  C C   . GLN A 1 455 ? 15.127  11.650  175.778 1.00 57.04  ? 456  GLN A C   1 
ATOM   2660  O O   . GLN A 1 455 ? 16.156  12.102  175.268 1.00 64.09  ? 456  GLN A O   1 
ATOM   2661  C CB  . GLN A 1 455 ? 15.369  9.662   177.294 1.00 50.96  ? 456  GLN A CB  1 
ATOM   2662  C CG  . GLN A 1 455 ? 15.480  9.127   178.709 1.00 55.52  ? 456  GLN A CG  1 
ATOM   2663  C CD  . GLN A 1 455 ? 16.424  9.944   179.567 1.00 54.83  ? 456  GLN A CD  1 
ATOM   2664  O OE1 . GLN A 1 455 ? 17.592  10.128  179.225 1.00 60.70  ? 456  GLN A OE1 1 
ATOM   2665  N NE2 . GLN A 1 455 ? 15.917  10.447  180.685 1.00 45.51  ? 456  GLN A NE2 1 
ATOM   2666  N N   . ILE A 1 456 ? 13.974  11.551  175.123 1.00 51.86  ? 457  ILE A N   1 
ATOM   2667  C CA  . ILE A 1 456 ? 13.815  12.086  173.775 1.00 57.43  ? 457  ILE A CA  1 
ATOM   2668  C C   . ILE A 1 456 ? 14.137  13.577  173.774 1.00 57.80  ? 457  ILE A C   1 
ATOM   2669  O O   . ILE A 1 456 ? 14.879  14.065  172.913 1.00 54.14  ? 457  ILE A O   1 
ATOM   2670  C CB  . ILE A 1 456 ? 12.385  11.868  173.240 1.00 52.79  ? 457  ILE A CB  1 
ATOM   2671  C CG1 . ILE A 1 456 ? 12.097  10.376  173.070 1.00 58.72  ? 457  ILE A CG1 1 
ATOM   2672  C CG2 . ILE A 1 456 ? 12.190  12.588  171.916 1.00 32.40  ? 457  ILE A CG2 1 
ATOM   2673  C CD1 . ILE A 1 456 ? 10.677  10.065  172.640 1.00 58.40  ? 457  ILE A CD1 1 
ATOM   2674  N N   . MET A 1 457 ? 13.583  14.290  174.752 1.00 58.76  ? 458  MET A N   1 
ATOM   2675  C CA  . MET A 1 457 ? 13.842  15.722  174.885 1.00 61.27  ? 458  MET A CA  1 
ATOM   2676  C C   . MET A 1 457 ? 15.334  16.002  175.051 1.00 59.15  ? 458  MET A C   1 
ATOM   2677  O O   . MET A 1 457 ? 15.884  16.895  174.402 1.00 53.04  ? 458  MET A O   1 
ATOM   2678  C CB  . MET A 1 457 ? 13.056  16.312  176.058 1.00 62.88  ? 458  MET A CB  1 
ATOM   2679  C CG  . MET A 1 457 ? 13.118  17.829  176.138 1.00 69.62  ? 458  MET A CG  1 
ATOM   2680  S SD  . MET A 1 457 ? 12.578  18.622  174.609 1.00 95.73  ? 458  MET A SD  1 
ATOM   2681  C CE  . MET A 1 457 ? 10.871  18.084  174.526 1.00 118.26 ? 458  MET A CE  1 
ATOM   2682  N N   . GLN A 1 458 ? 15.982  15.226  175.916 1.00 54.82  ? 459  GLN A N   1 
ATOM   2683  C CA  . GLN A 1 458 ? 17.423  15.334  176.127 1.00 46.50  ? 459  GLN A CA  1 
ATOM   2684  C C   . GLN A 1 458 ? 18.193  15.191  174.814 1.00 47.60  ? 459  GLN A C   1 
ATOM   2685  O O   . GLN A 1 458 ? 19.080  16.001  174.505 1.00 66.16  ? 459  GLN A O   1 
ATOM   2686  C CB  . GLN A 1 458 ? 17.888  14.270  177.123 1.00 47.43  ? 459  GLN A CB  1 
ATOM   2687  C CG  . GLN A 1 458 ? 17.276  14.407  178.508 1.00 54.92  ? 459  GLN A CG  1 
ATOM   2688  C CD  . GLN A 1 458 ? 17.916  15.516  179.316 1.00 67.04  ? 459  GLN A CD  1 
ATOM   2689  O OE1 . GLN A 1 458 ? 19.024  15.958  179.014 1.00 77.92  ? 459  GLN A OE1 1 
ATOM   2690  N NE2 . GLN A 1 458 ? 17.220  15.972  180.352 1.00 57.29  ? 459  GLN A NE2 1 
ATOM   2691  N N   . LEU A 1 459 ? 17.846  14.160  174.048 1.00 37.40  ? 460  LEU A N   1 
ATOM   2692  C CA  . LEU A 1 459 ? 18.446  13.936  172.737 1.00 37.17  ? 460  LEU A CA  1 
ATOM   2693  C C   . LEU A 1 459 ? 18.262  15.145  171.823 1.00 50.13  ? 460  LEU A C   1 
ATOM   2694  O O   . LEU A 1 459 ? 19.204  15.566  171.145 1.00 65.61  ? 460  LEU A O   1 
ATOM   2695  C CB  . LEU A 1 459 ? 17.857  12.687  172.080 1.00 48.04  ? 460  LEU A CB  1 
ATOM   2696  C CG  . LEU A 1 459 ? 18.164  11.353  172.763 1.00 45.78  ? 460  LEU A CG  1 
ATOM   2697  C CD1 . LEU A 1 459 ? 17.576  10.198  171.973 1.00 43.10  ? 460  LEU A CD1 1 
ATOM   2698  C CD2 . LEU A 1 459 ? 19.661  11.179  172.929 1.00 51.79  ? 460  LEU A CD2 1 
ATOM   2699  N N   . LYS A 1 460 ? 17.050  15.698  171.808 1.00 47.31  ? 461  LYS A N   1 
ATOM   2700  C CA  . LYS A 1 460 ? 16.777  16.910  171.039 1.00 51.43  ? 461  LYS A CA  1 
ATOM   2701  C C   . LYS A 1 460 ? 17.727  18.038  171.434 1.00 62.00  ? 461  LYS A C   1 
ATOM   2702  O O   . LYS A 1 460 ? 18.329  18.687  170.575 1.00 59.80  ? 461  LYS A O   1 
ATOM   2703  C CB  . LYS A 1 460 ? 15.330  17.369  171.232 1.00 54.02  ? 461  LYS A CB  1 
ATOM   2704  C CG  . LYS A 1 460 ? 14.281  16.482  170.582 1.00 61.77  ? 461  LYS A CG  1 
ATOM   2705  C CD  . LYS A 1 460 ? 12.890  17.071  170.769 1.00 78.40  ? 461  LYS A CD  1 
ATOM   2706  C CE  . LYS A 1 460 ? 11.815  16.206  170.129 1.00 77.30  ? 461  LYS A CE  1 
ATOM   2707  N NZ  . LYS A 1 460 ? 10.453  16.782  170.322 1.00 61.70  ? 461  LYS A NZ  1 
ATOM   2708  N N   . ILE A 1 461 ? 17.856  18.257  172.740 1.00 61.45  ? 462  ILE A N   1 
ATOM   2709  C CA  . ILE A 1 461 ? 18.705  19.319  173.274 1.00 60.79  ? 462  ILE A CA  1 
ATOM   2710  C C   . ILE A 1 461 ? 20.159  19.173  172.836 1.00 61.02  ? 462  ILE A C   1 
ATOM   2711  O O   . ILE A 1 461 ? 20.745  20.100  172.262 1.00 52.75  ? 462  ILE A O   1 
ATOM   2712  C CB  . ILE A 1 461 ? 18.660  19.349  174.814 1.00 59.42  ? 462  ILE A CB  1 
ATOM   2713  C CG1 . ILE A 1 461 ? 17.236  19.618  175.304 1.00 60.41  ? 462  ILE A CG1 1 
ATOM   2714  C CG2 . ILE A 1 461 ? 19.617  20.399  175.355 1.00 57.14  ? 462  ILE A CG2 1 
ATOM   2715  C CD1 . ILE A 1 461 ? 17.068  19.463  176.799 1.00 61.01  ? 462  ILE A CD1 1 
ATOM   2716  N N   . MET A 1 462 ? 20.736  18.006  173.112 1.00 62.43  ? 463  MET A N   1 
ATOM   2717  C CA  . MET A 1 462 ? 22.132  17.759  172.765 1.00 50.62  ? 463  MET A CA  1 
ATOM   2718  C C   . MET A 1 462 ? 22.356  17.865  171.257 1.00 47.10  ? 463  MET A C   1 
ATOM   2719  O O   . MET A 1 462 ? 23.381  18.391  170.809 1.00 48.53  ? 463  MET A O   1 
ATOM   2720  C CB  . MET A 1 462 ? 22.591  16.397  173.294 1.00 53.34  ? 463  MET A CB  1 
ATOM   2721  C CG  . MET A 1 462 ? 24.067  16.103  173.066 1.00 58.81  ? 463  MET A CG  1 
ATOM   2722  S SD  . MET A 1 462 ? 25.154  17.451  173.572 1.00 68.40  ? 463  MET A SD  1 
ATOM   2723  C CE  . MET A 1 462 ? 24.788  17.556  175.321 1.00 31.33  ? 463  MET A CE  1 
ATOM   2724  N N   . THR A 1 463 ? 21.392  17.382  170.477 1.00 37.10  ? 464  THR A N   1 
ATOM   2725  C CA  . THR A 1 463 ? 21.476  17.488  169.023 1.00 42.17  ? 464  THR A CA  1 
ATOM   2726  C C   . THR A 1 463 ? 21.503  18.952  168.591 1.00 58.51  ? 464  THR A C   1 
ATOM   2727  O O   . THR A 1 463 ? 22.259  19.329  167.692 1.00 74.67  ? 464  THR A O   1 
ATOM   2728  C CB  . THR A 1 463 ? 20.310  16.764  168.321 1.00 39.01  ? 464  THR A CB  1 
ATOM   2729  O OG1 . THR A 1 463 ? 20.250  15.406  168.771 1.00 45.41  ? 464  THR A OG1 1 
ATOM   2730  C CG2 . THR A 1 463 ? 20.503  16.776  166.811 1.00 31.26  ? 464  THR A CG2 1 
ATOM   2731  N N   . ASN A 1 464 ? 20.680  19.773  169.239 1.00 63.89  ? 465  ASN A N   1 
ATOM   2732  C CA  . ASN A 1 464 ? 20.695  21.211  168.989 1.00 76.62  ? 465  ASN A CA  1 
ATOM   2733  C C   . ASN A 1 464 ? 22.061  21.817  169.295 1.00 75.33  ? 465  ASN A C   1 
ATOM   2734  O O   . ASN A 1 464 ? 22.602  22.586  168.495 1.00 73.65  ? 465  ASN A O   1 
ATOM   2735  C CB  . ASN A 1 464 ? 19.600  21.923  169.790 1.00 86.51  ? 465  ASN A CB  1 
ATOM   2736  C CG  . ASN A 1 464 ? 18.219  21.733  169.189 1.00 93.57  ? 465  ASN A CG  1 
ATOM   2737  O OD1 . ASN A 1 464 ? 18.077  21.541  167.981 1.00 92.65  ? 465  ASN A OD1 1 
ATOM   2738  N ND2 . ASN A 1 464 ? 17.193  21.792  170.031 1.00 93.93  ? 465  ASN A ND2 1 
ATOM   2739  N N   . ARG A 1 465 ? 22.619  21.460  170.451 1.00 70.41  ? 466  ARG A N   1 
ATOM   2740  C CA  . ARG A 1 465 ? 23.950  21.931  170.831 1.00 63.99  ? 466  ARG A CA  1 
ATOM   2741  C C   . ARG A 1 465 ? 25.011  21.565  169.794 1.00 62.66  ? 466  ARG A C   1 
ATOM   2742  O O   . ARG A 1 465 ? 25.877  22.378  169.465 1.00 61.73  ? 466  ARG A O   1 
ATOM   2743  C CB  . ARG A 1 465 ? 24.348  21.396  172.211 1.00 55.66  ? 466  ARG A CB  1 
ATOM   2744  C CG  . ARG A 1 465 ? 24.040  22.350  173.354 1.00 66.85  ? 466  ARG A CG  1 
ATOM   2745  C CD  . ARG A 1 465 ? 24.578  21.841  174.683 1.00 69.66  ? 466  ARG A CD  1 
ATOM   2746  N NE  . ARG A 1 465 ? 23.575  21.092  175.436 1.00 82.82  ? 466  ARG A NE  1 
ATOM   2747  C CZ  . ARG A 1 465 ? 23.733  20.690  176.693 1.00 93.20  ? 466  ARG A CZ  1 
ATOM   2748  N NH1 . ARG A 1 465 ? 24.856  20.965  177.344 1.00 98.01  ? 466  ARG A NH1 1 
ATOM   2749  N NH2 . ARG A 1 465 ? 22.768  20.015  177.303 1.00 91.41  ? 466  ARG A NH2 1 
ATOM   2750  N N   . LEU A 1 466 ? 24.933  20.345  169.273 1.00 58.08  ? 467  LEU A N   1 
ATOM   2751  C CA  . LEU A 1 466 ? 25.906  19.883  168.287 1.00 58.07  ? 467  LEU A CA  1 
ATOM   2752  C C   . LEU A 1 466 ? 25.750  20.548  166.918 1.00 63.38  ? 467  LEU A C   1 
ATOM   2753  O O   . LEU A 1 466 ? 26.747  20.880  166.272 1.00 67.53  ? 467  LEU A O   1 
ATOM   2754  C CB  . LEU A 1 466 ? 25.871  18.359  168.168 1.00 66.06  ? 467  LEU A CB  1 
ATOM   2755  C CG  . LEU A 1 466 ? 26.638  17.635  169.276 1.00 67.55  ? 467  LEU A CG  1 
ATOM   2756  C CD1 . LEU A 1 466 ? 25.898  16.389  169.717 1.00 69.35  ? 467  LEU A CD1 1 
ATOM   2757  C CD2 . LEU A 1 466 ? 28.041  17.285  168.804 1.00 65.58  ? 467  LEU A CD2 1 
ATOM   2758  N N   . ARG A 1 467 ? 24.509  20.742  166.475 1.00 58.99  ? 468  ARG A N   1 
ATOM   2759  C CA  . ARG A 1 467 ? 24.265  21.448  165.219 1.00 57.38  ? 468  ARG A CA  1 
ATOM   2760  C C   . ARG A 1 467 ? 24.781  22.882  165.317 1.00 66.21  ? 468  ARG A C   1 
ATOM   2761  O O   . ARG A 1 467 ? 25.506  23.365  164.432 1.00 67.91  ? 468  ARG A O   1 
ATOM   2762  C CB  . ARG A 1 467 ? 22.775  21.452  164.865 1.00 60.25  ? 468  ARG A CB  1 
ATOM   2763  C CG  . ARG A 1 467 ? 22.198  20.092  164.485 1.00 87.39  ? 468  ARG A CG  1 
ATOM   2764  C CD  . ARG A 1 467 ? 20.930  20.258  163.651 1.00 107.62 ? 468  ARG A CD  1 
ATOM   2765  N NE  . ARG A 1 467 ? 19.752  19.652  164.271 1.00 116.99 ? 468  ARG A NE  1 
ATOM   2766  C CZ  . ARG A 1 467 ? 19.221  18.491  163.896 1.00 112.42 ? 468  ARG A CZ  1 
ATOM   2767  N NH1 . ARG A 1 467 ? 19.761  17.802  162.900 1.00 108.90 ? 468  ARG A NH1 1 
ATOM   2768  N NH2 . ARG A 1 467 ? 18.147  18.019  164.515 1.00 104.37 ? 468  ARG A NH2 1 
ATOM   2769  N N   . SER A 1 468 ? 24.404  23.548  166.408 1.00 68.01  ? 469  SER A N   1 
ATOM   2770  C CA  . SER A 1 468 ? 24.856  24.906  166.687 1.00 73.06  ? 469  SER A CA  1 
ATOM   2771  C C   . SER A 1 468 ? 26.376  24.982  166.662 1.00 72.15  ? 469  SER A C   1 
ATOM   2772  O O   . SER A 1 468 ? 26.949  25.851  166.006 1.00 65.60  ? 469  SER A O   1 
ATOM   2773  C CB  . SER A 1 468 ? 24.332  25.382  168.044 1.00 80.94  ? 469  SER A CB  1 
ATOM   2774  O OG  . SER A 1 468 ? 22.919  25.478  168.043 1.00 83.90  ? 469  SER A OG  1 
ATOM   2775  N N   . ALA A 1 469 ? 27.020  24.056  167.369 1.00 75.27  ? 470  ALA A N   1 
ATOM   2776  C CA  . ALA A 1 469 ? 28.477  23.988  167.398 1.00 54.46  ? 470  ALA A CA  1 
ATOM   2777  C C   . ALA A 1 469 ? 29.055  23.817  165.999 1.00 45.01  ? 470  ALA A C   1 
ATOM   2778  O O   . ALA A 1 469 ? 30.091  24.395  165.675 1.00 61.15  ? 470  ALA A O   1 
ATOM   2779  C CB  . ALA A 1 469 ? 28.940  22.858  168.304 1.00 51.24  ? 470  ALA A CB  1 
ATOM   2780  N N   . TYR A 1 470 ? 28.389  23.015  165.175 1.00 49.07  ? 471  TYR A N   1 
ATOM   2781  C CA  . TYR A 1 470 ? 28.850  22.794  163.811 1.00 56.96  ? 471  TYR A CA  1 
ATOM   2782  C C   . TYR A 1 470 ? 28.815  24.062  162.960 1.00 73.30  ? 471  TYR A C   1 
ATOM   2783  O O   . TYR A 1 470 ? 29.849  24.496  162.453 1.00 89.06  ? 471  TYR A O   1 
ATOM   2784  C CB  . TYR A 1 470 ? 28.042  21.682  163.132 1.00 69.28  ? 471  TYR A CB  1 
ATOM   2785  C CG  . TYR A 1 470 ? 28.590  21.263  161.782 1.00 65.21  ? 471  TYR A CG  1 
ATOM   2786  C CD1 . TYR A 1 470 ? 29.606  20.321  161.687 1.00 60.74  ? 471  TYR A CD1 1 
ATOM   2787  C CD2 . TYR A 1 470 ? 28.089  21.805  160.604 1.00 62.89  ? 471  TYR A CD2 1 
ATOM   2788  C CE1 . TYR A 1 470 ? 30.110  19.933  160.459 1.00 67.28  ? 471  TYR A CE1 1 
ATOM   2789  C CE2 . TYR A 1 470 ? 28.588  21.423  159.371 1.00 64.73  ? 471  TYR A CE2 1 
ATOM   2790  C CZ  . TYR A 1 470 ? 29.598  20.487  159.304 1.00 67.26  ? 471  TYR A CZ  1 
ATOM   2791  O OH  . TYR A 1 470 ? 30.097  20.104  158.079 1.00 64.57  ? 471  TYR A OH  1 
ATOM   2792  N N   . ASN A 1 471 ? 27.636  24.659  162.797 1.00 83.26  ? 472  ASN A N   1 
ATOM   2793  C CA  . ASN A 1 471 ? 27.525  25.790  161.863 1.00 90.17  ? 472  ASN A CA  1 
ATOM   2794  C C   . ASN A 1 471 ? 27.553  27.232  162.395 1.00 101.48 ? 472  ASN A C   1 
ATOM   2795  O O   . ASN A 1 471 ? 27.400  28.170  161.614 1.00 113.50 ? 472  ASN A O   1 
ATOM   2796  C CB  . ASN A 1 471 ? 26.391  25.592  160.841 1.00 91.17  ? 472  ASN A CB  1 
ATOM   2797  C CG  . ASN A 1 471 ? 25.126  25.041  161.462 1.00 88.39  ? 472  ASN A CG  1 
ATOM   2798  O OD1 . ASN A 1 471 ? 24.803  25.336  162.611 1.00 102.65 ? 472  ASN A OD1 1 
ATOM   2799  N ND2 . ASN A 1 471 ? 24.400  24.230  160.698 1.00 72.59  ? 472  ASN A ND2 1 
ATOM   2800  N N   . GLY A 1 472 ? 27.743  27.425  163.698 1.00 106.80 ? 473  GLY A N   1 
ATOM   2801  C CA  . GLY A 1 472 ? 27.792  28.782  164.218 1.00 114.90 ? 473  GLY A CA  1 
ATOM   2802  C C   . GLY A 1 472 ? 27.979  28.964  165.713 1.00 114.84 ? 473  GLY A C   1 
ATOM   2803  O O   . GLY A 1 472 ? 28.462  28.074  166.412 1.00 108.80 ? 473  GLY A O   1 
ATOM   2804  N N   . ASN A 1 473 ? 27.612  30.148  166.195 1.00 118.28 ? 474  ASN A N   1 
ATOM   2805  C CA  . ASN A 1 473 ? 27.697  30.470  167.615 1.00 117.08 ? 474  ASN A CA  1 
ATOM   2806  C C   . ASN A 1 473 ? 26.503  29.930  168.393 1.00 106.47 ? 474  ASN A C   1 
ATOM   2807  O O   . ASN A 1 473 ? 26.634  28.990  169.177 1.00 99.86  ? 474  ASN A O   1 
ATOM   2808  C CB  . ASN A 1 473 ? 27.807  31.985  167.817 1.00 120.06 ? 474  ASN A CB  1 
ATOM   2809  C CG  . ASN A 1 473 ? 29.083  32.563  167.235 1.00 118.89 ? 474  ASN A CG  1 
ATOM   2810  O OD1 . ASN A 1 473 ? 30.119  32.604  167.899 1.00 119.38 ? 474  ASN A OD1 1 
ATOM   2811  N ND2 . ASN A 1 473 ? 29.012  33.019  165.989 1.00 116.18 ? 474  ASN A ND2 1 
ATOM   2812  N N   . SER B 1 28  ? -13.259 52.855  128.374 1.00 107.78 ? 29   SER B N   1 
ATOM   2813  C CA  . SER B 1 28  ? -12.854 51.492  128.706 1.00 107.56 ? 29   SER B CA  1 
ATOM   2814  C C   . SER B 1 28  ? -13.122 50.553  127.532 1.00 97.85  ? 29   SER B C   1 
ATOM   2815  O O   . SER B 1 28  ? -12.986 50.946  126.374 1.00 112.40 ? 29   SER B O   1 
ATOM   2816  C CB  . SER B 1 28  ? -13.607 51.005  129.945 1.00 109.78 ? 29   SER B CB  1 
ATOM   2817  O OG  . SER B 1 28  ? -13.592 51.986  130.969 1.00 111.05 ? 29   SER B OG  1 
ATOM   2818  N N   . ARG B 1 29  ? -13.494 49.314  127.847 1.00 75.39  ? 30   ARG B N   1 
ATOM   2819  C CA  . ARG B 1 29  ? -13.939 48.329  126.855 1.00 78.77  ? 30   ARG B CA  1 
ATOM   2820  C C   . ARG B 1 29  ? -12.993 48.114  125.676 1.00 96.95  ? 30   ARG B C   1 
ATOM   2821  O O   . ARG B 1 29  ? -13.438 47.825  124.565 1.00 96.52  ? 30   ARG B O   1 
ATOM   2822  C CB  . ARG B 1 29  ? -15.324 48.695  126.318 1.00 69.64  ? 30   ARG B CB  1 
ATOM   2823  C CG  . ARG B 1 29  ? -16.408 48.807  127.371 1.00 71.07  ? 30   ARG B CG  1 
ATOM   2824  C CD  . ARG B 1 29  ? -17.732 49.162  126.720 1.00 75.46  ? 30   ARG B CD  1 
ATOM   2825  N NE  . ARG B 1 29  ? -18.813 49.307  127.687 1.00 76.10  ? 30   ARG B NE  1 
ATOM   2826  C CZ  . ARG B 1 29  ? -20.073 49.565  127.355 1.00 78.01  ? 30   ARG B CZ  1 
ATOM   2827  N NH1 . ARG B 1 29  ? -20.407 49.703  126.079 1.00 74.95  ? 30   ARG B NH1 1 
ATOM   2828  N NH2 . ARG B 1 29  ? -21.000 49.682  128.296 1.00 86.54  ? 30   ARG B NH2 1 
ATOM   2829  N N   . SER B 1 30  ? -11.693 48.249  125.911 1.00 108.13 ? 31   SER B N   1 
ATOM   2830  C CA  . SER B 1 30  ? -10.719 48.028  124.851 1.00 99.80  ? 31   SER B CA  1 
ATOM   2831  C C   . SER B 1 30  ? -10.079 46.652  124.989 1.00 92.97  ? 31   SER B C   1 
ATOM   2832  O O   . SER B 1 30  ? -9.748  46.220  126.093 1.00 97.19  ? 31   SER B O   1 
ATOM   2833  C CB  . SER B 1 30  ? -9.649  49.118  124.858 1.00 101.71 ? 31   SER B CB  1 
ATOM   2834  O OG  . SER B 1 30  ? -8.785  48.982  123.743 1.00 105.88 ? 31   SER B OG  1 
ATOM   2835  N N   . CYS B 1 31  ? -9.909  45.969  123.862 1.00 88.83  ? 32   CYS B N   1 
ATOM   2836  C CA  . CYS B 1 31  ? -9.371  44.610  123.853 1.00 85.54  ? 32   CYS B CA  1 
ATOM   2837  C C   . CYS B 1 31  ? -7.856  44.545  123.648 1.00 82.13  ? 32   CYS B C   1 
ATOM   2838  O O   . CYS B 1 31  ? -7.298  43.463  123.495 1.00 85.76  ? 32   CYS B O   1 
ATOM   2839  C CB  . CYS B 1 31  ? -10.099 43.750  122.815 1.00 78.98  ? 32   CYS B CB  1 
ATOM   2840  S SG  . CYS B 1 31  ? -11.749 43.211  123.335 1.00 79.81  ? 32   CYS B SG  1 
ATOM   2841  N N   . GLY B 1 32  ? -7.204  45.704  123.639 1.00 76.23  ? 33   GLY B N   1 
ATOM   2842  C CA  . GLY B 1 32  ? -5.779  45.803  123.364 1.00 74.66  ? 33   GLY B CA  1 
ATOM   2843  C C   . GLY B 1 32  ? -4.856  44.879  124.146 1.00 77.41  ? 33   GLY B C   1 
ATOM   2844  O O   . GLY B 1 32  ? -4.015  44.193  123.555 1.00 82.10  ? 33   GLY B O   1 
ATOM   2845  N N   . GLU B 1 33  ? -5.000  44.866  125.470 1.00 75.27  ? 34   GLU B N   1 
ATOM   2846  C CA  . GLU B 1 33  ? -4.149  44.040  126.322 1.00 78.33  ? 34   GLU B CA  1 
ATOM   2847  C C   . GLU B 1 33  ? -4.312  42.565  125.991 1.00 78.20  ? 34   GLU B C   1 
ATOM   2848  O O   . GLU B 1 33  ? -3.331  41.862  125.735 1.00 78.61  ? 34   GLU B O   1 
ATOM   2849  C CB  . GLU B 1 33  ? -4.471  44.268  127.797 1.00 90.53  ? 34   GLU B CB  1 
ATOM   2850  C CG  . GLU B 1 33  ? -4.253  45.685  128.286 1.00 108.04 ? 34   GLU B CG  1 
ATOM   2851  C CD  . GLU B 1 33  ? -4.406  45.793  129.788 1.00 121.72 ? 34   GLU B CD  1 
ATOM   2852  O OE1 . GLU B 1 33  ? -4.394  44.740  130.461 1.00 119.67 ? 34   GLU B OE1 1 
ATOM   2853  O OE2 . GLU B 1 33  ? -4.542  46.925  130.295 1.00 134.03 ? 34   GLU B OE2 1 
ATOM   2854  N N   . VAL B 1 34  ? -5.560  42.107  125.994 1.00 74.36  ? 35   VAL B N   1 
ATOM   2855  C CA  . VAL B 1 34  ? -5.881  40.725  125.659 1.00 63.18  ? 35   VAL B CA  1 
ATOM   2856  C C   . VAL B 1 34  ? -5.347  40.372  124.272 1.00 69.44  ? 35   VAL B C   1 
ATOM   2857  O O   . VAL B 1 34  ? -4.920  39.250  124.032 1.00 65.78  ? 35   VAL B O   1 
ATOM   2858  C CB  . VAL B 1 34  ? -7.405  40.473  125.742 1.00 50.30  ? 35   VAL B CB  1 
ATOM   2859  C CG1 . VAL B 1 34  ? -7.754  39.073  125.265 1.00 46.81  ? 35   VAL B CG1 1 
ATOM   2860  C CG2 . VAL B 1 34  ? -7.897  40.692  127.167 1.00 46.96  ? 35   VAL B CG2 1 
ATOM   2861  N N   . ARG B 1 35  ? -5.352  41.351  123.373 1.00 72.80  ? 36   ARG B N   1 
ATOM   2862  C CA  . ARG B 1 35  ? -4.820  41.180  122.027 1.00 72.45  ? 36   ARG B CA  1 
ATOM   2863  C C   . ARG B 1 35  ? -3.308  40.961  122.082 1.00 70.78  ? 36   ARG B C   1 
ATOM   2864  O O   . ARG B 1 35  ? -2.756  40.174  121.305 1.00 68.18  ? 36   ARG B O   1 
ATOM   2865  C CB  . ARG B 1 35  ? -5.146  42.412  121.173 1.00 72.53  ? 36   ARG B CB  1 
ATOM   2866  C CG  . ARG B 1 35  ? -4.747  42.306  119.711 1.00 78.09  ? 36   ARG B CG  1 
ATOM   2867  C CD  . ARG B 1 35  ? -4.967  43.628  118.986 1.00 89.45  ? 36   ARG B CD  1 
ATOM   2868  N NE  . ARG B 1 35  ? -5.162  43.443  117.550 1.00 103.13 ? 36   ARG B NE  1 
ATOM   2869  C CZ  . ARG B 1 35  ? -6.352  43.382  116.960 1.00 109.94 ? 36   ARG B CZ  1 
ATOM   2870  N NH1 . ARG B 1 35  ? -7.459  43.493  117.683 1.00 108.97 ? 36   ARG B NH1 1 
ATOM   2871  N NH2 . ARG B 1 35  ? -6.439  43.213  115.647 1.00 110.64 ? 36   ARG B NH2 1 
ATOM   2872  N N   . GLN B 1 36  ? -2.647  41.663  123.002 1.00 72.64  ? 37   GLN B N   1 
ATOM   2873  C CA  . GLN B 1 36  ? -1.205  41.528  123.201 1.00 86.50  ? 37   GLN B CA  1 
ATOM   2874  C C   . GLN B 1 36  ? -0.834  40.164  123.797 1.00 84.22  ? 37   GLN B C   1 
ATOM   2875  O O   . GLN B 1 36  ? 0.136   39.541  123.362 1.00 88.26  ? 37   GLN B O   1 
ATOM   2876  C CB  . GLN B 1 36  ? -0.676  42.685  124.065 1.00 92.52  ? 37   GLN B CB  1 
ATOM   2877  C CG  . GLN B 1 36  ? 0.426   42.327  125.066 1.00 97.56  ? 37   GLN B CG  1 
ATOM   2878  C CD  . GLN B 1 36  ? 1.778   42.090  124.418 1.00 104.04 ? 37   GLN B CD  1 
ATOM   2879  O OE1 . GLN B 1 36  ? 2.019   42.496  123.281 1.00 111.19 ? 37   GLN B OE1 1 
ATOM   2880  N NE2 . GLN B 1 36  ? 2.670   41.423  125.144 1.00 101.19 ? 37   GLN B NE2 1 
ATOM   2881  N N   . ILE B 1 37  ? -1.605  39.698  124.779 1.00 65.96  ? 38   ILE B N   1 
ATOM   2882  C CA  . ILE B 1 37  ? -1.359  38.387  125.398 1.00 67.92  ? 38   ILE B CA  1 
ATOM   2883  C C   . ILE B 1 37  ? -1.692  37.217  124.461 1.00 75.48  ? 38   ILE B C   1 
ATOM   2884  O O   . ILE B 1 37  ? -0.859  36.310  124.275 1.00 87.18  ? 38   ILE B O   1 
ATOM   2885  C CB  . ILE B 1 37  ? -2.121  38.223  126.741 1.00 74.68  ? 38   ILE B CB  1 
ATOM   2886  C CG1 . ILE B 1 37  ? -1.376  38.941  127.867 1.00 65.63  ? 38   ILE B CG1 1 
ATOM   2887  C CG2 . ILE B 1 37  ? -2.303  36.747  127.103 1.00 71.98  ? 38   ILE B CG2 1 
ATOM   2888  C CD1 . ILE B 1 37  ? -1.489  40.439  127.833 1.00 58.17  ? 38   ILE B CD1 1 
ATOM   2889  N N   . TYR B 1 38  ? -2.899  37.243  123.888 1.00 71.01  ? 39   TYR B N   1 
ATOM   2890  C CA  . TYR B 1 38  ? -3.317  36.281  122.873 1.00 73.75  ? 39   TYR B CA  1 
ATOM   2891  C C   . TYR B 1 38  ? -2.189  36.248  121.863 1.00 92.87  ? 39   TYR B C   1 
ATOM   2892  O O   . TYR B 1 38  ? -1.495  35.239  121.755 1.00 98.96  ? 39   TYR B O   1 
ATOM   2893  C CB  . TYR B 1 38  ? -4.621  36.741  122.231 1.00 69.76  ? 39   TYR B CB  1 
ATOM   2894  C CG  . TYR B 1 38  ? -5.319  35.687  121.406 1.00 66.04  ? 39   TYR B CG  1 
ATOM   2895  C CD1 . TYR B 1 38  ? -5.901  34.578  122.008 1.00 63.90  ? 39   TYR B CD1 1 
ATOM   2896  C CD2 . TYR B 1 38  ? -5.405  35.805  120.024 1.00 68.76  ? 39   TYR B CD2 1 
ATOM   2897  C CE1 . TYR B 1 38  ? -6.538  33.613  121.257 1.00 57.65  ? 39   TYR B CE1 1 
ATOM   2898  C CE2 . TYR B 1 38  ? -6.042  34.845  119.269 1.00 68.24  ? 39   TYR B CE2 1 
ATOM   2899  C CZ  . TYR B 1 38  ? -6.605  33.753  119.893 1.00 63.88  ? 39   TYR B CZ  1 
ATOM   2900  O OH  . TYR B 1 38  ? -7.241  32.788  119.154 1.00 68.26  ? 39   TYR B OH  1 
ATOM   2901  N N   . GLY B 1 39  ? -2.042  37.309  121.075 1.00 102.94 ? 40   GLY B N   1 
ATOM   2902  C CA  . GLY B 1 39  ? -0.738  37.937  120.970 1.00 103.81 ? 40   GLY B CA  1 
ATOM   2903  C C   . GLY B 1 39  ? 0.471   37.032  120.923 1.00 99.67  ? 40   GLY B C   1 
ATOM   2904  O O   . GLY B 1 39  ? 0.609   36.164  120.065 1.00 93.89  ? 40   GLY B O   1 
ATOM   2905  N N   . ALA B 1 40  ? 1.361   37.290  121.880 1.00 98.42  ? 41   ALA B N   1 
ATOM   2906  C CA  . ALA B 1 40  ? 2.551   36.480  122.138 1.00 91.97  ? 41   ALA B CA  1 
ATOM   2907  C C   . ALA B 1 40  ? 2.282   34.985  122.356 1.00 92.59  ? 41   ALA B C   1 
ATOM   2908  O O   . ALA B 1 40  ? 3.192   34.173  122.183 1.00 101.33 ? 41   ALA B O   1 
ATOM   2909  C CB  . ALA B 1 40  ? 3.306   37.042  123.343 1.00 84.90  ? 41   ALA B CB  1 
ATOM   2910  N N   . LYS B 1 41  ? 1.064   34.617  122.753 1.00 90.00  ? 42   LYS B N   1 
ATOM   2911  C CA  . LYS B 1 41  ? 0.734   33.198  122.928 1.00 85.20  ? 42   LYS B CA  1 
ATOM   2912  C C   . LYS B 1 41  ? 0.731   32.404  121.617 1.00 84.51  ? 42   LYS B C   1 
ATOM   2913  O O   . LYS B 1 41  ? 0.591   31.182  121.630 1.00 77.80  ? 42   LYS B O   1 
ATOM   2914  C CB  . LYS B 1 41  ? -0.588  33.029  123.686 1.00 76.05  ? 42   LYS B CB  1 
ATOM   2915  C CG  . LYS B 1 41  ? -0.447  33.204  125.186 1.00 75.63  ? 42   LYS B CG  1 
ATOM   2916  C CD  . LYS B 1 41  ? 0.567   32.215  125.742 1.00 80.82  ? 42   LYS B CD  1 
ATOM   2917  C CE  . LYS B 1 41  ? 1.201   32.734  127.017 1.00 82.31  ? 42   LYS B CE  1 
ATOM   2918  N NZ  . LYS B 1 41  ? 0.168   33.071  128.031 1.00 81.07  ? 42   LYS B NZ  1 
ATOM   2919  N N   . GLY B 1 42  ? 0.855   33.104  120.492 1.00 89.59  ? 43   GLY B N   1 
ATOM   2920  C CA  . GLY B 1 42  ? 1.117   32.458  119.218 1.00 90.11  ? 43   GLY B CA  1 
ATOM   2921  C C   . GLY B 1 42  ? -0.053  32.303  118.263 1.00 96.14  ? 43   GLY B C   1 
ATOM   2922  O O   . GLY B 1 42  ? 0.102   31.728  117.185 1.00 94.34  ? 43   GLY B O   1 
ATOM   2923  N N   . PHE B 1 43  ? -1.224  32.800  118.649 1.00 97.10  ? 44   PHE B N   1 
ATOM   2924  C CA  . PHE B 1 43  ? -2.416  32.661  117.810 1.00 91.74  ? 44   PHE B CA  1 
ATOM   2925  C C   . PHE B 1 43  ? -2.637  33.864  116.887 1.00 97.37  ? 44   PHE B C   1 
ATOM   2926  O O   . PHE B 1 43  ? -1.863  34.823  116.903 1.00 94.26  ? 44   PHE B O   1 
ATOM   2927  C CB  . PHE B 1 43  ? -3.656  32.386  118.668 1.00 86.45  ? 44   PHE B CB  1 
ATOM   2928  C CG  . PHE B 1 43  ? -3.485  31.235  119.623 1.00 90.51  ? 44   PHE B CG  1 
ATOM   2929  C CD1 . PHE B 1 43  ? -3.621  29.924  119.189 1.00 86.67  ? 44   PHE B CD1 1 
ATOM   2930  C CD2 . PHE B 1 43  ? -3.172  31.465  120.952 1.00 91.95  ? 44   PHE B CD2 1 
ATOM   2931  C CE1 . PHE B 1 43  ? -3.452  28.865  120.069 1.00 78.34  ? 44   PHE B CE1 1 
ATOM   2932  C CE2 . PHE B 1 43  ? -3.003  30.412  121.835 1.00 81.60  ? 44   PHE B CE2 1 
ATOM   2933  C CZ  . PHE B 1 43  ? -3.143  29.111  121.394 1.00 75.52  ? 44   PHE B CZ  1 
ATOM   2934  N N   . SER B 1 44  ? -3.694  33.807  116.080 1.00 107.28 ? 45   SER B N   1 
ATOM   2935  C CA  . SER B 1 44  ? -3.947  34.843  115.077 1.00 114.59 ? 45   SER B CA  1 
ATOM   2936  C C   . SER B 1 44  ? -4.729  36.042  115.631 1.00 105.56 ? 45   SER B C   1 
ATOM   2937  O O   . SER B 1 44  ? -5.816  35.888  116.185 1.00 105.45 ? 45   SER B O   1 
ATOM   2938  C CB  . SER B 1 44  ? -4.659  34.250  113.854 1.00 117.49 ? 45   SER B CB  1 
ATOM   2939  O OG  . SER B 1 44  ? -5.945  33.759  114.191 1.00 114.13 ? 45   SER B OG  1 
ATOM   2940  N N   . LEU B 1 45  ? -4.163  37.235  115.470 1.00 92.54  ? 46   LEU B N   1 
ATOM   2941  C CA  . LEU B 1 45  ? -4.752  38.473  115.972 1.00 80.88  ? 46   LEU B CA  1 
ATOM   2942  C C   . LEU B 1 45  ? -6.125  38.735  115.348 1.00 81.42  ? 46   LEU B C   1 
ATOM   2943  O O   . LEU B 1 45  ? -6.990  39.368  115.960 1.00 80.78  ? 46   LEU B O   1 
ATOM   2944  C CB  . LEU B 1 45  ? -3.812  39.641  115.674 1.00 65.74  ? 46   LEU B CB  1 
ATOM   2945  C CG  . LEU B 1 45  ? -2.425  39.596  116.319 1.00 58.00  ? 46   LEU B CG  1 
ATOM   2946  C CD1 . LEU B 1 45  ? -1.481  40.624  115.697 1.00 61.89  ? 46   LEU B CD1 1 
ATOM   2947  C CD2 . LEU B 1 45  ? -2.534  39.806  117.825 1.00 49.93  ? 46   LEU B CD2 1 
ATOM   2948  N N   . SER B 1 46  ? -6.330  38.231  114.133 1.00 80.09  ? 47   SER B N   1 
ATOM   2949  C CA  . SER B 1 46  ? -7.619  38.363  113.461 1.00 77.05  ? 47   SER B CA  1 
ATOM   2950  C C   . SER B 1 46  ? -8.759  37.772  114.291 1.00 71.20  ? 47   SER B C   1 
ATOM   2951  O O   . SER B 1 46  ? -9.924  38.080  114.047 1.00 70.00  ? 47   SER B O   1 
ATOM   2952  C CB  . SER B 1 46  ? -7.582  37.699  112.086 1.00 86.87  ? 47   SER B CB  1 
ATOM   2953  O OG  . SER B 1 46  ? -6.578  38.274  111.271 1.00 95.58  ? 47   SER B OG  1 
ATOM   2954  N N   . ASP B 1 47  ? -8.426  36.936  115.274 1.00 77.26  ? 48   ASP B N   1 
ATOM   2955  C CA  . ASP B 1 47  ? -9.448  36.344  116.134 1.00 82.83  ? 48   ASP B CA  1 
ATOM   2956  C C   . ASP B 1 47  ? -9.971  37.290  117.208 1.00 72.52  ? 48   ASP B C   1 
ATOM   2957  O O   . ASP B 1 47  ? -11.086 37.109  117.694 1.00 74.51  ? 48   ASP B O   1 
ATOM   2958  C CB  . ASP B 1 47  ? -8.934  35.063  116.795 1.00 89.35  ? 48   ASP B CB  1 
ATOM   2959  C CG  . ASP B 1 47  ? -8.631  33.977  115.790 1.00 83.60  ? 48   ASP B CG  1 
ATOM   2960  O OD1 . ASP B 1 47  ? -9.171  34.057  114.668 1.00 86.48  ? 48   ASP B OD1 1 
ATOM   2961  O OD2 . ASP B 1 47  ? -7.855  33.052  116.110 1.00 73.04  ? 48   ASP B OD2 1 
ATOM   2962  N N   . VAL B 1 48  ? -9.179  38.287  117.593 1.00 66.30  ? 49   VAL B N   1 
ATOM   2963  C CA  . VAL B 1 48  ? -9.609  39.163  118.681 1.00 66.42  ? 49   VAL B CA  1 
ATOM   2964  C C   . VAL B 1 48  ? -10.274 40.464  118.210 1.00 70.81  ? 49   VAL B C   1 
ATOM   2965  O O   . VAL B 1 48  ? -9.695  41.233  117.437 1.00 75.53  ? 49   VAL B O   1 
ATOM   2966  C CB  . VAL B 1 48  ? -8.475  39.442  119.696 1.00 68.76  ? 49   VAL B CB  1 
ATOM   2967  C CG1 . VAL B 1 48  ? -7.186  39.807  118.992 1.00 70.40  ? 49   VAL B CG1 1 
ATOM   2968  C CG2 . VAL B 1 48  ? -8.894  40.528  120.674 1.00 62.77  ? 49   VAL B CG2 1 
ATOM   2969  N N   . PRO B 1 49  ? -11.511 40.700  118.677 1.00 79.99  ? 50   PRO B N   1 
ATOM   2970  C CA  . PRO B 1 49  ? -12.329 41.868  118.320 1.00 76.66  ? 50   PRO B CA  1 
ATOM   2971  C C   . PRO B 1 49  ? -11.712 43.195  118.763 1.00 81.94  ? 50   PRO B C   1 
ATOM   2972  O O   . PRO B 1 49  ? -10.836 43.209  119.628 1.00 77.97  ? 50   PRO B O   1 
ATOM   2973  C CB  . PRO B 1 49  ? -13.636 41.627  119.085 1.00 72.84  ? 50   PRO B CB  1 
ATOM   2974  C CG  . PRO B 1 49  ? -13.660 40.161  119.369 1.00 75.76  ? 50   PRO B CG  1 
ATOM   2975  C CD  . PRO B 1 49  ? -12.231 39.780  119.574 1.00 81.38  ? 50   PRO B CD  1 
ATOM   2976  N N   . GLN B 1 50  ? -12.168 44.296  118.169 1.00 86.61  ? 51   GLN B N   1 
ATOM   2977  C CA  . GLN B 1 50  ? -11.717 45.627  118.568 1.00 83.63  ? 51   GLN B CA  1 
ATOM   2978  C C   . GLN B 1 50  ? -12.176 45.953  119.989 1.00 72.59  ? 51   GLN B C   1 
ATOM   2979  O O   . GLN B 1 50  ? -11.392 46.429  120.811 1.00 58.34  ? 51   GLN B O   1 
ATOM   2980  C CB  . GLN B 1 50  ? -12.222 46.696  117.591 1.00 95.27  ? 51   GLN B CB  1 
ATOM   2981  C CG  . GLN B 1 50  ? -11.657 46.587  116.178 1.00 106.48 ? 51   GLN B CG  1 
ATOM   2982  C CD  . GLN B 1 50  ? -12.100 47.729  115.274 1.00 116.28 ? 51   GLN B CD  1 
ATOM   2983  O OE1 . GLN B 1 50  ? -12.915 48.566  115.663 1.00 113.37 ? 51   GLN B OE1 1 
ATOM   2984  N NE2 . GLN B 1 50  ? -11.559 47.765  114.061 1.00 117.63 ? 51   GLN B NE2 1 
ATOM   2985  N N   . ALA B 1 51  ? -13.449 45.690  120.270 1.00 71.74  ? 52   ALA B N   1 
ATOM   2986  C CA  . ALA B 1 51  ? -14.020 45.965  121.585 1.00 67.49  ? 52   ALA B CA  1 
ATOM   2987  C C   . ALA B 1 51  ? -14.694 44.728  122.176 1.00 62.66  ? 52   ALA B C   1 
ATOM   2988  O O   . ALA B 1 51  ? -14.701 43.661  121.562 1.00 66.44  ? 52   ALA B O   1 
ATOM   2989  C CB  . ALA B 1 51  ? -15.005 47.120  121.501 1.00 66.98  ? 52   ALA B CB  1 
ATOM   2990  N N   . GLU B 1 52  ? -15.264 44.882  123.367 1.00 57.41  ? 53   GLU B N   1 
ATOM   2991  C CA  . GLU B 1 52  ? -15.902 43.771  124.067 1.00 58.43  ? 53   GLU B CA  1 
ATOM   2992  C C   . GLU B 1 52  ? -17.180 43.298  123.378 1.00 60.77  ? 53   GLU B C   1 
ATOM   2993  O O   . GLU B 1 52  ? -17.870 44.077  122.722 1.00 73.32  ? 53   GLU B O   1 
ATOM   2994  C CB  . GLU B 1 52  ? -16.215 44.158  125.514 1.00 64.91  ? 53   GLU B CB  1 
ATOM   2995  C CG  . GLU B 1 52  ? -14.994 44.500  126.352 1.00 73.92  ? 53   GLU B CG  1 
ATOM   2996  C CD  . GLU B 1 52  ? -15.344 44.773  127.803 1.00 72.96  ? 53   GLU B CD  1 
ATOM   2997  O OE1 . GLU B 1 52  ? -16.539 44.684  128.154 1.00 63.58  ? 53   GLU B OE1 1 
ATOM   2998  O OE2 . GLU B 1 52  ? -14.424 45.077  128.592 1.00 68.95  ? 53   GLU B OE2 1 
ATOM   2999  N N   . ILE B 1 53  ? -17.478 42.010  123.528 1.00 60.93  ? 54   ILE B N   1 
ATOM   3000  C CA  . ILE B 1 53  ? -18.723 41.427  123.036 1.00 61.97  ? 54   ILE B CA  1 
ATOM   3001  C C   . ILE B 1 53  ? -19.338 40.594  124.162 1.00 70.97  ? 54   ILE B C   1 
ATOM   3002  O O   . ILE B 1 53  ? -18.655 40.261  125.130 1.00 78.00  ? 54   ILE B O   1 
ATOM   3003  C CB  . ILE B 1 53  ? -18.489 40.543  121.784 1.00 84.65  ? 54   ILE B CB  1 
ATOM   3004  C CG1 . ILE B 1 53  ? -17.470 41.189  120.842 1.00 88.54  ? 54   ILE B CG1 1 
ATOM   3005  C CG2 . ILE B 1 53  ? -19.794 40.292  121.037 1.00 91.87  ? 54   ILE B CG2 1 
ATOM   3006  C CD1 . ILE B 1 53  ? -17.297 40.452  119.532 1.00 97.43  ? 54   ILE B CD1 1 
ATOM   3007  N N   . SER B 1 54  ? -20.623 40.266  124.042 1.00 80.51  ? 55   SER B N   1 
ATOM   3008  C CA  . SER B 1 54  ? -21.321 39.496  125.070 1.00 95.08  ? 55   SER B CA  1 
ATOM   3009  C C   . SER B 1 54  ? -20.763 38.079  125.210 1.00 97.50  ? 55   SER B C   1 
ATOM   3010  O O   . SER B 1 54  ? -20.196 37.525  124.267 1.00 85.89  ? 55   SER B O   1 
ATOM   3011  C CB  . SER B 1 54  ? -22.823 39.449  124.782 1.00 99.93  ? 55   SER B CB  1 
ATOM   3012  O OG  . SER B 1 54  ? -23.084 38.839  123.530 1.00 107.54 ? 55   SER B OG  1 
ATOM   3013  N N   . GLY B 1 55  ? -20.929 37.502  126.397 1.00 102.95 ? 56   GLY B N   1 
ATOM   3014  C CA  . GLY B 1 55  ? -20.345 36.211  126.715 1.00 109.90 ? 56   GLY B CA  1 
ATOM   3015  C C   . GLY B 1 55  ? -21.294 35.028  126.704 1.00 115.24 ? 56   GLY B C   1 
ATOM   3016  O O   . GLY B 1 55  ? -21.016 34.006  127.332 1.00 115.84 ? 56   GLY B O   1 
ATOM   3017  N N   . GLU B 1 56  ? -22.413 35.157  125.999 1.00 116.19 ? 57   GLU B N   1 
ATOM   3018  C CA  . GLU B 1 56  ? -23.373 34.062  125.895 1.00 107.80 ? 57   GLU B CA  1 
ATOM   3019  C C   . GLU B 1 56  ? -22.793 32.874  125.128 1.00 92.21  ? 57   GLU B C   1 
ATOM   3020  O O   . GLU B 1 56  ? -23.311 31.760  125.207 1.00 83.24  ? 57   GLU B O   1 
ATOM   3021  C CB  . GLU B 1 56  ? -24.666 34.537  125.229 1.00 116.46 ? 57   GLU B CB  1 
ATOM   3022  C CG  . GLU B 1 56  ? -25.462 35.532  126.056 1.00 135.80 ? 57   GLU B CG  1 
ATOM   3023  C CD  . GLU B 1 56  ? -26.769 35.923  125.395 1.00 159.13 ? 57   GLU B CD  1 
ATOM   3024  O OE1 . GLU B 1 56  ? -26.981 35.546  124.223 1.00 167.16 ? 57   GLU B OE1 1 
ATOM   3025  O OE2 . GLU B 1 56  ? -27.587 36.605  126.048 1.00 165.66 ? 57   GLU B OE2 1 
ATOM   3026  N N   . HIS B 1 57  ? -21.714 33.120  124.393 1.00 85.28  ? 58   HIS B N   1 
ATOM   3027  C CA  . HIS B 1 57  ? -21.076 32.086  123.585 1.00 87.05  ? 58   HIS B CA  1 
ATOM   3028  C C   . HIS B 1 57  ? -19.943 31.379  124.325 1.00 78.54  ? 58   HIS B C   1 
ATOM   3029  O O   . HIS B 1 57  ? -19.271 30.516  123.761 1.00 62.68  ? 58   HIS B O   1 
ATOM   3030  C CB  . HIS B 1 57  ? -20.542 32.684  122.281 1.00 95.35  ? 58   HIS B CB  1 
ATOM   3031  C CG  . HIS B 1 57  ? -19.371 33.602  122.472 1.00 101.57 ? 58   HIS B CG  1 
ATOM   3032  N ND1 . HIS B 1 57  ? -19.163 34.310  123.631 1.00 99.79  ? 58   HIS B ND1 1 
ATOM   3033  C CD2 . HIS B 1 57  ? -18.345 33.916  121.644 1.00 103.04 ? 58   HIS B CD2 1 
ATOM   3034  C CE1 . HIS B 1 57  ? -18.057 35.029  123.514 1.00 95.58  ? 58   HIS B CE1 1 
ATOM   3035  N NE2 . HIS B 1 57  ? -17.544 34.806  122.320 1.00 96.14  ? 58   HIS B NE2 1 
ATOM   3036  N N   . LEU B 1 58  ? -19.726 31.748  125.584 1.00 87.03  ? 59   LEU B N   1 
ATOM   3037  C CA  . LEU B 1 58  ? -18.636 31.165  126.360 1.00 87.90  ? 59   LEU B CA  1 
ATOM   3038  C C   . LEU B 1 58  ? -19.065 29.871  127.042 1.00 84.27  ? 59   LEU B C   1 
ATOM   3039  O O   . LEU B 1 58  ? -19.953 29.873  127.895 1.00 76.66  ? 59   LEU B O   1 
ATOM   3040  C CB  . LEU B 1 58  ? -18.139 32.162  127.410 1.00 83.20  ? 59   LEU B CB  1 
ATOM   3041  C CG  . LEU B 1 58  ? -17.599 33.500  126.902 1.00 71.25  ? 59   LEU B CG  1 
ATOM   3042  C CD1 . LEU B 1 58  ? -17.351 34.447  128.065 1.00 63.22  ? 59   LEU B CD1 1 
ATOM   3043  C CD2 . LEU B 1 58  ? -16.325 33.297  126.094 1.00 66.87  ? 59   LEU B CD2 1 
ATOM   3044  N N   . ARG B 1 59  ? -18.439 28.764  126.653 1.00 86.37  ? 60   ARG B N   1 
ATOM   3045  C CA  . ARG B 1 59  ? -18.686 27.484  127.303 1.00 88.88  ? 60   ARG B CA  1 
ATOM   3046  C C   . ARG B 1 59  ? -17.949 27.353  128.636 1.00 82.76  ? 60   ARG B C   1 
ATOM   3047  O O   . ARG B 1 59  ? -18.551 27.036  129.661 1.00 88.13  ? 60   ARG B O   1 
ATOM   3048  C CB  . ARG B 1 59  ? -18.289 26.332  126.377 1.00 99.09  ? 60   ARG B CB  1 
ATOM   3049  C CG  . ARG B 1 59  ? -19.133 26.224  125.119 1.00 112.05 ? 60   ARG B CG  1 
ATOM   3050  C CD  . ARG B 1 59  ? -20.605 26.066  125.464 1.00 125.72 ? 60   ARG B CD  1 
ATOM   3051  N NE  . ARG B 1 59  ? -21.428 25.817  124.284 1.00 133.89 ? 60   ARG B NE  1 
ATOM   3052  C CZ  . ARG B 1 59  ? -21.742 24.606  123.835 1.00 132.88 ? 60   ARG B CZ  1 
ATOM   3053  N NH1 . ARG B 1 59  ? -21.301 23.527  124.469 1.00 128.59 ? 60   ARG B NH1 1 
ATOM   3054  N NH2 . ARG B 1 59  ? -22.497 24.471  122.753 1.00 131.05 ? 60   ARG B NH2 1 
ATOM   3055  N N   . ILE B 1 60  ? -16.641 27.597  128.610 1.00 73.07  ? 61   ILE B N   1 
ATOM   3056  C CA  . ILE B 1 60  ? -15.801 27.417  129.792 1.00 66.87  ? 61   ILE B CA  1 
ATOM   3057  C C   . ILE B 1 60  ? -15.817 28.606  130.753 1.00 58.27  ? 61   ILE B C   1 
ATOM   3058  O O   . ILE B 1 60  ? -15.940 28.435  131.967 1.00 50.28  ? 61   ILE B O   1 
ATOM   3059  C CB  . ILE B 1 60  ? -14.342 27.121  129.393 1.00 66.04  ? 61   ILE B CB  1 
ATOM   3060  C CG1 . ILE B 1 60  ? -14.298 26.098  128.255 1.00 63.39  ? 61   ILE B CG1 1 
ATOM   3061  C CG2 . ILE B 1 60  ? -13.549 26.636  130.598 1.00 44.90  ? 61   ILE B CG2 1 
ATOM   3062  C CD1 . ILE B 1 60  ? -12.941 25.976  127.599 1.00 63.62  ? 61   ILE B CD1 1 
ATOM   3063  N N   . CYS B 1 61  ? -15.703 29.810  130.201 1.00 62.27  ? 62   CYS B N   1 
ATOM   3064  C CA  . CYS B 1 61  ? -15.596 31.021  131.009 1.00 62.10  ? 62   CYS B CA  1 
ATOM   3065  C C   . CYS B 1 61  ? -16.965 31.516  131.458 1.00 63.14  ? 62   CYS B C   1 
ATOM   3066  O O   . CYS B 1 61  ? -17.954 31.329  130.749 1.00 72.21  ? 62   CYS B O   1 
ATOM   3067  C CB  . CYS B 1 61  ? -14.875 32.124  130.227 1.00 57.19  ? 62   CYS B CB  1 
ATOM   3068  S SG  . CYS B 1 61  ? -13.122 31.812  129.924 1.00 89.38  ? 62   CYS B SG  1 
ATOM   3069  N N   . PRO B 1 62  ? -17.025 32.142  132.647 1.00 60.05  ? 63   PRO B N   1 
ATOM   3070  C CA  . PRO B 1 62  ? -18.264 32.744  133.152 1.00 58.14  ? 63   PRO B CA  1 
ATOM   3071  C C   . PRO B 1 62  ? -18.849 33.711  132.131 1.00 65.06  ? 63   PRO B C   1 
ATOM   3072  O O   . PRO B 1 62  ? -18.113 34.511  131.554 1.00 66.00  ? 63   PRO B O   1 
ATOM   3073  C CB  . PRO B 1 62  ? -17.796 33.509  134.392 1.00 45.11  ? 63   PRO B CB  1 
ATOM   3074  C CG  . PRO B 1 62  ? -16.605 32.757  134.859 1.00 58.87  ? 63   PRO B CG  1 
ATOM   3075  C CD  . PRO B 1 62  ? -15.918 32.272  133.612 1.00 58.25  ? 63   PRO B CD  1 
ATOM   3076  N N   . GLN B 1 63  ? -20.155 33.630  131.907 1.00 73.70  ? 64   GLN B N   1 
ATOM   3077  C CA  . GLN B 1 63  ? -20.788 34.422  130.861 1.00 78.40  ? 64   GLN B CA  1 
ATOM   3078  C C   . GLN B 1 63  ? -20.937 35.888  131.258 1.00 77.13  ? 64   GLN B C   1 
ATOM   3079  O O   . GLN B 1 63  ? -21.538 36.219  132.280 1.00 78.64  ? 64   GLN B O   1 
ATOM   3080  C CB  . GLN B 1 63  ? -22.133 33.811  130.460 1.00 90.14  ? 64   GLN B CB  1 
ATOM   3081  C CG  . GLN B 1 63  ? -22.015 32.363  130.001 1.00 93.44  ? 64   GLN B CG  1 
ATOM   3082  C CD  . GLN B 1 63  ? -23.198 31.906  129.172 1.00 102.79 ? 64   GLN B CD  1 
ATOM   3083  O OE1 . GLN B 1 63  ? -23.029 31.324  128.100 1.00 101.28 ? 64   GLN B OE1 1 
ATOM   3084  N NE2 . GLN B 1 63  ? -24.404 32.161  129.667 1.00 108.77 ? 64   GLN B NE2 1 
ATOM   3085  N N   . GLY B 1 64  ? -20.371 36.757  130.428 1.00 73.77  ? 65   GLY B N   1 
ATOM   3086  C CA  . GLY B 1 64  ? -20.357 38.187  130.668 1.00 68.06  ? 65   GLY B CA  1 
ATOM   3087  C C   . GLY B 1 64  ? -19.578 38.839  129.544 1.00 73.15  ? 65   GLY B C   1 
ATOM   3088  O O   . GLY B 1 64  ? -18.965 38.141  128.738 1.00 67.89  ? 65   GLY B O   1 
ATOM   3089  N N   . TYR B 1 65  ? -19.602 40.166  129.479 1.00 81.25  ? 66   TYR B N   1 
ATOM   3090  C CA  . TYR B 1 65  ? -18.961 40.873  128.375 1.00 79.89  ? 66   TYR B CA  1 
ATOM   3091  C C   . TYR B 1 65  ? -17.463 40.598  128.313 1.00 73.74  ? 66   TYR B C   1 
ATOM   3092  O O   . TYR B 1 65  ? -16.744 40.783  129.295 1.00 74.90  ? 66   TYR B O   1 
ATOM   3093  C CB  . TYR B 1 65  ? -19.273 42.369  128.431 1.00 83.31  ? 66   TYR B CB  1 
ATOM   3094  C CG  . TYR B 1 65  ? -20.725 42.655  128.126 1.00 85.85  ? 66   TYR B CG  1 
ATOM   3095  C CD1 . TYR B 1 65  ? -21.188 42.657  126.817 1.00 88.27  ? 66   TYR B CD1 1 
ATOM   3096  C CD2 . TYR B 1 65  ? -21.638 42.892  129.145 1.00 81.79  ? 66   TYR B CD2 1 
ATOM   3097  C CE1 . TYR B 1 65  ? -22.516 42.902  126.529 1.00 96.66  ? 66   TYR B CE1 1 
ATOM   3098  C CE2 . TYR B 1 65  ? -22.971 43.140  128.866 1.00 86.93  ? 66   TYR B CE2 1 
ATOM   3099  C CZ  . TYR B 1 65  ? -23.402 43.143  127.555 1.00 88.32  ? 66   TYR B CZ  1 
ATOM   3100  O OH  . TYR B 1 65  ? -24.723 43.386  127.264 1.00 66.53  ? 66   TYR B OH  1 
ATOM   3101  N N   . THR B 1 66  ? -17.008 40.154  127.145 1.00 64.31  ? 67   THR B N   1 
ATOM   3102  C CA  . THR B 1 66  ? -15.679 39.572  127.015 1.00 57.08  ? 67   THR B CA  1 
ATOM   3103  C C   . THR B 1 66  ? -14.962 39.968  125.727 1.00 61.31  ? 67   THR B C   1 
ATOM   3104  O O   . THR B 1 66  ? -15.586 40.404  124.760 1.00 53.00  ? 67   THR B O   1 
ATOM   3105  C CB  . THR B 1 66  ? -15.760 38.035  127.050 1.00 51.86  ? 67   THR B CB  1 
ATOM   3106  O OG1 . THR B 1 66  ? -14.470 37.481  126.765 1.00 65.48  ? 67   THR B OG1 1 
ATOM   3107  C CG2 . THR B 1 66  ? -16.755 37.532  126.017 1.00 42.68  ? 67   THR B CG2 1 
ATOM   3108  N N   . CYS B 1 67  ? -13.641 39.814  125.733 1.00 66.25  ? 68   CYS B N   1 
ATOM   3109  C CA  . CYS B 1 67  ? -12.828 40.024  124.541 1.00 64.75  ? 68   CYS B CA  1 
ATOM   3110  C C   . CYS B 1 67  ? -12.533 38.703  123.834 1.00 61.35  ? 68   CYS B C   1 
ATOM   3111  O O   . CYS B 1 67  ? -11.853 38.676  122.809 1.00 64.68  ? 68   CYS B O   1 
ATOM   3112  C CB  . CYS B 1 67  ? -11.520 40.734  124.901 1.00 62.12  ? 68   CYS B CB  1 
ATOM   3113  S SG  . CYS B 1 67  ? -11.706 42.501  125.239 1.00 86.99  ? 68   CYS B SG  1 
ATOM   3114  N N   . CYS B 1 68  ? -13.052 37.612  124.390 1.00 56.49  ? 69   CYS B N   1 
ATOM   3115  C CA  . CYS B 1 68  ? -12.746 36.272  123.893 1.00 52.44  ? 69   CYS B CA  1 
ATOM   3116  C C   . CYS B 1 68  ? -13.857 35.667  123.040 1.00 52.19  ? 69   CYS B C   1 
ATOM   3117  O O   . CYS B 1 68  ? -14.937 35.353  123.541 1.00 61.85  ? 69   CYS B O   1 
ATOM   3118  C CB  . CYS B 1 68  ? -12.434 35.327  125.059 1.00 45.63  ? 69   CYS B CB  1 
ATOM   3119  S SG  . CYS B 1 68  ? -10.886 35.671  125.928 1.00 67.59  ? 69   CYS B SG  1 
ATOM   3120  N N   . THR B 1 69  ? -13.582 35.504  121.750 1.00 52.30  ? 70   THR B N   1 
ATOM   3121  C CA  . THR B 1 69  ? -14.452 34.734  120.871 1.00 66.48  ? 70   THR B CA  1 
ATOM   3122  C C   . THR B 1 69  ? -14.269 33.250  121.175 1.00 91.07  ? 70   THR B C   1 
ATOM   3123  O O   . THR B 1 69  ? -13.278 32.862  121.793 1.00 103.14 ? 70   THR B O   1 
ATOM   3124  C CB  . THR B 1 69  ? -14.140 34.995  119.389 1.00 63.51  ? 70   THR B CB  1 
ATOM   3125  O OG1 . THR B 1 69  ? -12.844 34.473  119.069 1.00 70.58  ? 70   THR B OG1 1 
ATOM   3126  C CG2 . THR B 1 69  ? -14.168 36.485  119.094 1.00 66.80  ? 70   THR B CG2 1 
ATOM   3127  N N   . SER B 1 70  ? -15.231 32.431  120.755 1.00 93.64  ? 71   SER B N   1 
ATOM   3128  C CA  . SER B 1 70  ? -15.203 30.989  121.006 1.00 86.43  ? 71   SER B CA  1 
ATOM   3129  C C   . SER B 1 70  ? -13.865 30.337  120.645 1.00 77.00  ? 71   SER B C   1 
ATOM   3130  O O   . SER B 1 70  ? -13.310 29.556  121.427 1.00 67.08  ? 71   SER B O   1 
ATOM   3131  C CB  . SER B 1 70  ? -16.342 30.301  120.247 1.00 86.83  ? 71   SER B CB  1 
ATOM   3132  O OG  . SER B 1 70  ? -16.318 28.899  120.451 1.00 88.75  ? 71   SER B OG  1 
ATOM   3133  N N   . GLU B 1 71  ? -13.352 30.671  119.464 1.00 78.12  ? 72   GLU B N   1 
ATOM   3134  C CA  . GLU B 1 71  ? -12.067 30.157  119.003 1.00 89.26  ? 72   GLU B CA  1 
ATOM   3135  C C   . GLU B 1 71  ? -10.952 30.535  119.974 1.00 93.93  ? 72   GLU B C   1 
ATOM   3136  O O   . GLU B 1 71  ? -10.082 29.719  120.287 1.00 103.17 ? 72   GLU B O   1 
ATOM   3137  C CB  . GLU B 1 71  ? -11.752 30.689  117.603 1.00 96.15  ? 72   GLU B CB  1 
ATOM   3138  C CG  . GLU B 1 71  ? -10.462 30.154  117.001 1.00 109.47 ? 72   GLU B CG  1 
ATOM   3139  C CD  . GLU B 1 71  ? -10.219 30.666  115.593 1.00 122.60 ? 72   GLU B CD  1 
ATOM   3140  O OE1 . GLU B 1 71  ? -11.052 31.451  115.091 1.00 129.60 ? 72   GLU B OE1 1 
ATOM   3141  O OE2 . GLU B 1 71  ? -9.196  30.283  114.988 1.00 121.92 ? 72   GLU B OE2 1 
ATOM   3142  N N   . MET B 1 72  ? -10.992 31.775  120.454 1.00 82.90  ? 73   MET B N   1 
ATOM   3143  C CA  . MET B 1 72  ? -10.019 32.254  121.427 1.00 71.90  ? 73   MET B CA  1 
ATOM   3144  C C   . MET B 1 72  ? -10.113 31.474  122.733 1.00 70.96  ? 73   MET B C   1 
ATOM   3145  O O   . MET B 1 72  ? -9.096  31.129  123.332 1.00 73.36  ? 73   MET B O   1 
ATOM   3146  C CB  . MET B 1 72  ? -10.217 33.747  121.696 1.00 66.15  ? 73   MET B CB  1 
ATOM   3147  C CG  . MET B 1 72  ? -9.970  34.637  120.493 1.00 73.20  ? 73   MET B CG  1 
ATOM   3148  S SD  . MET B 1 72  ? -10.251 36.375  120.872 1.00 70.55  ? 73   MET B SD  1 
ATOM   3149  C CE  . MET B 1 72  ? -9.119  36.608  122.241 1.00 51.28  ? 73   MET B CE  1 
ATOM   3150  N N   . GLU B 1 73  ? -11.339 31.200  123.170 1.00 57.80  ? 74   GLU B N   1 
ATOM   3151  C CA  . GLU B 1 73  ? -11.561 30.449  124.400 1.00 50.41  ? 74   GLU B CA  1 
ATOM   3152  C C   . GLU B 1 73  ? -10.968 29.050  124.285 1.00 64.33  ? 74   GLU B C   1 
ATOM   3153  O O   . GLU B 1 73  ? -10.263 28.589  125.186 1.00 76.39  ? 74   GLU B O   1 
ATOM   3154  C CB  . GLU B 1 73  ? -13.056 30.360  124.710 1.00 45.04  ? 74   GLU B CB  1 
ATOM   3155  C CG  . GLU B 1 73  ? -13.377 29.791  126.083 1.00 54.66  ? 74   GLU B CG  1 
ATOM   3156  C CD  . GLU B 1 73  ? -14.870 29.676  126.331 1.00 65.18  ? 74   GLU B CD  1 
ATOM   3157  O OE1 . GLU B 1 73  ? -15.602 29.288  125.396 1.00 66.51  ? 74   GLU B OE1 1 
ATOM   3158  O OE2 . GLU B 1 73  ? -15.313 29.978  127.459 1.00 62.86  ? 74   GLU B OE2 1 
ATOM   3159  N N   . GLU B 1 74  ? -11.252 28.385  123.168 1.00 66.72  ? 75   GLU B N   1 
ATOM   3160  C CA  . GLU B 1 74  ? -10.718 27.049  122.919 1.00 64.11  ? 75   GLU B CA  1 
ATOM   3161  C C   . GLU B 1 74  ? -9.189  27.053  122.898 1.00 59.98  ? 75   GLU B C   1 
ATOM   3162  O O   . GLU B 1 74  ? -8.544  26.257  123.591 1.00 54.86  ? 75   GLU B O   1 
ATOM   3163  C CB  . GLU B 1 74  ? -11.272 26.490  121.607 1.00 71.21  ? 75   GLU B CB  1 
ATOM   3164  C CG  . GLU B 1 74  ? -12.785 26.326  121.603 1.00 85.05  ? 75   GLU B CG  1 
ATOM   3165  C CD  . GLU B 1 74  ? -13.337 26.000  120.230 1.00 94.48  ? 75   GLU B CD  1 
ATOM   3166  O OE1 . GLU B 1 74  ? -12.550 25.980  119.261 1.00 102.82 ? 75   GLU B OE1 1 
ATOM   3167  O OE2 . GLU B 1 74  ? -14.560 25.766  120.118 1.00 85.46  ? 75   GLU B OE2 1 
ATOM   3168  N N   . ASN B 1 75  ? -8.620  27.961  122.109 1.00 62.78  ? 76   ASN B N   1 
ATOM   3169  C CA  . ASN B 1 75  ? -7.168  28.089  121.995 1.00 57.61  ? 76   ASN B CA  1 
ATOM   3170  C C   . ASN B 1 75  ? -6.475  28.353  123.330 1.00 63.86  ? 76   ASN B C   1 
ATOM   3171  O O   . ASN B 1 75  ? -5.452  27.741  123.643 1.00 72.55  ? 76   ASN B O   1 
ATOM   3172  C CB  . ASN B 1 75  ? -6.809  29.184  120.990 1.00 52.50  ? 76   ASN B CB  1 
ATOM   3173  C CG  . ASN B 1 75  ? -7.201  28.823  119.571 1.00 72.02  ? 76   ASN B CG  1 
ATOM   3174  O OD1 . ASN B 1 75  ? -7.881  27.823  119.340 1.00 81.98  ? 76   ASN B OD1 1 
ATOM   3175  N ND2 . ASN B 1 75  ? -6.778  29.639  118.613 1.00 76.27  ? 76   ASN B ND2 1 
ATOM   3176  N N   . LEU B 1 76  ? -7.037  29.265  124.115 1.00 61.81  ? 77   LEU B N   1 
ATOM   3177  C CA  . LEU B 1 76  ? -6.477  29.599  125.418 1.00 66.73  ? 77   LEU B CA  1 
ATOM   3178  C C   . LEU B 1 76  ? -6.577  28.430  126.395 1.00 61.79  ? 77   LEU B C   1 
ATOM   3179  O O   . LEU B 1 76  ? -5.624  28.139  127.121 1.00 54.13  ? 77   LEU B O   1 
ATOM   3180  C CB  . LEU B 1 76  ? -7.144  30.851  125.993 1.00 64.60  ? 77   LEU B CB  1 
ATOM   3181  C CG  . LEU B 1 76  ? -6.638  32.166  125.397 1.00 54.49  ? 77   LEU B CG  1 
ATOM   3182  C CD1 . LEU B 1 76  ? -7.436  33.353  125.917 1.00 55.05  ? 77   LEU B CD1 1 
ATOM   3183  C CD2 . LEU B 1 76  ? -5.155  32.340  125.698 1.00 41.32  ? 77   LEU B CD2 1 
ATOM   3184  N N   . ALA B 1 77  ? -7.730  27.764  126.411 1.00 61.32  ? 78   ALA B N   1 
ATOM   3185  C CA  . ALA B 1 77  ? -7.913  26.574  127.239 1.00 55.26  ? 78   ALA B CA  1 
ATOM   3186  C C   . ALA B 1 77  ? -6.844  25.534  126.915 1.00 58.98  ? 78   ALA B C   1 
ATOM   3187  O O   . ALA B 1 77  ? -6.204  24.970  127.816 1.00 65.36  ? 78   ALA B O   1 
ATOM   3188  C CB  . ALA B 1 77  ? -9.303  25.994  127.035 1.00 32.39  ? 78   ALA B CB  1 
ATOM   3189  N N   . ASN B 1 78  ? -6.646  25.301  125.621 1.00 48.82  ? 79   ASN B N   1 
ATOM   3190  C CA  . ASN B 1 78  ? -5.612  24.385  125.161 1.00 55.25  ? 79   ASN B CA  1 
ATOM   3191  C C   . ASN B 1 78  ? -4.220  24.812  125.618 1.00 49.87  ? 79   ASN B C   1 
ATOM   3192  O O   . ASN B 1 78  ? -3.432  23.984  126.073 1.00 52.62  ? 79   ASN B O   1 
ATOM   3193  C CB  . ASN B 1 78  ? -5.647  24.251  123.639 1.00 68.77  ? 79   ASN B CB  1 
ATOM   3194  C CG  . ASN B 1 78  ? -4.664  23.218  123.122 1.00 85.07  ? 79   ASN B CG  1 
ATOM   3195  O OD1 . ASN B 1 78  ? -4.096  22.440  123.889 1.00 89.13  ? 79   ASN B OD1 1 
ATOM   3196  N ND2 . ASN B 1 78  ? -4.467  23.198  121.813 1.00 96.06  ? 79   ASN B ND2 1 
ATOM   3197  N N   . ARG B 1 79  ? -3.921  26.101  125.499 1.00 55.75  ? 80   ARG B N   1 
ATOM   3198  C CA  . ARG B 1 79  ? -2.616  26.608  125.910 1.00 61.76  ? 80   ARG B CA  1 
ATOM   3199  C C   . ARG B 1 79  ? -2.369  26.370  127.398 1.00 56.68  ? 80   ARG B C   1 
ATOM   3200  O O   . ARG B 1 79  ? -1.299  25.902  127.788 1.00 53.99  ? 80   ARG B O   1 
ATOM   3201  C CB  . ARG B 1 79  ? -2.472  28.094  125.570 1.00 63.63  ? 80   ARG B CB  1 
ATOM   3202  C CG  . ARG B 1 79  ? -1.116  28.687  125.932 1.00 68.32  ? 80   ARG B CG  1 
ATOM   3203  C CD  . ARG B 1 79  ? 0.030   27.817  125.429 1.00 78.12  ? 80   ARG B CD  1 
ATOM   3204  N NE  . ARG B 1 79  ? -0.023  27.601  123.986 1.00 89.70  ? 80   ARG B NE  1 
ATOM   3205  C CZ  . ARG B 1 79  ? 0.698   28.281  123.100 1.00 96.31  ? 80   ARG B CZ  1 
ATOM   3206  N NH1 . ARG B 1 79  ? 1.535   29.225  123.508 1.00 95.24  ? 80   ARG B NH1 1 
ATOM   3207  N NH2 . ARG B 1 79  ? 0.584   28.016  121.806 1.00 96.46  ? 80   ARG B NH2 1 
ATOM   3208  N N   . SER B 1 80  ? -3.367  26.679  128.221 1.00 47.33  ? 81   SER B N   1 
ATOM   3209  C CA  . SER B 1 80  ? -3.258  26.480  129.662 1.00 45.96  ? 81   SER B CA  1 
ATOM   3210  C C   . SER B 1 80  ? -3.024  25.008  129.991 1.00 42.69  ? 81   SER B C   1 
ATOM   3211  O O   . SER B 1 80  ? -2.141  24.670  130.792 1.00 52.42  ? 81   SER B O   1 
ATOM   3212  C CB  . SER B 1 80  ? -4.508  26.997  130.380 1.00 57.89  ? 81   SER B CB  1 
ATOM   3213  O OG  . SER B 1 80  ? -5.681  26.371  129.890 1.00 76.04  ? 81   SER B OG  1 
ATOM   3214  N N   . HIS B 1 81  ? -3.810  24.141  129.357 1.00 48.27  ? 82   HIS B N   1 
ATOM   3215  C CA  . HIS B 1 81  ? -3.672  22.696  129.534 1.00 49.99  ? 82   HIS B CA  1 
ATOM   3216  C C   . HIS B 1 81  ? -2.255  22.218  129.198 1.00 50.48  ? 82   HIS B C   1 
ATOM   3217  O O   . HIS B 1 81  ? -1.613  21.517  129.990 1.00 45.81  ? 82   HIS B O   1 
ATOM   3218  C CB  . HIS B 1 81  ? -4.701  21.968  128.667 1.00 42.02  ? 82   HIS B CB  1 
ATOM   3219  C CG  . HIS B 1 81  ? -4.627  20.478  128.760 1.00 56.30  ? 82   HIS B CG  1 
ATOM   3220  N ND1 . HIS B 1 81  ? -3.992  19.702  127.811 1.00 69.68  ? 82   HIS B ND1 1 
ATOM   3221  C CD2 . HIS B 1 81  ? -5.113  19.613  129.682 1.00 54.56  ? 82   HIS B CD2 1 
ATOM   3222  C CE1 . HIS B 1 81  ? -4.088  18.431  128.146 1.00 58.77  ? 82   HIS B CE1 1 
ATOM   3223  N NE2 . HIS B 1 81  ? -4.765  18.348  129.281 1.00 56.17  ? 82   HIS B NE2 1 
ATOM   3224  N N   . ALA B 1 82  ? -1.772  22.617  128.025 1.00 44.40  ? 83   ALA B N   1 
ATOM   3225  C CA  . ALA B 1 82  ? -0.426  22.275  127.576 1.00 36.83  ? 83   ALA B CA  1 
ATOM   3226  C C   . ALA B 1 82  ? 0.641   22.767  128.550 1.00 42.87  ? 83   ALA B C   1 
ATOM   3227  O O   . ALA B 1 82  ? 1.620   22.070  128.812 1.00 63.18  ? 83   ALA B O   1 
ATOM   3228  C CB  . ALA B 1 82  ? -0.172  22.837  126.186 1.00 32.13  ? 83   ALA B CB  1 
ATOM   3229  N N   . GLU B 1 83  ? 0.452   23.971  129.078 1.00 39.35  ? 84   GLU B N   1 
ATOM   3230  C CA  . GLU B 1 83  ? 1.413   24.547  130.012 1.00 48.97  ? 84   GLU B CA  1 
ATOM   3231  C C   . GLU B 1 83  ? 1.482   23.745  131.311 1.00 53.69  ? 84   GLU B C   1 
ATOM   3232  O O   . GLU B 1 83  ? 2.575   23.428  131.802 1.00 69.45  ? 84   GLU B O   1 
ATOM   3233  C CB  . GLU B 1 83  ? 1.086   26.017  130.285 1.00 39.72  ? 84   GLU B CB  1 
ATOM   3234  C CG  . GLU B 1 83  ? 1.391   26.929  129.104 1.00 50.30  ? 84   GLU B CG  1 
ATOM   3235  C CD  . GLU B 1 83  ? 0.847   28.333  129.286 1.00 67.76  ? 84   GLU B CD  1 
ATOM   3236  O OE1 . GLU B 1 83  ? 0.098   28.562  130.259 1.00 70.97  ? 84   GLU B OE1 1 
ATOM   3237  O OE2 . GLU B 1 83  ? 1.166   29.209  128.453 1.00 72.03  ? 84   GLU B OE2 1 
ATOM   3238  N N   . LEU B 1 84  ? 0.316   23.407  131.853 1.00 41.63  ? 85   LEU B N   1 
ATOM   3239  C CA  . LEU B 1 84  ? 0.257   22.570  133.047 1.00 41.64  ? 85   LEU B CA  1 
ATOM   3240  C C   . LEU B 1 84  ? 0.942   21.223  132.806 1.00 57.09  ? 85   LEU B C   1 
ATOM   3241  O O   . LEU B 1 84  ? 1.737   20.753  133.636 1.00 71.17  ? 85   LEU B O   1 
ATOM   3242  C CB  . LEU B 1 84  ? -1.192  22.343  133.474 1.00 35.89  ? 85   LEU B CB  1 
ATOM   3243  C CG  . LEU B 1 84  ? -1.341  21.617  134.811 1.00 45.26  ? 85   LEU B CG  1 
ATOM   3244  C CD1 . LEU B 1 84  ? -0.746  22.460  135.922 1.00 58.91  ? 85   LEU B CD1 1 
ATOM   3245  C CD2 . LEU B 1 84  ? -2.793  21.291  135.102 1.00 31.89  ? 85   LEU B CD2 1 
ATOM   3246  N N   . GLU B 1 85  ? 0.633   20.611  131.663 1.00 45.40  ? 86   GLU B N   1 
ATOM   3247  C CA  . GLU B 1 85  ? 1.260   19.348  131.284 1.00 49.62  ? 86   GLU B CA  1 
ATOM   3248  C C   . GLU B 1 85  ? 2.780   19.475  131.219 1.00 55.70  ? 86   GLU B C   1 
ATOM   3249  O O   . GLU B 1 85  ? 3.507   18.562  131.618 1.00 48.90  ? 86   GLU B O   1 
ATOM   3250  C CB  . GLU B 1 85  ? 0.713   18.839  129.948 1.00 51.71  ? 86   GLU B CB  1 
ATOM   3251  C CG  . GLU B 1 85  ? -0.691  18.261  130.030 1.00 69.00  ? 86   GLU B CG  1 
ATOM   3252  C CD  . GLU B 1 85  ? -0.901  17.099  129.076 1.00 77.53  ? 86   GLU B CD  1 
ATOM   3253  O OE1 . GLU B 1 85  ? -0.571  17.236  127.878 1.00 72.27  ? 86   GLU B OE1 1 
ATOM   3254  O OE2 . GLU B 1 85  ? -1.390  16.042  129.530 1.00 83.05  ? 86   GLU B OE2 1 
ATOM   3255  N N   . THR B 1 86  ? 3.251   20.613  130.719 1.00 62.12  ? 87   THR B N   1 
ATOM   3256  C CA  . THR B 1 86  ? 4.681   20.886  130.651 1.00 57.84  ? 87   THR B CA  1 
ATOM   3257  C C   . THR B 1 86  ? 5.290   20.934  132.047 1.00 50.41  ? 87   THR B C   1 
ATOM   3258  O O   . THR B 1 86  ? 6.345   20.342  132.291 1.00 47.63  ? 87   THR B O   1 
ATOM   3259  C CB  . THR B 1 86  ? 4.979   22.201  129.904 1.00 61.03  ? 87   THR B CB  1 
ATOM   3260  O OG1 . THR B 1 86  ? 4.708   22.028  128.508 1.00 70.55  ? 87   THR B OG1 1 
ATOM   3261  C CG2 . THR B 1 86  ? 6.437   22.598  130.081 1.00 46.06  ? 87   THR B CG2 1 
ATOM   3262  N N   . ALA B 1 87  ? 4.620   21.628  132.964 1.00 45.95  ? 88   ALA B N   1 
ATOM   3263  C CA  . ALA B 1 87  ? 5.096   21.703  134.345 1.00 41.56  ? 88   ALA B CA  1 
ATOM   3264  C C   . ALA B 1 87  ? 5.219   20.313  134.969 1.00 46.45  ? 88   ALA B C   1 
ATOM   3265  O O   . ALA B 1 87  ? 6.273   19.956  135.517 1.00 65.38  ? 88   ALA B O   1 
ATOM   3266  C CB  . ALA B 1 87  ? 4.179   22.581  135.181 1.00 38.25  ? 88   ALA B CB  1 
ATOM   3267  N N   . LEU B 1 88  ? 4.145   19.530  134.872 1.00 39.40  ? 89   LEU B N   1 
ATOM   3268  C CA  . LEU B 1 88  ? 4.143   18.169  135.410 1.00 40.01  ? 89   LEU B CA  1 
ATOM   3269  C C   . LEU B 1 88  ? 5.267   17.318  134.819 1.00 41.72  ? 89   LEU B C   1 
ATOM   3270  O O   . LEU B 1 88  ? 6.005   16.642  135.549 1.00 50.38  ? 89   LEU B O   1 
ATOM   3271  C CB  . LEU B 1 88  ? 2.793   17.494  135.162 1.00 43.11  ? 89   LEU B CB  1 
ATOM   3272  C CG  . LEU B 1 88  ? 1.596   18.084  135.907 1.00 52.07  ? 89   LEU B CG  1 
ATOM   3273  C CD1 . LEU B 1 88  ? 0.308   17.406  135.469 1.00 55.43  ? 89   LEU B CD1 1 
ATOM   3274  C CD2 . LEU B 1 88  ? 1.790   17.958  137.410 1.00 46.87  ? 89   LEU B CD2 1 
ATOM   3275  N N   . ARG B 1 89  ? 5.392   17.367  133.496 1.00 34.24  ? 90   ARG B N   1 
ATOM   3276  C CA  . ARG B 1 89  ? 6.435   16.636  132.786 1.00 44.64  ? 90   ARG B CA  1 
ATOM   3277  C C   . ARG B 1 89  ? 7.833   17.014  133.275 1.00 60.44  ? 90   ARG B C   1 
ATOM   3278  O O   . ARG B 1 89  ? 8.677   16.144  133.486 1.00 69.07  ? 90   ARG B O   1 
ATOM   3279  C CB  . ARG B 1 89  ? 6.308   16.861  131.275 1.00 43.74  ? 90   ARG B CB  1 
ATOM   3280  C CG  . ARG B 1 89  ? 7.524   16.431  130.470 1.00 68.94  ? 90   ARG B CG  1 
ATOM   3281  C CD  . ARG B 1 89  ? 7.252   16.468  128.969 1.00 94.04  ? 90   ARG B CD  1 
ATOM   3282  N NE  . ARG B 1 89  ? 6.814   17.783  128.503 1.00 113.37 ? 90   ARG B NE  1 
ATOM   3283  C CZ  . ARG B 1 89  ? 5.561   18.082  128.170 1.00 114.13 ? 90   ARG B CZ  1 
ATOM   3284  N NH1 . ARG B 1 89  ? 4.613   17.158  128.248 1.00 109.12 ? 90   ARG B NH1 1 
ATOM   3285  N NH2 . ARG B 1 89  ? 5.256   19.305  127.755 1.00 108.64 ? 90   ARG B NH2 1 
ATOM   3286  N N   . ASP B 1 90  ? 8.070   18.310  133.462 1.00 45.01  ? 91   ASP B N   1 
ATOM   3287  C CA  . ASP B 1 90  ? 9.357   18.784  133.964 1.00 51.36  ? 91   ASP B CA  1 
ATOM   3288  C C   . ASP B 1 90  ? 9.658   18.263  135.370 1.00 59.73  ? 91   ASP B C   1 
ATOM   3289  O O   . ASP B 1 90  ? 10.745  17.730  135.623 1.00 72.08  ? 91   ASP B O   1 
ATOM   3290  C CB  . ASP B 1 90  ? 9.422   20.314  133.943 1.00 55.58  ? 91   ASP B CB  1 
ATOM   3291  C CG  . ASP B 1 90  ? 9.543   20.874  132.539 1.00 68.61  ? 91   ASP B CG  1 
ATOM   3292  O OD1 . ASP B 1 90  ? 9.910   20.109  131.622 1.00 67.79  ? 91   ASP B OD1 1 
ATOM   3293  O OD2 . ASP B 1 90  ? 9.280   22.082  132.353 1.00 69.45  ? 91   ASP B OD2 1 
ATOM   3294  N N   . SER B 1 91  ? 8.695   18.415  136.277 1.00 51.05  ? 92   SER B N   1 
ATOM   3295  C CA  . SER B 1 91  ? 8.873   17.952  137.655 1.00 56.65  ? 92   SER B CA  1 
ATOM   3296  C C   . SER B 1 91  ? 9.207   16.457  137.700 1.00 56.62  ? 92   SER B C   1 
ATOM   3297  O O   . SER B 1 91  ? 10.214  16.032  138.302 1.00 64.33  ? 92   SER B O   1 
ATOM   3298  C CB  . SER B 1 91  ? 7.616   18.241  138.479 1.00 43.51  ? 92   SER B CB  1 
ATOM   3299  O OG  . SER B 1 91  ? 7.824   17.954  139.851 1.00 56.42  ? 92   SER B OG  1 
ATOM   3300  N N   . SER B 1 92  ? 8.357   15.672  137.040 1.00 49.67  ? 93   SER B N   1 
ATOM   3301  C CA  . SER B 1 92  ? 8.546   14.231  136.946 1.00 52.94  ? 93   SER B CA  1 
ATOM   3302  C C   . SER B 1 92  ? 9.921   13.890  136.374 1.00 52.40  ? 93   SER B C   1 
ATOM   3303  O O   . SER B 1 92  ? 10.599  12.986  136.864 1.00 50.27  ? 93   SER B O   1 
ATOM   3304  C CB  . SER B 1 92  ? 7.447   13.611  136.081 1.00 47.10  ? 93   SER B CB  1 
ATOM   3305  O OG  . SER B 1 92  ? 7.589   12.204  136.007 1.00 53.96  ? 93   SER B OG  1 
ATOM   3306  N N   . ARG B 1 93  ? 10.324  14.630  135.343 1.00 54.26  ? 94   ARG B N   1 
ATOM   3307  C CA  . ARG B 1 93  ? 11.619  14.435  134.695 1.00 47.50  ? 94   ARG B CA  1 
ATOM   3308  C C   . ARG B 1 93  ? 12.776  14.633  135.673 1.00 48.44  ? 94   ARG B C   1 
ATOM   3309  O O   . ARG B 1 93  ? 13.708  13.821  135.727 1.00 58.05  ? 94   ARG B O   1 
ATOM   3310  C CB  . ARG B 1 93  ? 11.761  15.395  133.510 1.00 33.31  ? 94   ARG B CB  1 
ATOM   3311  C CG  . ARG B 1 93  ? 13.051  15.246  132.723 1.00 54.62  ? 94   ARG B CG  1 
ATOM   3312  C CD  . ARG B 1 93  ? 13.176  16.336  131.670 1.00 79.32  ? 94   ARG B CD  1 
ATOM   3313  N NE  . ARG B 1 93  ? 12.934  17.662  132.232 1.00 97.74  ? 94   ARG B NE  1 
ATOM   3314  C CZ  . ARG B 1 93  ? 13.854  18.393  132.855 1.00 103.94 ? 94   ARG B CZ  1 
ATOM   3315  N NH1 . ARG B 1 93  ? 15.087  17.927  133.003 1.00 110.61 ? 94   ARG B NH1 1 
ATOM   3316  N NH2 . ARG B 1 93  ? 13.540  19.589  133.335 1.00 91.07  ? 94   ARG B NH2 1 
ATOM   3317  N N   . VAL B 1 94  ? 12.711  15.716  136.442 1.00 31.25  ? 95   VAL B N   1 
ATOM   3318  C CA  . VAL B 1 94  ? 13.724  15.994  137.455 1.00 24.61  ? 95   VAL B CA  1 
ATOM   3319  C C   . VAL B 1 94  ? 13.828  14.836  138.446 1.00 28.94  ? 95   VAL B C   1 
ATOM   3320  O O   . VAL B 1 94  ? 14.927  14.304  138.697 1.00 49.15  ? 95   VAL B O   1 
ATOM   3321  C CB  . VAL B 1 94  ? 13.422  17.309  138.207 1.00 25.84  ? 95   VAL B CB  1 
ATOM   3322  C CG1 . VAL B 1 94  ? 14.293  17.437  139.446 1.00 19.06  ? 95   VAL B CG1 1 
ATOM   3323  C CG2 . VAL B 1 94  ? 13.623  18.502  137.284 1.00 21.87  ? 95   VAL B CG2 1 
ATOM   3324  N N   . LEU B 1 95  ? 12.679  14.438  138.989 1.00 32.92  ? 96   LEU B N   1 
ATOM   3325  C CA  . LEU B 1 95  ? 12.632  13.308  139.919 1.00 33.97  ? 96   LEU B CA  1 
ATOM   3326  C C   . LEU B 1 95  ? 13.283  12.046  139.337 1.00 39.22  ? 96   LEU B C   1 
ATOM   3327  O O   . LEU B 1 95  ? 14.106  11.388  139.993 1.00 41.74  ? 96   LEU B O   1 
ATOM   3328  C CB  . LEU B 1 95  ? 11.186  13.017  140.327 1.00 33.02  ? 96   LEU B CB  1 
ATOM   3329  C CG  . LEU B 1 95  ? 10.994  11.981  141.434 1.00 49.09  ? 96   LEU B CG  1 
ATOM   3330  C CD1 . LEU B 1 95  ? 11.828  12.342  142.648 1.00 48.23  ? 96   LEU B CD1 1 
ATOM   3331  C CD2 . LEU B 1 95  ? 9.531   11.876  141.811 1.00 43.19  ? 96   LEU B CD2 1 
ATOM   3332  N N   . GLN B 1 96  ? 12.917  11.725  138.097 1.00 34.07  ? 97   GLN B N   1 
ATOM   3333  C CA  . GLN B 1 96  ? 13.461  10.560  137.405 1.00 48.86  ? 97   GLN B CA  1 
ATOM   3334  C C   . GLN B 1 96  ? 14.977  10.638  137.275 1.00 57.84  ? 97   GLN B C   1 
ATOM   3335  O O   . GLN B 1 96  ? 15.673  9.642   137.476 1.00 47.21  ? 97   GLN B O   1 
ATOM   3336  C CB  . GLN B 1 96  ? 12.831  10.406  136.019 1.00 51.15  ? 97   GLN B CB  1 
ATOM   3337  C CG  . GLN B 1 96  ? 11.360  10.031  136.036 1.00 63.57  ? 97   GLN B CG  1 
ATOM   3338  C CD  . GLN B 1 96  ? 10.743  10.047  134.651 1.00 72.43  ? 97   GLN B CD  1 
ATOM   3339  O OE1 . GLN B 1 96  ? 9.761   10.749  134.403 1.00 49.93  ? 97   GLN B OE1 1 
ATOM   3340  N NE2 . GLN B 1 96  ? 11.316  9.268   133.739 1.00 75.54  ? 97   GLN B NE2 1 
ATOM   3341  N N   . ALA B 1 97  ? 15.483  11.821  136.932 1.00 60.96  ? 98   ALA B N   1 
ATOM   3342  C CA  . ALA B 1 97  ? 16.924  12.025  136.812 1.00 46.47  ? 98   ALA B CA  1 
ATOM   3343  C C   . ALA B 1 97  ? 17.631  11.746  138.134 1.00 40.21  ? 98   ALA B C   1 
ATOM   3344  O O   . ALA B 1 97  ? 18.663  11.063  138.167 1.00 54.59  ? 98   ALA B O   1 
ATOM   3345  C CB  . ALA B 1 97  ? 17.228  13.433  136.333 1.00 31.19  ? 98   ALA B CB  1 
ATOM   3346  N N   . MET B 1 98  ? 17.071  12.273  139.222 1.00 31.73  ? 99   MET B N   1 
ATOM   3347  C CA  . MET B 1 98  ? 17.631  12.013  140.548 1.00 21.85  ? 99   MET B CA  1 
ATOM   3348  C C   . MET B 1 98  ? 17.683  10.513  140.849 1.00 47.93  ? 99   MET B C   1 
ATOM   3349  O O   . MET B 1 98  ? 18.751  9.964   141.168 1.00 61.13  ? 99   MET B O   1 
ATOM   3350  C CB  . MET B 1 98  ? 16.827  12.746  141.626 1.00 17.89  ? 99   MET B CB  1 
ATOM   3351  C CG  . MET B 1 98  ? 17.385  12.611  143.040 1.00 24.02  ? 99   MET B CG  1 
ATOM   3352  S SD  . MET B 1 98  ? 16.824  11.139  143.924 1.00 45.77  ? 99   MET B SD  1 
ATOM   3353  C CE  . MET B 1 98  ? 15.085  11.504  144.138 1.00 55.09  ? 99   MET B CE  1 
ATOM   3354  N N   . LEU B 1 99  ? 16.529  9.855   140.746 1.00 41.81  ? 100  LEU B N   1 
ATOM   3355  C CA  . LEU B 1 99  ? 16.441  8.425   141.047 1.00 44.95  ? 100  LEU B CA  1 
ATOM   3356  C C   . LEU B 1 99  ? 17.385  7.572   140.188 1.00 46.12  ? 100  LEU B C   1 
ATOM   3357  O O   . LEU B 1 99  ? 17.992  6.617   140.678 1.00 50.44  ? 100  LEU B O   1 
ATOM   3358  C CB  . LEU B 1 99  ? 14.995  7.929   140.927 1.00 38.00  ? 100  LEU B CB  1 
ATOM   3359  C CG  . LEU B 1 99  ? 14.019  8.409   142.008 1.00 37.90  ? 100  LEU B CG  1 
ATOM   3360  C CD1 . LEU B 1 99  ? 12.594  7.995   141.680 1.00 42.48  ? 100  LEU B CD1 1 
ATOM   3361  C CD2 . LEU B 1 99  ? 14.421  7.891   143.383 1.00 23.73  ? 100  LEU B CD2 1 
ATOM   3362  N N   . ALA B 1 100 ? 17.515  7.932   138.913 1.00 40.47  ? 101  ALA B N   1 
ATOM   3363  C CA  . ALA B 1 100 ? 18.401  7.221   137.995 1.00 42.48  ? 101  ALA B CA  1 
ATOM   3364  C C   . ALA B 1 100 ? 19.862  7.384   138.400 1.00 57.59  ? 101  ALA B C   1 
ATOM   3365  O O   . ALA B 1 100 ? 20.632  6.410   138.413 1.00 74.32  ? 101  ALA B O   1 
ATOM   3366  C CB  . ALA B 1 100 ? 18.191  7.710   136.569 1.00 28.54  ? 101  ALA B CB  1 
ATOM   3367  N N   . THR B 1 101 ? 20.237  8.620   138.725 1.00 37.36  ? 102  THR B N   1 
ATOM   3368  C CA  . THR B 1 101 ? 21.585  8.906   139.205 1.00 48.83  ? 102  THR B CA  1 
ATOM   3369  C C   . THR B 1 101 ? 21.918  8.049   140.426 1.00 56.14  ? 102  THR B C   1 
ATOM   3370  O O   . THR B 1 101 ? 22.954  7.368   140.458 1.00 73.31  ? 102  THR B O   1 
ATOM   3371  C CB  . THR B 1 101 ? 21.759  10.401  139.541 1.00 49.10  ? 102  THR B CB  1 
ATOM   3372  O OG1 . THR B 1 101 ? 21.872  11.153  138.326 1.00 41.18  ? 102  THR B OG1 1 
ATOM   3373  C CG2 . THR B 1 101 ? 23.007  10.625  140.379 1.00 41.77  ? 102  THR B CG2 1 
ATOM   3374  N N   . GLN B 1 102 ? 21.028  8.069   141.418 1.00 38.00  ? 103  GLN B N   1 
ATOM   3375  C CA  . GLN B 1 102 ? 21.202  7.243   142.613 1.00 41.19  ? 103  GLN B CA  1 
ATOM   3376  C C   . GLN B 1 102 ? 21.378  5.766   142.250 1.00 50.14  ? 103  GLN B C   1 
ATOM   3377  O O   . GLN B 1 102 ? 22.288  5.082   142.750 1.00 55.36  ? 103  GLN B O   1 
ATOM   3378  C CB  . GLN B 1 102 ? 20.007  7.412   143.554 1.00 25.67  ? 103  GLN B CB  1 
ATOM   3379  C CG  . GLN B 1 102 ? 19.842  8.819   144.098 1.00 31.73  ? 103  GLN B CG  1 
ATOM   3380  C CD  . GLN B 1 102 ? 20.939  9.197   145.071 1.00 49.06  ? 103  GLN B CD  1 
ATOM   3381  O OE1 . GLN B 1 102 ? 21.368  8.381   145.888 1.00 55.62  ? 103  GLN B OE1 1 
ATOM   3382  N NE2 . GLN B 1 102 ? 21.406  10.437  144.985 1.00 42.53  ? 103  GLN B NE2 1 
ATOM   3383  N N   . LEU B 1 103 ? 20.505  5.296   141.362 1.00 46.38  ? 104  LEU B N   1 
ATOM   3384  C CA  . LEU B 1 103 ? 20.523  3.916   140.891 1.00 40.90  ? 104  LEU B CA  1 
ATOM   3385  C C   . LEU B 1 103 ? 21.899  3.512   140.381 1.00 48.27  ? 104  LEU B C   1 
ATOM   3386  O O   . LEU B 1 103 ? 22.541  2.616   140.947 1.00 66.45  ? 104  LEU B O   1 
ATOM   3387  C CB  . LEU B 1 103 ? 19.481  3.711   139.789 1.00 45.38  ? 104  LEU B CB  1 
ATOM   3388  C CG  . LEU B 1 103 ? 19.251  2.265   139.347 1.00 33.05  ? 104  LEU B CG  1 
ATOM   3389  C CD1 . LEU B 1 103 ? 18.760  1.443   140.517 1.00 22.32  ? 104  LEU B CD1 1 
ATOM   3390  C CD2 . LEU B 1 103 ? 18.263  2.188   138.194 1.00 29.58  ? 104  LEU B CD2 1 
ATOM   3391  N N   . ARG B 1 104 ? 22.354  4.171   139.316 1.00 45.19  ? 105  ARG B N   1 
ATOM   3392  C CA  . ARG B 1 104 ? 23.644  3.809   138.729 1.00 40.60  ? 105  ARG B CA  1 
ATOM   3393  C C   . ARG B 1 104 ? 24.792  3.978   139.724 1.00 41.86  ? 105  ARG B C   1 
ATOM   3394  O O   . ARG B 1 104 ? 25.743  3.194   139.713 1.00 46.61  ? 105  ARG B O   1 
ATOM   3395  C CB  . ARG B 1 104 ? 23.919  4.564   137.421 1.00 34.05  ? 105  ARG B CB  1 
ATOM   3396  C CG  . ARG B 1 104 ? 24.281  6.030   137.572 1.00 73.96  ? 105  ARG B CG  1 
ATOM   3397  C CD  . ARG B 1 104 ? 24.709  6.607   136.233 1.00 99.75  ? 105  ARG B CD  1 
ATOM   3398  N NE  . ARG B 1 104 ? 24.828  8.062   136.262 1.00 113.85 ? 105  ARG B NE  1 
ATOM   3399  C CZ  . ARG B 1 104 ? 25.978  8.718   136.379 1.00 119.34 ? 105  ARG B CZ  1 
ATOM   3400  N NH1 . ARG B 1 104 ? 27.119  8.050   136.480 1.00 119.34 ? 105  ARG B NH1 1 
ATOM   3401  N NH2 . ARG B 1 104 ? 25.987  10.044  136.393 1.00 124.04 ? 105  ARG B NH2 1 
ATOM   3402  N N   . SER B 1 105 ? 24.691  4.982   140.593 1.00 38.52  ? 106  SER B N   1 
ATOM   3403  C CA  . SER B 1 105 ? 25.686  5.176   141.647 1.00 26.88  ? 106  SER B CA  1 
ATOM   3404  C C   . SER B 1 105 ? 25.858  3.930   142.516 1.00 39.11  ? 106  SER B C   1 
ATOM   3405  O O   . SER B 1 105 ? 26.934  3.319   142.540 1.00 54.53  ? 106  SER B O   1 
ATOM   3406  C CB  . SER B 1 105 ? 25.327  6.379   142.520 1.00 25.81  ? 106  SER B CB  1 
ATOM   3407  O OG  . SER B 1 105 ? 25.449  7.588   141.794 1.00 46.27  ? 106  SER B OG  1 
ATOM   3408  N N   . PHE B 1 106 ? 24.797  3.553   143.226 1.00 34.67  ? 107  PHE B N   1 
ATOM   3409  C CA  . PHE B 1 106 ? 24.874  2.408   144.134 1.00 31.20  ? 107  PHE B CA  1 
ATOM   3410  C C   . PHE B 1 106 ? 25.178  1.090   143.422 1.00 46.94  ? 107  PHE B C   1 
ATOM   3411  O O   . PHE B 1 106 ? 25.977  0.276   143.910 1.00 52.42  ? 107  PHE B O   1 
ATOM   3412  C CB  . PHE B 1 106 ? 23.597  2.290   144.966 1.00 25.94  ? 107  PHE B CB  1 
ATOM   3413  C CG  . PHE B 1 106 ? 23.523  3.277   146.089 1.00 20.47  ? 107  PHE B CG  1 
ATOM   3414  C CD1 . PHE B 1 106 ? 22.970  4.529   145.892 1.00 19.18  ? 107  PHE B CD1 1 
ATOM   3415  C CD2 . PHE B 1 106 ? 24.019  2.956   147.342 1.00 21.11  ? 107  PHE B CD2 1 
ATOM   3416  C CE1 . PHE B 1 106 ? 22.906  5.442   146.927 1.00 31.54  ? 107  PHE B CE1 1 
ATOM   3417  C CE2 . PHE B 1 106 ? 23.959  3.864   148.380 1.00 28.37  ? 107  PHE B CE2 1 
ATOM   3418  C CZ  . PHE B 1 106 ? 23.401  5.108   148.172 1.00 23.03  ? 107  PHE B CZ  1 
ATOM   3419  N N   . ASP B 1 107 ? 24.543  0.888   142.270 1.00 48.25  ? 108  ASP B N   1 
ATOM   3420  C CA  . ASP B 1 107 ? 24.769  -0.315  141.474 1.00 47.56  ? 108  ASP B CA  1 
ATOM   3421  C C   . ASP B 1 107 ? 26.253  -0.457  141.128 1.00 52.40  ? 108  ASP B C   1 
ATOM   3422  O O   . ASP B 1 107 ? 26.879  -1.495  141.406 1.00 57.33  ? 108  ASP B O   1 
ATOM   3423  C CB  . ASP B 1 107 ? 23.924  -0.261  140.200 1.00 47.88  ? 108  ASP B CB  1 
ATOM   3424  C CG  . ASP B 1 107 ? 23.894  -1.580  139.461 1.00 48.37  ? 108  ASP B CG  1 
ATOM   3425  O OD1 . ASP B 1 107 ? 23.988  -2.638  140.119 1.00 42.34  ? 108  ASP B OD1 1 
ATOM   3426  O OD2 . ASP B 1 107 ? 23.771  -1.558  138.219 1.00 48.15  ? 108  ASP B OD2 1 
ATOM   3427  N N   . ASP B 1 108 ? 26.812  0.601   140.543 1.00 62.76  ? 109  ASP B N   1 
ATOM   3428  C CA  . ASP B 1 108 ? 28.233  0.634   140.211 1.00 50.37  ? 109  ASP B CA  1 
ATOM   3429  C C   . ASP B 1 108 ? 29.117  0.406   141.430 1.00 47.69  ? 109  ASP B C   1 
ATOM   3430  O O   . ASP B 1 108 ? 30.119  -0.302  141.339 1.00 55.63  ? 109  ASP B O   1 
ATOM   3431  C CB  . ASP B 1 108 ? 28.614  1.954   139.535 1.00 41.50  ? 109  ASP B CB  1 
ATOM   3432  C CG  . ASP B 1 108 ? 28.146  2.029   138.095 1.00 59.81  ? 109  ASP B CG  1 
ATOM   3433  O OD1 . ASP B 1 108 ? 27.854  0.966   137.505 1.00 70.56  ? 109  ASP B OD1 1 
ATOM   3434  O OD2 . ASP B 1 108 ? 28.080  3.151   137.550 1.00 59.50  ? 109  ASP B OD2 1 
ATOM   3435  N N   . HIS B 1 109 ? 28.754  0.998   142.565 1.00 37.57  ? 110  HIS B N   1 
ATOM   3436  C CA  . HIS B 1 109 ? 29.564  0.815   143.768 1.00 45.00  ? 110  HIS B CA  1 
ATOM   3437  C C   . HIS B 1 109 ? 29.615  -0.643  144.216 1.00 51.90  ? 110  HIS B C   1 
ATOM   3438  O O   . HIS B 1 109 ? 30.686  -1.166  144.530 1.00 60.61  ? 110  HIS B O   1 
ATOM   3439  C CB  . HIS B 1 109 ? 29.082  1.696   144.920 1.00 46.02  ? 110  HIS B CB  1 
ATOM   3440  C CG  . HIS B 1 109 ? 29.975  1.641   146.122 1.00 54.58  ? 110  HIS B CG  1 
ATOM   3441  N ND1 . HIS B 1 109 ? 29.548  1.165   147.346 1.00 60.66  ? 110  HIS B ND1 1 
ATOM   3442  C CD2 . HIS B 1 109 ? 31.273  1.983   146.284 1.00 39.81  ? 110  HIS B CD2 1 
ATOM   3443  C CE1 . HIS B 1 109 ? 30.549  1.227   148.209 1.00 59.92  ? 110  HIS B CE1 1 
ATOM   3444  N NE2 . HIS B 1 109 ? 31.605  1.720   147.591 1.00 42.84  ? 110  HIS B NE2 1 
ATOM   3445  N N   . PHE B 1 110 ? 28.457  -1.297  144.241 1.00 52.71  ? 111  PHE B N   1 
ATOM   3446  C CA  . PHE B 1 110 ? 28.395  -2.698  144.650 1.00 51.79  ? 111  PHE B CA  1 
ATOM   3447  C C   . PHE B 1 110 ? 29.172  -3.608  143.692 1.00 57.14  ? 111  PHE B C   1 
ATOM   3448  O O   . PHE B 1 110 ? 29.985  -4.452  144.123 1.00 68.04  ? 111  PHE B O   1 
ATOM   3449  C CB  . PHE B 1 110 ? 26.938  -3.149  144.776 1.00 39.20  ? 111  PHE B CB  1 
ATOM   3450  C CG  . PHE B 1 110 ? 26.169  -2.415  145.842 1.00 35.93  ? 111  PHE B CG  1 
ATOM   3451  C CD1 . PHE B 1 110 ? 26.819  -1.909  146.959 1.00 36.89  ? 111  PHE B CD1 1 
ATOM   3452  C CD2 . PHE B 1 110 ? 24.801  -2.223  145.727 1.00 38.26  ? 111  PHE B CD2 1 
ATOM   3453  C CE1 . PHE B 1 110 ? 26.120  -1.231  147.945 1.00 27.67  ? 111  PHE B CE1 1 
ATOM   3454  C CE2 . PHE B 1 110 ? 24.095  -1.543  146.711 1.00 46.19  ? 111  PHE B CE2 1 
ATOM   3455  C CZ  . PHE B 1 110 ? 24.757  -1.048  147.822 1.00 35.78  ? 111  PHE B CZ  1 
ATOM   3456  N N   . GLN B 1 111 ? 28.930  -3.424  142.394 1.00 52.48  ? 112  GLN B N   1 
ATOM   3457  C CA  . GLN B 1 111 ? 29.658  -4.184  141.377 1.00 58.56  ? 112  GLN B CA  1 
ATOM   3458  C C   . GLN B 1 111 ? 31.170  -4.011  141.529 1.00 65.56  ? 112  GLN B C   1 
ATOM   3459  O O   . GLN B 1 111 ? 31.928  -4.987  141.494 1.00 64.01  ? 112  GLN B O   1 
ATOM   3460  C CB  . GLN B 1 111 ? 29.226  -3.767  139.970 1.00 55.79  ? 112  GLN B CB  1 
ATOM   3461  C CG  . GLN B 1 111 ? 27.796  -4.129  139.614 1.00 56.90  ? 112  GLN B CG  1 
ATOM   3462  C CD  . GLN B 1 111 ? 27.455  -3.783  138.178 1.00 64.16  ? 112  GLN B CD  1 
ATOM   3463  O OE1 . GLN B 1 111 ? 26.939  -2.703  137.893 1.00 66.43  ? 112  GLN B OE1 1 
ATOM   3464  N NE2 . GLN B 1 111 ? 27.749  -4.700  137.264 1.00 69.01  ? 112  GLN B NE2 1 
ATOM   3465  N N   . HIS B 1 112 ? 31.593  -2.762  141.705 1.00 69.01  ? 113  HIS B N   1 
ATOM   3466  C CA  . HIS B 1 112 ? 33.001  -2.438  141.905 1.00 62.27  ? 113  HIS B CA  1 
ATOM   3467  C C   . HIS B 1 112 ? 33.568  -3.118  143.141 1.00 48.76  ? 113  HIS B C   1 
ATOM   3468  O O   . HIS B 1 112 ? 34.703  -3.576  143.126 1.00 68.71  ? 113  HIS B O   1 
ATOM   3469  C CB  . HIS B 1 112 ? 33.201  -0.926  142.012 1.00 63.14  ? 113  HIS B CB  1 
ATOM   3470  C CG  . HIS B 1 112 ? 33.358  -0.243  140.689 1.00 69.79  ? 113  HIS B CG  1 
ATOM   3471  N ND1 . HIS B 1 112 ? 32.580  0.830   140.310 1.00 71.66  ? 113  HIS B ND1 1 
ATOM   3472  C CD2 . HIS B 1 112 ? 34.209  -0.474  139.663 1.00 73.97  ? 113  HIS B CD2 1 
ATOM   3473  C CE1 . HIS B 1 112 ? 32.942  1.226   139.102 1.00 75.25  ? 113  HIS B CE1 1 
ATOM   3474  N NE2 . HIS B 1 112 ? 33.928  0.453   138.687 1.00 79.65  ? 113  HIS B NE2 1 
ATOM   3475  N N   . LEU B 1 113 ? 32.778  -3.172  144.208 1.00 30.04  ? 114  LEU B N   1 
ATOM   3476  C CA  . LEU B 1 113 ? 33.180  -3.866  145.426 1.00 36.74  ? 114  LEU B CA  1 
ATOM   3477  C C   . LEU B 1 113 ? 33.501  -5.325  145.122 1.00 53.09  ? 114  LEU B C   1 
ATOM   3478  O O   . LEU B 1 113 ? 34.587  -5.828  145.460 1.00 49.94  ? 114  LEU B O   1 
ATOM   3479  C CB  . LEU B 1 113 ? 32.059  -3.790  146.463 1.00 43.89  ? 114  LEU B CB  1 
ATOM   3480  C CG  . LEU B 1 113 ? 32.326  -3.043  147.768 1.00 54.93  ? 114  LEU B CG  1 
ATOM   3481  C CD1 . LEU B 1 113 ? 33.040  -1.728  147.509 1.00 56.36  ? 114  LEU B CD1 1 
ATOM   3482  C CD2 . LEU B 1 113 ? 31.008  -2.801  148.475 1.00 63.29  ? 114  LEU B CD2 1 
ATOM   3483  N N   . LEU B 1 114 ? 32.553  -6.001  144.475 1.00 57.37  ? 115  LEU B N   1 
ATOM   3484  C CA  . LEU B 1 114 ? 32.759  -7.402  144.112 1.00 55.14  ? 115  LEU B CA  1 
ATOM   3485  C C   . LEU B 1 114 ? 34.010  -7.592  143.247 1.00 49.62  ? 115  LEU B C   1 
ATOM   3486  O O   . LEU B 1 114 ? 34.829  -8.488  143.503 1.00 44.76  ? 115  LEU B O   1 
ATOM   3487  C CB  . LEU B 1 114 ? 31.528  -7.965  143.402 1.00 49.65  ? 115  LEU B CB  1 
ATOM   3488  C CG  . LEU B 1 114 ? 31.524  -9.480  143.194 1.00 39.00  ? 115  LEU B CG  1 
ATOM   3489  C CD1 . LEU B 1 114 ? 31.790  -10.189 144.512 1.00 37.32  ? 115  LEU B CD1 1 
ATOM   3490  C CD2 . LEU B 1 114 ? 30.202  -9.931  142.602 1.00 34.64  ? 115  LEU B CD2 1 
ATOM   3491  N N   . ASN B 1 115 ? 34.158  -6.739  142.235 1.00 41.47  ? 116  ASN B N   1 
ATOM   3492  C CA  . ASN B 1 115 ? 35.319  -6.797  141.348 1.00 42.95  ? 116  ASN B CA  1 
ATOM   3493  C C   . ASN B 1 115 ? 36.637  -6.567  142.089 1.00 51.65  ? 116  ASN B C   1 
ATOM   3494  O O   . ASN B 1 115 ? 37.673  -7.139  141.734 1.00 42.91  ? 116  ASN B O   1 
ATOM   3495  C CB  . ASN B 1 115 ? 35.172  -5.801  140.193 1.00 38.61  ? 116  ASN B CB  1 
ATOM   3496  C CG  . ASN B 1 115 ? 34.187  -6.271  139.135 1.00 51.86  ? 116  ASN B CG  1 
ATOM   3497  O OD1 . ASN B 1 115 ? 33.254  -7.018  139.430 1.00 52.81  ? 116  ASN B OD1 1 
ATOM   3498  N ND2 . ASN B 1 115 ? 34.397  -5.837  137.893 1.00 69.66  ? 116  ASN B ND2 1 
ATOM   3499  N N   . ASP B 1 116 ? 36.586  -5.734  143.124 1.00 50.42  ? 117  ASP B N   1 
ATOM   3500  C CA  . ASP B 1 116 ? 37.750  -5.455  143.955 1.00 55.52  ? 117  ASP B CA  1 
ATOM   3501  C C   . ASP B 1 116 ? 38.123  -6.685  144.758 1.00 66.78  ? 117  ASP B C   1 
ATOM   3502  O O   . ASP B 1 116 ? 39.303  -7.008  144.896 1.00 78.18  ? 117  ASP B O   1 
ATOM   3503  C CB  . ASP B 1 116 ? 37.486  -4.282  144.898 1.00 55.88  ? 117  ASP B CB  1 
ATOM   3504  C CG  . ASP B 1 116 ? 37.531  -2.948  144.190 1.00 65.13  ? 117  ASP B CG  1 
ATOM   3505  O OD1 . ASP B 1 116 ? 38.072  -2.894  143.066 1.00 56.25  ? 117  ASP B OD1 1 
ATOM   3506  O OD2 . ASP B 1 116 ? 37.032  -1.954  144.759 1.00 83.10  ? 117  ASP B OD2 1 
ATOM   3507  N N   . SER B 1 117 ? 37.114  -7.365  145.295 1.00 72.59  ? 118  SER B N   1 
ATOM   3508  C CA  . SER B 1 117 ? 37.359  -8.623  145.990 1.00 62.90  ? 118  SER B CA  1 
ATOM   3509  C C   . SER B 1 117 ? 38.035  -9.617  145.052 1.00 56.01  ? 118  SER B C   1 
ATOM   3510  O O   . SER B 1 117 ? 39.035  -10.244 145.414 1.00 43.75  ? 118  SER B O   1 
ATOM   3511  C CB  . SER B 1 117 ? 36.057  -9.215  146.532 1.00 60.08  ? 118  SER B CB  1 
ATOM   3512  O OG  . SER B 1 117 ? 36.303  -10.432 147.216 1.00 53.88  ? 118  SER B OG  1 
ATOM   3513  N N   . GLU B 1 118 ? 37.496  -9.744  143.842 1.00 58.62  ? 119  GLU B N   1 
ATOM   3514  C CA  . GLU B 1 118 ? 38.038  -10.695 142.872 1.00 57.96  ? 119  GLU B CA  1 
ATOM   3515  C C   . GLU B 1 118 ? 39.482  -10.376 142.475 1.00 62.86  ? 119  GLU B C   1 
ATOM   3516  O O   . GLU B 1 118 ? 40.319  -11.276 142.379 1.00 62.67  ? 119  GLU B O   1 
ATOM   3517  C CB  . GLU B 1 118 ? 37.150  -10.773 141.629 1.00 70.28  ? 119  GLU B CB  1 
ATOM   3518  C CG  . GLU B 1 118 ? 37.464  -11.952 140.721 1.00 80.05  ? 119  GLU B CG  1 
ATOM   3519  C CD  . GLU B 1 118 ? 36.481  -12.086 139.575 1.00 92.97  ? 119  GLU B CD  1 
ATOM   3520  O OE1 . GLU B 1 118 ? 35.890  -11.062 139.171 1.00 105.29 ? 119  GLU B OE1 1 
ATOM   3521  O OE2 . GLU B 1 118 ? 36.296  -13.218 139.080 1.00 86.72  ? 119  GLU B OE2 1 
ATOM   3522  N N   . ARG B 1 119 ? 39.772  -9.098  142.250 1.00 72.86  ? 120  ARG B N   1 
ATOM   3523  C CA  . ARG B 1 119 ? 41.122  -8.690  141.861 1.00 58.95  ? 120  ARG B CA  1 
ATOM   3524  C C   . ARG B 1 119 ? 42.129  -8.834  143.004 1.00 62.44  ? 120  ARG B C   1 
ATOM   3525  O O   . ARG B 1 119 ? 43.281  -9.223  142.783 1.00 56.45  ? 120  ARG B O   1 
ATOM   3526  C CB  . ARG B 1 119 ? 41.124  -7.267  141.296 1.00 38.98  ? 120  ARG B CB  1 
ATOM   3527  C CG  . ARG B 1 119 ? 41.050  -7.226  139.776 1.00 48.30  ? 120  ARG B CG  1 
ATOM   3528  C CD  . ARG B 1 119 ? 41.060  -5.806  139.231 1.00 60.30  ? 120  ARG B CD  1 
ATOM   3529  N NE  . ARG B 1 119 ? 39.719  -5.232  139.156 1.00 74.83  ? 120  ARG B NE  1 
ATOM   3530  C CZ  . ARG B 1 119 ? 39.214  -4.387  140.048 1.00 80.36  ? 120  ARG B CZ  1 
ATOM   3531  N NH1 . ARG B 1 119 ? 39.940  -4.006  141.091 1.00 91.25  ? 120  ARG B NH1 1 
ATOM   3532  N NH2 . ARG B 1 119 ? 37.983  -3.918  139.895 1.00 71.07  ? 120  ARG B NH2 1 
ATOM   3533  N N   . THR B 1 120 ? 41.689  -8.523  144.221 1.00 64.15  ? 121  THR B N   1 
ATOM   3534  C CA  . THR B 1 120 ? 42.501  -8.759  145.408 1.00 58.27  ? 121  THR B CA  1 
ATOM   3535  C C   . THR B 1 120 ? 42.820  -10.245 145.510 1.00 62.98  ? 121  THR B C   1 
ATOM   3536  O O   . THR B 1 120 ? 43.944  -10.624 145.839 1.00 71.07  ? 121  THR B O   1 
ATOM   3537  C CB  . THR B 1 120 ? 41.787  -8.295  146.694 1.00 68.41  ? 121  THR B CB  1 
ATOM   3538  O OG1 . THR B 1 120 ? 41.590  -6.877  146.647 1.00 68.49  ? 121  THR B OG1 1 
ATOM   3539  C CG2 . THR B 1 120 ? 42.611  -8.639  147.927 1.00 35.94  ? 121  THR B CG2 1 
ATOM   3540  N N   . LEU B 1 121 ? 41.827  -11.080 145.212 1.00 78.52  ? 122  LEU B N   1 
ATOM   3541  C CA  . LEU B 1 121 ? 42.021  -12.529 145.206 1.00 85.39  ? 122  LEU B CA  1 
ATOM   3542  C C   . LEU B 1 121 ? 43.080  -12.938 144.185 1.00 80.21  ? 122  LEU B C   1 
ATOM   3543  O O   . LEU B 1 121 ? 44.024  -13.660 144.511 1.00 85.67  ? 122  LEU B O   1 
ATOM   3544  C CB  . LEU B 1 121 ? 40.700  -13.257 144.927 1.00 79.90  ? 122  LEU B CB  1 
ATOM   3545  C CG  . LEU B 1 121 ? 40.742  -14.786 144.818 1.00 70.27  ? 122  LEU B CG  1 
ATOM   3546  C CD1 . LEU B 1 121 ? 39.555  -15.405 145.539 1.00 57.27  ? 122  LEU B CD1 1 
ATOM   3547  C CD2 . LEU B 1 121 ? 40.768  -15.236 143.362 1.00 68.46  ? 122  LEU B CD2 1 
ATOM   3548  N N   . GLN B 1 122 ? 42.919  -12.464 142.953 1.00 59.83  ? 123  GLN B N   1 
ATOM   3549  C CA  . GLN B 1 122 ? 43.844  -12.798 141.875 1.00 57.53  ? 123  GLN B CA  1 
ATOM   3550  C C   . GLN B 1 122 ? 45.270  -12.342 142.172 1.00 64.76  ? 123  GLN B C   1 
ATOM   3551  O O   . GLN B 1 122 ? 46.233  -12.980 141.749 1.00 69.26  ? 123  GLN B O   1 
ATOM   3552  C CB  . GLN B 1 122 ? 43.368  -12.196 140.551 1.00 51.27  ? 123  GLN B CB  1 
ATOM   3553  C CG  . GLN B 1 122 ? 42.089  -12.813 140.012 1.00 55.16  ? 123  GLN B CG  1 
ATOM   3554  C CD  . GLN B 1 122 ? 41.653  -12.196 138.695 1.00 71.15  ? 123  GLN B CD  1 
ATOM   3555  O OE1 . GLN B 1 122 ? 40.867  -11.248 138.671 1.00 76.13  ? 123  GLN B OE1 1 
ATOM   3556  N NE2 . GLN B 1 122 ? 42.163  -12.732 137.592 1.00 72.84  ? 123  GLN B NE2 1 
ATOM   3557  N N   . ALA B 1 123 ? 45.400  -11.236 142.897 1.00 65.83  ? 124  ALA B N   1 
ATOM   3558  C CA  . ALA B 1 123 ? 46.717  -10.708 143.237 1.00 60.34  ? 124  ALA B CA  1 
ATOM   3559  C C   . ALA B 1 123 ? 47.376  -11.452 144.402 1.00 62.05  ? 124  ALA B C   1 
ATOM   3560  O O   . ALA B 1 123 ? 48.570  -11.746 144.359 1.00 71.97  ? 124  ALA B O   1 
ATOM   3561  C CB  . ALA B 1 123 ? 46.628  -9.218  143.539 1.00 56.55  ? 124  ALA B CB  1 
ATOM   3562  N N   . THR B 1 124 ? 46.597  -11.743 145.440 1.00 61.28  ? 125  THR B N   1 
ATOM   3563  C CA  . THR B 1 124 ? 47.130  -12.352 146.661 1.00 73.16  ? 125  THR B CA  1 
ATOM   3564  C C   . THR B 1 124 ? 47.317  -13.869 146.605 1.00 80.01  ? 125  THR B C   1 
ATOM   3565  O O   . THR B 1 124 ? 48.321  -14.392 147.089 1.00 86.24  ? 125  THR B O   1 
ATOM   3566  C CB  . THR B 1 124 ? 46.259  -12.012 147.887 1.00 83.56  ? 125  THR B CB  1 
ATOM   3567  O OG1 . THR B 1 124 ? 44.913  -12.445 147.653 1.00 87.93  ? 125  THR B OG1 1 
ATOM   3568  C CG2 . THR B 1 124 ? 46.269  -10.515 148.149 1.00 85.45  ? 125  THR B CG2 1 
ATOM   3569  N N   . PHE B 1 125 ? 46.347  -14.567 146.021 1.00 85.88  ? 126  PHE B N   1 
ATOM   3570  C CA  . PHE B 1 125 ? 46.303  -16.036 146.068 1.00 83.02  ? 126  PHE B CA  1 
ATOM   3571  C C   . PHE B 1 125 ? 47.525  -16.816 145.545 1.00 81.25  ? 126  PHE B C   1 
ATOM   3572  O O   . PHE B 1 125 ? 47.935  -17.790 146.176 1.00 81.78  ? 126  PHE B O   1 
ATOM   3573  C CB  . PHE B 1 125 ? 45.011  -16.565 145.432 1.00 66.88  ? 126  PHE B CB  1 
ATOM   3574  C CG  . PHE B 1 125 ? 43.848  -16.623 146.381 1.00 67.98  ? 126  PHE B CG  1 
ATOM   3575  C CD1 . PHE B 1 125 ? 43.448  -15.497 147.081 1.00 70.84  ? 126  PHE B CD1 1 
ATOM   3576  C CD2 . PHE B 1 125 ? 43.149  -17.804 146.568 1.00 66.11  ? 126  PHE B CD2 1 
ATOM   3577  C CE1 . PHE B 1 125 ? 42.377  -15.549 147.954 1.00 61.62  ? 126  PHE B CE1 1 
ATOM   3578  C CE2 . PHE B 1 125 ? 42.076  -17.862 147.437 1.00 66.01  ? 126  PHE B CE2 1 
ATOM   3579  C CZ  . PHE B 1 125 ? 41.690  -16.733 148.131 1.00 53.04  ? 126  PHE B CZ  1 
ATOM   3580  N N   . PRO B 1 126 ? 48.100  -16.415 144.395 1.00 70.33  ? 127  PRO B N   1 
ATOM   3581  C CA  . PRO B 1 126 ? 49.262  -17.177 143.918 1.00 66.94  ? 127  PRO B CA  1 
ATOM   3582  C C   . PRO B 1 126 ? 50.447  -17.191 144.890 1.00 68.65  ? 127  PRO B C   1 
ATOM   3583  O O   . PRO B 1 126 ? 51.219  -18.147 144.888 1.00 64.07  ? 127  PRO B O   1 
ATOM   3584  C CB  . PRO B 1 126 ? 49.642  -16.454 142.623 1.00 65.46  ? 127  PRO B CB  1 
ATOM   3585  C CG  . PRO B 1 126 ? 48.368  -15.866 142.148 1.00 58.00  ? 127  PRO B CG  1 
ATOM   3586  C CD  . PRO B 1 126 ? 47.650  -15.433 143.391 1.00 64.40  ? 127  PRO B CD  1 
ATOM   3587  N N   . GLY B 1 127 ? 50.596  -16.143 145.693 1.00 77.33  ? 128  GLY B N   1 
ATOM   3588  C CA  . GLY B 1 127 ? 51.653  -16.100 146.687 1.00 68.10  ? 128  GLY B CA  1 
ATOM   3589  C C   . GLY B 1 127 ? 51.310  -16.814 147.981 1.00 63.02  ? 128  GLY B C   1 
ATOM   3590  O O   . GLY B 1 127 ? 52.181  -17.401 148.622 1.00 57.35  ? 128  GLY B O   1 
ATOM   3591  N N   . ALA B 1 128 ? 50.042  -16.761 148.372 1.00 69.22  ? 129  ALA B N   1 
ATOM   3592  C CA  . ALA B 1 128 ? 49.589  -17.392 149.610 1.00 80.65  ? 129  ALA B CA  1 
ATOM   3593  C C   . ALA B 1 128 ? 49.363  -18.886 149.419 1.00 81.70  ? 129  ALA B C   1 
ATOM   3594  O O   . ALA B 1 128 ? 49.685  -19.696 150.293 1.00 75.40  ? 129  ALA B O   1 
ATOM   3595  C CB  . ALA B 1 128 ? 48.317  -16.728 150.109 1.00 86.43  ? 129  ALA B CB  1 
ATOM   3596  N N   . PHE B 1 129 ? 48.803  -19.247 148.269 1.00 81.97  ? 130  PHE B N   1 
ATOM   3597  C CA  . PHE B 1 129 ? 48.562  -20.646 147.949 1.00 73.38  ? 130  PHE B CA  1 
ATOM   3598  C C   . PHE B 1 129 ? 49.272  -20.996 146.647 1.00 76.45  ? 130  PHE B C   1 
ATOM   3599  O O   . PHE B 1 129 ? 49.657  -20.118 145.886 1.00 87.54  ? 130  PHE B O   1 
ATOM   3600  C CB  . PHE B 1 129 ? 47.063  -20.926 147.833 1.00 65.15  ? 130  PHE B CB  1 
ATOM   3601  C CG  . PHE B 1 129 ? 46.246  -20.317 148.936 1.00 67.16  ? 130  PHE B CG  1 
ATOM   3602  C CD1 . PHE B 1 129 ? 46.304  -20.824 150.223 1.00 72.80  ? 130  PHE B CD1 1 
ATOM   3603  C CD2 . PHE B 1 129 ? 45.416  -19.238 148.683 1.00 62.44  ? 130  PHE B CD2 1 
ATOM   3604  C CE1 . PHE B 1 129 ? 45.553  -20.266 151.238 1.00 71.94  ? 130  PHE B CE1 1 
ATOM   3605  C CE2 . PHE B 1 129 ? 44.660  -18.675 149.693 1.00 65.47  ? 130  PHE B CE2 1 
ATOM   3606  C CZ  . PHE B 1 129 ? 44.728  -19.189 150.973 1.00 69.47  ? 130  PHE B CZ  1 
ATOM   3607  N N   . GLY B 1 130 ? 49.460  -22.287 146.416 1.00 63.55  ? 131  GLY B N   1 
ATOM   3608  C CA  . GLY B 1 130 ? 50.196  -22.785 145.271 1.00 78.47  ? 131  GLY B CA  1 
ATOM   3609  C C   . GLY B 1 130 ? 49.308  -23.197 144.117 1.00 78.65  ? 131  GLY B C   1 
ATOM   3610  O O   . GLY B 1 130 ? 48.305  -22.545 143.795 1.00 78.65  ? 131  GLY B O   1 
ATOM   3611  N N   . GLU B 1 131 ? 49.711  -24.284 143.466 1.00 90.67  ? 132  GLU B N   1 
ATOM   3612  C CA  . GLU B 1 131 ? 48.911  -24.920 142.425 1.00 91.24  ? 132  GLU B CA  1 
ATOM   3613  C C   . GLU B 1 131 ? 47.499  -25.196 142.942 1.00 73.74  ? 132  GLU B C   1 
ATOM   3614  O O   . GLU B 1 131 ? 46.563  -25.345 142.157 1.00 70.20  ? 132  GLU B O   1 
ATOM   3615  C CB  . GLU B 1 131 ? 49.559  -26.230 141.967 1.00 102.20 ? 132  GLU B CB  1 
ATOM   3616  C CG  . GLU B 1 131 ? 51.022  -26.116 141.539 1.00 109.95 ? 132  GLU B CG  1 
ATOM   3617  C CD  . GLU B 1 131 ? 51.990  -26.114 142.713 1.00 116.53 ? 132  GLU B CD  1 
ATOM   3618  O OE1 . GLU B 1 131 ? 51.532  -26.022 143.872 1.00 105.97 ? 132  GLU B OE1 1 
ATOM   3619  O OE2 . GLU B 1 131 ? 53.212  -26.207 142.475 1.00 125.68 ? 132  GLU B OE2 1 
ATOM   3620  N N   . LEU B 1 132 ? 47.365  -25.270 144.264 1.00 58.95  ? 133  LEU B N   1 
ATOM   3621  C CA  . LEU B 1 132 ? 46.071  -25.288 144.923 1.00 69.88  ? 133  LEU B CA  1 
ATOM   3622  C C   . LEU B 1 132 ? 45.190  -24.180 144.358 1.00 79.55  ? 133  LEU B C   1 
ATOM   3623  O O   . LEU B 1 132 ? 44.049  -24.425 143.978 1.00 83.17  ? 133  LEU B O   1 
ATOM   3624  C CB  . LEU B 1 132 ? 46.255  -25.076 146.425 1.00 70.88  ? 133  LEU B CB  1 
ATOM   3625  C CG  . LEU B 1 132 ? 46.922  -26.195 147.229 1.00 72.78  ? 133  LEU B CG  1 
ATOM   3626  C CD1 . LEU B 1 132 ? 47.338  -25.702 148.607 1.00 66.84  ? 133  LEU B CD1 1 
ATOM   3627  C CD2 . LEU B 1 132 ? 45.986  -27.385 147.354 1.00 75.61  ? 133  LEU B CD2 1 
ATOM   3628  N N   . TYR B 1 133 ? 45.715  -22.959 144.310 1.00 85.78  ? 134  TYR B N   1 
ATOM   3629  C CA  . TYR B 1 133 ? 44.992  -21.864 143.672 1.00 87.52  ? 134  TYR B CA  1 
ATOM   3630  C C   . TYR B 1 133 ? 45.105  -21.838 142.150 1.00 76.97  ? 134  TYR B C   1 
ATOM   3631  O O   . TYR B 1 133 ? 44.100  -21.698 141.452 1.00 71.77  ? 134  TYR B O   1 
ATOM   3632  C CB  . TYR B 1 133 ? 45.420  -20.503 144.224 1.00 96.11  ? 134  TYR B CB  1 
ATOM   3633  C CG  . TYR B 1 133 ? 44.836  -19.362 143.422 1.00 94.01  ? 134  TYR B CG  1 
ATOM   3634  C CD1 . TYR B 1 133 ? 43.471  -19.104 143.447 1.00 94.70  ? 134  TYR B CD1 1 
ATOM   3635  C CD2 . TYR B 1 133 ? 45.640  -18.561 142.620 1.00 90.39  ? 134  TYR B CD2 1 
ATOM   3636  C CE1 . TYR B 1 133 ? 42.926  -18.074 142.710 1.00 100.17 ? 134  TYR B CE1 1 
ATOM   3637  C CE2 . TYR B 1 133 ? 45.102  -17.527 141.880 1.00 91.34  ? 134  TYR B CE2 1 
ATOM   3638  C CZ  . TYR B 1 133 ? 43.745  -17.290 141.929 1.00 99.46  ? 134  TYR B CZ  1 
ATOM   3639  O OH  . TYR B 1 133 ? 43.203  -16.263 141.195 1.00 100.86 ? 134  TYR B OH  1 
ATOM   3640  N N   . THR B 1 134 ? 46.325  -21.965 141.636 1.00 72.43  ? 135  THR B N   1 
ATOM   3641  C CA  . THR B 1 134 ? 46.544  -21.697 140.213 1.00 75.21  ? 135  THR B CA  1 
ATOM   3642  C C   . THR B 1 134 ? 45.908  -22.718 139.270 1.00 75.81  ? 135  THR B C   1 
ATOM   3643  O O   . THR B 1 134 ? 45.568  -22.384 138.137 1.00 66.38  ? 135  THR B O   1 
ATOM   3644  C CB  . THR B 1 134 ? 48.037  -21.499 139.876 1.00 73.46  ? 135  THR B CB  1 
ATOM   3645  O OG1 . THR B 1 134 ? 48.815  -22.531 140.491 1.00 67.23  ? 135  THR B OG1 1 
ATOM   3646  C CG2 . THR B 1 134 ? 48.509  -20.144 140.383 1.00 71.87  ? 135  THR B CG2 1 
ATOM   3647  N N   . GLN B 1 135 ? 45.751  -23.956 139.728 1.00 88.65  ? 136  GLN B N   1 
ATOM   3648  C CA  . GLN B 1 135 ? 45.084  -24.971 138.918 1.00 96.59  ? 136  GLN B CA  1 
ATOM   3649  C C   . GLN B 1 135 ? 43.568  -24.819 139.004 1.00 91.99  ? 136  GLN B C   1 
ATOM   3650  O O   . GLN B 1 135 ? 42.848  -25.112 138.053 1.00 101.68 ? 136  GLN B O   1 
ATOM   3651  C CB  . GLN B 1 135 ? 45.508  -26.375 139.359 1.00 114.19 ? 136  GLN B CB  1 
ATOM   3652  C CG  . GLN B 1 135 ? 44.771  -27.517 138.667 1.00 130.78 ? 136  GLN B CG  1 
ATOM   3653  C CD  . GLN B 1 135 ? 45.244  -27.765 137.244 1.00 139.79 ? 136  GLN B CD  1 
ATOM   3654  O OE1 . GLN B 1 135 ? 46.126  -27.073 136.733 1.00 146.67 ? 136  GLN B OE1 1 
ATOM   3655  N NE2 . GLN B 1 135 ? 44.658  -28.767 136.599 1.00 134.52 ? 136  GLN B NE2 1 
ATOM   3656  N N   . ASN B 1 136 ? 43.096  -24.351 140.155 1.00 87.86  ? 137  ASN B N   1 
ATOM   3657  C CA  . ASN B 1 136 ? 41.664  -24.270 140.441 1.00 92.72  ? 137  ASN B CA  1 
ATOM   3658  C C   . ASN B 1 136 ? 41.014  -22.907 140.184 1.00 90.79  ? 137  ASN B C   1 
ATOM   3659  O O   . ASN B 1 136 ? 39.839  -22.712 140.491 1.00 83.32  ? 137  ASN B O   1 
ATOM   3660  C CB  . ASN B 1 136 ? 41.402  -24.720 141.879 1.00 94.07  ? 137  ASN B CB  1 
ATOM   3661  C CG  . ASN B 1 136 ? 42.084  -26.033 142.205 1.00 92.68  ? 137  ASN B CG  1 
ATOM   3662  O OD1 . ASN B 1 136 ? 42.143  -26.937 141.372 1.00 99.94  ? 137  ASN B OD1 1 
ATOM   3663  N ND2 . ASN B 1 136 ? 42.616  -26.139 143.415 1.00 86.07  ? 137  ASN B ND2 1 
ATOM   3664  N N   . ALA B 1 137 ? 41.787  -21.972 139.636 1.00 95.84  ? 138  ALA B N   1 
ATOM   3665  C CA  . ALA B 1 137 ? 41.359  -20.577 139.473 1.00 92.09  ? 138  ALA B CA  1 
ATOM   3666  C C   . ALA B 1 137 ? 39.992  -20.370 138.807 1.00 100.34 ? 138  ALA B C   1 
ATOM   3667  O O   . ALA B 1 137 ? 39.202  -19.524 139.244 1.00 103.10 ? 138  ALA B O   1 
ATOM   3668  C CB  . ALA B 1 137 ? 42.433  -19.782 138.736 1.00 83.76  ? 138  ALA B CB  1 
ATOM   3669  N N   . ARG B 1 138 ? 39.716  -21.138 137.755 1.00 98.88  ? 139  ARG B N   1 
ATOM   3670  C CA  . ARG B 1 138 ? 38.472  -20.985 137.001 1.00 91.81  ? 139  ARG B CA  1 
ATOM   3671  C C   . ARG B 1 138 ? 37.239  -21.237 137.865 1.00 80.11  ? 139  ARG B C   1 
ATOM   3672  O O   . ARG B 1 138 ? 36.172  -20.678 137.615 1.00 76.04  ? 139  ARG B O   1 
ATOM   3673  C CB  . ARG B 1 138 ? 38.449  -21.913 135.782 1.00 103.15 ? 139  ARG B CB  1 
ATOM   3674  C CG  . ARG B 1 138 ? 37.377  -21.551 134.760 1.00 107.54 ? 139  ARG B CG  1 
ATOM   3675  C CD  . ARG B 1 138 ? 37.136  -22.673 133.760 1.00 114.81 ? 139  ARG B CD  1 
ATOM   3676  N NE  . ARG B 1 138 ? 37.036  -22.175 132.390 1.00 117.37 ? 139  ARG B NE  1 
ATOM   3677  C CZ  . ARG B 1 138 ? 35.941  -21.632 131.864 1.00 110.67 ? 139  ARG B CZ  1 
ATOM   3678  N NH1 . ARG B 1 138 ? 34.839  -21.506 132.592 1.00 111.72 ? 139  ARG B NH1 1 
ATOM   3679  N NH2 . ARG B 1 138 ? 35.950  -21.210 130.606 1.00 101.18 ? 139  ARG B NH2 1 
ATOM   3680  N N   . ALA B 1 139 ? 37.390  -22.084 138.879 1.00 83.29  ? 140  ALA B N   1 
ATOM   3681  C CA  . ALA B 1 139 ? 36.297  -22.378 139.798 1.00 77.81  ? 140  ALA B CA  1 
ATOM   3682  C C   . ALA B 1 139 ? 35.963  -21.147 140.631 1.00 71.07  ? 140  ALA B C   1 
ATOM   3683  O O   . ALA B 1 139 ? 34.792  -20.841 140.865 1.00 70.68  ? 140  ALA B O   1 
ATOM   3684  C CB  . ALA B 1 139 ? 36.658  -23.549 140.696 1.00 78.54  ? 140  ALA B CB  1 
ATOM   3685  N N   . PHE B 1 140 ? 37.001  -20.443 141.071 1.00 61.89  ? 141  PHE B N   1 
ATOM   3686  C CA  . PHE B 1 140 ? 36.829  -19.204 141.819 1.00 68.08  ? 141  PHE B CA  1 
ATOM   3687  C C   . PHE B 1 140 ? 36.204  -18.131 140.930 1.00 63.26  ? 141  PHE B C   1 
ATOM   3688  O O   . PHE B 1 140 ? 35.283  -17.416 141.344 1.00 39.23  ? 141  PHE B O   1 
ATOM   3689  C CB  . PHE B 1 140 ? 38.173  -18.721 142.367 1.00 53.06  ? 141  PHE B CB  1 
ATOM   3690  C CG  . PHE B 1 140 ? 38.789  -19.652 143.371 1.00 42.98  ? 141  PHE B CG  1 
ATOM   3691  C CD1 . PHE B 1 140 ? 38.487  -19.535 144.717 1.00 36.95  ? 141  PHE B CD1 1 
ATOM   3692  C CD2 . PHE B 1 140 ? 39.670  -20.640 142.970 1.00 45.82  ? 141  PHE B CD2 1 
ATOM   3693  C CE1 . PHE B 1 140 ? 39.052  -20.388 145.644 1.00 40.88  ? 141  PHE B CE1 1 
ATOM   3694  C CE2 . PHE B 1 140 ? 40.237  -21.496 143.892 1.00 49.64  ? 141  PHE B CE2 1 
ATOM   3695  C CZ  . PHE B 1 140 ? 39.928  -21.370 145.230 1.00 41.55  ? 141  PHE B CZ  1 
ATOM   3696  N N   . ARG B 1 141 ? 36.711  -18.032 139.703 1.00 57.82  ? 142  ARG B N   1 
ATOM   3697  C CA  . ARG B 1 141 ? 36.190  -17.085 138.724 1.00 51.40  ? 142  ARG B CA  1 
ATOM   3698  C C   . ARG B 1 141 ? 34.694  -17.305 138.499 1.00 64.95  ? 142  ARG B C   1 
ATOM   3699  O O   . ARG B 1 141 ? 33.898  -16.360 138.543 1.00 77.12  ? 142  ARG B O   1 
ATOM   3700  C CB  . ARG B 1 141 ? 36.952  -17.222 137.404 1.00 52.53  ? 142  ARG B CB  1 
ATOM   3701  C CG  . ARG B 1 141 ? 36.638  -16.149 136.377 1.00 75.75  ? 142  ARG B CG  1 
ATOM   3702  C CD  . ARG B 1 141 ? 37.628  -16.198 135.221 1.00 89.14  ? 142  ARG B CD  1 
ATOM   3703  N NE  . ARG B 1 141 ? 37.504  -17.423 134.435 1.00 95.66  ? 142  ARG B NE  1 
ATOM   3704  C CZ  . ARG B 1 141 ? 38.410  -17.842 133.557 1.00 97.60  ? 142  ARG B CZ  1 
ATOM   3705  N NH1 . ARG B 1 141 ? 39.517  -17.139 133.356 1.00 99.16  ? 142  ARG B NH1 1 
ATOM   3706  N NH2 . ARG B 1 141 ? 38.214  -18.967 132.884 1.00 100.99 ? 142  ARG B NH2 1 
ATOM   3707  N N   . ASP B 1 142 ? 34.317  -18.560 138.279 1.00 59.80  ? 143  ASP B N   1 
ATOM   3708  C CA  . ASP B 1 142 ? 32.919  -18.910 138.065 1.00 60.43  ? 143  ASP B CA  1 
ATOM   3709  C C   . ASP B 1 142 ? 32.083  -18.702 139.322 1.00 52.14  ? 143  ASP B C   1 
ATOM   3710  O O   . ASP B 1 142 ? 30.891  -18.424 139.233 1.00 57.35  ? 143  ASP B O   1 
ATOM   3711  C CB  . ASP B 1 142 ? 32.784  -20.349 137.564 1.00 73.80  ? 143  ASP B CB  1 
ATOM   3712  C CG  . ASP B 1 142 ? 33.223  -20.505 136.122 1.00 86.10  ? 143  ASP B CG  1 
ATOM   3713  O OD1 . ASP B 1 142 ? 33.250  -19.488 135.397 1.00 90.02  ? 143  ASP B OD1 1 
ATOM   3714  O OD2 . ASP B 1 142 ? 33.534  -21.642 135.712 1.00 87.98  ? 143  ASP B OD2 1 
ATOM   3715  N N   . LEU B 1 143 ? 32.706  -18.841 140.488 1.00 45.06  ? 144  LEU B N   1 
ATOM   3716  C CA  . LEU B 1 143 ? 32.021  -18.555 141.743 1.00 42.22  ? 144  LEU B CA  1 
ATOM   3717  C C   . LEU B 1 143 ? 31.660  -17.077 141.810 1.00 61.50  ? 144  LEU B C   1 
ATOM   3718  O O   . LEU B 1 143 ? 30.543  -16.715 142.191 1.00 73.25  ? 144  LEU B O   1 
ATOM   3719  C CB  . LEU B 1 143 ? 32.891  -18.929 142.942 1.00 48.04  ? 144  LEU B CB  1 
ATOM   3720  C CG  . LEU B 1 143 ? 32.289  -18.561 144.299 1.00 44.87  ? 144  LEU B CG  1 
ATOM   3721  C CD1 . LEU B 1 143 ? 30.986  -19.313 144.521 1.00 40.27  ? 144  LEU B CD1 1 
ATOM   3722  C CD2 . LEU B 1 143 ? 33.273  -18.830 145.426 1.00 49.82  ? 144  LEU B CD2 1 
ATOM   3723  N N   . TYR B 1 144 ? 32.610  -16.225 141.437 1.00 64.37  ? 145  TYR B N   1 
ATOM   3724  C CA  . TYR B 1 144 ? 32.353  -14.791 141.386 1.00 65.08  ? 145  TYR B CA  1 
ATOM   3725  C C   . TYR B 1 144 ? 31.284  -14.456 140.349 1.00 69.33  ? 145  TYR B C   1 
ATOM   3726  O O   . TYR B 1 144 ? 30.458  -13.568 140.565 1.00 64.79  ? 145  TYR B O   1 
ATOM   3727  C CB  . TYR B 1 144 ? 33.641  -14.007 141.117 1.00 50.19  ? 145  TYR B CB  1 
ATOM   3728  C CG  . TYR B 1 144 ? 34.404  -13.657 142.376 1.00 49.02  ? 145  TYR B CG  1 
ATOM   3729  C CD1 . TYR B 1 144 ? 34.143  -12.479 143.062 1.00 57.49  ? 145  TYR B CD1 1 
ATOM   3730  C CD2 . TYR B 1 144 ? 35.377  -14.508 142.883 1.00 54.12  ? 145  TYR B CD2 1 
ATOM   3731  C CE1 . TYR B 1 144 ? 34.833  -12.155 144.216 1.00 62.72  ? 145  TYR B CE1 1 
ATOM   3732  C CE2 . TYR B 1 144 ? 36.072  -14.192 144.036 1.00 47.20  ? 145  TYR B CE2 1 
ATOM   3733  C CZ  . TYR B 1 144 ? 35.796  -13.015 144.698 1.00 51.35  ? 145  TYR B CZ  1 
ATOM   3734  O OH  . TYR B 1 144 ? 36.484  -12.695 145.846 1.00 50.39  ? 145  TYR B OH  1 
ATOM   3735  N N   . SER B 1 145 ? 31.300  -15.174 139.229 1.00 68.07  ? 146  SER B N   1 
ATOM   3736  C CA  . SER B 1 145 ? 30.278  -14.994 138.202 1.00 57.07  ? 146  SER B CA  1 
ATOM   3737  C C   . SER B 1 145 ? 28.891  -15.339 138.743 1.00 56.86  ? 146  SER B C   1 
ATOM   3738  O O   . SER B 1 145 ? 27.919  -14.616 138.501 1.00 66.24  ? 146  SER B O   1 
ATOM   3739  C CB  . SER B 1 145 ? 30.593  -15.847 136.972 1.00 60.10  ? 146  SER B CB  1 
ATOM   3740  O OG  . SER B 1 145 ? 31.821  -15.455 136.384 1.00 76.35  ? 146  SER B OG  1 
ATOM   3741  N N   . GLU B 1 146 ? 28.809  -16.443 139.482 1.00 54.73  ? 147  GLU B N   1 
ATOM   3742  C CA  . GLU B 1 146 ? 27.563  -16.866 140.110 1.00 52.94  ? 147  GLU B CA  1 
ATOM   3743  C C   . GLU B 1 146 ? 27.095  -15.829 141.121 1.00 59.35  ? 147  GLU B C   1 
ATOM   3744  O O   . GLU B 1 146 ? 25.898  -15.573 141.252 1.00 67.40  ? 147  GLU B O   1 
ATOM   3745  C CB  . GLU B 1 146 ? 27.734  -18.222 140.800 1.00 55.80  ? 147  GLU B CB  1 
ATOM   3746  C CG  . GLU B 1 146 ? 27.974  -19.388 139.855 1.00 70.57  ? 147  GLU B CG  1 
ATOM   3747  C CD  . GLU B 1 146 ? 26.758  -19.728 139.018 1.00 79.06  ? 147  GLU B CD  1 
ATOM   3748  O OE1 . GLU B 1 146 ? 25.625  -19.577 139.521 1.00 82.24  ? 147  GLU B OE1 1 
ATOM   3749  O OE2 . GLU B 1 146 ? 26.938  -20.149 137.856 1.00 75.11  ? 147  GLU B OE2 1 
ATOM   3750  N N   . LEU B 1 147 ? 28.045  -15.238 141.838 1.00 49.23  ? 148  LEU B N   1 
ATOM   3751  C CA  . LEU B 1 147 ? 27.722  -14.177 142.785 1.00 51.17  ? 148  LEU B CA  1 
ATOM   3752  C C   . LEU B 1 147 ? 27.177  -12.941 142.072 1.00 59.47  ? 148  LEU B C   1 
ATOM   3753  O O   . LEU B 1 147 ? 26.273  -12.275 142.576 1.00 54.53  ? 148  LEU B O   1 
ATOM   3754  C CB  . LEU B 1 147 ? 28.944  -13.809 143.627 1.00 52.78  ? 148  LEU B CB  1 
ATOM   3755  C CG  . LEU B 1 147 ? 29.360  -14.841 144.676 1.00 55.06  ? 148  LEU B CG  1 
ATOM   3756  C CD1 . LEU B 1 147 ? 30.536  -14.331 145.495 1.00 53.61  ? 148  LEU B CD1 1 
ATOM   3757  C CD2 . LEU B 1 147 ? 28.183  -15.186 145.576 1.00 20.51  ? 148  LEU B CD2 1 
ATOM   3758  N N   . ARG B 1 148 ? 27.730  -12.639 140.902 1.00 66.33  ? 149  ARG B N   1 
ATOM   3759  C CA  . ARG B 1 148 ? 27.258  -11.513 140.102 1.00 59.32  ? 149  ARG B CA  1 
ATOM   3760  C C   . ARG B 1 148 ? 25.833  -11.749 139.614 1.00 59.62  ? 149  ARG B C   1 
ATOM   3761  O O   . ARG B 1 148 ? 24.980  -10.861 139.707 1.00 47.40  ? 149  ARG B O   1 
ATOM   3762  C CB  . ARG B 1 148 ? 28.190  -11.258 138.915 1.00 54.05  ? 149  ARG B CB  1 
ATOM   3763  C CG  . ARG B 1 148 ? 29.229  -10.178 139.165 1.00 50.04  ? 149  ARG B CG  1 
ATOM   3764  C CD  . ARG B 1 148 ? 30.084  -9.927  137.936 1.00 50.98  ? 149  ARG B CD  1 
ATOM   3765  N NE  . ARG B 1 148 ? 30.990  -11.037 137.660 1.00 70.80  ? 149  ARG B NE  1 
ATOM   3766  C CZ  . ARG B 1 148 ? 32.237  -11.111 138.112 1.00 71.56  ? 149  ARG B CZ  1 
ATOM   3767  N NH1 . ARG B 1 148 ? 32.732  -10.137 138.862 1.00 43.28  ? 149  ARG B NH1 1 
ATOM   3768  N NH2 . ARG B 1 148 ? 32.992  -12.160 137.812 1.00 87.51  ? 149  ARG B NH2 1 
ATOM   3769  N N   . LEU B 1 149 ? 25.584  -12.949 139.093 1.00 63.15  ? 150  LEU B N   1 
ATOM   3770  C CA  . LEU B 1 149 ? 24.243  -13.331 138.657 1.00 51.21  ? 150  LEU B CA  1 
ATOM   3771  C C   . LEU B 1 149 ? 23.250  -13.265 139.811 1.00 50.37  ? 150  LEU B C   1 
ATOM   3772  O O   . LEU B 1 149 ? 22.125  -12.789 139.650 1.00 47.38  ? 150  LEU B O   1 
ATOM   3773  C CB  . LEU B 1 149 ? 24.248  -14.739 138.063 1.00 50.16  ? 150  LEU B CB  1 
ATOM   3774  C CG  . LEU B 1 149 ? 24.806  -14.898 136.651 1.00 65.03  ? 150  LEU B CG  1 
ATOM   3775  C CD1 . LEU B 1 149 ? 24.844  -16.367 136.266 1.00 64.74  ? 150  LEU B CD1 1 
ATOM   3776  C CD2 . LEU B 1 149 ? 23.968  -14.101 135.663 1.00 56.99  ? 150  LEU B CD2 1 
ATOM   3777  N N   . TYR B 1 150 ? 23.673  -13.745 140.975 1.00 52.98  ? 151  TYR B N   1 
ATOM   3778  C CA  . TYR B 1 150 ? 22.826  -13.727 142.159 1.00 46.10  ? 151  TYR B CA  1 
ATOM   3779  C C   . TYR B 1 150 ? 22.524  -12.298 142.588 1.00 49.65  ? 151  TYR B C   1 
ATOM   3780  O O   . TYR B 1 150 ? 21.418  -11.998 143.037 1.00 45.23  ? 151  TYR B O   1 
ATOM   3781  C CB  . TYR B 1 150 ? 23.481  -14.499 143.303 1.00 43.39  ? 151  TYR B CB  1 
ATOM   3782  C CG  . TYR B 1 150 ? 22.679  -14.471 144.582 1.00 54.35  ? 151  TYR B CG  1 
ATOM   3783  C CD1 . TYR B 1 150 ? 21.436  -15.085 144.655 1.00 52.59  ? 151  TYR B CD1 1 
ATOM   3784  C CD2 . TYR B 1 150 ? 23.165  -13.835 145.717 1.00 57.64  ? 151  TYR B CD2 1 
ATOM   3785  C CE1 . TYR B 1 150 ? 20.697  -15.063 145.821 1.00 44.45  ? 151  TYR B CE1 1 
ATOM   3786  C CE2 . TYR B 1 150 ? 22.433  -13.810 146.888 1.00 66.43  ? 151  TYR B CE2 1 
ATOM   3787  C CZ  . TYR B 1 150 ? 21.199  -14.426 146.934 1.00 63.71  ? 151  TYR B CZ  1 
ATOM   3788  O OH  . TYR B 1 150 ? 20.466  -14.406 148.096 1.00 77.05  ? 151  TYR B OH  1 
ATOM   3789  N N   . TYR B 1 151 ? 23.511  -11.419 142.445 1.00 67.25  ? 152  TYR B N   1 
ATOM   3790  C CA  . TYR B 1 151 ? 23.328  -10.007 142.757 1.00 53.68  ? 152  TYR B CA  1 
ATOM   3791  C C   . TYR B 1 151 ? 22.342  -9.367  141.787 1.00 46.47  ? 152  TYR B C   1 
ATOM   3792  O O   . TYR B 1 151 ? 21.559  -8.497  142.168 1.00 57.45  ? 152  TYR B O   1 
ATOM   3793  C CB  . TYR B 1 151 ? 24.666  -9.264  142.719 1.00 56.82  ? 152  TYR B CB  1 
ATOM   3794  C CG  . TYR B 1 151 ? 24.526  -7.758  142.744 1.00 51.68  ? 152  TYR B CG  1 
ATOM   3795  C CD1 . TYR B 1 151 ? 24.200  -7.090  143.917 1.00 45.62  ? 152  TYR B CD1 1 
ATOM   3796  C CD2 . TYR B 1 151 ? 24.719  -7.005  141.593 1.00 41.69  ? 152  TYR B CD2 1 
ATOM   3797  C CE1 . TYR B 1 151 ? 24.068  -5.714  143.943 1.00 37.89  ? 152  TYR B CE1 1 
ATOM   3798  C CE2 . TYR B 1 151 ? 24.589  -5.630  141.609 1.00 49.07  ? 152  TYR B CE2 1 
ATOM   3799  C CZ  . TYR B 1 151 ? 24.264  -4.990  142.786 1.00 47.26  ? 152  TYR B CZ  1 
ATOM   3800  O OH  . TYR B 1 151 ? 24.136  -3.620  142.804 1.00 53.05  ? 152  TYR B OH  1 
ATOM   3801  N N   . ARG B 1 152 ? 22.381  -9.806  140.532 1.00 51.88  ? 153  ARG B N   1 
ATOM   3802  C CA  . ARG B 1 152 ? 21.451  -9.309  139.523 1.00 58.74  ? 153  ARG B CA  1 
ATOM   3803  C C   . ARG B 1 152 ? 20.070  -9.939  139.687 1.00 64.17  ? 153  ARG B C   1 
ATOM   3804  O O   . ARG B 1 152 ? 19.091  -9.469  139.107 1.00 56.32  ? 153  ARG B O   1 
ATOM   3805  C CB  . ARG B 1 152 ? 21.984  -9.574  138.113 1.00 56.64  ? 153  ARG B CB  1 
ATOM   3806  C CG  . ARG B 1 152 ? 23.300  -8.883  137.801 1.00 70.72  ? 153  ARG B CG  1 
ATOM   3807  C CD  . ARG B 1 152 ? 23.795  -9.261  136.415 1.00 86.75  ? 153  ARG B CD  1 
ATOM   3808  N NE  . ARG B 1 152 ? 22.848  -8.871  135.374 1.00 101.71 ? 153  ARG B NE  1 
ATOM   3809  C CZ  . ARG B 1 152 ? 22.957  -9.217  134.095 1.00 113.91 ? 153  ARG B CZ  1 
ATOM   3810  N NH1 . ARG B 1 152 ? 23.972  -9.971  133.693 1.00 115.35 ? 153  ARG B NH1 1 
ATOM   3811  N NH2 . ARG B 1 152 ? 22.048  -8.814  133.218 1.00 117.00 ? 153  ARG B NH2 1 
ATOM   3812  N N   . GLY B 1 153 ? 20.000  -11.004 140.480 1.00 69.15  ? 154  GLY B N   1 
ATOM   3813  C CA  . GLY B 1 153 ? 18.747  -11.691 140.734 1.00 64.81  ? 154  GLY B CA  1 
ATOM   3814  C C   . GLY B 1 153 ? 18.379  -12.695 139.658 1.00 72.66  ? 154  GLY B C   1 
ATOM   3815  O O   . GLY B 1 153 ? 17.224  -13.111 139.558 1.00 71.23  ? 154  GLY B O   1 
ATOM   3816  N N   . ALA B 1 154 ? 19.362  -13.088 138.851 1.00 70.75  ? 155  ALA B N   1 
ATOM   3817  C CA  . ALA B 1 154 ? 19.126  -14.028 137.759 1.00 73.45  ? 155  ALA B CA  1 
ATOM   3818  C C   . ALA B 1 154 ? 18.825  -15.434 138.277 1.00 96.09  ? 155  ALA B C   1 
ATOM   3819  O O   . ALA B 1 154 ? 17.794  -16.018 137.942 1.00 97.99  ? 155  ALA B O   1 
ATOM   3820  C CB  . ALA B 1 154 ? 20.316  -14.049 136.812 1.00 64.56  ? 155  ALA B CB  1 
ATOM   3821  N N   . ASN B 1 155 ? 19.723  -15.973 139.096 1.00 106.76 ? 156  ASN B N   1 
ATOM   3822  C CA  . ASN B 1 155 ? 19.467  -17.246 139.764 1.00 111.11 ? 156  ASN B CA  1 
ATOM   3823  C C   . ASN B 1 155 ? 19.437  -17.062 141.279 1.00 112.59 ? 156  ASN B C   1 
ATOM   3824  O O   . ASN B 1 155 ? 20.379  -16.537 141.874 1.00 118.71 ? 156  ASN B O   1 
ATOM   3825  C CB  . ASN B 1 155 ? 20.474  -18.325 139.343 1.00 112.56 ? 156  ASN B CB  1 
ATOM   3826  C CG  . ASN B 1 155 ? 21.866  -18.084 139.896 1.00 112.02 ? 156  ASN B CG  1 
ATOM   3827  O OD1 . ASN B 1 155 ? 22.204  -18.554 140.983 1.00 108.39 ? 156  ASN B OD1 1 
ATOM   3828  N ND2 . ASN B 1 155 ? 22.682  -17.357 139.146 1.00 116.73 ? 156  ASN B ND2 1 
ATOM   3829  N N   . LEU B 1 156 ? 18.339  -17.482 141.896 1.00 106.73 ? 157  LEU B N   1 
ATOM   3830  C CA  . LEU B 1 156 ? 18.095  -17.170 143.300 1.00 106.66 ? 157  LEU B CA  1 
ATOM   3831  C C   . LEU B 1 156 ? 18.544  -18.236 144.296 1.00 110.64 ? 157  LEU B C   1 
ATOM   3832  O O   . LEU B 1 156 ? 18.293  -18.105 145.494 1.00 106.48 ? 157  LEU B O   1 
ATOM   3833  C CB  . LEU B 1 156 ? 16.629  -16.791 143.529 1.00 99.47  ? 157  LEU B CB  1 
ATOM   3834  C CG  . LEU B 1 156 ? 16.387  -15.296 143.754 1.00 91.77  ? 157  LEU B CG  1 
ATOM   3835  C CD1 . LEU B 1 156 ? 17.034  -14.469 142.651 1.00 83.70  ? 157  LEU B CD1 1 
ATOM   3836  C CD2 . LEU B 1 156 ? 14.900  -14.996 143.849 1.00 94.02  ? 157  LEU B CD2 1 
ATOM   3837  N N   . HIS B 1 157 ? 19.204  -19.287 143.821 1.00 118.38 ? 158  HIS B N   1 
ATOM   3838  C CA  . HIS B 1 157 ? 19.713  -20.285 144.752 1.00 123.88 ? 158  HIS B CA  1 
ATOM   3839  C C   . HIS B 1 157 ? 21.205  -20.077 144.999 1.00 122.28 ? 158  HIS B C   1 
ATOM   3840  O O   . HIS B 1 157 ? 22.046  -20.384 144.154 1.00 132.78 ? 158  HIS B O   1 
ATOM   3841  C CB  . HIS B 1 157 ? 19.428  -21.707 144.243 1.00 127.59 ? 158  HIS B CB  1 
ATOM   3842  C CG  . HIS B 1 157 ? 19.994  -21.997 142.886 1.00 132.51 ? 158  HIS B CG  1 
ATOM   3843  N ND1 . HIS B 1 157 ? 21.276  -22.466 142.699 1.00 135.65 ? 158  HIS B ND1 1 
ATOM   3844  C CD2 . HIS B 1 157 ? 19.450  -21.885 141.650 1.00 133.04 ? 158  HIS B CD2 1 
ATOM   3845  C CE1 . HIS B 1 157 ? 21.499  -22.631 141.407 1.00 134.49 ? 158  HIS B CE1 1 
ATOM   3846  N NE2 . HIS B 1 157 ? 20.408  -22.286 140.749 1.00 134.30 ? 158  HIS B NE2 1 
ATOM   3847  N N   . LEU B 1 158 ? 21.520  -19.540 146.174 1.00 104.78 ? 159  LEU B N   1 
ATOM   3848  C CA  . LEU B 1 158 ? 22.903  -19.356 146.594 1.00 88.08  ? 159  LEU B CA  1 
ATOM   3849  C C   . LEU B 1 158 ? 23.444  -20.639 147.214 1.00 93.79  ? 159  LEU B C   1 
ATOM   3850  O O   . LEU B 1 158 ? 24.584  -21.034 146.968 1.00 103.01 ? 159  LEU B O   1 
ATOM   3851  C CB  . LEU B 1 158 ? 23.016  -18.188 147.578 1.00 65.27  ? 159  LEU B CB  1 
ATOM   3852  C CG  . LEU B 1 158 ? 24.414  -17.594 147.769 1.00 63.61  ? 159  LEU B CG  1 
ATOM   3853  C CD1 . LEU B 1 158 ? 25.002  -17.176 146.431 1.00 68.78  ? 159  LEU B CD1 1 
ATOM   3854  C CD2 . LEU B 1 158 ? 24.378  -16.413 148.728 1.00 43.68  ? 159  LEU B CD2 1 
ATOM   3855  N N   . GLU B 1 159 ? 22.599  -21.282 148.016 1.00 81.91  ? 160  GLU B N   1 
ATOM   3856  C CA  . GLU B 1 159 ? 22.984  -22.448 148.804 1.00 81.15  ? 160  GLU B CA  1 
ATOM   3857  C C   . GLU B 1 159 ? 23.533  -23.593 147.956 1.00 84.36  ? 160  GLU B C   1 
ATOM   3858  O O   . GLU B 1 159 ? 24.596  -24.139 148.255 1.00 81.76  ? 160  GLU B O   1 
ATOM   3859  C CB  . GLU B 1 159 ? 21.798  -22.925 149.646 1.00 76.70  ? 160  GLU B CB  1 
ATOM   3860  C CG  . GLU B 1 159 ? 22.117  -24.075 150.584 1.00 91.05  ? 160  GLU B CG  1 
ATOM   3861  C CD  . GLU B 1 159 ? 21.151  -24.156 151.749 1.00 100.97 ? 160  GLU B CD  1 
ATOM   3862  O OE1 . GLU B 1 159 ? 20.941  -23.121 152.418 1.00 93.92  ? 160  GLU B OE1 1 
ATOM   3863  O OE2 . GLU B 1 159 ? 20.600  -25.250 151.996 1.00 108.95 ? 160  GLU B OE2 1 
ATOM   3864  N N   . GLU B 1 160 ? 22.810  -23.947 146.899 1.00 84.16  ? 161  GLU B N   1 
ATOM   3865  C CA  . GLU B 1 160 ? 23.233  -25.023 146.009 1.00 93.87  ? 161  GLU B CA  1 
ATOM   3866  C C   . GLU B 1 160 ? 24.525  -24.659 145.280 1.00 99.99  ? 161  GLU B C   1 
ATOM   3867  O O   . GLU B 1 160 ? 25.397  -25.508 145.075 1.00 103.69 ? 161  GLU B O   1 
ATOM   3868  C CB  . GLU B 1 160 ? 22.123  -25.353 145.008 1.00 96.53  ? 161  GLU B CB  1 
ATOM   3869  C CG  . GLU B 1 160 ? 20.804  -25.736 145.663 1.00 102.90 ? 161  GLU B CG  1 
ATOM   3870  C CD  . GLU B 1 160 ? 19.669  -25.859 144.667 1.00 104.07 ? 161  GLU B CD  1 
ATOM   3871  O OE1 . GLU B 1 160 ? 19.949  -25.989 143.457 1.00 98.69  ? 161  GLU B OE1 1 
ATOM   3872  O OE2 . GLU B 1 160 ? 18.496  -25.819 145.095 1.00 105.32 ? 161  GLU B OE2 1 
ATOM   3873  N N   . THR B 1 161 ? 24.643  -23.388 144.903 1.00 96.49  ? 162  THR B N   1 
ATOM   3874  C CA  . THR B 1 161 ? 25.831  -22.885 144.221 1.00 88.86  ? 162  THR B CA  1 
ATOM   3875  C C   . THR B 1 161 ? 27.076  -23.046 145.088 1.00 78.61  ? 162  THR B C   1 
ATOM   3876  O O   . THR B 1 161 ? 28.060  -23.673 144.680 1.00 70.30  ? 162  THR B O   1 
ATOM   3877  C CB  . THR B 1 161 ? 25.676  -21.396 143.859 1.00 83.14  ? 162  THR B CB  1 
ATOM   3878  O OG1 . THR B 1 161 ? 24.541  -21.219 143.002 1.00 81.13  ? 162  THR B OG1 1 
ATOM   3879  C CG2 . THR B 1 161 ? 26.922  -20.888 143.156 1.00 84.46  ? 162  THR B CG2 1 
ATOM   3880  N N   . LEU B 1 162 ? 27.020  -22.480 146.290 1.00 71.31  ? 163  LEU B N   1 
ATOM   3881  C CA  . LEU B 1 162 ? 28.142  -22.534 147.219 1.00 68.02  ? 163  LEU B CA  1 
ATOM   3882  C C   . LEU B 1 162 ? 28.458  -23.968 147.637 1.00 69.51  ? 163  LEU B C   1 
ATOM   3883  O O   . LEU B 1 162 ? 29.625  -24.350 147.727 1.00 69.41  ? 163  LEU B O   1 
ATOM   3884  C CB  . LEU B 1 162 ? 27.862  -21.671 148.453 1.00 65.55  ? 163  LEU B CB  1 
ATOM   3885  C CG  . LEU B 1 162 ? 27.484  -20.211 148.183 1.00 59.27  ? 163  LEU B CG  1 
ATOM   3886  C CD1 . LEU B 1 162 ? 27.329  -19.444 149.486 1.00 40.27  ? 163  LEU B CD1 1 
ATOM   3887  C CD2 . LEU B 1 162 ? 28.507  -19.542 147.279 1.00 65.26  ? 163  LEU B CD2 1 
ATOM   3888  N N   . ALA B 1 163 ? 27.417  -24.759 147.885 1.00 69.26  ? 164  ALA B N   1 
ATOM   3889  C CA  . ALA B 1 163 ? 27.596  -26.154 148.280 1.00 66.82  ? 164  ALA B CA  1 
ATOM   3890  C C   . ALA B 1 163 ? 28.312  -26.961 147.199 1.00 69.65  ? 164  ALA B C   1 
ATOM   3891  O O   . ALA B 1 163 ? 29.266  -27.691 147.489 1.00 75.79  ? 164  ALA B O   1 
ATOM   3892  C CB  . ALA B 1 163 ? 26.258  -26.791 148.619 1.00 60.34  ? 164  ALA B CB  1 
ATOM   3893  N N   . GLU B 1 164 ? 27.850  -26.830 145.957 1.00 65.04  ? 165  GLU B N   1 
ATOM   3894  C CA  . GLU B 1 164 ? 28.491  -27.515 144.841 1.00 81.58  ? 165  GLU B CA  1 
ATOM   3895  C C   . GLU B 1 164 ? 29.936  -27.053 144.686 1.00 85.90  ? 165  GLU B C   1 
ATOM   3896  O O   . GLU B 1 164 ? 30.846  -27.870 144.484 1.00 83.48  ? 165  GLU B O   1 
ATOM   3897  C CB  . GLU B 1 164 ? 27.719  -27.290 143.540 1.00 90.51  ? 165  GLU B CB  1 
ATOM   3898  C CG  . GLU B 1 164 ? 28.445  -27.816 142.311 1.00 108.93 ? 165  GLU B CG  1 
ATOM   3899  C CD  . GLU B 1 164 ? 27.505  -28.147 141.171 1.00 122.19 ? 165  GLU B CD  1 
ATOM   3900  O OE1 . GLU B 1 164 ? 26.340  -27.696 141.205 1.00 124.09 ? 165  GLU B OE1 1 
ATOM   3901  O OE2 . GLU B 1 164 ? 27.930  -28.867 140.242 1.00 126.15 ? 165  GLU B OE2 1 
ATOM   3902  N N   . PHE B 1 165 ? 30.133  -25.740 144.790 1.00 74.92  ? 166  PHE B N   1 
ATOM   3903  C CA  . PHE B 1 165 ? 31.465  -25.151 144.733 1.00 61.46  ? 166  PHE B CA  1 
ATOM   3904  C C   . PHE B 1 165 ? 32.414  -25.806 145.732 1.00 60.34  ? 166  PHE B C   1 
ATOM   3905  O O   . PHE B 1 165 ? 33.480  -26.295 145.356 1.00 46.39  ? 166  PHE B O   1 
ATOM   3906  C CB  . PHE B 1 165 ? 31.399  -23.645 144.993 1.00 51.19  ? 166  PHE B CB  1 
ATOM   3907  C CG  . PHE B 1 165 ? 32.745  -23.009 145.209 1.00 59.92  ? 166  PHE B CG  1 
ATOM   3908  C CD1 . PHE B 1 165 ? 33.580  -22.739 144.136 1.00 56.27  ? 166  PHE B CD1 1 
ATOM   3909  C CD2 . PHE B 1 165 ? 33.176  -22.683 146.486 1.00 58.73  ? 166  PHE B CD2 1 
ATOM   3910  C CE1 . PHE B 1 165 ? 34.821  -22.157 144.332 1.00 52.93  ? 166  PHE B CE1 1 
ATOM   3911  C CE2 . PHE B 1 165 ? 34.416  -22.101 146.688 1.00 57.51  ? 166  PHE B CE2 1 
ATOM   3912  C CZ  . PHE B 1 165 ? 35.239  -21.838 145.610 1.00 56.27  ? 166  PHE B CZ  1 
ATOM   3913  N N   . TRP B 1 166 ? 32.018  -25.820 147.002 1.00 54.78  ? 167  TRP B N   1 
ATOM   3914  C CA  . TRP B 1 166 ? 32.852  -26.397 148.051 1.00 50.44  ? 167  TRP B CA  1 
ATOM   3915  C C   . TRP B 1 166 ? 33.069  -27.892 147.856 1.00 64.55  ? 167  TRP B C   1 
ATOM   3916  O O   . TRP B 1 166 ? 34.140  -28.412 148.168 1.00 76.25  ? 167  TRP B O   1 
ATOM   3917  C CB  . TRP B 1 166 ? 32.267  -26.123 149.439 1.00 50.95  ? 167  TRP B CB  1 
ATOM   3918  C CG  . TRP B 1 166 ? 32.323  -24.681 149.843 1.00 70.19  ? 167  TRP B CG  1 
ATOM   3919  C CD1 . TRP B 1 166 ? 31.270  -23.887 150.190 1.00 68.76  ? 167  TRP B CD1 1 
ATOM   3920  C CD2 . TRP B 1 166 ? 33.493  -23.857 149.935 1.00 74.08  ? 167  TRP B CD2 1 
ATOM   3921  N NE1 . TRP B 1 166 ? 31.709  -22.623 150.496 1.00 62.52  ? 167  TRP B NE1 1 
ATOM   3922  C CE2 . TRP B 1 166 ? 33.070  -22.578 150.347 1.00 62.48  ? 167  TRP B CE2 1 
ATOM   3923  C CE3 . TRP B 1 166 ? 34.856  -24.077 149.711 1.00 78.43  ? 167  TRP B CE3 1 
ATOM   3924  C CZ2 . TRP B 1 166 ? 33.959  -21.524 150.539 1.00 55.43  ? 167  TRP B CZ2 1 
ATOM   3925  C CZ3 . TRP B 1 166 ? 35.736  -23.028 149.902 1.00 69.61  ? 167  TRP B CZ3 1 
ATOM   3926  C CH2 . TRP B 1 166 ? 35.284  -21.769 150.311 1.00 62.30  ? 167  TRP B CH2 1 
ATOM   3927  N N   . ALA B 1 167 ? 32.053  -28.581 147.344 1.00 67.57  ? 168  ALA B N   1 
ATOM   3928  C CA  . ALA B 1 167 ? 32.172  -30.010 147.080 1.00 67.22  ? 168  ALA B CA  1 
ATOM   3929  C C   . ALA B 1 167 ? 33.263  -30.296 146.049 1.00 72.95  ? 168  ALA B C   1 
ATOM   3930  O O   . ALA B 1 167 ? 34.221  -31.030 146.325 1.00 89.05  ? 168  ALA B O   1 
ATOM   3931  C CB  . ALA B 1 167 ? 30.841  -30.577 146.618 1.00 64.90  ? 168  ALA B CB  1 
ATOM   3932  N N   . ARG B 1 168 ? 33.125  -29.703 144.867 1.00 72.57  ? 169  ARG B N   1 
ATOM   3933  C CA  . ARG B 1 168 ? 34.089  -29.938 143.796 1.00 88.36  ? 169  ARG B CA  1 
ATOM   3934  C C   . ARG B 1 168 ? 35.483  -29.427 144.164 1.00 92.82  ? 169  ARG B C   1 
ATOM   3935  O O   . ARG B 1 168 ? 36.500  -30.047 143.822 1.00 95.94  ? 169  ARG B O   1 
ATOM   3936  C CB  . ARG B 1 168 ? 33.609  -29.314 142.484 1.00 98.33  ? 169  ARG B CB  1 
ATOM   3937  C CG  . ARG B 1 168 ? 32.337  -29.944 141.935 1.00 102.24 ? 169  ARG B CG  1 
ATOM   3938  C CD  . ARG B 1 168 ? 32.304  -29.879 140.419 1.00 109.38 ? 169  ARG B CD  1 
ATOM   3939  N NE  . ARG B 1 168 ? 33.492  -30.492 139.831 1.00 123.81 ? 169  ARG B NE  1 
ATOM   3940  C CZ  . ARG B 1 168 ? 33.723  -30.576 138.525 1.00 128.51 ? 169  ARG B CZ  1 
ATOM   3941  N NH1 . ARG B 1 168 ? 32.843  -30.088 137.662 1.00 126.51 ? 169  ARG B NH1 1 
ATOM   3942  N NH2 . ARG B 1 168 ? 34.834  -31.149 138.083 1.00 127.52 ? 169  ARG B NH2 1 
ATOM   3943  N N   . LEU B 1 169 ? 35.521  -28.302 144.871 1.00 87.22  ? 170  LEU B N   1 
ATOM   3944  C CA  . LEU B 1 169 ? 36.782  -27.739 145.334 1.00 86.41  ? 170  LEU B CA  1 
ATOM   3945  C C   . LEU B 1 169 ? 37.472  -28.701 146.290 1.00 93.57  ? 170  LEU B C   1 
ATOM   3946  O O   . LEU B 1 169 ? 38.689  -28.860 146.246 1.00 103.58 ? 170  LEU B O   1 
ATOM   3947  C CB  . LEU B 1 169 ? 36.563  -26.395 146.024 1.00 80.85  ? 170  LEU B CB  1 
ATOM   3948  C CG  . LEU B 1 169 ? 37.846  -25.610 146.301 1.00 72.51  ? 170  LEU B CG  1 
ATOM   3949  C CD1 . LEU B 1 169 ? 38.439  -25.092 144.999 1.00 60.86  ? 170  LEU B CD1 1 
ATOM   3950  C CD2 . LEU B 1 169 ? 37.597  -24.471 147.276 1.00 79.61  ? 170  LEU B CD2 1 
ATOM   3951  N N   . LEU B 1 170 ? 36.689  -29.339 147.155 1.00 82.63  ? 171  LEU B N   1 
ATOM   3952  C CA  . LEU B 1 170 ? 37.233  -30.329 148.077 1.00 73.73  ? 171  LEU B CA  1 
ATOM   3953  C C   . LEU B 1 170 ? 37.761  -31.534 147.311 1.00 67.98  ? 171  LEU B C   1 
ATOM   3954  O O   . LEU B 1 170 ? 38.803  -32.092 147.663 1.00 68.65  ? 171  LEU B O   1 
ATOM   3955  C CB  . LEU B 1 170 ? 36.185  -30.767 149.102 1.00 62.03  ? 171  LEU B CB  1 
ATOM   3956  C CG  . LEU B 1 170 ? 36.652  -31.817 150.113 1.00 53.36  ? 171  LEU B CG  1 
ATOM   3957  C CD1 . LEU B 1 170 ? 37.932  -31.369 150.800 1.00 69.73  ? 171  LEU B CD1 1 
ATOM   3958  C CD2 . LEU B 1 170 ? 35.568  -32.089 151.137 1.00 53.64  ? 171  LEU B CD2 1 
ATOM   3959  N N   . GLU B 1 171 ? 37.037  -31.929 146.265 1.00 74.28  ? 172  GLU B N   1 
ATOM   3960  C CA  . GLU B 1 171 ? 37.496  -32.998 145.381 1.00 82.35  ? 172  GLU B CA  1 
ATOM   3961  C C   . GLU B 1 171 ? 38.891  -32.699 144.828 1.00 82.95  ? 172  GLU B C   1 
ATOM   3962  O O   . GLU B 1 171 ? 39.862  -33.419 145.116 1.00 81.66  ? 172  GLU B O   1 
ATOM   3963  C CB  . GLU B 1 171 ? 36.508  -33.211 144.231 1.00 96.52  ? 172  GLU B CB  1 
ATOM   3964  C CG  . GLU B 1 171 ? 37.038  -34.106 143.118 1.00 111.38 ? 172  GLU B CG  1 
ATOM   3965  C CD  . GLU B 1 171 ? 36.184  -34.053 141.866 1.00 120.23 ? 172  GLU B CD  1 
ATOM   3966  O OE1 . GLU B 1 171 ? 34.991  -33.700 141.975 1.00 124.47 ? 172  GLU B OE1 1 
ATOM   3967  O OE2 . GLU B 1 171 ? 36.706  -34.361 140.772 1.00 119.06 ? 172  GLU B OE2 1 
ATOM   3968  N N   . ARG B 1 172 ? 38.987  -31.629 144.042 1.00 81.83  ? 173  ARG B N   1 
ATOM   3969  C CA  . ARG B 1 172 ? 40.256  -31.259 143.417 1.00 90.13  ? 173  ARG B CA  1 
ATOM   3970  C C   . ARG B 1 172 ? 41.383  -31.007 144.428 1.00 82.96  ? 173  ARG B C   1 
ATOM   3971  O O   . ARG B 1 172 ? 42.528  -31.411 144.204 1.00 52.83  ? 173  ARG B O   1 
ATOM   3972  C CB  . ARG B 1 172 ? 40.076  -30.045 142.499 1.00 99.14  ? 173  ARG B CB  1 
ATOM   3973  C CG  . ARG B 1 172 ? 39.296  -30.345 141.223 1.00 105.38 ? 173  ARG B CG  1 
ATOM   3974  C CD  . ARG B 1 172 ? 39.171  -29.115 140.331 1.00 117.00 ? 173  ARG B CD  1 
ATOM   3975  N NE  . ARG B 1 172 ? 38.329  -28.085 140.933 1.00 127.18 ? 173  ARG B NE  1 
ATOM   3976  C CZ  . ARG B 1 172 ? 37.017  -27.990 140.744 1.00 131.54 ? 173  ARG B CZ  1 
ATOM   3977  N NH1 . ARG B 1 172 ? 36.393  -28.863 139.965 1.00 132.06 ? 173  ARG B NH1 1 
ATOM   3978  N NH2 . ARG B 1 172 ? 36.326  -27.021 141.331 1.00 129.42 ? 173  ARG B NH2 1 
ATOM   3979  N N   . LEU B 1 173 ? 41.057  -30.352 145.539 1.00 71.73  ? 174  LEU B N   1 
ATOM   3980  C CA  . LEU B 1 173 ? 42.062  -30.020 146.547 1.00 73.12  ? 174  LEU B CA  1 
ATOM   3981  C C   . LEU B 1 173 ? 42.578  -31.247 147.289 1.00 70.95  ? 174  LEU B C   1 
ATOM   3982  O O   . LEU B 1 173 ? 43.742  -31.288 147.679 1.00 73.66  ? 174  LEU B O   1 
ATOM   3983  C CB  . LEU B 1 173 ? 41.541  -28.975 147.541 1.00 82.32  ? 174  LEU B CB  1 
ATOM   3984  C CG  . LEU B 1 173 ? 42.126  -27.569 147.377 1.00 83.32  ? 174  LEU B CG  1 
ATOM   3985  C CD1 . LEU B 1 173 ? 41.375  -26.801 146.305 1.00 84.15  ? 174  LEU B CD1 1 
ATOM   3986  C CD2 . LEU B 1 173 ? 42.128  -26.810 148.696 1.00 80.14  ? 174  LEU B CD2 1 
ATOM   3987  N N   . PHE B 1 174 ? 41.721  -32.244 147.486 1.00 81.88  ? 175  PHE B N   1 
ATOM   3988  C CA  . PHE B 1 174 ? 42.163  -33.480 148.117 1.00 75.72  ? 175  PHE B CA  1 
ATOM   3989  C C   . PHE B 1 174 ? 43.028  -34.253 147.133 1.00 83.69  ? 175  PHE B C   1 
ATOM   3990  O O   . PHE B 1 174 ? 44.064  -34.822 147.512 1.00 80.53  ? 175  PHE B O   1 
ATOM   3991  C CB  . PHE B 1 174 ? 40.980  -34.333 148.561 1.00 65.43  ? 175  PHE B CB  1 
ATOM   3992  C CG  . PHE B 1 174 ? 41.287  -35.222 149.730 1.00 68.75  ? 175  PHE B CG  1 
ATOM   3993  C CD1 . PHE B 1 174 ? 41.308  -34.713 151.019 1.00 71.07  ? 175  PHE B CD1 1 
ATOM   3994  C CD2 . PHE B 1 174 ? 41.558  -36.564 149.541 1.00 72.58  ? 175  PHE B CD2 1 
ATOM   3995  C CE1 . PHE B 1 174 ? 41.593  -35.529 152.099 1.00 70.82  ? 175  PHE B CE1 1 
ATOM   3996  C CE2 . PHE B 1 174 ? 41.842  -37.385 150.613 1.00 80.26  ? 175  PHE B CE2 1 
ATOM   3997  C CZ  . PHE B 1 174 ? 41.860  -36.867 151.895 1.00 78.08  ? 175  PHE B CZ  1 
ATOM   3998  N N   . LYS B 1 175 ? 42.603  -34.260 145.869 1.00 90.68  ? 176  LYS B N   1 
ATOM   3999  C CA  . LYS B 1 175 ? 43.394  -34.874 144.811 1.00 87.88  ? 176  LYS B CA  1 
ATOM   4000  C C   . LYS B 1 175 ? 44.795  -34.277 144.737 1.00 86.12  ? 176  LYS B C   1 
ATOM   4001  O O   . LYS B 1 175 ? 45.764  -34.998 144.508 1.00 85.82  ? 176  LYS B O   1 
ATOM   4002  C CB  . LYS B 1 175 ? 42.697  -34.732 143.458 1.00 91.74  ? 176  LYS B CB  1 
ATOM   4003  C CG  . LYS B 1 175 ? 41.705  -35.837 143.143 1.00 100.51 ? 176  LYS B CG  1 
ATOM   4004  C CD  . LYS B 1 175 ? 41.463  -35.934 141.648 1.00 104.80 ? 176  LYS B CD  1 
ATOM   4005  C CE  . LYS B 1 175 ? 40.687  -37.187 141.295 1.00 105.57 ? 176  LYS B CE  1 
ATOM   4006  N NZ  . LYS B 1 175 ? 40.611  -37.386 139.823 1.00 104.88 ? 176  LYS B NZ  1 
ATOM   4007  N N   . GLN B 1 176 ? 44.899  -32.963 144.934 1.00 88.12  ? 177  GLN B N   1 
ATOM   4008  C CA  . GLN B 1 176 ? 46.192  -32.280 144.877 1.00 88.24  ? 177  GLN B CA  1 
ATOM   4009  C C   . GLN B 1 176 ? 47.018  -32.459 146.152 1.00 95.17  ? 177  GLN B C   1 
ATOM   4010  O O   . GLN B 1 176 ? 48.239  -32.597 146.092 1.00 102.05 ? 177  GLN B O   1 
ATOM   4011  C CB  . GLN B 1 176 ? 46.002  -30.793 144.572 1.00 92.01  ? 177  GLN B CB  1 
ATOM   4012  C CG  . GLN B 1 176 ? 45.385  -30.524 143.211 1.00 104.79 ? 177  GLN B CG  1 
ATOM   4013  C CD  . GLN B 1 176 ? 45.099  -29.058 142.977 1.00 104.00 ? 177  GLN B CD  1 
ATOM   4014  O OE1 . GLN B 1 176 ? 45.819  -28.188 143.466 1.00 96.41  ? 177  GLN B OE1 1 
ATOM   4015  N NE2 . GLN B 1 176 ? 44.037  -28.774 142.231 1.00 103.86 ? 177  GLN B NE2 1 
ATOM   4016  N N   . LEU B 1 177 ? 46.351  -32.459 147.301 1.00 93.76  ? 178  LEU B N   1 
ATOM   4017  C CA  . LEU B 1 177 ? 47.035  -32.658 148.574 1.00 97.22  ? 178  LEU B CA  1 
ATOM   4018  C C   . LEU B 1 177 ? 47.616  -34.061 148.692 1.00 106.58 ? 178  LEU B C   1 
ATOM   4019  O O   . LEU B 1 177 ? 48.620  -34.263 149.381 1.00 105.32 ? 178  LEU B O   1 
ATOM   4020  C CB  . LEU B 1 177 ? 46.102  -32.372 149.749 1.00 90.77  ? 178  LEU B CB  1 
ATOM   4021  C CG  . LEU B 1 177 ? 45.985  -30.898 150.126 1.00 88.73  ? 178  LEU B CG  1 
ATOM   4022  C CD1 . LEU B 1 177 ? 45.118  -30.741 151.361 1.00 86.25  ? 178  LEU B CD1 1 
ATOM   4023  C CD2 . LEU B 1 177 ? 47.361  -30.292 150.351 1.00 94.05  ? 178  LEU B CD2 1 
ATOM   4024  N N   . HIS B 1 178 ? 46.982  -35.026 148.028 1.00 111.42 ? 179  HIS B N   1 
ATOM   4025  C CA  . HIS B 1 178 ? 47.529  -36.379 147.962 1.00 109.61 ? 179  HIS B CA  1 
ATOM   4026  C C   . HIS B 1 178 ? 47.685  -36.805 146.502 1.00 101.71 ? 179  HIS B C   1 
ATOM   4027  O O   . HIS B 1 178 ? 46.884  -37.590 145.988 1.00 88.65  ? 179  HIS B O   1 
ATOM   4028  C CB  . HIS B 1 178 ? 46.633  -37.359 148.723 1.00 105.57 ? 179  HIS B CB  1 
ATOM   4029  C CG  . HIS B 1 178 ? 46.456  -37.019 150.172 1.00 96.34  ? 179  HIS B CG  1 
ATOM   4030  N ND1 . HIS B 1 178 ? 47.436  -37.237 151.114 1.00 91.87  ? 179  HIS B ND1 1 
ATOM   4031  C CD2 . HIS B 1 178 ? 45.406  -36.480 150.838 1.00 88.84  ? 179  HIS B CD2 1 
ATOM   4032  C CE1 . HIS B 1 178 ? 47.003  -36.845 152.298 1.00 87.32  ? 179  HIS B CE1 1 
ATOM   4033  N NE2 . HIS B 1 178 ? 45.773  -36.381 152.160 1.00 86.62  ? 179  HIS B NE2 1 
ATOM   4034  N N   . PRO B 1 179 ? 48.727  -36.282 145.831 1.00 103.14 ? 180  PRO B N   1 
ATOM   4035  C CA  . PRO B 1 179 ? 48.939  -36.466 144.390 1.00 105.44 ? 180  PRO B CA  1 
ATOM   4036  C C   . PRO B 1 179 ? 49.230  -37.911 143.991 1.00 113.11 ? 180  PRO B C   1 
ATOM   4037  O O   . PRO B 1 179 ? 48.809  -38.337 142.915 1.00 117.01 ? 180  PRO B O   1 
ATOM   4038  C CB  . PRO B 1 179 ? 50.156  -35.578 144.104 1.00 104.79 ? 180  PRO B CB  1 
ATOM   4039  C CG  . PRO B 1 179 ? 50.881  -35.503 145.397 1.00 101.26 ? 180  PRO B CG  1 
ATOM   4040  C CD  . PRO B 1 179 ? 49.807  -35.492 146.446 1.00 100.44 ? 180  PRO B CD  1 
ATOM   4041  N N   . GLN B 1 180 ? 49.938  -38.650 144.839 1.00 113.84 ? 181  GLN B N   1 
ATOM   4042  C CA  . GLN B 1 180 ? 50.315  -40.024 144.519 1.00 117.80 ? 181  GLN B CA  1 
ATOM   4043  C C   . GLN B 1 180 ? 49.165  -41.004 144.735 1.00 109.71 ? 181  GLN B C   1 
ATOM   4044  O O   . GLN B 1 180 ? 49.131  -42.078 144.134 1.00 114.31 ? 181  GLN B O   1 
ATOM   4045  C CB  . GLN B 1 180 ? 51.541  -40.457 145.332 1.00 130.16 ? 181  GLN B CB  1 
ATOM   4046  C CG  . GLN B 1 180 ? 51.284  -40.677 146.819 1.00 132.15 ? 181  GLN B CG  1 
ATOM   4047  C CD  . GLN B 1 180 ? 51.207  -39.384 147.614 1.00 134.96 ? 181  GLN B CD  1 
ATOM   4048  O OE1 . GLN B 1 180 ? 51.329  -38.291 147.063 1.00 138.86 ? 181  GLN B OE1 1 
ATOM   4049  N NE2 . GLN B 1 180 ? 51.009  -39.508 148.922 1.00 131.71 ? 181  GLN B NE2 1 
ATOM   4050  N N   . LEU B 1 181 ? 48.230  -40.627 145.600 1.00 103.76 ? 182  LEU B N   1 
ATOM   4051  C CA  . LEU B 1 181 ? 47.081  -41.470 145.907 1.00 97.70  ? 182  LEU B CA  1 
ATOM   4052  C C   . LEU B 1 181 ? 46.125  -41.561 144.721 1.00 97.43  ? 182  LEU B C   1 
ATOM   4053  O O   . LEU B 1 181 ? 45.810  -40.555 144.085 1.00 91.09  ? 182  LEU B O   1 
ATOM   4054  C CB  . LEU B 1 181 ? 46.346  -40.945 147.144 1.00 96.89  ? 182  LEU B CB  1 
ATOM   4055  C CG  . LEU B 1 181 ? 46.738  -41.522 148.508 1.00 94.49  ? 182  LEU B CG  1 
ATOM   4056  C CD1 . LEU B 1 181 ? 48.223  -41.358 148.779 1.00 91.84  ? 182  LEU B CD1 1 
ATOM   4057  C CD2 . LEU B 1 181 ? 45.920  -40.874 149.615 1.00 92.03  ? 182  LEU B CD2 1 
ATOM   4058  N N   . LEU B 1 182 ? 45.671  -42.774 144.427 1.00 107.88 ? 183  LEU B N   1 
ATOM   4059  C CA  . LEU B 1 182 ? 44.740  -42.997 143.329 1.00 120.02 ? 183  LEU B CA  1 
ATOM   4060  C C   . LEU B 1 182 ? 43.301  -42.998 143.827 1.00 119.38 ? 183  LEU B C   1 
ATOM   4061  O O   . LEU B 1 182 ? 42.902  -43.867 144.603 1.00 123.08 ? 183  LEU B O   1 
ATOM   4062  C CB  . LEU B 1 182 ? 45.052  -44.314 142.617 1.00 134.50 ? 183  LEU B CB  1 
ATOM   4063  C CG  . LEU B 1 182 ? 44.097  -44.723 141.493 1.00 139.50 ? 183  LEU B CG  1 
ATOM   4064  C CD1 . LEU B 1 182 ? 43.946  -43.605 140.470 1.00 136.29 ? 183  LEU B CD1 1 
ATOM   4065  C CD2 . LEU B 1 182 ? 44.577  -46.002 140.821 1.00 144.58 ? 183  LEU B CD2 1 
ATOM   4066  N N   . LEU B 1 183 ? 42.523  -42.021 143.375 1.00 114.62 ? 184  LEU B N   1 
ATOM   4067  C CA  . LEU B 1 183 ? 41.131  -41.912 143.788 1.00 109.38 ? 184  LEU B CA  1 
ATOM   4068  C C   . LEU B 1 183 ? 40.174  -42.148 142.618 1.00 117.57 ? 184  LEU B C   1 
ATOM   4069  O O   . LEU B 1 183 ? 40.063  -41.313 141.720 1.00 122.60 ? 184  LEU B O   1 
ATOM   4070  C CB  . LEU B 1 183 ? 40.881  -40.554 144.444 1.00 99.91  ? 184  LEU B CB  1 
ATOM   4071  C CG  . LEU B 1 183 ? 41.862  -40.230 145.576 1.00 88.03  ? 184  LEU B CG  1 
ATOM   4072  C CD1 . LEU B 1 183 ? 41.579  -38.862 146.173 1.00 88.74  ? 184  LEU B CD1 1 
ATOM   4073  C CD2 . LEU B 1 183 ? 41.823  -41.306 146.652 1.00 79.97  ? 184  LEU B CD2 1 
ATOM   4074  N N   . PRO B 1 184 ? 39.480  -43.299 142.637 1.00 123.51 ? 185  PRO B N   1 
ATOM   4075  C CA  . PRO B 1 184 ? 38.543  -43.796 141.621 1.00 124.93 ? 185  PRO B CA  1 
ATOM   4076  C C   . PRO B 1 184 ? 37.298  -42.924 141.444 1.00 114.08 ? 185  PRO B C   1 
ATOM   4077  O O   . PRO B 1 184 ? 36.561  -43.153 140.491 1.00 113.84 ? 185  PRO B O   1 
ATOM   4078  C CB  . PRO B 1 184 ? 38.142  -45.179 142.155 1.00 130.79 ? 185  PRO B CB  1 
ATOM   4079  C CG  . PRO B 1 184 ? 39.219  -45.558 143.106 1.00 131.85 ? 185  PRO B CG  1 
ATOM   4080  C CD  . PRO B 1 184 ? 39.658  -44.273 143.728 1.00 128.20 ? 185  PRO B CD  1 
ATOM   4081  N N   . ASP B 1 185 ? 37.082  -41.985 142.365 1.00 105.34 ? 186  ASP B N   1 
ATOM   4082  C CA  . ASP B 1 185 ? 35.898  -41.105 142.476 1.00 115.71 ? 186  ASP B CA  1 
ATOM   4083  C C   . ASP B 1 185 ? 34.714  -41.722 143.235 1.00 122.12 ? 186  ASP B C   1 
ATOM   4084  O O   . ASP B 1 185 ? 33.794  -41.006 143.656 1.00 118.39 ? 186  ASP B O   1 
ATOM   4085  C CB  . ASP B 1 185 ? 35.485  -40.408 141.150 1.00 112.75 ? 186  ASP B CB  1 
ATOM   4086  C CG  . ASP B 1 185 ? 34.535  -41.241 140.281 1.00 106.85 ? 186  ASP B CG  1 
ATOM   4087  O OD1 . ASP B 1 185 ? 33.476  -41.703 140.763 1.00 102.24 ? 186  ASP B OD1 1 
ATOM   4088  O OD2 . ASP B 1 185 ? 34.851  -41.417 139.085 1.00 101.56 ? 186  ASP B OD2 1 
ATOM   4089  N N   . ASP B 1 186 ? 34.766  -43.034 143.450 1.00 126.78 ? 187  ASP B N   1 
ATOM   4090  C CA  . ASP B 1 186 ? 33.894  -43.672 144.423 1.00 123.62 ? 187  ASP B CA  1 
ATOM   4091  C C   . ASP B 1 186 ? 34.405  -43.220 145.780 1.00 118.48 ? 187  ASP B C   1 
ATOM   4092  O O   . ASP B 1 186 ? 33.631  -42.814 146.658 1.00 115.03 ? 187  ASP B O   1 
ATOM   4093  C CB  . ASP B 1 186 ? 33.987  -45.196 144.318 1.00 119.83 ? 187  ASP B CB  1 
ATOM   4094  C CG  . ASP B 1 186 ? 32.739  -45.821 143.717 1.00 119.50 ? 187  ASP B CG  1 
ATOM   4095  O OD1 . ASP B 1 186 ? 31.775  -46.065 144.476 1.00 120.77 ? 187  ASP B OD1 1 
ATOM   4096  O OD2 . ASP B 1 186 ? 32.722  -46.064 142.490 1.00 119.92 ? 187  ASP B OD2 1 
ATOM   4097  N N   . TYR B 1 187 ? 35.726  -43.284 145.926 1.00 112.24 ? 188  TYR B N   1 
ATOM   4098  C CA  . TYR B 1 187 ? 36.416  -42.807 147.110 1.00 104.51 ? 188  TYR B CA  1 
ATOM   4099  C C   . TYR B 1 187 ? 36.178  -41.309 147.273 1.00 96.99  ? 188  TYR B C   1 
ATOM   4100  O O   . TYR B 1 187 ? 36.114  -40.807 148.391 1.00 100.55 ? 188  TYR B O   1 
ATOM   4101  C CB  . TYR B 1 187 ? 37.913  -43.090 146.974 1.00 99.78  ? 188  TYR B CB  1 
ATOM   4102  C CG  . TYR B 1 187 ? 38.672  -43.033 148.278 1.00 90.95  ? 188  TYR B CG  1 
ATOM   4103  C CD1 . TYR B 1 187 ? 39.009  -41.816 148.854 1.00 81.66  ? 188  TYR B CD1 1 
ATOM   4104  C CD2 . TYR B 1 187 ? 39.050  -44.197 148.936 1.00 92.25  ? 188  TYR B CD2 1 
ATOM   4105  C CE1 . TYR B 1 187 ? 39.695  -41.758 150.047 1.00 77.78  ? 188  TYR B CE1 1 
ATOM   4106  C CE2 . TYR B 1 187 ? 39.739  -44.148 150.131 1.00 90.78  ? 188  TYR B CE2 1 
ATOM   4107  C CZ  . TYR B 1 187 ? 40.059  -42.924 150.681 1.00 83.93  ? 188  TYR B CZ  1 
ATOM   4108  O OH  . TYR B 1 187 ? 40.745  -42.861 151.870 1.00 79.47  ? 188  TYR B OH  1 
ATOM   4109  N N   . LEU B 1 188 ? 36.049  -40.598 146.154 1.00 88.53  ? 189  LEU B N   1 
ATOM   4110  C CA  . LEU B 1 188 ? 35.744  -39.169 146.194 1.00 86.45  ? 189  LEU B CA  1 
ATOM   4111  C C   . LEU B 1 188 ? 34.335  -38.896 146.707 1.00 85.39  ? 189  LEU B C   1 
ATOM   4112  O O   . LEU B 1 188 ? 34.125  -37.918 147.428 1.00 79.40  ? 189  LEU B O   1 
ATOM   4113  C CB  . LEU B 1 188 ? 35.943  -38.504 144.829 1.00 83.93  ? 189  LEU B CB  1 
ATOM   4114  C CG  . LEU B 1 188 ? 37.388  -38.409 144.340 1.00 95.90  ? 189  LEU B CG  1 
ATOM   4115  C CD1 . LEU B 1 188 ? 37.446  -37.745 142.973 1.00 100.65 ? 189  LEU B CD1 1 
ATOM   4116  C CD2 . LEU B 1 188 ? 38.246  -37.661 145.345 1.00 89.13  ? 189  LEU B CD2 1 
ATOM   4117  N N   . ASP B 1 189 ? 33.374  -39.745 146.334 1.00 90.96  ? 190  ASP B N   1 
ATOM   4118  C CA  . ASP B 1 189 ? 32.009  -39.596 146.840 1.00 86.88  ? 190  ASP B CA  1 
ATOM   4119  C C   . ASP B 1 189 ? 31.951  -39.887 148.335 1.00 75.55  ? 190  ASP B C   1 
ATOM   4120  O O   . ASP B 1 189 ? 31.275  -39.175 149.097 1.00 60.60  ? 190  ASP B O   1 
ATOM   4121  C CB  . ASP B 1 189 ? 31.034  -40.494 146.072 1.00 93.66  ? 190  ASP B CB  1 
ATOM   4122  C CG  . ASP B 1 189 ? 30.683  -39.931 144.708 1.00 100.27 ? 190  ASP B CG  1 
ATOM   4123  O OD1 . ASP B 1 189 ? 30.846  -38.708 144.521 1.00 101.71 ? 190  ASP B OD1 1 
ATOM   4124  O OD2 . ASP B 1 189 ? 30.246  -40.701 143.825 1.00 107.84 ? 190  ASP B OD2 1 
ATOM   4125  N N   . CYS B 1 190 ? 32.666  -40.931 148.749 1.00 72.56  ? 191  CYS B N   1 
ATOM   4126  C CA  . CYS B 1 190 ? 32.697  -41.312 150.154 1.00 78.68  ? 191  CYS B CA  1 
ATOM   4127  C C   . CYS B 1 190 ? 33.346  -40.197 150.967 1.00 84.29  ? 191  CYS B C   1 
ATOM   4128  O O   . CYS B 1 190 ? 32.880  -39.842 152.050 1.00 89.29  ? 191  CYS B O   1 
ATOM   4129  C CB  . CYS B 1 190 ? 33.462  -42.621 150.327 1.00 71.54  ? 191  CYS B CB  1 
ATOM   4130  S SG  . CYS B 1 190 ? 33.610  -43.166 152.037 1.00 79.15  ? 191  CYS B SG  1 
ATOM   4131  N N   . LEU B 1 191 ? 34.426  -39.652 150.416 1.00 77.62  ? 192  LEU B N   1 
ATOM   4132  C CA  . LEU B 1 191 ? 35.128  -38.503 150.975 1.00 72.78  ? 192  LEU B CA  1 
ATOM   4133  C C   . LEU B 1 191 ? 34.172  -37.338 151.159 1.00 67.50  ? 192  LEU B C   1 
ATOM   4134  O O   . LEU B 1 191 ? 34.119  -36.719 152.229 1.00 60.58  ? 192  LEU B O   1 
ATOM   4135  C CB  . LEU B 1 191 ? 36.245  -38.086 150.024 1.00 68.50  ? 192  LEU B CB  1 
ATOM   4136  C CG  . LEU B 1 191 ? 36.857  -36.694 150.174 1.00 68.97  ? 192  LEU B CG  1 
ATOM   4137  C CD1 . LEU B 1 191 ? 37.972  -36.711 151.201 1.00 67.44  ? 192  LEU B CD1 1 
ATOM   4138  C CD2 . LEU B 1 191 ? 37.357  -36.194 148.827 1.00 65.54  ? 192  LEU B CD2 1 
ATOM   4139  N N   . GLY B 1 192 ? 33.416  -37.052 150.103 1.00 65.32  ? 193  GLY B N   1 
ATOM   4140  C CA  . GLY B 1 192 ? 32.402  -36.017 150.133 1.00 65.35  ? 193  GLY B CA  1 
ATOM   4141  C C   . GLY B 1 192 ? 31.387  -36.250 151.233 1.00 75.54  ? 193  GLY B C   1 
ATOM   4142  O O   . GLY B 1 192 ? 30.846  -35.297 151.795 1.00 85.64  ? 193  GLY B O   1 
ATOM   4143  N N   . LYS B 1 193 ? 31.124  -37.518 151.538 1.00 78.01  ? 194  LYS B N   1 
ATOM   4144  C CA  . LYS B 1 193 ? 30.196  -37.852 152.614 1.00 84.08  ? 194  LYS B CA  1 
ATOM   4145  C C   . LYS B 1 193 ? 30.832  -37.704 153.999 1.00 86.49  ? 194  LYS B C   1 
ATOM   4146  O O   . LYS B 1 193 ? 30.144  -37.388 154.967 1.00 88.25  ? 194  LYS B O   1 
ATOM   4147  C CB  . LYS B 1 193 ? 29.609  -39.253 152.422 1.00 77.33  ? 194  LYS B CB  1 
ATOM   4148  C CG  . LYS B 1 193 ? 28.639  -39.346 151.258 1.00 70.23  ? 194  LYS B CG  1 
ATOM   4149  C CD  . LYS B 1 193 ? 28.136  -40.760 151.048 1.00 91.37  ? 194  LYS B CD  1 
ATOM   4150  C CE  . LYS B 1 193 ? 27.212  -40.821 149.844 1.00 106.02 ? 194  LYS B CE  1 
ATOM   4151  N NZ  . LYS B 1 193 ? 27.859  -40.262 148.622 1.00 113.30 ? 194  LYS B NZ  1 
ATOM   4152  N N   . GLN B 1 194 ? 32.143  -37.924 154.090 1.00 80.85  ? 195  GLN B N   1 
ATOM   4153  C CA  . GLN B 1 194 ? 32.872  -37.720 155.344 1.00 78.37  ? 195  GLN B CA  1 
ATOM   4154  C C   . GLN B 1 194 ? 33.027  -36.231 155.641 1.00 84.55  ? 195  GLN B C   1 
ATOM   4155  O O   . GLN B 1 194 ? 33.206  -35.823 156.797 1.00 77.13  ? 195  GLN B O   1 
ATOM   4156  C CB  . GLN B 1 194 ? 34.258  -38.371 155.286 1.00 78.78  ? 195  GLN B CB  1 
ATOM   4157  C CG  . GLN B 1 194 ? 34.239  -39.875 155.069 1.00 87.78  ? 195  GLN B CG  1 
ATOM   4158  C CD  . GLN B 1 194 ? 33.564  -40.619 156.203 1.00 87.91  ? 195  GLN B CD  1 
ATOM   4159  O OE1 . GLN B 1 194 ? 33.966  -40.507 157.361 1.00 81.40  ? 195  GLN B OE1 1 
ATOM   4160  N NE2 . GLN B 1 194 ? 32.525  -41.377 155.875 1.00 87.50  ? 195  GLN B NE2 1 
ATOM   4161  N N   . ALA B 1 195 ? 32.952  -35.430 154.582 1.00 95.72  ? 196  ALA B N   1 
ATOM   4162  C CA  . ALA B 1 195 ? 33.130  -33.986 154.664 1.00 92.82  ? 196  ALA B CA  1 
ATOM   4163  C C   . ALA B 1 195 ? 32.187  -33.308 155.660 1.00 93.97  ? 196  ALA B C   1 
ATOM   4164  O O   . ALA B 1 195 ? 32.638  -32.634 156.585 1.00 105.42 ? 196  ALA B O   1 
ATOM   4165  C CB  . ALA B 1 195 ? 32.966  -33.369 153.283 1.00 82.60  ? 196  ALA B CB  1 
ATOM   4166  N N   . GLU B 1 196 ? 30.882  -33.493 155.475 1.00 88.14  ? 197  GLU B N   1 
ATOM   4167  C CA  . GLU B 1 196 ? 29.885  -32.786 156.283 1.00 99.06  ? 197  GLU B CA  1 
ATOM   4168  C C   . GLU B 1 196 ? 30.062  -33.013 157.785 1.00 94.16  ? 197  GLU B C   1 
ATOM   4169  O O   . GLU B 1 196 ? 29.818  -32.118 158.594 1.00 105.09 ? 197  GLU B O   1 
ATOM   4170  C CB  . GLU B 1 196 ? 28.463  -33.160 155.851 1.00 108.69 ? 197  GLU B CB  1 
ATOM   4171  C CG  . GLU B 1 196 ? 27.376  -32.310 156.499 1.00 118.33 ? 197  GLU B CG  1 
ATOM   4172  C CD  . GLU B 1 196 ? 27.574  -30.822 156.255 1.00 117.95 ? 197  GLU B CD  1 
ATOM   4173  O OE1 . GLU B 1 196 ? 27.923  -30.445 155.115 1.00 112.46 ? 197  GLU B OE1 1 
ATOM   4174  O OE2 . GLU B 1 196 ? 27.383  -30.031 157.203 1.00 116.83 ? 197  GLU B OE2 1 
ATOM   4175  N N   . ALA B 1 197 ? 30.495  -34.213 158.152 1.00 79.10  ? 198  ALA B N   1 
ATOM   4176  C CA  . ALA B 1 197 ? 30.747  -34.532 159.551 1.00 75.20  ? 198  ALA B CA  1 
ATOM   4177  C C   . ALA B 1 197 ? 32.097  -33.993 160.023 1.00 82.87  ? 198  ALA B C   1 
ATOM   4178  O O   . ALA B 1 197 ? 32.232  -33.573 161.173 1.00 83.15  ? 198  ALA B O   1 
ATOM   4179  C CB  . ALA B 1 197 ? 30.671  -36.030 159.773 1.00 68.63  ? 198  ALA B CB  1 
ATOM   4180  N N   . LEU B 1 198 ? 33.090  -34.005 159.134 1.00 89.24  ? 199  LEU B N   1 
ATOM   4181  C CA  . LEU B 1 198 ? 34.458  -33.651 159.520 1.00 88.12  ? 199  LEU B CA  1 
ATOM   4182  C C   . LEU B 1 198 ? 34.828  -32.168 159.450 1.00 100.43 ? 199  LEU B C   1 
ATOM   4183  O O   . LEU B 1 198 ? 35.871  -31.775 159.974 1.00 110.98 ? 199  LEU B O   1 
ATOM   4184  C CB  . LEU B 1 198 ? 35.467  -34.469 158.714 1.00 76.23  ? 199  LEU B CB  1 
ATOM   4185  C CG  . LEU B 1 198 ? 35.475  -35.952 159.065 1.00 72.58  ? 199  LEU B CG  1 
ATOM   4186  C CD1 . LEU B 1 198 ? 36.562  -36.676 158.296 1.00 75.75  ? 199  LEU B CD1 1 
ATOM   4187  C CD2 . LEU B 1 198 ? 35.651  -36.126 160.564 1.00 69.03  ? 199  LEU B CD2 1 
ATOM   4188  N N   . ARG B 1 199 ? 33.987  -31.358 158.810 1.00 100.67 ? 200  ARG B N   1 
ATOM   4189  C CA  . ARG B 1 199 ? 34.268  -29.931 158.618 1.00 108.12 ? 200  ARG B CA  1 
ATOM   4190  C C   . ARG B 1 199 ? 35.654  -29.678 158.021 1.00 92.21  ? 200  ARG B C   1 
ATOM   4191  O O   . ARG B 1 199 ? 36.532  -29.156 158.708 1.00 84.74  ? 200  ARG B O   1 
ATOM   4192  C CB  . ARG B 1 199 ? 34.162  -29.170 159.945 1.00 127.76 ? 200  ARG B CB  1 
ATOM   4193  C CG  . ARG B 1 199 ? 32.798  -29.174 160.612 1.00 143.44 ? 200  ARG B CG  1 
ATOM   4194  C CD  . ARG B 1 199 ? 32.874  -28.412 161.930 1.00 157.47 ? 200  ARG B CD  1 
ATOM   4195  N NE  . ARG B 1 199 ? 31.607  -28.386 162.653 1.00 164.21 ? 200  ARG B NE  1 
ATOM   4196  C CZ  . ARG B 1 199 ? 31.452  -27.848 163.859 1.00 160.53 ? 200  ARG B CZ  1 
ATOM   4197  N NH1 . ARG B 1 199 ? 32.487  -27.295 164.479 1.00 155.64 ? 200  ARG B NH1 1 
ATOM   4198  N NH2 . ARG B 1 199 ? 30.264  -27.866 164.449 1.00 158.35 ? 200  ARG B NH2 1 
ATOM   4199  N N   . PRO B 1 200 ? 35.858  -30.041 156.743 1.00 84.19  ? 201  PRO B N   1 
ATOM   4200  C CA  . PRO B 1 200 ? 37.180  -29.892 156.123 1.00 83.28  ? 201  PRO B CA  1 
ATOM   4201  C C   . PRO B 1 200 ? 37.616  -28.431 155.997 1.00 100.37 ? 201  PRO B C   1 
ATOM   4202  O O   . PRO B 1 200 ? 38.792  -28.126 156.202 1.00 114.75 ? 201  PRO B O   1 
ATOM   4203  C CB  . PRO B 1 200 ? 36.988  -30.506 154.728 1.00 72.26  ? 201  PRO B CB  1 
ATOM   4204  C CG  . PRO B 1 200 ? 35.745  -31.334 154.828 1.00 68.88  ? 201  PRO B CG  1 
ATOM   4205  C CD  . PRO B 1 200 ? 34.878  -30.608 155.804 1.00 73.34  ? 201  PRO B CD  1 
ATOM   4206  N N   . PHE B 1 201 ? 36.680  -27.547 155.665 1.00 90.80  ? 202  PHE B N   1 
ATOM   4207  C CA  . PHE B 1 201 ? 37.003  -26.141 155.430 1.00 72.37  ? 202  PHE B CA  1 
ATOM   4208  C C   . PHE B 1 201 ? 36.787  -25.238 156.648 1.00 67.52  ? 202  PHE B C   1 
ATOM   4209  O O   . PHE B 1 201 ? 37.016  -24.032 156.572 1.00 64.50  ? 202  PHE B O   1 
ATOM   4210  C CB  . PHE B 1 201 ? 36.210  -25.599 154.235 1.00 66.57  ? 202  PHE B CB  1 
ATOM   4211  C CG  . PHE B 1 201 ? 36.602  -26.205 152.916 1.00 57.72  ? 202  PHE B CG  1 
ATOM   4212  C CD1 . PHE B 1 201 ? 37.801  -25.864 152.316 1.00 44.80  ? 202  PHE B CD1 1 
ATOM   4213  C CD2 . PHE B 1 201 ? 35.766  -27.104 152.270 1.00 53.11  ? 202  PHE B CD2 1 
ATOM   4214  C CE1 . PHE B 1 201 ? 38.167  -26.411 151.102 1.00 46.13  ? 202  PHE B CE1 1 
ATOM   4215  C CE2 . PHE B 1 201 ? 36.128  -27.656 151.052 1.00 50.35  ? 202  PHE B CE2 1 
ATOM   4216  C CZ  . PHE B 1 201 ? 37.330  -27.308 150.469 1.00 52.36  ? 202  PHE B CZ  1 
ATOM   4217  N N   . GLY B 1 202 ? 36.351  -25.814 157.764 1.00 67.70  ? 203  GLY B N   1 
ATOM   4218  C CA  . GLY B 1 202 ? 36.097  -25.034 158.964 1.00 64.68  ? 203  GLY B CA  1 
ATOM   4219  C C   . GLY B 1 202 ? 34.737  -24.357 158.973 1.00 70.34  ? 203  GLY B C   1 
ATOM   4220  O O   . GLY B 1 202 ? 33.766  -24.899 158.445 1.00 76.60  ? 203  GLY B O   1 
ATOM   4221  N N   . GLU B 1 203 ? 34.666  -23.172 159.577 1.00 77.58  ? 204  GLU B N   1 
ATOM   4222  C CA  . GLU B 1 203 ? 33.408  -22.428 159.670 1.00 82.99  ? 204  GLU B CA  1 
ATOM   4223  C C   . GLU B 1 203 ? 33.228  -21.479 158.488 1.00 74.86  ? 204  GLU B C   1 
ATOM   4224  O O   . GLU B 1 203 ? 32.155  -20.885 158.310 1.00 90.24  ? 204  GLU B O   1 
ATOM   4225  C CB  . GLU B 1 203 ? 33.341  -21.632 160.976 1.00 93.02  ? 204  GLU B CB  1 
ATOM   4226  C CG  . GLU B 1 203 ? 33.454  -22.487 162.237 1.00 106.22 ? 204  GLU B CG  1 
ATOM   4227  C CD  . GLU B 1 203 ? 33.141  -21.701 163.500 1.00 116.92 ? 204  GLU B CD  1 
ATOM   4228  O OE1 . GLU B 1 203 ? 32.557  -20.599 163.384 1.00 122.76 ? 204  GLU B OE1 1 
ATOM   4229  O OE2 . GLU B 1 203 ? 33.473  -22.183 164.605 1.00 115.48 ? 204  GLU B OE2 1 
ATOM   4230  N N   . ALA B 1 204 ? 34.277  -21.353 157.680 1.00 66.91  ? 205  ALA B N   1 
ATOM   4231  C CA  . ALA B 1 204 ? 34.302  -20.417 156.561 1.00 76.84  ? 205  ALA B CA  1 
ATOM   4232  C C   . ALA B 1 204 ? 33.139  -20.542 155.557 1.00 81.13  ? 205  ALA B C   1 
ATOM   4233  O O   . ALA B 1 204 ? 32.557  -19.523 155.177 1.00 92.81  ? 205  ALA B O   1 
ATOM   4234  C CB  . ALA B 1 204 ? 35.664  -20.465 155.851 1.00 81.74  ? 205  ALA B CB  1 
ATOM   4235  N N   . PRO B 1 205 ? 32.806  -21.771 155.110 1.00 80.46  ? 206  PRO B N   1 
ATOM   4236  C CA  . PRO B 1 205 ? 31.698  -21.844 154.150 1.00 86.52  ? 206  PRO B CA  1 
ATOM   4237  C C   . PRO B 1 205 ? 30.351  -21.404 154.732 1.00 93.94  ? 206  PRO B C   1 
ATOM   4238  O O   . PRO B 1 205 ? 29.546  -20.805 154.015 1.00 95.52  ? 206  PRO B O   1 
ATOM   4239  C CB  . PRO B 1 205 ? 31.654  -23.330 153.779 1.00 82.85  ? 206  PRO B CB  1 
ATOM   4240  C CG  . PRO B 1 205 ? 33.025  -23.820 154.026 1.00 85.19  ? 206  PRO B CG  1 
ATOM   4241  C CD  . PRO B 1 205 ? 33.491  -23.071 155.240 1.00 86.75  ? 206  PRO B CD  1 
ATOM   4242  N N   . ARG B 1 206 ? 30.113  -21.692 156.009 1.00 91.35  ? 207  ARG B N   1 
ATOM   4243  C CA  . ARG B 1 206 ? 28.855  -21.319 156.648 1.00 88.60  ? 207  ARG B CA  1 
ATOM   4244  C C   . ARG B 1 206 ? 28.784  -19.805 156.833 1.00 85.03  ? 207  ARG B C   1 
ATOM   4245  O O   . ARG B 1 206 ? 27.795  -19.162 156.444 1.00 90.84  ? 207  ARG B O   1 
ATOM   4246  C CB  . ARG B 1 206 ? 28.699  -22.024 157.998 1.00 91.36  ? 207  ARG B CB  1 
ATOM   4247  C CG  . ARG B 1 206 ? 27.261  -22.083 158.488 1.00 91.10  ? 207  ARG B CG  1 
ATOM   4248  C CD  . ARG B 1 206 ? 27.147  -21.736 159.964 1.00 95.78  ? 207  ARG B CD  1 
ATOM   4249  N NE  . ARG B 1 206 ? 25.752  -21.617 160.382 1.00 105.59 ? 207  ARG B NE  1 
ATOM   4250  C CZ  . ARG B 1 206 ? 25.356  -21.191 161.578 1.00 101.24 ? 207  ARG B CZ  1 
ATOM   4251  N NH1 . ARG B 1 206 ? 26.247  -20.835 162.494 1.00 100.03 ? 207  ARG B NH1 1 
ATOM   4252  N NH2 . ARG B 1 206 ? 24.062  -21.120 161.858 1.00 87.87  ? 207  ARG B NH2 1 
ATOM   4253  N N   . GLU B 1 207 ? 29.841  -19.250 157.427 1.00 73.58  ? 208  GLU B N   1 
ATOM   4254  C CA  . GLU B 1 207 ? 29.969  -17.806 157.592 1.00 69.32  ? 208  GLU B CA  1 
ATOM   4255  C C   . GLU B 1 207 ? 29.718  -17.099 156.270 1.00 65.93  ? 208  GLU B C   1 
ATOM   4256  O O   . GLU B 1 207 ? 28.929  -16.149 156.194 1.00 76.88  ? 208  GLU B O   1 
ATOM   4257  C CB  . GLU B 1 207 ? 31.374  -17.463 158.081 1.00 82.43  ? 208  GLU B CB  1 
ATOM   4258  C CG  . GLU B 1 207 ? 31.648  -17.831 159.525 1.00 94.84  ? 208  GLU B CG  1 
ATOM   4259  C CD  . GLU B 1 207 ? 31.318  -16.702 160.477 1.00 100.17 ? 208  GLU B CD  1 
ATOM   4260  O OE1 . GLU B 1 207 ? 32.177  -15.815 160.672 1.00 94.05  ? 208  GLU B OE1 1 
ATOM   4261  O OE2 . GLU B 1 207 ? 30.200  -16.703 161.031 1.00 98.16  ? 208  GLU B OE2 1 
ATOM   4262  N N   . LEU B 1 208 ? 30.385  -17.585 155.228 1.00 52.46  ? 209  LEU B N   1 
ATOM   4263  C CA  . LEU B 1 208 ? 30.268  -16.996 153.903 1.00 52.06  ? 209  LEU B CA  1 
ATOM   4264  C C   . LEU B 1 208 ? 28.847  -17.102 153.361 1.00 65.43  ? 209  LEU B C   1 
ATOM   4265  O O   . LEU B 1 208 ? 28.327  -16.142 152.802 1.00 73.74  ? 209  LEU B O   1 
ATOM   4266  C CB  . LEU B 1 208 ? 31.256  -17.640 152.931 1.00 43.46  ? 209  LEU B CB  1 
ATOM   4267  C CG  . LEU B 1 208 ? 31.211  -17.084 151.506 1.00 43.98  ? 209  LEU B CG  1 
ATOM   4268  C CD1 . LEU B 1 208 ? 31.562  -15.600 151.484 1.00 41.82  ? 209  LEU B CD1 1 
ATOM   4269  C CD2 . LEU B 1 208 ? 32.128  -17.874 150.587 1.00 41.87  ? 209  LEU B CD2 1 
ATOM   4270  N N   . ARG B 1 209 ? 28.218  -18.262 153.534 1.00 74.57  ? 210  ARG B N   1 
ATOM   4271  C CA  . ARG B 1 209 ? 26.859  -18.453 153.033 1.00 74.43  ? 210  ARG B CA  1 
ATOM   4272  C C   . ARG B 1 209 ? 25.901  -17.453 153.673 1.00 69.81  ? 210  ARG B C   1 
ATOM   4273  O O   . ARG B 1 209 ? 25.226  -16.689 152.970 1.00 75.76  ? 210  ARG B O   1 
ATOM   4274  C CB  . ARG B 1 209 ? 26.365  -19.882 153.277 1.00 72.56  ? 210  ARG B CB  1 
ATOM   4275  C CG  . ARG B 1 209 ? 25.200  -20.280 152.375 1.00 78.60  ? 210  ARG B CG  1 
ATOM   4276  C CD  . ARG B 1 209 ? 24.544  -21.589 152.800 1.00 86.95  ? 210  ARG B CD  1 
ATOM   4277  N NE  . ARG B 1 209 ? 23.546  -21.393 153.849 1.00 97.13  ? 210  ARG B NE  1 
ATOM   4278  C CZ  . ARG B 1 209 ? 23.720  -21.730 155.122 1.00 98.98  ? 210  ARG B CZ  1 
ATOM   4279  N NH1 . ARG B 1 209 ? 24.855  -22.292 155.513 1.00 88.17  ? 210  ARG B NH1 1 
ATOM   4280  N NH2 . ARG B 1 209 ? 22.754  -21.511 156.005 1.00 103.49 ? 210  ARG B NH2 1 
ATOM   4281  N N   . LEU B 1 210 ? 25.867  -17.450 155.004 1.00 62.35  ? 211  LEU B N   1 
ATOM   4282  C CA  . LEU B 1 210 ? 24.988  -16.550 155.746 1.00 66.27  ? 211  LEU B CA  1 
ATOM   4283  C C   . LEU B 1 210 ? 25.230  -15.089 155.367 1.00 73.25  ? 211  LEU B C   1 
ATOM   4284  O O   . LEU B 1 210 ? 24.317  -14.386 154.898 1.00 90.16  ? 211  LEU B O   1 
ATOM   4285  C CB  . LEU B 1 210 ? 25.192  -16.733 157.254 1.00 60.43  ? 211  LEU B CB  1 
ATOM   4286  C CG  . LEU B 1 210 ? 24.942  -18.121 157.853 1.00 61.94  ? 211  LEU B CG  1 
ATOM   4287  C CD1 . LEU B 1 210 ? 25.198  -18.117 159.355 1.00 58.55  ? 211  LEU B CD1 1 
ATOM   4288  C CD2 . LEU B 1 210 ? 23.529  -18.599 157.552 1.00 53.97  ? 211  LEU B CD2 1 
ATOM   4289  N N   . ARG B 1 211 ? 26.473  -14.648 155.546 1.00 58.63  ? 212  ARG B N   1 
ATOM   4290  C CA  . ARG B 1 211 ? 26.817  -13.243 155.350 1.00 57.60  ? 212  ARG B CA  1 
ATOM   4291  C C   . ARG B 1 211 ? 26.613  -12.753 153.915 1.00 58.83  ? 212  ARG B C   1 
ATOM   4292  O O   . ARG B 1 211 ? 26.047  -11.678 153.698 1.00 57.81  ? 212  ARG B O   1 
ATOM   4293  C CB  . ARG B 1 211 ? 28.243  -12.962 155.831 1.00 56.92  ? 212  ARG B CB  1 
ATOM   4294  C CG  . ARG B 1 211 ? 28.375  -12.883 157.347 1.00 65.92  ? 212  ARG B CG  1 
ATOM   4295  C CD  . ARG B 1 211 ? 29.751  -12.381 157.742 1.00 87.58  ? 212  ARG B CD  1 
ATOM   4296  N NE  . ARG B 1 211 ? 29.794  -11.847 159.101 1.00 106.91 ? 212  ARG B NE  1 
ATOM   4297  C CZ  . ARG B 1 211 ? 30.441  -12.417 160.113 1.00 115.01 ? 212  ARG B CZ  1 
ATOM   4298  N NH1 . ARG B 1 211 ? 31.109  -13.548 159.926 1.00 121.18 ? 212  ARG B NH1 1 
ATOM   4299  N NH2 . ARG B 1 211 ? 30.425  -11.853 161.313 1.00 116.60 ? 212  ARG B NH2 1 
ATOM   4300  N N   . ALA B 1 212 ? 27.061  -13.538 152.939 1.00 51.14  ? 213  ALA B N   1 
ATOM   4301  C CA  . ALA B 1 212 ? 26.882  -13.162 151.540 1.00 49.91  ? 213  ALA B CA  1 
ATOM   4302  C C   . ALA B 1 212 ? 25.407  -13.138 151.159 1.00 65.52  ? 213  ALA B C   1 
ATOM   4303  O O   . ALA B 1 212 ? 24.974  -12.255 150.419 1.00 78.72  ? 213  ALA B O   1 
ATOM   4304  C CB  . ALA B 1 212 ? 27.659  -14.084 150.614 1.00 32.09  ? 213  ALA B CB  1 
ATOM   4305  N N   . THR B 1 213 ? 24.638  -14.101 151.665 1.00 63.61  ? 214  THR B N   1 
ATOM   4306  C CA  . THR B 1 213 ? 23.199  -14.108 151.412 1.00 70.16  ? 214  THR B CA  1 
ATOM   4307  C C   . THR B 1 213 ? 22.569  -12.803 151.892 1.00 64.70  ? 214  THR B C   1 
ATOM   4308  O O   . THR B 1 213 ? 21.927  -12.083 151.113 1.00 74.81  ? 214  THR B O   1 
ATOM   4309  C CB  . THR B 1 213 ? 22.493  -15.287 152.108 1.00 73.32  ? 214  THR B CB  1 
ATOM   4310  O OG1 . THR B 1 213 ? 23.128  -16.517 151.739 1.00 79.16  ? 214  THR B OG1 1 
ATOM   4311  C CG2 . THR B 1 213 ? 21.027  -15.341 151.706 1.00 78.01  ? 214  THR B CG2 1 
ATOM   4312  N N   . ARG B 1 214 ? 22.780  -12.494 153.170 1.00 47.57  ? 215  ARG B N   1 
ATOM   4313  C CA  . ARG B 1 214 ? 22.196  -11.294 153.768 1.00 58.26  ? 215  ARG B CA  1 
ATOM   4314  C C   . ARG B 1 214 ? 22.624  -10.004 153.054 1.00 63.32  ? 215  ARG B C   1 
ATOM   4315  O O   . ARG B 1 214 ? 21.784  -9.181  152.659 1.00 60.93  ? 215  ARG B O   1 
ATOM   4316  C CB  . ARG B 1 214 ? 22.549  -11.224 155.256 1.00 71.90  ? 215  ARG B CB  1 
ATOM   4317  C CG  . ARG B 1 214 ? 21.464  -10.615 156.129 1.00 93.16  ? 215  ARG B CG  1 
ATOM   4318  C CD  . ARG B 1 214 ? 21.757  -10.845 157.604 1.00 107.59 ? 215  ARG B CD  1 
ATOM   4319  N NE  . ARG B 1 214 ? 22.096  -12.239 157.878 1.00 118.81 ? 215  ARG B NE  1 
ATOM   4320  C CZ  . ARG B 1 214 ? 21.202  -13.196 158.109 1.00 117.30 ? 215  ARG B CZ  1 
ATOM   4321  N NH1 . ARG B 1 214 ? 19.906  -12.915 158.099 1.00 115.75 ? 215  ARG B NH1 1 
ATOM   4322  N NH2 . ARG B 1 214 ? 21.605  -14.437 158.349 1.00 113.87 ? 215  ARG B NH2 1 
ATOM   4323  N N   . ALA B 1 215 ? 23.933  -9.837  152.880 1.00 55.47  ? 216  ALA B N   1 
ATOM   4324  C CA  . ALA B 1 215 ? 24.471  -8.638  152.246 1.00 50.44  ? 216  ALA B CA  1 
ATOM   4325  C C   . ALA B 1 215 ? 23.948  -8.461  150.821 1.00 51.58  ? 216  ALA B C   1 
ATOM   4326  O O   . ALA B 1 215 ? 23.432  -7.394  150.464 1.00 66.82  ? 216  ALA B O   1 
ATOM   4327  C CB  . ALA B 1 215 ? 25.992  -8.666  152.257 1.00 51.03  ? 216  ALA B CB  1 
ATOM   4328  N N   . PHE B 1 216 ? 24.069  -9.514  150.016 1.00 41.83  ? 217  PHE B N   1 
ATOM   4329  C CA  . PHE B 1 216 ? 23.617  -9.458  148.630 1.00 50.67  ? 217  PHE B CA  1 
ATOM   4330  C C   . PHE B 1 216 ? 22.123  -9.169  148.496 1.00 56.47  ? 217  PHE B C   1 
ATOM   4331  O O   . PHE B 1 216 ? 21.730  -8.363  147.648 1.00 71.10  ? 217  PHE B O   1 
ATOM   4332  C CB  . PHE B 1 216 ? 23.989  -10.730 147.865 1.00 54.16  ? 217  PHE B CB  1 
ATOM   4333  C CG  . PHE B 1 216 ? 25.362  -10.689 147.251 1.00 63.30  ? 217  PHE B CG  1 
ATOM   4334  C CD1 . PHE B 1 216 ? 25.599  -9.956  146.099 1.00 64.54  ? 217  PHE B CD1 1 
ATOM   4335  C CD2 . PHE B 1 216 ? 26.413  -11.391 147.820 1.00 67.69  ? 217  PHE B CD2 1 
ATOM   4336  C CE1 . PHE B 1 216 ? 26.862  -9.919  145.530 1.00 69.28  ? 217  PHE B CE1 1 
ATOM   4337  C CE2 . PHE B 1 216 ? 27.676  -11.359 147.256 1.00 53.63  ? 217  PHE B CE2 1 
ATOM   4338  C CZ  . PHE B 1 216 ? 27.901  -10.623 146.110 1.00 52.05  ? 217  PHE B CZ  1 
ATOM   4339  N N   . VAL B 1 217 ? 21.287  -9.807  149.316 1.00 49.65  ? 218  VAL B N   1 
ATOM   4340  C CA  . VAL B 1 217 ? 19.859  -9.498  149.231 1.00 53.06  ? 218  VAL B CA  1 
ATOM   4341  C C   . VAL B 1 217 ? 19.578  -8.057  149.653 1.00 53.74  ? 218  VAL B C   1 
ATOM   4342  O O   . VAL B 1 217 ? 18.710  -7.402  149.075 1.00 63.52  ? 218  VAL B O   1 
ATOM   4343  C CB  . VAL B 1 217 ? 18.941  -10.488 150.004 1.00 54.97  ? 218  VAL B CB  1 
ATOM   4344  C CG1 . VAL B 1 217 ? 19.100  -11.901 149.468 1.00 59.30  ? 218  VAL B CG1 1 
ATOM   4345  C CG2 . VAL B 1 217 ? 19.194  -10.434 151.500 1.00 57.85  ? 218  VAL B CG2 1 
ATOM   4346  N N   . ALA B 1 218 ? 20.322  -7.558  150.638 1.00 50.13  ? 219  ALA B N   1 
ATOM   4347  C CA  . ALA B 1 218 ? 20.163  -6.166  151.057 1.00 47.48  ? 219  ALA B CA  1 
ATOM   4348  C C   . ALA B 1 218 ? 20.462  -5.199  149.908 1.00 54.51  ? 219  ALA B C   1 
ATOM   4349  O O   . ALA B 1 218 ? 19.617  -4.370  149.536 1.00 69.41  ? 219  ALA B O   1 
ATOM   4350  C CB  . ALA B 1 218 ? 21.051  -5.863  152.254 1.00 32.06  ? 219  ALA B CB  1 
ATOM   4351  N N   . ALA B 1 219 ? 21.661  -5.321  149.343 1.00 44.99  ? 220  ALA B N   1 
ATOM   4352  C CA  . ALA B 1 219 ? 22.090  -4.455  148.247 1.00 45.61  ? 220  ALA B CA  1 
ATOM   4353  C C   . ALA B 1 219 ? 21.145  -4.535  147.049 1.00 50.98  ? 220  ALA B C   1 
ATOM   4354  O O   . ALA B 1 219 ? 20.672  -3.505  146.538 1.00 69.57  ? 220  ALA B O   1 
ATOM   4355  C CB  . ALA B 1 219 ? 23.507  -4.808  147.825 1.00 50.06  ? 220  ALA B CB  1 
ATOM   4356  N N   . ARG B 1 220 ? 20.874  -5.763  146.612 1.00 47.38  ? 221  ARG B N   1 
ATOM   4357  C CA  . ARG B 1 220 ? 19.986  -5.998  145.479 1.00 54.17  ? 221  ARG B CA  1 
ATOM   4358  C C   . ARG B 1 220 ? 18.615  -5.370  145.718 1.00 55.80  ? 221  ARG B C   1 
ATOM   4359  O O   . ARG B 1 220 ? 18.035  -4.766  144.814 1.00 55.40  ? 221  ARG B O   1 
ATOM   4360  C CB  . ARG B 1 220 ? 19.836  -7.498  145.204 1.00 49.03  ? 221  ARG B CB  1 
ATOM   4361  C CG  . ARG B 1 220 ? 19.011  -7.808  143.967 1.00 53.25  ? 221  ARG B CG  1 
ATOM   4362  C CD  . ARG B 1 220 ? 17.911  -8.820  144.249 1.00 64.49  ? 221  ARG B CD  1 
ATOM   4363  N NE  . ARG B 1 220 ? 18.381  -10.202 144.182 1.00 67.31  ? 221  ARG B NE  1 
ATOM   4364  C CZ  . ARG B 1 220 ? 18.399  -11.040 145.213 1.00 65.17  ? 221  ARG B CZ  1 
ATOM   4365  N NH1 . ARG B 1 220 ? 17.973  -10.643 146.405 1.00 58.31  ? 221  ARG B NH1 1 
ATOM   4366  N NH2 . ARG B 1 220 ? 18.841  -12.280 145.051 1.00 75.14  ? 221  ARG B NH2 1 
ATOM   4367  N N   . SER B 1 221 ? 18.110  -5.501  146.941 1.00 46.77  ? 222  SER B N   1 
ATOM   4368  C CA  . SER B 1 221 ? 16.817  -4.922  147.291 1.00 33.43  ? 222  SER B CA  1 
ATOM   4369  C C   . SER B 1 221 ? 16.826  -3.397  147.247 1.00 30.87  ? 222  SER B C   1 
ATOM   4370  O O   . SER B 1 221 ? 15.852  -2.789  146.809 1.00 38.72  ? 222  SER B O   1 
ATOM   4371  C CB  . SER B 1 221 ? 16.350  -5.411  148.662 1.00 33.55  ? 222  SER B CB  1 
ATOM   4372  O OG  . SER B 1 221 ? 16.146  -6.812  148.651 1.00 41.73  ? 222  SER B OG  1 
ATOM   4373  N N   . PHE B 1 222 ? 17.915  -2.782  147.705 1.00 36.52  ? 223  PHE B N   1 
ATOM   4374  C CA  . PHE B 1 222 ? 18.027  -1.322  147.657 1.00 40.25  ? 223  PHE B CA  1 
ATOM   4375  C C   . PHE B 1 222 ? 18.018  -0.818  146.211 1.00 45.47  ? 223  PHE B C   1 
ATOM   4376  O O   . PHE B 1 222 ? 17.228  0.073   145.843 1.00 56.00  ? 223  PHE B O   1 
ATOM   4377  C CB  . PHE B 1 222 ? 19.296  -0.857  148.378 1.00 42.27  ? 223  PHE B CB  1 
ATOM   4378  C CG  . PHE B 1 222 ? 19.434  0.639   148.469 1.00 51.85  ? 223  PHE B CG  1 
ATOM   4379  C CD1 . PHE B 1 222 ? 18.721  1.360   149.415 1.00 46.47  ? 223  PHE B CD1 1 
ATOM   4380  C CD2 . PHE B 1 222 ? 20.286  1.324   147.617 1.00 57.61  ? 223  PHE B CD2 1 
ATOM   4381  C CE1 . PHE B 1 222 ? 18.849  2.735   149.505 1.00 38.75  ? 223  PHE B CE1 1 
ATOM   4382  C CE2 . PHE B 1 222 ? 20.419  2.701   147.701 1.00 47.03  ? 223  PHE B CE2 1 
ATOM   4383  C CZ  . PHE B 1 222 ? 19.699  3.407   148.647 1.00 40.23  ? 223  PHE B CZ  1 
ATOM   4384  N N   . VAL B 1 223 ? 18.890  -1.405  145.394 1.00 44.67  ? 224  VAL B N   1 
ATOM   4385  C CA  . VAL B 1 223 ? 18.973  -1.047  143.979 1.00 50.45  ? 224  VAL B CA  1 
ATOM   4386  C C   . VAL B 1 223 ? 17.629  -1.232  143.268 1.00 52.56  ? 224  VAL B C   1 
ATOM   4387  O O   . VAL B 1 223 ? 17.133  -0.321  142.588 1.00 49.43  ? 224  VAL B O   1 
ATOM   4388  C CB  . VAL B 1 223 ? 20.063  -1.869  143.263 1.00 44.96  ? 224  VAL B CB  1 
ATOM   4389  C CG1 . VAL B 1 223 ? 19.955  -1.716  141.753 1.00 34.66  ? 224  VAL B CG1 1 
ATOM   4390  C CG2 . VAL B 1 223 ? 21.442  -1.459  143.755 1.00 39.35  ? 224  VAL B CG2 1 
ATOM   4391  N N   . GLN B 1 224 ? 17.038  -2.411  143.446 1.00 49.39  ? 225  GLN B N   1 
ATOM   4392  C CA  . GLN B 1 224 ? 15.734  -2.712  142.866 1.00 53.90  ? 225  GLN B CA  1 
ATOM   4393  C C   . GLN B 1 224 ? 14.679  -1.723  143.339 1.00 44.12  ? 225  GLN B C   1 
ATOM   4394  O O   . GLN B 1 224 ? 13.777  -1.368  142.587 1.00 40.62  ? 225  GLN B O   1 
ATOM   4395  C CB  . GLN B 1 224 ? 15.300  -4.138  143.208 1.00 62.52  ? 225  GLN B CB  1 
ATOM   4396  C CG  . GLN B 1 224 ? 15.932  -5.206  142.334 1.00 71.57  ? 225  GLN B CG  1 
ATOM   4397  C CD  . GLN B 1 224 ? 15.472  -6.601  142.705 1.00 89.84  ? 225  GLN B CD  1 
ATOM   4398  O OE1 . GLN B 1 224 ? 15.135  -6.871  143.858 1.00 93.33  ? 225  GLN B OE1 1 
ATOM   4399  N NE2 . GLN B 1 224 ? 15.452  -7.497  141.725 1.00 100.04 ? 225  GLN B NE2 1 
ATOM   4400  N N   . GLY B 1 225 ? 14.800  -1.284  144.587 1.00 37.56  ? 226  GLY B N   1 
ATOM   4401  C CA  . GLY B 1 225 ? 13.895  -0.296  145.143 1.00 38.27  ? 226  GLY B CA  1 
ATOM   4402  C C   . GLY B 1 225 ? 13.963  1.007   144.373 1.00 40.22  ? 226  GLY B C   1 
ATOM   4403  O O   . GLY B 1 225 ? 12.934  1.537   143.932 1.00 47.98  ? 226  GLY B O   1 
ATOM   4404  N N   . LEU B 1 226 ? 15.177  1.527   144.209 1.00 34.39  ? 227  LEU B N   1 
ATOM   4405  C CA  . LEU B 1 226 ? 15.365  2.744   143.424 1.00 32.46  ? 227  LEU B CA  1 
ATOM   4406  C C   . LEU B 1 226 ? 14.785  2.589   142.019 1.00 41.75  ? 227  LEU B C   1 
ATOM   4407  O O   . LEU B 1 226 ? 14.081  3.478   141.517 1.00 58.84  ? 227  LEU B O   1 
ATOM   4408  C CB  . LEU B 1 226 ? 16.846  3.115   143.344 1.00 27.40  ? 227  LEU B CB  1 
ATOM   4409  C CG  . LEU B 1 226 ? 17.494  3.538   144.663 1.00 39.50  ? 227  LEU B CG  1 
ATOM   4410  C CD1 . LEU B 1 226 ? 18.966  3.859   144.455 1.00 47.60  ? 227  LEU B CD1 1 
ATOM   4411  C CD2 . LEU B 1 226 ? 16.757  4.728   145.260 1.00 20.32  ? 227  LEU B CD2 1 
ATOM   4412  N N   . GLY B 1 227 ? 15.075  1.450   141.396 1.00 44.30  ? 228  GLY B N   1 
ATOM   4413  C CA  . GLY B 1 227 ? 14.574  1.171   140.061 1.00 55.88  ? 228  GLY B CA  1 
ATOM   4414  C C   . GLY B 1 227 ? 13.058  1.196   139.988 1.00 57.00  ? 228  GLY B C   1 
ATOM   4415  O O   . GLY B 1 227 ? 12.473  1.738   139.046 1.00 62.31  ? 228  GLY B O   1 
ATOM   4416  N N   . VAL B 1 228 ? 12.421  0.611   140.996 1.00 52.99  ? 229  VAL B N   1 
ATOM   4417  C CA  . VAL B 1 228 ? 10.966  0.570   141.058 1.00 42.52  ? 229  VAL B CA  1 
ATOM   4418  C C   . VAL B 1 228 ? 10.379  1.967   141.231 1.00 36.46  ? 229  VAL B C   1 
ATOM   4419  O O   . VAL B 1 228 ? 9.427   2.321   140.542 1.00 42.65  ? 229  VAL B O   1 
ATOM   4420  C CB  . VAL B 1 228 ? 10.464  -0.386  142.165 1.00 30.66  ? 229  VAL B CB  1 
ATOM   4421  C CG1 . VAL B 1 228 ? 9.003   -0.127  142.486 1.00 16.80  ? 229  VAL B CG1 1 
ATOM   4422  C CG2 . VAL B 1 228 ? 10.662  -1.824  141.733 1.00 20.42  ? 229  VAL B CG2 1 
ATOM   4423  N N   . ALA B 1 229 ? 10.947  2.761   142.137 1.00 26.86  ? 230  ALA B N   1 
ATOM   4424  C CA  . ALA B 1 229 ? 10.504  4.149   142.298 1.00 26.33  ? 230  ALA B CA  1 
ATOM   4425  C C   . ALA B 1 229 ? 10.581  4.905   140.971 1.00 19.56  ? 230  ALA B C   1 
ATOM   4426  O O   . ALA B 1 229 ? 9.627   5.591   140.567 1.00 39.31  ? 230  ALA B O   1 
ATOM   4427  C CB  . ALA B 1 229 ? 11.326  4.856   143.366 1.00 6.12   ? 230  ALA B CB  1 
ATOM   4428  N N   . SER B 1 230 ? 11.714  4.757   140.289 1.00 30.58  ? 231  SER B N   1 
ATOM   4429  C CA  . SER B 1 230 ? 11.890  5.356   138.969 1.00 37.74  ? 231  SER B CA  1 
ATOM   4430  C C   . SER B 1 230 ? 10.788  4.918   138.001 1.00 41.73  ? 231  SER B C   1 
ATOM   4431  O O   . SER B 1 230 ? 10.212  5.745   137.289 1.00 37.48  ? 231  SER B O   1 
ATOM   4432  C CB  . SER B 1 230 ? 13.266  5.001   138.398 1.00 32.57  ? 231  SER B CB  1 
ATOM   4433  O OG  . SER B 1 230 ? 13.499  5.665   137.168 1.00 45.47  ? 231  SER B OG  1 
ATOM   4434  N N   . ASP B 1 231 ? 10.491  3.621   137.987 1.00 42.14  ? 232  ASP B N   1 
ATOM   4435  C CA  . ASP B 1 231 ? 9.472   3.078   137.088 1.00 45.12  ? 232  ASP B CA  1 
ATOM   4436  C C   . ASP B 1 231 ? 8.065   3.593   137.390 1.00 42.05  ? 232  ASP B C   1 
ATOM   4437  O O   . ASP B 1 231 ? 7.301   3.906   136.476 1.00 30.32  ? 232  ASP B O   1 
ATOM   4438  C CB  . ASP B 1 231 ? 9.488   1.549   137.114 1.00 53.79  ? 232  ASP B CB  1 
ATOM   4439  C CG  . ASP B 1 231 ? 10.499  0.964   136.151 1.00 74.65  ? 232  ASP B CG  1 
ATOM   4440  O OD1 . ASP B 1 231 ? 10.642  1.513   135.039 1.00 84.74  ? 232  ASP B OD1 1 
ATOM   4441  O OD2 . ASP B 1 231 ? 11.150  -0.041  136.507 1.00 77.84  ? 232  ASP B OD2 1 
ATOM   4442  N N   . VAL B 1 232 ? 7.729   3.664   138.673 1.00 25.74  ? 233  VAL B N   1 
ATOM   4443  C CA  . VAL B 1 232 ? 6.447   4.195   139.110 1.00 21.18  ? 233  VAL B CA  1 
ATOM   4444  C C   . VAL B 1 232 ? 6.290   5.627   138.624 1.00 35.89  ? 233  VAL B C   1 
ATOM   4445  O O   . VAL B 1 232 ? 5.285   5.970   137.992 1.00 41.19  ? 233  VAL B O   1 
ATOM   4446  C CB  . VAL B 1 232 ? 6.316   4.159   140.644 1.00 29.29  ? 233  VAL B CB  1 
ATOM   4447  C CG1 . VAL B 1 232 ? 5.134   5.005   141.105 1.00 22.60  ? 233  VAL B CG1 1 
ATOM   4448  C CG2 . VAL B 1 232 ? 6.184   2.725   141.131 1.00 31.96  ? 233  VAL B CG2 1 
ATOM   4449  N N   . VAL B 1 233 ? 7.292   6.457   138.906 1.00 32.16  ? 234  VAL B N   1 
ATOM   4450  C CA  . VAL B 1 233 ? 7.250   7.848   138.464 1.00 29.94  ? 234  VAL B CA  1 
ATOM   4451  C C   . VAL B 1 233 ? 7.095   7.952   136.945 1.00 33.15  ? 234  VAL B C   1 
ATOM   4452  O O   . VAL B 1 233 ? 6.231   8.680   136.446 1.00 47.73  ? 234  VAL B O   1 
ATOM   4453  C CB  . VAL B 1 233 ? 8.498   8.629   138.912 1.00 33.99  ? 234  VAL B CB  1 
ATOM   4454  C CG1 . VAL B 1 233 ? 8.471   10.040  138.348 1.00 27.87  ? 234  VAL B CG1 1 
ATOM   4455  C CG2 . VAL B 1 233 ? 8.578   8.661   140.428 1.00 30.35  ? 234  VAL B CG2 1 
ATOM   4456  N N   . ARG B 1 234 ? 7.915   7.200   136.218 1.00 41.17  ? 235  ARG B N   1 
ATOM   4457  C CA  . ARG B 1 234 ? 7.905   7.250   134.759 1.00 47.35  ? 235  ARG B CA  1 
ATOM   4458  C C   . ARG B 1 234 ? 6.566   6.823   134.155 1.00 48.67  ? 235  ARG B C   1 
ATOM   4459  O O   . ARG B 1 234 ? 6.076   7.457   133.222 1.00 52.38  ? 235  ARG B O   1 
ATOM   4460  C CB  . ARG B 1 234 ? 9.043   6.405   134.183 1.00 42.58  ? 235  ARG B CB  1 
ATOM   4461  C CG  . ARG B 1 234 ? 9.170   6.482   132.670 1.00 42.71  ? 235  ARG B CG  1 
ATOM   4462  C CD  . ARG B 1 234 ? 10.261  5.553   132.162 1.00 64.18  ? 235  ARG B CD  1 
ATOM   4463  N NE  . ARG B 1 234 ? 10.120  4.206   132.708 1.00 77.60  ? 235  ARG B NE  1 
ATOM   4464  C CZ  . ARG B 1 234 ? 9.290   3.286   132.225 1.00 77.39  ? 235  ARG B CZ  1 
ATOM   4465  N NH1 . ARG B 1 234 ? 8.520   3.565   131.182 1.00 73.78  ? 235  ARG B NH1 1 
ATOM   4466  N NH2 . ARG B 1 234 ? 9.227   2.088   132.789 1.00 73.05  ? 235  ARG B NH2 1 
ATOM   4467  N N   . LYS B 1 235 ? 5.977   5.752   134.683 1.00 55.08  ? 236  LYS B N   1 
ATOM   4468  C CA  . LYS B 1 235 ? 4.687   5.277   134.182 1.00 54.99  ? 236  LYS B CA  1 
ATOM   4469  C C   . LYS B 1 235 ? 3.556   6.244   134.524 1.00 39.34  ? 236  LYS B C   1 
ATOM   4470  O O   . LYS B 1 235 ? 2.736   6.576   133.667 1.00 36.97  ? 236  LYS B O   1 
ATOM   4471  C CB  . LYS B 1 235 ? 4.354   3.881   134.721 1.00 50.78  ? 236  LYS B CB  1 
ATOM   4472  C CG  . LYS B 1 235 ? 5.294   2.777   134.264 1.00 53.55  ? 236  LYS B CG  1 
ATOM   4473  C CD  . LYS B 1 235 ? 4.671   1.406   134.488 1.00 55.13  ? 236  LYS B CD  1 
ATOM   4474  C CE  . LYS B 1 235 ? 5.716   0.302   134.488 1.00 52.86  ? 236  LYS B CE  1 
ATOM   4475  N NZ  . LYS B 1 235 ? 6.546   0.321   135.726 1.00 44.88  ? 236  LYS B NZ  1 
ATOM   4476  N N   . VAL B 1 236 ? 3.516   6.687   135.778 1.00 26.79  ? 237  VAL B N   1 
ATOM   4477  C CA  . VAL B 1 236 ? 2.483   7.613   136.237 1.00 36.05  ? 237  VAL B CA  1 
ATOM   4478  C C   . VAL B 1 236 ? 2.523   8.925   135.452 1.00 44.37  ? 237  VAL B C   1 
ATOM   4479  O O   . VAL B 1 236 ? 1.483   9.529   135.170 1.00 33.70  ? 237  VAL B O   1 
ATOM   4480  C CB  . VAL B 1 236 ? 2.609   7.882   137.755 1.00 36.14  ? 237  VAL B CB  1 
ATOM   4481  C CG1 . VAL B 1 236 ? 1.768   9.080   138.177 1.00 26.66  ? 237  VAL B CG1 1 
ATOM   4482  C CG2 . VAL B 1 236 ? 2.210   6.641   138.542 1.00 44.90  ? 237  VAL B CG2 1 
ATOM   4483  N N   . ALA B 1 237 ? 3.729   9.335   135.067 1.00 49.43  ? 238  ALA B N   1 
ATOM   4484  C CA  . ALA B 1 237 ? 3.933   10.570  134.312 1.00 45.92  ? 238  ALA B CA  1 
ATOM   4485  C C   . ALA B 1 237 ? 3.157   10.630  132.994 1.00 50.98  ? 238  ALA B C   1 
ATOM   4486  O O   . ALA B 1 237 ? 2.960   11.710  132.437 1.00 59.07  ? 238  ALA B O   1 
ATOM   4487  C CB  . ALA B 1 237 ? 5.417   10.785  134.054 1.00 37.27  ? 238  ALA B CB  1 
ATOM   4488  N N   . GLN B 1 238 ? 2.723   9.477   132.494 1.00 48.57  ? 239  GLN B N   1 
ATOM   4489  C CA  . GLN B 1 238 ? 2.028   9.422   131.211 1.00 56.62  ? 239  GLN B CA  1 
ATOM   4490  C C   . GLN B 1 238 ? 0.508   9.509   131.342 1.00 56.12  ? 239  GLN B C   1 
ATOM   4491  O O   . GLN B 1 238 ? -0.205  9.492   130.340 1.00 60.67  ? 239  GLN B O   1 
ATOM   4492  C CB  . GLN B 1 238 ? 2.422   8.162   130.437 1.00 57.05  ? 239  GLN B CB  1 
ATOM   4493  C CG  . GLN B 1 238 ? 3.918   8.035   130.191 1.00 74.45  ? 239  GLN B CG  1 
ATOM   4494  C CD  . GLN B 1 238 ? 4.510   9.264   129.524 1.00 87.63  ? 239  GLN B CD  1 
ATOM   4495  O OE1 . GLN B 1 238 ? 4.982   10.183  130.196 1.00 93.98  ? 239  GLN B OE1 1 
ATOM   4496  N NE2 . GLN B 1 238 ? 4.493   9.284   128.196 1.00 87.96  ? 239  GLN B NE2 1 
ATOM   4497  N N   . VAL B 1 239 ? 0.015   9.600   132.573 1.00 44.92  ? 240  VAL B N   1 
ATOM   4498  C CA  . VAL B 1 239 ? -1.421  9.738   132.800 1.00 52.17  ? 240  VAL B CA  1 
ATOM   4499  C C   . VAL B 1 239 ? -1.908  11.122  132.375 1.00 59.98  ? 240  VAL B C   1 
ATOM   4500  O O   . VAL B 1 239 ? -1.442  12.136  132.895 1.00 57.43  ? 240  VAL B O   1 
ATOM   4501  C CB  . VAL B 1 239 ? -1.795  9.481   134.273 1.00 50.30  ? 240  VAL B CB  1 
ATOM   4502  C CG1 . VAL B 1 239 ? -3.217  9.946   134.553 1.00 39.51  ? 240  VAL B CG1 1 
ATOM   4503  C CG2 . VAL B 1 239 ? -1.636  8.007   134.609 1.00 62.73  ? 240  VAL B CG2 1 
ATOM   4504  N N   . PRO B 1 240 ? -2.846  11.164  131.416 1.00 67.53  ? 241  PRO B N   1 
ATOM   4505  C CA  . PRO B 1 240 ? -3.368  12.415  130.854 1.00 67.54  ? 241  PRO B CA  1 
ATOM   4506  C C   . PRO B 1 240 ? -4.276  13.171  131.819 1.00 59.50  ? 241  PRO B C   1 
ATOM   4507  O O   . PRO B 1 240 ? -4.815  12.584  132.757 1.00 61.83  ? 241  PRO B O   1 
ATOM   4508  C CB  . PRO B 1 240 ? -4.185  11.944  129.642 1.00 54.39  ? 241  PRO B CB  1 
ATOM   4509  C CG  . PRO B 1 240 ? -3.751  10.534  129.387 1.00 63.41  ? 241  PRO B CG  1 
ATOM   4510  C CD  . PRO B 1 240 ? -3.395  9.986   130.726 1.00 68.19  ? 241  PRO B CD  1 
ATOM   4511  N N   . LEU B 1 241 ? -4.434  14.468  131.584 1.00 49.69  ? 242  LEU B N   1 
ATOM   4512  C CA  . LEU B 1 241 ? -5.362  15.279  132.358 1.00 57.97  ? 242  LEU B CA  1 
ATOM   4513  C C   . LEU B 1 241 ? -6.776  15.104  131.818 1.00 54.39  ? 242  LEU B C   1 
ATOM   4514  O O   . LEU B 1 241 ? -6.977  14.987  130.608 1.00 52.41  ? 242  LEU B O   1 
ATOM   4515  C CB  . LEU B 1 241 ? -4.963  16.753  132.290 1.00 53.53  ? 242  LEU B CB  1 
ATOM   4516  C CG  . LEU B 1 241 ? -3.595  17.142  132.856 1.00 50.89  ? 242  LEU B CG  1 
ATOM   4517  C CD1 . LEU B 1 241 ? -3.333  18.625  132.632 1.00 47.94  ? 242  LEU B CD1 1 
ATOM   4518  C CD2 . LEU B 1 241 ? -3.505  16.798  134.334 1.00 34.77  ? 242  LEU B CD2 1 
ATOM   4519  N N   . GLY B 1 242 ? -7.754  15.082  132.718 1.00 46.05  ? 243  GLY B N   1 
ATOM   4520  C CA  . GLY B 1 242 ? -9.143  14.947  132.319 1.00 51.10  ? 243  GLY B CA  1 
ATOM   4521  C C   . GLY B 1 242 ? -9.663  16.211  131.664 1.00 51.39  ? 243  GLY B C   1 
ATOM   4522  O O   . GLY B 1 242 ? -9.074  17.278  131.828 1.00 64.42  ? 243  GLY B O   1 
ATOM   4523  N N   . PRO B 1 243 ? -10.767 16.096  130.910 1.00 49.67  ? 244  PRO B N   1 
ATOM   4524  C CA  . PRO B 1 243 ? -11.398 17.259  130.274 1.00 56.23  ? 244  PRO B CA  1 
ATOM   4525  C C   . PRO B 1 243 ? -11.941 18.248  131.306 1.00 51.71  ? 244  PRO B C   1 
ATOM   4526  O O   . PRO B 1 243 ? -11.831 19.467  131.124 1.00 48.19  ? 244  PRO B O   1 
ATOM   4527  C CB  . PRO B 1 243 ? -12.544 16.638  129.469 1.00 48.20  ? 244  PRO B CB  1 
ATOM   4528  C CG  . PRO B 1 243 ? -12.815 15.329  130.134 1.00 43.13  ? 244  PRO B CG  1 
ATOM   4529  C CD  . PRO B 1 243 ? -11.481 14.844  130.605 1.00 50.77  ? 244  PRO B CD  1 
ATOM   4530  N N   . GLU B 1 244 ? -12.522 17.714  132.378 1.00 39.23  ? 245  GLU B N   1 
ATOM   4531  C CA  . GLU B 1 244 ? -13.001 18.527  133.488 1.00 42.30  ? 245  GLU B CA  1 
ATOM   4532  C C   . GLU B 1 244 ? -11.850 19.320  134.087 1.00 60.20  ? 245  GLU B C   1 
ATOM   4533  O O   . GLU B 1 244 ? -11.951 20.534  134.282 1.00 77.80  ? 245  GLU B O   1 
ATOM   4534  C CB  . GLU B 1 244 ? -13.641 17.642  134.558 1.00 53.07  ? 245  GLU B CB  1 
ATOM   4535  C CG  . GLU B 1 244 ? -15.083 17.271  134.268 1.00 74.48  ? 245  GLU B CG  1 
ATOM   4536  C CD  . GLU B 1 244 ? -16.003 18.476  134.293 1.00 89.45  ? 245  GLU B CD  1 
ATOM   4537  O OE1 . GLU B 1 244 ? -16.342 18.940  135.402 1.00 92.91  ? 245  GLU B OE1 1 
ATOM   4538  O OE2 . GLU B 1 244 ? -16.384 18.962  133.206 1.00 85.69  ? 245  GLU B OE2 1 
ATOM   4539  N N   . CYS B 1 245 ? -10.754 18.622  134.373 1.00 61.62  ? 246  CYS B N   1 
ATOM   4540  C CA  . CYS B 1 245 ? -9.535  19.264  134.847 1.00 46.65  ? 246  CYS B CA  1 
ATOM   4541  C C   . CYS B 1 245 ? -9.068  20.340  133.873 1.00 46.62  ? 246  CYS B C   1 
ATOM   4542  O O   . CYS B 1 245 ? -8.657  21.421  134.286 1.00 47.77  ? 246  CYS B O   1 
ATOM   4543  C CB  . CYS B 1 245 ? -8.428  18.227  135.050 1.00 32.10  ? 246  CYS B CB  1 
ATOM   4544  S SG  . CYS B 1 245 ? -6.804  18.923  135.447 1.00 88.56  ? 246  CYS B SG  1 
ATOM   4545  N N   . SER B 1 246 ? -9.149  20.043  132.579 1.00 34.32  ? 247  SER B N   1 
ATOM   4546  C CA  . SER B 1 246 ? -8.696  20.970  131.546 1.00 47.72  ? 247  SER B CA  1 
ATOM   4547  C C   . SER B 1 246 ? -9.468  22.283  131.586 1.00 50.53  ? 247  SER B C   1 
ATOM   4548  O O   . SER B 1 246 ? -8.875  23.365  131.692 1.00 55.10  ? 247  SER B O   1 
ATOM   4549  C CB  . SER B 1 246 ? -8.815  20.334  130.158 1.00 50.21  ? 247  SER B CB  1 
ATOM   4550  O OG  . SER B 1 246 ? -8.500  21.272  129.142 1.00 62.05  ? 247  SER B OG  1 
ATOM   4551  N N   . ARG B 1 247 ? -10.792 22.187  131.505 1.00 41.85  ? 248  ARG B N   1 
ATOM   4552  C CA  . ARG B 1 247 ? -11.620 23.387  131.523 1.00 48.31  ? 248  ARG B CA  1 
ATOM   4553  C C   . ARG B 1 247 ? -11.527 24.137  132.855 1.00 42.80  ? 248  ARG B C   1 
ATOM   4554  O O   . ARG B 1 247 ? -11.518 25.372  132.879 1.00 55.87  ? 248  ARG B O   1 
ATOM   4555  C CB  . ARG B 1 247 ? -13.072 23.067  131.154 1.00 66.39  ? 248  ARG B CB  1 
ATOM   4556  C CG  . ARG B 1 247 ? -13.752 22.018  132.012 1.00 76.07  ? 248  ARG B CG  1 
ATOM   4557  C CD  . ARG B 1 247 ? -15.175 21.799  131.530 1.00 80.44  ? 248  ARG B CD  1 
ATOM   4558  N NE  . ARG B 1 247 ? -15.921 23.054  131.495 1.00 94.82  ? 248  ARG B NE  1 
ATOM   4559  C CZ  . ARG B 1 247 ? -17.049 23.237  130.816 1.00 101.08 ? 248  ARG B CZ  1 
ATOM   4560  N NH1 . ARG B 1 247 ? -17.566 22.246  130.104 1.00 111.27 ? 248  ARG B NH1 1 
ATOM   4561  N NH2 . ARG B 1 247 ? -17.657 24.415  130.844 1.00 93.35  ? 248  ARG B NH2 1 
ATOM   4562  N N   . ALA B 1 248 ? -11.440 23.393  133.955 1.00 31.82  ? 249  ALA B N   1 
ATOM   4563  C CA  . ALA B 1 248 ? -11.263 24.005  135.269 1.00 35.69  ? 249  ALA B CA  1 
ATOM   4564  C C   . ALA B 1 248 ? -9.972  24.816  135.317 1.00 42.60  ? 249  ALA B C   1 
ATOM   4565  O O   . ALA B 1 248 ? -9.942  25.924  135.852 1.00 45.28  ? 249  ALA B O   1 
ATOM   4566  C CB  . ALA B 1 248 ? -11.265 22.946  136.360 1.00 36.09  ? 249  ALA B CB  1 
ATOM   4567  N N   . VAL B 1 249 ? -8.912  24.255  134.743 1.00 45.16  ? 250  VAL B N   1 
ATOM   4568  C CA  . VAL B 1 249 ? -7.620  24.930  134.660 1.00 49.05  ? 250  VAL B CA  1 
ATOM   4569  C C   . VAL B 1 249 ? -7.713  26.186  133.791 1.00 47.38  ? 250  VAL B C   1 
ATOM   4570  O O   . VAL B 1 249 ? -7.137  27.226  134.123 1.00 44.04  ? 250  VAL B O   1 
ATOM   4571  C CB  . VAL B 1 249 ? -6.518  23.968  134.142 1.00 56.63  ? 250  VAL B CB  1 
ATOM   4572  C CG1 . VAL B 1 249 ? -5.351  24.735  133.545 1.00 42.25  ? 250  VAL B CG1 1 
ATOM   4573  C CG2 . VAL B 1 249 ? -6.045  23.059  135.267 1.00 50.43  ? 250  VAL B CG2 1 
ATOM   4574  N N   . MET B 1 250 ? -8.452  26.088  132.689 1.00 51.73  ? 251  MET B N   1 
ATOM   4575  C CA  . MET B 1 250 ? -8.705  27.246  131.832 1.00 50.06  ? 251  MET B CA  1 
ATOM   4576  C C   . MET B 1 250 ? -9.367  28.387  132.606 1.00 49.76  ? 251  MET B C   1 
ATOM   4577  O O   . MET B 1 250 ? -8.913  29.542  132.545 1.00 50.92  ? 251  MET B O   1 
ATOM   4578  C CB  . MET B 1 250 ? -9.592  26.858  130.651 1.00 37.14  ? 251  MET B CB  1 
ATOM   4579  C CG  . MET B 1 250 ? -10.220 28.043  129.937 1.00 39.67  ? 251  MET B CG  1 
ATOM   4580  S SD  . MET B 1 250 ? -8.993  29.227  129.352 1.00 58.81  ? 251  MET B SD  1 
ATOM   4581  C CE  . MET B 1 250 ? -10.021 30.331  128.388 1.00 76.91  ? 251  MET B CE  1 
ATOM   4582  N N   . LYS B 1 251 ? -10.437 28.053  133.328 1.00 50.95  ? 252  LYS B N   1 
ATOM   4583  C CA  . LYS B 1 251 ? -11.149 29.016  134.161 1.00 54.67  ? 252  LYS B CA  1 
ATOM   4584  C C   . LYS B 1 251 ? -10.240 29.565  135.254 1.00 51.83  ? 252  LYS B C   1 
ATOM   4585  O O   . LYS B 1 251 ? -10.410 30.692  135.710 1.00 48.57  ? 252  LYS B O   1 
ATOM   4586  C CB  . LYS B 1 251 ? -12.388 28.361  134.777 1.00 57.89  ? 252  LYS B CB  1 
ATOM   4587  C CG  . LYS B 1 251 ? -13.261 29.283  135.627 1.00 58.48  ? 252  LYS B CG  1 
ATOM   4588  C CD  . LYS B 1 251 ? -14.632 28.664  135.886 1.00 73.79  ? 252  LYS B CD  1 
ATOM   4589  C CE  . LYS B 1 251 ? -15.475 29.526  136.821 1.00 67.56  ? 252  LYS B CE  1 
ATOM   4590  N NZ  . LYS B 1 251 ? -15.033 29.454  138.245 1.00 60.91  ? 252  LYS B NZ  1 
ATOM   4591  N N   . LEU B 1 252 ? -9.272  28.758  135.671 1.00 58.84  ? 253  LEU B N   1 
ATOM   4592  C CA  . LEU B 1 252 ? -8.308  29.180  136.678 1.00 49.63  ? 253  LEU B CA  1 
ATOM   4593  C C   . LEU B 1 252 ? -7.336  30.212  136.116 1.00 51.58  ? 253  LEU B C   1 
ATOM   4594  O O   . LEU B 1 252 ? -6.928  31.145  136.811 1.00 56.34  ? 253  LEU B O   1 
ATOM   4595  C CB  . LEU B 1 252 ? -7.523  27.971  137.182 1.00 57.26  ? 253  LEU B CB  1 
ATOM   4596  C CG  . LEU B 1 252 ? -6.334  28.264  138.097 1.00 57.08  ? 253  LEU B CG  1 
ATOM   4597  C CD1 . LEU B 1 252 ? -6.813  28.722  139.464 1.00 51.82  ? 253  LEU B CD1 1 
ATOM   4598  C CD2 . LEU B 1 252 ? -5.415  27.055  138.214 1.00 50.95  ? 253  LEU B CD2 1 
ATOM   4599  N N   . VAL B 1 253 ? -6.972  30.042  134.850 1.00 44.59  ? 254  VAL B N   1 
ATOM   4600  C CA  . VAL B 1 253 ? -5.892  30.833  134.266 1.00 46.53  ? 254  VAL B CA  1 
ATOM   4601  C C   . VAL B 1 253 ? -6.337  31.997  133.364 1.00 49.97  ? 254  VAL B C   1 
ATOM   4602  O O   . VAL B 1 253 ? -6.199  33.161  133.741 1.00 63.27  ? 254  VAL B O   1 
ATOM   4603  C CB  . VAL B 1 253 ? -4.885  29.929  133.519 1.00 49.24  ? 254  VAL B CB  1 
ATOM   4604  C CG1 . VAL B 1 253 ? -3.764  30.756  132.916 1.00 46.53  ? 254  VAL B CG1 1 
ATOM   4605  C CG2 . VAL B 1 253 ? -4.322  28.887  134.468 1.00 50.62  ? 254  VAL B CG2 1 
ATOM   4606  N N   . TYR B 1 254 ? -6.875  31.687  132.188 1.00 45.71  ? 255  TYR B N   1 
ATOM   4607  C CA  . TYR B 1 254 ? -7.069  32.713  131.160 1.00 52.14  ? 255  TYR B CA  1 
ATOM   4608  C C   . TYR B 1 254 ? -8.473  33.327  131.113 1.00 56.60  ? 255  TYR B C   1 
ATOM   4609  O O   . TYR B 1 254 ? -8.745  34.238  130.318 1.00 65.20  ? 255  TYR B O   1 
ATOM   4610  C CB  . TYR B 1 254 ? -6.658  32.167  129.791 1.00 43.32  ? 255  TYR B CB  1 
ATOM   4611  C CG  . TYR B 1 254 ? -5.169  31.939  129.650 1.00 48.28  ? 255  TYR B CG  1 
ATOM   4612  C CD1 . TYR B 1 254 ? -4.255  32.863  130.143 1.00 61.68  ? 255  TYR B CD1 1 
ATOM   4613  C CD2 . TYR B 1 254 ? -4.677  30.800  129.027 1.00 50.19  ? 255  TYR B CD2 1 
ATOM   4614  C CE1 . TYR B 1 254 ? -2.897  32.660  130.015 1.00 64.36  ? 255  TYR B CE1 1 
ATOM   4615  C CE2 . TYR B 1 254 ? -3.319  30.590  128.897 1.00 62.23  ? 255  TYR B CE2 1 
ATOM   4616  C CZ  . TYR B 1 254 ? -2.436  31.523  129.392 1.00 65.63  ? 255  TYR B CZ  1 
ATOM   4617  O OH  . TYR B 1 254 ? -1.081  31.322  129.266 1.00 58.32  ? 255  TYR B OH  1 
ATOM   4618  N N   . CYS B 1 255 ? -9.358  32.851  131.979 1.00 51.41  ? 256  CYS B N   1 
ATOM   4619  C CA  . CYS B 1 255 ? -10.705 33.393  132.037 1.00 59.33  ? 256  CYS B CA  1 
ATOM   4620  C C   . CYS B 1 255 ? -10.692 34.791  132.644 1.00 64.37  ? 256  CYS B C   1 
ATOM   4621  O O   . CYS B 1 255 ? -11.585 35.592  132.384 1.00 70.46  ? 256  CYS B O   1 
ATOM   4622  C CB  . CYS B 1 255 ? -11.619 32.456  132.817 1.00 55.09  ? 256  CYS B CB  1 
ATOM   4623  S SG  . CYS B 1 255 ? -12.465 31.263  131.765 1.00 66.74  ? 256  CYS B SG  1 
ATOM   4624  N N   . ALA B 1 256 ? -9.668  35.085  133.443 1.00 62.39  ? 257  ALA B N   1 
ATOM   4625  C CA  . ALA B 1 256 ? -9.466  36.437  133.957 1.00 57.01  ? 257  ALA B CA  1 
ATOM   4626  C C   . ALA B 1 256 ? -9.184  37.391  132.799 1.00 57.87  ? 257  ALA B C   1 
ATOM   4627  O O   . ALA B 1 256 ? -9.669  38.524  132.775 1.00 51.36  ? 257  ALA B O   1 
ATOM   4628  C CB  . ALA B 1 256 ? -8.322  36.469  134.966 1.00 46.98  ? 257  ALA B CB  1 
ATOM   4629  N N   . HIS B 1 257 ? -8.387  36.920  131.846 1.00 51.27  ? 258  HIS B N   1 
ATOM   4630  C CA  . HIS B 1 257 ? -8.086  37.684  130.644 1.00 48.22  ? 258  HIS B CA  1 
ATOM   4631  C C   . HIS B 1 257 ? -9.368  37.884  129.854 1.00 44.53  ? 258  HIS B C   1 
ATOM   4632  O O   . HIS B 1 257 ? -9.635  38.977  129.359 1.00 54.05  ? 258  HIS B O   1 
ATOM   4633  C CB  . HIS B 1 257 ? -7.063  36.949  129.773 1.00 48.26  ? 258  HIS B CB  1 
ATOM   4634  C CG  . HIS B 1 257 ? -5.775  36.644  130.442 1.00 59.10  ? 258  HIS B CG  1 
ATOM   4635  N ND1 . HIS B 1 257 ? -5.553  36.876  131.808 1.00 67.04  ? 258  HIS B ND1 1 
ATOM   4636  C CD2 . HIS B 1 257 ? -4.611  36.129  129.995 1.00 60.35  ? 258  HIS B CD2 1 
ATOM   4637  C CE1 . HIS B 1 257 ? -4.346  36.521  132.126 1.00 60.66  ? 258  HIS B CE1 1 
ATOM   4638  N NE2 . HIS B 1 257 ? -3.731  36.052  131.032 1.00 68.40  ? 258  HIS B NE2 1 
ATOM   4639  N N   . CYS B 1 258 ? -10.155 36.818  129.739 1.00 48.34  ? 259  CYS B N   1 
ATOM   4640  C CA  . CYS B 1 258 ? -11.410 36.880  128.998 1.00 56.92  ? 259  CYS B CA  1 
ATOM   4641  C C   . CYS B 1 258 ? -12.436 37.821  129.634 1.00 64.42  ? 259  CYS B C   1 
ATOM   4642  O O   . CYS B 1 258 ? -13.266 38.399  128.937 1.00 59.36  ? 259  CYS B O   1 
ATOM   4643  C CB  . CYS B 1 258 ? -11.998 35.476  128.834 1.00 47.95  ? 259  CYS B CB  1 
ATOM   4644  S SG  . CYS B 1 258 ? -11.217 34.479  127.540 1.00 66.17  ? 259  CYS B SG  1 
ATOM   4645  N N   . LEU B 1 259 ? -12.379 37.984  130.952 1.00 64.35  ? 260  LEU B N   1 
ATOM   4646  C CA  . LEU B 1 259 ? -13.370 38.805  131.647 1.00 64.07  ? 260  LEU B CA  1 
ATOM   4647  C C   . LEU B 1 259 ? -12.930 40.251  131.883 1.00 83.65  ? 260  LEU B C   1 
ATOM   4648  O O   . LEU B 1 259 ? -13.652 41.035  132.501 1.00 96.37  ? 260  LEU B O   1 
ATOM   4649  C CB  . LEU B 1 259 ? -13.796 38.148  132.961 1.00 52.24  ? 260  LEU B CB  1 
ATOM   4650  C CG  . LEU B 1 259 ? -14.609 36.862  132.803 1.00 61.38  ? 260  LEU B CG  1 
ATOM   4651  C CD1 . LEU B 1 259 ? -15.165 36.418  134.146 1.00 64.39  ? 260  LEU B CD1 1 
ATOM   4652  C CD2 . LEU B 1 259 ? -15.728 37.046  131.786 1.00 65.92  ? 260  LEU B CD2 1 
ATOM   4653  N N   . GLY B 1 260 ? -11.745 40.599  131.394 1.00 83.99  ? 261  GLY B N   1 
ATOM   4654  C CA  . GLY B 1 260 ? -11.277 41.971  131.462 1.00 78.13  ? 261  GLY B CA  1 
ATOM   4655  C C   . GLY B 1 260 ? -10.315 42.283  132.592 1.00 74.92  ? 261  GLY B C   1 
ATOM   4656  O O   . GLY B 1 260 ? -10.060 43.450  132.888 1.00 88.06  ? 261  GLY B O   1 
ATOM   4657  N N   . VAL B 1 261 ? -9.775  41.249  133.227 1.00 66.93  ? 262  VAL B N   1 
ATOM   4658  C CA  . VAL B 1 261 ? -8.774  41.444  134.274 1.00 60.90  ? 262  VAL B CA  1 
ATOM   4659  C C   . VAL B 1 261 ? -7.530  40.578  134.055 1.00 66.25  ? 262  VAL B C   1 
ATOM   4660  O O   . VAL B 1 261 ? -7.279  39.640  134.811 1.00 68.72  ? 262  VAL B O   1 
ATOM   4661  C CB  . VAL B 1 261 ? -9.362  41.187  135.681 1.00 51.66  ? 262  VAL B CB  1 
ATOM   4662  C CG1 . VAL B 1 261 ? -10.118 42.411  136.173 1.00 43.80  ? 262  VAL B CG1 1 
ATOM   4663  C CG2 . VAL B 1 261 ? -10.268 39.963  135.673 1.00 47.61  ? 262  VAL B CG2 1 
ATOM   4664  N N   . PRO B 1 262 ? -6.739  40.900  133.018 1.00 74.49  ? 263  PRO B N   1 
ATOM   4665  C CA  . PRO B 1 262 ? -5.579  40.084  132.640 1.00 71.08  ? 263  PRO B CA  1 
ATOM   4666  C C   . PRO B 1 262 ? -4.449  40.138  133.663 1.00 62.17  ? 263  PRO B C   1 
ATOM   4667  O O   . PRO B 1 262 ? -3.657  39.199  133.750 1.00 61.57  ? 263  PRO B O   1 
ATOM   4668  C CB  . PRO B 1 262 ? -5.114  40.722  131.324 1.00 83.09  ? 263  PRO B CB  1 
ATOM   4669  C CG  . PRO B 1 262 ? -6.262  41.582  130.866 1.00 81.45  ? 263  PRO B CG  1 
ATOM   4670  C CD  . PRO B 1 262 ? -6.908  42.054  132.121 1.00 76.85  ? 263  PRO B CD  1 
ATOM   4671  N N   . GLY B 1 263 ? -4.375  41.225  134.424 1.00 66.03  ? 264  GLY B N   1 
ATOM   4672  C CA  . GLY B 1 263 ? -3.293  41.412  135.373 1.00 82.46  ? 264  GLY B CA  1 
ATOM   4673  C C   . GLY B 1 263 ? -3.532  40.746  136.714 1.00 84.36  ? 264  GLY B C   1 
ATOM   4674  O O   . GLY B 1 263 ? -2.710  40.852  137.625 1.00 84.96  ? 264  GLY B O   1 
ATOM   4675  N N   . ALA B 1 264 ? -4.658  40.051  136.835 1.00 80.55  ? 265  ALA B N   1 
ATOM   4676  C CA  . ALA B 1 264 ? -5.022  39.408  138.092 1.00 78.64  ? 265  ALA B CA  1 
ATOM   4677  C C   . ALA B 1 264 ? -4.528  37.968  138.156 1.00 80.96  ? 265  ALA B C   1 
ATOM   4678  O O   . ALA B 1 264 ? -4.963  37.115  137.382 1.00 79.78  ? 265  ALA B O   1 
ATOM   4679  C CB  . ALA B 1 264 ? -6.529  39.460  138.294 1.00 79.49  ? 265  ALA B CB  1 
ATOM   4680  N N   . ARG B 1 265 ? -3.617  37.703  139.086 1.00 86.27  ? 266  ARG B N   1 
ATOM   4681  C CA  . ARG B 1 265 ? -3.124  36.351  139.305 1.00 78.48  ? 266  ARG B CA  1 
ATOM   4682  C C   . ARG B 1 265 ? -4.106  35.598  140.196 1.00 64.92  ? 266  ARG B C   1 
ATOM   4683  O O   . ARG B 1 265 ? -4.645  36.168  141.144 1.00 66.14  ? 266  ARG B O   1 
ATOM   4684  C CB  . ARG B 1 265 ? -1.737  36.382  139.950 1.00 85.47  ? 266  ARG B CB  1 
ATOM   4685  C CG  . ARG B 1 265 ? -0.714  37.220  139.195 1.00 93.91  ? 266  ARG B CG  1 
ATOM   4686  C CD  . ARG B 1 265 ? -0.586  36.780  137.745 1.00 100.40 ? 266  ARG B CD  1 
ATOM   4687  N NE  . ARG B 1 265 ? 0.519   37.454  137.069 1.00 110.87 ? 266  ARG B NE  1 
ATOM   4688  C CZ  . ARG B 1 265 ? 0.774   37.355  135.768 1.00 120.05 ? 266  ARG B CZ  1 
ATOM   4689  N NH1 . ARG B 1 265 ? -0.002  36.611  134.992 1.00 124.69 ? 266  ARG B NH1 1 
ATOM   4690  N NH2 . ARG B 1 265 ? 1.804   38.005  135.241 1.00 119.52 ? 266  ARG B NH2 1 
ATOM   4691  N N   . PRO B 1 266 ? -4.347  34.315  139.889 1.00 56.97  ? 267  PRO B N   1 
ATOM   4692  C CA  . PRO B 1 266 ? -5.305  33.496  140.643 1.00 53.74  ? 267  PRO B CA  1 
ATOM   4693  C C   . PRO B 1 266 ? -4.940  33.363  142.120 1.00 46.11  ? 267  PRO B C   1 
ATOM   4694  O O   . PRO B 1 266 ? -3.759  33.363  142.468 1.00 51.47  ? 267  PRO B O   1 
ATOM   4695  C CB  . PRO B 1 266 ? -5.224  32.131  139.947 1.00 52.60  ? 267  PRO B CB  1 
ATOM   4696  C CG  . PRO B 1 266 ? -3.912  32.133  139.245 1.00 49.99  ? 267  PRO B CG  1 
ATOM   4697  C CD  . PRO B 1 266 ? -3.697  33.547  138.815 1.00 51.83  ? 267  PRO B CD  1 
ATOM   4698  N N   . CYS B 1 267 ? -5.951  33.259  142.977 1.00 35.78  ? 268  CYS B N   1 
ATOM   4699  C CA  . CYS B 1 267 ? -5.734  33.082  144.408 1.00 39.11  ? 268  CYS B CA  1 
ATOM   4700  C C   . CYS B 1 267 ? -5.110  31.720  144.692 1.00 68.30  ? 268  CYS B C   1 
ATOM   4701  O O   . CYS B 1 267 ? -5.499  30.716  144.092 1.00 79.09  ? 268  CYS B O   1 
ATOM   4702  C CB  . CYS B 1 267 ? -7.055  33.211  145.167 1.00 49.52  ? 268  CYS B CB  1 
ATOM   4703  S SG  . CYS B 1 267 ? -7.999  34.718  144.814 1.00 64.92  ? 268  CYS B SG  1 
ATOM   4704  N N   . PRO B 1 268 ? -4.138  31.682  145.617 1.00 73.43  ? 269  PRO B N   1 
ATOM   4705  C CA  . PRO B 1 268 ? -3.414  30.460  145.984 1.00 64.31  ? 269  PRO B CA  1 
ATOM   4706  C C   . PRO B 1 268 ? -4.323  29.288  146.357 1.00 54.65  ? 269  PRO B C   1 
ATOM   4707  O O   . PRO B 1 268 ? -4.026  28.157  145.979 1.00 56.01  ? 269  PRO B O   1 
ATOM   4708  C CB  . PRO B 1 268 ? -2.570  30.896  147.194 1.00 52.84  ? 269  PRO B CB  1 
ATOM   4709  C CG  . PRO B 1 268 ? -3.101  32.239  147.598 1.00 60.79  ? 269  PRO B CG  1 
ATOM   4710  C CD  . PRO B 1 268 ? -3.637  32.851  146.353 1.00 64.51  ? 269  PRO B CD  1 
ATOM   4711  N N   . ASP B 1 269 ? -5.413  29.551  147.071 1.00 47.42  ? 270  ASP B N   1 
ATOM   4712  C CA  . ASP B 1 269 ? -6.318  28.483  147.495 1.00 50.78  ? 270  ASP B CA  1 
ATOM   4713  C C   . ASP B 1 269 ? -7.231  27.996  146.366 1.00 45.81  ? 270  ASP B C   1 
ATOM   4714  O O   . ASP B 1 269 ? -7.585  26.816  146.306 1.00 48.57  ? 270  ASP B O   1 
ATOM   4715  C CB  . ASP B 1 269 ? -7.132  28.920  148.716 1.00 49.33  ? 270  ASP B CB  1 
ATOM   4716  C CG  . ASP B 1 269 ? -6.299  28.956  149.984 1.00 55.27  ? 270  ASP B CG  1 
ATOM   4717  O OD1 . ASP B 1 269 ? -5.055  28.916  149.877 1.00 47.00  ? 270  ASP B OD1 1 
ATOM   4718  O OD2 . ASP B 1 269 ? -6.882  29.022  151.087 1.00 66.76  ? 270  ASP B OD2 1 
ATOM   4719  N N   . TYR B 1 270 ? -7.609  28.912  145.481 1.00 37.42  ? 271  TYR B N   1 
ATOM   4720  C CA  . TYR B 1 270 ? -8.340  28.571  144.267 1.00 35.78  ? 271  TYR B CA  1 
ATOM   4721  C C   . TYR B 1 270 ? -7.483  27.614  143.444 1.00 41.22  ? 271  TYR B C   1 
ATOM   4722  O O   . TYR B 1 270 ? -7.924  26.520  143.063 1.00 49.50  ? 271  TYR B O   1 
ATOM   4723  C CB  . TYR B 1 270 ? -8.622  29.847  143.468 1.00 38.39  ? 271  TYR B CB  1 
ATOM   4724  C CG  . TYR B 1 270 ? -9.360  29.647  142.161 1.00 39.53  ? 271  TYR B CG  1 
ATOM   4725  C CD1 . TYR B 1 270 ? -10.140 28.519  141.938 1.00 38.60  ? 271  TYR B CD1 1 
ATOM   4726  C CD2 . TYR B 1 270 ? -9.273  30.592  141.147 1.00 34.14  ? 271  TYR B CD2 1 
ATOM   4727  C CE1 . TYR B 1 270 ? -10.809 28.339  140.743 1.00 39.36  ? 271  TYR B CE1 1 
ATOM   4728  C CE2 . TYR B 1 270 ? -9.940  30.419  139.948 1.00 41.72  ? 271  TYR B CE2 1 
ATOM   4729  C CZ  . TYR B 1 270 ? -10.707 29.290  139.752 1.00 43.89  ? 271  TYR B CZ  1 
ATOM   4730  O OH  . TYR B 1 270 ? -11.376 29.110  138.562 1.00 41.66  ? 271  TYR B OH  1 
ATOM   4731  N N   . CYS B 1 271 ? -6.250  28.040  143.188 1.00 42.86  ? 272  CYS B N   1 
ATOM   4732  C CA  . CYS B 1 271 ? -5.278  27.236  142.458 1.00 47.32  ? 272  CYS B CA  1 
ATOM   4733  C C   . CYS B 1 271 ? -5.074  25.883  143.137 1.00 50.25  ? 272  CYS B C   1 
ATOM   4734  O O   . CYS B 1 271 ? -4.965  24.851  142.471 1.00 46.25  ? 272  CYS B O   1 
ATOM   4735  C CB  . CYS B 1 271 ? -3.949  27.991  142.366 1.00 36.77  ? 272  CYS B CB  1 
ATOM   4736  S SG  . CYS B 1 271 ? -2.757  27.305  141.198 1.00 74.53  ? 272  CYS B SG  1 
ATOM   4737  N N   . ARG B 1 272 ? -5.027  25.899  144.465 1.00 41.11  ? 273  ARG B N   1 
ATOM   4738  C CA  . ARG B 1 272 ? -4.859  24.681  145.247 1.00 32.06  ? 273  ARG B CA  1 
ATOM   4739  C C   . ARG B 1 272 ? -5.997  23.697  145.007 1.00 46.92  ? 273  ARG B C   1 
ATOM   4740  O O   . ARG B 1 272 ? -5.754  22.529  144.710 1.00 54.35  ? 273  ARG B O   1 
ATOM   4741  C CB  . ARG B 1 272 ? -4.732  25.007  146.738 1.00 44.98  ? 273  ARG B CB  1 
ATOM   4742  C CG  . ARG B 1 272 ? -3.294  25.159  147.207 1.00 56.51  ? 273  ARG B CG  1 
ATOM   4743  C CD  . ARG B 1 272 ? -3.179  26.091  148.405 1.00 76.93  ? 273  ARG B CD  1 
ATOM   4744  N NE  . ARG B 1 272 ? -1.790  26.257  148.829 1.00 99.05  ? 273  ARG B NE  1 
ATOM   4745  C CZ  . ARG B 1 272 ? -0.903  27.029  148.209 1.00 108.52 ? 273  ARG B CZ  1 
ATOM   4746  N NH1 . ARG B 1 272 ? -1.252  27.713  147.126 1.00 111.43 ? 273  ARG B NH1 1 
ATOM   4747  N NH2 . ARG B 1 272 ? 0.339   27.116  148.667 1.00 110.19 ? 273  ARG B NH2 1 
ATOM   4748  N N   . ASN B 1 273 ? -7.235  24.169  145.124 1.00 40.38  ? 274  ASN B N   1 
ATOM   4749  C CA  . ASN B 1 273 ? -8.389  23.312  144.863 1.00 30.02  ? 274  ASN B CA  1 
ATOM   4750  C C   . ASN B 1 273 ? -8.416  22.763  143.435 1.00 38.89  ? 274  ASN B C   1 
ATOM   4751  O O   . ASN B 1 273 ? -8.692  21.573  143.223 1.00 47.47  ? 274  ASN B O   1 
ATOM   4752  C CB  . ASN B 1 273 ? -9.697  24.036  145.189 1.00 29.48  ? 274  ASN B CB  1 
ATOM   4753  C CG  . ASN B 1 273 ? -10.046 23.974  146.664 1.00 46.25  ? 274  ASN B CG  1 
ATOM   4754  O OD1 . ASN B 1 273 ? -9.500  23.159  147.408 1.00 47.96  ? 274  ASN B OD1 1 
ATOM   4755  N ND2 . ASN B 1 273 ? -10.968 24.829  147.093 1.00 41.43  ? 274  ASN B ND2 1 
ATOM   4756  N N   . VAL B 1 274 ? -8.119  23.623  142.462 1.00 27.04  ? 275  VAL B N   1 
ATOM   4757  C CA  . VAL B 1 274 ? -8.074  23.191  141.065 1.00 31.04  ? 275  VAL B CA  1 
ATOM   4758  C C   . VAL B 1 274 ? -7.035  22.089  140.847 1.00 44.08  ? 275  VAL B C   1 
ATOM   4759  O O   . VAL B 1 274 ? -7.337  21.038  140.272 1.00 47.54  ? 275  VAL B O   1 
ATOM   4760  C CB  . VAL B 1 274 ? -7.764  24.362  140.113 1.00 28.21  ? 275  VAL B CB  1 
ATOM   4761  C CG1 . VAL B 1 274 ? -7.590  23.866  138.683 1.00 24.41  ? 275  VAL B CG1 1 
ATOM   4762  C CG2 . VAL B 1 274 ? -8.861  25.403  140.182 1.00 39.15  ? 275  VAL B CG2 1 
ATOM   4763  N N   . LEU B 1 275 ? -5.814  22.327  141.316 1.00 42.05  ? 276  LEU B N   1 
ATOM   4764  C CA  . LEU B 1 275 ? -4.725  21.373  141.111 1.00 53.38  ? 276  LEU B CA  1 
ATOM   4765  C C   . LEU B 1 275 ? -4.899  20.069  141.892 1.00 53.34  ? 276  LEU B C   1 
ATOM   4766  O O   . LEU B 1 275 ? -4.512  19.003  141.418 1.00 52.49  ? 276  LEU B O   1 
ATOM   4767  C CB  . LEU B 1 275 ? -3.362  22.011  141.404 1.00 51.48  ? 276  LEU B CB  1 
ATOM   4768  C CG  . LEU B 1 275 ? -2.790  22.884  140.284 1.00 56.58  ? 276  LEU B CG  1 
ATOM   4769  C CD1 . LEU B 1 275 ? -1.310  23.137  140.502 1.00 58.62  ? 276  LEU B CD1 1 
ATOM   4770  C CD2 . LEU B 1 275 ? -3.034  22.238  138.926 1.00 51.31  ? 276  LEU B CD2 1 
ATOM   4771  N N   . LYS B 1 276 ? -5.480  20.151  143.084 1.00 27.06  ? 277  LYS B N   1 
ATOM   4772  C CA  . LYS B 1 276 ? -5.767  18.947  143.855 1.00 32.14  ? 277  LYS B CA  1 
ATOM   4773  C C   . LYS B 1 276 ? -6.843  18.134  143.144 1.00 37.87  ? 277  LYS B C   1 
ATOM   4774  O O   . LYS B 1 276 ? -6.806  16.887  143.142 1.00 40.00  ? 277  LYS B O   1 
ATOM   4775  C CB  . LYS B 1 276 ? -6.222  19.291  145.274 1.00 12.57  ? 277  LYS B CB  1 
ATOM   4776  C CG  . LYS B 1 276 ? -5.108  19.765  146.191 1.00 28.10  ? 277  LYS B CG  1 
ATOM   4777  C CD  . LYS B 1 276 ? -5.576  19.782  147.632 1.00 34.10  ? 277  LYS B CD  1 
ATOM   4778  C CE  . LYS B 1 276 ? -4.465  20.243  148.549 1.00 43.42  ? 277  LYS B CE  1 
ATOM   4779  N NZ  . LYS B 1 276 ? -4.860  20.154  149.978 1.00 44.11  ? 277  LYS B NZ  1 
ATOM   4780  N N   . GLY B 1 277 ? -7.799  18.848  142.547 1.00 33.67  ? 278  GLY B N   1 
ATOM   4781  C CA  . GLY B 1 277 ? -8.861  18.216  141.789 1.00 39.55  ? 278  GLY B CA  1 
ATOM   4782  C C   . GLY B 1 277 ? -8.305  17.492  140.583 1.00 30.31  ? 278  GLY B C   1 
ATOM   4783  O O   . GLY B 1 277 ? -8.705  16.372  140.287 1.00 33.88  ? 278  GLY B O   1 
ATOM   4784  N N   . CYS B 1 278 ? -7.368  18.129  139.891 1.00 26.19  ? 279  CYS B N   1 
ATOM   4785  C CA  . CYS B 1 278 ? -6.754  17.517  138.715 1.00 47.94  ? 279  CYS B CA  1 
ATOM   4786  C C   . CYS B 1 278 ? -5.841  16.332  139.063 1.00 48.80  ? 279  CYS B C   1 
ATOM   4787  O O   . CYS B 1 278 ? -5.865  15.292  138.398 1.00 53.50  ? 279  CYS B O   1 
ATOM   4788  C CB  . CYS B 1 278 ? -5.952  18.562  137.936 1.00 62.98  ? 279  CYS B CB  1 
ATOM   4789  S SG  . CYS B 1 278 ? -6.932  19.903  137.221 1.00 59.22  ? 279  CYS B SG  1 
ATOM   4790  N N   . LEU B 1 279 ? -5.033  16.505  140.103 1.00 31.03  ? 280  LEU B N   1 
ATOM   4791  C CA  . LEU B 1 279 ? -3.968  15.556  140.434 1.00 34.52  ? 280  LEU B CA  1 
ATOM   4792  C C   . LEU B 1 279 ? -4.286  14.499  141.506 1.00 49.25  ? 280  LEU B C   1 
ATOM   4793  O O   . LEU B 1 279 ? -3.396  13.743  141.906 1.00 60.05  ? 280  LEU B O   1 
ATOM   4794  C CB  . LEU B 1 279 ? -2.668  16.306  140.762 1.00 34.47  ? 280  LEU B CB  1 
ATOM   4795  C CG  . LEU B 1 279 ? -2.163  17.229  139.644 1.00 31.32  ? 280  LEU B CG  1 
ATOM   4796  C CD1 . LEU B 1 279 ? -0.891  17.966  140.051 1.00 22.79  ? 280  LEU B CD1 1 
ATOM   4797  C CD2 . LEU B 1 279 ? -1.949  16.449  138.353 1.00 17.37  ? 280  LEU B CD2 1 
ATOM   4798  N N   . ALA B 1 280 ? -5.536  14.453  141.963 1.00 39.72  ? 281  ALA B N   1 
ATOM   4799  C CA  . ALA B 1 280 ? -5.944  13.544  143.040 1.00 41.10  ? 281  ALA B CA  1 
ATOM   4800  C C   . ALA B 1 280 ? -5.467  12.088  142.911 1.00 45.09  ? 281  ALA B C   1 
ATOM   4801  O O   . ALA B 1 280 ? -4.945  11.503  143.873 1.00 54.23  ? 281  ALA B O   1 
ATOM   4802  C CB  . ALA B 1 280 ? -7.446  13.582  143.183 1.00 51.33  ? 281  ALA B CB  1 
ATOM   4803  N N   . ASN B 1 281 ? -5.661  11.507  141.730 1.00 35.50  ? 282  ASN B N   1 
ATOM   4804  C CA  . ASN B 1 281 ? -5.199  10.147  141.459 1.00 30.41  ? 282  ASN B CA  1 
ATOM   4805  C C   . ASN B 1 281 ? -3.708  9.989   141.718 1.00 40.62  ? 282  ASN B C   1 
ATOM   4806  O O   . ASN B 1 281 ? -3.271  9.015   142.329 1.00 47.11  ? 282  ASN B O   1 
ATOM   4807  C CB  . ASN B 1 281 ? -5.510  9.738   140.016 1.00 37.76  ? 282  ASN B CB  1 
ATOM   4808  C CG  . ASN B 1 281 ? -6.953  9.328   139.819 1.00 50.57  ? 282  ASN B CG  1 
ATOM   4809  O OD1 . ASN B 1 281 ? -7.555  8.685   140.679 1.00 58.35  ? 282  ASN B OD1 1 
ATOM   4810  N ND2 . ASN B 1 281 ? -7.515  9.694   138.673 1.00 53.29  ? 282  ASN B ND2 1 
ATOM   4811  N N   . GLN B 1 282 ? -2.934  10.958  141.242 1.00 36.07  ? 283  GLN B N   1 
ATOM   4812  C CA  . GLN B 1 282 ? -1.497  10.982  141.466 1.00 21.11  ? 283  GLN B CA  1 
ATOM   4813  C C   . GLN B 1 282 ? -1.193  11.152  142.948 1.00 19.06  ? 283  GLN B C   1 
ATOM   4814  O O   . GLN B 1 282 ? -0.188  10.647  143.445 1.00 48.78  ? 283  GLN B O   1 
ATOM   4815  C CB  . GLN B 1 282 ? -0.849  12.119  140.671 1.00 27.82  ? 283  GLN B CB  1 
ATOM   4816  C CG  . GLN B 1 282 ? -0.941  11.972  139.152 1.00 44.14  ? 283  GLN B CG  1 
ATOM   4817  C CD  . GLN B 1 282 ? -2.286  12.406  138.586 1.00 48.41  ? 283  GLN B CD  1 
ATOM   4818  O OE1 . GLN B 1 282 ? -3.260  12.562  139.320 1.00 50.25  ? 283  GLN B OE1 1 
ATOM   4819  N NE2 . GLN B 1 282 ? -2.340  12.606  137.272 1.00 31.63  ? 283  GLN B NE2 1 
ATOM   4820  N N   . ALA B 1 283 ? -2.070  11.863  143.647 1.00 14.23  ? 284  ALA B N   1 
ATOM   4821  C CA  . ALA B 1 283 ? -1.892  12.129  145.068 1.00 24.31  ? 284  ALA B CA  1 
ATOM   4822  C C   . ALA B 1 283 ? -2.175  10.887  145.898 1.00 35.56  ? 284  ALA B C   1 
ATOM   4823  O O   . ALA B 1 283 ? -1.796  10.812  147.068 1.00 44.06  ? 284  ALA B O   1 
ATOM   4824  C CB  . ALA B 1 283 ? -2.784  13.280  145.508 1.00 32.78  ? 284  ALA B CB  1 
ATOM   4825  N N   . ASP B 1 284 ? -2.849  9.912   145.294 1.00 51.28  ? 285  ASP B N   1 
ATOM   4826  C CA  . ASP B 1 284 ? -3.089  8.635   145.972 1.00 54.86  ? 285  ASP B CA  1 
ATOM   4827  C C   . ASP B 1 284 ? -1.816  7.815   146.227 1.00 50.55  ? 285  ASP B C   1 
ATOM   4828  O O   . ASP B 1 284 ? -1.790  6.960   147.113 1.00 42.03  ? 285  ASP B O   1 
ATOM   4829  C CB  . ASP B 1 284 ? -4.112  7.795   145.205 1.00 64.60  ? 285  ASP B CB  1 
ATOM   4830  C CG  . ASP B 1 284 ? -5.525  8.299   145.388 1.00 69.52  ? 285  ASP B CG  1 
ATOM   4831  O OD1 . ASP B 1 284 ? -5.794  8.937   146.428 1.00 45.67  ? 285  ASP B OD1 1 
ATOM   4832  O OD2 . ASP B 1 284 ? -6.366  8.057   144.496 1.00 87.22  ? 285  ASP B OD2 1 
ATOM   4833  N N   . LEU B 1 285 ? -0.766  8.085   145.457 1.00 58.84  ? 286  LEU B N   1 
ATOM   4834  C CA  . LEU B 1 285 ? 0.494   7.345   145.563 1.00 42.42  ? 286  LEU B CA  1 
ATOM   4835  C C   . LEU B 1 285 ? 1.260   7.620   146.859 1.00 32.94  ? 286  LEU B C   1 
ATOM   4836  O O   . LEU B 1 285 ? 2.193   6.890   147.200 1.00 31.65  ? 286  LEU B O   1 
ATOM   4837  C CB  . LEU B 1 285 ? 1.397   7.665   144.368 1.00 29.02  ? 286  LEU B CB  1 
ATOM   4838  C CG  . LEU B 1 285 ? 0.966   7.144   142.996 1.00 34.99  ? 286  LEU B CG  1 
ATOM   4839  C CD1 . LEU B 1 285 ? 1.622   7.953   141.893 1.00 16.95  ? 286  LEU B CD1 1 
ATOM   4840  C CD2 . LEU B 1 285 ? 1.316   5.671   142.855 1.00 24.92  ? 286  LEU B CD2 1 
ATOM   4841  N N   . ASP B 1 286 ? 0.846   8.662   147.575 1.00 34.74  ? 287  ASP B N   1 
ATOM   4842  C CA  . ASP B 1 286 ? 1.583   9.187   148.726 1.00 29.56  ? 287  ASP B CA  1 
ATOM   4843  C C   . ASP B 1 286 ? 1.987   8.136   149.764 1.00 27.99  ? 287  ASP B C   1 
ATOM   4844  O O   . ASP B 1 286 ? 3.167   8.010   150.097 1.00 46.90  ? 287  ASP B O   1 
ATOM   4845  C CB  . ASP B 1 286 ? 0.768   10.294  149.405 1.00 38.08  ? 287  ASP B CB  1 
ATOM   4846  C CG  . ASP B 1 286 ? 1.555   11.036  150.469 1.00 51.73  ? 287  ASP B CG  1 
ATOM   4847  O OD1 . ASP B 1 286 ? 2.712   11.422  150.201 1.00 61.37  ? 287  ASP B OD1 1 
ATOM   4848  O OD2 . ASP B 1 286 ? 1.014   11.232  151.578 1.00 53.05  ? 287  ASP B OD2 1 
ATOM   4849  N N   . ALA B 1 287 ? 1.011   7.379   150.257 1.00 41.42  ? 288  ALA B N   1 
ATOM   4850  C CA  . ALA B 1 287 ? 1.242   6.421   151.339 1.00 45.35  ? 288  ALA B CA  1 
ATOM   4851  C C   . ALA B 1 287 ? 2.289   5.364   150.996 1.00 48.35  ? 288  ALA B C   1 
ATOM   4852  O O   . ALA B 1 287 ? 3.275   5.192   151.720 1.00 56.17  ? 288  ALA B O   1 
ATOM   4853  C CB  . ALA B 1 287 ? -0.063  5.756   151.746 1.00 27.70  ? 288  ALA B CB  1 
ATOM   4854  N N   . GLU B 1 288 ? 2.070   4.658   149.893 1.00 34.19  ? 289  GLU B N   1 
ATOM   4855  C CA  . GLU B 1 288 ? 2.978   3.597   149.475 1.00 44.34  ? 289  GLU B CA  1 
ATOM   4856  C C   . GLU B 1 288 ? 4.330   4.128   149.000 1.00 44.96  ? 289  GLU B C   1 
ATOM   4857  O O   . GLU B 1 288 ? 5.351   3.449   149.127 1.00 56.15  ? 289  GLU B O   1 
ATOM   4858  C CB  . GLU B 1 288 ? 2.328   2.721   148.402 1.00 54.56  ? 289  GLU B CB  1 
ATOM   4859  C CG  . GLU B 1 288 ? 1.151   1.911   148.918 1.00 49.82  ? 289  GLU B CG  1 
ATOM   4860  C CD  . GLU B 1 288 ? 1.518   1.049   150.113 1.00 53.13  ? 289  GLU B CD  1 
ATOM   4861  O OE1 . GLU B 1 288 ? 2.664   0.552   150.166 1.00 76.20  ? 289  GLU B OE1 1 
ATOM   4862  O OE2 . GLU B 1 288 ? 0.660   0.873   151.003 1.00 37.09  ? 289  GLU B OE2 1 
ATOM   4863  N N   . TRP B 1 289 ? 4.334   5.340   148.453 1.00 42.64  ? 290  TRP B N   1 
ATOM   4864  C CA  . TRP B 1 289 ? 5.582   6.000   148.086 1.00 44.55  ? 290  TRP B CA  1 
ATOM   4865  C C   . TRP B 1 289 ? 6.428   6.214   149.338 1.00 46.38  ? 290  TRP B C   1 
ATOM   4866  O O   . TRP B 1 289 ? 7.620   5.883   149.368 1.00 50.08  ? 290  TRP B O   1 
ATOM   4867  C CB  . TRP B 1 289 ? 5.300   7.336   147.395 1.00 31.37  ? 290  TRP B CB  1 
ATOM   4868  C CG  . TRP B 1 289 ? 6.532   8.091   146.997 1.00 38.27  ? 290  TRP B CG  1 
ATOM   4869  C CD1 . TRP B 1 289 ? 7.125   9.111   147.683 1.00 43.29  ? 290  TRP B CD1 1 
ATOM   4870  C CD2 . TRP B 1 289 ? 7.324   7.889   145.819 1.00 29.97  ? 290  TRP B CD2 1 
ATOM   4871  N NE1 . TRP B 1 289 ? 8.236   9.555   147.006 1.00 42.27  ? 290  TRP B NE1 1 
ATOM   4872  C CE2 . TRP B 1 289 ? 8.379   8.820   145.858 1.00 35.29  ? 290  TRP B CE2 1 
ATOM   4873  C CE3 . TRP B 1 289 ? 7.241   7.008   144.735 1.00 33.82  ? 290  TRP B CE3 1 
ATOM   4874  C CZ2 . TRP B 1 289 ? 9.345   8.897   144.858 1.00 40.95  ? 290  TRP B CZ2 1 
ATOM   4875  C CZ3 . TRP B 1 289 ? 8.202   7.088   143.742 1.00 41.89  ? 290  TRP B CZ3 1 
ATOM   4876  C CH2 . TRP B 1 289 ? 9.239   8.025   143.811 1.00 41.84  ? 290  TRP B CH2 1 
ATOM   4877  N N   . ARG B 1 290 ? 5.795   6.757   150.374 1.00 35.60  ? 291  ARG B N   1 
ATOM   4878  C CA  . ARG B 1 290 ? 6.461   6.970   151.653 1.00 39.58  ? 291  ARG B CA  1 
ATOM   4879  C C   . ARG B 1 290 ? 6.914   5.654   152.280 1.00 40.27  ? 291  ARG B C   1 
ATOM   4880  O O   . ARG B 1 290 ? 7.960   5.597   152.925 1.00 46.87  ? 291  ARG B O   1 
ATOM   4881  C CB  . ARG B 1 290 ? 5.549   7.732   152.616 1.00 38.33  ? 291  ARG B CB  1 
ATOM   4882  C CG  . ARG B 1 290 ? 5.277   9.167   152.198 1.00 40.51  ? 291  ARG B CG  1 
ATOM   4883  C CD  . ARG B 1 290 ? 4.281   9.838   153.128 1.00 37.96  ? 291  ARG B CD  1 
ATOM   4884  N NE  . ARG B 1 290 ? 4.047   11.229  152.756 1.00 46.41  ? 291  ARG B NE  1 
ATOM   4885  C CZ  . ARG B 1 290 ? 4.687   12.263  153.292 1.00 53.09  ? 291  ARG B CZ  1 
ATOM   4886  N NH1 . ARG B 1 290 ? 5.600   12.064  154.232 1.00 65.24  ? 291  ARG B NH1 1 
ATOM   4887  N NH2 . ARG B 1 290 ? 4.411   13.496  152.891 1.00 58.36  ? 291  ARG B NH2 1 
ATOM   4888  N N   . ASN B 1 291 ? 6.127   4.599   152.090 1.00 38.10  ? 292  ASN B N   1 
ATOM   4889  C CA  . ASN B 1 291 ? 6.499   3.280   152.598 1.00 46.67  ? 292  ASN B CA  1 
ATOM   4890  C C   . ASN B 1 291 ? 7.759   2.741   151.924 1.00 43.95  ? 292  ASN B C   1 
ATOM   4891  O O   . ASN B 1 291 ? 8.686   2.263   152.590 1.00 43.32  ? 292  ASN B O   1 
ATOM   4892  C CB  . ASN B 1 291 ? 5.342   2.293   152.432 1.00 47.60  ? 292  ASN B CB  1 
ATOM   4893  C CG  . ASN B 1 291 ? 4.222   2.538   153.422 1.00 50.64  ? 292  ASN B CG  1 
ATOM   4894  O OD1 . ASN B 1 291 ? 4.461   2.972   154.550 1.00 33.11  ? 292  ASN B OD1 1 
ATOM   4895  N ND2 . ASN B 1 291 ? 2.991   2.260   153.007 1.00 43.13  ? 292  ASN B ND2 1 
ATOM   4896  N N   . LEU B 1 292 ? 7.783   2.830   150.598 1.00 36.99  ? 293  LEU B N   1 
ATOM   4897  C CA  . LEU B 1 292 ? 8.935   2.402   149.816 1.00 27.68  ? 293  LEU B CA  1 
ATOM   4898  C C   . LEU B 1 292 ? 10.186  3.181   150.203 1.00 42.96  ? 293  LEU B C   1 
ATOM   4899  O O   . LEU B 1 292 ? 11.245  2.597   150.438 1.00 51.37  ? 293  LEU B O   1 
ATOM   4900  C CB  . LEU B 1 292 ? 8.664   2.577   148.322 1.00 27.77  ? 293  LEU B CB  1 
ATOM   4901  C CG  . LEU B 1 292 ? 9.831   2.161   147.429 1.00 33.09  ? 293  LEU B CG  1 
ATOM   4902  C CD1 . LEU B 1 292 ? 10.134  0.699   147.657 1.00 32.09  ? 293  LEU B CD1 1 
ATOM   4903  C CD2 . LEU B 1 292 ? 9.541   2.426   145.963 1.00 33.58  ? 293  LEU B CD2 1 
ATOM   4904  N N   . LEU B 1 293 ? 10.059  4.503   150.267 1.00 42.50  ? 294  LEU B N   1 
ATOM   4905  C CA  . LEU B 1 293 ? 11.191  5.349   150.634 1.00 29.55  ? 294  LEU B CA  1 
ATOM   4906  C C   . LEU B 1 293 ? 11.700  5.040   152.042 1.00 30.35  ? 294  LEU B C   1 
ATOM   4907  O O   . LEU B 1 293 ? 12.910  4.941   152.266 1.00 50.51  ? 294  LEU B O   1 
ATOM   4908  C CB  . LEU B 1 293 ? 10.828  6.829   150.501 1.00 22.79  ? 294  LEU B CB  1 
ATOM   4909  C CG  . LEU B 1 293 ? 11.244  7.527   149.203 1.00 24.00  ? 294  LEU B CG  1 
ATOM   4910  C CD1 . LEU B 1 293 ? 10.702  6.802   147.981 1.00 20.10  ? 294  LEU B CD1 1 
ATOM   4911  C CD2 . LEU B 1 293 ? 10.789  8.979   149.208 1.00 28.94  ? 294  LEU B CD2 1 
ATOM   4912  N N   . ASP B 1 294 ? 10.773  4.876   152.982 1.00 26.70  ? 295  ASP B N   1 
ATOM   4913  C CA  . ASP B 1 294 ? 11.132  4.546   154.359 1.00 35.33  ? 295  ASP B CA  1 
ATOM   4914  C C   . ASP B 1 294 ? 11.877  3.221   154.442 1.00 34.76  ? 295  ASP B C   1 
ATOM   4915  O O   . ASP B 1 294 ? 12.833  3.085   155.208 1.00 45.55  ? 295  ASP B O   1 
ATOM   4916  C CB  . ASP B 1 294 ? 9.894   4.501   155.257 1.00 43.85  ? 295  ASP B CB  1 
ATOM   4917  C CG  . ASP B 1 294 ? 9.401   5.881   155.646 1.00 64.73  ? 295  ASP B CG  1 
ATOM   4918  O OD1 . ASP B 1 294 ? 10.163  6.859   155.481 1.00 60.50  ? 295  ASP B OD1 1 
ATOM   4919  O OD2 . ASP B 1 294 ? 8.252   5.987   156.126 1.00 77.59  ? 295  ASP B OD2 1 
ATOM   4920  N N   . SER B 1 295 ? 11.440  2.247   153.648 1.00 35.47  ? 296  SER B N   1 
ATOM   4921  C CA  . SER B 1 295 ? 12.091  0.942   153.643 1.00 30.39  ? 296  SER B CA  1 
ATOM   4922  C C   . SER B 1 295 ? 13.484  1.017   153.017 1.00 45.66  ? 296  SER B C   1 
ATOM   4923  O O   . SER B 1 295 ? 14.426  0.393   153.508 1.00 50.87  ? 296  SER B O   1 
ATOM   4924  C CB  . SER B 1 295 ? 11.230  -0.097  152.922 1.00 32.33  ? 296  SER B CB  1 
ATOM   4925  O OG  . SER B 1 295 ? 11.183  0.155   151.529 1.00 52.89  ? 296  SER B OG  1 
ATOM   4926  N N   . MET B 1 296 ? 13.612  1.788   151.939 1.00 45.30  ? 297  MET B N   1 
ATOM   4927  C CA  . MET B 1 296 ? 14.901  1.952   151.270 1.00 36.05  ? 297  MET B CA  1 
ATOM   4928  C C   . MET B 1 296 ? 15.912  2.669   152.156 1.00 44.29  ? 297  MET B C   1 
ATOM   4929  O O   . MET B 1 296 ? 17.102  2.358   152.126 1.00 52.43  ? 297  MET B O   1 
ATOM   4930  C CB  . MET B 1 296 ? 14.744  2.708   149.951 1.00 30.20  ? 297  MET B CB  1 
ATOM   4931  C CG  . MET B 1 296 ? 13.993  1.946   148.881 1.00 27.81  ? 297  MET B CG  1 
ATOM   4932  S SD  . MET B 1 296 ? 14.171  2.709   147.259 1.00 55.71  ? 297  MET B SD  1 
ATOM   4933  C CE  . MET B 1 296 ? 13.637  4.382   147.613 1.00 146.93 ? 297  MET B CE  1 
ATOM   4934  N N   . VAL B 1 297 ? 15.443  3.638   152.933 1.00 40.45  ? 298  VAL B N   1 
ATOM   4935  C CA  . VAL B 1 297 ? 16.312  4.305   153.893 1.00 39.09  ? 298  VAL B CA  1 
ATOM   4936  C C   . VAL B 1 297 ? 16.666  3.339   155.020 1.00 39.24  ? 298  VAL B C   1 
ATOM   4937  O O   . VAL B 1 297 ? 17.795  3.327   155.517 1.00 34.25  ? 298  VAL B O   1 
ATOM   4938  C CB  . VAL B 1 297 ? 15.654  5.581   154.467 1.00 39.51  ? 298  VAL B CB  1 
ATOM   4939  C CG1 . VAL B 1 297 ? 16.457  6.130   155.641 1.00 21.77  ? 298  VAL B CG1 1 
ATOM   4940  C CG2 . VAL B 1 297 ? 15.511  6.633   153.380 1.00 47.77  ? 298  VAL B CG2 1 
ATOM   4941  N N   . LEU B 1 298 ? 15.699  2.509   155.399 1.00 28.00  ? 299  LEU B N   1 
ATOM   4942  C CA  . LEU B 1 298 ? 15.876  1.584   156.514 1.00 31.83  ? 299  LEU B CA  1 
ATOM   4943  C C   . LEU B 1 298 ? 16.874  0.462   156.216 1.00 42.16  ? 299  LEU B C   1 
ATOM   4944  O O   . LEU B 1 298 ? 17.580  -0.002  157.114 1.00 45.31  ? 299  LEU B O   1 
ATOM   4945  C CB  . LEU B 1 298 ? 14.530  0.984   156.918 1.00 46.12  ? 299  LEU B CB  1 
ATOM   4946  C CG  . LEU B 1 298 ? 14.456  0.397   158.325 1.00 59.57  ? 299  LEU B CG  1 
ATOM   4947  C CD1 . LEU B 1 298 ? 14.617  1.503   159.351 1.00 62.26  ? 299  LEU B CD1 1 
ATOM   4948  C CD2 . LEU B 1 298 ? 13.146  -0.342  158.524 1.00 79.08  ? 299  LEU B CD2 1 
ATOM   4949  N N   . ILE B 1 299 ? 16.928  0.032   154.958 1.00 38.78  ? 300  ILE B N   1 
ATOM   4950  C CA  . ILE B 1 299 ? 17.777  -1.090  154.563 1.00 28.82  ? 300  ILE B CA  1 
ATOM   4951  C C   . ILE B 1 299 ? 19.264  -0.724  154.595 1.00 48.27  ? 300  ILE B C   1 
ATOM   4952  O O   . ILE B 1 299 ? 20.125  -1.602  154.637 1.00 57.09  ? 300  ILE B O   1 
ATOM   4953  C CB  . ILE B 1 299 ? 17.389  -1.630  153.161 1.00 18.46  ? 300  ILE B CB  1 
ATOM   4954  C CG1 . ILE B 1 299 ? 17.886  -3.063  152.967 1.00 22.20  ? 300  ILE B CG1 1 
ATOM   4955  C CG2 . ILE B 1 299 ? 17.921  -0.724  152.069 1.00 24.11  ? 300  ILE B CG2 1 
ATOM   4956  C CD1 . ILE B 1 299 ? 17.434  -4.004  154.046 1.00 25.17  ? 300  ILE B CD1 1 
ATOM   4957  N N   . THR B 1 300 ? 19.561  0.573   154.590 1.00 50.11  ? 301  THR B N   1 
ATOM   4958  C CA  . THR B 1 300 ? 20.947  1.039   154.598 1.00 42.03  ? 301  THR B CA  1 
ATOM   4959  C C   . THR B 1 300 ? 21.626  0.778   155.941 1.00 46.38  ? 301  THR B C   1 
ATOM   4960  O O   . THR B 1 300 ? 22.853  0.815   156.040 1.00 50.93  ? 301  THR B O   1 
ATOM   4961  C CB  . THR B 1 300 ? 21.060  2.536   154.250 1.00 37.93  ? 301  THR B CB  1 
ATOM   4962  O OG1 . THR B 1 300 ? 20.355  3.312   155.227 1.00 49.26  ? 301  THR B OG1 1 
ATOM   4963  C CG2 . THR B 1 300 ? 20.486  2.813   152.866 1.00 28.36  ? 301  THR B CG2 1 
ATOM   4964  N N   . ASP B 1 301 ? 20.823  0.516   156.969 1.00 35.33  ? 302  ASP B N   1 
ATOM   4965  C CA  . ASP B 1 301 ? 21.339  0.108   158.274 1.00 42.35  ? 302  ASP B CA  1 
ATOM   4966  C C   . ASP B 1 301 ? 22.192  -1.151  158.156 1.00 49.81  ? 302  ASP B C   1 
ATOM   4967  O O   . ASP B 1 301 ? 23.112  -1.369  158.945 1.00 52.19  ? 302  ASP B O   1 
ATOM   4968  C CB  . ASP B 1 301 ? 20.186  -0.155  159.242 1.00 52.32  ? 302  ASP B CB  1 
ATOM   4969  C CG  . ASP B 1 301 ? 19.479  1.112   159.664 1.00 80.59  ? 302  ASP B CG  1 
ATOM   4970  O OD1 . ASP B 1 301 ? 19.647  2.139   158.974 1.00 92.61  ? 302  ASP B OD1 1 
ATOM   4971  O OD2 . ASP B 1 301 ? 18.757  1.081   160.683 1.00 90.72  ? 302  ASP B OD2 1 
ATOM   4972  N N   . LYS B 1 302 ? 21.872  -1.977  157.165 1.00 37.58  ? 303  LYS B N   1 
ATOM   4973  C CA  . LYS B 1 302 ? 22.587  -3.225  156.934 1.00 36.70  ? 303  LYS B CA  1 
ATOM   4974  C C   . LYS B 1 302 ? 23.858  -3.033  156.101 1.00 49.53  ? 303  LYS B C   1 
ATOM   4975  O O   . LYS B 1 302 ? 24.603  -3.987  155.875 1.00 56.90  ? 303  LYS B O   1 
ATOM   4976  C CB  . LYS B 1 302 ? 21.667  -4.238  156.247 1.00 43.81  ? 303  LYS B CB  1 
ATOM   4977  C CG  . LYS B 1 302 ? 20.346  -4.462  156.962 1.00 41.07  ? 303  LYS B CG  1 
ATOM   4978  C CD  . LYS B 1 302 ? 20.573  -4.953  158.379 1.00 41.50  ? 303  LYS B CD  1 
ATOM   4979  C CE  . LYS B 1 302 ? 19.254  -5.225  159.081 1.00 53.97  ? 303  LYS B CE  1 
ATOM   4980  N NZ  . LYS B 1 302 ? 19.451  -5.685  160.483 1.00 59.98  ? 303  LYS B NZ  1 
ATOM   4981  N N   . PHE B 1 303 ? 24.101  -1.808  155.636 1.00 56.10  ? 304  PHE B N   1 
ATOM   4982  C CA  . PHE B 1 303 ? 25.316  -1.523  154.872 1.00 45.54  ? 304  PHE B CA  1 
ATOM   4983  C C   . PHE B 1 303 ? 26.522  -1.466  155.799 1.00 44.68  ? 304  PHE B C   1 
ATOM   4984  O O   . PHE B 1 303 ? 27.659  -1.659  155.370 1.00 48.04  ? 304  PHE B O   1 
ATOM   4985  C CB  . PHE B 1 303 ? 25.201  -0.192  154.122 1.00 47.86  ? 304  PHE B CB  1 
ATOM   4986  C CG  . PHE B 1 303 ? 24.251  -0.222  152.953 1.00 49.55  ? 304  PHE B CG  1 
ATOM   4987  C CD1 . PHE B 1 303 ? 23.643  -1.402  152.559 1.00 50.33  ? 304  PHE B CD1 1 
ATOM   4988  C CD2 . PHE B 1 303 ? 23.977  0.936   152.242 1.00 36.27  ? 304  PHE B CD2 1 
ATOM   4989  C CE1 . PHE B 1 303 ? 22.770  -1.425  151.483 1.00 43.54  ? 304  PHE B CE1 1 
ATOM   4990  C CE2 . PHE B 1 303 ? 23.109  0.921   151.167 1.00 39.73  ? 304  PHE B CE2 1 
ATOM   4991  C CZ  . PHE B 1 303 ? 22.504  -0.262  150.786 1.00 45.65  ? 304  PHE B CZ  1 
ATOM   4992  N N   . TRP B 1 304 ? 26.262  -1.188  157.072 1.00 44.75  ? 305  TRP B N   1 
ATOM   4993  C CA  . TRP B 1 304 ? 27.322  -1.027  158.058 1.00 41.63  ? 305  TRP B CA  1 
ATOM   4994  C C   . TRP B 1 304 ? 27.412  -2.236  158.983 1.00 60.73  ? 305  TRP B C   1 
ATOM   4995  O O   . TRP B 1 304 ? 26.639  -3.184  158.857 1.00 75.75  ? 305  TRP B O   1 
ATOM   4996  C CB  . TRP B 1 304 ? 27.091  0.253   158.859 1.00 28.81  ? 305  TRP B CB  1 
ATOM   4997  C CG  . TRP B 1 304 ? 26.440  1.319   158.038 1.00 54.61  ? 305  TRP B CG  1 
ATOM   4998  C CD1 . TRP B 1 304 ? 25.188  1.836   158.208 1.00 50.41  ? 305  TRP B CD1 1 
ATOM   4999  C CD2 . TRP B 1 304 ? 26.990  1.976   156.890 1.00 58.99  ? 305  TRP B CD2 1 
ATOM   5000  N NE1 . TRP B 1 304 ? 24.932  2.785   157.249 1.00 48.93  ? 305  TRP B NE1 1 
ATOM   5001  C CE2 . TRP B 1 304 ? 26.025  2.889   156.425 1.00 54.16  ? 305  TRP B CE2 1 
ATOM   5002  C CE3 . TRP B 1 304 ? 28.213  1.884   156.213 1.00 51.22  ? 305  TRP B CE3 1 
ATOM   5003  C CZ2 . TRP B 1 304 ? 26.239  3.707   155.318 1.00 53.76  ? 305  TRP B CZ2 1 
ATOM   5004  C CZ3 . TRP B 1 304 ? 28.424  2.697   155.113 1.00 47.80  ? 305  TRP B CZ3 1 
ATOM   5005  C CH2 . TRP B 1 304 ? 27.443  3.595   154.677 1.00 51.41  ? 305  TRP B CH2 1 
ATOM   5006  N N   . GLY B 1 305 ? 28.356  -2.192  159.917 1.00 64.06  ? 306  GLY B N   1 
ATOM   5007  C CA  . GLY B 1 305 ? 28.617  -3.321  160.789 1.00 66.33  ? 306  GLY B CA  1 
ATOM   5008  C C   . GLY B 1 305 ? 29.527  -4.318  160.102 1.00 74.96  ? 306  GLY B C   1 
ATOM   5009  O O   . GLY B 1 305 ? 29.873  -4.144  158.932 1.00 58.11  ? 306  GLY B O   1 
ATOM   5010  N N   . THR B 1 306 ? 29.914  -5.366  160.823 1.00 91.74  ? 307  THR B N   1 
ATOM   5011  C CA  . THR B 1 306 ? 30.816  -6.375  160.278 1.00 89.79  ? 307  THR B CA  1 
ATOM   5012  C C   . THR B 1 306 ? 30.064  -7.373  159.400 1.00 81.51  ? 307  THR B C   1 
ATOM   5013  O O   . THR B 1 306 ? 30.671  -8.124  158.638 1.00 60.17  ? 307  THR B O   1 
ATOM   5014  C CB  . THR B 1 306 ? 31.573  -7.125  161.391 1.00 81.40  ? 307  THR B CB  1 
ATOM   5015  O OG1 . THR B 1 306 ? 32.650  -7.876  160.818 1.00 74.28  ? 307  THR B OG1 1 
ATOM   5016  C CG2 . THR B 1 306 ? 30.639  -8.065  162.138 1.00 74.36  ? 307  THR B CG2 1 
ATOM   5017  N N   . SER B 1 307 ? 28.740  -7.375  159.519 1.00 89.67  ? 308  SER B N   1 
ATOM   5018  C CA  . SER B 1 307 ? 27.884  -8.168  158.645 1.00 87.79  ? 308  SER B CA  1 
ATOM   5019  C C   . SER B 1 307 ? 27.440  -7.305  157.468 1.00 72.47  ? 308  SER B C   1 
ATOM   5020  O O   . SER B 1 307 ? 26.629  -7.721  156.639 1.00 61.74  ? 308  SER B O   1 
ATOM   5021  C CB  . SER B 1 307 ? 26.670  -8.698  159.413 1.00 95.77  ? 308  SER B CB  1 
ATOM   5022  O OG  . SER B 1 307 ? 27.065  -9.580  160.452 1.00 103.88 ? 308  SER B OG  1 
ATOM   5023  N N   . GLY B 1 308 ? 27.980  -6.091  157.416 1.00 63.28  ? 309  GLY B N   1 
ATOM   5024  C CA  . GLY B 1 308 ? 27.620  -5.119  156.401 1.00 53.52  ? 309  GLY B CA  1 
ATOM   5025  C C   . GLY B 1 308 ? 27.903  -5.532  154.970 1.00 51.87  ? 309  GLY B C   1 
ATOM   5026  O O   . GLY B 1 308 ? 28.775  -6.366  154.702 1.00 70.28  ? 309  GLY B O   1 
ATOM   5027  N N   . VAL B 1 309 ? 27.156  -4.926  154.051 1.00 44.17  ? 310  VAL B N   1 
ATOM   5028  C CA  . VAL B 1 309 ? 27.273  -5.191  152.622 1.00 51.42  ? 310  VAL B CA  1 
ATOM   5029  C C   . VAL B 1 309 ? 28.693  -4.967  152.116 1.00 48.57  ? 310  VAL B C   1 
ATOM   5030  O O   . VAL B 1 309 ? 29.285  -5.851  151.491 1.00 57.75  ? 310  VAL B O   1 
ATOM   5031  C CB  . VAL B 1 309 ? 26.294  -4.297  151.821 1.00 56.75  ? 310  VAL B CB  1 
ATOM   5032  C CG1 . VAL B 1 309 ? 26.623  -4.322  150.334 1.00 56.34  ? 310  VAL B CG1 1 
ATOM   5033  C CG2 . VAL B 1 309 ? 24.855  -4.728  152.073 1.00 41.69  ? 310  VAL B CG2 1 
ATOM   5034  N N   . GLU B 1 310 ? 29.231  -3.785  152.399 1.00 53.26  ? 311  GLU B N   1 
ATOM   5035  C CA  . GLU B 1 310 ? 30.582  -3.422  151.984 1.00 59.00  ? 311  GLU B CA  1 
ATOM   5036  C C   . GLU B 1 310 ? 31.597  -4.437  152.502 1.00 59.78  ? 311  GLU B C   1 
ATOM   5037  O O   . GLU B 1 310 ? 32.382  -5.000  151.727 1.00 71.16  ? 311  GLU B O   1 
ATOM   5038  C CB  . GLU B 1 310 ? 30.925  -2.018  152.488 1.00 54.41  ? 311  GLU B CB  1 
ATOM   5039  C CG  . GLU B 1 310 ? 31.942  -1.276  151.636 1.00 59.38  ? 311  GLU B CG  1 
ATOM   5040  C CD  . GLU B 1 310 ? 32.102  0.176   152.048 1.00 68.02  ? 311  GLU B CD  1 
ATOM   5041  O OE1 . GLU B 1 310 ? 32.109  0.457   153.266 1.00 69.07  ? 311  GLU B OE1 1 
ATOM   5042  O OE2 . GLU B 1 310 ? 32.216  1.037   151.151 1.00 68.30  ? 311  GLU B OE2 1 
ATOM   5043  N N   . SER B 1 311 ? 31.555  -4.671  153.813 1.00 53.06  ? 312  SER B N   1 
ATOM   5044  C CA  . SER B 1 311 ? 32.413  -5.648  154.480 1.00 46.52  ? 312  SER B CA  1 
ATOM   5045  C C   . SER B 1 311 ? 32.411  -6.998  153.779 1.00 54.10  ? 312  SER B C   1 
ATOM   5046  O O   . SER B 1 311 ? 33.447  -7.447  153.299 1.00 62.40  ? 312  SER B O   1 
ATOM   5047  C CB  . SER B 1 311 ? 31.992  -5.833  155.939 1.00 46.50  ? 312  SER B CB  1 
ATOM   5048  O OG  . SER B 1 311 ? 31.979  -4.594  156.624 1.00 69.22  ? 312  SER B OG  1 
ATOM   5049  N N   . VAL B 1 312 ? 31.244  -7.637  153.729 1.00 45.25  ? 313  VAL B N   1 
ATOM   5050  C CA  . VAL B 1 312 ? 31.117  -8.982  153.168 1.00 46.30  ? 313  VAL B CA  1 
ATOM   5051  C C   . VAL B 1 312 ? 31.496  -9.077  151.691 1.00 48.85  ? 313  VAL B C   1 
ATOM   5052  O O   . VAL B 1 312 ? 32.367  -9.880  151.304 1.00 61.72  ? 313  VAL B O   1 
ATOM   5053  C CB  . VAL B 1 312 ? 29.685  -9.514  153.335 1.00 45.79  ? 313  VAL B CB  1 
ATOM   5054  C CG1 . VAL B 1 312 ? 29.547  -10.873 152.670 1.00 39.18  ? 313  VAL B CG1 1 
ATOM   5055  C CG2 . VAL B 1 312 ? 29.324  -9.590  154.810 1.00 49.87  ? 313  VAL B CG2 1 
ATOM   5056  N N   . ILE B 1 313 ? 30.842  -8.254  150.872 1.00 36.34  ? 314  ILE B N   1 
ATOM   5057  C CA  . ILE B 1 313 ? 31.039  -8.295  149.427 1.00 40.50  ? 314  ILE B CA  1 
ATOM   5058  C C   . ILE B 1 313 ? 32.481  -7.940  149.069 1.00 63.50  ? 314  ILE B C   1 
ATOM   5059  O O   . ILE B 1 313 ? 32.978  -8.312  148.005 1.00 78.54  ? 314  ILE B O   1 
ATOM   5060  C CB  . ILE B 1 313 ? 30.024  -7.389  148.685 1.00 41.99  ? 314  ILE B CB  1 
ATOM   5061  C CG1 . ILE B 1 313 ? 28.596  -7.761  149.089 1.00 49.72  ? 314  ILE B CG1 1 
ATOM   5062  C CG2 . ILE B 1 313 ? 30.166  -7.521  147.175 1.00 46.04  ? 314  ILE B CG2 1 
ATOM   5063  C CD1 . ILE B 1 313 ? 27.524  -7.096  148.251 1.00 46.07  ? 314  ILE B CD1 1 
ATOM   5064  N N   . GLY B 1 314 ? 33.162  -7.243  149.974 1.00 71.18  ? 315  GLY B N   1 
ATOM   5065  C CA  . GLY B 1 314 ? 34.586  -7.015  149.811 1.00 61.80  ? 315  GLY B CA  1 
ATOM   5066  C C   . GLY B 1 314 ? 35.444  -8.168  150.311 1.00 67.58  ? 315  GLY B C   1 
ATOM   5067  O O   . GLY B 1 314 ? 36.535  -8.397  149.797 1.00 79.79  ? 315  GLY B O   1 
ATOM   5068  N N   . SER B 1 315 ? 34.949  -8.894  151.313 1.00 79.04  ? 316  SER B N   1 
ATOM   5069  C CA  . SER B 1 315 ? 35.733  -9.917  152.020 1.00 85.06  ? 316  SER B CA  1 
ATOM   5070  C C   . SER B 1 315 ? 35.520  -11.379 151.584 1.00 78.94  ? 316  SER B C   1 
ATOM   5071  O O   . SER B 1 315 ? 36.069  -12.313 152.203 1.00 88.77  ? 316  SER B O   1 
ATOM   5072  C CB  . SER B 1 315 ? 35.531  -9.780  153.531 1.00 85.48  ? 316  SER B CB  1 
ATOM   5073  O OG  . SER B 1 315 ? 35.653  -8.427  153.935 1.00 75.85  ? 316  SER B OG  1 
ATOM   5074  N N   . VAL B 1 316 ? 34.711  -11.578 150.545 1.00 69.86  ? 317  VAL B N   1 
ATOM   5075  C CA  . VAL B 1 316 ? 34.470  -12.921 150.007 1.00 72.78  ? 317  VAL B CA  1 
ATOM   5076  C C   . VAL B 1 316 ? 35.767  -13.726 149.834 1.00 77.16  ? 317  VAL B C   1 
ATOM   5077  O O   . VAL B 1 316 ? 35.853  -14.899 150.236 1.00 79.05  ? 317  VAL B O   1 
ATOM   5078  C CB  . VAL B 1 316 ? 33.753  -12.846 148.643 1.00 65.88  ? 317  VAL B CB  1 
ATOM   5079  C CG1 . VAL B 1 316 ? 33.698  -14.218 147.988 1.00 62.12  ? 317  VAL B CG1 1 
ATOM   5080  C CG2 . VAL B 1 316 ? 32.357  -12.265 148.805 1.00 67.72  ? 317  VAL B CG2 1 
ATOM   5081  N N   . HIS B 1 317 ? 36.782  -13.079 149.266 1.00 72.83  ? 318  HIS B N   1 
ATOM   5082  C CA  . HIS B 1 317 ? 38.081  -13.715 149.077 1.00 59.99  ? 318  HIS B CA  1 
ATOM   5083  C C   . HIS B 1 317 ? 38.729  -14.084 150.409 1.00 42.27  ? 318  HIS B C   1 
ATOM   5084  O O   . HIS B 1 317 ? 39.448  -15.078 150.497 1.00 53.28  ? 318  HIS B O   1 
ATOM   5085  C CB  . HIS B 1 317 ? 39.019  -12.829 148.250 1.00 56.63  ? 318  HIS B CB  1 
ATOM   5086  C CG  . HIS B 1 317 ? 39.349  -11.520 148.897 1.00 56.48  ? 318  HIS B CG  1 
ATOM   5087  N ND1 . HIS B 1 317 ? 38.798  -10.325 148.484 1.00 62.08  ? 318  HIS B ND1 1 
ATOM   5088  C CD2 . HIS B 1 317 ? 40.181  -11.213 149.921 1.00 55.99  ? 318  HIS B CD2 1 
ATOM   5089  C CE1 . HIS B 1 317 ? 39.273  -9.343  149.227 1.00 55.64  ? 318  HIS B CE1 1 
ATOM   5090  N NE2 . HIS B 1 317 ? 40.113  -9.856  150.110 1.00 54.22  ? 318  HIS B NE2 1 
ATOM   5091  N N   . THR B 1 318 ? 38.473  -13.285 151.442 1.00 42.46  ? 319  THR B N   1 
ATOM   5092  C CA  . THR B 1 318 ? 39.001  -13.583 152.768 1.00 49.69  ? 319  THR B CA  1 
ATOM   5093  C C   . THR B 1 318 ? 38.381  -14.876 153.273 1.00 53.99  ? 319  THR B C   1 
ATOM   5094  O O   . THR B 1 318 ? 39.074  -15.729 153.839 1.00 50.81  ? 319  THR B O   1 
ATOM   5095  C CB  . THR B 1 318 ? 38.715  -12.457 153.786 1.00 56.70  ? 319  THR B CB  1 
ATOM   5096  O OG1 . THR B 1 318 ? 37.328  -12.474 154.148 1.00 56.78  ? 319  THR B OG1 1 
ATOM   5097  C CG2 . THR B 1 318 ? 39.070  -11.097 153.203 1.00 56.75  ? 319  THR B CG2 1 
ATOM   5098  N N   . TRP B 1 319 ? 37.077  -15.031 153.060 1.00 66.10  ? 320  TRP B N   1 
ATOM   5099  C CA  . TRP B 1 319 ? 36.427  -16.281 153.462 1.00 66.16  ? 320  TRP B CA  1 
ATOM   5100  C C   . TRP B 1 319 ? 36.949  -17.502 152.696 1.00 65.99  ? 320  TRP B C   1 
ATOM   5101  O O   . TRP B 1 319 ? 37.261  -18.537 153.303 1.00 79.91  ? 320  TRP B O   1 
ATOM   5102  C CB  . TRP B 1 319 ? 34.902  -16.179 153.387 1.00 67.76  ? 320  TRP B CB  1 
ATOM   5103  C CG  . TRP B 1 319 ? 34.332  -15.485 154.580 1.00 81.20  ? 320  TRP B CG  1 
ATOM   5104  C CD1 . TRP B 1 319 ? 34.262  -15.971 155.852 1.00 88.15  ? 320  TRP B CD1 1 
ATOM   5105  C CD2 . TRP B 1 319 ? 33.771  -14.170 154.620 1.00 77.44  ? 320  TRP B CD2 1 
ATOM   5106  N NE1 . TRP B 1 319 ? 33.687  -15.042 156.682 1.00 86.00  ? 320  TRP B NE1 1 
ATOM   5107  C CE2 . TRP B 1 319 ? 33.375  -13.926 155.950 1.00 80.75  ? 320  TRP B CE2 1 
ATOM   5108  C CE3 . TRP B 1 319 ? 33.558  -13.174 153.663 1.00 68.96  ? 320  TRP B CE3 1 
ATOM   5109  C CZ2 . TRP B 1 319 ? 32.785  -12.731 156.346 1.00 78.88  ? 320  TRP B CZ2 1 
ATOM   5110  C CZ3 . TRP B 1 319 ? 32.969  -11.989 154.057 1.00 73.51  ? 320  TRP B CZ3 1 
ATOM   5111  C CH2 . TRP B 1 319 ? 32.589  -11.777 155.387 1.00 77.08  ? 320  TRP B CH2 1 
ATOM   5112  N N   . LEU B 1 320 ? 37.057  -17.375 151.375 1.00 56.87  ? 321  LEU B N   1 
ATOM   5113  C CA  . LEU B 1 320 ? 37.609  -18.459 150.558 1.00 57.17  ? 321  LEU B CA  1 
ATOM   5114  C C   . LEU B 1 320 ? 39.013  -18.859 151.028 1.00 73.01  ? 321  LEU B C   1 
ATOM   5115  O O   . LEU B 1 320 ? 39.326  -20.051 151.187 1.00 76.15  ? 321  LEU B O   1 
ATOM   5116  C CB  . LEU B 1 320 ? 37.648  -18.056 149.082 1.00 48.76  ? 321  LEU B CB  1 
ATOM   5117  C CG  . LEU B 1 320 ? 36.326  -17.627 148.441 1.00 57.96  ? 321  LEU B CG  1 
ATOM   5118  C CD1 . LEU B 1 320 ? 36.504  -17.392 146.949 1.00 62.60  ? 321  LEU B CD1 1 
ATOM   5119  C CD2 . LEU B 1 320 ? 35.239  -18.656 148.696 1.00 69.56  ? 321  LEU B CD2 1 
ATOM   5120  N N   . ALA B 1 321 ? 39.847  -17.848 151.256 1.00 64.71  ? 322  ALA B N   1 
ATOM   5121  C CA  . ALA B 1 321 ? 41.212  -18.054 151.725 1.00 68.32  ? 322  ALA B CA  1 
ATOM   5122  C C   . ALA B 1 321 ? 41.239  -18.775 153.069 1.00 72.33  ? 322  ALA B C   1 
ATOM   5123  O O   . ALA B 1 321 ? 42.029  -19.699 153.265 1.00 85.41  ? 322  ALA B O   1 
ATOM   5124  C CB  . ALA B 1 321 ? 41.950  -16.727 151.816 1.00 55.36  ? 322  ALA B CB  1 
ATOM   5125  N N   . GLU B 1 322 ? 40.380  -18.350 153.991 1.00 64.22  ? 323  GLU B N   1 
ATOM   5126  C CA  . GLU B 1 322 ? 40.293  -19.003 155.295 1.00 69.17  ? 323  GLU B CA  1 
ATOM   5127  C C   . GLU B 1 322 ? 39.876  -20.469 155.173 1.00 75.08  ? 323  GLU B C   1 
ATOM   5128  O O   . GLU B 1 322 ? 40.360  -21.323 155.922 1.00 70.48  ? 323  GLU B O   1 
ATOM   5129  C CB  . GLU B 1 322 ? 39.347  -18.242 156.229 1.00 75.48  ? 323  GLU B CB  1 
ATOM   5130  C CG  . GLU B 1 322 ? 39.967  -16.999 156.855 1.00 88.09  ? 323  GLU B CG  1 
ATOM   5131  C CD  . GLU B 1 322 ? 38.983  -16.220 157.710 1.00 98.67  ? 323  GLU B CD  1 
ATOM   5132  O OE1 . GLU B 1 322 ? 37.776  -16.539 157.670 1.00 107.27 ? 323  GLU B OE1 1 
ATOM   5133  O OE2 . GLU B 1 322 ? 39.416  -15.287 158.421 1.00 97.82  ? 323  GLU B OE2 1 
ATOM   5134  N N   . ALA B 1 323 ? 38.987  -20.760 154.227 1.00 75.78  ? 324  ALA B N   1 
ATOM   5135  C CA  . ALA B 1 323 ? 38.589  -22.145 153.976 1.00 66.61  ? 324  ALA B CA  1 
ATOM   5136  C C   . ALA B 1 323 ? 39.766  -22.992 153.483 1.00 60.02  ? 324  ALA B C   1 
ATOM   5137  O O   . ALA B 1 323 ? 40.066  -24.056 154.049 1.00 67.47  ? 324  ALA B O   1 
ATOM   5138  C CB  . ALA B 1 323 ? 37.448  -22.196 152.979 1.00 64.15  ? 324  ALA B CB  1 
ATOM   5139  N N   . ILE B 1 324 ? 40.426  -22.514 152.429 1.00 58.13  ? 325  ILE B N   1 
ATOM   5140  C CA  . ILE B 1 324 ? 41.585  -23.215 151.876 1.00 58.20  ? 325  ILE B CA  1 
ATOM   5141  C C   . ILE B 1 324 ? 42.645  -23.466 152.949 1.00 66.08  ? 325  ILE B C   1 
ATOM   5142  O O   . ILE B 1 324 ? 43.154  -24.582 153.089 1.00 64.84  ? 325  ILE B O   1 
ATOM   5143  C CB  . ILE B 1 324 ? 42.218  -22.436 150.708 1.00 57.43  ? 325  ILE B CB  1 
ATOM   5144  C CG1 . ILE B 1 324 ? 41.223  -22.307 149.553 1.00 56.28  ? 325  ILE B CG1 1 
ATOM   5145  C CG2 . ILE B 1 324 ? 43.491  -23.122 150.237 1.00 49.26  ? 325  ILE B CG2 1 
ATOM   5146  C CD1 . ILE B 1 324 ? 41.776  -21.576 148.352 1.00 47.70  ? 325  ILE B CD1 1 
ATOM   5147  N N   . ASN B 1 325 ? 42.957  -22.425 153.713 1.00 72.25  ? 326  ASN B N   1 
ATOM   5148  C CA  . ASN B 1 325 ? 43.913  -22.537 154.808 1.00 67.10  ? 326  ASN B CA  1 
ATOM   5149  C C   . ASN B 1 325 ? 43.468  -23.541 155.869 1.00 55.04  ? 326  ASN B C   1 
ATOM   5150  O O   . ASN B 1 325 ? 44.294  -24.247 156.451 1.00 56.66  ? 326  ASN B O   1 
ATOM   5151  C CB  . ASN B 1 325 ? 44.163  -21.167 155.442 1.00 68.28  ? 326  ASN B CB  1 
ATOM   5152  C CG  . ASN B 1 325 ? 44.979  -21.256 156.715 1.00 76.33  ? 326  ASN B CG  1 
ATOM   5153  O OD1 . ASN B 1 325 ? 46.181  -21.523 156.678 1.00 81.89  ? 326  ASN B OD1 1 
ATOM   5154  N ND2 . ASN B 1 325 ? 44.330  -21.027 157.851 1.00 70.06  ? 326  ASN B ND2 1 
ATOM   5155  N N   . ALA B 1 326 ? 42.163  -23.607 156.114 1.00 56.78  ? 327  ALA B N   1 
ATOM   5156  C CA  . ALA B 1 326 ? 41.623  -24.570 157.069 1.00 70.63  ? 327  ALA B CA  1 
ATOM   5157  C C   . ALA B 1 326 ? 41.862  -25.996 156.584 1.00 78.48  ? 327  ALA B C   1 
ATOM   5158  O O   . ALA B 1 326 ? 42.182  -26.891 157.375 1.00 75.59  ? 327  ALA B O   1 
ATOM   5159  C CB  . ALA B 1 326 ? 40.145  -24.324 157.299 1.00 81.71  ? 327  ALA B CB  1 
ATOM   5160  N N   . LEU B 1 327 ? 41.710  -26.205 155.279 1.00 80.49  ? 328  LEU B N   1 
ATOM   5161  C CA  . LEU B 1 327 ? 42.026  -27.507 154.697 1.00 76.07  ? 328  LEU B CA  1 
ATOM   5162  C C   . LEU B 1 327 ? 43.520  -27.815 154.830 1.00 79.82  ? 328  LEU B C   1 
ATOM   5163  O O   . LEU B 1 327 ? 43.907  -28.949 155.146 1.00 87.32  ? 328  LEU B O   1 
ATOM   5164  C CB  . LEU B 1 327 ? 41.590  -27.570 153.232 1.00 75.82  ? 328  LEU B CB  1 
ATOM   5165  C CG  . LEU B 1 327 ? 41.693  -28.947 152.576 1.00 69.17  ? 328  LEU B CG  1 
ATOM   5166  C CD1 . LEU B 1 327 ? 41.167  -30.010 153.518 1.00 69.50  ? 328  LEU B CD1 1 
ATOM   5167  C CD2 . LEU B 1 327 ? 40.919  -28.975 151.271 1.00 68.93  ? 328  LEU B CD2 1 
ATOM   5168  N N   . GLN B 1 328 ? 44.346  -26.796 154.594 1.00 83.55  ? 329  GLN B N   1 
ATOM   5169  C CA  . GLN B 1 328 ? 45.795  -26.907 154.762 1.00 76.76  ? 329  GLN B CA  1 
ATOM   5170  C C   . GLN B 1 328 ? 46.142  -27.408 156.158 1.00 70.71  ? 329  GLN B C   1 
ATOM   5171  O O   . GLN B 1 328 ? 46.944  -28.328 156.317 1.00 60.53  ? 329  GLN B O   1 
ATOM   5172  C CB  . GLN B 1 328 ? 46.470  -25.549 154.545 1.00 82.89  ? 329  GLN B CB  1 
ATOM   5173  C CG  . GLN B 1 328 ? 46.277  -24.937 153.168 1.00 87.81  ? 329  GLN B CG  1 
ATOM   5174  C CD  . GLN B 1 328 ? 47.316  -25.399 152.167 1.00 92.18  ? 329  GLN B CD  1 
ATOM   5175  O OE1 . GLN B 1 328 ? 47.420  -26.588 151.866 1.00 105.76 ? 329  GLN B OE1 1 
ATOM   5176  N NE2 . GLN B 1 328 ? 48.095  -24.458 151.648 1.00 85.09  ? 329  GLN B NE2 1 
ATOM   5177  N N   . ASP B 1 329 ? 45.532  -26.793 157.166 1.00 74.04  ? 330  ASP B N   1 
ATOM   5178  C CA  . ASP B 1 329 ? 45.814  -27.135 158.555 1.00 77.48  ? 330  ASP B CA  1 
ATOM   5179  C C   . ASP B 1 329 ? 45.266  -28.506 158.941 1.00 79.54  ? 330  ASP B C   1 
ATOM   5180  O O   . ASP B 1 329 ? 45.884  -29.232 159.720 1.00 69.59  ? 330  ASP B O   1 
ATOM   5181  C CB  . ASP B 1 329 ? 45.247  -26.069 159.497 1.00 80.12  ? 330  ASP B CB  1 
ATOM   5182  C CG  . ASP B 1 329 ? 45.914  -24.719 159.319 1.00 90.15  ? 330  ASP B CG  1 
ATOM   5183  O OD1 . ASP B 1 329 ? 47.123  -24.686 159.009 1.00 86.37  ? 330  ASP B OD1 1 
ATOM   5184  O OD2 . ASP B 1 329 ? 45.226  -23.689 159.491 1.00 93.42  ? 330  ASP B OD2 1 
ATOM   5185  N N   . ASN B 1 330 ? 44.106  -28.858 158.395 1.00 91.83  ? 331  ASN B N   1 
ATOM   5186  C CA  . ASN B 1 330 ? 43.437  -30.099 158.778 1.00 90.49  ? 331  ASN B CA  1 
ATOM   5187  C C   . ASN B 1 330 ? 43.803  -31.321 157.937 1.00 91.84  ? 331  ASN B C   1 
ATOM   5188  O O   . ASN B 1 330 ? 43.297  -32.416 158.189 1.00 106.62 ? 331  ASN B O   1 
ATOM   5189  C CB  . ASN B 1 330 ? 41.917  -29.912 158.776 1.00 101.49 ? 331  ASN B CB  1 
ATOM   5190  C CG  . ASN B 1 330 ? 41.440  -29.018 159.902 1.00 111.14 ? 331  ASN B CG  1 
ATOM   5191  O OD1 . ASN B 1 330 ? 42.033  -28.988 160.980 1.00 118.16 ? 331  ASN B OD1 1 
ATOM   5192  N ND2 . ASN B 1 330 ? 40.360  -28.284 159.658 1.00 104.03 ? 331  ASN B ND2 1 
ATOM   5193  N N   . ARG B 1 331 ? 44.693  -31.136 156.965 1.00 84.36  ? 332  ARG B N   1 
ATOM   5194  C CA  . ARG B 1 331 ? 45.042  -32.191 156.007 1.00 92.21  ? 332  ARG B CA  1 
ATOM   5195  C C   . ARG B 1 331 ? 45.336  -33.573 156.611 1.00 95.60  ? 332  ARG B C   1 
ATOM   5196  O O   . ARG B 1 331 ? 44.761  -34.575 156.180 1.00 93.59  ? 332  ARG B O   1 
ATOM   5197  C CB  . ARG B 1 331 ? 46.236  -31.748 155.155 1.00 97.74  ? 332  ARG B CB  1 
ATOM   5198  C CG  . ARG B 1 331 ? 46.950  -32.888 154.442 1.00 103.08 ? 332  ARG B CG  1 
ATOM   5199  C CD  . ARG B 1 331 ? 48.240  -32.418 153.784 1.00 117.93 ? 332  ARG B CD  1 
ATOM   5200  N NE  . ARG B 1 331 ? 49.061  -31.621 154.692 1.00 119.58 ? 332  ARG B NE  1 
ATOM   5201  C CZ  . ARG B 1 331 ? 49.336  -30.332 154.515 1.00 107.52 ? 332  ARG B CZ  1 
ATOM   5202  N NH1 . ARG B 1 331 ? 48.862  -29.691 153.455 1.00 93.63  ? 332  ARG B NH1 1 
ATOM   5203  N NH2 . ARG B 1 331 ? 50.090  -29.685 155.394 1.00 110.74 ? 332  ARG B NH2 1 
ATOM   5204  N N   . ASP B 1 332 ? 46.218  -33.626 157.605 1.00 102.65 ? 333  ASP B N   1 
ATOM   5205  C CA  . ASP B 1 332 ? 46.648  -34.904 158.176 1.00 102.58 ? 333  ASP B CA  1 
ATOM   5206  C C   . ASP B 1 332 ? 45.532  -35.696 158.859 1.00 98.78  ? 333  ASP B C   1 
ATOM   5207  O O   . ASP B 1 332 ? 45.250  -36.836 158.486 1.00 91.07  ? 333  ASP B O   1 
ATOM   5208  C CB  . ASP B 1 332 ? 47.818  -34.700 159.142 1.00 97.17  ? 333  ASP B CB  1 
ATOM   5209  C CG  . ASP B 1 332 ? 49.151  -34.598 158.427 1.00 97.62  ? 333  ASP B CG  1 
ATOM   5210  O OD1 . ASP B 1 332 ? 49.153  -34.319 157.209 1.00 97.49  ? 333  ASP B OD1 1 
ATOM   5211  O OD2 . ASP B 1 332 ? 50.195  -34.799 159.081 1.00 100.38 ? 333  ASP B OD2 1 
ATOM   5212  N N   . THR B 1 333 ? 44.899  -35.084 159.855 1.00 102.37 ? 334  THR B N   1 
ATOM   5213  C CA  . THR B 1 333 ? 43.845  -35.747 160.614 1.00 97.98  ? 334  THR B CA  1 
ATOM   5214  C C   . THR B 1 333 ? 42.628  -36.030 159.738 1.00 91.42  ? 334  THR B C   1 
ATOM   5215  O O   . THR B 1 333 ? 41.984  -37.079 159.873 1.00 91.21  ? 334  THR B O   1 
ATOM   5216  C CB  . THR B 1 333 ? 43.421  -34.910 161.832 1.00 93.83  ? 334  THR B CB  1 
ATOM   5217  O OG1 . THR B 1 333 ? 43.021  -33.604 161.399 1.00 87.17  ? 334  THR B OG1 1 
ATOM   5218  C CG2 . THR B 1 333 ? 44.578  -34.780 162.812 1.00 86.62  ? 334  THR B CG2 1 
ATOM   5219  N N   . LEU B 1 334 ? 42.321  -35.096 158.841 1.00 78.71  ? 335  LEU B N   1 
ATOM   5220  C CA  . LEU B 1 334 ? 41.239  -35.302 157.886 1.00 79.18  ? 335  LEU B CA  1 
ATOM   5221  C C   . LEU B 1 334 ? 41.523  -36.533 157.041 1.00 81.31  ? 335  LEU B C   1 
ATOM   5222  O O   . LEU B 1 334 ? 40.639  -37.353 156.825 1.00 80.94  ? 335  LEU B O   1 
ATOM   5223  C CB  . LEU B 1 334 ? 41.052  -34.086 156.979 1.00 81.03  ? 335  LEU B CB  1 
ATOM   5224  C CG  . LEU B 1 334 ? 39.940  -34.217 155.936 1.00 78.60  ? 335  LEU B CG  1 
ATOM   5225  C CD1 . LEU B 1 334 ? 38.574  -34.178 156.600 1.00 73.47  ? 335  LEU B CD1 1 
ATOM   5226  C CD2 . LEU B 1 334 ? 40.056  -33.140 154.874 1.00 78.63  ? 335  LEU B CD2 1 
ATOM   5227  N N   . THR B 1 335 ? 42.762  -36.661 156.573 1.00 82.70  ? 336  THR B N   1 
ATOM   5228  C CA  . THR B 1 335 ? 43.159  -37.825 155.787 1.00 82.52  ? 336  THR B CA  1 
ATOM   5229  C C   . THR B 1 335 ? 43.049  -39.100 156.617 1.00 77.60  ? 336  THR B C   1 
ATOM   5230  O O   . THR B 1 335 ? 42.660  -40.150 156.105 1.00 69.33  ? 336  THR B O   1 
ATOM   5231  C CB  . THR B 1 335 ? 44.597  -37.693 155.253 1.00 83.55  ? 336  THR B CB  1 
ATOM   5232  O OG1 . THR B 1 335 ? 44.747  -36.435 154.583 1.00 76.59  ? 336  THR B OG1 1 
ATOM   5233  C CG2 . THR B 1 335 ? 44.907  -38.822 154.280 1.00 64.31  ? 336  THR B CG2 1 
ATOM   5234  N N   . ALA B 1 336 ? 43.386  -38.998 157.899 1.00 82.13  ? 337  ALA B N   1 
ATOM   5235  C CA  . ALA B 1 336 ? 43.306  -40.137 158.807 1.00 79.30  ? 337  ALA B CA  1 
ATOM   5236  C C   . ALA B 1 336 ? 41.876  -40.655 158.934 1.00 89.03  ? 337  ALA B C   1 
ATOM   5237  O O   . ALA B 1 336 ? 41.619  -41.849 158.763 1.00 100.26 ? 337  ALA B O   1 
ATOM   5238  C CB  . ALA B 1 336 ? 43.862  -39.769 160.175 1.00 75.71  ? 337  ALA B CB  1 
ATOM   5239  N N   . LYS B 1 337 ? 40.944  -39.755 159.229 1.00 95.51  ? 338  LYS B N   1 
ATOM   5240  C CA  . LYS B 1 337 ? 39.546  -40.156 159.362 1.00 93.59  ? 338  LYS B CA  1 
ATOM   5241  C C   . LYS B 1 337 ? 38.932  -40.565 158.022 1.00 80.57  ? 338  LYS B C   1 
ATOM   5242  O O   . LYS B 1 337 ? 38.051  -41.425 157.972 1.00 83.82  ? 338  LYS B O   1 
ATOM   5243  C CB  . LYS B 1 337 ? 38.717  -39.053 160.025 1.00 99.64  ? 338  LYS B CB  1 
ATOM   5244  C CG  . LYS B 1 337 ? 39.098  -38.779 161.472 1.00 104.10 ? 338  LYS B CG  1 
ATOM   5245  C CD  . LYS B 1 337 ? 37.891  -38.331 162.280 1.00 101.79 ? 338  LYS B CD  1 
ATOM   5246  C CE  . LYS B 1 337 ? 36.793  -39.386 162.252 1.00 97.40  ? 338  LYS B CE  1 
ATOM   5247  N NZ  . LYS B 1 337 ? 35.583  -38.969 163.014 1.00 86.72  ? 338  LYS B NZ  1 
ATOM   5248  N N   . VAL B 1 338 ? 39.405  -39.951 156.941 1.00 71.46  ? 339  VAL B N   1 
ATOM   5249  C CA  . VAL B 1 338 ? 38.926  -40.270 155.600 1.00 66.01  ? 339  VAL B CA  1 
ATOM   5250  C C   . VAL B 1 338 ? 39.323  -41.681 155.187 1.00 76.00  ? 339  VAL B C   1 
ATOM   5251  O O   . VAL B 1 338 ? 38.505  -42.422 154.649 1.00 90.36  ? 339  VAL B O   1 
ATOM   5252  C CB  . VAL B 1 338 ? 39.422  -39.250 154.547 1.00 76.69  ? 339  VAL B CB  1 
ATOM   5253  C CG1 . VAL B 1 338 ? 39.442  -39.868 153.154 1.00 66.97  ? 339  VAL B CG1 1 
ATOM   5254  C CG2 . VAL B 1 338 ? 38.551  -38.003 154.568 1.00 95.61  ? 339  VAL B CG2 1 
ATOM   5255  N N   . ILE B 1 339 ? 40.573  -42.057 155.438 1.00 79.97  ? 340  ILE B N   1 
ATOM   5256  C CA  . ILE B 1 339 ? 41.007  -43.418 155.139 1.00 89.83  ? 340  ILE B CA  1 
ATOM   5257  C C   . ILE B 1 339 ? 40.404  -44.394 156.141 1.00 93.86  ? 340  ILE B C   1 
ATOM   5258  O O   . ILE B 1 339 ? 40.229  -45.574 155.843 1.00 100.67 ? 340  ILE B O   1 
ATOM   5259  C CB  . ILE B 1 339 ? 42.552  -43.564 155.100 1.00 87.38  ? 340  ILE B CB  1 
ATOM   5260  C CG1 . ILE B 1 339 ? 43.175  -43.300 156.475 1.00 86.51  ? 340  ILE B CG1 1 
ATOM   5261  C CG2 . ILE B 1 339 ? 43.152  -42.647 154.044 1.00 82.67  ? 340  ILE B CG2 1 
ATOM   5262  C CD1 . ILE B 1 339 ? 43.561  -44.556 157.237 1.00 83.39  ? 340  ILE B CD1 1 
ATOM   5263  N N   . GLN B 1 340 ? 40.082  -43.893 157.329 1.00 90.72  ? 341  GLN B N   1 
ATOM   5264  C CA  . GLN B 1 340 ? 39.457  -44.720 158.352 1.00 88.55  ? 341  GLN B CA  1 
ATOM   5265  C C   . GLN B 1 340 ? 38.051  -45.132 157.919 1.00 88.71  ? 341  GLN B C   1 
ATOM   5266  O O   . GLN B 1 340 ? 37.663  -46.293 158.054 1.00 83.64  ? 341  GLN B O   1 
ATOM   5267  C CB  . GLN B 1 340 ? 39.415  -43.972 159.685 1.00 92.56  ? 341  GLN B CB  1 
ATOM   5268  C CG  . GLN B 1 340 ? 39.165  -44.853 160.895 1.00 101.02 ? 341  GLN B CG  1 
ATOM   5269  C CD  . GLN B 1 340 ? 39.673  -44.223 162.177 1.00 105.38 ? 341  GLN B CD  1 
ATOM   5270  O OE1 . GLN B 1 340 ? 40.762  -43.648 162.209 1.00 107.96 ? 341  GLN B OE1 1 
ATOM   5271  N NE2 . GLN B 1 340 ? 38.885  -44.322 163.241 1.00 106.90 ? 341  GLN B NE2 1 
ATOM   5272  N N   . GLY B 1 341 ? 37.291  -44.171 157.403 1.00 95.55  ? 342  GLY B N   1 
ATOM   5273  C CA  . GLY B 1 341 ? 35.947  -44.435 156.920 1.00 100.84 ? 342  GLY B CA  1 
ATOM   5274  C C   . GLY B 1 341 ? 35.862  -45.103 155.559 1.00 98.50  ? 342  GLY B C   1 
ATOM   5275  O O   . GLY B 1 341 ? 35.115  -46.064 155.375 1.00 108.68 ? 342  GLY B O   1 
ATOM   5276  N N   . CYS B 1 342 ? 36.628  -44.590 154.602 1.00 80.32  ? 343  CYS B N   1 
ATOM   5277  C CA  . CYS B 1 342 ? 36.538  -45.026 153.212 1.00 70.74  ? 343  CYS B CA  1 
ATOM   5278  C C   . CYS B 1 342 ? 37.563  -46.097 152.837 1.00 70.35  ? 343  CYS B C   1 
ATOM   5279  O O   . CYS B 1 342 ? 37.609  -46.542 151.691 1.00 70.27  ? 343  CYS B O   1 
ATOM   5280  C CB  . CYS B 1 342 ? 36.677  -43.826 152.270 1.00 71.48  ? 343  CYS B CB  1 
ATOM   5281  S SG  . CYS B 1 342 ? 35.465  -42.512 152.544 1.00 91.35  ? 343  CYS B SG  1 
ATOM   5282  N N   . GLY B 1 343 ? 38.385  -46.504 153.798 1.00 72.64  ? 344  GLY B N   1 
ATOM   5283  C CA  . GLY B 1 343 ? 39.376  -47.538 153.554 1.00 84.04  ? 344  GLY B CA  1 
ATOM   5284  C C   . GLY B 1 343 ? 40.665  -46.995 152.968 1.00 93.91  ? 344  GLY B C   1 
ATOM   5285  O O   . GLY B 1 343 ? 40.757  -45.814 152.636 1.00 97.16  ? 344  GLY B O   1 
ATOM   5286  N N   . ASN B 1 344 ? 41.666  -47.860 152.839 1.00 104.10 ? 345  ASN B N   1 
ATOM   5287  C CA  . ASN B 1 344 ? 42.960  -47.459 152.296 1.00 105.87 ? 345  ASN B CA  1 
ATOM   5288  C C   . ASN B 1 344 ? 42.971  -47.366 150.773 1.00 103.89 ? 345  ASN B C   1 
ATOM   5289  O O   . ASN B 1 344 ? 42.708  -48.350 150.083 1.00 102.29 ? 345  ASN B O   1 
ATOM   5290  C CB  . ASN B 1 344 ? 44.062  -48.413 152.766 1.00 114.50 ? 345  ASN B CB  1 
ATOM   5291  C CG  . ASN B 1 344 ? 44.475  -48.166 154.203 1.00 117.99 ? 345  ASN B CG  1 
ATOM   5292  O OD1 . ASN B 1 344 ? 45.369  -47.363 154.473 1.00 120.15 ? 345  ASN B OD1 1 
ATOM   5293  N ND2 . ASN B 1 344 ? 43.828  -48.857 155.133 1.00 116.66 ? 345  ASN B ND2 1 
ATOM   5294  N N   . PRO B 1 345 ? 43.279  -46.172 150.244 1.00 103.30 ? 346  PRO B N   1 
ATOM   5295  C CA  . PRO B 1 345 ? 43.418  -45.970 148.799 1.00 101.65 ? 346  PRO B CA  1 
ATOM   5296  C C   . PRO B 1 345 ? 44.738  -46.540 148.291 1.00 107.40 ? 346  PRO B C   1 
ATOM   5297  O O   . PRO B 1 345 ? 45.682  -46.694 149.067 1.00 103.07 ? 346  PRO B O   1 
ATOM   5298  C CB  . PRO B 1 345 ? 43.407  -44.447 148.662 1.00 96.59  ? 346  PRO B CB  1 
ATOM   5299  C CG  . PRO B 1 345 ? 43.949  -43.958 149.957 1.00 96.17  ? 346  PRO B CG  1 
ATOM   5300  C CD  . PRO B 1 345 ? 43.457  -44.919 150.999 1.00 99.56  ? 346  PRO B CD  1 
ATOM   5301  N N   . LYS B 1 346 ? 44.800  -46.849 147.000 1.00 113.37 ? 347  LYS B N   1 
ATOM   5302  C CA  . LYS B 1 346 ? 45.987  -47.466 146.415 1.00 117.16 ? 347  LYS B CA  1 
ATOM   5303  C C   . LYS B 1 346 ? 47.024  -46.440 145.963 1.00 108.14 ? 347  LYS B C   1 
ATOM   5304  O O   . LYS B 1 346 ? 46.683  -45.417 145.369 1.00 112.96 ? 347  LYS B O   1 
ATOM   5305  C CB  . LYS B 1 346 ? 45.594  -48.377 145.249 1.00 123.81 ? 347  LYS B CB  1 
ATOM   5306  C CG  . LYS B 1 346 ? 44.605  -47.754 144.274 1.00 118.85 ? 347  LYS B CG  1 
ATOM   5307  C CD  . LYS B 1 346 ? 44.185  -48.731 143.179 1.00 123.77 ? 347  LYS B CD  1 
ATOM   5308  C CE  . LYS B 1 346 ? 43.407  -49.919 143.732 1.00 127.71 ? 347  LYS B CE  1 
ATOM   5309  N NZ  . LYS B 1 346 ? 44.285  -51.058 144.129 1.00 128.96 ? 347  LYS B NZ  1 
ATOM   5310  N N   . VAL B 1 347 ? 48.291  -46.725 146.248 1.00 101.41 ? 348  VAL B N   1 
ATOM   5311  C CA  . VAL B 1 347 ? 49.385  -45.839 145.864 1.00 99.49  ? 348  VAL B CA  1 
ATOM   5312  C C   . VAL B 1 347 ? 49.878  -46.150 144.455 1.00 99.87  ? 348  VAL B C   1 
ATOM   5313  O O   . VAL B 1 347 ? 49.885  -45.281 143.583 1.00 101.14 ? 348  VAL B O   1 
ATOM   5314  C CB  . VAL B 1 347 ? 50.568  -45.944 146.846 1.00 97.13  ? 348  VAL B CB  1 
ATOM   5315  C CG1 . VAL B 1 347 ? 51.744  -45.113 146.353 1.00 98.06  ? 348  VAL B CG1 1 
ATOM   5316  C CG2 . VAL B 1 347 ? 50.143  -45.507 148.240 1.00 86.18  ? 348  VAL B CG2 1 
ATOM   5317  N N   . GLY B 1 361 ? 53.634  -16.164 153.530 1.00 98.99  ? 362  GLY B N   1 
ATOM   5318  C CA  . GLY B 1 361 ? 52.335  -15.667 153.946 1.00 110.48 ? 362  GLY B CA  1 
ATOM   5319  C C   . GLY B 1 361 ? 51.607  -14.941 152.832 1.00 109.68 ? 362  GLY B C   1 
ATOM   5320  O O   . GLY B 1 361 ? 50.929  -15.567 152.015 1.00 106.20 ? 362  GLY B O   1 
ATOM   5321  N N   . LYS B 1 362 ? 51.752  -13.617 152.804 1.00 113.73 ? 363  LYS B N   1 
ATOM   5322  C CA  . LYS B 1 362 ? 51.153  -12.774 151.769 1.00 120.92 ? 363  LYS B CA  1 
ATOM   5323  C C   . LYS B 1 362 ? 49.631  -12.931 151.677 1.00 103.85 ? 363  LYS B C   1 
ATOM   5324  O O   . LYS B 1 362 ? 49.092  -13.236 150.613 1.00 101.76 ? 363  LYS B O   1 
ATOM   5325  C CB  . LYS B 1 362 ? 51.808  -13.043 150.408 1.00 136.91 ? 363  LYS B CB  1 
ATOM   5326  C CG  . LYS B 1 362 ? 51.593  -11.947 149.370 1.00 144.44 ? 363  LYS B CG  1 
ATOM   5327  C CD  . LYS B 1 362 ? 51.990  -12.422 147.980 1.00 144.98 ? 363  LYS B CD  1 
ATOM   5328  C CE  . LYS B 1 362 ? 51.613  -11.403 146.917 1.00 141.68 ? 363  LYS B CE  1 
ATOM   5329  N NZ  . LYS B 1 362 ? 51.904  -11.902 145.544 1.00 141.15 ? 363  LYS B NZ  1 
ATOM   5330  N N   . LEU B 1 363 ? 48.941  -12.736 152.797 1.00 92.62  ? 364  LEU B N   1 
ATOM   5331  C CA  . LEU B 1 363 ? 47.484  -12.841 152.807 1.00 97.63  ? 364  LEU B CA  1 
ATOM   5332  C C   . LEU B 1 363 ? 46.831  -11.614 153.440 1.00 100.70 ? 364  LEU B C   1 
ATOM   5333  O O   . LEU B 1 363 ? 47.070  -11.301 154.607 1.00 95.37  ? 364  LEU B O   1 
ATOM   5334  C CB  . LEU B 1 363 ? 47.041  -14.119 153.523 1.00 100.30 ? 364  LEU B CB  1 
ATOM   5335  C CG  . LEU B 1 363 ? 45.654  -14.641 153.142 1.00 95.29  ? 364  LEU B CG  1 
ATOM   5336  C CD1 . LEU B 1 363 ? 45.501  -14.671 151.629 1.00 90.96  ? 364  LEU B CD1 1 
ATOM   5337  C CD2 . LEU B 1 363 ? 45.424  -16.024 153.730 1.00 95.56  ? 364  LEU B CD2 1 
ATOM   5338  N N   . ALA B 1 364 ? 45.999  -10.927 152.661 1.00 111.05 ? 365  ALA B N   1 
ATOM   5339  C CA  . ALA B 1 364 ? 45.392  -9.670  153.094 1.00 114.01 ? 365  ALA B CA  1 
ATOM   5340  C C   . ALA B 1 364 ? 44.104  -9.867  153.892 1.00 114.97 ? 365  ALA B C   1 
ATOM   5341  O O   . ALA B 1 364 ? 43.139  -10.448 153.392 1.00 104.03 ? 365  ALA B O   1 
ATOM   5342  C CB  . ALA B 1 364 ? 45.140  -8.764  151.895 1.00 108.20 ? 365  ALA B CB  1 
ATOM   5343  N N   . PRO B 1 365 ? 44.090  -9.377  155.142 1.00 121.50 ? 366  PRO B N   1 
ATOM   5344  C CA  . PRO B 1 365 ? 42.924  -9.435  156.032 1.00 121.74 ? 366  PRO B CA  1 
ATOM   5345  C C   . PRO B 1 365 ? 41.847  -8.438  155.616 1.00 119.28 ? 366  PRO B C   1 
ATOM   5346  O O   . PRO B 1 365 ? 42.131  -7.513  154.856 1.00 119.62 ? 366  PRO B O   1 
ATOM   5347  C CB  . PRO B 1 365 ? 43.501  -9.032  157.397 1.00 120.60 ? 366  PRO B CB  1 
ATOM   5348  C CG  . PRO B 1 365 ? 44.992  -9.137  157.253 1.00 121.96 ? 366  PRO B CG  1 
ATOM   5349  C CD  . PRO B 1 365 ? 45.266  -8.814  155.824 1.00 121.65 ? 366  PRO B CD  1 
ATOM   5350  N N   . ARG B 1 366 ? 40.628  -8.626  156.111 1.00 114.05 ? 367  ARG B N   1 
ATOM   5351  C CA  . ARG B 1 366 ? 39.535  -7.713  155.797 1.00 112.39 ? 367  ARG B CA  1 
ATOM   5352  C C   . ARG B 1 366 ? 39.492  -6.532  156.762 1.00 103.95 ? 367  ARG B C   1 
ATOM   5353  O O   . ARG B 1 366 ? 39.651  -6.698  157.972 1.00 93.47  ? 367  ARG B O   1 
ATOM   5354  C CB  . ARG B 1 366 ? 38.192  -8.449  155.787 1.00 119.14 ? 367  ARG B CB  1 
ATOM   5355  C CG  . ARG B 1 366 ? 37.859  -9.196  157.069 1.00 122.20 ? 367  ARG B CG  1 
ATOM   5356  C CD  . ARG B 1 366 ? 36.438  -9.742  157.026 1.00 117.18 ? 367  ARG B CD  1 
ATOM   5357  N NE  . ARG B 1 366 ? 36.155  -10.638 158.143 1.00 121.28 ? 367  ARG B NE  1 
ATOM   5358  C CZ  . ARG B 1 366 ? 36.324  -11.956 158.103 1.00 122.35 ? 367  ARG B CZ  1 
ATOM   5359  N NH1 . ARG B 1 366 ? 36.776  -12.535 156.999 1.00 118.66 ? 367  ARG B NH1 1 
ATOM   5360  N NH2 . ARG B 1 366 ? 36.042  -12.696 159.167 1.00 123.43 ? 367  ARG B NH2 1 
ATOM   5361  N N   . GLU B 1 367 ? 39.279  -5.340  156.214 1.00 104.33 ? 368  GLU B N   1 
ATOM   5362  C CA  . GLU B 1 367 ? 39.246  -4.120  157.012 1.00 103.40 ? 368  GLU B CA  1 
ATOM   5363  C C   . GLU B 1 367 ? 38.381  -3.052  156.350 1.00 97.35  ? 368  GLU B C   1 
ATOM   5364  O O   . GLU B 1 367 ? 38.046  -3.157  155.169 1.00 91.43  ? 368  GLU B O   1 
ATOM   5365  C CB  . GLU B 1 367 ? 40.663  -3.585  157.236 1.00 106.92 ? 368  GLU B CB  1 
ATOM   5366  C CG  . GLU B 1 367 ? 41.369  -3.129  155.969 1.00 106.31 ? 368  GLU B CG  1 
ATOM   5367  C CD  . GLU B 1 367 ? 42.749  -2.559  156.244 1.00 103.86 ? 368  GLU B CD  1 
ATOM   5368  O OE1 . GLU B 1 367 ? 43.283  -2.794  157.348 1.00 96.79  ? 368  GLU B OE1 1 
ATOM   5369  O OE2 . GLU B 1 367 ? 43.298  -1.871  155.357 1.00 97.31  ? 368  GLU B OE2 1 
ATOM   5370  N N   . ARG B 1 368 ? 38.014  -2.035  157.124 1.00 98.92  ? 369  ARG B N   1 
ATOM   5371  C CA  . ARG B 1 368 ? 37.216  -0.919  156.625 1.00 102.44 ? 369  ARG B CA  1 
ATOM   5372  C C   . ARG B 1 368 ? 37.915  -0.239  155.448 1.00 103.11 ? 369  ARG B C   1 
ATOM   5373  O O   . ARG B 1 368 ? 39.102  0.080   155.533 1.00 94.91  ? 369  ARG B O   1 
ATOM   5374  C CB  . ARG B 1 368 ? 36.983  0.100   157.744 1.00 102.25 ? 369  ARG B CB  1 
ATOM   5375  C CG  . ARG B 1 368 ? 35.537  0.552   157.922 1.00 95.84  ? 369  ARG B CG  1 
ATOM   5376  C CD  . ARG B 1 368 ? 34.847  -0.197  159.057 1.00 104.93 ? 369  ARG B CD  1 
ATOM   5377  N NE  . ARG B 1 368 ? 34.120  -1.375  158.589 1.00 119.83 ? 369  ARG B NE  1 
ATOM   5378  C CZ  . ARG B 1 368 ? 33.454  -2.208  159.384 1.00 125.21 ? 369  ARG B CZ  1 
ATOM   5379  N NH1 . ARG B 1 368 ? 33.425  -1.999  160.693 1.00 125.77 ? 369  ARG B NH1 1 
ATOM   5380  N NH2 . ARG B 1 368 ? 32.818  -3.252  158.870 1.00 124.85 ? 369  ARG B NH2 1 
ATOM   5381  N N   . PRO B 1 369 ? 37.179  -0.031  154.342 1.00 100.15 ? 370  PRO B N   1 
ATOM   5382  C CA  . PRO B 1 369 ? 37.686  0.656   153.147 1.00 100.47 ? 370  PRO B CA  1 
ATOM   5383  C C   . PRO B 1 369 ? 38.310  2.008   153.495 1.00 107.92 ? 370  PRO B C   1 
ATOM   5384  O O   . PRO B 1 369 ? 37.815  2.681   154.400 1.00 107.23 ? 370  PRO B O   1 
ATOM   5385  C CB  . PRO B 1 369 ? 36.425  0.844   152.300 1.00 85.98  ? 370  PRO B CB  1 
ATOM   5386  C CG  . PRO B 1 369 ? 35.565  -0.309  152.675 1.00 75.75  ? 370  PRO B CG  1 
ATOM   5387  C CD  . PRO B 1 369 ? 35.802  -0.520  154.148 1.00 85.41  ? 370  PRO B CD  1 
ATOM   5388  N N   . PRO B 1 370 ? 39.382  2.398   152.780 1.00 105.32 ? 371  PRO B N   1 
ATOM   5389  C CA  . PRO B 1 370 ? 40.221  3.561   153.106 1.00 100.04 ? 371  PRO B CA  1 
ATOM   5390  C C   . PRO B 1 370 ? 39.434  4.857   153.291 1.00 103.48 ? 371  PRO B C   1 
ATOM   5391  O O   . PRO B 1 370 ? 39.673  5.590   154.251 1.00 92.79  ? 371  PRO B O   1 
ATOM   5392  C CB  . PRO B 1 370 ? 41.153  3.674   151.890 1.00 81.43  ? 371  PRO B CB  1 
ATOM   5393  C CG  . PRO B 1 370 ? 40.467  2.913   150.797 1.00 75.87  ? 371  PRO B CG  1 
ATOM   5394  C CD  . PRO B 1 370 ? 39.769  1.790   151.495 1.00 90.25  ? 371  PRO B CD  1 
ATOM   5395  N N   . SER B 1 371 ? 38.510  5.130   152.379 1.00 112.38 ? 372  SER B N   1 
ATOM   5396  C CA  . SER B 1 371 ? 37.630  6.284   152.492 1.00 110.97 ? 372  SER B CA  1 
ATOM   5397  C C   . SER B 1 371 ? 36.234  5.823   152.125 1.00 106.27 ? 372  SER B C   1 
ATOM   5398  O O   . SER B 1 371 ? 36.027  5.292   151.032 1.00 109.36 ? 372  SER B O   1 
ATOM   5399  C CB  . SER B 1 371 ? 38.071  7.392   151.539 1.00 112.16 ? 372  SER B CB  1 
ATOM   5400  O OG  . SER B 1 371 ? 37.850  7.014   150.190 1.00 108.59 ? 372  SER B OG  1 
ATOM   5401  N N   . GLY B 1 372 ? 35.276  5.999   153.028 1.00 97.80  ? 373  GLY B N   1 
ATOM   5402  C CA  . GLY B 1 372 ? 33.947  5.503   152.744 1.00 94.47  ? 373  GLY B CA  1 
ATOM   5403  C C   . GLY B 1 372 ? 33.318  6.257   151.592 1.00 83.00  ? 373  GLY B C   1 
ATOM   5404  O O   . GLY B 1 372 ? 33.071  7.461   151.670 1.00 80.01  ? 373  GLY B O   1 
ATOM   5405  N N   . THR B 1 373 ? 33.052  5.526   150.518 1.00 70.35  ? 374  THR B N   1 
ATOM   5406  C CA  . THR B 1 373 ? 32.268  6.024   149.403 1.00 59.91  ? 374  THR B CA  1 
ATOM   5407  C C   . THR B 1 373 ? 30.807  5.815   149.756 1.00 55.88  ? 374  THR B C   1 
ATOM   5408  O O   . THR B 1 373 ? 29.951  6.663   149.498 1.00 41.70  ? 374  THR B O   1 
ATOM   5409  C CB  . THR B 1 373 ? 32.624  5.280   148.103 1.00 46.95  ? 374  THR B CB  1 
ATOM   5410  O OG1 . THR B 1 373 ? 33.923  5.694   147.660 1.00 40.17  ? 374  THR B OG1 1 
ATOM   5411  C CG2 . THR B 1 373 ? 31.606  5.575   147.014 1.00 50.82  ? 374  THR B CG2 1 
ATOM   5412  N N   . LEU B 1 374 ? 30.550  4.669   150.377 1.00 56.52  ? 375  LEU B N   1 
ATOM   5413  C CA  . LEU B 1 374 ? 29.208  4.248   150.741 1.00 55.46  ? 375  LEU B CA  1 
ATOM   5414  C C   . LEU B 1 374 ? 28.568  5.200   151.741 1.00 54.41  ? 375  LEU B C   1 
ATOM   5415  O O   . LEU B 1 374 ? 27.358  5.397   151.719 1.00 70.61  ? 375  LEU B O   1 
ATOM   5416  C CB  . LEU B 1 374 ? 29.247  2.833   151.318 1.00 43.76  ? 375  LEU B CB  1 
ATOM   5417  C CG  . LEU B 1 374 ? 27.919  2.085   151.413 1.00 43.79  ? 375  LEU B CG  1 
ATOM   5418  C CD1 . LEU B 1 374 ? 27.297  1.941   150.035 1.00 51.25  ? 375  LEU B CD1 1 
ATOM   5419  C CD2 . LEU B 1 374 ? 28.129  0.724   152.053 1.00 51.99  ? 375  LEU B CD2 1 
ATOM   5420  N N   . GLU B 1 375 ? 29.378  5.790   152.613 1.00 34.30  ? 376  GLU B N   1 
ATOM   5421  C CA  . GLU B 1 375 ? 28.858  6.709   153.619 1.00 53.53  ? 376  GLU B CA  1 
ATOM   5422  C C   . GLU B 1 375 ? 28.339  7.991   152.975 1.00 66.09  ? 376  GLU B C   1 
ATOM   5423  O O   . GLU B 1 375 ? 27.253  8.471   153.305 1.00 78.94  ? 376  GLU B O   1 
ATOM   5424  C CB  . GLU B 1 375 ? 29.929  7.039   154.659 1.00 70.68  ? 376  GLU B CB  1 
ATOM   5425  C CG  . GLU B 1 375 ? 29.400  7.819   155.852 1.00 90.14  ? 376  GLU B CG  1 
ATOM   5426  C CD  . GLU B 1 375 ? 30.484  8.173   156.849 1.00 107.18 ? 376  GLU B CD  1 
ATOM   5427  O OE1 . GLU B 1 375 ? 31.655  8.301   156.435 1.00 117.95 ? 376  GLU B OE1 1 
ATOM   5428  O OE2 . GLU B 1 375 ? 30.165  8.321   158.048 1.00 103.69 ? 376  GLU B OE2 1 
ATOM   5429  N N   . LYS B 1 376 ? 29.120  8.536   152.049 1.00 51.74  ? 377  LYS B N   1 
ATOM   5430  C CA  . LYS B 1 376 ? 28.750  9.765   151.358 1.00 49.68  ? 377  LYS B CA  1 
ATOM   5431  C C   . LYS B 1 376 ? 27.588  9.526   150.401 1.00 52.29  ? 377  LYS B C   1 
ATOM   5432  O O   . LYS B 1 376 ? 26.664  10.341  150.315 1.00 68.06  ? 377  LYS B O   1 
ATOM   5433  C CB  . LYS B 1 376 ? 29.951  10.339  150.606 1.00 55.72  ? 377  LYS B CB  1 
ATOM   5434  C CG  . LYS B 1 376 ? 31.164  10.580  151.489 1.00 39.19  ? 377  LYS B CG  1 
ATOM   5435  C CD  . LYS B 1 376 ? 32.296  11.229  150.717 1.00 45.54  ? 377  LYS B CD  1 
ATOM   5436  C CE  . LYS B 1 376 ? 33.558  11.298  151.562 1.00 67.60  ? 377  LYS B CE  1 
ATOM   5437  N NZ  . LYS B 1 376 ? 33.332  12.010  152.850 1.00 76.03  ? 377  LYS B NZ  1 
ATOM   5438  N N   . LEU B 1 377 ? 27.640  8.405   149.685 1.00 35.35  ? 378  LEU B N   1 
ATOM   5439  C CA  . LEU B 1 377 ? 26.557  8.020   148.787 1.00 32.95  ? 378  LEU B CA  1 
ATOM   5440  C C   . LEU B 1 377 ? 25.250  7.843   149.551 1.00 36.77  ? 378  LEU B C   1 
ATOM   5441  O O   . LEU B 1 377 ? 24.196  8.280   149.094 1.00 40.90  ? 378  LEU B O   1 
ATOM   5442  C CB  . LEU B 1 377 ? 26.894  6.730   148.036 1.00 26.72  ? 378  LEU B CB  1 
ATOM   5443  C CG  . LEU B 1 377 ? 27.888  6.807   146.877 1.00 41.33  ? 378  LEU B CG  1 
ATOM   5444  C CD1 . LEU B 1 377 ? 27.881  5.499   146.098 1.00 46.80  ? 378  LEU B CD1 1 
ATOM   5445  C CD2 . LEU B 1 377 ? 27.576  7.984   145.964 1.00 16.51  ? 378  LEU B CD2 1 
ATOM   5446  N N   . VAL B 1 378 ? 25.328  7.203   150.714 1.00 28.19  ? 379  VAL B N   1 
ATOM   5447  C CA  . VAL B 1 378 ? 24.152  6.968   151.548 1.00 35.09  ? 379  VAL B CA  1 
ATOM   5448  C C   . VAL B 1 378 ? 23.640  8.266   152.173 1.00 46.63  ? 379  VAL B C   1 
ATOM   5449  O O   . VAL B 1 378 ? 22.438  8.442   152.351 1.00 43.48  ? 379  VAL B O   1 
ATOM   5450  C CB  . VAL B 1 378 ? 24.425  5.885   152.626 1.00 34.74  ? 379  VAL B CB  1 
ATOM   5451  C CG1 . VAL B 1 378 ? 23.533  6.060   153.848 1.00 45.50  ? 379  VAL B CG1 1 
ATOM   5452  C CG2 . VAL B 1 378 ? 24.253  4.498   152.030 1.00 39.96  ? 379  VAL B CG2 1 
ATOM   5453  N N   . SER B 1 379 ? 24.551  9.180   152.487 1.00 47.91  ? 380  SER B N   1 
ATOM   5454  C CA  . SER B 1 379 ? 24.160  10.476  153.033 1.00 44.86  ? 380  SER B CA  1 
ATOM   5455  C C   . SER B 1 379 ? 23.391  11.286  151.986 1.00 47.37  ? 380  SER B C   1 
ATOM   5456  O O   . SER B 1 379 ? 22.296  11.805  152.251 1.00 37.99  ? 380  SER B O   1 
ATOM   5457  C CB  . SER B 1 379 ? 25.395  11.247  153.501 1.00 41.95  ? 380  SER B CB  1 
ATOM   5458  O OG  . SER B 1 379 ? 25.098  12.055  154.627 1.00 48.34  ? 380  SER B OG  1 
ATOM   5459  N N   . GLU B 1 380 ? 23.973  11.379  150.793 1.00 47.20  ? 381  GLU B N   1 
ATOM   5460  C CA  . GLU B 1 380 ? 23.346  12.085  149.682 1.00 39.15  ? 381  GLU B CA  1 
ATOM   5461  C C   . GLU B 1 380 ? 22.014  11.439  149.316 1.00 50.80  ? 381  GLU B C   1 
ATOM   5462  O O   . GLU B 1 380 ? 21.050  12.129  148.982 1.00 46.18  ? 381  GLU B O   1 
ATOM   5463  C CB  . GLU B 1 380 ? 24.282  12.111  148.469 1.00 38.23  ? 381  GLU B CB  1 
ATOM   5464  C CG  . GLU B 1 380 ? 24.496  13.494  147.869 1.00 56.38  ? 381  GLU B CG  1 
ATOM   5465  C CD  . GLU B 1 380 ? 23.345  13.938  146.987 1.00 72.07  ? 381  GLU B CD  1 
ATOM   5466  O OE1 . GLU B 1 380 ? 22.967  13.172  146.075 1.00 78.57  ? 381  GLU B OE1 1 
ATOM   5467  O OE2 . GLU B 1 380 ? 22.817  15.050  147.204 1.00 64.98  ? 381  GLU B OE2 1 
ATOM   5468  N N   . ALA B 1 381 ? 21.968  10.111  149.396 1.00 62.00  ? 382  ALA B N   1 
ATOM   5469  C CA  . ALA B 1 381 ? 20.754  9.357   149.101 1.00 48.65  ? 382  ALA B CA  1 
ATOM   5470  C C   . ALA B 1 381 ? 19.659  9.645   150.123 1.00 51.05  ? 382  ALA B C   1 
ATOM   5471  O O   . ALA B 1 381 ? 18.505  9.858   149.759 1.00 52.02  ? 382  ALA B O   1 
ATOM   5472  C CB  . ALA B 1 381 ? 21.051  7.868   149.054 1.00 37.61  ? 382  ALA B CB  1 
ATOM   5473  N N   . LYS B 1 382 ? 20.028  9.643   151.400 1.00 39.18  ? 383  LYS B N   1 
ATOM   5474  C CA  . LYS B 1 382 ? 19.091  9.960   152.471 1.00 37.39  ? 383  LYS B CA  1 
ATOM   5475  C C   . LYS B 1 382 ? 18.522  11.352  152.274 1.00 43.33  ? 383  LYS B C   1 
ATOM   5476  O O   . LYS B 1 382 ? 17.319  11.555  152.409 1.00 54.51  ? 383  LYS B O   1 
ATOM   5477  C CB  . LYS B 1 382 ? 19.754  9.863   153.847 1.00 25.26  ? 383  LYS B CB  1 
ATOM   5478  C CG  . LYS B 1 382 ? 19.854  8.453   154.399 1.00 34.30  ? 383  LYS B CG  1 
ATOM   5479  C CD  . LYS B 1 382 ? 20.233  8.474   155.871 1.00 42.04  ? 383  LYS B CD  1 
ATOM   5480  C CE  . LYS B 1 382 ? 20.276  7.071   156.452 1.00 53.52  ? 383  LYS B CE  1 
ATOM   5481  N NZ  . LYS B 1 382 ? 20.556  7.077   157.915 1.00 53.88  ? 383  LYS B NZ  1 
ATOM   5482  N N   . ALA B 1 383 ? 19.388  12.306  151.949 1.00 48.50  ? 384  ALA B N   1 
ATOM   5483  C CA  . ALA B 1 383 ? 18.939  13.672  151.701 1.00 43.82  ? 384  ALA B CA  1 
ATOM   5484  C C   . ALA B 1 383 ? 17.953  13.744  150.532 1.00 44.52  ? 384  ALA B C   1 
ATOM   5485  O O   . ALA B 1 383 ? 16.835  14.260  150.677 1.00 48.54  ? 384  ALA B O   1 
ATOM   5486  C CB  . ALA B 1 383 ? 20.131  14.583  151.455 1.00 32.17  ? 384  ALA B CB  1 
ATOM   5487  N N   . GLN B 1 384 ? 18.369  13.216  149.383 1.00 33.82  ? 385  GLN B N   1 
ATOM   5488  C CA  . GLN B 1 384 ? 17.553  13.260  148.170 1.00 45.02  ? 385  GLN B CA  1 
ATOM   5489  C C   . GLN B 1 384 ? 16.205  12.559  148.330 1.00 62.25  ? 385  GLN B C   1 
ATOM   5490  O O   . GLN B 1 384 ? 15.187  13.045  147.838 1.00 67.34  ? 385  GLN B O   1 
ATOM   5491  C CB  . GLN B 1 384 ? 18.314  12.673  146.978 1.00 30.41  ? 385  GLN B CB  1 
ATOM   5492  C CG  . GLN B 1 384 ? 19.509  13.501  146.532 1.00 41.70  ? 385  GLN B CG  1 
ATOM   5493  C CD  . GLN B 1 384 ? 19.115  14.876  146.028 1.00 61.34  ? 385  GLN B CD  1 
ATOM   5494  O OE1 . GLN B 1 384 ? 18.737  15.040  144.867 1.00 60.59  ? 385  GLN B OE1 1 
ATOM   5495  N NE2 . GLN B 1 384 ? 19.208  15.876  146.898 1.00 72.43  ? 385  GLN B NE2 1 
ATOM   5496  N N   . LEU B 1 385 ? 16.199  11.420  149.015 1.00 63.75  ? 386  LEU B N   1 
ATOM   5497  C CA  . LEU B 1 385 ? 14.959  10.688  149.252 1.00 58.81  ? 386  LEU B CA  1 
ATOM   5498  C C   . LEU B 1 385 ? 14.072  11.420  150.253 1.00 51.86  ? 386  LEU B C   1 
ATOM   5499  O O   . LEU B 1 385 ? 12.857  11.487  150.079 1.00 59.55  ? 386  LEU B O   1 
ATOM   5500  C CB  . LEU B 1 385 ? 15.239  9.259   149.732 1.00 43.80  ? 386  LEU B CB  1 
ATOM   5501  C CG  . LEU B 1 385 ? 15.876  8.298   148.723 1.00 30.49  ? 386  LEU B CG  1 
ATOM   5502  C CD1 . LEU B 1 385 ? 16.045  6.910   149.327 1.00 32.88  ? 386  LEU B CD1 1 
ATOM   5503  C CD2 . LEU B 1 385 ? 15.065  8.233   147.438 1.00 14.58  ? 386  LEU B CD2 1 
ATOM   5504  N N   . ARG B 1 386 ? 14.685  11.971  151.297 1.00 50.99  ? 387  ARG B N   1 
ATOM   5505  C CA  . ARG B 1 386 ? 13.940  12.688  152.326 1.00 54.25  ? 387  ARG B CA  1 
ATOM   5506  C C   . ARG B 1 386 ? 13.249  13.911  151.742 1.00 51.69  ? 387  ARG B C   1 
ATOM   5507  O O   . ARG B 1 386 ? 12.149  14.269  152.162 1.00 62.19  ? 387  ARG B O   1 
ATOM   5508  C CB  . ARG B 1 386 ? 14.859  13.113  153.475 1.00 60.59  ? 387  ARG B CB  1 
ATOM   5509  C CG  . ARG B 1 386 ? 14.124  13.625  154.706 1.00 76.48  ? 387  ARG B CG  1 
ATOM   5510  C CD  . ARG B 1 386 ? 13.935  12.529  155.751 1.00 100.42 ? 387  ARG B CD  1 
ATOM   5511  N NE  . ARG B 1 386 ? 13.229  11.362  155.229 1.00 114.47 ? 387  ARG B NE  1 
ATOM   5512  C CZ  . ARG B 1 386 ? 12.959  10.273  155.942 1.00 115.03 ? 387  ARG B CZ  1 
ATOM   5513  N NH1 . ARG B 1 386 ? 13.336  10.201  157.211 1.00 118.58 ? 387  ARG B NH1 1 
ATOM   5514  N NH2 . ARG B 1 386 ? 12.313  9.255   155.388 1.00 105.39 ? 387  ARG B NH2 1 
ATOM   5515  N N   . ASP B 1 387 ? 13.897  14.547  150.771 1.00 50.40  ? 388  ASP B N   1 
ATOM   5516  C CA  . ASP B 1 387 ? 13.336  15.741  150.149 1.00 50.38  ? 388  ASP B CA  1 
ATOM   5517  C C   . ASP B 1 387 ? 12.068  15.443  149.344 1.00 57.74  ? 388  ASP B C   1 
ATOM   5518  O O   . ASP B 1 387 ? 11.127  16.238  149.338 1.00 68.60  ? 388  ASP B O   1 
ATOM   5519  C CB  . ASP B 1 387 ? 14.373  16.415  149.250 1.00 61.32  ? 388  ASP B CB  1 
ATOM   5520  C CG  . ASP B 1 387 ? 13.934  17.788  148.788 1.00 78.23  ? 388  ASP B CG  1 
ATOM   5521  O OD1 . ASP B 1 387 ? 13.439  18.566  149.631 1.00 84.96  ? 388  ASP B OD1 1 
ATOM   5522  O OD2 . ASP B 1 387 ? 14.076  18.086  147.583 1.00 77.88  ? 388  ASP B OD2 1 
ATOM   5523  N N   . VAL B 1 388 ? 12.049  14.296  148.672 1.00 38.44  ? 389  VAL B N   1 
ATOM   5524  C CA  . VAL B 1 388 ? 10.946  13.935  147.781 1.00 18.51  ? 389  VAL B CA  1 
ATOM   5525  C C   . VAL B 1 388 ? 9.853   13.069  148.414 1.00 28.01  ? 389  VAL B C   1 
ATOM   5526  O O   . VAL B 1 388 ? 8.979   12.566  147.709 1.00 42.60  ? 389  VAL B O   1 
ATOM   5527  C CB  . VAL B 1 388 ? 11.445  13.282  146.477 1.00 22.93  ? 389  VAL B CB  1 
ATOM   5528  C CG1 . VAL B 1 388 ? 12.287  14.271  145.687 1.00 26.12  ? 389  VAL B CG1 1 
ATOM   5529  C CG2 . VAL B 1 388 ? 12.229  12.013  146.777 1.00 30.09  ? 389  VAL B CG2 1 
ATOM   5530  N N   . GLN B 1 389 ? 9.929   12.863  149.727 1.00 23.02  ? 390  GLN B N   1 
ATOM   5531  C CA  . GLN B 1 389 ? 8.914   12.099  150.459 1.00 28.52  ? 390  GLN B CA  1 
ATOM   5532  C C   . GLN B 1 389 ? 7.476   12.543  150.162 1.00 34.05  ? 390  GLN B C   1 
ATOM   5533  O O   . GLN B 1 389 ? 6.576   11.712  150.031 1.00 51.59  ? 390  GLN B O   1 
ATOM   5534  C CB  . GLN B 1 389 ? 9.174   12.174  151.967 1.00 27.25  ? 390  GLN B CB  1 
ATOM   5535  C CG  . GLN B 1 389 ? 10.275  11.248  152.465 1.00 70.21  ? 390  GLN B CG  1 
ATOM   5536  C CD  . GLN B 1 389 ? 9.747   9.899   152.923 1.00 86.69  ? 390  GLN B CD  1 
ATOM   5537  O OE1 . GLN B 1 389 ? 10.480  8.910   152.954 1.00 81.92  ? 390  GLN B OE1 1 
ATOM   5538  N NE2 . GLN B 1 389 ? 8.472   9.856   153.294 1.00 87.29  ? 390  GLN B NE2 1 
ATOM   5539  N N   . ASP B 1 390 ? 7.270   13.852  150.054 1.00 36.86  ? 391  ASP B N   1 
ATOM   5540  C CA  . ASP B 1 390 ? 5.935   14.420  149.858 1.00 42.10  ? 391  ASP B CA  1 
ATOM   5541  C C   . ASP B 1 390 ? 5.559   14.663  148.394 1.00 44.47  ? 391  ASP B C   1 
ATOM   5542  O O   . ASP B 1 390 ? 4.524   15.267  148.114 1.00 40.03  ? 391  ASP B O   1 
ATOM   5543  C CB  . ASP B 1 390 ? 5.753   15.704  150.677 1.00 26.63  ? 391  ASP B CB  1 
ATOM   5544  C CG  . ASP B 1 390 ? 6.792   16.762  150.355 1.00 55.39  ? 391  ASP B CG  1 
ATOM   5545  O OD1 . ASP B 1 390 ? 7.515   16.616  149.346 1.00 61.12  ? 391  ASP B OD1 1 
ATOM   5546  O OD2 . ASP B 1 390 ? 6.880   17.749  151.116 1.00 62.90  ? 391  ASP B OD2 1 
ATOM   5547  N N   . PHE B 1 391 ? 6.402   14.194  147.477 1.00 41.40  ? 392  PHE B N   1 
ATOM   5548  C CA  . PHE B 1 391 ? 6.318   14.546  146.055 1.00 46.59  ? 392  PHE B CA  1 
ATOM   5549  C C   . PHE B 1 391 ? 4.912   14.488  145.452 1.00 47.66  ? 392  PHE B C   1 
ATOM   5550  O O   . PHE B 1 391 ? 4.539   15.352  144.659 1.00 54.69  ? 392  PHE B O   1 
ATOM   5551  C CB  . PHE B 1 391 ? 7.265   13.657  145.237 1.00 25.32  ? 392  PHE B CB  1 
ATOM   5552  C CG  . PHE B 1 391 ? 7.215   13.909  143.752 1.00 21.60  ? 392  PHE B CG  1 
ATOM   5553  C CD1 . PHE B 1 391 ? 7.998   14.896  143.179 1.00 22.35  ? 392  PHE B CD1 1 
ATOM   5554  C CD2 . PHE B 1 391 ? 6.397   13.147  142.929 1.00 30.08  ? 392  PHE B CD2 1 
ATOM   5555  C CE1 . PHE B 1 391 ? 7.960   15.129  141.815 1.00 29.11  ? 392  PHE B CE1 1 
ATOM   5556  C CE2 . PHE B 1 391 ? 6.353   13.376  141.563 1.00 30.46  ? 392  PHE B CE2 1 
ATOM   5557  C CZ  . PHE B 1 391 ? 7.138   14.369  141.006 1.00 25.05  ? 392  PHE B CZ  1 
ATOM   5558  N N   . TRP B 1 392 ? 4.135   13.481  145.829 1.00 45.39  ? 393  TRP B N   1 
ATOM   5559  C CA  . TRP B 1 392 ? 2.825   13.275  145.217 1.00 52.43  ? 393  TRP B CA  1 
ATOM   5560  C C   . TRP B 1 392 ? 1.737   14.226  145.719 1.00 44.81  ? 393  TRP B C   1 
ATOM   5561  O O   . TRP B 1 392 ? 0.807   14.551  144.982 1.00 43.85  ? 393  TRP B O   1 
ATOM   5562  C CB  . TRP B 1 392 ? 2.390   11.814  145.354 1.00 37.97  ? 393  TRP B CB  1 
ATOM   5563  C CG  . TRP B 1 392 ? 3.324   10.883  144.661 1.00 22.80  ? 393  TRP B CG  1 
ATOM   5564  C CD1 . TRP B 1 392 ? 4.202   10.017  145.242 1.00 28.01  ? 393  TRP B CD1 1 
ATOM   5565  C CD2 . TRP B 1 392 ? 3.502   10.746  143.247 1.00 28.25  ? 393  TRP B CD2 1 
ATOM   5566  N NE1 . TRP B 1 392 ? 4.904   9.338   144.278 1.00 31.29  ? 393  TRP B NE1 1 
ATOM   5567  C CE2 . TRP B 1 392 ? 4.493   9.768   143.043 1.00 24.47  ? 393  TRP B CE2 1 
ATOM   5568  C CE3 . TRP B 1 392 ? 2.912   11.351  142.132 1.00 42.81  ? 393  TRP B CE3 1 
ATOM   5569  C CZ2 . TRP B 1 392 ? 4.911   9.380   141.773 1.00 32.74  ? 393  TRP B CZ2 1 
ATOM   5570  C CZ3 . TRP B 1 392 ? 3.327   10.965  140.871 1.00 45.23  ? 393  TRP B CZ3 1 
ATOM   5571  C CH2 . TRP B 1 392 ? 4.317   9.989   140.702 1.00 47.16  ? 393  TRP B CH2 1 
ATOM   5572  N N   . ILE B 1 393 ? 1.843   14.659  146.971 1.00 30.60  ? 394  ILE B N   1 
ATOM   5573  C CA  . ILE B 1 393 ? 0.902   15.638  147.502 1.00 30.57  ? 394  ILE B CA  1 
ATOM   5574  C C   . ILE B 1 393 ? 1.443   17.066  147.430 1.00 44.90  ? 394  ILE B C   1 
ATOM   5575  O O   . ILE B 1 393 ? 0.736   18.018  147.755 1.00 52.33  ? 394  ILE B O   1 
ATOM   5576  C CB  . ILE B 1 393 ? 0.505   15.317  148.957 1.00 27.07  ? 394  ILE B CB  1 
ATOM   5577  C CG1 . ILE B 1 393 ? 1.711   15.464  149.887 1.00 21.76  ? 394  ILE B CG1 1 
ATOM   5578  C CG2 . ILE B 1 393 ? -0.082  13.919  149.048 1.00 36.48  ? 394  ILE B CG2 1 
ATOM   5579  C CD1 . ILE B 1 393 ? 1.389   15.219  151.347 1.00 16.38  ? 394  ILE B CD1 1 
ATOM   5580  N N   . SER B 1 394 ? 2.692   17.211  146.995 1.00 56.78  ? 395  SER B N   1 
ATOM   5581  C CA  . SER B 1 394 ? 3.350   18.518  146.965 1.00 56.94  ? 395  SER B CA  1 
ATOM   5582  C C   . SER B 1 394 ? 3.208   19.242  145.625 1.00 56.89  ? 395  SER B C   1 
ATOM   5583  O O   . SER B 1 394 ? 3.576   20.411  145.504 1.00 48.89  ? 395  SER B O   1 
ATOM   5584  C CB  . SER B 1 394 ? 4.832   18.378  147.319 1.00 59.66  ? 395  SER B CB  1 
ATOM   5585  O OG  . SER B 1 394 ? 5.536   17.694  146.297 1.00 63.54  ? 395  SER B OG  1 
ATOM   5586  N N   . LEU B 1 395 ? 2.680   18.545  144.624 1.00 57.49  ? 396  LEU B N   1 
ATOM   5587  C CA  . LEU B 1 395 ? 2.536   19.116  143.284 1.00 57.71  ? 396  LEU B CA  1 
ATOM   5588  C C   . LEU B 1 395 ? 1.706   20.414  143.219 1.00 67.05  ? 396  LEU B C   1 
ATOM   5589  O O   . LEU B 1 395 ? 2.174   21.406  142.651 1.00 65.16  ? 396  LEU B O   1 
ATOM   5590  C CB  . LEU B 1 395 ? 2.014   18.068  142.290 1.00 60.84  ? 396  LEU B CB  1 
ATOM   5591  C CG  . LEU B 1 395 ? 2.873   16.814  142.097 1.00 66.09  ? 396  LEU B CG  1 
ATOM   5592  C CD1 . LEU B 1 395 ? 2.237   15.863  141.088 1.00 55.35  ? 396  LEU B CD1 1 
ATOM   5593  C CD2 . LEU B 1 395 ? 4.288   17.185  141.672 1.00 61.23  ? 396  LEU B CD2 1 
ATOM   5594  N N   . PRO B 1 396 ? 0.483   20.421  143.795 1.00 70.49  ? 397  PRO B N   1 
ATOM   5595  C CA  . PRO B 1 396 ? -0.323  21.646  143.720 1.00 60.88  ? 397  PRO B CA  1 
ATOM   5596  C C   . PRO B 1 396 ? 0.349   22.831  144.406 1.00 54.09  ? 397  PRO B C   1 
ATOM   5597  O O   . PRO B 1 396 ? 0.378   23.931  143.850 1.00 52.49  ? 397  PRO B O   1 
ATOM   5598  C CB  . PRO B 1 396 ? -1.608  21.266  144.468 1.00 61.68  ? 397  PRO B CB  1 
ATOM   5599  C CG  . PRO B 1 396 ? -1.670  19.793  144.390 1.00 71.91  ? 397  PRO B CG  1 
ATOM   5600  C CD  . PRO B 1 396 ? -0.246  19.351  144.499 1.00 74.69  ? 397  PRO B CD  1 
ATOM   5601  N N   . GLY B 1 397 ? 0.893   22.600  145.597 1.00 52.98  ? 398  GLY B N   1 
ATOM   5602  C CA  . GLY B 1 397 ? 1.577   23.645  146.335 1.00 58.61  ? 398  GLY B CA  1 
ATOM   5603  C C   . GLY B 1 397 ? 2.774   24.187  145.580 1.00 59.42  ? 398  GLY B C   1 
ATOM   5604  O O   . GLY B 1 397 ? 2.931   25.397  145.439 1.00 49.80  ? 398  GLY B O   1 
ATOM   5605  N N   . THR B 1 398 ? 3.615   23.286  145.085 1.00 66.71  ? 399  THR B N   1 
ATOM   5606  C CA  . THR B 1 398 ? 4.797   23.679  144.324 1.00 62.55  ? 399  THR B CA  1 
ATOM   5607  C C   . THR B 1 398 ? 4.432   24.506  143.090 1.00 59.87  ? 399  THR B C   1 
ATOM   5608  O O   . THR B 1 398 ? 4.932   25.611  142.910 1.00 63.12  ? 399  THR B O   1 
ATOM   5609  C CB  . THR B 1 398 ? 5.633   22.453  143.900 1.00 65.27  ? 399  THR B CB  1 
ATOM   5610  O OG1 . THR B 1 398 ? 6.370   21.959  145.026 1.00 74.90  ? 399  THR B OG1 1 
ATOM   5611  C CG2 . THR B 1 398 ? 6.610   22.825  142.796 1.00 59.54  ? 399  THR B CG2 1 
ATOM   5612  N N   . LEU B 1 399 ? 3.546   23.974  142.252 1.00 63.93  ? 400  LEU B N   1 
ATOM   5613  C CA  . LEU B 1 399 ? 3.177   24.654  141.013 1.00 59.44  ? 400  LEU B CA  1 
ATOM   5614  C C   . LEU B 1 399 ? 2.511   26.007  141.272 1.00 72.74  ? 400  LEU B C   1 
ATOM   5615  O O   . LEU B 1 399 ? 2.972   27.040  140.757 1.00 92.75  ? 400  LEU B O   1 
ATOM   5616  C CB  . LEU B 1 399 ? 2.268   23.772  140.159 1.00 60.28  ? 400  LEU B CB  1 
ATOM   5617  C CG  . LEU B 1 399 ? 2.940   22.860  139.135 1.00 75.18  ? 400  LEU B CG  1 
ATOM   5618  C CD1 . LEU B 1 399 ? 3.913   21.904  139.805 1.00 71.45  ? 400  LEU B CD1 1 
ATOM   5619  C CD2 . LEU B 1 399 ? 1.902   22.083  138.355 1.00 83.63  ? 400  LEU B CD2 1 
ATOM   5620  N N   . CYS B 1 400 ? 1.444   25.994  142.074 1.00 68.33  ? 401  CYS B N   1 
ATOM   5621  C CA  . CYS B 1 400 ? 0.702   27.211  142.408 1.00 76.34  ? 401  CYS B CA  1 
ATOM   5622  C C   . CYS B 1 400 ? 1.563   28.267  143.083 1.00 86.28  ? 401  CYS B C   1 
ATOM   5623  O O   . CYS B 1 400 ? 1.684   29.382  142.580 1.00 102.99 ? 401  CYS B O   1 
ATOM   5624  C CB  . CYS B 1 400 ? -0.491  26.891  143.307 1.00 84.20  ? 401  CYS B CB  1 
ATOM   5625  S SG  . CYS B 1 400 ? -1.825  26.028  142.472 1.00 85.10  ? 401  CYS B SG  1 
ATOM   5626  N N   . SER B 1 401 ? 2.166   27.911  144.214 1.00 92.88  ? 402  SER B N   1 
ATOM   5627  C CA  . SER B 1 401 ? 2.923   28.873  145.012 1.00 102.27 ? 402  SER B CA  1 
ATOM   5628  C C   . SER B 1 401 ? 4.237   29.311  144.359 1.00 100.85 ? 402  SER B C   1 
ATOM   5629  O O   . SER B 1 401 ? 4.534   30.505  144.309 1.00 97.12  ? 402  SER B O   1 
ATOM   5630  C CB  . SER B 1 401 ? 3.192   28.329  146.419 1.00 101.47 ? 402  SER B CB  1 
ATOM   5631  O OG  . SER B 1 401 ? 3.771   29.321  147.252 1.00 106.68 ? 402  SER B OG  1 
ATOM   5632  N N   . GLU B 1 402 ? 5.022   28.360  143.858 1.00 109.64 ? 403  GLU B N   1 
ATOM   5633  C CA  . GLU B 1 402 ? 6.309   28.712  143.260 1.00 128.64 ? 403  GLU B CA  1 
ATOM   5634  C C   . GLU B 1 402 ? 6.162   29.402  141.901 1.00 133.09 ? 403  GLU B C   1 
ATOM   5635  O O   . GLU B 1 402 ? 6.808   30.426  141.664 1.00 134.82 ? 403  GLU B O   1 
ATOM   5636  C CB  . GLU B 1 402 ? 7.238   27.499  143.145 1.00 139.99 ? 403  GLU B CB  1 
ATOM   5637  C CG  . GLU B 1 402 ? 7.506   26.779  144.465 1.00 148.93 ? 403  GLU B CG  1 
ATOM   5638  C CD  . GLU B 1 402 ? 8.389   25.557  144.291 1.00 154.91 ? 403  GLU B CD  1 
ATOM   5639  O OE1 . GLU B 1 402 ? 8.968   25.393  143.197 1.00 154.13 ? 403  GLU B OE1 1 
ATOM   5640  O OE2 . GLU B 1 402 ? 8.505   24.757  145.243 1.00 157.35 ? 403  GLU B OE2 1 
ATOM   5641  N N   . LYS B 1 403 ? 5.331   28.871  141.004 1.00 135.74 ? 404  LYS B N   1 
ATOM   5642  C CA  . LYS B 1 403 ? 5.255   29.500  139.685 1.00 142.46 ? 404  LYS B CA  1 
ATOM   5643  C C   . LYS B 1 403 ? 3.856   29.954  139.271 1.00 150.55 ? 404  LYS B C   1 
ATOM   5644  O O   . LYS B 1 403 ? 3.530   31.141  139.366 1.00 147.64 ? 404  LYS B O   1 
ATOM   5645  C CB  . LYS B 1 403 ? 5.846   28.567  138.623 1.00 136.20 ? 404  LYS B CB  1 
ATOM   5646  C CG  . LYS B 1 403 ? 7.334   28.273  138.816 1.00 141.32 ? 404  LYS B CG  1 
ATOM   5647  C CD  . LYS B 1 403 ? 7.898   27.387  137.708 1.00 149.99 ? 404  LYS B CD  1 
ATOM   5648  C CE  . LYS B 1 403 ? 9.390   27.141  137.902 1.00 154.93 ? 404  LYS B CE  1 
ATOM   5649  N NZ  . LYS B 1 403 ? 9.973   26.289  136.827 1.00 155.37 ? 404  LYS B NZ  1 
ATOM   5650  N N   . MET B 1 404 ? 3.040   28.982  138.860 1.00 156.12 ? 405  MET B N   1 
ATOM   5651  C CA  . MET B 1 404 ? 1.723   29.190  138.236 1.00 159.82 ? 405  MET B CA  1 
ATOM   5652  C C   . MET B 1 404 ? 1.439   30.605  137.717 1.00 159.58 ? 405  MET B C   1 
ATOM   5653  O O   . MET B 1 404 ? 2.170   31.125  136.871 1.00 158.90 ? 405  MET B O   1 
ATOM   5654  C CB  . MET B 1 404 ? 0.601   28.726  139.171 1.00 160.80 ? 405  MET B CB  1 
ATOM   5655  C CG  . MET B 1 404 ? -0.788  28.755  138.542 1.00 160.01 ? 405  MET B CG  1 
ATOM   5656  S SD  . MET B 1 404 ? -0.944  27.739  137.058 1.00 126.96 ? 405  MET B SD  1 
ATOM   5657  C CE  . MET B 1 404 ? -0.542  26.113  137.692 1.00 47.92  ? 405  MET B CE  1 
ATOM   5658  N N   . ARG B 1 413 ? -5.830  41.560  145.860 1.00 81.06  ? 414  ARG B N   1 
ATOM   5659  C CA  . ARG B 1 413 ? -7.024  41.261  145.074 1.00 95.12  ? 414  ARG B CA  1 
ATOM   5660  C C   . ARG B 1 413 ? -6.740  40.224  143.992 1.00 94.15  ? 414  ARG B C   1 
ATOM   5661  O O   . ARG B 1 413 ? -6.653  40.553  142.809 1.00 99.40  ? 414  ARG B O   1 
ATOM   5662  C CB  . ARG B 1 413 ? -7.588  42.532  144.438 1.00 106.58 ? 414  ARG B CB  1 
ATOM   5663  C CG  . ARG B 1 413 ? -8.011  43.601  145.433 1.00 105.79 ? 414  ARG B CG  1 
ATOM   5664  C CD  . ARG B 1 413 ? -8.815  44.689  144.741 1.00 104.01 ? 414  ARG B CD  1 
ATOM   5665  N NE  . ARG B 1 413 ? -8.210  45.078  143.470 1.00 100.62 ? 414  ARG B NE  1 
ATOM   5666  C CZ  . ARG B 1 413 ? -8.892  45.256  142.343 1.00 91.89  ? 414  ARG B CZ  1 
ATOM   5667  N NH1 . ARG B 1 413 ? -10.207 45.088  142.328 1.00 89.13  ? 414  ARG B NH1 1 
ATOM   5668  N NH2 . ARG B 1 413 ? -8.259  45.609  141.232 1.00 76.91  ? 414  ARG B NH2 1 
ATOM   5669  N N   . CYS B 1 414 ? -6.594  38.972  144.408 1.00 86.38  ? 415  CYS B N   1 
ATOM   5670  C CA  . CYS B 1 414 ? -6.346  37.870  143.487 1.00 61.85  ? 415  CYS B CA  1 
ATOM   5671  C C   . CYS B 1 414 ? -7.602  37.485  142.705 1.00 64.49  ? 415  CYS B C   1 
ATOM   5672  O O   . CYS B 1 414 ? -8.715  37.837  143.090 1.00 73.05  ? 415  CYS B O   1 
ATOM   5673  C CB  . CYS B 1 414 ? -5.797  36.662  144.245 1.00 44.86  ? 415  CYS B CB  1 
ATOM   5674  S SG  . CYS B 1 414 ? -6.810  36.138  145.648 1.00 128.64 ? 415  CYS B SG  1 
ATOM   5675  N N   . TRP B 1 415 ? -7.414  36.780  141.595 1.00 61.56  ? 416  TRP B N   1 
ATOM   5676  C CA  . TRP B 1 415 ? -8.530  36.304  140.784 1.00 57.58  ? 416  TRP B CA  1 
ATOM   5677  C C   . TRP B 1 415 ? -9.129  35.026  141.372 1.00 60.20  ? 416  TRP B C   1 
ATOM   5678  O O   . TRP B 1 415 ? -8.448  34.007  141.480 1.00 71.10  ? 416  TRP B O   1 
ATOM   5679  C CB  . TRP B 1 415 ? -8.053  36.065  139.350 1.00 53.55  ? 416  TRP B CB  1 
ATOM   5680  C CG  . TRP B 1 415 ? -8.955  35.205  138.520 1.00 60.90  ? 416  TRP B CG  1 
ATOM   5681  C CD1 . TRP B 1 415 ? -8.827  33.866  138.292 1.00 56.48  ? 416  TRP B CD1 1 
ATOM   5682  C CD2 . TRP B 1 415 ? -10.115 35.628  137.793 1.00 65.59  ? 416  TRP B CD2 1 
ATOM   5683  N NE1 . TRP B 1 415 ? -9.839  33.427  137.472 1.00 53.85  ? 416  TRP B NE1 1 
ATOM   5684  C CE2 . TRP B 1 415 ? -10.641 34.489  137.151 1.00 60.96  ? 416  TRP B CE2 1 
ATOM   5685  C CE3 . TRP B 1 415 ? -10.759 36.857  137.623 1.00 69.90  ? 416  TRP B CE3 1 
ATOM   5686  C CZ2 . TRP B 1 415 ? -11.784 34.544  136.354 1.00 61.41  ? 416  TRP B CZ2 1 
ATOM   5687  C CZ3 . TRP B 1 415 ? -11.892 36.908  136.831 1.00 65.23  ? 416  TRP B CZ3 1 
ATOM   5688  C CH2 . TRP B 1 415 ? -12.393 35.759  136.208 1.00 62.63  ? 416  TRP B CH2 1 
ATOM   5689  N N   . ASN B 1 416 ? -10.404 35.086  141.749 1.00 48.13  ? 417  ASN B N   1 
ATOM   5690  C CA  . ASN B 1 416 ? -11.071 33.953  142.393 1.00 45.59  ? 417  ASN B CA  1 
ATOM   5691  C C   . ASN B 1 416 ? -11.906 33.071  141.463 1.00 49.55  ? 417  ASN B C   1 
ATOM   5692  O O   . ASN B 1 416 ? -12.560 32.131  141.914 1.00 54.99  ? 417  ASN B O   1 
ATOM   5693  C CB  . ASN B 1 416 ? -11.906 34.415  143.596 1.00 47.48  ? 417  ASN B CB  1 
ATOM   5694  C CG  . ASN B 1 416 ? -12.956 35.448  143.225 1.00 54.95  ? 417  ASN B CG  1 
ATOM   5695  O OD1 . ASN B 1 416 ? -13.515 35.422  142.128 1.00 52.53  ? 417  ASN B OD1 1 
ATOM   5696  N ND2 . ASN B 1 416 ? -13.228 36.367  144.144 1.00 52.56  ? 417  ASN B ND2 1 
ATOM   5697  N N   . GLY B 1 417 ? -11.894 33.382  140.171 1.00 52.82  ? 418  GLY B N   1 
ATOM   5698  C CA  . GLY B 1 417 ? -12.670 32.626  139.204 1.00 55.10  ? 418  GLY B CA  1 
ATOM   5699  C C   . GLY B 1 417 ? -13.881 33.398  138.718 1.00 67.26  ? 418  GLY B C   1 
ATOM   5700  O O   . GLY B 1 417 ? -14.553 32.995  137.768 1.00 60.10  ? 418  GLY B O   1 
ATOM   5701  N N   . MET B 1 418 ? -14.152 34.519  139.377 1.00 81.01  ? 419  MET B N   1 
ATOM   5702  C CA  . MET B 1 418 ? -15.265 35.388  139.016 1.00 81.53  ? 419  MET B CA  1 
ATOM   5703  C C   . MET B 1 418 ? -14.768 36.816  138.819 1.00 82.19  ? 419  MET B C   1 
ATOM   5704  O O   . MET B 1 418 ? -14.885 37.382  137.732 1.00 83.71  ? 419  MET B O   1 
ATOM   5705  C CB  . MET B 1 418 ? -16.360 35.337  140.082 1.00 90.56  ? 419  MET B CB  1 
ATOM   5706  C CG  . MET B 1 418 ? -17.556 36.229  139.791 1.00 99.43  ? 419  MET B CG  1 
ATOM   5707  S SD  . MET B 1 418 ? -18.946 35.897  140.891 1.00 131.38 ? 419  MET B SD  1 
ATOM   5708  C CE  . MET B 1 418 ? -18.150 36.016  142.491 1.00 121.03 ? 419  MET B CE  1 
ATOM   5709  N N   . ALA B 1 419 ? -14.231 37.398  139.887 1.00 79.27  ? 420  ALA B N   1 
ATOM   5710  C CA  . ALA B 1 419 ? -13.618 38.720  139.826 1.00 70.84  ? 420  ALA B CA  1 
ATOM   5711  C C   . ALA B 1 419 ? -12.395 38.784  140.738 1.00 74.30  ? 420  ALA B C   1 
ATOM   5712  O O   . ALA B 1 419 ? -11.965 37.768  141.283 1.00 86.15  ? 420  ALA B O   1 
ATOM   5713  C CB  . ALA B 1 419 ? -14.625 39.787  140.210 1.00 69.63  ? 420  ALA B CB  1 
ATOM   5714  N N   . ARG B 1 420 ? -11.829 39.977  140.892 1.00 69.60  ? 421  ARG B N   1 
ATOM   5715  C CA  . ARG B 1 420 ? -10.703 40.182  141.801 1.00 72.55  ? 421  ARG B CA  1 
ATOM   5716  C C   . ARG B 1 420 ? -11.154 40.144  143.260 1.00 80.70  ? 421  ARG B C   1 
ATOM   5717  O O   . ARG B 1 420 ? -12.339 40.288  143.554 1.00 68.83  ? 421  ARG B O   1 
ATOM   5718  C CB  . ARG B 1 420 ? -9.984  41.500  141.503 1.00 62.28  ? 421  ARG B CB  1 
ATOM   5719  C CG  . ARG B 1 420 ? -9.342  41.570  140.126 1.00 62.46  ? 421  ARG B CG  1 
ATOM   5720  C CD  . ARG B 1 420 ? -8.057  42.384  140.167 1.00 73.39  ? 421  ARG B CD  1 
ATOM   5721  N NE  . ARG B 1 420 ? -7.504  42.616  138.836 1.00 87.28  ? 421  ARG B NE  1 
ATOM   5722  C CZ  . ARG B 1 420 ? -6.248  42.985  138.604 1.00 86.88  ? 421  ARG B CZ  1 
ATOM   5723  N NH1 . ARG B 1 420 ? -5.407  43.155  139.615 1.00 79.79  ? 421  ARG B NH1 1 
ATOM   5724  N NH2 . ARG B 1 420 ? -5.830  43.175  137.359 1.00 83.99  ? 421  ARG B NH2 1 
ATOM   5725  N N   . GLY B 1 421 ? -10.201 39.953  144.169 1.00 86.94  ? 422  GLY B N   1 
ATOM   5726  C CA  . GLY B 1 421 ? -10.498 39.865  145.589 1.00 88.34  ? 422  GLY B CA  1 
ATOM   5727  C C   . GLY B 1 421 ? -10.344 38.467  146.159 1.00 95.12  ? 422  GLY B C   1 
ATOM   5728  O O   . GLY B 1 421 ? -9.956  37.540  145.452 1.00 112.47 ? 422  GLY B O   1 
ATOM   5729  N N   . ARG B 1 422 ? -10.655 38.314  147.442 1.00 89.94  ? 423  ARG B N   1 
ATOM   5730  C CA  . ARG B 1 422 ? -10.365 37.074  148.163 1.00 81.70  ? 423  ARG B CA  1 
ATOM   5731  C C   . ARG B 1 422 ? -11.142 35.854  147.661 1.00 68.31  ? 423  ARG B C   1 
ATOM   5732  O O   . ARG B 1 422 ? -12.216 35.982  147.071 1.00 49.40  ? 423  ARG B O   1 
ATOM   5733  C CB  . ARG B 1 422 ? -10.588 37.260  149.667 1.00 74.41  ? 423  ARG B CB  1 
ATOM   5734  C CG  . ARG B 1 422 ? -12.032 37.518  150.061 1.00 70.64  ? 423  ARG B CG  1 
ATOM   5735  C CD  . ARG B 1 422 ? -12.167 37.660  151.569 1.00 71.62  ? 423  ARG B CD  1 
ATOM   5736  N NE  . ARG B 1 422 ? -13.558 37.819  151.983 1.00 74.01  ? 423  ARG B NE  1 
ATOM   5737  C CZ  . ARG B 1 422 ? -13.954 37.914  153.248 1.00 78.02  ? 423  ARG B CZ  1 
ATOM   5738  N NH1 . ARG B 1 422 ? -13.063 37.866  154.229 1.00 73.40  ? 423  ARG B NH1 1 
ATOM   5739  N NH2 . ARG B 1 422 ? -15.241 38.057  153.533 1.00 83.26  ? 423  ARG B NH2 1 
ATOM   5740  N N   . TYR B 1 423 ? -10.575 34.674  147.902 1.00 74.01  ? 424  TYR B N   1 
ATOM   5741  C CA  . TYR B 1 423 ? -11.193 33.406  147.525 1.00 69.82  ? 424  TYR B CA  1 
ATOM   5742  C C   . TYR B 1 423 ? -11.829 32.738  148.741 1.00 63.40  ? 424  TYR B C   1 
ATOM   5743  O O   . TYR B 1 423 ? -11.133 32.300  149.658 1.00 63.05  ? 424  TYR B O   1 
ATOM   5744  C CB  . TYR B 1 423 ? -10.153 32.477  146.896 1.00 58.12  ? 424  TYR B CB  1 
ATOM   5745  C CG  . TYR B 1 423 ? -10.671 31.101  146.542 1.00 61.98  ? 424  TYR B CG  1 
ATOM   5746  C CD1 . TYR B 1 423 ? -11.417 30.893  145.389 1.00 64.22  ? 424  TYR B CD1 1 
ATOM   5747  C CD2 . TYR B 1 423 ? -10.400 30.006  147.353 1.00 64.43  ? 424  TYR B CD2 1 
ATOM   5748  C CE1 . TYR B 1 423 ? -11.888 29.635  145.058 1.00 52.12  ? 424  TYR B CE1 1 
ATOM   5749  C CE2 . TYR B 1 423 ? -10.867 28.744  147.030 1.00 57.34  ? 424  TYR B CE2 1 
ATOM   5750  C CZ  . TYR B 1 423 ? -11.609 28.565  145.882 1.00 54.00  ? 424  TYR B CZ  1 
ATOM   5751  O OH  . TYR B 1 423 ? -12.076 27.311  145.557 1.00 62.55  ? 424  TYR B OH  1 
ATOM   5752  N N   . LEU B 1 424 ? -13.154 32.662  148.735 1.00 54.36  ? 425  LEU B N   1 
ATOM   5753  C CA  . LEU B 1 424 ? -13.918 32.167  149.883 1.00 63.73  ? 425  LEU B CA  1 
ATOM   5754  C C   . LEU B 1 424 ? -13.779 30.675  150.252 1.00 62.88  ? 425  LEU B C   1 
ATOM   5755  O O   . LEU B 1 424 ? -13.500 30.364  151.412 1.00 60.24  ? 425  LEU B O   1 
ATOM   5756  C CB  . LEU B 1 424 ? -15.397 32.549  149.744 1.00 67.16  ? 425  LEU B CB  1 
ATOM   5757  C CG  . LEU B 1 424 ? -15.966 33.382  150.892 1.00 67.27  ? 425  LEU B CG  1 
ATOM   5758  C CD1 . LEU B 1 424 ? -15.083 34.594  151.149 1.00 36.23  ? 425  LEU B CD1 1 
ATOM   5759  C CD2 . LEU B 1 424 ? -17.394 33.805  150.588 1.00 85.93  ? 425  LEU B CD2 1 
ATOM   5760  N N   . PRO B 1 425 ? -13.973 29.753  149.283 1.00 62.50  ? 426  PRO B N   1 
ATOM   5761  C CA  . PRO B 1 425 ? -14.086 28.328  149.630 1.00 61.08  ? 426  PRO B CA  1 
ATOM   5762  C C   . PRO B 1 425 ? -12.883 27.719  150.354 1.00 65.91  ? 426  PRO B C   1 
ATOM   5763  O O   . PRO B 1 425 ? -11.763 28.226  150.269 1.00 52.00  ? 426  PRO B O   1 
ATOM   5764  C CB  . PRO B 1 425 ? -14.260 27.647  148.267 1.00 56.33  ? 426  PRO B CB  1 
ATOM   5765  C CG  . PRO B 1 425 ? -14.811 28.699  147.387 1.00 53.30  ? 426  PRO B CG  1 
ATOM   5766  C CD  . PRO B 1 425 ? -14.147 29.962  147.833 1.00 60.38  ? 426  PRO B CD  1 
ATOM   5767  N N   . GLU B 1 426 ? -13.149 26.624  151.063 1.00 75.16  ? 427  GLU B N   1 
ATOM   5768  C CA  . GLU B 1 426 ? -12.140 25.880  151.810 1.00 72.34  ? 427  GLU B CA  1 
ATOM   5769  C C   . GLU B 1 426 ? -11.244 25.066  150.875 1.00 56.39  ? 427  GLU B C   1 
ATOM   5770  O O   . GLU B 1 426 ? -11.606 24.800  149.730 1.00 53.48  ? 427  GLU B O   1 
ATOM   5771  C CB  . GLU B 1 426 ? -12.827 24.946  152.811 1.00 79.27  ? 427  GLU B CB  1 
ATOM   5772  C CG  . GLU B 1 426 ? -11.959 24.513  153.982 1.00 90.46  ? 427  GLU B CG  1 
ATOM   5773  C CD  . GLU B 1 426 ? -11.864 25.573  155.060 1.00 93.75  ? 427  GLU B CD  1 
ATOM   5774  O OE1 . GLU B 1 426 ? -10.956 26.427  154.980 1.00 93.09  ? 427  GLU B OE1 1 
ATOM   5775  O OE2 . GLU B 1 426 ? -12.700 25.551  155.988 1.00 88.11  ? 427  GLU B OE2 1 
ATOM   5776  N N   . VAL B 1 427 ? -10.072 24.677  151.368 1.00 45.42  ? 428  VAL B N   1 
ATOM   5777  C CA  . VAL B 1 427 ? -9.147  23.852  150.596 1.00 48.61  ? 428  VAL B CA  1 
ATOM   5778  C C   . VAL B 1 427 ? -9.361  22.361  150.868 1.00 50.21  ? 428  VAL B C   1 
ATOM   5779  O O   . VAL B 1 427 ? -9.473  21.941  152.019 1.00 55.94  ? 428  VAL B O   1 
ATOM   5780  C CB  . VAL B 1 427 ? -7.682  24.241  150.886 1.00 47.79  ? 428  VAL B CB  1 
ATOM   5781  C CG1 . VAL B 1 427 ? -6.720  23.271  150.215 1.00 46.42  ? 428  VAL B CG1 1 
ATOM   5782  C CG2 . VAL B 1 427 ? -7.419  25.668  150.429 1.00 28.96  ? 428  VAL B CG2 1 
ATOM   5783  N N   . MET B 1 428 ? -9.421  21.570  149.799 1.00 43.13  ? 429  MET B N   1 
ATOM   5784  C CA  . MET B 1 428 ? -9.674  20.135  149.903 1.00 43.84  ? 429  MET B CA  1 
ATOM   5785  C C   . MET B 1 428 ? -8.477  19.360  150.443 1.00 45.38  ? 429  MET B C   1 
ATOM   5786  O O   . MET B 1 428 ? -7.341  19.830  150.388 1.00 57.55  ? 429  MET B O   1 
ATOM   5787  C CB  . MET B 1 428 ? -10.073 19.561  148.540 1.00 38.03  ? 429  MET B CB  1 
ATOM   5788  C CG  . MET B 1 428 ? -11.354 20.131  147.945 1.00 45.84  ? 429  MET B CG  1 
ATOM   5789  S SD  . MET B 1 428 ? -12.856 19.619  148.805 1.00 66.62  ? 429  MET B SD  1 
ATOM   5790  C CE  . MET B 1 428 ? -13.124 21.002  149.914 1.00 44.89  ? 429  MET B CE  1 
ATOM   5791  N N   . GLY B 1 429 ? -8.744  18.167  150.965 1.00 39.94  ? 430  GLY B N   1 
ATOM   5792  C CA  . GLY B 1 429 ? -7.690  17.260  151.376 1.00 25.35  ? 430  GLY B CA  1 
ATOM   5793  C C   . GLY B 1 429 ? -7.114  16.541  150.171 1.00 39.80  ? 430  GLY B C   1 
ATOM   5794  O O   . GLY B 1 429 ? -7.655  16.637  149.069 1.00 35.11  ? 430  GLY B O   1 
ATOM   5795  N N   . ASP B 1 430 ? -6.018  15.819  150.376 1.00 46.19  ? 431  ASP B N   1 
ATOM   5796  C CA  . ASP B 1 430 ? -5.343  15.128  149.282 1.00 38.46  ? 431  ASP B CA  1 
ATOM   5797  C C   . ASP B 1 430 ? -6.011  13.795  148.960 1.00 35.10  ? 431  ASP B C   1 
ATOM   5798  O O   . ASP B 1 430 ? -6.531  13.122  149.850 1.00 42.94  ? 431  ASP B O   1 
ATOM   5799  C CB  . ASP B 1 430 ? -3.872  14.903  149.627 1.00 51.92  ? 431  ASP B CB  1 
ATOM   5800  C CG  . ASP B 1 430 ? -3.149  16.191  149.962 1.00 65.35  ? 431  ASP B CG  1 
ATOM   5801  O OD1 . ASP B 1 430 ? -3.434  17.223  149.319 1.00 63.89  ? 431  ASP B OD1 1 
ATOM   5802  O OD2 . ASP B 1 430 ? -2.294  16.170  150.873 1.00 71.07  ? 431  ASP B OD2 1 
ATOM   5803  N N   . GLY B 1 431 ? -5.989  13.417  147.685 1.00 32.70  ? 432  GLY B N   1 
ATOM   5804  C CA  . GLY B 1 431 ? -6.542  12.143  147.256 1.00 47.60  ? 432  GLY B CA  1 
ATOM   5805  C C   . GLY B 1 431 ? -7.833  12.227  146.462 1.00 54.47  ? 432  GLY B C   1 
ATOM   5806  O O   . GLY B 1 431 ? -8.497  13.263  146.436 1.00 57.55  ? 432  GLY B O   1 
ATOM   5807  N N   . LEU B 1 432 ? -8.182  11.120  145.812 1.00 54.09  ? 433  LEU B N   1 
ATOM   5808  C CA  . LEU B 1 432 ? -9.356  11.049  144.945 1.00 43.42  ? 433  LEU B CA  1 
ATOM   5809  C C   . LEU B 1 432 ? -10.667 11.334  145.679 1.00 44.82  ? 433  LEU B C   1 
ATOM   5810  O O   . LEU B 1 432 ? -11.402 12.248  145.314 1.00 46.34  ? 433  LEU B O   1 
ATOM   5811  C CB  . LEU B 1 432 ? -9.426  9.677   144.267 1.00 24.27  ? 433  LEU B CB  1 
ATOM   5812  C CG  . LEU B 1 432 ? -10.445 9.535   143.135 1.00 26.67  ? 433  LEU B CG  1 
ATOM   5813  C CD1 . LEU B 1 432 ? -10.052 10.389  141.938 1.00 26.64  ? 433  LEU B CD1 1 
ATOM   5814  C CD2 . LEU B 1 432 ? -10.605 8.083   142.724 1.00 19.35  ? 433  LEU B CD2 1 
ATOM   5815  N N   . ALA B 1 433 ? -10.943 10.547  146.716 1.00 23.86  ? 434  ALA B N   1 
ATOM   5816  C CA  . ALA B 1 433 ? -12.193 10.639  147.468 1.00 37.67  ? 434  ALA B CA  1 
ATOM   5817  C C   . ALA B 1 433 ? -12.466 12.056  147.972 1.00 44.09  ? 434  ALA B C   1 
ATOM   5818  O O   . ALA B 1 433 ? -13.584 12.568  147.842 1.00 65.71  ? 434  ALA B O   1 
ATOM   5819  C CB  . ALA B 1 433 ? -12.181 9.660   148.632 1.00 21.05  ? 434  ALA B CB  1 
ATOM   5820  N N   . ASN B 1 434 ? -11.437 12.700  148.519 1.00 33.56  ? 435  ASN B N   1 
ATOM   5821  C CA  . ASN B 1 434 ? -11.579 14.047  149.058 1.00 40.53  ? 435  ASN B CA  1 
ATOM   5822  C C   . ASN B 1 434 ? -11.985 15.090  148.016 1.00 47.98  ? 435  ASN B C   1 
ATOM   5823  O O   . ASN B 1 434 ? -12.337 16.216  148.362 1.00 57.17  ? 435  ASN B O   1 
ATOM   5824  C CB  . ASN B 1 434 ? -10.292 14.473  149.750 1.00 43.40  ? 435  ASN B CB  1 
ATOM   5825  C CG  . ASN B 1 434 ? -10.088 13.768  151.072 1.00 39.70  ? 435  ASN B CG  1 
ATOM   5826  O OD1 . ASN B 1 434 ? -11.047 13.453  151.774 1.00 35.11  ? 435  ASN B OD1 1 
ATOM   5827  N ND2 . ASN B 1 434 ? -8.833  13.514  151.417 1.00 32.80  ? 435  ASN B ND2 1 
ATOM   5828  N N   . GLN B 1 435 ? -11.943 14.716  146.742 1.00 42.50  ? 436  GLN B N   1 
ATOM   5829  C CA  . GLN B 1 435 ? -12.322 15.639  145.681 1.00 37.63  ? 436  GLN B CA  1 
ATOM   5830  C C   . GLN B 1 435 ? -13.799 15.546  145.312 1.00 47.89  ? 436  GLN B C   1 
ATOM   5831  O O   . GLN B 1 435 ? -14.245 16.213  144.380 1.00 60.43  ? 436  GLN B O   1 
ATOM   5832  C CB  . GLN B 1 435 ? -11.453 15.425  144.443 1.00 37.40  ? 436  GLN B CB  1 
ATOM   5833  C CG  . GLN B 1 435 ? -9.973  15.572  144.720 1.00 47.31  ? 436  GLN B CG  1 
ATOM   5834  C CD  . GLN B 1 435 ? -9.650  16.847  145.463 1.00 55.75  ? 436  GLN B CD  1 
ATOM   5835  O OE1 . GLN B 1 435 ? -9.882  17.946  144.962 1.00 73.68  ? 436  GLN B OE1 1 
ATOM   5836  N NE2 . GLN B 1 435 ? -9.119  16.708  146.671 1.00 54.90  ? 436  GLN B NE2 1 
ATOM   5837  N N   . ILE B 1 436 ? -14.555 14.724  146.035 1.00 48.35  ? 437  ILE B N   1 
ATOM   5838  C CA  . ILE B 1 436 ? -15.980 14.596  145.749 1.00 48.85  ? 437  ILE B CA  1 
ATOM   5839  C C   . ILE B 1 436 ? -16.728 15.931  145.895 1.00 63.99  ? 437  ILE B C   1 
ATOM   5840  O O   . ILE B 1 436 ? -17.569 16.269  145.065 1.00 73.52  ? 437  ILE B O   1 
ATOM   5841  C CB  . ILE B 1 436 ? -16.626 13.482  146.600 1.00 47.01  ? 437  ILE B CB  1 
ATOM   5842  C CG1 . ILE B 1 436 ? -18.079 13.266  146.189 1.00 43.40  ? 437  ILE B CG1 1 
ATOM   5843  C CG2 . ILE B 1 436 ? -16.523 13.786  148.089 1.00 53.55  ? 437  ILE B CG2 1 
ATOM   5844  C CD1 . ILE B 1 436 ? -18.736 12.120  146.905 1.00 39.43  ? 437  ILE B CD1 1 
ATOM   5845  N N   . ASN B 1 437 ? -16.405 16.688  146.940 1.00 63.18  ? 438  ASN B N   1 
ATOM   5846  C CA  . ASN B 1 437 ? -17.032 17.985  147.193 1.00 61.16  ? 438  ASN B CA  1 
ATOM   5847  C C   . ASN B 1 437 ? -16.238 19.171  146.659 1.00 58.24  ? 438  ASN B C   1 
ATOM   5848  O O   . ASN B 1 437 ? -16.575 20.324  146.931 1.00 50.41  ? 438  ASN B O   1 
ATOM   5849  C CB  . ASN B 1 437 ? -17.321 18.172  148.682 1.00 58.45  ? 438  ASN B CB  1 
ATOM   5850  C CG  . ASN B 1 437 ? -18.558 17.424  149.127 1.00 51.70  ? 438  ASN B CG  1 
ATOM   5851  O OD1 . ASN B 1 437 ? -19.438 17.125  148.319 1.00 29.95  ? 438  ASN B OD1 1 
ATOM   5852  N ND2 . ASN B 1 437 ? -18.636 17.124  150.417 1.00 34.99  ? 438  ASN B ND2 1 
ATOM   5853  N N   . ASN B 1 438 ? -15.165 18.879  145.932 1.00 61.33  ? 439  ASN B N   1 
ATOM   5854  C CA  . ASN B 1 438 ? -14.316 19.919  145.366 1.00 59.40  ? 439  ASN B CA  1 
ATOM   5855  C C   . ASN B 1 438 ? -15.110 20.881  144.490 1.00 59.57  ? 439  ASN B C   1 
ATOM   5856  O O   . ASN B 1 438 ? -15.684 20.483  143.477 1.00 48.12  ? 439  ASN B O   1 
ATOM   5857  C CB  . ASN B 1 438 ? -13.182 19.294  144.555 1.00 37.80  ? 439  ASN B CB  1 
ATOM   5858  C CG  . ASN B 1 438 ? -12.201 20.323  144.033 1.00 38.97  ? 439  ASN B CG  1 
ATOM   5859  O OD1 . ASN B 1 438 ? -12.472 21.019  143.054 1.00 46.91  ? 439  ASN B OD1 1 
ATOM   5860  N ND2 . ASN B 1 438 ? -11.045 20.416  144.678 1.00 57.35  ? 439  ASN B ND2 1 
ATOM   5861  N N   . PRO B 1 439 ? -15.138 22.160  144.884 1.00 55.61  ? 440  PRO B N   1 
ATOM   5862  C CA  . PRO B 1 439 ? -15.937 23.191  144.216 1.00 48.53  ? 440  PRO B CA  1 
ATOM   5863  C C   . PRO B 1 439 ? -15.439 23.526  142.811 1.00 44.83  ? 440  PRO B C   1 
ATOM   5864  O O   . PRO B 1 439 ? -16.247 23.814  141.929 1.00 52.92  ? 440  PRO B O   1 
ATOM   5865  C CB  . PRO B 1 439 ? -15.788 24.399  145.145 1.00 31.32  ? 440  PRO B CB  1 
ATOM   5866  C CG  . PRO B 1 439 ? -14.507 24.178  145.845 1.00 44.14  ? 440  PRO B CG  1 
ATOM   5867  C CD  . PRO B 1 439 ? -14.392 22.700  146.033 1.00 43.39  ? 440  PRO B CD  1 
ATOM   5868  N N   . GLU B 1 440 ? -14.128 23.493  142.607 1.00 38.08  ? 441  GLU B N   1 
ATOM   5869  C CA  . GLU B 1 440 ? -13.559 23.886  141.322 1.00 48.29  ? 441  GLU B CA  1 
ATOM   5870  C C   . GLU B 1 440 ? -13.598 22.789  140.256 1.00 38.12  ? 441  GLU B C   1 
ATOM   5871  O O   . GLU B 1 440 ? -13.796 23.071  139.074 1.00 36.35  ? 441  GLU B O   1 
ATOM   5872  C CB  . GLU B 1 440 ? -12.136 24.425  141.500 1.00 51.72  ? 441  GLU B CB  1 
ATOM   5873  C CG  . GLU B 1 440 ? -11.981 25.414  142.654 1.00 54.93  ? 441  GLU B CG  1 
ATOM   5874  C CD  . GLU B 1 440 ? -13.030 26.515  142.650 1.00 70.48  ? 441  GLU B CD  1 
ATOM   5875  O OE1 . GLU B 1 440 ? -13.438 26.964  141.557 1.00 78.87  ? 441  GLU B OE1 1 
ATOM   5876  O OE2 . GLU B 1 440 ? -13.450 26.932  143.750 1.00 77.29  ? 441  GLU B OE2 1 
ATOM   5877  N N   . VAL B 1 441 ? -13.395 21.544  140.674 1.00 31.84  ? 442  VAL B N   1 
ATOM   5878  C CA  . VAL B 1 441 ? -13.361 20.423  139.740 1.00 40.90  ? 442  VAL B CA  1 
ATOM   5879  C C   . VAL B 1 441 ? -14.324 19.322  140.166 1.00 52.91  ? 442  VAL B C   1 
ATOM   5880  O O   . VAL B 1 441 ? -14.220 18.792  141.273 1.00 58.96  ? 442  VAL B O   1 
ATOM   5881  C CB  . VAL B 1 441 ? -11.948 19.807  139.638 1.00 39.88  ? 442  VAL B CB  1 
ATOM   5882  C CG1 . VAL B 1 441 ? -11.776 19.100  138.302 1.00 40.65  ? 442  VAL B CG1 1 
ATOM   5883  C CG2 . VAL B 1 441 ? -10.876 20.872  139.821 1.00 40.64  ? 442  VAL B CG2 1 
ATOM   5884  N N   . GLU B 1 442 ? -15.261 18.975  139.290 1.00 53.79  ? 443  GLU B N   1 
ATOM   5885  C CA  . GLU B 1 442 ? -16.165 17.866  139.567 1.00 57.89  ? 443  GLU B CA  1 
ATOM   5886  C C   . GLU B 1 442 ? -15.443 16.562  139.236 1.00 46.10  ? 443  GLU B C   1 
ATOM   5887  O O   . GLU B 1 442 ? -15.032 16.341  138.096 1.00 41.81  ? 443  GLU B O   1 
ATOM   5888  C CB  . GLU B 1 442 ? -17.456 17.997  138.751 1.00 71.79  ? 443  GLU B CB  1 
ATOM   5889  C CG  . GLU B 1 442 ? -18.667 17.287  139.360 1.00 73.76  ? 443  GLU B CG  1 
ATOM   5890  C CD  . GLU B 1 442 ? -19.233 18.015  140.572 1.00 72.40  ? 443  GLU B CD  1 
ATOM   5891  O OE1 . GLU B 1 442 ? -19.487 19.234  140.470 1.00 68.78  ? 443  GLU B OE1 1 
ATOM   5892  O OE2 . GLU B 1 442 ? -19.424 17.370  141.626 1.00 64.57  ? 443  GLU B OE2 1 
ATOM   5893  N N   . VAL B 1 443 ? -15.284 15.706  140.240 1.00 37.74  ? 444  VAL B N   1 
ATOM   5894  C CA  . VAL B 1 443 ? -14.507 14.480  140.090 1.00 29.65  ? 444  VAL B CA  1 
ATOM   5895  C C   . VAL B 1 443 ? -15.314 13.256  140.505 1.00 37.87  ? 444  VAL B C   1 
ATOM   5896  O O   . VAL B 1 443 ? -15.973 13.258  141.544 1.00 59.46  ? 444  VAL B O   1 
ATOM   5897  C CB  . VAL B 1 443 ? -13.207 14.535  140.932 1.00 32.38  ? 444  VAL B CB  1 
ATOM   5898  C CG1 . VAL B 1 443 ? -12.446 13.222  140.841 1.00 31.74  ? 444  VAL B CG1 1 
ATOM   5899  C CG2 . VAL B 1 443 ? -12.327 15.693  140.487 1.00 23.18  ? 444  VAL B CG2 1 
ATOM   5900  N N   . ASP B 1 444 ? -15.254 12.208  139.691 1.00 33.30  ? 445  ASP B N   1 
ATOM   5901  C CA  . ASP B 1 444 ? -15.907 10.952  140.020 1.00 37.18  ? 445  ASP B CA  1 
ATOM   5902  C C   . ASP B 1 444 ? -14.916 10.103  140.810 1.00 48.87  ? 445  ASP B C   1 
ATOM   5903  O O   . ASP B 1 444 ? -13.888 9.678   140.282 1.00 49.53  ? 445  ASP B O   1 
ATOM   5904  C CB  . ASP B 1 444 ? -16.317 10.227  138.738 1.00 50.50  ? 445  ASP B CB  1 
ATOM   5905  C CG  . ASP B 1 444 ? -17.318 9.117   138.987 1.00 70.82  ? 445  ASP B CG  1 
ATOM   5906  O OD1 . ASP B 1 444 ? -17.426 8.650   140.141 1.00 82.59  ? 445  ASP B OD1 1 
ATOM   5907  O OD2 . ASP B 1 444 ? -17.995 8.708   138.021 1.00 74.83  ? 445  ASP B OD2 1 
ATOM   5908  N N   . ILE B 1 445 ? -15.230 9.854   142.078 1.00 44.16  ? 446  ILE B N   1 
ATOM   5909  C CA  . ILE B 1 445 ? -14.304 9.155   142.962 1.00 41.12  ? 446  ILE B CA  1 
ATOM   5910  C C   . ILE B 1 445 ? -14.415 7.641   142.826 1.00 44.18  ? 446  ILE B C   1 
ATOM   5911  O O   . ILE B 1 445 ? -13.682 6.896   143.477 1.00 50.35  ? 446  ILE B O   1 
ATOM   5912  C CB  . ILE B 1 445 ? -14.510 9.554   144.439 1.00 40.14  ? 446  ILE B CB  1 
ATOM   5913  C CG1 . ILE B 1 445 ? -15.794 8.934   144.995 1.00 43.19  ? 446  ILE B CG1 1 
ATOM   5914  C CG2 . ILE B 1 445 ? -14.528 11.067  144.584 1.00 37.08  ? 446  ILE B CG2 1 
ATOM   5915  C CD1 . ILE B 1 445 ? -15.997 9.183   146.477 1.00 27.87  ? 446  ILE B CD1 1 
ATOM   5916  N N   . THR B 1 446 ? -15.337 7.194   141.981 1.00 51.49  ? 447  THR B N   1 
ATOM   5917  C CA  . THR B 1 446 ? -15.524 5.770   141.735 1.00 58.57  ? 447  THR B CA  1 
ATOM   5918  C C   . THR B 1 446 ? -14.776 5.319   140.487 1.00 59.42  ? 447  THR B C   1 
ATOM   5919  O O   . THR B 1 446 ? -14.842 4.152   140.102 1.00 56.57  ? 447  THR B O   1 
ATOM   5920  C CB  . THR B 1 446 ? -17.011 5.415   141.590 1.00 54.47  ? 447  THR B CB  1 
ATOM   5921  O OG1 . THR B 1 446 ? -17.534 6.011   140.395 1.00 54.05  ? 447  THR B OG1 1 
ATOM   5922  C CG2 . THR B 1 446 ? -17.789 5.918   142.795 1.00 52.35  ? 447  THR B CG2 1 
ATOM   5923  N N   . LYS B 1 447 ? -14.068 6.251   139.855 1.00 56.14  ? 448  LYS B N   1 
ATOM   5924  C CA  . LYS B 1 447 ? -13.294 5.938   138.659 1.00 44.30  ? 448  LYS B CA  1 
ATOM   5925  C C   . LYS B 1 447 ? -11.814 6.257   138.844 1.00 45.30  ? 448  LYS B C   1 
ATOM   5926  O O   . LYS B 1 447 ? -11.316 7.244   138.303 1.00 55.69  ? 448  LYS B O   1 
ATOM   5927  C CB  . LYS B 1 447 ? -13.851 6.686   137.447 1.00 47.22  ? 448  LYS B CB  1 
ATOM   5928  C CG  . LYS B 1 447 ? -15.285 6.315   137.102 1.00 72.92  ? 448  LYS B CG  1 
ATOM   5929  C CD  . LYS B 1 447 ? -15.650 6.743   135.692 1.00 77.30  ? 448  LYS B CD  1 
ATOM   5930  C CE  . LYS B 1 447 ? -16.990 6.156   135.283 1.00 86.56  ? 448  LYS B CE  1 
ATOM   5931  N NZ  . LYS B 1 447 ? -17.274 6.355   133.835 1.00 94.48  ? 448  LYS B NZ  1 
ATOM   5932  N N   . PRO B 1 448 ? -11.102 5.412   139.607 1.00 41.41  ? 449  PRO B N   1 
ATOM   5933  C CA  . PRO B 1 448 ? -9.676  5.625   139.864 1.00 49.33  ? 449  PRO B CA  1 
ATOM   5934  C C   . PRO B 1 448 ? -8.875  5.329   138.604 1.00 58.96  ? 449  PRO B C   1 
ATOM   5935  O O   . PRO B 1 448 ? -9.372  4.630   137.722 1.00 70.51  ? 449  PRO B O   1 
ATOM   5936  C CB  . PRO B 1 448 ? -9.350  4.579   140.945 1.00 43.23  ? 449  PRO B CB  1 
ATOM   5937  C CG  . PRO B 1 448 ? -10.678 4.046   141.414 1.00 52.79  ? 449  PRO B CG  1 
ATOM   5938  C CD  . PRO B 1 448 ? -11.586 4.178   140.244 1.00 48.75  ? 449  PRO B CD  1 
ATOM   5939  N N   . ASP B 1 449 ? -7.660  5.862   138.514 1.00 53.72  ? 450  ASP B N   1 
ATOM   5940  C CA  . ASP B 1 449 ? -6.792  5.554   137.389 1.00 46.60  ? 450  ASP B CA  1 
ATOM   5941  C C   . ASP B 1 449 ? -6.120  4.203   137.608 1.00 40.37  ? 450  ASP B C   1 
ATOM   5942  O O   . ASP B 1 449 ? -5.365  4.009   138.570 1.00 44.62  ? 450  ASP B O   1 
ATOM   5943  C CB  . ASP B 1 449 ? -5.754  6.653   137.167 1.00 57.12  ? 450  ASP B CB  1 
ATOM   5944  C CG  . ASP B 1 449 ? -4.873  6.378   135.967 1.00 71.34  ? 450  ASP B CG  1 
ATOM   5945  O OD1 . ASP B 1 449 ? -5.281  6.698   134.828 1.00 55.96  ? 450  ASP B OD1 1 
ATOM   5946  O OD2 . ASP B 1 449 ? -3.762  5.847   136.164 1.00 91.30  ? 450  ASP B OD2 1 
ATOM   5947  N N   . MET B 1 450 ? -6.391  3.275   136.696 1.00 45.76  ? 451  MET B N   1 
ATOM   5948  C CA  . MET B 1 450 ? -5.951  1.897   136.853 1.00 58.82  ? 451  MET B CA  1 
ATOM   5949  C C   . MET B 1 450 ? -4.433  1.763   136.779 1.00 55.85  ? 451  MET B C   1 
ATOM   5950  O O   . MET B 1 450 ? -3.857  0.900   137.435 1.00 47.28  ? 451  MET B O   1 
ATOM   5951  C CB  . MET B 1 450 ? -6.636  0.996   135.823 1.00 71.19  ? 451  MET B CB  1 
ATOM   5952  C CG  . MET B 1 450 ? -8.162  0.961   135.936 1.00 72.43  ? 451  MET B CG  1 
ATOM   5953  S SD  . MET B 1 450 ? -8.836  -0.353  136.980 1.00 194.56 ? 451  MET B SD  1 
ATOM   5954  C CE  . MET B 1 450 ? -8.546  0.283   138.631 1.00 20.04  ? 451  MET B CE  1 
ATOM   5955  N N   . THR B 1 451 ? -3.790  2.627   135.998 1.00 61.16  ? 452  THR B N   1 
ATOM   5956  C CA  . THR B 1 451 ? -2.331  2.645   135.929 1.00 51.98  ? 452  THR B CA  1 
ATOM   5957  C C   . THR B 1 451 ? -1.741  2.970   137.296 1.00 34.92  ? 452  THR B C   1 
ATOM   5958  O O   . THR B 1 451 ? -0.842  2.280   137.779 1.00 53.68  ? 452  THR B O   1 
ATOM   5959  C CB  . THR B 1 451 ? -1.815  3.672   134.904 1.00 35.18  ? 452  THR B CB  1 
ATOM   5960  O OG1 . THR B 1 451 ? -2.292  3.329   133.598 1.00 46.18  ? 452  THR B OG1 1 
ATOM   5961  C CG2 . THR B 1 451 ? -0.297  3.693   134.889 1.00 37.63  ? 452  THR B CG2 1 
ATOM   5962  N N   . ILE B 1 452 ? -2.266  4.019   137.920 1.00 17.87  ? 453  ILE B N   1 
ATOM   5963  C CA  . ILE B 1 452 ? -1.819  4.430   139.244 1.00 32.20  ? 453  ILE B CA  1 
ATOM   5964  C C   . ILE B 1 452 ? -2.127  3.361   140.296 1.00 38.08  ? 453  ILE B C   1 
ATOM   5965  O O   . ILE B 1 452 ? -1.351  3.165   141.232 1.00 58.00  ? 453  ILE B O   1 
ATOM   5966  C CB  . ILE B 1 452 ? -2.420  5.800   139.637 1.00 28.17  ? 453  ILE B CB  1 
ATOM   5967  C CG1 . ILE B 1 452 ? -1.884  6.885   138.700 1.00 28.83  ? 453  ILE B CG1 1 
ATOM   5968  C CG2 . ILE B 1 452 ? -2.100  6.149   141.082 1.00 16.39  ? 453  ILE B CG2 1 
ATOM   5969  C CD1 . ILE B 1 452 ? -2.304  8.285   139.074 1.00 22.38  ? 453  ILE B CD1 1 
ATOM   5970  N N   . ARG B 1 453 ? -3.240  2.653   140.127 1.00 42.21  ? 454  ARG B N   1 
ATOM   5971  C CA  . ARG B 1 453 ? -3.562  1.552   141.031 1.00 41.03  ? 454  ARG B CA  1 
ATOM   5972  C C   . ARG B 1 453 ? -2.520  0.441   140.920 1.00 42.25  ? 454  ARG B C   1 
ATOM   5973  O O   . ARG B 1 453 ? -2.019  -0.063  141.934 1.00 54.26  ? 454  ARG B O   1 
ATOM   5974  C CB  . ARG B 1 453 ? -4.956  1.005   140.735 1.00 47.97  ? 454  ARG B CB  1 
ATOM   5975  C CG  . ARG B 1 453 ? -6.065  2.022   140.927 1.00 56.80  ? 454  ARG B CG  1 
ATOM   5976  C CD  . ARG B 1 453 ? -6.059  2.570   142.345 1.00 69.30  ? 454  ARG B CD  1 
ATOM   5977  N NE  . ARG B 1 453 ? -6.475  3.969   142.390 1.00 90.03  ? 454  ARG B NE  1 
ATOM   5978  C CZ  . ARG B 1 453 ? -6.487  4.710   143.493 1.00 98.06  ? 454  ARG B CZ  1 
ATOM   5979  N NH1 . ARG B 1 453 ? -6.106  4.186   144.649 1.00 100.49 ? 454  ARG B NH1 1 
ATOM   5980  N NH2 . ARG B 1 453 ? -6.881  5.976   143.439 1.00 88.74  ? 454  ARG B NH2 1 
ATOM   5981  N N   . GLN B 1 454 ? -2.200  0.071   139.680 1.00 36.99  ? 455  GLN B N   1 
ATOM   5982  C CA  . GLN B 1 454 ? -1.156  -0.911  139.398 1.00 29.37  ? 455  GLN B CA  1 
ATOM   5983  C C   . GLN B 1 454 ? 0.166   -0.507  140.042 1.00 39.55  ? 455  GLN B C   1 
ATOM   5984  O O   . GLN B 1 454 ? 0.817   -1.310  140.716 1.00 39.99  ? 455  GLN B O   1 
ATOM   5985  C CB  . GLN B 1 454 ? -0.961  -1.058  137.888 1.00 19.58  ? 455  GLN B CB  1 
ATOM   5986  C CG  . GLN B 1 454 ? -2.134  -1.695  137.165 1.00 51.85  ? 455  GLN B CG  1 
ATOM   5987  C CD  . GLN B 1 454 ? -2.115  -1.420  135.676 1.00 65.93  ? 455  GLN B CD  1 
ATOM   5988  O OE1 . GLN B 1 454 ? -1.141  -0.887  135.146 1.00 73.21  ? 455  GLN B OE1 1 
ATOM   5989  N NE2 . GLN B 1 454 ? -3.198  -1.777  134.994 1.00 54.70  ? 455  GLN B NE2 1 
ATOM   5990  N N   . GLN B 1 455 ? 0.547   0.749   139.840 1.00 33.71  ? 456  GLN B N   1 
ATOM   5991  C CA  . GLN B 1 455 ? 1.804   1.254   140.370 1.00 35.58  ? 456  GLN B CA  1 
ATOM   5992  C C   . GLN B 1 455 ? 1.815   1.251   141.897 1.00 41.66  ? 456  GLN B C   1 
ATOM   5993  O O   . GLN B 1 455 ? 2.856   1.017   142.515 1.00 52.53  ? 456  GLN B O   1 
ATOM   5994  C CB  . GLN B 1 455 ? 2.092   2.650   139.824 1.00 39.23  ? 456  GLN B CB  1 
ATOM   5995  C CG  . GLN B 1 455 ? 2.210   2.697   138.311 1.00 40.87  ? 456  GLN B CG  1 
ATOM   5996  C CD  . GLN B 1 455 ? 3.153   1.645   137.768 1.00 45.08  ? 456  GLN B CD  1 
ATOM   5997  O OE1 . GLN B 1 455 ? 4.354   1.671   138.039 1.00 48.77  ? 456  GLN B OE1 1 
ATOM   5998  N NE2 . GLN B 1 455 ? 2.612   0.708   137.001 1.00 48.54  ? 456  GLN B NE2 1 
ATOM   5999  N N   . ILE B 1 456 ? 0.658   1.505   142.502 1.00 23.85  ? 457  ILE B N   1 
ATOM   6000  C CA  . ILE B 1 456 ? 0.521   1.398   143.951 1.00 36.91  ? 457  ILE B CA  1 
ATOM   6001  C C   . ILE B 1 456 ? 0.791   -0.040  144.384 1.00 48.63  ? 457  ILE B C   1 
ATOM   6002  O O   . ILE B 1 456 ? 1.516   -0.285  145.357 1.00 48.73  ? 457  ILE B O   1 
ATOM   6003  C CB  . ILE B 1 456 ? -0.876  1.845   144.424 1.00 31.81  ? 457  ILE B CB  1 
ATOM   6004  C CG1 . ILE B 1 456 ? -0.985  3.369   144.374 1.00 51.10  ? 457  ILE B CG1 1 
ATOM   6005  C CG2 . ILE B 1 456 ? -1.153  1.359   145.835 1.00 20.22  ? 457  ILE B CG2 1 
ATOM   6006  C CD1 . ILE B 1 456 ? -2.294  3.916   144.904 1.00 56.99  ? 457  ILE B CD1 1 
ATOM   6007  N N   . MET B 1 457 ? 0.214   -0.985  143.644 1.00 45.47  ? 458  MET B N   1 
ATOM   6008  C CA  . MET B 1 457 ? 0.463   -2.404  143.886 1.00 50.95  ? 458  MET B CA  1 
ATOM   6009  C C   . MET B 1 457 ? 1.961   -2.721  143.836 1.00 47.29  ? 458  MET B C   1 
ATOM   6010  O O   . MET B 1 457 ? 2.496   -3.390  144.726 1.00 43.40  ? 458  MET B O   1 
ATOM   6011  C CB  . MET B 1 457 ? -0.304  -3.267  142.879 1.00 60.45  ? 458  MET B CB  1 
ATOM   6012  C CG  . MET B 1 457 ? -0.099  -4.765  143.045 1.00 65.82  ? 458  MET B CG  1 
ATOM   6013  S SD  . MET B 1 457 ? -0.746  -5.392  144.605 1.00 67.42  ? 458  MET B SD  1 
ATOM   6014  C CE  . MET B 1 457 ? -2.497  -5.075  144.397 1.00 62.68  ? 458  MET B CE  1 
ATOM   6015  N N   . GLN B 1 458 ? 2.634   -2.223  142.801 1.00 38.63  ? 459  GLN B N   1 
ATOM   6016  C CA  . GLN B 1 458 ? 4.074   -2.429  142.655 1.00 37.19  ? 459  GLN B CA  1 
ATOM   6017  C C   . GLN B 1 458 ? 4.843   -1.858  143.847 1.00 49.02  ? 459  GLN B C   1 
ATOM   6018  O O   . GLN B 1 458 ? 5.788   -2.478  144.345 1.00 63.21  ? 459  GLN B O   1 
ATOM   6019  C CB  . GLN B 1 458 ? 4.582   -1.814  141.348 1.00 14.99  ? 459  GLN B CB  1 
ATOM   6020  C CG  . GLN B 1 458 ? 3.837   -2.284  140.109 1.00 47.04  ? 459  GLN B CG  1 
ATOM   6021  C CD  . GLN B 1 458 ? 3.803   -3.795  139.981 1.00 71.33  ? 459  GLN B CD  1 
ATOM   6022  O OE1 . GLN B 1 458 ? 4.844   -4.452  139.937 1.00 69.08  ? 459  GLN B OE1 1 
ATOM   6023  N NE2 . GLN B 1 458 ? 2.600   -4.356  139.924 1.00 74.81  ? 459  GLN B NE2 1 
ATOM   6024  N N   . LEU B 1 459 ? 4.427   -0.678  144.301 1.00 50.05  ? 460  LEU B N   1 
ATOM   6025  C CA  . LEU B 1 459 ? 5.012   -0.057  145.486 1.00 46.76  ? 460  LEU B CA  1 
ATOM   6026  C C   . LEU B 1 459 ? 4.874   -0.959  146.714 1.00 49.90  ? 460  LEU B C   1 
ATOM   6027  O O   . LEU B 1 459 ? 5.840   -1.160  147.457 1.00 50.96  ? 460  LEU B O   1 
ATOM   6028  C CB  . LEU B 1 459 ? 4.367   1.307   145.754 1.00 38.08  ? 460  LEU B CB  1 
ATOM   6029  C CG  . LEU B 1 459 ? 4.674   2.453   144.784 1.00 37.31  ? 460  LEU B CG  1 
ATOM   6030  C CD1 . LEU B 1 459 ? 3.810   3.662   145.093 1.00 53.75  ? 460  LEU B CD1 1 
ATOM   6031  C CD2 . LEU B 1 459 ? 6.142   2.834   144.836 1.00 40.50  ? 460  LEU B CD2 1 
ATOM   6032  N N   . LYS B 1 460 ? 3.675   -1.503  146.920 1.00 51.60  ? 461  LYS B N   1 
ATOM   6033  C CA  . LYS B 1 460 ? 3.430   -2.418  148.037 1.00 38.89  ? 461  LYS B CA  1 
ATOM   6034  C C   . LYS B 1 460 ? 4.357   -3.627  147.966 1.00 33.42  ? 461  LYS B C   1 
ATOM   6035  O O   . LYS B 1 460 ? 5.013   -3.988  148.952 1.00 35.28  ? 461  LYS B O   1 
ATOM   6036  C CB  . LYS B 1 460 ? 1.976   -2.905  148.051 1.00 37.61  ? 461  LYS B CB  1 
ATOM   6037  C CG  . LYS B 1 460 ? 0.920   -1.830  148.252 1.00 45.03  ? 461  LYS B CG  1 
ATOM   6038  C CD  . LYS B 1 460 ? -0.243  -2.380  149.071 1.00 56.55  ? 461  LYS B CD  1 
ATOM   6039  C CE  . LYS B 1 460 ? -1.482  -1.503  148.976 1.00 60.21  ? 461  LYS B CE  1 
ATOM   6040  N NZ  . LYS B 1 460 ? -2.128  -1.590  147.637 1.00 59.16  ? 461  LYS B NZ  1 
ATOM   6041  N N   . ILE B 1 461 ? 4.399   -4.244  146.788 1.00 24.73  ? 462  ILE B N   1 
ATOM   6042  C CA  . ILE B 1 461 ? 5.209   -5.434  146.554 1.00 26.92  ? 462  ILE B CA  1 
ATOM   6043  C C   . ILE B 1 461 ? 6.683   -5.195  146.863 1.00 36.51  ? 462  ILE B C   1 
ATOM   6044  O O   . ILE B 1 461 ? 7.292   -5.937  147.640 1.00 34.64  ? 462  ILE B O   1 
ATOM   6045  C CB  . ILE B 1 461 ? 5.066   -5.915  145.099 1.00 31.34  ? 462  ILE B CB  1 
ATOM   6046  C CG1 . ILE B 1 461 ? 3.647   -6.431  144.853 1.00 25.00  ? 462  ILE B CG1 1 
ATOM   6047  C CG2 . ILE B 1 461 ? 6.100   -6.987  144.787 1.00 11.69  ? 462  ILE B CG2 1 
ATOM   6048  C CD1 . ILE B 1 461 ? 3.349   -6.725  143.403 1.00 40.28  ? 462  ILE B CD1 1 
ATOM   6049  N N   . MET B 1 462 ? 7.246   -4.151  146.261 1.00 45.68  ? 463  MET B N   1 
ATOM   6050  C CA  . MET B 1 462 ? 8.653   -3.823  146.467 1.00 35.71  ? 463  MET B CA  1 
ATOM   6051  C C   . MET B 1 462 ? 8.938   -3.467  147.925 1.00 28.45  ? 463  MET B C   1 
ATOM   6052  O O   . MET B 1 462 ? 10.002  -3.796  148.456 1.00 35.23  ? 463  MET B O   1 
ATOM   6053  C CB  . MET B 1 462 ? 9.089   -2.691  145.533 1.00 26.45  ? 463  MET B CB  1 
ATOM   6054  C CG  . MET B 1 462 ? 10.524  -2.220  145.733 1.00 34.01  ? 463  MET B CG  1 
ATOM   6055  S SD  . MET B 1 462 ? 11.735  -3.553  145.810 1.00 54.94  ? 463  MET B SD  1 
ATOM   6056  C CE  . MET B 1 462 ? 11.633  -4.203  144.149 1.00 19.58  ? 463  MET B CE  1 
ATOM   6057  N N   . THR B 1 463 ? 7.985   -2.806  148.575 1.00 18.02  ? 464  THR B N   1 
ATOM   6058  C CA  . THR B 1 463 ? 8.137   -2.478  149.990 1.00 27.26  ? 464  THR B CA  1 
ATOM   6059  C C   . THR B 1 463 ? 8.248   -3.745  150.838 1.00 38.55  ? 464  THR B C   1 
ATOM   6060  O O   . THR B 1 463 ? 9.140   -3.863  151.685 1.00 39.39  ? 464  THR B O   1 
ATOM   6061  C CB  . THR B 1 463 ? 6.980   -1.602  150.504 1.00 30.29  ? 464  THR B CB  1 
ATOM   6062  O OG1 . THR B 1 463 ? 6.966   -0.361  149.788 1.00 34.11  ? 464  THR B OG1 1 
ATOM   6063  C CG2 . THR B 1 463 ? 7.146   -1.318  151.989 1.00 16.34  ? 464  THR B CG2 1 
ATOM   6064  N N   . ASN B 1 464 ? 7.344   -4.692  150.603 1.00 50.93  ? 465  ASN B N   1 
ATOM   6065  C CA  . ASN B 1 464 ? 7.404   -5.978  151.293 1.00 56.90  ? 465  ASN B CA  1 
ATOM   6066  C C   . ASN B 1 464 ? 8.714   -6.711  151.026 1.00 51.15  ? 465  ASN B C   1 
ATOM   6067  O O   . ASN B 1 464 ? 9.310   -7.295  151.937 1.00 45.77  ? 465  ASN B O   1 
ATOM   6068  C CB  . ASN B 1 464 ? 6.223   -6.863  150.897 1.00 63.76  ? 465  ASN B CB  1 
ATOM   6069  C CG  . ASN B 1 464 ? 5.185   -6.964  151.992 1.00 70.87  ? 465  ASN B CG  1 
ATOM   6070  O OD1 . ASN B 1 464 ? 4.292   -6.124  152.097 1.00 69.64  ? 465  ASN B OD1 1 
ATOM   6071  N ND2 . ASN B 1 464 ? 5.300   -7.996  152.822 1.00 72.97  ? 465  ASN B ND2 1 
ATOM   6072  N N   . ARG B 1 465 ? 9.157   -6.668  149.773 1.00 42.46  ? 466  ARG B N   1 
ATOM   6073  C CA  . ARG B 1 465 ? 10.415  -7.294  149.389 1.00 39.81  ? 466  ARG B CA  1 
ATOM   6074  C C   . ARG B 1 465 ? 11.570  -6.701  150.192 1.00 50.12  ? 466  ARG B C   1 
ATOM   6075  O O   . ARG B 1 465 ? 12.444  -7.427  150.670 1.00 56.24  ? 466  ARG B O   1 
ATOM   6076  C CB  . ARG B 1 465 ? 10.663  -7.115  147.890 1.00 31.73  ? 466  ARG B CB  1 
ATOM   6077  C CG  . ARG B 1 465 ? 11.563  -8.177  147.286 1.00 35.47  ? 466  ARG B CG  1 
ATOM   6078  C CD  . ARG B 1 465 ? 11.869  -7.887  145.829 1.00 49.72  ? 466  ARG B CD  1 
ATOM   6079  N NE  . ARG B 1 465 ? 10.658  -7.721  145.032 1.00 57.02  ? 466  ARG B NE  1 
ATOM   6080  C CZ  . ARG B 1 465 ? 10.655  -7.521  143.718 1.00 74.08  ? 466  ARG B CZ  1 
ATOM   6081  N NH1 . ARG B 1 465 ? 11.803  -7.464  143.055 1.00 72.47  ? 466  ARG B NH1 1 
ATOM   6082  N NH2 . ARG B 1 465 ? 9.508   -7.377  143.068 1.00 72.28  ? 466  ARG B NH2 1 
ATOM   6083  N N   . LEU B 1 466 ? 11.559  -5.381  150.348 1.00 43.67  ? 467  LEU B N   1 
ATOM   6084  C CA  . LEU B 1 466 ? 12.594  -4.686  151.110 1.00 31.87  ? 467  LEU B CA  1 
ATOM   6085  C C   . LEU B 1 466 ? 12.523  -4.971  152.610 1.00 36.29  ? 467  LEU B C   1 
ATOM   6086  O O   . LEU B 1 466 ? 13.549  -4.992  153.290 1.00 36.92  ? 467  LEU B O   1 
ATOM   6087  C CB  . LEU B 1 466 ? 12.529  -3.179  150.855 1.00 31.67  ? 467  LEU B CB  1 
ATOM   6088  C CG  . LEU B 1 466 ? 13.272  -2.687  149.613 1.00 37.51  ? 467  LEU B CG  1 
ATOM   6089  C CD1 . LEU B 1 466 ? 12.657  -1.405  149.101 1.00 39.96  ? 467  LEU B CD1 1 
ATOM   6090  C CD2 . LEU B 1 466 ? 14.739  -2.473  149.935 1.00 44.54  ? 467  LEU B CD2 1 
ATOM   6091  N N   . ARG B 1 467 ? 11.316  -5.183  153.126 1.00 38.35  ? 468  ARG B N   1 
ATOM   6092  C CA  . ARG B 1 467 ? 11.156  -5.521  154.538 1.00 45.73  ? 468  ARG B CA  1 
ATOM   6093  C C   . ARG B 1 467 ? 11.688  -6.926  154.834 1.00 61.07  ? 468  ARG B C   1 
ATOM   6094  O O   . ARG B 1 467 ? 12.437  -7.134  155.799 1.00 73.71  ? 468  ARG B O   1 
ATOM   6095  C CB  . ARG B 1 467 ? 9.693   -5.389  154.964 1.00 41.45  ? 468  ARG B CB  1 
ATOM   6096  C CG  . ARG B 1 467 ? 9.172   -3.956  154.940 1.00 50.58  ? 468  ARG B CG  1 
ATOM   6097  C CD  . ARG B 1 467 ? 7.674   -3.898  155.204 1.00 76.78  ? 468  ARG B CD  1 
ATOM   6098  N NE  . ARG B 1 467 ? 7.316   -4.506  156.483 1.00 90.75  ? 468  ARG B NE  1 
ATOM   6099  C CZ  . ARG B 1 467 ? 7.137   -3.827  157.612 1.00 85.84  ? 468  ARG B CZ  1 
ATOM   6100  N NH1 . ARG B 1 467 ? 7.277   -2.509  157.625 1.00 87.51  ? 468  ARG B NH1 1 
ATOM   6101  N NH2 . ARG B 1 467 ? 6.814   -4.466  158.729 1.00 72.94  ? 468  ARG B NH2 1 
ATOM   6102  N N   . SER B 1 468 ? 11.312  -7.887  153.994 1.00 58.54  ? 469  SER B N   1 
ATOM   6103  C CA  . SER B 1 468 ? 11.834  -9.244  154.128 1.00 58.51  ? 469  SER B CA  1 
ATOM   6104  C C   . SER B 1 468 ? 13.341  -9.255  153.876 1.00 71.23  ? 469  SER B C   1 
ATOM   6105  O O   . SER B 1 468 ? 14.061  -10.114 154.384 1.00 76.66  ? 469  SER B O   1 
ATOM   6106  C CB  . SER B 1 468 ? 11.117  -10.210 153.180 1.00 56.87  ? 469  SER B CB  1 
ATOM   6107  O OG  . SER B 1 468 ? 11.339  -9.864  151.825 1.00 76.79  ? 469  SER B OG  1 
ATOM   6108  N N   . ALA B 1 469 ? 13.811  -8.291  153.090 1.00 69.39  ? 470  ALA B N   1 
ATOM   6109  C CA  . ALA B 1 469 ? 15.242  -8.111  152.876 1.00 51.72  ? 470  ALA B CA  1 
ATOM   6110  C C   . ALA B 1 469 ? 15.916  -7.613  154.151 1.00 45.76  ? 470  ALA B C   1 
ATOM   6111  O O   . ALA B 1 469 ? 17.044  -7.998  154.456 1.00 59.33  ? 470  ALA B O   1 
ATOM   6112  C CB  . ALA B 1 469 ? 15.492  -7.147  151.737 1.00 47.04  ? 470  ALA B CB  1 
ATOM   6113  N N   . TYR B 1 470 ? 15.221  -6.751  154.889 1.00 44.46  ? 471  TYR B N   1 
ATOM   6114  C CA  . TYR B 1 470 ? 15.722  -6.279  156.175 1.00 43.55  ? 471  TYR B CA  1 
ATOM   6115  C C   . TYR B 1 470 ? 15.805  -7.446  157.142 1.00 50.16  ? 471  TYR B C   1 
ATOM   6116  O O   . TYR B 1 470 ? 16.730  -7.531  157.948 1.00 52.42  ? 471  TYR B O   1 
ATOM   6117  C CB  . TYR B 1 470 ? 14.823  -5.183  156.751 1.00 45.92  ? 471  TYR B CB  1 
ATOM   6118  C CG  . TYR B 1 470 ? 15.405  -4.479  157.962 1.00 50.05  ? 471  TYR B CG  1 
ATOM   6119  C CD1 . TYR B 1 470 ? 15.188  -4.964  159.246 1.00 39.99  ? 471  TYR B CD1 1 
ATOM   6120  C CD2 . TYR B 1 470 ? 16.167  -3.325  157.819 1.00 45.27  ? 471  TYR B CD2 1 
ATOM   6121  C CE1 . TYR B 1 470 ? 15.717  -4.321  160.354 1.00 39.07  ? 471  TYR B CE1 1 
ATOM   6122  C CE2 . TYR B 1 470 ? 16.699  -2.676  158.921 1.00 44.06  ? 471  TYR B CE2 1 
ATOM   6123  C CZ  . TYR B 1 470 ? 16.471  -3.178  160.185 1.00 40.61  ? 471  TYR B CZ  1 
ATOM   6124  O OH  . TYR B 1 470 ? 16.998  -2.534  161.283 1.00 43.27  ? 471  TYR B OH  1 
ATOM   6125  N N   . ASN B 1 471 ? 14.830  -8.346  157.058 1.00 62.21  ? 472  ASN B N   1 
ATOM   6126  C CA  . ASN B 1 471 ? 14.847  -9.545  157.889 1.00 73.61  ? 472  ASN B CA  1 
ATOM   6127  C C   . ASN B 1 471 ? 15.873  -10.577 157.417 1.00 79.48  ? 472  ASN B C   1 
ATOM   6128  O O   . ASN B 1 471 ? 16.144  -11.559 158.108 1.00 66.90  ? 472  ASN B O   1 
ATOM   6129  C CB  . ASN B 1 471 ? 13.452  -10.164 157.972 1.00 85.03  ? 472  ASN B CB  1 
ATOM   6130  C CG  . ASN B 1 471 ? 12.481  -9.299  158.751 1.00 91.21  ? 472  ASN B CG  1 
ATOM   6131  O OD1 . ASN B 1 471 ? 12.858  -8.651  159.728 1.00 88.77  ? 472  ASN B OD1 1 
ATOM   6132  N ND2 . ASN B 1 471 ? 11.225  -9.281  158.321 1.00 95.72  ? 472  ASN B ND2 1 
ATOM   6133  N N   . GLY B 1 472 ? 16.440  -10.345 156.237 1.00 90.32  ? 473  GLY B N   1 
ATOM   6134  C CA  . GLY B 1 472 ? 17.498  -11.191 155.714 1.00 84.30  ? 473  GLY B CA  1 
ATOM   6135  C C   . GLY B 1 472 ? 17.002  -12.349 154.870 1.00 93.40  ? 473  GLY B C   1 
ATOM   6136  O O   . GLY B 1 472 ? 17.764  -13.262 154.551 1.00 95.65  ? 473  GLY B O   1 
ATOM   6137  N N   . ASN B 1 473 ? 15.725  -12.311 154.501 1.00 99.38  ? 474  ASN B N   1 
ATOM   6138  C CA  . ASN B 1 473 ? 15.127  -13.398 153.734 1.00 97.49  ? 474  ASN B CA  1 
ATOM   6139  C C   . ASN B 1 473 ? 14.983  -13.076 152.249 1.00 96.28  ? 474  ASN B C   1 
ATOM   6140  O O   . ASN B 1 473 ? 15.252  -11.953 151.821 1.00 88.91  ? 474  ASN B O   1 
ATOM   6141  C CB  . ASN B 1 473 ? 13.760  -13.759 154.317 1.00 92.12  ? 474  ASN B CB  1 
ATOM   6142  C CG  . ASN B 1 473 ? 13.792  -13.903 155.825 1.00 91.44  ? 474  ASN B CG  1 
ATOM   6143  O OD1 . ASN B 1 473 ? 14.761  -14.407 156.392 1.00 96.72  ? 474  ASN B OD1 1 
ATOM   6144  N ND2 . ASN B 1 473 ? 12.732  -13.450 156.485 1.00 84.97  ? 474  ASN B ND2 1 
ATOM   6145  N N   . ASP B 1 474 ? 14.521  -14.068 151.489 1.00 100.58 ? 475  ASP B N   1 
ATOM   6146  C CA  . ASP B 1 474 ? 14.335  -13.971 150.038 1.00 104.54 ? 475  ASP B CA  1 
ATOM   6147  C C   . ASP B 1 474 ? 15.475  -13.251 149.314 1.00 111.96 ? 475  ASP B C   1 
ATOM   6148  O O   . ASP B 1 474 ? 16.003  -13.742 148.315 1.00 113.64 ? 475  ASP B O   1 
ATOM   6149  C CB  . ASP B 1 474 ? 12.991  -13.316 149.705 1.00 102.33 ? 475  ASP B CB  1 
ATOM   6150  C CG  . ASP B 1 474 ? 12.602  -13.496 148.249 1.00 100.08 ? 475  ASP B CG  1 
ATOM   6151  O OD1 . ASP B 1 474 ? 11.964  -14.520 147.926 1.00 83.77  ? 475  ASP B OD1 1 
ATOM   6152  O OD2 . ASP B 1 474 ? 12.940  -12.617 147.428 1.00 108.72 ? 475  ASP B OD2 1 
ATOM   6153  N N   . SER C 1 28  ? -15.201 -43.965 97.081  1.00 76.29  ? 29   SER C N   1 
ATOM   6154  C CA  . SER C 1 28  ? -16.123 -42.835 97.105  1.00 83.76  ? 29   SER C CA  1 
ATOM   6155  C C   . SER C 1 28  ? -16.733 -42.658 98.490  1.00 89.87  ? 29   SER C C   1 
ATOM   6156  O O   . SER C 1 28  ? -16.830 -43.615 99.259  1.00 103.21 ? 29   SER C O   1 
ATOM   6157  C CB  . SER C 1 28  ? -17.230 -43.022 96.066  1.00 83.38  ? 29   SER C CB  1 
ATOM   6158  O OG  . SER C 1 28  ? -16.693 -43.101 94.757  1.00 81.63  ? 29   SER C OG  1 
ATOM   6159  N N   . ARG C 1 29  ? -17.108 -41.421 98.810  1.00 88.64  ? 30   ARG C N   1 
ATOM   6160  C CA  . ARG C 1 29  ? -17.792 -41.091 100.063 1.00 92.23  ? 30   ARG C CA  1 
ATOM   6161  C C   . ARG C 1 29  ? -16.934 -41.321 101.308 1.00 104.21 ? 30   ARG C C   1 
ATOM   6162  O O   . ARG C 1 29  ? -17.357 -41.030 102.426 1.00 67.75  ? 30   ARG C O   1 
ATOM   6163  C CB  . ARG C 1 29  ? -19.140 -41.812 100.177 1.00 77.19  ? 30   ARG C CB  1 
ATOM   6164  C CG  . ARG C 1 29  ? -20.091 -41.518 99.026  1.00 72.39  ? 30   ARG C CG  1 
ATOM   6165  C CD  . ARG C 1 29  ? -21.508 -41.958 99.351  1.00 79.31  ? 30   ARG C CD  1 
ATOM   6166  N NE  . ARG C 1 29  ? -22.357 -42.012 98.163  1.00 83.23  ? 30   ARG C NE  1 
ATOM   6167  C CZ  . ARG C 1 29  ? -23.624 -42.412 98.172  1.00 86.28  ? 30   ARG C CZ  1 
ATOM   6168  N NH1 . ARG C 1 29  ? -24.192 -42.790 99.309  1.00 89.69  ? 30   ARG C NH1 1 
ATOM   6169  N NH2 . ARG C 1 29  ? -24.326 -42.433 97.047  1.00 81.77  ? 30   ARG C NH2 1 
ATOM   6170  N N   . SER C 1 30  ? -15.738 -41.864 101.107 1.00 104.62 ? 31   SER C N   1 
ATOM   6171  C CA  . SER C 1 30  ? -14.792 -42.046 102.194 1.00 105.12 ? 31   SER C CA  1 
ATOM   6172  C C   . SER C 1 30  ? -14.151 -40.707 102.518 1.00 105.54 ? 31   SER C C   1 
ATOM   6173  O O   . SER C 1 30  ? -13.880 -39.904 101.624 1.00 91.01  ? 31   SER C O   1 
ATOM   6174  C CB  . SER C 1 30  ? -13.723 -43.067 101.809 1.00 108.43 ? 31   SER C CB  1 
ATOM   6175  O OG  . SER C 1 30  ? -14.317 -44.290 101.410 1.00 121.13 ? 31   SER C OG  1 
ATOM   6176  N N   . CYS C 1 31  ? -13.926 -40.467 103.803 1.00 113.95 ? 32   CYS C N   1 
ATOM   6177  C CA  . CYS C 1 31  ? -13.297 -39.234 104.256 1.00 110.45 ? 32   CYS C CA  1 
ATOM   6178  C C   . CYS C 1 31  ? -11.787 -39.368 104.437 1.00 105.13 ? 32   CYS C C   1 
ATOM   6179  O O   . CYS C 1 31  ? -11.147 -38.453 104.926 1.00 106.30 ? 32   CYS C O   1 
ATOM   6180  C CB  . CYS C 1 31  ? -13.944 -38.751 105.556 1.00 113.67 ? 32   CYS C CB  1 
ATOM   6181  S SG  . CYS C 1 31  ? -15.540 -37.926 105.331 1.00 128.66 ? 32   CYS C SG  1 
ATOM   6182  N N   . GLY C 1 32  ? -11.235 -40.517 104.060 1.00 103.99 ? 33   GLY C N   1 
ATOM   6183  C CA  . GLY C 1 32  ? -9.835  -40.830 104.304 1.00 107.09 ? 33   GLY C CA  1 
ATOM   6184  C C   . GLY C 1 32  ? -8.810  -39.795 103.862 1.00 102.06 ? 33   GLY C C   1 
ATOM   6185  O O   . GLY C 1 32  ? -7.970  -39.370 104.659 1.00 94.81  ? 33   GLY C O   1 
ATOM   6186  N N   . GLU C 1 33  ? -8.870  -39.394 102.595 1.00 97.68  ? 34   GLU C N   1 
ATOM   6187  C CA  . GLU C 1 33  ? -7.928  -38.424 102.041 1.00 75.47  ? 34   GLU C CA  1 
ATOM   6188  C C   . GLU C 1 33  ? -8.018  -37.091 102.771 1.00 82.53  ? 34   GLU C C   1 
ATOM   6189  O O   . GLU C 1 33  ? -7.002  -36.484 103.112 1.00 91.28  ? 34   GLU C O   1 
ATOM   6190  C CB  . GLU C 1 33  ? -8.189  -38.220 100.547 1.00 67.94  ? 34   GLU C CB  1 
ATOM   6191  C CG  . GLU C 1 33  ? -7.294  -37.177 99.890  1.00 94.51  ? 34   GLU C CG  1 
ATOM   6192  C CD  . GLU C 1 33  ? -5.868  -37.660 99.692  1.00 121.03 ? 34   GLU C CD  1 
ATOM   6193  O OE1 . GLU C 1 33  ? -5.649  -38.889 99.656  1.00 133.96 ? 34   GLU C OE1 1 
ATOM   6194  O OE2 . GLU C 1 33  ? -4.963  -36.808 99.567  1.00 119.85 ? 34   GLU C OE2 1 
ATOM   6195  N N   . VAL C 1 34  ? -9.245  -36.646 103.016 1.00 88.65  ? 35   VAL C N   1 
ATOM   6196  C CA  . VAL C 1 34  ? -9.477  -35.384 103.706 1.00 89.67  ? 35   VAL C CA  1 
ATOM   6197  C C   . VAL C 1 34  ? -9.037  -35.473 105.165 1.00 100.93 ? 35   VAL C C   1 
ATOM   6198  O O   . VAL C 1 34  ? -8.608  -34.491 105.754 1.00 100.45 ? 35   VAL C O   1 
ATOM   6199  C CB  . VAL C 1 34  ? -10.966 -34.967 103.613 1.00 92.27  ? 35   VAL C CB  1 
ATOM   6200  C CG1 . VAL C 1 34  ? -11.218 -33.668 104.361 1.00 53.60  ? 35   VAL C CG1 1 
ATOM   6201  C CG2 . VAL C 1 34  ? -11.380 -34.829 102.154 1.00 90.75  ? 35   VAL C CG2 1 
ATOM   6202  N N   . ARG C 1 35  ? -9.128  -36.667 105.735 1.00 112.00 ? 36   ARG C N   1 
ATOM   6203  C CA  . ARG C 1 35  ? -8.739  -36.905 107.118 1.00 120.11 ? 36   ARG C CA  1 
ATOM   6204  C C   . ARG C 1 35  ? -7.221  -36.892 107.226 1.00 119.49 ? 36   ARG C C   1 
ATOM   6205  O O   . ARG C 1 35  ? -6.662  -36.520 108.258 1.00 123.06 ? 36   ARG C O   1 
ATOM   6206  C CB  . ARG C 1 35  ? -9.297  -38.246 107.610 1.00 129.99 ? 36   ARG C CB  1 
ATOM   6207  C CG  . ARG C 1 35  ? -9.105  -38.502 109.100 1.00 142.92 ? 36   ARG C CG  1 
ATOM   6208  C CD  . ARG C 1 35  ? -9.965  -39.665 109.584 1.00 152.13 ? 36   ARG C CD  1 
ATOM   6209  N NE  . ARG C 1 35  ? -9.196  -40.895 109.763 1.00 157.54 ? 36   ARG C NE  1 
ATOM   6210  C CZ  . ARG C 1 35  ? -9.719  -42.051 110.159 1.00 163.07 ? 36   ARG C CZ  1 
ATOM   6211  N NH1 . ARG C 1 35  ? -11.018 -42.142 110.415 1.00 163.83 ? 36   ARG C NH1 1 
ATOM   6212  N NH2 . ARG C 1 35  ? -8.944  -43.119 110.299 1.00 165.10 ? 36   ARG C NH2 1 
ATOM   6213  N N   . GLN C 1 36  ? -6.562  -37.304 106.148 1.00 116.10 ? 37   GLN C N   1 
ATOM   6214  C CA  . GLN C 1 36  ? -5.105  -37.330 106.097 1.00 113.52 ? 37   GLN C CA  1 
ATOM   6215  C C   . GLN C 1 36  ? -4.537  -35.936 105.840 1.00 98.67  ? 37   GLN C C   1 
ATOM   6216  O O   . GLN C 1 36  ? -3.489  -35.576 106.377 1.00 76.70  ? 37   GLN C O   1 
ATOM   6217  C CB  . GLN C 1 36  ? -4.628  -38.310 105.021 1.00 119.54 ? 37   GLN C CB  1 
ATOM   6218  C CG  . GLN C 1 36  ? -3.136  -38.616 105.054 1.00 127.09 ? 37   GLN C CG  1 
ATOM   6219  C CD  . GLN C 1 36  ? -2.359  -37.872 103.986 1.00 130.64 ? 37   GLN C CD  1 
ATOM   6220  O OE1 . GLN C 1 36  ? -2.230  -36.649 104.031 1.00 129.26 ? 37   GLN C OE1 1 
ATOM   6221  N NE2 . GLN C 1 36  ? -1.837  -38.610 103.013 1.00 132.98 ? 37   GLN C NE2 1 
ATOM   6222  N N   . ILE C 1 37  ? -5.232  -35.159 105.013 1.00 98.21  ? 38   ILE C N   1 
ATOM   6223  C CA  . ILE C 1 37  ? -4.807  -33.798 104.698 1.00 93.88  ? 38   ILE C CA  1 
ATOM   6224  C C   . ILE C 1 37  ? -5.080  -32.849 105.866 1.00 99.42  ? 38   ILE C C   1 
ATOM   6225  O O   . ILE C 1 37  ? -4.244  -32.015 106.215 1.00 111.77 ? 38   ILE C O   1 
ATOM   6226  C CB  . ILE C 1 37  ? -5.491  -33.277 103.415 1.00 92.25  ? 38   ILE C CB  1 
ATOM   6227  C CG1 . ILE C 1 37  ? -5.054  -34.110 102.207 1.00 90.86  ? 38   ILE C CG1 1 
ATOM   6228  C CG2 . ILE C 1 37  ? -5.168  -31.806 103.189 1.00 92.94  ? 38   ILE C CG2 1 
ATOM   6229  C CD1 . ILE C 1 37  ? -5.667  -33.665 100.897 1.00 90.01  ? 38   ILE C CD1 1 
ATOM   6230  N N   . TYR C 1 38  ? -6.259  -32.988 106.464 1.00 92.48  ? 39   TYR C N   1 
ATOM   6231  C CA  . TYR C 1 38  ? -6.633  -32.246 107.663 1.00 91.89  ? 39   TYR C CA  1 
ATOM   6232  C C   . TYR C 1 38  ? -5.762  -32.712 108.825 1.00 105.61 ? 39   TYR C C   1 
ATOM   6233  O O   . TYR C 1 38  ? -5.446  -31.939 109.729 1.00 100.70 ? 39   TYR C O   1 
ATOM   6234  C CB  . TYR C 1 38  ? -8.117  -32.483 107.967 1.00 86.33  ? 39   TYR C CB  1 
ATOM   6235  C CG  . TYR C 1 38  ? -8.675  -31.794 109.193 1.00 81.51  ? 39   TYR C CG  1 
ATOM   6236  C CD1 . TYR C 1 38  ? -8.645  -32.414 110.436 1.00 81.42  ? 39   TYR C CD1 1 
ATOM   6237  C CD2 . TYR C 1 38  ? -9.272  -30.543 109.100 1.00 79.01  ? 39   TYR C CD2 1 
ATOM   6238  C CE1 . TYR C 1 38  ? -9.169  -31.798 111.555 1.00 82.14  ? 39   TYR C CE1 1 
ATOM   6239  C CE2 . TYR C 1 38  ? -9.800  -29.919 110.216 1.00 82.67  ? 39   TYR C CE2 1 
ATOM   6240  C CZ  . TYR C 1 38  ? -9.745  -30.552 111.440 1.00 84.52  ? 39   TYR C CZ  1 
ATOM   6241  O OH  . TYR C 1 38  ? -10.266 -29.940 112.557 1.00 92.72  ? 39   TYR C OH  1 
ATOM   6242  N N   . GLY C 1 39  ? -5.372  -33.983 108.783 1.00 118.17 ? 40   GLY C N   1 
ATOM   6243  C CA  . GLY C 1 39  ? -4.524  -34.566 109.808 1.00 127.84 ? 40   GLY C CA  1 
ATOM   6244  C C   . GLY C 1 39  ? -3.083  -34.102 109.718 1.00 129.25 ? 40   GLY C C   1 
ATOM   6245  O O   . GLY C 1 39  ? -2.385  -34.020 110.729 1.00 125.04 ? 40   GLY C O   1 
ATOM   6246  N N   . ALA C 1 40  ? -2.635  -33.805 108.502 1.00 129.67 ? 41   ALA C N   1 
ATOM   6247  C CA  . ALA C 1 40  ? -1.287  -33.294 108.285 1.00 124.43 ? 41   ALA C CA  1 
ATOM   6248  C C   . ALA C 1 40  ? -1.145  -31.906 108.898 1.00 126.35 ? 41   ALA C C   1 
ATOM   6249  O O   . ALA C 1 40  ? -0.055  -31.500 109.299 1.00 132.01 ? 41   ALA C O   1 
ATOM   6250  C CB  . ALA C 1 40  ? -0.962  -33.259 106.801 1.00 114.24 ? 41   ALA C CB  1 
ATOM   6251  N N   . LYS C 1 41  ? -2.259  -31.183 108.966 1.00 119.21 ? 42   LYS C N   1 
ATOM   6252  C CA  . LYS C 1 41  ? -2.286  -29.875 109.606 1.00 113.07 ? 42   LYS C CA  1 
ATOM   6253  C C   . LYS C 1 41  ? -2.344  -30.032 111.122 1.00 116.23 ? 42   LYS C C   1 
ATOM   6254  O O   . LYS C 1 41  ? -2.097  -29.084 111.867 1.00 111.41 ? 42   LYS C O   1 
ATOM   6255  C CB  . LYS C 1 41  ? -3.470  -29.053 109.095 1.00 106.14 ? 42   LYS C CB  1 
ATOM   6256  C CG  . LYS C 1 41  ? -3.374  -28.712 107.616 1.00 94.88  ? 42   LYS C CG  1 
ATOM   6257  C CD  . LYS C 1 41  ? -4.534  -27.846 107.160 1.00 83.39  ? 42   LYS C CD  1 
ATOM   6258  C CE  . LYS C 1 41  ? -4.240  -27.211 105.810 1.00 82.90  ? 42   LYS C CE  1 
ATOM   6259  N NZ  . LYS C 1 41  ? -3.878  -28.220 104.776 1.00 81.42  ? 42   LYS C NZ  1 
ATOM   6260  N N   . GLY C 1 42  ? -2.667  -31.243 111.566 1.00 124.30 ? 43   GLY C N   1 
ATOM   6261  C CA  . GLY C 1 42  ? -2.583  -31.599 112.971 1.00 138.42 ? 43   GLY C CA  1 
ATOM   6262  C C   . GLY C 1 42  ? -3.613  -30.977 113.893 1.00 145.26 ? 43   GLY C C   1 
ATOM   6263  O O   . GLY C 1 42  ? -3.263  -30.414 114.929 1.00 147.23 ? 43   GLY C O   1 
ATOM   6264  N N   . PHE C 1 43  ? -4.885  -31.075 113.521 1.00 144.70 ? 44   PHE C N   1 
ATOM   6265  C CA  . PHE C 1 43  ? -5.966  -30.675 114.414 1.00 145.50 ? 44   PHE C CA  1 
ATOM   6266  C C   . PHE C 1 43  ? -6.543  -31.909 115.100 1.00 147.92 ? 44   PHE C C   1 
ATOM   6267  O O   . PHE C 1 43  ? -6.049  -33.017 114.903 1.00 151.54 ? 44   PHE C O   1 
ATOM   6268  C CB  . PHE C 1 43  ? -7.055  -29.918 113.653 1.00 143.38 ? 44   PHE C CB  1 
ATOM   6269  C CG  . PHE C 1 43  ? -6.612  -28.577 113.137 1.00 141.23 ? 44   PHE C CG  1 
ATOM   6270  C CD1 . PHE C 1 43  ? -6.717  -27.446 113.931 1.00 145.02 ? 44   PHE C CD1 1 
ATOM   6271  C CD2 . PHE C 1 43  ? -6.090  -28.449 111.861 1.00 142.09 ? 44   PHE C CD2 1 
ATOM   6272  C CE1 . PHE C 1 43  ? -6.310  -26.210 113.460 1.00 147.33 ? 44   PHE C CE1 1 
ATOM   6273  C CE2 . PHE C 1 43  ? -5.681  -27.216 111.384 1.00 145.91 ? 44   PHE C CE2 1 
ATOM   6274  C CZ  . PHE C 1 43  ? -5.791  -26.095 112.185 1.00 147.15 ? 44   PHE C CZ  1 
ATOM   6275  N N   . SER C 1 44  ? -7.584  -31.719 115.905 1.00 147.31 ? 45   SER C N   1 
ATOM   6276  C CA  . SER C 1 44  ? -8.191  -32.828 116.637 1.00 152.20 ? 45   SER C CA  1 
ATOM   6277  C C   . SER C 1 44  ? -8.862  -33.823 115.692 1.00 150.36 ? 45   SER C C   1 
ATOM   6278  O O   . SER C 1 44  ? -9.673  -33.440 114.848 1.00 147.61 ? 45   SER C O   1 
ATOM   6279  C CB  . SER C 1 44  ? -9.200  -32.307 117.663 1.00 155.74 ? 45   SER C CB  1 
ATOM   6280  O OG  . SER C 1 44  ? -9.733  -33.367 118.439 1.00 160.48 ? 45   SER C OG  1 
ATOM   6281  N N   . LEU C 1 45  ? -8.520  -35.100 115.842 1.00 147.37 ? 46   LEU C N   1 
ATOM   6282  C CA  . LEU C 1 45  ? -9.064  -36.148 114.981 1.00 135.81 ? 46   LEU C CA  1 
ATOM   6283  C C   . LEU C 1 45  ? -10.353 -36.742 115.539 1.00 133.32 ? 46   LEU C C   1 
ATOM   6284  O O   . LEU C 1 45  ? -10.908 -37.683 114.973 1.00 124.84 ? 46   LEU C O   1 
ATOM   6285  C CB  . LEU C 1 45  ? -8.035  -37.258 114.741 1.00 128.77 ? 46   LEU C CB  1 
ATOM   6286  C CG  . LEU C 1 45  ? -6.944  -37.007 113.695 1.00 116.92 ? 46   LEU C CG  1 
ATOM   6287  C CD1 . LEU C 1 45  ? -7.534  -36.395 112.430 1.00 110.45 ? 46   LEU C CD1 1 
ATOM   6288  C CD2 . LEU C 1 45  ? -5.818  -36.143 114.248 1.00 105.17 ? 46   LEU C CD2 1 
ATOM   6289  N N   . SER C 1 46  ? -10.821 -36.199 116.657 1.00 138.64 ? 47   SER C N   1 
ATOM   6290  C CA  . SER C 1 46  ? -12.101 -36.608 117.217 1.00 139.78 ? 47   SER C CA  1 
ATOM   6291  C C   . SER C 1 46  ? -13.226 -35.855 116.517 1.00 133.20 ? 47   SER C C   1 
ATOM   6292  O O   . SER C 1 46  ? -14.405 -36.163 116.696 1.00 123.12 ? 47   SER C O   1 
ATOM   6293  C CB  . SER C 1 46  ? -12.139 -36.342 118.723 1.00 141.97 ? 47   SER C CB  1 
ATOM   6294  O OG  . SER C 1 46  ? -11.919 -34.970 119.004 1.00 140.71 ? 47   SER C OG  1 
ATOM   6295  N N   . ASP C 1 47  ? -12.846 -34.861 115.719 1.00 132.90 ? 48   ASP C N   1 
ATOM   6296  C CA  . ASP C 1 47  ? -13.804 -34.019 115.014 1.00 134.21 ? 48   ASP C CA  1 
ATOM   6297  C C   . ASP C 1 47  ? -14.051 -34.478 113.576 1.00 133.91 ? 48   ASP C C   1 
ATOM   6298  O O   . ASP C 1 47  ? -14.875 -33.895 112.873 1.00 134.64 ? 48   ASP C O   1 
ATOM   6299  C CB  . ASP C 1 47  ? -13.318 -32.567 115.004 1.00 140.02 ? 48   ASP C CB  1 
ATOM   6300  C CG  . ASP C 1 47  ? -12.957 -32.060 116.388 1.00 143.66 ? 48   ASP C CG  1 
ATOM   6301  O OD1 . ASP C 1 47  ? -12.862 -32.884 117.321 1.00 145.98 ? 48   ASP C OD1 1 
ATOM   6302  O OD2 . ASP C 1 47  ? -12.756 -30.836 116.539 1.00 138.54 ? 48   ASP C OD2 1 
ATOM   6303  N N   . VAL C 1 48  ? -13.343 -35.516 113.139 1.00 137.70 ? 49   VAL C N   1 
ATOM   6304  C CA  . VAL C 1 48  ? -13.421 -35.941 111.740 1.00 139.63 ? 49   VAL C CA  1 
ATOM   6305  C C   . VAL C 1 48  ? -14.238 -37.219 111.516 1.00 137.37 ? 49   VAL C C   1 
ATOM   6306  O O   . VAL C 1 48  ? -13.984 -38.251 112.139 1.00 139.36 ? 49   VAL C O   1 
ATOM   6307  C CB  . VAL C 1 48  ? -12.016 -36.076 111.095 1.00 111.11 ? 49   VAL C CB  1 
ATOM   6308  C CG1 . VAL C 1 48  ? -11.135 -37.022 111.895 1.00 119.17 ? 49   VAL C CG1 1 
ATOM   6309  C CG2 . VAL C 1 48  ? -12.132 -36.533 109.647 1.00 99.24  ? 49   VAL C CG2 1 
ATOM   6310  N N   . PRO C 1 49  ? -15.242 -37.138 110.628 1.00 126.31 ? 50   PRO C N   1 
ATOM   6311  C CA  . PRO C 1 49  ? -16.087 -38.272 110.238 1.00 119.43 ? 50   PRO C CA  1 
ATOM   6312  C C   . PRO C 1 49  ? -15.318 -39.328 109.450 1.00 117.06 ? 50   PRO C C   1 
ATOM   6313  O O   . PRO C 1 49  ? -14.332 -39.009 108.786 1.00 111.84 ? 50   PRO C O   1 
ATOM   6314  C CB  . PRO C 1 49  ? -17.140 -37.628 109.329 1.00 115.81 ? 50   PRO C CB  1 
ATOM   6315  C CG  . PRO C 1 49  ? -17.136 -36.182 109.694 1.00 116.96 ? 50   PRO C CG  1 
ATOM   6316  C CD  . PRO C 1 49  ? -15.715 -35.875 110.036 1.00 119.51 ? 50   PRO C CD  1 
ATOM   6317  N N   . GLN C 1 50  ? -15.771 -40.575 109.530 1.00 125.11 ? 51   GLN C N   1 
ATOM   6318  C CA  . GLN C 1 50  ? -15.178 -41.665 108.764 1.00 122.41 ? 51   GLN C CA  1 
ATOM   6319  C C   . GLN C 1 50  ? -15.690 -41.675 107.323 1.00 107.95 ? 51   GLN C C   1 
ATOM   6320  O O   . GLN C 1 50  ? -14.946 -41.977 106.390 1.00 102.44 ? 51   GLN C O   1 
ATOM   6321  C CB  . GLN C 1 50  ? -15.460 -43.006 109.443 1.00 127.88 ? 51   GLN C CB  1 
ATOM   6322  C CG  . GLN C 1 50  ? -14.878 -43.118 110.845 1.00 136.59 ? 51   GLN C CG  1 
ATOM   6323  C CD  . GLN C 1 50  ? -15.379 -44.338 111.592 1.00 154.10 ? 51   GLN C CD  1 
ATOM   6324  O OE1 . GLN C 1 50  ? -16.366 -44.960 111.197 1.00 161.15 ? 51   GLN C OE1 1 
ATOM   6325  N NE2 . GLN C 1 50  ? -14.701 -44.687 112.680 1.00 157.03 ? 51   GLN C NE2 1 
ATOM   6326  N N   . ALA C 1 51  ? -16.966 -41.341 107.154 1.00 95.97  ? 52   ALA C N   1 
ATOM   6327  C CA  . ALA C 1 51  ? -17.588 -41.288 105.835 1.00 82.09  ? 52   ALA C CA  1 
ATOM   6328  C C   . ALA C 1 51  ? -18.370 -39.988 105.668 1.00 78.72  ? 52   ALA C C   1 
ATOM   6329  O O   . ALA C 1 51  ? -18.588 -39.266 106.640 1.00 86.01  ? 52   ALA C O   1 
ATOM   6330  C CB  . ALA C 1 51  ? -18.496 -42.486 105.628 1.00 84.85  ? 52   ALA C CB  1 
ATOM   6331  N N   . GLU C 1 52  ? -18.782 -39.692 104.438 1.00 75.71  ? 53   GLU C N   1 
ATOM   6332  C CA  . GLU C 1 52  ? -19.490 -38.445 104.143 1.00 82.83  ? 53   GLU C CA  1 
ATOM   6333  C C   . GLU C 1 52  ? -20.782 -38.277 104.944 1.00 88.00  ? 53   GLU C C   1 
ATOM   6334  O O   . GLU C 1 52  ? -21.516 -39.238 105.175 1.00 102.76 ? 53   GLU C O   1 
ATOM   6335  C CB  . GLU C 1 52  ? -19.766 -38.311 102.642 1.00 77.69  ? 53   GLU C CB  1 
ATOM   6336  C CG  . GLU C 1 52  ? -18.542 -37.937 101.822 1.00 77.21  ? 53   GLU C CG  1 
ATOM   6337  C CD  . GLU C 1 52  ? -18.869 -37.679 100.364 1.00 76.58  ? 53   GLU C CD  1 
ATOM   6338  O OE1 . GLU C 1 52  ? -20.052 -37.810 99.987  1.00 76.74  ? 53   GLU C OE1 1 
ATOM   6339  O OE2 . GLU C 1 52  ? -17.943 -37.343 99.596  1.00 68.45  ? 53   GLU C OE2 1 
ATOM   6340  N N   . ILE C 1 53  ? -21.043 -37.041 105.362 1.00 71.00  ? 54   ILE C N   1 
ATOM   6341  C CA  . ILE C 1 53  ? -22.173 -36.712 106.225 1.00 71.02  ? 54   ILE C CA  1 
ATOM   6342  C C   . ILE C 1 53  ? -22.939 -35.519 105.639 1.00 85.78  ? 54   ILE C C   1 
ATOM   6343  O O   . ILE C 1 53  ? -22.368 -34.718 104.899 1.00 102.30 ? 54   ILE C O   1 
ATOM   6344  C CB  . ILE C 1 53  ? -21.684 -36.397 107.668 1.00 112.94 ? 54   ILE C CB  1 
ATOM   6345  C CG1 . ILE C 1 53  ? -20.953 -37.603 108.261 1.00 116.64 ? 54   ILE C CG1 1 
ATOM   6346  C CG2 . ILE C 1 53  ? -22.833 -35.998 108.585 1.00 119.58 ? 54   ILE C CG2 1 
ATOM   6347  C CD1 . ILE C 1 53  ? -20.698 -37.494 109.751 1.00 119.67 ? 54   ILE C CD1 1 
ATOM   6348  N N   . SER C 1 54  ? -24.231 -35.423 105.951 1.00 83.99  ? 55   SER C N   1 
ATOM   6349  C CA  . SER C 1 54  ? -25.070 -34.306 105.517 1.00 82.34  ? 55   SER C CA  1 
ATOM   6350  C C   . SER C 1 54  ? -24.470 -32.949 105.887 1.00 83.02  ? 55   SER C C   1 
ATOM   6351  O O   . SER C 1 54  ? -23.970 -32.759 106.997 1.00 81.60  ? 55   SER C O   1 
ATOM   6352  C CB  . SER C 1 54  ? -26.471 -34.438 106.120 1.00 78.49  ? 55   SER C CB  1 
ATOM   6353  O OG  . SER C 1 54  ? -27.286 -33.333 105.772 1.00 71.95  ? 55   SER C OG  1 
ATOM   6354  N N   . GLY C 1 55  ? -24.523 -32.010 104.946 1.00 77.86  ? 56   GLY C N   1 
ATOM   6355  C CA  . GLY C 1 55  ? -23.871 -30.721 105.102 1.00 90.97  ? 56   GLY C CA  1 
ATOM   6356  C C   . GLY C 1 55  ? -24.766 -29.531 105.392 1.00 100.11 ? 56   GLY C C   1 
ATOM   6357  O O   . GLY C 1 55  ? -24.373 -28.389 105.148 1.00 93.78  ? 56   GLY C O   1 
ATOM   6358  N N   . GLU C 1 56  ? -25.967 -29.790 105.902 1.00 106.52 ? 57   GLU C N   1 
ATOM   6359  C CA  . GLU C 1 56  ? -26.928 -28.729 106.204 1.00 106.34 ? 57   GLU C CA  1 
ATOM   6360  C C   . GLU C 1 56  ? -26.378 -27.676 107.170 1.00 94.74  ? 57   GLU C C   1 
ATOM   6361  O O   . GLU C 1 56  ? -26.891 -26.560 107.240 1.00 91.77  ? 57   GLU C O   1 
ATOM   6362  C CB  . GLU C 1 56  ? -28.213 -29.327 106.784 1.00 119.68 ? 57   GLU C CB  1 
ATOM   6363  C CG  . GLU C 1 56  ? -28.939 -30.284 105.851 1.00 134.04 ? 57   GLU C CG  1 
ATOM   6364  C CD  . GLU C 1 56  ? -30.178 -30.890 106.486 1.00 145.24 ? 57   GLU C CD  1 
ATOM   6365  O OE1 . GLU C 1 56  ? -30.408 -30.656 107.691 1.00 153.60 ? 57   GLU C OE1 1 
ATOM   6366  O OE2 . GLU C 1 56  ? -30.924 -31.601 105.779 1.00 143.07 ? 57   GLU C OE2 1 
ATOM   6367  N N   . HIS C 1 57  ? -25.334 -28.040 107.907 1.00 86.65  ? 58   HIS C N   1 
ATOM   6368  C CA  . HIS C 1 57  ? -24.780 -27.185 108.950 1.00 93.76  ? 58   HIS C CA  1 
ATOM   6369  C C   . HIS C 1 57  ? -23.688 -26.243 108.445 1.00 99.69  ? 58   HIS C C   1 
ATOM   6370  O O   . HIS C 1 57  ? -23.257 -25.346 109.170 1.00 104.82 ? 58   HIS C O   1 
ATOM   6371  C CB  . HIS C 1 57  ? -24.206 -28.054 110.068 1.00 101.60 ? 58   HIS C CB  1 
ATOM   6372  C CG  . HIS C 1 57  ? -23.059 -28.910 109.631 1.00 109.74 ? 58   HIS C CG  1 
ATOM   6373  N ND1 . HIS C 1 57  ? -23.217 -29.994 108.795 1.00 108.98 ? 58   HIS C ND1 1 
ATOM   6374  C CD2 . HIS C 1 57  ? -21.735 -28.836 109.906 1.00 113.15 ? 58   HIS C CD2 1 
ATOM   6375  C CE1 . HIS C 1 57  ? -22.041 -30.554 108.577 1.00 110.78 ? 58   HIS C CE1 1 
ATOM   6376  N NE2 . HIS C 1 57  ? -21.125 -29.871 109.240 1.00 113.58 ? 58   HIS C NE2 1 
ATOM   6377  N N   . LEU C 1 58  ? -23.243 -26.444 107.208 1.00 96.46  ? 59   LEU C N   1 
ATOM   6378  C CA  . LEU C 1 58  ? -22.119 -25.677 106.672 1.00 85.11  ? 59   LEU C CA  1 
ATOM   6379  C C   . LEU C 1 58  ? -22.436 -24.193 106.497 1.00 85.57  ? 59   LEU C C   1 
ATOM   6380  O O   . LEU C 1 58  ? -23.434 -23.826 105.875 1.00 81.50  ? 59   LEU C O   1 
ATOM   6381  C CB  . LEU C 1 58  ? -21.632 -26.274 105.348 1.00 75.11  ? 59   LEU C CB  1 
ATOM   6382  C CG  . LEU C 1 58  ? -20.971 -27.652 105.428 1.00 71.88  ? 59   LEU C CG  1 
ATOM   6383  C CD1 . LEU C 1 58  ? -20.464 -28.079 104.060 1.00 74.51  ? 59   LEU C CD1 1 
ATOM   6384  C CD2 . LEU C 1 58  ? -19.842 -27.658 106.448 1.00 68.18  ? 59   LEU C CD2 1 
ATOM   6385  N N   . ARG C 1 59  ? -21.574 -23.347 107.054 1.00 87.48  ? 60   ARG C N   1 
ATOM   6386  C CA  . ARG C 1 59  ? -21.738 -21.901 106.974 1.00 90.50  ? 60   ARG C CA  1 
ATOM   6387  C C   . ARG C 1 59  ? -21.115 -21.332 105.701 1.00 93.69  ? 60   ARG C C   1 
ATOM   6388  O O   . ARG C 1 59  ? -21.822 -20.842 104.821 1.00 104.18 ? 60   ARG C O   1 
ATOM   6389  C CB  . ARG C 1 59  ? -21.121 -21.228 108.204 1.00 96.38  ? 60   ARG C CB  1 
ATOM   6390  C CG  . ARG C 1 59  ? -21.953 -21.356 109.469 1.00 106.26 ? 60   ARG C CG  1 
ATOM   6391  C CD  . ARG C 1 59  ? -22.929 -20.196 109.608 1.00 110.84 ? 60   ARG C CD  1 
ATOM   6392  N NE  . ARG C 1 59  ? -23.940 -20.448 110.632 1.00 116.75 ? 60   ARG C NE  1 
ATOM   6393  C CZ  . ARG C 1 59  ? -23.763 -20.231 111.932 1.00 117.26 ? 60   ARG C CZ  1 
ATOM   6394  N NH1 . ARG C 1 59  ? -22.606 -19.758 112.378 1.00 115.19 ? 60   ARG C NH1 1 
ATOM   6395  N NH2 . ARG C 1 59  ? -24.743 -20.491 112.787 1.00 116.14 ? 60   ARG C NH2 1 
ATOM   6396  N N   . ILE C 1 60  ? -19.791 -21.396 105.612 1.00 85.73  ? 61   ILE C N   1 
ATOM   6397  C CA  . ILE C 1 60  ? -19.073 -20.827 104.475 1.00 75.61  ? 61   ILE C CA  1 
ATOM   6398  C C   . ILE C 1 60  ? -19.225 -21.657 103.200 1.00 69.85  ? 61   ILE C C   1 
ATOM   6399  O O   . ILE C 1 60  ? -19.578 -21.128 102.146 1.00 73.73  ? 61   ILE C O   1 
ATOM   6400  C CB  . ILE C 1 60  ? -17.566 -20.644 104.771 1.00 72.08  ? 61   ILE C CB  1 
ATOM   6401  C CG1 . ILE C 1 60  ? -17.350 -19.874 106.077 1.00 79.88  ? 61   ILE C CG1 1 
ATOM   6402  C CG2 . ILE C 1 60  ? -16.883 -19.936 103.611 1.00 61.92  ? 61   ILE C CG2 1 
ATOM   6403  C CD1 . ILE C 1 60  ? -17.124 -20.759 107.291 1.00 90.00  ? 61   ILE C CD1 1 
ATOM   6404  N N   . CYS C 1 61  ? -18.957 -22.956 103.302 1.00 53.86  ? 62   CYS C N   1 
ATOM   6405  C CA  . CYS C 1 61  ? -18.991 -23.845 102.143 1.00 49.01  ? 62   CYS C CA  1 
ATOM   6406  C C   . CYS C 1 61  ? -20.407 -24.050 101.612 1.00 64.62  ? 62   CYS C C   1 
ATOM   6407  O O   . CYS C 1 61  ? -21.365 -24.071 102.387 1.00 71.58  ? 62   CYS C O   1 
ATOM   6408  C CB  . CYS C 1 61  ? -18.373 -25.201 102.493 1.00 45.90  ? 62   CYS C CB  1 
ATOM   6409  S SG  . CYS C 1 61  ? -16.619 -25.148 102.919 1.00 86.87  ? 62   CYS C SG  1 
ATOM   6410  N N   . PRO C 1 62  ? -20.545 -24.193 100.282 1.00 63.65  ? 63   PRO C N   1 
ATOM   6411  C CA  . PRO C 1 62  ? -21.842 -24.514 99.680  1.00 61.97  ? 63   PRO C CA  1 
ATOM   6412  C C   . PRO C 1 62  ? -22.372 -25.828 100.235 1.00 66.73  ? 63   PRO C C   1 
ATOM   6413  O O   . PRO C 1 62  ? -21.634 -26.811 100.291 1.00 70.50  ? 63   PRO C O   1 
ATOM   6414  C CB  . PRO C 1 62  ? -21.511 -24.665 98.192  1.00 51.74  ? 63   PRO C CB  1 
ATOM   6415  C CG  . PRO C 1 62  ? -20.282 -23.852 97.997  1.00 55.16  ? 63   PRO C CG  1 
ATOM   6416  C CD  . PRO C 1 62  ? -19.496 -24.011 99.264  1.00 62.16  ? 63   PRO C CD  1 
ATOM   6417  N N   . GLN C 1 63  ? -23.636 -25.840 100.640 1.00 80.05  ? 64   GLN C N   1 
ATOM   6418  C CA  . GLN C 1 63  ? -24.204 -26.994 101.325 1.00 83.97  ? 64   GLN C CA  1 
ATOM   6419  C C   . GLN C 1 63  ? -24.379 -28.195 100.397 1.00 84.03  ? 64   GLN C C   1 
ATOM   6420  O O   . GLN C 1 63  ? -25.025 -28.107 99.353  1.00 82.14  ? 64   GLN C O   1 
ATOM   6421  C CB  . GLN C 1 63  ? -25.534 -26.618 101.981 1.00 81.47  ? 64   GLN C CB  1 
ATOM   6422  C CG  . GLN C 1 63  ? -25.713 -25.117 102.159 1.00 89.20  ? 64   GLN C CG  1 
ATOM   6423  C CD  . GLN C 1 63  ? -26.297 -24.747 103.508 1.00 96.71  ? 64   GLN C CD  1 
ATOM   6424  O OE1 . GLN C 1 63  ? -26.166 -25.491 104.481 1.00 90.13  ? 64   GLN C OE1 1 
ATOM   6425  N NE2 . GLN C 1 63  ? -26.945 -23.590 103.572 1.00 106.57 ? 64   GLN C NE2 1 
ATOM   6426  N N   . GLY C 1 64  ? -23.787 -29.313 100.799 1.00 82.07  ? 65   GLY C N   1 
ATOM   6427  C CA  . GLY C 1 64  ? -23.874 -30.566 100.071 1.00 90.39  ? 65   GLY C CA  1 
ATOM   6428  C C   . GLY C 1 64  ? -23.367 -31.648 101.000 1.00 95.90  ? 65   GLY C C   1 
ATOM   6429  O O   . GLY C 1 64  ? -23.185 -31.395 102.187 1.00 105.48 ? 65   GLY C O   1 
ATOM   6430  N N   . TYR C 1 65  ? -23.122 -32.847 100.484 1.00 84.58  ? 66   TYR C N   1 
ATOM   6431  C CA  . TYR C 1 65  ? -22.594 -33.901 101.341 1.00 81.94  ? 66   TYR C CA  1 
ATOM   6432  C C   . TYR C 1 65  ? -21.102 -33.684 101.576 1.00 83.11  ? 66   TYR C C   1 
ATOM   6433  O O   . TYR C 1 65  ? -20.309 -33.654 100.635 1.00 85.87  ? 66   TYR C O   1 
ATOM   6434  C CB  . TYR C 1 65  ? -22.891 -35.287 100.765 1.00 79.76  ? 66   TYR C CB  1 
ATOM   6435  C CG  . TYR C 1 65  ? -24.323 -35.720 100.987 1.00 79.04  ? 66   TYR C CG  1 
ATOM   6436  C CD1 . TYR C 1 65  ? -24.731 -36.227 102.215 1.00 82.93  ? 66   TYR C CD1 1 
ATOM   6437  C CD2 . TYR C 1 65  ? -25.270 -35.610 99.978  1.00 76.49  ? 66   TYR C CD2 1 
ATOM   6438  C CE1 . TYR C 1 65  ? -26.039 -36.619 102.430 1.00 77.39  ? 66   TYR C CE1 1 
ATOM   6439  C CE2 . TYR C 1 65  ? -26.584 -35.999 100.183 1.00 74.10  ? 66   TYR C CE2 1 
ATOM   6440  C CZ  . TYR C 1 65  ? -26.961 -36.503 101.411 1.00 74.37  ? 66   TYR C CZ  1 
ATOM   6441  O OH  . TYR C 1 65  ? -28.263 -36.892 101.625 1.00 73.94  ? 66   TYR C OH  1 
ATOM   6442  N N   . THR C 1 66  ? -20.734 -33.528 102.844 1.00 80.06  ? 67   THR C N   1 
ATOM   6443  C CA  . THR C 1 66  ? -19.396 -33.078 103.207 1.00 77.59  ? 67   THR C CA  1 
ATOM   6444  C C   . THR C 1 66  ? -18.694 -34.005 104.192 1.00 80.42  ? 67   THR C C   1 
ATOM   6445  O O   . THR C 1 66  ? -19.336 -34.759 104.922 1.00 76.96  ? 67   THR C O   1 
ATOM   6446  C CB  . THR C 1 66  ? -19.443 -31.669 103.831 1.00 82.32  ? 67   THR C CB  1 
ATOM   6447  O OG1 . THR C 1 66  ? -18.122 -31.270 104.218 1.00 80.52  ? 67   THR C OG1 1 
ATOM   6448  C CG2 . THR C 1 66  ? -20.345 -31.660 105.056 1.00 84.73  ? 67   THR C CG2 1 
ATOM   6449  N N   . CYS C 1 67  ? -17.367 -33.942 104.201 1.00 85.62  ? 68   CYS C N   1 
ATOM   6450  C CA  . CYS C 1 67  ? -16.571 -34.649 105.196 1.00 86.03  ? 68   CYS C CA  1 
ATOM   6451  C C   . CYS C 1 67  ? -16.205 -33.721 106.352 1.00 80.91  ? 68   CYS C C   1 
ATOM   6452  O O   . CYS C 1 67  ? -15.520 -34.127 107.290 1.00 85.01  ? 68   CYS C O   1 
ATOM   6453  C CB  . CYS C 1 67  ? -15.307 -35.239 104.564 1.00 77.95  ? 68   CYS C CB  1 
ATOM   6454  S SG  . CYS C 1 67  ? -15.579 -36.780 103.655 1.00 156.97 ? 68   CYS C SG  1 
ATOM   6455  N N   . CYS C 1 68  ? -16.676 -32.479 106.282 1.00 69.72  ? 69   CYS C N   1 
ATOM   6456  C CA  . CYS C 1 68  ? -16.341 -31.470 107.282 1.00 81.09  ? 69   CYS C CA  1 
ATOM   6457  C C   . CYS C 1 68  ? -17.485 -31.205 108.255 1.00 78.82  ? 69   CYS C C   1 
ATOM   6458  O O   . CYS C 1 68  ? -18.644 -31.105 107.855 1.00 71.99  ? 69   CYS C O   1 
ATOM   6459  C CB  . CYS C 1 68  ? -15.949 -30.152 106.604 1.00 79.96  ? 69   CYS C CB  1 
ATOM   6460  S SG  . CYS C 1 68  ? -14.632 -30.275 105.373 1.00 85.95  ? 69   CYS C SG  1 
ATOM   6461  N N   . THR C 1 69  ? -17.149 -31.088 109.536 1.00 82.19  ? 70   THR C N   1 
ATOM   6462  C CA  . THR C 1 69  ? -18.094 -30.603 110.534 1.00 90.70  ? 70   THR C CA  1 
ATOM   6463  C C   . THR C 1 69  ? -17.880 -29.104 110.702 1.00 99.22  ? 70   THR C C   1 
ATOM   6464  O O   . THR C 1 69  ? -17.044 -28.517 110.016 1.00 106.55 ? 70   THR C O   1 
ATOM   6465  C CB  . THR C 1 69  ? -17.911 -31.308 111.891 1.00 101.16 ? 70   THR C CB  1 
ATOM   6466  O OG1 . THR C 1 69  ? -18.884 -30.816 112.822 1.00 109.71 ? 70   THR C OG1 1 
ATOM   6467  C CG2 . THR C 1 69  ? -16.520 -31.055 112.443 1.00 100.39 ? 70   THR C CG2 1 
ATOM   6468  N N   . SER C 1 70  ? -18.629 -28.483 111.608 1.00 100.39 ? 71   SER C N   1 
ATOM   6469  C CA  . SER C 1 70  ? -18.495 -27.047 111.842 1.00 102.85 ? 71   SER C CA  1 
ATOM   6470  C C   . SER C 1 70  ? -17.137 -26.703 112.448 1.00 110.99 ? 71   SER C C   1 
ATOM   6471  O O   . SER C 1 70  ? -16.538 -25.680 112.108 1.00 114.85 ? 71   SER C O   1 
ATOM   6472  C CB  . SER C 1 70  ? -19.626 -26.528 112.732 1.00 99.54  ? 71   SER C CB  1 
ATOM   6473  O OG  . SER C 1 70  ? -20.859 -26.517 112.034 1.00 100.06 ? 71   SER C OG  1 
ATOM   6474  N N   . GLU C 1 71  ? -16.661 -27.567 113.343 1.00 116.79 ? 72   GLU C N   1 
ATOM   6475  C CA  . GLU C 1 71  ? -15.341 -27.414 113.946 1.00 122.15 ? 72   GLU C CA  1 
ATOM   6476  C C   . GLU C 1 71  ? -14.284 -27.364 112.851 1.00 114.05 ? 72   GLU C C   1 
ATOM   6477  O O   . GLU C 1 71  ? -13.463 -26.445 112.801 1.00 113.99 ? 72   GLU C O   1 
ATOM   6478  C CB  . GLU C 1 71  ? -15.045 -28.586 114.884 1.00 138.53 ? 72   GLU C CB  1 
ATOM   6479  C CG  . GLU C 1 71  ? -16.111 -28.846 115.939 1.00 154.23 ? 72   GLU C CG  1 
ATOM   6480  C CD  . GLU C 1 71  ? -15.748 -28.274 117.297 1.00 160.03 ? 72   GLU C CD  1 
ATOM   6481  O OE1 . GLU C 1 71  ? -15.083 -27.218 117.342 1.00 159.43 ? 72   GLU C OE1 1 
ATOM   6482  O OE2 . GLU C 1 71  ? -16.121 -28.888 118.319 1.00 161.43 ? 72   GLU C OE2 1 
ATOM   6483  N N   . MET C 1 72  ? -14.323 -28.359 111.970 1.00 112.46 ? 73   MET C N   1 
ATOM   6484  C CA  . MET C 1 72  ? -13.389 -28.454 110.856 1.00 116.41 ? 73   MET C CA  1 
ATOM   6485  C C   . MET C 1 72  ? -13.490 -27.248 109.929 1.00 109.10 ? 73   MET C C   1 
ATOM   6486  O O   . MET C 1 72  ? -12.475 -26.702 109.501 1.00 111.21 ? 73   MET C O   1 
ATOM   6487  C CB  . MET C 1 72  ? -13.634 -29.738 110.060 1.00 124.14 ? 73   MET C CB  1 
ATOM   6488  C CG  . MET C 1 72  ? -13.276 -31.016 110.800 1.00 129.58 ? 73   MET C CG  1 
ATOM   6489  S SD  . MET C 1 72  ? -13.706 -32.493 109.859 1.00 114.41 ? 73   MET C SD  1 
ATOM   6490  C CE  . MET C 1 72  ? -12.772 -32.222 108.355 1.00 58.81  ? 73   MET C CE  1 
ATOM   6491  N N   . GLU C 1 73  ? -14.718 -26.836 109.626 1.00 95.52  ? 74   GLU C N   1 
ATOM   6492  C CA  . GLU C 1 73  ? -14.941 -25.731 108.700 1.00 82.97  ? 74   GLU C CA  1 
ATOM   6493  C C   . GLU C 1 73  ? -14.371 -24.421 109.235 1.00 92.67  ? 74   GLU C C   1 
ATOM   6494  O O   . GLU C 1 73  ? -13.646 -23.719 108.529 1.00 104.31 ? 74   GLU C O   1 
ATOM   6495  C CB  . GLU C 1 73  ? -16.431 -25.566 108.396 1.00 73.44  ? 74   GLU C CB  1 
ATOM   6496  C CG  . GLU C 1 73  ? -16.715 -24.628 107.233 1.00 71.61  ? 74   GLU C CG  1 
ATOM   6497  C CD  . GLU C 1 73  ? -18.188 -24.308 107.081 1.00 74.43  ? 74   GLU C CD  1 
ATOM   6498  O OE1 . GLU C 1 73  ? -18.890 -24.230 108.111 1.00 80.81  ? 74   GLU C OE1 1 
ATOM   6499  O OE2 . GLU C 1 73  ? -18.645 -24.134 105.932 1.00 69.31  ? 74   GLU C OE2 1 
ATOM   6500  N N   . GLU C 1 74  ? -14.696 -24.095 110.482 1.00 90.64  ? 75   GLU C N   1 
ATOM   6501  C CA  . GLU C 1 74  ? -14.215 -22.852 111.075 1.00 90.97  ? 75   GLU C CA  1 
ATOM   6502  C C   . GLU C 1 74  ? -12.707 -22.884 111.316 1.00 95.63  ? 75   GLU C C   1 
ATOM   6503  O O   . GLU C 1 74  ? -12.021 -21.871 111.144 1.00 94.78  ? 75   GLU C O   1 
ATOM   6504  C CB  . GLU C 1 74  ? -14.977 -22.523 112.361 1.00 98.72  ? 75   GLU C CB  1 
ATOM   6505  C CG  . GLU C 1 74  ? -16.464 -22.284 112.136 1.00 111.76 ? 75   GLU C CG  1 
ATOM   6506  C CD  . GLU C 1 74  ? -17.140 -21.619 113.318 1.00 121.93 ? 75   GLU C CD  1 
ATOM   6507  O OE1 . GLU C 1 74  ? -16.433 -20.990 114.133 1.00 128.72 ? 75   GLU C OE1 1 
ATOM   6508  O OE2 . GLU C 1 74  ? -18.380 -21.726 113.430 1.00 117.81 ? 75   GLU C OE2 1 
ATOM   6509  N N   . ASN C 1 75  ? -12.193 -24.048 111.706 1.00 93.23  ? 76   ASN C N   1 
ATOM   6510  C CA  . ASN C 1 75  ? -10.751 -24.221 111.855 1.00 89.88  ? 76   ASN C CA  1 
ATOM   6511  C C   . ASN C 1 75  ? -10.013 -23.985 110.541 1.00 97.63  ? 76   ASN C C   1 
ATOM   6512  O O   . ASN C 1 75  ? -8.984  -23.309 110.510 1.00 109.80 ? 76   ASN C O   1 
ATOM   6513  C CB  . ASN C 1 75  ? -10.416 -25.608 112.410 1.00 90.74  ? 76   ASN C CB  1 
ATOM   6514  C CG  . ASN C 1 75  ? -10.288 -25.616 113.920 1.00 95.54  ? 76   ASN C CG  1 
ATOM   6515  O OD1 . ASN C 1 75  ? -11.087 -26.237 114.621 1.00 98.67  ? 76   ASN C OD1 1 
ATOM   6516  N ND2 . ASN C 1 75  ? -9.273  -24.927 114.431 1.00 93.04  ? 76   ASN C ND2 1 
ATOM   6517  N N   . LEU C 1 76  ? -10.549 -24.538 109.458 1.00 88.87  ? 77   LEU C N   1 
ATOM   6518  C CA  . LEU C 1 76  ? -9.959  -24.361 108.135 1.00 85.82  ? 77   LEU C CA  1 
ATOM   6519  C C   . LEU C 1 76  ? -10.101 -22.921 107.647 1.00 86.74  ? 77   LEU C C   1 
ATOM   6520  O O   . LEU C 1 76  ? -9.256  -22.425 106.901 1.00 94.98  ? 77   LEU C O   1 
ATOM   6521  C CB  . LEU C 1 76  ? -10.586 -25.330 107.130 1.00 79.44  ? 77   LEU C CB  1 
ATOM   6522  C CG  . LEU C 1 76  ? -10.166 -26.794 107.275 1.00 78.20  ? 77   LEU C CG  1 
ATOM   6523  C CD1 . LEU C 1 76  ? -11.039 -27.694 106.413 1.00 72.21  ? 77   LEU C CD1 1 
ATOM   6524  C CD2 . LEU C 1 76  ? -8.699  -26.960 106.913 1.00 45.31  ? 77   LEU C CD2 1 
ATOM   6525  N N   . ALA C 1 77  ? -11.172 -22.255 108.070 1.00 73.18  ? 78   ALA C N   1 
ATOM   6526  C CA  . ALA C 1 77  ? -11.371 -20.847 107.746 1.00 74.88  ? 78   ALA C CA  1 
ATOM   6527  C C   . ALA C 1 77  ? -10.279 -20.004 108.396 1.00 78.00  ? 78   ALA C C   1 
ATOM   6528  O O   . ALA C 1 77  ? -9.602  -19.213 107.727 1.00 71.35  ? 78   ALA C O   1 
ATOM   6529  C CB  . ALA C 1 77  ? -12.744 -20.386 108.203 1.00 69.76  ? 78   ALA C CB  1 
ATOM   6530  N N   . ASN C 1 78  ? -10.116 -20.186 109.705 1.00 84.87  ? 79   ASN C N   1 
ATOM   6531  C CA  . ASN C 1 78  ? -9.047  -19.538 110.457 1.00 91.89  ? 79   ASN C CA  1 
ATOM   6532  C C   . ASN C 1 78  ? -7.684  -19.822 109.826 1.00 95.63  ? 79   ASN C C   1 
ATOM   6533  O O   . ASN C 1 78  ? -6.840  -18.928 109.702 1.00 98.61  ? 79   ASN C O   1 
ATOM   6534  C CB  . ASN C 1 78  ? -9.074  -20.011 111.915 1.00 94.61  ? 79   ASN C CB  1 
ATOM   6535  C CG  . ASN C 1 78  ? -8.051  -19.302 112.783 1.00 98.29  ? 79   ASN C CG  1 
ATOM   6536  O OD1 . ASN C 1 78  ? -8.288  -18.193 113.262 1.00 94.06  ? 79   ASN C OD1 1 
ATOM   6537  N ND2 . ASN C 1 78  ? -6.910  -19.947 113.000 1.00 100.88 ? 79   ASN C ND2 1 
ATOM   6538  N N   . ARG C 1 79  ? -7.497  -21.071 109.408 1.00 90.40  ? 80   ARG C N   1 
ATOM   6539  C CA  . ARG C 1 79  ? -6.265  -21.513 108.764 1.00 87.77  ? 80   ARG C CA  1 
ATOM   6540  C C   . ARG C 1 79  ? -5.971  -20.720 107.494 1.00 88.56  ? 80   ARG C C   1 
ATOM   6541  O O   . ARG C 1 79  ? -4.920  -20.088 107.377 1.00 93.89  ? 80   ARG C O   1 
ATOM   6542  C CB  . ARG C 1 79  ? -6.364  -23.000 108.424 1.00 88.22  ? 80   ARG C CB  1 
ATOM   6543  C CG  . ARG C 1 79  ? -5.126  -23.584 107.766 1.00 88.47  ? 80   ARG C CG  1 
ATOM   6544  C CD  . ARG C 1 79  ? -4.104  -24.022 108.800 1.00 96.87  ? 80   ARG C CD  1 
ATOM   6545  N NE  . ARG C 1 79  ? -3.060  -24.854 108.209 1.00 107.60 ? 80   ARG C NE  1 
ATOM   6546  C CZ  . ARG C 1 79  ? -2.158  -25.533 108.911 1.00 120.50 ? 80   ARG C CZ  1 
ATOM   6547  N NH1 . ARG C 1 79  ? -2.173  -25.482 110.236 1.00 126.32 ? 80   ARG C NH1 1 
ATOM   6548  N NH2 . ARG C 1 79  ? -1.245  -26.266 108.290 1.00 118.85 ? 80   ARG C NH2 1 
ATOM   6549  N N   . SER C 1 80  ? -6.910  -20.752 106.551 1.00 81.87  ? 81   SER C N   1 
ATOM   6550  C CA  . SER C 1 80  ? -6.744  -20.075 105.268 1.00 78.53  ? 81   SER C CA  1 
ATOM   6551  C C   . SER C 1 80  ? -6.528  -18.574 105.443 1.00 76.35  ? 81   SER C C   1 
ATOM   6552  O O   . SER C 1 80  ? -5.657  -17.980 104.795 1.00 73.84  ? 81   SER C O   1 
ATOM   6553  C CB  . SER C 1 80  ? -7.954  -20.332 104.366 1.00 74.05  ? 81   SER C CB  1 
ATOM   6554  O OG  . SER C 1 80  ? -9.144  -19.829 104.949 1.00 81.50  ? 81   SER C OG  1 
ATOM   6555  N N   . HIS C 1 81  ? -7.325  -17.970 106.323 1.00 72.08  ? 82   HIS C N   1 
ATOM   6556  C CA  . HIS C 1 81  ? -7.186  -16.552 106.640 1.00 69.48  ? 82   HIS C CA  1 
ATOM   6557  C C   . HIS C 1 81  ? -5.766  -16.241 107.110 1.00 68.41  ? 82   HIS C C   1 
ATOM   6558  O O   . HIS C 1 81  ? -5.096  -15.346 106.574 1.00 69.28  ? 82   HIS C O   1 
ATOM   6559  C CB  . HIS C 1 81  ? -8.196  -16.152 107.718 1.00 77.55  ? 82   HIS C CB  1 
ATOM   6560  C CG  . HIS C 1 81  ? -8.128  -14.707 108.107 1.00 85.14  ? 82   HIS C CG  1 
ATOM   6561  N ND1 . HIS C 1 81  ? -7.215  -14.223 109.018 1.00 91.23  ? 82   HIS C ND1 1 
ATOM   6562  C CD2 . HIS C 1 81  ? -8.866  -13.643 107.712 1.00 90.80  ? 82   HIS C CD2 1 
ATOM   6563  C CE1 . HIS C 1 81  ? -7.389  -12.922 109.165 1.00 93.15  ? 82   HIS C CE1 1 
ATOM   6564  N NE2 . HIS C 1 81  ? -8.385  -12.545 108.384 1.00 93.63  ? 82   HIS C NE2 1 
ATOM   6565  N N   . ALA C 1 82  ? -5.313  -17.000 108.105 1.00 70.07  ? 83   ALA C N   1 
ATOM   6566  C CA  . ALA C 1 82  ? -3.973  -16.832 108.659 1.00 68.77  ? 83   ALA C CA  1 
ATOM   6567  C C   . ALA C 1 82  ? -2.891  -16.977 107.591 1.00 70.89  ? 83   ALA C C   1 
ATOM   6568  O O   . ALA C 1 82  ? -1.918  -16.221 107.576 1.00 81.95  ? 83   ALA C O   1 
ATOM   6569  C CB  . ALA C 1 82  ? -3.741  -17.824 109.788 1.00 62.44  ? 83   ALA C CB  1 
ATOM   6570  N N   . GLU C 1 83  ? -3.070  -17.945 106.697 1.00 63.58  ? 84   GLU C N   1 
ATOM   6571  C CA  . GLU C 1 83  ? -2.109  -18.189 105.625 1.00 64.57  ? 84   GLU C CA  1 
ATOM   6572  C C   . GLU C 1 83  ? -2.017  -17.007 104.656 1.00 76.52  ? 84   GLU C C   1 
ATOM   6573  O O   . GLU C 1 83  ? -0.917  -16.544 104.327 1.00 91.43  ? 84   GLU C O   1 
ATOM   6574  C CB  . GLU C 1 83  ? -2.460  -19.477 104.874 1.00 57.51  ? 84   GLU C CB  1 
ATOM   6575  C CG  . GLU C 1 83  ? -2.300  -20.740 105.710 1.00 66.63  ? 84   GLU C CG  1 
ATOM   6576  C CD  . GLU C 1 83  ? -2.826  -21.979 105.010 1.00 78.35  ? 84   GLU C CD  1 
ATOM   6577  O OE1 . GLU C 1 83  ? -3.388  -21.847 103.903 1.00 83.51  ? 84   GLU C OE1 1 
ATOM   6578  O OE2 . GLU C 1 83  ? -2.677  -23.086 105.570 1.00 83.09  ? 84   GLU C OE2 1 
ATOM   6579  N N   . LEU C 1 84  ? -3.174  -16.522 104.209 1.00 65.27  ? 85   LEU C N   1 
ATOM   6580  C CA  . LEU C 1 84  ? -3.218  -15.359 103.326 1.00 55.66  ? 85   LEU C CA  1 
ATOM   6581  C C   . LEU C 1 84  ? -2.526  -14.164 103.978 1.00 64.49  ? 85   LEU C C   1 
ATOM   6582  O O   . LEU C 1 84  ? -1.680  -13.500 103.358 1.00 72.74  ? 85   LEU C O   1 
ATOM   6583  C CB  . LEU C 1 84  ? -4.664  -15.002 102.971 1.00 48.30  ? 85   LEU C CB  1 
ATOM   6584  C CG  . LEU C 1 84  ? -4.853  -13.795 102.048 1.00 47.80  ? 85   LEU C CG  1 
ATOM   6585  C CD1 . LEU C 1 84  ? -4.180  -14.029 100.704 1.00 53.00  ? 85   LEU C CD1 1 
ATOM   6586  C CD2 . LEU C 1 84  ? -6.326  -13.480 101.859 1.00 30.99  ? 85   LEU C CD2 1 
ATOM   6587  N N   . GLU C 1 85  ? -2.882  -13.907 105.236 1.00 63.30  ? 86   GLU C N   1 
ATOM   6588  C CA  . GLU C 1 85  ? -2.254  -12.833 106.001 1.00 67.27  ? 86   GLU C CA  1 
ATOM   6589  C C   . GLU C 1 85  ? -0.736  -12.976 106.024 1.00 71.44  ? 86   GLU C C   1 
ATOM   6590  O O   . GLU C 1 85  ? -0.007  -12.004 105.806 1.00 75.43  ? 86   GLU C O   1 
ATOM   6591  C CB  . GLU C 1 85  ? -2.789  -12.803 107.434 1.00 64.60  ? 86   GLU C CB  1 
ATOM   6592  C CG  . GLU C 1 85  ? -3.955  -11.858 107.644 1.00 70.37  ? 86   GLU C CG  1 
ATOM   6593  C CD  . GLU C 1 85  ? -4.317  -11.705 109.108 1.00 81.98  ? 86   GLU C CD  1 
ATOM   6594  O OE1 . GLU C 1 85  ? -3.829  -12.509 109.930 1.00 78.54  ? 86   GLU C OE1 1 
ATOM   6595  O OE2 . GLU C 1 85  ? -5.085  -10.777 109.436 1.00 90.59  ? 86   GLU C OE2 1 
ATOM   6596  N N   . THR C 1 86  ? -0.272  -14.197 106.278 1.00 58.73  ? 87   THR C N   1 
ATOM   6597  C CA  . THR C 1 86  ? 1.156   -14.488 106.340 1.00 57.05  ? 87   THR C CA  1 
ATOM   6598  C C   . THR C 1 86  ? 1.866   -14.174 105.027 1.00 61.07  ? 87   THR C C   1 
ATOM   6599  O O   . THR C 1 86  ? 2.913   -13.520 105.020 1.00 63.97  ? 87   THR C O   1 
ATOM   6600  C CB  . THR C 1 86  ? 1.412   -15.955 106.719 1.00 59.91  ? 87   THR C CB  1 
ATOM   6601  O OG1 . THR C 1 86  ? 0.933   -16.194 108.048 1.00 74.20  ? 87   THR C OG1 1 
ATOM   6602  C CG2 . THR C 1 86  ? 2.898   -16.272 106.658 1.00 57.22  ? 87   THR C CG2 1 
ATOM   6603  N N   . ALA C 1 87  ? 1.294   -14.636 103.918 1.00 56.16  ? 88   ALA C N   1 
ATOM   6604  C CA  . ALA C 1 87  ? 1.877   -14.368 102.604 1.00 49.43  ? 88   ALA C CA  1 
ATOM   6605  C C   . ALA C 1 87  ? 1.961   -12.868 102.324 1.00 57.60  ? 88   ALA C C   1 
ATOM   6606  O O   . ALA C 1 87  ? 3.010   -12.358 101.892 1.00 67.27  ? 88   ALA C O   1 
ATOM   6607  C CB  . ALA C 1 87  ? 1.080   -15.066 101.517 1.00 43.48  ? 88   ALA C CB  1 
ATOM   6608  N N   . LEU C 1 88  ? 0.855   -12.169 102.580 1.00 57.81  ? 89   LEU C N   1 
ATOM   6609  C CA  . LEU C 1 88  ? 0.808   -10.719 102.394 1.00 47.14  ? 89   LEU C CA  1 
ATOM   6610  C C   . LEU C 1 88  ? 1.907   -10.022 103.191 1.00 57.30  ? 89   LEU C C   1 
ATOM   6611  O O   . LEU C 1 88  ? 2.649   -9.191  102.655 1.00 73.30  ? 89   LEU C O   1 
ATOM   6612  C CB  . LEU C 1 88  ? -0.561  -10.163 102.791 1.00 52.73  ? 89   LEU C CB  1 
ATOM   6613  C CG  . LEU C 1 88  ? -1.729  -10.406 101.834 1.00 57.52  ? 89   LEU C CG  1 
ATOM   6614  C CD1 . LEU C 1 88  ? -3.018  -9.858  102.425 1.00 59.48  ? 89   LEU C CD1 1 
ATOM   6615  C CD2 . LEU C 1 88  ? -1.454  -9.782  100.474 1.00 46.38  ? 89   LEU C CD2 1 
ATOM   6616  N N   . ARG C 1 89  ? 2.012   -10.373 104.470 1.00 57.09  ? 90   ARG C N   1 
ATOM   6617  C CA  . ARG C 1 89  ? 3.043   -9.804  105.331 1.00 66.20  ? 90   ARG C CA  1 
ATOM   6618  C C   . ARG C 1 89  ? 4.452   -10.111 104.827 1.00 71.77  ? 90   ARG C C   1 
ATOM   6619  O O   . ARG C 1 89  ? 5.347   -9.279  104.949 1.00 79.65  ? 90   ARG C O   1 
ATOM   6620  C CB  . ARG C 1 89  ? 2.869   -10.269 106.779 1.00 72.89  ? 90   ARG C CB  1 
ATOM   6621  C CG  . ARG C 1 89  ? 1.912   -9.405  107.587 1.00 93.91  ? 90   ARG C CG  1 
ATOM   6622  C CD  . ARG C 1 89  ? 1.625   -10.012 108.951 1.00 111.23 ? 90   ARG C CD  1 
ATOM   6623  N NE  . ARG C 1 89  ? 2.846   -10.288 109.704 1.00 120.66 ? 90   ARG C NE  1 
ATOM   6624  C CZ  . ARG C 1 89  ? 2.865   -10.789 110.935 1.00 123.94 ? 90   ARG C CZ  1 
ATOM   6625  N NH1 . ARG C 1 89  ? 1.726   -11.069 111.555 1.00 131.46 ? 90   ARG C NH1 1 
ATOM   6626  N NH2 . ARG C 1 89  ? 4.020   -11.011 111.548 1.00 113.62 ? 90   ARG C NH2 1 
ATOM   6627  N N   . ASP C 1 90  ? 4.642   -11.298 104.256 1.00 62.54  ? 91   ASP C N   1 
ATOM   6628  C CA  . ASP C 1 90  ? 5.935   -11.664 103.682 1.00 61.74  ? 91   ASP C CA  1 
ATOM   6629  C C   . ASP C 1 90  ? 6.319   -10.741 102.525 1.00 71.73  ? 91   ASP C C   1 
ATOM   6630  O O   . ASP C 1 90  ? 7.399   -10.131 102.534 1.00 88.10  ? 91   ASP C O   1 
ATOM   6631  C CB  . ASP C 1 90  ? 5.933   -13.120 103.211 1.00 67.02  ? 91   ASP C CB  1 
ATOM   6632  C CG  . ASP C 1 90  ? 5.842   -14.105 104.359 1.00 77.67  ? 91   ASP C CG  1 
ATOM   6633  O OD1 . ASP C 1 90  ? 6.347   -13.794 105.459 1.00 72.13  ? 91   ASP C OD1 1 
ATOM   6634  O OD2 . ASP C 1 90  ? 5.264   -15.194 104.160 1.00 89.51  ? 91   ASP C OD2 1 
ATOM   6635  N N   . SER C 1 91  ? 5.432   -10.638 101.537 1.00 68.91  ? 92   SER C N   1 
ATOM   6636  C CA  . SER C 1 91  ? 5.695   -9.781  100.378 1.00 75.33  ? 92   SER C CA  1 
ATOM   6637  C C   . SER C 1 91  ? 5.929   -8.327  100.798 1.00 68.38  ? 92   SER C C   1 
ATOM   6638  O O   . SER C 1 91  ? 6.867   -7.662  100.322 1.00 71.14  ? 92   SER C O   1 
ATOM   6639  C CB  . SER C 1 91  ? 4.546   -9.866  99.370  1.00 78.29  ? 92   SER C CB  1 
ATOM   6640  O OG  . SER C 1 91  ? 3.315   -9.494  99.964  1.00 84.63  ? 92   SER C OG  1 
ATOM   6641  N N   . SER C 1 92  ? 5.081   -7.846  101.703 1.00 57.16  ? 93   SER C N   1 
ATOM   6642  C CA  . SER C 1 92  ? 5.203   -6.488  102.219 1.00 57.23  ? 93   SER C CA  1 
ATOM   6643  C C   . SER C 1 92  ? 6.552   -6.275  102.903 1.00 45.00  ? 93   SER C C   1 
ATOM   6644  O O   . SER C 1 92  ? 7.184   -5.231  102.732 1.00 53.99  ? 93   SER C O   1 
ATOM   6645  C CB  . SER C 1 92  ? 4.062   -6.179  103.189 1.00 55.30  ? 93   SER C CB  1 
ATOM   6646  O OG  . SER C 1 92  ? 4.024   -4.800  103.510 1.00 53.33  ? 93   SER C OG  1 
ATOM   6647  N N   . ARG C 1 93  ? 6.989   -7.270  103.671 1.00 51.85  ? 94   ARG C N   1 
ATOM   6648  C CA  . ARG C 1 93  ? 8.304   -7.225  104.306 1.00 59.98  ? 94   ARG C CA  1 
ATOM   6649  C C   . ARG C 1 93  ? 9.415   -7.104  103.271 1.00 56.14  ? 94   ARG C C   1 
ATOM   6650  O O   . ARG C 1 93  ? 10.340  -6.310  103.439 1.00 60.55  ? 94   ARG C O   1 
ATOM   6651  C CB  . ARG C 1 93  ? 8.549   -8.460  105.176 1.00 61.51  ? 94   ARG C CB  1 
ATOM   6652  C CG  . ARG C 1 93  ? 7.944   -8.394  106.568 1.00 67.36  ? 94   ARG C CG  1 
ATOM   6653  C CD  . ARG C 1 93  ? 8.723   -9.281  107.526 1.00 80.93  ? 94   ARG C CD  1 
ATOM   6654  N NE  . ARG C 1 93  ? 9.161   -10.517 106.882 1.00 95.18  ? 94   ARG C NE  1 
ATOM   6655  C CZ  . ARG C 1 93  ? 8.527   -11.680 106.981 1.00 96.39  ? 94   ARG C CZ  1 
ATOM   6656  N NH1 . ARG C 1 93  ? 7.423   -11.777 107.709 1.00 90.31  ? 94   ARG C NH1 1 
ATOM   6657  N NH2 . ARG C 1 93  ? 9.001   -12.749 106.356 1.00 98.40  ? 94   ARG C NH2 1 
ATOM   6658  N N   . VAL C 1 94  ? 9.324   -7.899  102.206 1.00 41.87  ? 95   VAL C N   1 
ATOM   6659  C CA  . VAL C 1 94  ? 10.315  -7.835  101.132 1.00 34.46  ? 95   VAL C CA  1 
ATOM   6660  C C   . VAL C 1 94  ? 10.413  -6.431  100.534 1.00 41.26  ? 95   VAL C C   1 
ATOM   6661  O O   . VAL C 1 94  ? 11.503  -5.837  100.470 1.00 64.49  ? 95   VAL C O   1 
ATOM   6662  C CB  . VAL C 1 94  ? 10.006  -8.851  100.011 1.00 36.03  ? 95   VAL C CB  1 
ATOM   6663  C CG1 . VAL C 1 94  ? 10.875  -8.581  98.791  1.00 30.66  ? 95   VAL C CG1 1 
ATOM   6664  C CG2 . VAL C 1 94  ? 10.208  -10.273 100.513 1.00 24.44  ? 95   VAL C CG2 1 
ATOM   6665  N N   . LEU C 1 95  ? 9.267   -5.901  100.114 1.00 42.98  ? 96   LEU C N   1 
ATOM   6666  C CA  . LEU C 1 95  ? 9.208   -4.559  99.533  1.00 51.27  ? 96   LEU C CA  1 
ATOM   6667  C C   . LEU C 1 95  ? 9.783   -3.497  100.476 1.00 48.15  ? 96   LEU C C   1 
ATOM   6668  O O   . LEU C 1 95  ? 10.590  -2.643  100.072 1.00 46.59  ? 96   LEU C O   1 
ATOM   6669  C CB  . LEU C 1 95  ? 7.763   -4.206  99.179  1.00 40.36  ? 96   LEU C CB  1 
ATOM   6670  C CG  . LEU C 1 95  ? 7.533   -2.856  98.499  1.00 42.37  ? 96   LEU C CG  1 
ATOM   6671  C CD1 . LEU C 1 95  ? 8.216   -2.822  97.143  1.00 41.91  ? 96   LEU C CD1 1 
ATOM   6672  C CD2 . LEU C 1 95  ? 6.048   -2.571  98.364  1.00 21.05  ? 96   LEU C CD2 1 
ATOM   6673  N N   . GLN C 1 96  ? 9.364   -3.569  101.736 1.00 52.17  ? 97   GLN C N   1 
ATOM   6674  C CA  . GLN C 1 96  ? 9.777   -2.610  102.754 1.00 64.11  ? 97   GLN C CA  1 
ATOM   6675  C C   . GLN C 1 96  ? 11.284  -2.654  102.985 1.00 71.05  ? 97   GLN C C   1 
ATOM   6676  O O   . GLN C 1 96  ? 11.933  -1.615  103.125 1.00 69.49  ? 97   GLN C O   1 
ATOM   6677  C CB  . GLN C 1 96  ? 9.030   -2.882  104.060 1.00 63.52  ? 97   GLN C CB  1 
ATOM   6678  C CG  . GLN C 1 96  ? 9.270   -1.854  105.148 1.00 74.08  ? 97   GLN C CG  1 
ATOM   6679  C CD  . GLN C 1 96  ? 8.412   -2.102  106.371 1.00 87.26  ? 97   GLN C CD  1 
ATOM   6680  O OE1 . GLN C 1 96  ? 8.506   -1.383  107.365 1.00 99.60  ? 97   GLN C OE1 1 
ATOM   6681  N NE2 . GLN C 1 96  ? 7.566   -3.125  106.304 1.00 77.99  ? 97   GLN C NE2 1 
ATOM   6682  N N   . ALA C 1 97  ? 11.835  -3.864  103.022 1.00 64.57  ? 98   ALA C N   1 
ATOM   6683  C CA  . ALA C 1 97  ? 13.269  -4.047  103.203 1.00 49.17  ? 98   ALA C CA  1 
ATOM   6684  C C   . ALA C 1 97  ? 14.040  -3.467  102.025 1.00 53.66  ? 98   ALA C C   1 
ATOM   6685  O O   . ALA C 1 97  ? 15.079  -2.826  102.212 1.00 64.64  ? 98   ALA C O   1 
ATOM   6686  C CB  . ALA C 1 97  ? 13.602  -5.518  103.384 1.00 38.15  ? 98   ALA C CB  1 
ATOM   6687  N N   . MET C 1 98  ? 13.533  -3.689  100.813 1.00 38.30  ? 99   MET C N   1 
ATOM   6688  C CA  . MET C 1 98  ? 14.170  -3.119  99.626  1.00 31.37  ? 99   MET C CA  1 
ATOM   6689  C C   . MET C 1 98  ? 14.226  -1.594  99.725  1.00 42.40  ? 99   MET C C   1 
ATOM   6690  O O   . MET C 1 98  ? 15.300  -0.978  99.585  1.00 53.89  ? 99   MET C O   1 
ATOM   6691  C CB  . MET C 1 98  ? 13.439  -3.549  98.351  1.00 18.12  ? 99   MET C CB  1 
ATOM   6692  C CG  . MET C 1 98  ? 14.074  -3.045  97.059  1.00 27.00  ? 99   MET C CG  1 
ATOM   6693  S SD  . MET C 1 98  ? 13.533  -1.395  96.548  1.00 54.98  ? 99   MET C SD  1 
ATOM   6694  C CE  . MET C 1 98  ? 11.859  -1.731  96.011  1.00 61.60  ? 99   MET C CE  1 
ATOM   6695  N N   . LEU C 1 99  ? 13.064  -0.993  99.976  1.00 44.33  ? 100  LEU C N   1 
ATOM   6696  C CA  . LEU C 1 99  ? 12.972  0.458   100.117 1.00 46.19  ? 100  LEU C CA  1 
ATOM   6697  C C   . LEU C 1 99  ? 13.918  0.995   101.192 1.00 43.54  ? 100  LEU C C   1 
ATOM   6698  O O   . LEU C 1 99  ? 14.626  1.977   100.966 1.00 47.57  ? 100  LEU C O   1 
ATOM   6699  C CB  . LEU C 1 99  ? 11.532  0.877   100.416 1.00 38.62  ? 100  LEU C CB  1 
ATOM   6700  C CG  . LEU C 1 99  ? 10.528  0.648   99.284  1.00 35.69  ? 100  LEU C CG  1 
ATOM   6701  C CD1 . LEU C 1 99  ? 9.108   0.897   99.765  1.00 53.16  ? 100  LEU C CD1 1 
ATOM   6702  C CD2 . LEU C 1 99  ? 10.853  1.533   98.087  1.00 20.13  ? 100  LEU C CD2 1 
ATOM   6703  N N   . ALA C 1 100 ? 13.941  0.337   102.348 1.00 42.25  ? 101  ALA C N   1 
ATOM   6704  C CA  . ALA C 1 100 ? 14.827  0.739   103.439 1.00 52.29  ? 101  ALA C CA  1 
ATOM   6705  C C   . ALA C 1 100 ? 16.301  0.675   103.036 1.00 62.40  ? 101  ALA C C   1 
ATOM   6706  O O   . ALA C 1 100 ? 17.084  1.564   103.383 1.00 70.84  ? 101  ALA C O   1 
ATOM   6707  C CB  . ALA C 1 100 ? 14.574  -0.113  104.677 1.00 39.46  ? 101  ALA C CB  1 
ATOM   6708  N N   . THR C 1 101 ? 16.674  -0.373  102.304 1.00 52.29  ? 102  THR C N   1 
ATOM   6709  C CA  . THR C 1 101 ? 18.046  -0.509  101.819 1.00 49.52  ? 102  THR C CA  1 
ATOM   6710  C C   . THR C 1 101 ? 18.428  0.643   100.892 1.00 44.55  ? 102  THR C C   1 
ATOM   6711  O O   . THR C 1 101 ? 19.496  1.246   101.047 1.00 47.31  ? 102  THR C O   1 
ATOM   6712  C CB  . THR C 1 101 ? 18.273  -1.858  101.107 1.00 46.42  ? 102  THR C CB  1 
ATOM   6713  O OG1 . THR C 1 101 ? 18.302  -2.910  102.079 1.00 56.16  ? 102  THR C OG1 1 
ATOM   6714  C CG2 . THR C 1 101 ? 19.591  -1.852  100.348 1.00 20.02  ? 102  THR C CG2 1 
ATOM   6715  N N   . GLN C 1 102 ? 17.554  0.953   99.936  1.00 35.72  ? 103  GLN C N   1 
ATOM   6716  C CA  . GLN C 1 102 ? 17.790  2.095   99.051  1.00 39.85  ? 103  GLN C CA  1 
ATOM   6717  C C   . GLN C 1 102 ? 17.945  3.389   99.852  1.00 47.78  ? 103  GLN C C   1 
ATOM   6718  O O   . GLN C 1 102 ? 18.832  4.210   99.580  1.00 49.65  ? 103  GLN C O   1 
ATOM   6719  C CB  . GLN C 1 102 ? 16.649  2.236   98.044  1.00 38.56  ? 103  GLN C CB  1 
ATOM   6720  C CG  . GLN C 1 102 ? 16.482  1.033   97.138  1.00 48.63  ? 103  GLN C CG  1 
ATOM   6721  C CD  . GLN C 1 102 ? 17.699  0.791   96.271  1.00 50.75  ? 103  GLN C CD  1 
ATOM   6722  O OE1 . GLN C 1 102 ? 18.243  1.719   95.673  1.00 47.97  ? 103  GLN C OE1 1 
ATOM   6723  N NE2 . GLN C 1 102 ? 18.137  -0.460  96.202  1.00 55.83  ? 103  GLN C NE2 1 
ATOM   6724  N N   . LEU C 1 103 ? 17.076  3.549   100.846 1.00 44.97  ? 104  LEU C N   1 
ATOM   6725  C CA  . LEU C 1 103 ? 17.101  4.705   101.734 1.00 50.84  ? 104  LEU C CA  1 
ATOM   6726  C C   . LEU C 1 103 ? 18.467  4.870   102.397 1.00 50.07  ? 104  LEU C C   1 
ATOM   6727  O O   . LEU C 1 103 ? 19.160  5.867   102.166 1.00 58.24  ? 104  LEU C O   1 
ATOM   6728  C CB  . LEU C 1 103 ? 16.005  4.582   102.795 1.00 52.09  ? 104  LEU C CB  1 
ATOM   6729  C CG  . LEU C 1 103 ? 15.837  5.762   103.754 1.00 59.61  ? 104  LEU C CG  1 
ATOM   6730  C CD1 . LEU C 1 103 ? 15.512  7.029   102.987 1.00 46.89  ? 104  LEU C CD1 1 
ATOM   6731  C CD2 . LEU C 1 103 ? 14.759  5.466   104.785 1.00 64.37  ? 104  LEU C CD2 1 
ATOM   6732  N N   . ARG C 1 104 ? 18.842  3.890   103.218 1.00 52.13  ? 105  ARG C N   1 
ATOM   6733  C CA  . ARG C 1 104 ? 20.135  3.900   103.900 1.00 54.54  ? 105  ARG C CA  1 
ATOM   6734  C C   . ARG C 1 104 ? 21.289  4.154   102.936 1.00 58.97  ? 105  ARG C C   1 
ATOM   6735  O O   . ARG C 1 104 ? 22.168  4.977   103.214 1.00 74.06  ? 105  ARG C O   1 
ATOM   6736  C CB  . ARG C 1 104 ? 20.360  2.587   104.657 1.00 60.25  ? 105  ARG C CB  1 
ATOM   6737  C CG  . ARG C 1 104 ? 19.694  2.535   106.025 1.00 88.73  ? 105  ARG C CG  1 
ATOM   6738  C CD  . ARG C 1 104 ? 19.803  1.154   106.661 1.00 114.61 ? 105  ARG C CD  1 
ATOM   6739  N NE  . ARG C 1 104 ? 18.807  0.222   106.136 1.00 125.77 ? 105  ARG C NE  1 
ATOM   6740  C CZ  . ARG C 1 104 ? 19.091  -0.961  105.600 1.00 124.64 ? 105  ARG C CZ  1 
ATOM   6741  N NH1 . ARG C 1 104 ? 20.350  -1.371  105.517 1.00 125.99 ? 105  ARG C NH1 1 
ATOM   6742  N NH2 . ARG C 1 104 ? 18.115  -1.738  105.150 1.00 120.48 ? 105  ARG C NH2 1 
ATOM   6743  N N   . SER C 1 105 ? 21.269  3.463   101.798 1.00 46.10  ? 106  SER C N   1 
ATOM   6744  C CA  . SER C 1 105 ? 22.314  3.618   100.789 1.00 49.79  ? 106  SER C CA  1 
ATOM   6745  C C   . SER C 1 105 ? 22.472  5.065   100.325 1.00 56.99  ? 106  SER C C   1 
ATOM   6746  O O   . SER C 1 105 ? 23.557  5.643   100.430 1.00 63.05  ? 106  SER C O   1 
ATOM   6747  C CB  . SER C 1 105 ? 22.044  2.711   99.588  1.00 44.03  ? 106  SER C CB  1 
ATOM   6748  O OG  . SER C 1 105 ? 22.132  1.347   99.957  1.00 60.66  ? 106  SER C OG  1 
ATOM   6749  N N   . PHE C 1 106 ? 21.389  5.654   99.826  1.00 56.27  ? 107  PHE C N   1 
ATOM   6750  C CA  . PHE C 1 106 ? 21.456  7.021   99.316  1.00 52.83  ? 107  PHE C CA  1 
ATOM   6751  C C   . PHE C 1 106 ? 21.792  8.052   100.395 1.00 57.99  ? 107  PHE C C   1 
ATOM   6752  O O   . PHE C 1 106 ? 22.648  8.918   100.187 1.00 64.68  ? 107  PHE C O   1 
ATOM   6753  C CB  . PHE C 1 106 ? 20.167  7.393   98.582  1.00 42.09  ? 107  PHE C CB  1 
ATOM   6754  C CG  . PHE C 1 106 ? 20.125  6.913   97.161  1.00 32.74  ? 107  PHE C CG  1 
ATOM   6755  C CD1 . PHE C 1 106 ? 19.789  5.604   96.870  1.00 24.68  ? 107  PHE C CD1 1 
ATOM   6756  C CD2 . PHE C 1 106 ? 20.429  7.771   96.117  1.00 24.91  ? 107  PHE C CD2 1 
ATOM   6757  C CE1 . PHE C 1 106 ? 19.753  5.160   95.566  1.00 40.88  ? 107  PHE C CE1 1 
ATOM   6758  C CE2 . PHE C 1 106 ? 20.394  7.332   94.810  1.00 23.72  ? 107  PHE C CE2 1 
ATOM   6759  C CZ  . PHE C 1 106 ? 20.056  6.025   94.534  1.00 37.60  ? 107  PHE C CZ  1 
ATOM   6760  N N   . ASP C 1 107 ? 21.128  7.949   101.544 1.00 57.70  ? 108  ASP C N   1 
ATOM   6761  C CA  . ASP C 1 107 ? 21.359  8.876   102.648 1.00 51.37  ? 108  ASP C CA  1 
ATOM   6762  C C   . ASP C 1 107 ? 22.831  8.869   103.058 1.00 58.29  ? 108  ASP C C   1 
ATOM   6763  O O   . ASP C 1 107 ? 23.497  9.920   103.100 1.00 68.74  ? 108  ASP C O   1 
ATOM   6764  C CB  . ASP C 1 107 ? 20.480  8.504   103.842 1.00 45.92  ? 108  ASP C CB  1 
ATOM   6765  C CG  . ASP C 1 107 ? 20.317  9.645   104.822 1.00 64.35  ? 108  ASP C CG  1 
ATOM   6766  O OD1 . ASP C 1 107 ? 20.373  10.813  104.385 1.00 71.18  ? 108  ASP C OD1 1 
ATOM   6767  O OD2 . ASP C 1 107 ? 20.128  9.374   106.027 1.00 64.29  ? 108  ASP C OD2 1 
ATOM   6768  N N   . ASP C 1 108 ? 23.337  7.670   103.336 1.00 57.65  ? 109  ASP C N   1 
ATOM   6769  C CA  . ASP C 1 108 ? 24.735  7.506   103.714 1.00 50.94  ? 109  ASP C CA  1 
ATOM   6770  C C   . ASP C 1 108 ? 25.680  7.987   102.619 1.00 47.98  ? 109  ASP C C   1 
ATOM   6771  O O   . ASP C 1 108 ? 26.748  8.522   102.912 1.00 66.87  ? 109  ASP C O   1 
ATOM   6772  C CB  . ASP C 1 108 ? 25.039  6.051   104.079 1.00 51.79  ? 109  ASP C CB  1 
ATOM   6773  C CG  . ASP C 1 108 ? 24.370  5.623   105.372 1.00 68.59  ? 109  ASP C CG  1 
ATOM   6774  O OD1 . ASP C 1 108 ? 23.887  6.506   106.113 1.00 80.63  ? 109  ASP C OD1 1 
ATOM   6775  O OD2 . ASP C 1 108 ? 24.336  4.407   105.653 1.00 72.48  ? 109  ASP C OD2 1 
ATOM   6776  N N   . HIS C 1 109 ? 25.290  7.804   101.360 1.00 39.22  ? 110  HIS C N   1 
ATOM   6777  C CA  . HIS C 1 109 ? 26.147  8.232   100.259 1.00 41.04  ? 110  HIS C CA  1 
ATOM   6778  C C   . HIS C 1 109 ? 26.254  9.748   100.144 1.00 48.69  ? 110  HIS C C   1 
ATOM   6779  O O   . HIS C 1 109 ? 27.336  10.274  99.892  1.00 58.72  ? 110  HIS C O   1 
ATOM   6780  C CB  . HIS C 1 109 ? 25.693  7.645   98.925  1.00 49.66  ? 110  HIS C CB  1 
ATOM   6781  C CG  . HIS C 1 109 ? 26.648  7.914   97.804  1.00 54.45  ? 110  HIS C CG  1 
ATOM   6782  N ND1 . HIS C 1 109 ? 27.993  7.624   97.888  1.00 38.40  ? 110  HIS C ND1 1 
ATOM   6783  C CD2 . HIS C 1 109 ? 26.457  8.455   96.577  1.00 57.77  ? 110  HIS C CD2 1 
ATOM   6784  C CE1 . HIS C 1 109 ? 28.588  7.969   96.763  1.00 43.54  ? 110  HIS C CE1 1 
ATOM   6785  N NE2 . HIS C 1 109 ? 27.679  8.476   95.948  1.00 52.58  ? 110  HIS C NE2 1 
ATOM   6786  N N   . PHE C 1 110 ? 25.139  10.449  100.320 1.00 66.39  ? 111  PHE C N   1 
ATOM   6787  C CA  . PHE C 1 110 ? 25.170  11.908  100.263 1.00 67.09  ? 111  PHE C CA  1 
ATOM   6788  C C   . PHE C 1 110 ? 25.935  12.485  101.452 1.00 64.12  ? 111  PHE C C   1 
ATOM   6789  O O   . PHE C 1 110 ? 26.793  13.373  101.288 1.00 65.85  ? 111  PHE C O   1 
ATOM   6790  C CB  . PHE C 1 110 ? 23.756  12.487  100.186 1.00 54.25  ? 111  PHE C CB  1 
ATOM   6791  C CG  . PHE C 1 110 ? 23.053  12.199  98.887  1.00 53.88  ? 111  PHE C CG  1 
ATOM   6792  C CD1 . PHE C 1 110 ? 23.625  12.566  97.679  1.00 50.29  ? 111  PHE C CD1 1 
ATOM   6793  C CD2 . PHE C 1 110 ? 21.818  11.571  98.872  1.00 50.86  ? 111  PHE C CD2 1 
ATOM   6794  C CE1 . PHE C 1 110 ? 22.983  12.305  96.480  1.00 48.49  ? 111  PHE C CE1 1 
ATOM   6795  C CE2 . PHE C 1 110 ? 21.171  11.307  97.676  1.00 54.58  ? 111  PHE C CE2 1 
ATOM   6796  C CZ  . PHE C 1 110 ? 21.755  11.675  96.479  1.00 49.52  ? 111  PHE C CZ  1 
ATOM   6797  N N   . GLN C 1 111 ? 25.635  11.971  102.646 1.00 55.74  ? 112  GLN C N   1 
ATOM   6798  C CA  . GLN C 1 111 ? 26.369  12.388  103.839 1.00 62.52  ? 112  GLN C CA  1 
ATOM   6799  C C   . GLN C 1 111 ? 27.873  12.183  103.671 1.00 87.92  ? 112  GLN C C   1 
ATOM   6800  O O   . GLN C 1 111 ? 28.674  13.090  103.931 1.00 96.60  ? 112  GLN C O   1 
ATOM   6801  C CB  . GLN C 1 111 ? 25.883  11.629  105.071 1.00 47.15  ? 112  GLN C CB  1 
ATOM   6802  C CG  . GLN C 1 111 ? 24.494  12.008  105.537 1.00 49.81  ? 112  GLN C CG  1 
ATOM   6803  C CD  . GLN C 1 111 ? 24.205  11.500  106.935 1.00 70.29  ? 112  GLN C CD  1 
ATOM   6804  O OE1 . GLN C 1 111 ? 24.902  11.846  107.890 1.00 73.09  ? 112  GLN C OE1 1 
ATOM   6805  N NE2 . GLN C 1 111 ? 23.184  10.662  107.061 1.00 75.57  ? 112  GLN C NE2 1 
ATOM   6806  N N   . HIS C 1 112 ? 28.246  10.986  103.226 1.00 91.62  ? 113  HIS C N   1 
ATOM   6807  C CA  . HIS C 1 112 ? 29.649  10.652  103.017 1.00 86.49  ? 113  HIS C CA  1 
ATOM   6808  C C   . HIS C 1 112 ? 30.293  11.549  101.968 1.00 73.19  ? 113  HIS C C   1 
ATOM   6809  O O   . HIS C 1 112 ? 31.442  11.947  102.121 1.00 88.11  ? 113  HIS C O   1 
ATOM   6810  C CB  . HIS C 1 112 ? 29.828  9.185   102.620 1.00 83.71  ? 113  HIS C CB  1 
ATOM   6811  C CG  . HIS C 1 112 ? 31.201  8.867   102.115 1.00 98.50  ? 113  HIS C CG  1 
ATOM   6812  N ND1 . HIS C 1 112 ? 31.533  8.927   100.778 1.00 103.64 ? 113  HIS C ND1 1 
ATOM   6813  C CD2 . HIS C 1 112 ? 32.330  8.502   102.767 1.00 103.32 ? 113  HIS C CD2 1 
ATOM   6814  C CE1 . HIS C 1 112 ? 32.806  8.608   100.628 1.00 99.78  ? 113  HIS C CE1 1 
ATOM   6815  N NE2 . HIS C 1 112 ? 33.312  8.346   101.820 1.00 101.79 ? 113  HIS C NE2 1 
ATOM   6816  N N   . LEU C 1 113 ? 29.561  11.852  100.900 1.00 42.54  ? 114  LEU C N   1 
ATOM   6817  C CA  . LEU C 1 113 ? 30.073  12.739  99.864  1.00 40.35  ? 114  LEU C CA  1 
ATOM   6818  C C   . LEU C 1 113 ? 30.419  14.095  100.457 1.00 60.44  ? 114  LEU C C   1 
ATOM   6819  O O   . LEU C 1 113 ? 31.512  14.623  100.221 1.00 67.68  ? 114  LEU C O   1 
ATOM   6820  C CB  . LEU C 1 113 ? 29.053  12.911  98.741  1.00 53.14  ? 114  LEU C CB  1 
ATOM   6821  C CG  . LEU C 1 113 ? 28.993  11.800  97.694  1.00 65.50  ? 114  LEU C CG  1 
ATOM   6822  C CD1 . LEU C 1 113 ? 27.834  12.034  96.741  1.00 72.21  ? 114  LEU C CD1 1 
ATOM   6823  C CD2 . LEU C 1 113 ? 30.307  11.704  96.936  1.00 54.98  ? 114  LEU C CD2 1 
ATOM   6824  N N   . LEU C 1 114 ? 29.493  14.656  101.234 1.00 77.57  ? 115  LEU C N   1 
ATOM   6825  C CA  . LEU C 1 114 ? 29.740  15.957  101.859 1.00 71.15  ? 115  LEU C CA  1 
ATOM   6826  C C   . LEU C 1 114 ? 30.946  15.923  102.801 1.00 64.74  ? 115  LEU C C   1 
ATOM   6827  O O   . LEU C 1 114 ? 31.870  16.731  102.673 1.00 58.54  ? 115  LEU C O   1 
ATOM   6828  C CB  . LEU C 1 114 ? 28.494  16.462  102.595 1.00 63.35  ? 115  LEU C CB  1 
ATOM   6829  C CG  . LEU C 1 114 ? 28.559  17.938  102.987 1.00 53.86  ? 115  LEU C CG  1 
ATOM   6830  C CD1 . LEU C 1 114 ? 28.692  18.801  101.738 1.00 42.81  ? 115  LEU C CD1 1 
ATOM   6831  C CD2 . LEU C 1 114 ? 27.334  18.334  103.791 1.00 61.43  ? 115  LEU C CD2 1 
ATOM   6832  N N   . ASN C 1 115 ? 30.926  14.986  103.742 1.00 54.18  ? 116  ASN C N   1 
ATOM   6833  C CA  . ASN C 1 115 ? 32.003  14.863  104.715 1.00 59.36  ? 116  ASN C CA  1 
ATOM   6834  C C   . ASN C 1 115 ? 33.369  14.664  104.067 1.00 79.15  ? 116  ASN C C   1 
ATOM   6835  O O   . ASN C 1 115 ? 34.383  15.209  104.515 1.00 65.24  ? 116  ASN C O   1 
ATOM   6836  C CB  . ASN C 1 115 ? 31.710  13.717  105.683 1.00 39.63  ? 116  ASN C CB  1 
ATOM   6837  C CG  . ASN C 1 115 ? 30.766  14.128  106.813 1.00 47.64  ? 116  ASN C CG  1 
ATOM   6838  O OD1 . ASN C 1 115 ? 30.100  15.146  106.709 1.00 66.24  ? 116  ASN C OD1 1 
ATOM   6839  N ND2 . ASN C 1 115 ? 30.685  13.320  107.883 1.00 56.08  ? 116  ASN C ND2 1 
ATOM   6840  N N   . ASP C 1 116 ? 33.375  13.889  102.989 1.00 93.91  ? 117  ASP C N   1 
ATOM   6841  C CA  . ASP C 1 116 ? 34.589  13.619  102.218 1.00 87.53  ? 117  ASP C CA  1 
ATOM   6842  C C   . ASP C 1 116 ? 35.084  14.880  101.519 1.00 76.37  ? 117  ASP C C   1 
ATOM   6843  O O   . ASP C 1 116 ? 36.292  15.131  101.453 1.00 80.61  ? 117  ASP C O   1 
ATOM   6844  C CB  . ASP C 1 116 ? 34.343  12.510  101.183 1.00 86.69  ? 117  ASP C CB  1 
ATOM   6845  C CG  . ASP C 1 116 ? 35.598  12.129  100.419 1.00 95.04  ? 117  ASP C CG  1 
ATOM   6846  O OD1 . ASP C 1 116 ? 36.675  12.062  101.044 1.00 100.94 ? 117  ASP C OD1 1 
ATOM   6847  O OD2 . ASP C 1 116 ? 35.499  11.902  99.195  1.00 95.94  ? 117  ASP C OD2 1 
ATOM   6848  N N   . SER C 1 117 ? 34.145  15.670  101.002 1.00 57.95  ? 118  SER C N   1 
ATOM   6849  C CA  . SER C 1 117 ? 34.487  16.957  100.405 1.00 50.21  ? 118  SER C CA  1 
ATOM   6850  C C   . SER C 1 117 ? 35.150  17.846  101.445 1.00 50.33  ? 118  SER C C   1 
ATOM   6851  O O   . SER C 1 117 ? 36.137  18.532  101.160 1.00 56.72  ? 118  SER C O   1 
ATOM   6852  C CB  . SER C 1 117 ? 33.244  17.650  99.844  1.00 53.35  ? 118  SER C CB  1 
ATOM   6853  O OG  . SER C 1 117 ? 33.588  18.879  99.227  1.00 55.10  ? 118  SER C OG  1 
ATOM   6854  N N   . GLU C 1 118 ? 34.606  17.820  102.659 1.00 47.63  ? 119  GLU C N   1 
ATOM   6855  C CA  . GLU C 1 118 ? 35.145  18.627  103.745 1.00 58.44  ? 119  GLU C CA  1 
ATOM   6856  C C   . GLU C 1 118 ? 36.554  18.187  104.133 1.00 72.86  ? 119  GLU C C   1 
ATOM   6857  O O   . GLU C 1 118 ? 37.429  19.022  104.357 1.00 75.34  ? 119  GLU C O   1 
ATOM   6858  C CB  . GLU C 1 118 ? 34.231  18.580  104.968 1.00 50.25  ? 119  GLU C CB  1 
ATOM   6859  C CG  . GLU C 1 118 ? 34.554  19.641  106.005 1.00 59.95  ? 119  GLU C CG  1 
ATOM   6860  C CD  . GLU C 1 118 ? 33.759  19.466  107.279 1.00 77.91  ? 119  GLU C CD  1 
ATOM   6861  O OE1 . GLU C 1 118 ? 33.420  18.311  107.616 1.00 87.85  ? 119  GLU C OE1 1 
ATOM   6862  O OE2 . GLU C 1 118 ? 33.473  20.484  107.943 1.00 83.92  ? 119  GLU C OE2 1 
ATOM   6863  N N   . ARG C 1 119 ? 36.773  16.878  104.219 1.00 73.01  ? 120  ARG C N   1 
ATOM   6864  C CA  . ARG C 1 119 ? 38.097  16.365  104.567 1.00 66.51  ? 120  ARG C CA  1 
ATOM   6865  C C   . ARG C 1 119 ? 39.130  16.660  103.482 1.00 75.82  ? 120  ARG C C   1 
ATOM   6866  O O   . ARG C 1 119 ? 40.282  16.991  103.782 1.00 77.89  ? 120  ARG C O   1 
ATOM   6867  C CB  . ARG C 1 119 ? 38.046  14.870  104.882 1.00 34.94  ? 120  ARG C CB  1 
ATOM   6868  C CG  . ARG C 1 119 ? 37.608  14.571  106.305 1.00 43.39  ? 120  ARG C CG  1 
ATOM   6869  C CD  . ARG C 1 119 ? 37.535  13.080  106.566 1.00 75.72  ? 120  ARG C CD  1 
ATOM   6870  N NE  . ARG C 1 119 ? 36.572  12.425  105.686 1.00 99.00  ? 120  ARG C NE  1 
ATOM   6871  C CZ  . ARG C 1 119 ? 35.264  12.379  105.914 1.00 105.61 ? 120  ARG C CZ  1 
ATOM   6872  N NH1 . ARG C 1 119 ? 34.756  12.953  106.997 1.00 99.42  ? 120  ARG C NH1 1 
ATOM   6873  N NH2 . ARG C 1 119 ? 34.462  11.761  105.059 1.00 111.35 ? 120  ARG C NH2 1 
ATOM   6874  N N   . THR C 1 120 ? 38.710  16.542  102.226 1.00 63.91  ? 121  THR C N   1 
ATOM   6875  C CA  . THR C 1 120 ? 39.551  16.931  101.100 1.00 64.93  ? 121  THR C CA  1 
ATOM   6876  C C   . THR C 1 120 ? 39.936  18.402  101.223 1.00 65.69  ? 121  THR C C   1 
ATOM   6877  O O   . THR C 1 120 ? 41.091  18.772  100.999 1.00 59.05  ? 121  THR C O   1 
ATOM   6878  C CB  . THR C 1 120 ? 38.842  16.689  99.754  1.00 69.37  ? 121  THR C CB  1 
ATOM   6879  O OG1 . THR C 1 120 ? 38.747  15.280  99.513  1.00 74.36  ? 121  THR C OG1 1 
ATOM   6880  C CG2 . THR C 1 120 ? 39.609  17.336  98.612  1.00 35.37  ? 121  THR C CG2 1 
ATOM   6881  N N   . LEU C 1 121 ? 38.966  19.233  101.593 1.00 68.37  ? 122  LEU C N   1 
ATOM   6882  C CA  . LEU C 1 121 ? 39.235  20.647  101.835 1.00 67.10  ? 122  LEU C CA  1 
ATOM   6883  C C   . LEU C 1 121 ? 40.277  20.833  102.937 1.00 68.99  ? 122  LEU C C   1 
ATOM   6884  O O   . LEU C 1 121 ? 41.224  21.604  102.782 1.00 74.78  ? 122  LEU C O   1 
ATOM   6885  C CB  . LEU C 1 121 ? 37.944  21.388  102.190 1.00 63.20  ? 122  LEU C CB  1 
ATOM   6886  C CG  . LEU C 1 121 ? 38.073  22.882  102.496 1.00 58.20  ? 122  LEU C CG  1 
ATOM   6887  C CD1 . LEU C 1 121 ? 37.044  23.674  101.714 1.00 49.47  ? 122  LEU C CD1 1 
ATOM   6888  C CD2 . LEU C 1 121 ? 37.923  23.146  103.987 1.00 57.82  ? 122  LEU C CD2 1 
ATOM   6889  N N   . GLN C 1 122 ? 40.102  20.112  104.042 1.00 59.16  ? 123  GLN C N   1 
ATOM   6890  C CA  . GLN C 1 122 ? 41.006  20.222  105.186 1.00 56.41  ? 123  GLN C CA  1 
ATOM   6891  C C   . GLN C 1 122 ? 42.427  19.767  104.863 1.00 72.18  ? 123  GLN C C   1 
ATOM   6892  O O   . GLN C 1 122 ? 43.388  20.244  105.466 1.00 71.14  ? 123  GLN C O   1 
ATOM   6893  C CB  . GLN C 1 122 ? 40.472  19.422  106.377 1.00 52.04  ? 123  GLN C CB  1 
ATOM   6894  C CG  . GLN C 1 122 ? 39.131  19.896  106.906 1.00 55.56  ? 123  GLN C CG  1 
ATOM   6895  C CD  . GLN C 1 122 ? 38.622  19.031  108.042 1.00 67.53  ? 123  GLN C CD  1 
ATOM   6896  O OE1 . GLN C 1 122 ? 37.484  18.564  108.020 1.00 78.33  ? 123  GLN C OE1 1 
ATOM   6897  N NE2 . GLN C 1 122 ? 39.467  18.814  109.043 1.00 61.01  ? 123  GLN C NE2 1 
ATOM   6898  N N   . ALA C 1 123 ? 42.558  18.827  103.933 1.00 80.56  ? 124  ALA C N   1 
ATOM   6899  C CA  . ALA C 1 123 ? 43.879  18.357  103.522 1.00 64.53  ? 124  ALA C CA  1 
ATOM   6900  C C   . ALA C 1 123 ? 44.548  19.285  102.508 1.00 69.20  ? 124  ALA C C   1 
ATOM   6901  O O   . ALA C 1 123 ? 45.742  19.567  102.608 1.00 82.69  ? 124  ALA C O   1 
ATOM   6902  C CB  . ALA C 1 123 ? 43.795  16.941  102.973 1.00 52.95  ? 124  ALA C CB  1 
ATOM   6903  N N   . THR C 1 124 ? 43.771  19.754  101.536 1.00 66.59  ? 125  THR C N   1 
ATOM   6904  C CA  . THR C 1 124 ? 44.306  20.540  100.425 1.00 81.24  ? 125  THR C CA  1 
ATOM   6905  C C   . THR C 1 124 ? 44.553  22.014  100.755 1.00 87.93  ? 125  THR C C   1 
ATOM   6906  O O   . THR C 1 124 ? 45.591  22.575  100.398 1.00 98.35  ? 125  THR C O   1 
ATOM   6907  C CB  . THR C 1 124 ? 43.377  20.459  99.194  1.00 89.60  ? 125  THR C CB  1 
ATOM   6908  O OG1 . THR C 1 124 ? 43.233  19.092  98.789  1.00 91.17  ? 125  THR C OG1 1 
ATOM   6909  C CG2 . THR C 1 124 ? 43.939  21.277  98.036  1.00 83.90  ? 125  THR C CG2 1 
ATOM   6910  N N   . PHE C 1 125 ? 43.599  22.632  101.441 1.00 83.91  ? 126  PHE C N   1 
ATOM   6911  C CA  . PHE C 1 125 ? 43.622  24.080  101.669 1.00 89.45  ? 126  PHE C CA  1 
ATOM   6912  C C   . PHE C 1 125 ? 44.811  24.652  102.467 1.00 92.50  ? 126  PHE C C   1 
ATOM   6913  O O   . PHE C 1 125 ? 45.305  25.729  102.127 1.00 90.47  ? 126  PHE C O   1 
ATOM   6914  C CB  . PHE C 1 125 ? 42.283  24.561  102.243 1.00 90.28  ? 126  PHE C CB  1 
ATOM   6915  C CG  . PHE C 1 125 ? 41.201  24.718  101.207 1.00 90.60  ? 126  PHE C CG  1 
ATOM   6916  C CD1 . PHE C 1 125 ? 40.883  23.676  100.351 1.00 92.84  ? 126  PHE C CD1 1 
ATOM   6917  C CD2 . PHE C 1 125 ? 40.498  25.906  101.093 1.00 93.05  ? 126  PHE C CD2 1 
ATOM   6918  C CE1 . PHE C 1 125 ? 39.892  23.817  99.399  1.00 89.34  ? 126  PHE C CE1 1 
ATOM   6919  C CE2 . PHE C 1 125 ? 39.503  26.051  100.143 1.00 92.25  ? 126  PHE C CE2 1 
ATOM   6920  C CZ  . PHE C 1 125 ? 39.201  25.005  99.295  1.00 86.31  ? 126  PHE C CZ  1 
ATOM   6921  N N   . PRO C 1 126 ? 45.261  23.960  103.533 1.00 94.06  ? 127  PRO C N   1 
ATOM   6922  C CA  . PRO C 1 126 ? 46.462  24.457  104.217 1.00 94.74  ? 127  PRO C CA  1 
ATOM   6923  C C   . PRO C 1 126 ? 47.684  24.461  103.305 1.00 102.04 ? 127  PRO C C   1 
ATOM   6924  O O   . PRO C 1 126 ? 48.483  25.395  103.350 1.00 104.23 ? 127  PRO C O   1 
ATOM   6925  C CB  . PRO C 1 126 ? 46.664  23.447  105.348 1.00 88.10  ? 127  PRO C CB  1 
ATOM   6926  C CG  . PRO C 1 126 ? 45.311  22.914  105.617 1.00 86.75  ? 127  PRO C CG  1 
ATOM   6927  C CD  . PRO C 1 126 ? 44.633  22.855  104.280 1.00 88.39  ? 127  PRO C CD  1 
ATOM   6928  N N   . GLY C 1 127 ? 47.830  23.418  102.495 1.00 107.66 ? 128  GLY C N   1 
ATOM   6929  C CA  . GLY C 1 127 ? 48.916  23.359  101.536 1.00 111.55 ? 128  GLY C CA  1 
ATOM   6930  C C   . GLY C 1 127 ? 48.757  24.420  100.466 1.00 112.15 ? 128  GLY C C   1 
ATOM   6931  O O   . GLY C 1 127 ? 49.664  25.219  100.226 1.00 123.47 ? 128  GLY C O   1 
ATOM   6932  N N   . ALA C 1 128 ? 47.597  24.422  99.819  1.00 99.20  ? 129  ALA C N   1 
ATOM   6933  C CA  . ALA C 1 128 ? 47.294  25.394  98.774  1.00 92.57  ? 129  ALA C CA  1 
ATOM   6934  C C   . ALA C 1 128 ? 47.338  26.851  99.241  1.00 77.56  ? 129  ALA C C   1 
ATOM   6935  O O   . ALA C 1 128 ? 48.224  27.606  98.850  1.00 59.80  ? 129  ALA C O   1 
ATOM   6936  C CB  . ALA C 1 128 ? 45.944  25.082  98.137  1.00 91.02  ? 129  ALA C CB  1 
ATOM   6937  N N   . PHE C 1 129 ? 46.377  27.241  100.073 1.00 85.43  ? 130  PHE C N   1 
ATOM   6938  C CA  . PHE C 1 129 ? 46.182  28.653  100.406 1.00 91.11  ? 130  PHE C CA  1 
ATOM   6939  C C   . PHE C 1 129 ? 46.818  29.111  101.721 1.00 86.19  ? 130  PHE C C   1 
ATOM   6940  O O   . PHE C 1 129 ? 46.791  30.299  102.047 1.00 77.49  ? 130  PHE C O   1 
ATOM   6941  C CB  . PHE C 1 129 ? 44.689  28.984  100.400 1.00 90.71  ? 130  PHE C CB  1 
ATOM   6942  C CG  . PHE C 1 129 ? 43.978  28.539  99.154  1.00 101.67 ? 130  PHE C CG  1 
ATOM   6943  C CD1 . PHE C 1 129 ? 44.549  28.728  97.905  1.00 104.62 ? 130  PHE C CD1 1 
ATOM   6944  C CD2 . PHE C 1 129 ? 42.741  27.919  99.232  1.00 107.16 ? 130  PHE C CD2 1 
ATOM   6945  C CE1 . PHE C 1 129 ? 43.896  28.316  96.759  1.00 108.27 ? 130  PHE C CE1 1 
ATOM   6946  C CE2 . PHE C 1 129 ? 42.083  27.505  98.089  1.00 108.53 ? 130  PHE C CE2 1 
ATOM   6947  C CZ  . PHE C 1 129 ? 42.662  27.704  96.851  1.00 109.33 ? 130  PHE C CZ  1 
ATOM   6948  N N   . GLY C 1 130 ? 47.390  28.172  102.467 1.00 76.63  ? 131  GLY C N   1 
ATOM   6949  C CA  . GLY C 1 130 ? 48.084  28.496  103.700 1.00 65.29  ? 131  GLY C CA  1 
ATOM   6950  C C   . GLY C 1 130 ? 47.263  29.222  104.750 1.00 80.72  ? 131  GLY C C   1 
ATOM   6951  O O   . GLY C 1 130 ? 46.201  28.753  105.177 1.00 87.47  ? 131  GLY C O   1 
ATOM   6952  N N   . GLU C 1 131 ? 47.774  30.378  105.165 1.00 90.34  ? 132  GLU C N   1 
ATOM   6953  C CA  . GLU C 1 131 ? 47.189  31.162  106.246 1.00 92.68  ? 132  GLU C CA  1 
ATOM   6954  C C   . GLU C 1 131 ? 45.769  31.629  105.941 1.00 82.15  ? 132  GLU C C   1 
ATOM   6955  O O   . GLU C 1 131 ? 44.952  31.780  106.856 1.00 82.22  ? 132  GLU C O   1 
ATOM   6956  C CB  . GLU C 1 131 ? 48.080  32.362  106.567 1.00 102.30 ? 132  GLU C CB  1 
ATOM   6957  C CG  . GLU C 1 131 ? 48.369  32.527  108.048 1.00 107.14 ? 132  GLU C CG  1 
ATOM   6958  C CD  . GLU C 1 131 ? 49.507  33.490  108.316 1.00 114.69 ? 132  GLU C CD  1 
ATOM   6959  O OE1 . GLU C 1 131 ? 49.603  34.513  107.606 1.00 117.13 ? 132  GLU C OE1 1 
ATOM   6960  O OE2 . GLU C 1 131 ? 50.312  33.218  109.231 1.00 113.36 ? 132  GLU C OE2 1 
ATOM   6961  N N   . LEU C 1 132 ? 45.485  31.857  104.661 1.00 71.07  ? 133  LEU C N   1 
ATOM   6962  C CA  . LEU C 1 132 ? 44.167  32.311  104.235 1.00 88.08  ? 133  LEU C CA  1 
ATOM   6963  C C   . LEU C 1 132 ? 43.079  31.322  104.641 1.00 95.43  ? 133  LEU C C   1 
ATOM   6964  O O   . LEU C 1 132 ? 42.010  31.721  105.095 1.00 90.55  ? 133  LEU C O   1 
ATOM   6965  C CB  . LEU C 1 132 ? 44.138  32.564  102.724 1.00 87.45  ? 133  LEU C CB  1 
ATOM   6966  C CG  . LEU C 1 132 ? 44.868  33.822  102.244 1.00 88.92  ? 133  LEU C CG  1 
ATOM   6967  C CD1 . LEU C 1 132 ? 44.530  34.137  100.794 1.00 88.61  ? 133  LEU C CD1 1 
ATOM   6968  C CD2 . LEU C 1 132 ? 44.540  35.008  103.138 1.00 87.15  ? 133  LEU C CD2 1 
ATOM   6969  N N   . TYR C 1 133 ? 43.346  30.033  104.468 1.00 91.37  ? 134  TYR C N   1 
ATOM   6970  C CA  . TYR C 1 133 ? 42.427  29.016  104.962 1.00 85.55  ? 134  TYR C CA  1 
ATOM   6971  C C   . TYR C 1 133 ? 42.571  28.776  106.462 1.00 83.22  ? 134  TYR C C   1 
ATOM   6972  O O   . TYR C 1 133 ? 41.579  28.771  107.194 1.00 88.13  ? 134  TYR C O   1 
ATOM   6973  C CB  . TYR C 1 133 ? 42.616  27.686  104.230 1.00 85.19  ? 134  TYR C CB  1 
ATOM   6974  C CG  . TYR C 1 133 ? 42.045  26.522  105.009 1.00 72.36  ? 134  TYR C CG  1 
ATOM   6975  C CD1 . TYR C 1 133 ? 40.674  26.318  105.078 1.00 65.00  ? 134  TYR C CD1 1 
ATOM   6976  C CD2 . TYR C 1 133 ? 42.874  25.642  105.693 1.00 74.10  ? 134  TYR C CD2 1 
ATOM   6977  C CE1 . TYR C 1 133 ? 40.144  25.266  105.798 1.00 77.81  ? 134  TYR C CE1 1 
ATOM   6978  C CE2 . TYR C 1 133 ? 42.352  24.588  106.417 1.00 78.28  ? 134  TYR C CE2 1 
ATOM   6979  C CZ  . TYR C 1 133 ? 40.988  24.404  106.464 1.00 80.94  ? 134  TYR C CZ  1 
ATOM   6980  O OH  . TYR C 1 133 ? 40.466  23.355  107.180 1.00 79.98  ? 134  TYR C OH  1 
ATOM   6981  N N   . THR C 1 134 ? 43.808  28.583  106.915 1.00 75.02  ? 135  THR C N   1 
ATOM   6982  C CA  . THR C 1 134 ? 44.041  28.117  108.281 1.00 81.82  ? 135  THR C CA  1 
ATOM   6983  C C   . THR C 1 134 ? 43.562  29.094  109.352 1.00 80.89  ? 135  THR C C   1 
ATOM   6984  O O   . THR C 1 134 ? 43.228  28.684  110.464 1.00 67.84  ? 135  THR C O   1 
ATOM   6985  C CB  . THR C 1 134 ? 45.519  27.759  108.521 1.00 90.02  ? 135  THR C CB  1 
ATOM   6986  O OG1 . THR C 1 134 ? 46.345  28.891  108.224 1.00 97.52  ? 135  THR C OG1 1 
ATOM   6987  C CG2 . THR C 1 134 ? 45.926  26.591  107.635 1.00 87.31  ? 135  THR C CG2 1 
ATOM   6988  N N   . GLN C 1 135 ? 43.528  30.381  109.020 1.00 93.00  ? 136  GLN C N   1 
ATOM   6989  C CA  . GLN C 1 135 ? 42.992  31.372  109.945 1.00 96.25  ? 136  GLN C CA  1 
ATOM   6990  C C   . GLN C 1 135 ? 41.468  31.323  109.962 1.00 94.30  ? 136  GLN C C   1 
ATOM   6991  O O   . GLN C 1 135 ? 40.838  31.568  110.990 1.00 103.05 ? 136  GLN C O   1 
ATOM   6992  C CB  . GLN C 1 135 ? 43.461  32.775  109.559 1.00 104.26 ? 136  GLN C CB  1 
ATOM   6993  C CG  . GLN C 1 135 ? 44.941  33.034  109.800 1.00 104.23 ? 136  GLN C CG  1 
ATOM   6994  C CD  . GLN C 1 135 ? 45.265  33.236  111.266 1.00 102.09 ? 136  GLN C CD  1 
ATOM   6995  O OE1 . GLN C 1 135 ? 45.500  32.277  112.001 1.00 92.78  ? 136  GLN C OE1 1 
ATOM   6996  N NE2 . GLN C 1 135 ? 45.281  34.491  111.700 1.00 104.99 ? 136  GLN C NE2 1 
ATOM   6997  N N   . ASN C 1 136 ? 40.886  31.018  108.806 1.00 88.18  ? 137  ASN C N   1 
ATOM   6998  C CA  . ASN C 1 136 ? 39.437  31.058  108.621 1.00 87.03  ? 137  ASN C CA  1 
ATOM   6999  C C   . ASN C 1 136 ? 38.695  29.724  108.742 1.00 81.06  ? 137  ASN C C   1 
ATOM   7000  O O   . ASN C 1 136 ? 37.495  29.668  108.482 1.00 90.61  ? 137  ASN C O   1 
ATOM   7001  C CB  . ASN C 1 136 ? 39.091  31.728  107.289 1.00 90.32  ? 137  ASN C CB  1 
ATOM   7002  C CG  . ASN C 1 136 ? 39.739  33.090  107.139 1.00 91.64  ? 137  ASN C CG  1 
ATOM   7003  O OD1 . ASN C 1 136 ? 39.304  34.069  107.747 1.00 99.64  ? 137  ASN C OD1 1 
ATOM   7004  N ND2 . ASN C 1 136 ? 40.783  33.161  106.324 1.00 89.19  ? 137  ASN C ND2 1 
ATOM   7005  N N   . ALA C 1 137 ? 39.407  28.662  109.113 1.00 70.93  ? 138  ALA C N   1 
ATOM   7006  C CA  . ALA C 1 137 ? 38.877  27.290  109.065 1.00 62.44  ? 138  ALA C CA  1 
ATOM   7007  C C   . ALA C 1 137 ? 37.483  27.090  109.675 1.00 63.95  ? 138  ALA C C   1 
ATOM   7008  O O   . ALA C 1 137 ? 36.645  26.365  109.120 1.00 70.68  ? 138  ALA C O   1 
ATOM   7009  C CB  . ALA C 1 137 ? 39.872  26.326  109.707 1.00 52.54  ? 138  ALA C CB  1 
ATOM   7010  N N   . ARG C 1 138 ? 37.239  27.745  110.808 1.00 66.60  ? 139  ARG C N   1 
ATOM   7011  C CA  . ARG C 1 138 ? 35.957  27.652  111.503 1.00 56.15  ? 139  ARG C CA  1 
ATOM   7012  C C   . ARG C 1 138 ? 34.795  28.061  110.602 1.00 46.24  ? 139  ARG C C   1 
ATOM   7013  O O   . ARG C 1 138 ? 33.703  27.504  110.696 1.00 49.67  ? 139  ARG C O   1 
ATOM   7014  C CB  . ARG C 1 138 ? 35.974  28.517  112.767 1.00 67.44  ? 139  ARG C CB  1 
ATOM   7015  C CG  . ARG C 1 138 ? 34.663  28.536  113.540 1.00 78.81  ? 139  ARG C CG  1 
ATOM   7016  C CD  . ARG C 1 138 ? 34.298  27.156  114.064 1.00 86.93  ? 139  ARG C CD  1 
ATOM   7017  N NE  . ARG C 1 138 ? 33.204  27.215  115.030 1.00 105.22 ? 139  ARG C NE  1 
ATOM   7018  C CZ  . ARG C 1 138 ? 33.373  27.358  116.341 1.00 119.52 ? 139  ARG C CZ  1 
ATOM   7019  N NH1 . ARG C 1 138 ? 34.595  27.457  116.847 1.00 122.79 ? 139  ARG C NH1 1 
ATOM   7020  N NH2 . ARG C 1 138 ? 32.321  27.403  117.147 1.00 123.44 ? 139  ARG C NH2 1 
ATOM   7021  N N   . ALA C 1 139 ? 35.042  29.028  109.723 1.00 41.44  ? 140  ALA C N   1 
ATOM   7022  C CA  . ALA C 1 139 ? 34.024  29.492  108.788 1.00 48.98  ? 140  ALA C CA  1 
ATOM   7023  C C   . ALA C 1 139 ? 33.630  28.392  107.807 1.00 58.67  ? 140  ALA C C   1 
ATOM   7024  O O   . ALA C 1 139 ? 32.445  28.162  107.568 1.00 75.34  ? 140  ALA C O   1 
ATOM   7025  C CB  . ALA C 1 139 ? 34.506  30.726  108.042 1.00 43.88  ? 140  ALA C CB  1 
ATOM   7026  N N   . PHE C 1 140 ? 34.625  27.714  107.244 1.00 54.34  ? 141  PHE C N   1 
ATOM   7027  C CA  . PHE C 1 140 ? 34.372  26.612  106.321 1.00 65.62  ? 141  PHE C CA  1 
ATOM   7028  C C   . PHE C 1 140 ? 33.651  25.465  107.026 1.00 60.39  ? 141  PHE C C   1 
ATOM   7029  O O   . PHE C 1 140 ? 32.726  24.856  106.468 1.00 54.71  ? 141  PHE C O   1 
ATOM   7030  C CB  . PHE C 1 140 ? 35.678  26.121  105.694 1.00 65.57  ? 141  PHE C CB  1 
ATOM   7031  C CG  . PHE C 1 140 ? 36.370  27.154  104.849 1.00 67.95  ? 141  PHE C CG  1 
ATOM   7032  C CD1 . PHE C 1 140 ? 36.039  27.312  103.513 1.00 64.06  ? 141  PHE C CD1 1 
ATOM   7033  C CD2 . PHE C 1 140 ? 37.350  27.970  105.392 1.00 78.98  ? 141  PHE C CD2 1 
ATOM   7034  C CE1 . PHE C 1 140 ? 36.674  28.263  102.734 1.00 75.41  ? 141  PHE C CE1 1 
ATOM   7035  C CE2 . PHE C 1 140 ? 37.989  28.923  104.618 1.00 74.17  ? 141  PHE C CE2 1 
ATOM   7036  C CZ  . PHE C 1 140 ? 37.650  29.070  103.289 1.00 74.45  ? 141  PHE C CZ  1 
ATOM   7037  N N   . ARG C 1 141 ? 34.077  25.177  108.255 1.00 55.84  ? 142  ARG C N   1 
ATOM   7038  C CA  . ARG C 1 141 ? 33.385  24.197  109.087 1.00 54.56  ? 142  ARG C CA  1 
ATOM   7039  C C   . ARG C 1 141 ? 31.907  24.548  109.222 1.00 59.02  ? 142  ARG C C   1 
ATOM   7040  O O   . ARG C 1 141 ? 31.031  23.706  108.997 1.00 54.87  ? 142  ARG C O   1 
ATOM   7041  C CB  . ARG C 1 141 ? 34.014  24.128  110.477 1.00 55.52  ? 142  ARG C CB  1 
ATOM   7042  C CG  . ARG C 1 141 ? 35.049  23.034  110.658 1.00 69.93  ? 142  ARG C CG  1 
ATOM   7043  C CD  . ARG C 1 141 ? 35.384  22.881  112.130 1.00 87.40  ? 142  ARG C CD  1 
ATOM   7044  N NE  . ARG C 1 141 ? 34.177  22.691  112.930 1.00 92.46  ? 142  ARG C NE  1 
ATOM   7045  C CZ  . ARG C 1 141 ? 34.010  23.159  114.163 1.00 93.11  ? 142  ARG C CZ  1 
ATOM   7046  N NH1 . ARG C 1 141 ? 34.976  23.852  114.750 1.00 94.63  ? 142  ARG C NH1 1 
ATOM   7047  N NH2 . ARG C 1 141 ? 32.873  22.937  114.810 1.00 82.76  ? 142  ARG C NH2 1 
ATOM   7048  N N   . ASP C 1 142 ? 31.643  25.799  109.588 1.00 61.49  ? 143  ASP C N   1 
ATOM   7049  C CA  . ASP C 1 142 ? 30.279  26.290  109.750 1.00 58.09  ? 143  ASP C CA  1 
ATOM   7050  C C   . ASP C 1 142 ? 29.480  26.161  108.460 1.00 59.25  ? 143  ASP C C   1 
ATOM   7051  O O   . ASP C 1 142 ? 28.302  25.815  108.492 1.00 73.71  ? 143  ASP C O   1 
ATOM   7052  C CB  . ASP C 1 142 ? 30.276  27.747  110.222 1.00 63.86  ? 143  ASP C CB  1 
ATOM   7053  C CG  . ASP C 1 142 ? 30.807  27.906  111.633 1.00 69.39  ? 143  ASP C CG  1 
ATOM   7054  O OD1 . ASP C 1 142 ? 30.826  26.905  112.381 1.00 66.95  ? 143  ASP C OD1 1 
ATOM   7055  O OD2 . ASP C 1 142 ? 31.201  29.035  111.997 1.00 66.59  ? 143  ASP C OD2 1 
ATOM   7056  N N   . LEU C 1 143 ? 30.120  26.436  107.327 1.00 44.35  ? 144  LEU C N   1 
ATOM   7057  C CA  . LEU C 1 143 ? 29.454  26.313  106.034 1.00 42.24  ? 144  LEU C CA  1 
ATOM   7058  C C   . LEU C 1 143 ? 29.048  24.868  105.758 1.00 62.48  ? 144  LEU C C   1 
ATOM   7059  O O   . LEU C 1 143 ? 27.925  24.604  105.322 1.00 67.16  ? 144  LEU C O   1 
ATOM   7060  C CB  . LEU C 1 143 ? 30.344  26.839  104.906 1.00 40.03  ? 144  LEU C CB  1 
ATOM   7061  C CG  . LEU C 1 143 ? 29.774  26.693  103.492 1.00 42.07  ? 144  LEU C CG  1 
ATOM   7062  C CD1 . LEU C 1 143 ? 28.431  27.396  103.369 1.00 34.78  ? 144  LEU C CD1 1 
ATOM   7063  C CD2 . LEU C 1 143 ? 30.751  27.216  102.451 1.00 45.43  ? 144  LEU C CD2 1 
ATOM   7064  N N   . TYR C 1 144 ? 29.958  23.933  106.018 1.00 62.66  ? 145  TYR C N   1 
ATOM   7065  C CA  . TYR C 1 144 ? 29.633  22.520  105.839 1.00 53.79  ? 145  TYR C CA  1 
ATOM   7066  C C   . TYR C 1 144 ? 28.514  22.064  106.776 1.00 50.76  ? 145  TYR C C   1 
ATOM   7067  O O   . TYR C 1 144 ? 27.656  21.266  106.388 1.00 52.47  ? 145  TYR C O   1 
ATOM   7068  C CB  . TYR C 1 144 ? 30.873  21.636  105.990 1.00 44.08  ? 145  TYR C CB  1 
ATOM   7069  C CG  . TYR C 1 144 ? 31.632  21.458  104.694 1.00 46.69  ? 145  TYR C CG  1 
ATOM   7070  C CD1 . TYR C 1 144 ? 31.326  20.419  103.824 1.00 47.75  ? 145  TYR C CD1 1 
ATOM   7071  C CD2 . TYR C 1 144 ? 32.646  22.335  104.335 1.00 59.74  ? 145  TYR C CD2 1 
ATOM   7072  C CE1 . TYR C 1 144 ? 32.014  20.255  102.635 1.00 52.15  ? 145  TYR C CE1 1 
ATOM   7073  C CE2 . TYR C 1 144 ? 33.338  22.180  103.149 1.00 64.97  ? 145  TYR C CE2 1 
ATOM   7074  C CZ  . TYR C 1 144 ? 33.018  21.139  102.304 1.00 60.55  ? 145  TYR C CZ  1 
ATOM   7075  O OH  . TYR C 1 144 ? 33.705  20.980  101.122 1.00 64.82  ? 145  TYR C OH  1 
ATOM   7076  N N   . SER C 1 145 ? 28.518  22.578  108.001 1.00 50.21  ? 146  SER C N   1 
ATOM   7077  C CA  . SER C 1 145 ? 27.442  22.282  108.940 1.00 54.13  ? 146  SER C CA  1 
ATOM   7078  C C   . SER C 1 145 ? 26.105  22.807  108.413 1.00 69.26  ? 146  SER C C   1 
ATOM   7079  O O   . SER C 1 145 ? 25.077  22.129  108.509 1.00 71.36  ? 146  SER C O   1 
ATOM   7080  C CB  . SER C 1 145 ? 27.745  22.877  110.316 1.00 52.01  ? 146  SER C CB  1 
ATOM   7081  O OG  . SER C 1 145 ? 28.860  22.241  110.918 1.00 47.34  ? 146  SER C OG  1 
ATOM   7082  N N   . GLU C 1 146 ? 26.129  24.014  107.852 1.00 70.72  ? 147  GLU C N   1 
ATOM   7083  C CA  . GLU C 1 146 ? 24.932  24.624  107.283 1.00 70.31  ? 147  GLU C CA  1 
ATOM   7084  C C   . GLU C 1 146 ? 24.402  23.811  106.108 1.00 75.76  ? 147  GLU C C   1 
ATOM   7085  O O   . GLU C 1 146 ? 23.194  23.625  105.972 1.00 82.07  ? 147  GLU C O   1 
ATOM   7086  C CB  . GLU C 1 146 ? 25.209  26.058  106.827 1.00 60.87  ? 147  GLU C CB  1 
ATOM   7087  C CG  . GLU C 1 146 ? 25.504  27.042  107.948 1.00 65.63  ? 147  GLU C CG  1 
ATOM   7088  C CD  . GLU C 1 146 ? 24.319  27.272  108.867 1.00 74.57  ? 147  GLU C CD  1 
ATOM   7089  O OE1 . GLU C 1 146 ? 23.173  26.994  108.455 1.00 89.25  ? 147  GLU C OE1 1 
ATOM   7090  O OE2 . GLU C 1 146 ? 24.535  27.736  110.006 1.00 69.58  ? 147  GLU C OE2 1 
ATOM   7091  N N   . LEU C 1 147 ? 25.308  23.337  105.258 1.00 74.70  ? 148  LEU C N   1 
ATOM   7092  C CA  . LEU C 1 147 ? 24.929  22.504  104.120 1.00 66.12  ? 148  LEU C CA  1 
ATOM   7093  C C   . LEU C 1 147 ? 24.346  21.179  104.595 1.00 59.32  ? 148  LEU C C   1 
ATOM   7094  O O   . LEU C 1 147 ? 23.448  20.616  103.966 1.00 65.12  ? 148  LEU C O   1 
ATOM   7095  C CB  . LEU C 1 147 ? 26.134  22.253  103.213 1.00 61.75  ? 148  LEU C CB  1 
ATOM   7096  C CG  . LEU C 1 147 ? 26.641  23.465  102.436 1.00 56.18  ? 148  LEU C CG  1 
ATOM   7097  C CD1 . LEU C 1 147 ? 27.831  23.085  101.570 1.00 55.82  ? 148  LEU C CD1 1 
ATOM   7098  C CD2 . LEU C 1 147 ? 25.514  24.043  101.595 1.00 45.52  ? 148  LEU C CD2 1 
ATOM   7099  N N   . ARG C 1 148 ? 24.865  20.691  105.716 1.00 52.59  ? 149  ARG C N   1 
ATOM   7100  C CA  . ARG C 1 148 ? 24.382  19.456  106.313 1.00 62.00  ? 149  ARG C CA  1 
ATOM   7101  C C   . ARG C 1 148 ? 22.941  19.639  106.791 1.00 65.75  ? 149  ARG C C   1 
ATOM   7102  O O   . ARG C 1 148 ? 22.059  18.829  106.473 1.00 67.12  ? 149  ARG C O   1 
ATOM   7103  C CB  . ARG C 1 148 ? 25.286  19.061  107.480 1.00 65.19  ? 149  ARG C CB  1 
ATOM   7104  C CG  . ARG C 1 148 ? 25.679  17.593  107.500 1.00 63.60  ? 149  ARG C CG  1 
ATOM   7105  C CD  . ARG C 1 148 ? 27.016  17.379  108.198 1.00 62.84  ? 149  ARG C CD  1 
ATOM   7106  N NE  . ARG C 1 148 ? 28.139  17.844  107.386 1.00 69.18  ? 149  ARG C NE  1 
ATOM   7107  C CZ  . ARG C 1 148 ? 29.382  17.977  107.838 1.00 65.87  ? 149  ARG C CZ  1 
ATOM   7108  N NH1 . ARG C 1 148 ? 29.663  17.689  109.100 1.00 49.18  ? 149  ARG C NH1 1 
ATOM   7109  N NH2 . ARG C 1 148 ? 30.344  18.408  107.033 1.00 64.46  ? 149  ARG C NH2 1 
ATOM   7110  N N   . LEU C 1 149 ? 22.706  20.712  107.548 1.00 63.43  ? 150  LEU C N   1 
ATOM   7111  C CA  . LEU C 1 149 ? 21.367  21.032  108.039 1.00 54.79  ? 150  LEU C CA  1 
ATOM   7112  C C   . LEU C 1 149 ? 20.393  21.245  106.887 1.00 57.16  ? 150  LEU C C   1 
ATOM   7113  O O   . LEU C 1 149 ? 19.233  20.837  106.953 1.00 51.47  ? 150  LEU C O   1 
ATOM   7114  C CB  . LEU C 1 149 ? 21.405  22.281  108.921 1.00 39.18  ? 150  LEU C CB  1 
ATOM   7115  C CG  . LEU C 1 149 ? 22.063  22.137  110.293 1.00 44.06  ? 150  LEU C CG  1 
ATOM   7116  C CD1 . LEU C 1 149 ? 22.154  23.486  110.987 1.00 40.84  ? 150  LEU C CD1 1 
ATOM   7117  C CD2 . LEU C 1 149 ? 21.292  21.142  111.147 1.00 40.78  ? 150  LEU C CD2 1 
ATOM   7118  N N   . TYR C 1 150 ? 20.878  21.896  105.837 1.00 60.63  ? 151  TYR C N   1 
ATOM   7119  C CA  . TYR C 1 150 ? 20.076  22.155  104.648 1.00 60.38  ? 151  TYR C CA  1 
ATOM   7120  C C   . TYR C 1 150 ? 19.708  20.856  103.945 1.00 62.91  ? 151  TYR C C   1 
ATOM   7121  O O   . TYR C 1 150 ? 18.616  20.727  103.387 1.00 51.45  ? 151  TYR C O   1 
ATOM   7122  C CB  . TYR C 1 150 ? 20.833  23.074  103.689 1.00 66.68  ? 151  TYR C CB  1 
ATOM   7123  C CG  . TYR C 1 150 ? 20.057  23.442  102.446 1.00 76.02  ? 151  TYR C CG  1 
ATOM   7124  C CD1 . TYR C 1 150 ? 18.911  24.222  102.526 1.00 77.55  ? 151  TYR C CD1 1 
ATOM   7125  C CD2 . TYR C 1 150 ? 20.476  23.019  101.192 1.00 78.25  ? 151  TYR C CD2 1 
ATOM   7126  C CE1 . TYR C 1 150 ? 18.201  24.564  101.394 1.00 81.77  ? 151  TYR C CE1 1 
ATOM   7127  C CE2 . TYR C 1 150 ? 19.774  23.357  100.054 1.00 78.61  ? 151  TYR C CE2 1 
ATOM   7128  C CZ  . TYR C 1 150 ? 18.637  24.130  100.162 1.00 79.73  ? 151  TYR C CZ  1 
ATOM   7129  O OH  . TYR C 1 150 ? 17.932  24.472  99.034  1.00 75.05  ? 151  TYR C OH  1 
ATOM   7130  N N   . TYR C 1 151 ? 20.628  19.898  103.973 1.00 72.13  ? 152  TYR C N   1 
ATOM   7131  C CA  . TYR C 1 151 ? 20.369  18.582  103.407 1.00 61.32  ? 152  TYR C CA  1 
ATOM   7132  C C   . TYR C 1 151 ? 19.330  17.829  104.228 1.00 56.00  ? 152  TYR C C   1 
ATOM   7133  O O   . TYR C 1 151 ? 18.491  17.124  103.672 1.00 63.69  ? 152  TYR C O   1 
ATOM   7134  C CB  . TYR C 1 151 ? 21.654  17.757  103.315 1.00 52.51  ? 152  TYR C CB  1 
ATOM   7135  C CG  . TYR C 1 151 ? 21.408  16.289  103.026 1.00 49.26  ? 152  TYR C CG  1 
ATOM   7136  C CD1 . TYR C 1 151 ? 21.084  15.855  101.746 1.00 47.35  ? 152  TYR C CD1 1 
ATOM   7137  C CD2 . TYR C 1 151 ? 21.491  15.340  104.036 1.00 49.48  ? 152  TYR C CD2 1 
ATOM   7138  C CE1 . TYR C 1 151 ? 20.853  14.515  101.480 1.00 45.39  ? 152  TYR C CE1 1 
ATOM   7139  C CE2 . TYR C 1 151 ? 21.262  14.001  103.781 1.00 53.40  ? 152  TYR C CE2 1 
ATOM   7140  C CZ  . TYR C 1 151 ? 20.944  13.593  102.501 1.00 52.75  ? 152  TYR C CZ  1 
ATOM   7141  O OH  . TYR C 1 151 ? 20.717  12.259  102.242 1.00 48.78  ? 152  TYR C OH  1 
ATOM   7142  N N   . ARG C 1 152 ? 19.378  17.982  105.549 1.00 52.87  ? 153  ARG C N   1 
ATOM   7143  C CA  . ARG C 1 152 ? 18.437  17.271  106.413 1.00 57.06  ? 153  ARG C CA  1 
ATOM   7144  C C   . ARG C 1 152 ? 17.090  17.984  106.503 1.00 59.98  ? 153  ARG C C   1 
ATOM   7145  O O   . ARG C 1 152 ? 16.186  17.524  107.200 1.00 60.23  ? 153  ARG C O   1 
ATOM   7146  C CB  . ARG C 1 152 ? 19.016  17.063  107.815 1.00 65.16  ? 153  ARG C CB  1 
ATOM   7147  C CG  . ARG C 1 152 ? 20.232  16.153  107.873 1.00 83.20  ? 153  ARG C CG  1 
ATOM   7148  C CD  . ARG C 1 152 ? 20.486  15.675  109.296 1.00 96.04  ? 153  ARG C CD  1 
ATOM   7149  N NE  . ARG C 1 152 ? 20.515  16.777  110.255 1.00 110.90 ? 153  ARG C NE  1 
ATOM   7150  C CZ  . ARG C 1 152 ? 20.749  16.630  111.556 1.00 112.69 ? 153  ARG C CZ  1 
ATOM   7151  N NH1 . ARG C 1 152 ? 20.979  15.424  112.057 1.00 112.54 ? 153  ARG C NH1 1 
ATOM   7152  N NH2 . ARG C 1 152 ? 20.757  17.688  112.357 1.00 109.54 ? 153  ARG C NH2 1 
ATOM   7153  N N   . GLY C 1 153 ? 16.966  19.115  105.815 1.00 70.98  ? 154  GLY C N   1 
ATOM   7154  C CA  . GLY C 1 153 ? 15.714  19.851  105.779 1.00 74.72  ? 154  GLY C CA  1 
ATOM   7155  C C   . GLY C 1 153 ? 15.421  20.646  107.039 1.00 82.81  ? 154  GLY C C   1 
ATOM   7156  O O   . GLY C 1 153 ? 14.391  21.316  107.132 1.00 84.12  ? 154  GLY C O   1 
ATOM   7157  N N   . ALA C 1 154 ? 16.327  20.580  108.011 1.00 86.19  ? 155  ALA C N   1 
ATOM   7158  C CA  . ALA C 1 154 ? 16.158  21.307  109.266 1.00 85.74  ? 155  ALA C CA  1 
ATOM   7159  C C   . ALA C 1 154 ? 16.243  22.814  109.051 1.00 84.56  ? 155  ALA C C   1 
ATOM   7160  O O   . ALA C 1 154 ? 15.782  23.596  109.882 1.00 86.42  ? 155  ALA C O   1 
ATOM   7161  C CB  . ALA C 1 154 ? 17.190  20.856  110.292 1.00 88.99  ? 155  ALA C CB  1 
ATOM   7162  N N   . ASN C 1 155 ? 16.838  23.211  107.931 1.00 85.93  ? 156  ASN C N   1 
ATOM   7163  C CA  . ASN C 1 155 ? 16.950  24.618  107.573 1.00 97.89  ? 156  ASN C CA  1 
ATOM   7164  C C   . ASN C 1 155 ? 16.150  24.933  106.313 1.00 104.36 ? 156  ASN C C   1 
ATOM   7165  O O   . ASN C 1 155 ? 16.271  24.248  105.296 1.00 95.44  ? 156  ASN C O   1 
ATOM   7166  C CB  . ASN C 1 155 ? 18.416  25.013  107.395 1.00 96.71  ? 156  ASN C CB  1 
ATOM   7167  C CG  . ASN C 1 155 ? 18.594  26.499  107.167 1.00 93.52  ? 156  ASN C CG  1 
ATOM   7168  O OD1 . ASN C 1 155 ? 17.686  27.292  107.416 1.00 99.79  ? 156  ASN C OD1 1 
ATOM   7169  N ND2 . ASN C 1 155 ? 19.773  26.887  106.695 1.00 87.10  ? 156  ASN C ND2 1 
ATOM   7170  N N   . LEU C 1 156 ? 15.327  25.972  106.398 1.00 119.31 ? 157  LEU C N   1 
ATOM   7171  C CA  . LEU C 1 156 ? 14.421  26.335  105.314 1.00 127.80 ? 157  LEU C CA  1 
ATOM   7172  C C   . LEU C 1 156 ? 15.111  26.945  104.093 1.00 125.42 ? 157  LEU C C   1 
ATOM   7173  O O   . LEU C 1 156 ? 14.927  26.469  102.971 1.00 122.14 ? 157  LEU C O   1 
ATOM   7174  C CB  . LEU C 1 156 ? 13.342  27.288  105.831 1.00 135.91 ? 157  LEU C CB  1 
ATOM   7175  C CG  . LEU C 1 156 ? 12.583  26.822  107.076 1.00 132.24 ? 157  LEU C CG  1 
ATOM   7176  C CD1 . LEU C 1 156 ? 11.620  27.900  107.559 1.00 135.71 ? 157  LEU C CD1 1 
ATOM   7177  C CD2 . LEU C 1 156 ? 11.845  25.519  106.807 1.00 119.15 ? 157  LEU C CD2 1 
ATOM   7178  N N   . HIS C 1 157 ? 15.902  27.993  104.310 1.00 123.38 ? 158  HIS C N   1 
ATOM   7179  C CA  . HIS C 1 157 ? 16.482  28.745  103.198 1.00 122.94 ? 158  HIS C CA  1 
ATOM   7180  C C   . HIS C 1 157 ? 18.010  28.817  103.241 1.00 119.21 ? 158  HIS C C   1 
ATOM   7181  O O   . HIS C 1 157 ? 18.601  29.215  104.246 1.00 123.46 ? 158  HIS C O   1 
ATOM   7182  C CB  . HIS C 1 157 ? 15.872  30.147  103.137 1.00 131.99 ? 158  HIS C CB  1 
ATOM   7183  C CG  . HIS C 1 157 ? 14.378  30.146  103.051 1.00 131.92 ? 158  HIS C CG  1 
ATOM   7184  N ND1 . HIS C 1 157 ? 13.569  30.293  104.157 1.00 129.27 ? 158  HIS C ND1 1 
ATOM   7185  C CD2 . HIS C 1 157 ? 13.546  30.009  101.992 1.00 126.04 ? 158  HIS C CD2 1 
ATOM   7186  C CE1 . HIS C 1 157 ? 12.303  30.253  103.782 1.00 125.44 ? 158  HIS C CE1 1 
ATOM   7187  N NE2 . HIS C 1 157 ? 12.262  30.081  102.473 1.00 123.87 ? 158  HIS C NE2 1 
ATOM   7188  N N   . LEU C 1 158 ? 18.631  28.437  102.129 1.00 115.47 ? 159  LEU C N   1 
ATOM   7189  C CA  . LEU C 1 158 ? 20.083  28.352  102.015 1.00 112.86 ? 159  LEU C CA  1 
ATOM   7190  C C   . LEU C 1 158 ? 20.768  29.699  101.716 1.00 119.45 ? 159  LEU C C   1 
ATOM   7191  O O   . LEU C 1 158 ? 21.873  29.977  102.220 1.00 125.58 ? 159  LEU C O   1 
ATOM   7192  C CB  . LEU C 1 158 ? 20.438  27.351  100.918 1.00 101.31 ? 159  LEU C CB  1 
ATOM   7193  C CG  . LEU C 1 158 ? 21.910  26.952  100.778 1.00 93.28  ? 159  LEU C CG  1 
ATOM   7194  C CD1 . LEU C 1 158 ? 22.370  26.183  102.007 1.00 86.30  ? 159  LEU C CD1 1 
ATOM   7195  C CD2 . LEU C 1 158 ? 22.107  26.134  99.521  1.00 90.22  ? 159  LEU C CD2 1 
ATOM   7196  N N   . GLU C 1 159 ? 20.109  30.531  100.906 1.00 120.39 ? 160  GLU C N   1 
ATOM   7197  C CA  . GLU C 1 159 ? 20.728  31.739  100.355 1.00 126.51 ? 160  GLU C CA  1 
ATOM   7198  C C   . GLU C 1 159 ? 21.218  32.738  101.405 1.00 117.11 ? 160  GLU C C   1 
ATOM   7199  O O   . GLU C 1 159 ? 22.290  33.326  101.248 1.00 114.60 ? 160  GLU C O   1 
ATOM   7200  C CB  . GLU C 1 159 ? 19.786  32.431  99.365  1.00 140.63 ? 160  GLU C CB  1 
ATOM   7201  C CG  . GLU C 1 159 ? 20.416  33.628  98.651  1.00 146.41 ? 160  GLU C CG  1 
ATOM   7202  C CD  . GLU C 1 159 ? 19.461  34.323  97.700  1.00 144.82 ? 160  GLU C CD  1 
ATOM   7203  O OE1 . GLU C 1 159 ? 19.289  33.833  96.564  1.00 141.77 ? 160  GLU C OE1 1 
ATOM   7204  O OE2 . GLU C 1 159 ? 18.882  35.358  98.092  1.00 143.12 ? 160  GLU C OE2 1 
ATOM   7205  N N   . GLU C 1 160 ? 20.437  32.937  102.464 1.00 110.76 ? 161  GLU C N   1 
ATOM   7206  C CA  . GLU C 1 160 ? 20.827  33.866  103.522 1.00 120.27 ? 161  GLU C CA  1 
ATOM   7207  C C   . GLU C 1 160 ? 22.099  33.383  104.219 1.00 119.68 ? 161  GLU C C   1 
ATOM   7208  O O   . GLU C 1 160 ? 23.006  34.171  104.512 1.00 121.01 ? 161  GLU C O   1 
ATOM   7209  C CB  . GLU C 1 160 ? 19.690  34.053  104.533 1.00 125.82 ? 161  GLU C CB  1 
ATOM   7210  C CG  . GLU C 1 160 ? 19.901  35.214  105.504 1.00 132.82 ? 161  GLU C CG  1 
ATOM   7211  C CD  . GLU C 1 160 ? 18.678  35.502  106.357 1.00 136.65 ? 161  GLU C CD  1 
ATOM   7212  O OE1 . GLU C 1 160 ? 17.786  34.631  106.436 1.00 132.90 ? 161  GLU C OE1 1 
ATOM   7213  O OE2 . GLU C 1 160 ? 18.608  36.603  106.946 1.00 140.73 ? 161  GLU C OE2 1 
ATOM   7214  N N   . THR C 1 161 ? 22.161  32.076  104.462 1.00 108.90 ? 162  THR C N   1 
ATOM   7215  C CA  . THR C 1 161 ? 23.323  31.456  105.085 1.00 94.80  ? 162  THR C CA  1 
ATOM   7216  C C   . THR C 1 161 ? 24.559  31.604  104.204 1.00 94.07  ? 162  THR C C   1 
ATOM   7217  O O   . THR C 1 161 ? 25.631  31.979  104.686 1.00 108.18 ? 162  THR C O   1 
ATOM   7218  C CB  . THR C 1 161 ? 23.079  29.961  105.371 1.00 85.42  ? 162  THR C CB  1 
ATOM   7219  O OG1 . THR C 1 161 ? 22.804  29.271  104.146 1.00 91.06  ? 162  THR C OG1 1 
ATOM   7220  C CG2 . THR C 1 161 ? 21.902  29.792  106.313 1.00 77.08  ? 162  THR C CG2 1 
ATOM   7221  N N   . LEU C 1 162 ? 24.408  31.319  102.914 1.00 78.14  ? 163  LEU C N   1 
ATOM   7222  C CA  . LEU C 1 162 ? 25.526  31.445  101.979 1.00 70.87  ? 163  LEU C CA  1 
ATOM   7223  C C   . LEU C 1 162 ? 26.038  32.881  101.857 1.00 85.76  ? 163  LEU C C   1 
ATOM   7224  O O   . LEU C 1 162 ? 27.248  33.127  101.901 1.00 78.08  ? 163  LEU C O   1 
ATOM   7225  C CB  . LEU C 1 162 ? 25.147  30.895  100.604 1.00 60.55  ? 163  LEU C CB  1 
ATOM   7226  C CG  . LEU C 1 162 ? 25.363  29.394  100.408 1.00 70.70  ? 163  LEU C CG  1 
ATOM   7227  C CD1 . LEU C 1 162 ? 24.785  28.937  99.079  1.00 65.41  ? 163  LEU C CD1 1 
ATOM   7228  C CD2 . LEU C 1 162 ? 26.845  29.059  100.492 1.00 68.63  ? 163  LEU C CD2 1 
ATOM   7229  N N   . ALA C 1 163 ? 25.113  33.824  101.711 1.00 96.81  ? 164  ALA C N   1 
ATOM   7230  C CA  . ALA C 1 163 ? 25.466  35.234  101.612 1.00 93.78  ? 164  ALA C CA  1 
ATOM   7231  C C   . ALA C 1 163 ? 26.188  35.703  102.871 1.00 93.00  ? 164  ALA C C   1 
ATOM   7232  O O   . ALA C 1 163 ? 27.199  36.409  102.796 1.00 95.86  ? 164  ALA C O   1 
ATOM   7233  C CB  . ALA C 1 163 ? 24.223  36.075  101.366 1.00 90.10  ? 164  ALA C CB  1 
ATOM   7234  N N   . GLU C 1 164 ? 25.665  35.303  104.025 1.00 87.75  ? 165  GLU C N   1 
ATOM   7235  C CA  . GLU C 1 164 ? 26.267  35.666  105.302 1.00 87.35  ? 165  GLU C CA  1 
ATOM   7236  C C   . GLU C 1 164 ? 27.686  35.108  105.381 1.00 83.04  ? 165  GLU C C   1 
ATOM   7237  O O   . GLU C 1 164 ? 28.622  35.798  105.815 1.00 78.96  ? 165  GLU C O   1 
ATOM   7238  C CB  . GLU C 1 164 ? 25.411  35.138  106.455 1.00 88.89  ? 165  GLU C CB  1 
ATOM   7239  C CG  . GLU C 1 164 ? 25.599  35.876  107.767 1.00 102.84 ? 165  GLU C CG  1 
ATOM   7240  C CD  . GLU C 1 164 ? 24.387  35.766  108.674 1.00 116.01 ? 165  GLU C CD  1 
ATOM   7241  O OE1 . GLU C 1 164 ? 23.361  35.203  108.236 1.00 115.08 ? 165  GLU C OE1 1 
ATOM   7242  O OE2 . GLU C 1 164 ? 24.459  36.247  109.825 1.00 124.41 ? 165  GLU C OE2 1 
ATOM   7243  N N   . PHE C 1 165 ? 27.834  33.862  104.934 1.00 77.44  ? 166  PHE C N   1 
ATOM   7244  C CA  . PHE C 1 165 ? 29.133  33.204  104.879 1.00 73.66  ? 166  PHE C CA  1 
ATOM   7245  C C   . PHE C 1 165 ? 30.132  34.002  104.056 1.00 82.12  ? 166  PHE C C   1 
ATOM   7246  O O   . PHE C 1 165 ? 31.215  34.318  104.537 1.00 84.59  ? 166  PHE C O   1 
ATOM   7247  C CB  . PHE C 1 165 ? 29.012  31.791  104.306 1.00 67.02  ? 166  PHE C CB  1 
ATOM   7248  C CG  . PHE C 1 165 ? 30.331  31.195  103.896 1.00 75.29  ? 166  PHE C CG  1 
ATOM   7249  C CD1 . PHE C 1 165 ? 31.224  30.736  104.850 1.00 77.65  ? 166  PHE C CD1 1 
ATOM   7250  C CD2 . PHE C 1 165 ? 30.681  31.103  102.558 1.00 74.11  ? 166  PHE C CD2 1 
ATOM   7251  C CE1 . PHE C 1 165 ? 32.442  30.193  104.477 1.00 75.33  ? 166  PHE C CE1 1 
ATOM   7252  C CE2 . PHE C 1 165 ? 31.897  30.562  102.179 1.00 67.71  ? 166  PHE C CE2 1 
ATOM   7253  C CZ  . PHE C 1 165 ? 32.777  30.106  103.140 1.00 68.65  ? 166  PHE C CZ  1 
ATOM   7254  N N   . TRP C 1 166 ? 29.768  34.322  102.816 1.00 91.05  ? 167  TRP C N   1 
ATOM   7255  C CA  . TRP C 1 166 ? 30.668  35.067  101.937 1.00 95.38  ? 167  TRP C CA  1 
ATOM   7256  C C   . TRP C 1 166 ? 31.014  36.445  102.497 1.00 111.30 ? 167  TRP C C   1 
ATOM   7257  O O   . TRP C 1 166 ? 32.157  36.895  102.393 1.00 121.23 ? 167  TRP C O   1 
ATOM   7258  C CB  . TRP C 1 166 ? 30.076  35.206  100.532 1.00 90.27  ? 167  TRP C CB  1 
ATOM   7259  C CG  . TRP C 1 166 ? 29.967  33.912  99.788  1.00 94.21  ? 167  TRP C CG  1 
ATOM   7260  C CD1 . TRP C 1 166 ? 28.822  33.308  99.361  1.00 94.64  ? 167  TRP C CD1 1 
ATOM   7261  C CD2 . TRP C 1 166 ? 31.046  33.057  99.387  1.00 98.37  ? 167  TRP C CD2 1 
ATOM   7262  N NE1 . TRP C 1 166 ? 29.119  32.132  98.716  1.00 94.07  ? 167  TRP C NE1 1 
ATOM   7263  C CE2 . TRP C 1 166 ? 30.477  31.955  98.718  1.00 88.99  ? 167  TRP C CE2 1 
ATOM   7264  C CE3 . TRP C 1 166 ? 32.437  33.117  99.527  1.00 98.88  ? 167  TRP C CE3 1 
ATOM   7265  C CZ2 . TRP C 1 166 ? 31.249  30.922  98.191  1.00 82.07  ? 167  TRP C CZ2 1 
ATOM   7266  C CZ3 . TRP C 1 166 ? 33.201  32.088  99.002  1.00 90.94  ? 167  TRP C CZ3 1 
ATOM   7267  C CH2 . TRP C 1 166 ? 32.605  31.006  98.343  1.00 83.44  ? 167  TRP C CH2 1 
ATOM   7268  N N   . ALA C 1 167 ? 30.024  37.108  103.087 1.00 105.17 ? 168  ALA C N   1 
ATOM   7269  C CA  . ALA C 1 167 ? 30.233  38.434  103.662 1.00 104.59 ? 168  ALA C CA  1 
ATOM   7270  C C   . ALA C 1 167 ? 31.251  38.409  104.802 1.00 114.42 ? 168  ALA C C   1 
ATOM   7271  O O   . ALA C 1 167 ? 32.289  39.087  104.744 1.00 116.60 ? 168  ALA C O   1 
ATOM   7272  C CB  . ALA C 1 167 ? 28.911  39.015  104.144 1.00 96.81  ? 168  ALA C CB  1 
ATOM   7273  N N   . ARG C 1 168 ? 30.962  37.614  105.829 1.00 111.73 ? 169  ARG C N   1 
ATOM   7274  C CA  . ARG C 1 168 ? 31.847  37.548  106.989 1.00 101.56 ? 169  ARG C CA  1 
ATOM   7275  C C   . ARG C 1 168 ? 33.220  36.985  106.624 1.00 87.36  ? 169  ARG C C   1 
ATOM   7276  O O   . ARG C 1 168 ? 34.246  37.428  107.153 1.00 81.25  ? 169  ARG C O   1 
ATOM   7277  C CB  . ARG C 1 168 ? 31.198  36.763  108.133 1.00 97.90  ? 169  ARG C CB  1 
ATOM   7278  C CG  . ARG C 1 168 ? 30.406  37.651  109.086 1.00 108.06 ? 169  ARG C CG  1 
ATOM   7279  C CD  . ARG C 1 168 ? 29.068  37.042  109.477 1.00 118.49 ? 169  ARG C CD  1 
ATOM   7280  N NE  . ARG C 1 168 ? 29.215  35.873  110.337 1.00 129.53 ? 169  ARG C NE  1 
ATOM   7281  C CZ  . ARG C 1 168 ? 28.205  35.285  110.972 1.00 134.36 ? 169  ARG C CZ  1 
ATOM   7282  N NH1 . ARG C 1 168 ? 26.974  35.763  110.848 1.00 137.52 ? 169  ARG C NH1 1 
ATOM   7283  N NH2 . ARG C 1 168 ? 28.425  34.224  111.736 1.00 131.00 ? 169  ARG C NH2 1 
ATOM   7284  N N   . LEU C 1 169 ? 33.233  36.031  105.698 1.00 82.00  ? 170  LEU C N   1 
ATOM   7285  C CA  . LEU C 1 169 ? 34.484  35.482  105.192 1.00 86.08  ? 170  LEU C CA  1 
ATOM   7286  C C   . LEU C 1 169 ? 35.322  36.564  104.532 1.00 100.09 ? 170  LEU C C   1 
ATOM   7287  O O   . LEU C 1 169 ? 36.527  36.614  104.731 1.00 105.33 ? 170  LEU C O   1 
ATOM   7288  C CB  . LEU C 1 169 ? 34.239  34.349  104.195 1.00 84.17  ? 170  LEU C CB  1 
ATOM   7289  C CG  . LEU C 1 169 ? 35.497  33.816  103.505 1.00 80.47  ? 170  LEU C CG  1 
ATOM   7290  C CD1 . LEU C 1 169 ? 36.476  33.261  104.530 1.00 78.76  ? 170  LEU C CD1 1 
ATOM   7291  C CD2 . LEU C 1 169 ? 35.153  32.766  102.459 1.00 86.11  ? 170  LEU C CD2 1 
ATOM   7292  N N   . LEU C 1 170 ? 34.686  37.425  103.742 1.00 108.20 ? 171  LEU C N   1 
ATOM   7293  C CA  . LEU C 1 170 ? 35.412  38.510  103.090 1.00 111.34 ? 171  LEU C CA  1 
ATOM   7294  C C   . LEU C 1 170 ? 35.949  39.500  104.118 1.00 114.58 ? 171  LEU C C   1 
ATOM   7295  O O   . LEU C 1 170 ? 37.083  39.979  103.995 1.00 119.65 ? 171  LEU C O   1 
ATOM   7296  C CB  . LEU C 1 170 ? 34.541  39.226  102.054 1.00 105.16 ? 171  LEU C CB  1 
ATOM   7297  C CG  . LEU C 1 170 ? 35.226  40.355  101.278 1.00 99.99  ? 171  LEU C CG  1 
ATOM   7298  C CD1 . LEU C 1 170 ? 36.564  39.894  100.711 1.00 93.62  ? 171  LEU C CD1 1 
ATOM   7299  C CD2 . LEU C 1 170 ? 34.324  40.869  100.167 1.00 99.17  ? 171  LEU C CD2 1 
ATOM   7300  N N   . GLU C 1 171 ? 35.138  39.797  105.133 1.00 104.17 ? 172  GLU C N   1 
ATOM   7301  C CA  . GLU C 1 171 ? 35.577  40.679  106.213 1.00 90.06  ? 172  GLU C CA  1 
ATOM   7302  C C   . GLU C 1 171 ? 36.845  40.151  106.884 1.00 97.64  ? 172  GLU C C   1 
ATOM   7303  O O   . GLU C 1 171 ? 37.873  40.840  106.927 1.00 102.37 ? 172  GLU C O   1 
ATOM   7304  C CB  . GLU C 1 171 ? 34.471  40.851  107.256 1.00 80.52  ? 172  GLU C CB  1 
ATOM   7305  C CG  . GLU C 1 171 ? 33.184  41.442  106.712 1.00 95.88  ? 172  GLU C CG  1 
ATOM   7306  C CD  . GLU C 1 171 ? 32.120  41.595  107.780 1.00 105.46 ? 172  GLU C CD  1 
ATOM   7307  O OE1 . GLU C 1 171 ? 32.468  41.981  108.917 1.00 102.17 ? 172  GLU C OE1 1 
ATOM   7308  O OE2 . GLU C 1 171 ? 30.937  41.326  107.484 1.00 106.30 ? 172  GLU C OE2 1 
ATOM   7309  N N   . ARG C 1 172 ? 36.772  38.921  107.390 1.00 102.77 ? 173  ARG C N   1 
ATOM   7310  C CA  . ARG C 1 172 ? 37.917  38.300  108.050 1.00 100.58 ? 173  ARG C CA  1 
ATOM   7311  C C   . ARG C 1 172 ? 39.127  38.213  107.121 1.00 99.47  ? 173  ARG C C   1 
ATOM   7312  O O   . ARG C 1 172 ? 40.234  38.603  107.492 1.00 101.66 ? 173  ARG C O   1 
ATOM   7313  C CB  . ARG C 1 172 ? 37.558  36.899  108.556 1.00 102.04 ? 173  ARG C CB  1 
ATOM   7314  C CG  . ARG C 1 172 ? 36.348  36.847  109.477 1.00 99.06  ? 173  ARG C CG  1 
ATOM   7315  C CD  . ARG C 1 172 ? 36.054  35.421  109.940 1.00 80.63  ? 173  ARG C CD  1 
ATOM   7316  N NE  . ARG C 1 172 ? 36.810  35.055  111.136 1.00 79.34  ? 173  ARG C NE  1 
ATOM   7317  C CZ  . ARG C 1 172 ? 37.976  34.416  111.127 1.00 81.66  ? 173  ARG C CZ  1 
ATOM   7318  N NH1 . ARG C 1 172 ? 38.536  34.062  109.978 1.00 88.42  ? 173  ARG C NH1 1 
ATOM   7319  N NH2 . ARG C 1 172 ? 38.585  34.130  112.269 1.00 76.27  ? 173  ARG C NH2 1 
ATOM   7320  N N   . LEU C 1 173 ? 38.898  37.711  105.910 1.00 98.49  ? 174  LEU C N   1 
ATOM   7321  C CA  . LEU C 1 173 ? 39.955  37.483  104.927 1.00 102.99 ? 174  LEU C CA  1 
ATOM   7322  C C   . LEU C 1 173 ? 40.717  38.764  104.611 1.00 113.43 ? 174  LEU C C   1 
ATOM   7323  O O   . LEU C 1 173 ? 41.944  38.767  104.598 1.00 119.41 ? 174  LEU C O   1 
ATOM   7324  C CB  . LEU C 1 173 ? 39.370  36.889  103.638 1.00 101.67 ? 174  LEU C CB  1 
ATOM   7325  C CG  . LEU C 1 173 ? 40.243  36.029  102.714 1.00 101.61 ? 174  LEU C CG  1 
ATOM   7326  C CD1 . LEU C 1 173 ? 41.298  36.848  101.974 1.00 107.77 ? 174  LEU C CD1 1 
ATOM   7327  C CD2 . LEU C 1 173 ? 40.892  34.886  103.485 1.00 98.53  ? 174  LEU C CD2 1 
ATOM   7328  N N   . PHE C 1 174 ? 39.993  39.848  104.348 1.00 115.12 ? 175  PHE C N   1 
ATOM   7329  C CA  . PHE C 1 174 ? 40.647  41.111  104.029 1.00 114.43 ? 175  PHE C CA  1 
ATOM   7330  C C   . PHE C 1 174 ? 41.341  41.690  105.258 1.00 108.47 ? 175  PHE C C   1 
ATOM   7331  O O   . PHE C 1 174 ? 42.460  42.223  105.159 1.00 105.64 ? 175  PHE C O   1 
ATOM   7332  C CB  . PHE C 1 174 ? 39.647  42.121  103.471 1.00 115.07 ? 175  PHE C CB  1 
ATOM   7333  C CG  . PHE C 1 174 ? 40.292  43.275  102.761 1.00 114.05 ? 175  PHE C CG  1 
ATOM   7334  C CD1 . PHE C 1 174 ? 40.743  43.138  101.457 1.00 112.92 ? 175  PHE C CD1 1 
ATOM   7335  C CD2 . PHE C 1 174 ? 40.449  44.494  103.394 1.00 115.60 ? 175  PHE C CD2 1 
ATOM   7336  C CE1 . PHE C 1 174 ? 41.339  44.198  100.800 1.00 118.57 ? 175  PHE C CE1 1 
ATOM   7337  C CE2 . PHE C 1 174 ? 41.044  45.558  102.744 1.00 118.59 ? 175  PHE C CE2 1 
ATOM   7338  C CZ  . PHE C 1 174 ? 41.489  45.411  101.445 1.00 120.62 ? 175  PHE C CZ  1 
ATOM   7339  N N   . LYS C 1 175 ? 40.682  41.579  106.411 1.00 101.31 ? 176  LYS C N   1 
ATOM   7340  C CA  . LYS C 1 175 ? 41.237  42.101  107.654 1.00 94.51  ? 176  LYS C CA  1 
ATOM   7341  C C   . LYS C 1 175 ? 42.565  41.427  107.996 1.00 95.98  ? 176  LYS C C   1 
ATOM   7342  O O   . LYS C 1 175 ? 43.457  42.053  108.566 1.00 72.46  ? 176  LYS C O   1 
ATOM   7343  C CB  . LYS C 1 175 ? 40.235  41.945  108.798 1.00 82.87  ? 176  LYS C CB  1 
ATOM   7344  C CG  . LYS C 1 175 ? 40.667  42.614  110.094 1.00 84.79  ? 176  LYS C CG  1 
ATOM   7345  C CD  . LYS C 1 175 ? 39.484  42.890  111.009 1.00 84.27  ? 176  LYS C CD  1 
ATOM   7346  C CE  . LYS C 1 175 ? 38.727  41.616  111.348 1.00 78.00  ? 176  LYS C CE  1 
ATOM   7347  N NZ  . LYS C 1 175 ? 37.562  41.888  112.237 1.00 76.42  ? 176  LYS C NZ  1 
ATOM   7348  N N   . GLN C 1 176 ? 42.687  40.150  107.641 1.00 115.54 ? 177  GLN C N   1 
ATOM   7349  C CA  . GLN C 1 176 ? 43.935  39.416  107.826 1.00 127.23 ? 177  GLN C CA  1 
ATOM   7350  C C   . GLN C 1 176 ? 44.934  39.764  106.730 1.00 132.34 ? 177  GLN C C   1 
ATOM   7351  O O   . GLN C 1 176 ? 46.130  39.897  106.987 1.00 131.85 ? 177  GLN C O   1 
ATOM   7352  C CB  . GLN C 1 176 ? 43.679  37.909  107.801 1.00 131.46 ? 177  GLN C CB  1 
ATOM   7353  C CG  . GLN C 1 176 ? 42.743  37.408  108.880 1.00 135.28 ? 177  GLN C CG  1 
ATOM   7354  C CD  . GLN C 1 176 ? 42.129  36.068  108.529 1.00 133.45 ? 177  GLN C CD  1 
ATOM   7355  O OE1 . GLN C 1 176 ? 42.573  35.392  107.599 1.00 133.35 ? 177  GLN C OE1 1 
ATOM   7356  N NE2 . GLN C 1 176 ? 41.097  35.678  109.267 1.00 131.50 ? 177  GLN C NE2 1 
ATOM   7357  N N   . LEU C 1 177 ? 44.426  39.896  105.507 1.00 137.23 ? 178  LEU C N   1 
ATOM   7358  C CA  . LEU C 1 177 ? 45.251  40.152  104.332 1.00 134.86 ? 178  LEU C CA  1 
ATOM   7359  C C   . LEU C 1 177 ? 46.073  41.414  104.542 1.00 143.33 ? 178  LEU C C   1 
ATOM   7360  O O   . LEU C 1 177 ? 47.289  41.408  104.340 1.00 141.64 ? 178  LEU C O   1 
ATOM   7361  C CB  . LEU C 1 177 ? 44.375  40.292  103.084 1.00 118.14 ? 178  LEU C CB  1 
ATOM   7362  C CG  . LEU C 1 177 ? 44.960  39.931  101.714 1.00 100.33 ? 178  LEU C CG  1 
ATOM   7363  C CD1 . LEU C 1 177 ? 43.828  39.683  100.733 1.00 78.96  ? 178  LEU C CD1 1 
ATOM   7364  C CD2 . LEU C 1 177 ? 45.893  41.011  101.180 1.00 108.16 ? 178  LEU C CD2 1 
ATOM   7365  N N   . HIS C 1 178 ? 45.406  42.499  104.930 1.00 150.58 ? 179  HIS C N   1 
ATOM   7366  C CA  . HIS C 1 178 ? 46.122  43.699  105.347 1.00 154.58 ? 179  HIS C CA  1 
ATOM   7367  C C   . HIS C 1 178 ? 45.842  43.988  106.822 1.00 151.39 ? 179  HIS C C   1 
ATOM   7368  O O   . HIS C 1 178 ? 44.743  44.417  107.181 1.00 149.02 ? 179  HIS C O   1 
ATOM   7369  C CB  . HIS C 1 178 ? 45.755  44.892  104.460 1.00 157.28 ? 179  HIS C CB  1 
ATOM   7370  C CG  . HIS C 1 178 ? 46.128  44.710  103.019 1.00 158.00 ? 179  HIS C CG  1 
ATOM   7371  N ND1 . HIS C 1 178 ? 47.437  44.608  102.596 1.00 158.39 ? 179  HIS C ND1 1 
ATOM   7372  C CD2 . HIS C 1 178 ? 45.365  44.615  101.904 1.00 156.21 ? 179  HIS C CD2 1 
ATOM   7373  C CE1 . HIS C 1 178 ? 47.463  44.454  101.284 1.00 157.98 ? 179  HIS C CE1 1 
ATOM   7374  N NE2 . HIS C 1 178 ? 46.219  44.455  100.839 1.00 156.59 ? 179  HIS C NE2 1 
ATOM   7375  N N   . PRO C 1 179 ? 46.846  43.746  107.680 1.00 149.06 ? 180  PRO C N   1 
ATOM   7376  C CA  . PRO C 1 179 ? 46.742  43.915  109.133 1.00 149.43 ? 180  PRO C CA  1 
ATOM   7377  C C   . PRO C 1 179 ? 46.441  45.356  109.534 1.00 156.25 ? 180  PRO C C   1 
ATOM   7378  O O   . PRO C 1 179 ? 45.414  45.590  110.174 1.00 155.93 ? 180  PRO C O   1 
ATOM   7379  C CB  . PRO C 1 179 ? 48.135  43.511  109.628 1.00 145.36 ? 180  PRO C CB  1 
ATOM   7380  C CG  . PRO C 1 179 ? 48.657  42.598  108.576 1.00 143.04 ? 180  PRO C CG  1 
ATOM   7381  C CD  . PRO C 1 179 ? 48.144  43.170  107.290 1.00 144.94 ? 180  PRO C CD  1 
ATOM   7382  N N   . GLU C 1 196 ? 29.991  47.492  99.849  1.00 131.90 ? 197  GLU C N   1 
ATOM   7383  C CA  . GLU C 1 196 ? 30.374  47.352  98.450  1.00 133.44 ? 197  GLU C CA  1 
ATOM   7384  C C   . GLU C 1 196 ? 30.138  45.924  97.966  1.00 134.34 ? 197  GLU C C   1 
ATOM   7385  O O   . GLU C 1 196 ? 30.467  44.960  98.659  1.00 128.04 ? 197  GLU C O   1 
ATOM   7386  C CB  . GLU C 1 196 ? 31.840  47.753  98.254  1.00 129.11 ? 197  GLU C CB  1 
ATOM   7387  C CG  . GLU C 1 196 ? 32.263  47.940  96.801  1.00 122.98 ? 197  GLU C CG  1 
ATOM   7388  C CD  . GLU C 1 196 ? 32.621  46.636  96.112  1.00 114.93 ? 197  GLU C CD  1 
ATOM   7389  O OE1 . GLU C 1 196 ? 32.931  45.653  96.818  1.00 109.88 ? 197  GLU C OE1 1 
ATOM   7390  O OE2 . GLU C 1 196 ? 32.592  46.593  94.865  1.00 108.19 ? 197  GLU C OE2 1 
ATOM   7391  N N   . ALA C 1 197 ? 29.570  45.798  96.771  1.00 138.64 ? 198  ALA C N   1 
ATOM   7392  C CA  . ALA C 1 197 ? 29.281  44.492  96.191  1.00 130.76 ? 198  ALA C CA  1 
ATOM   7393  C C   . ALA C 1 197 ? 29.754  44.400  94.742  1.00 137.43 ? 198  ALA C C   1 
ATOM   7394  O O   . ALA C 1 197 ? 29.364  45.201  93.892  1.00 143.32 ? 198  ALA C O   1 
ATOM   7395  C CB  . ALA C 1 197 ? 27.794  44.185  96.290  1.00 118.67 ? 198  ALA C CB  1 
ATOM   7396  N N   . LEU C 1 198 ? 30.597  43.409  94.477  1.00 134.41 ? 199  LEU C N   1 
ATOM   7397  C CA  . LEU C 1 198 ? 31.173  43.180  93.157  1.00 134.92 ? 199  LEU C CA  1 
ATOM   7398  C C   . LEU C 1 198 ? 31.536  41.705  93.087  1.00 140.41 ? 199  LEU C C   1 
ATOM   7399  O O   . LEU C 1 198 ? 31.048  40.917  93.896  1.00 147.22 ? 199  LEU C O   1 
ATOM   7400  C CB  . LEU C 1 198 ? 32.393  44.069  92.913  1.00 127.87 ? 199  LEU C CB  1 
ATOM   7401  C CG  . LEU C 1 198 ? 32.543  44.553  91.468  1.00 120.83 ? 199  LEU C CG  1 
ATOM   7402  C CD1 . LEU C 1 198 ? 31.267  45.242  91.004  1.00 119.00 ? 199  LEU C CD1 1 
ATOM   7403  C CD2 . LEU C 1 198 ? 33.739  45.481  91.327  1.00 115.20 ? 199  LEU C CD2 1 
ATOM   7404  N N   . ARG C 1 199 ? 32.360  41.315  92.120  1.00 137.69 ? 200  ARG C N   1 
ATOM   7405  C CA  . ARG C 1 199 ? 32.738  39.910  91.990  1.00 126.67 ? 200  ARG C CA  1 
ATOM   7406  C C   . ARG C 1 199 ? 34.231  39.677  92.234  1.00 116.85 ? 200  ARG C C   1 
ATOM   7407  O O   . ARG C 1 199 ? 34.977  39.398  91.295  1.00 110.73 ? 200  ARG C O   1 
ATOM   7408  C CB  . ARG C 1 199 ? 32.367  39.396  90.593  1.00 124.19 ? 200  ARG C CB  1 
ATOM   7409  C CG  . ARG C 1 199 ? 31.085  38.573  90.522  1.00 120.84 ? 200  ARG C CG  1 
ATOM   7410  C CD  . ARG C 1 199 ? 29.996  39.143  91.415  1.00 121.86 ? 200  ARG C CD  1 
ATOM   7411  N NE  . ARG C 1 199 ? 28.710  39.251  90.733  1.00 125.51 ? 200  ARG C NE  1 
ATOM   7412  C CZ  . ARG C 1 199 ? 28.143  40.403  90.388  1.00 130.53 ? 200  ARG C CZ  1 
ATOM   7413  N NH1 . ARG C 1 199 ? 28.745  41.552  90.664  1.00 127.38 ? 200  ARG C NH1 1 
ATOM   7414  N NH2 . ARG C 1 199 ? 26.969  40.407  89.771  1.00 132.72 ? 200  ARG C NH2 1 
ATOM   7415  N N   . PRO C 1 200 ? 34.673  39.794  93.502  1.00 114.85 ? 201  PRO C N   1 
ATOM   7416  C CA  . PRO C 1 200 ? 36.046  39.429  93.863  1.00 115.87 ? 201  PRO C CA  1 
ATOM   7417  C C   . PRO C 1 200 ? 36.247  37.914  93.917  1.00 132.29 ? 201  PRO C C   1 
ATOM   7418  O O   . PRO C 1 200 ? 37.365  37.440  93.724  1.00 145.23 ? 201  PRO C O   1 
ATOM   7419  C CB  . PRO C 1 200 ? 36.232  40.065  95.245  1.00 104.61 ? 201  PRO C CB  1 
ATOM   7420  C CG  . PRO C 1 200 ? 34.848  40.300  95.780  1.00 108.44 ? 201  PRO C CG  1 
ATOM   7421  C CD  . PRO C 1 200 ? 33.844  39.999  94.701  1.00 112.02 ? 201  PRO C CD  1 
ATOM   7422  N N   . PHE C 1 201 ? 35.172  37.175  94.185  1.00 124.41 ? 202  PHE C N   1 
ATOM   7423  C CA  . PHE C 1 201 ? 35.243  35.726  94.338  1.00 112.48 ? 202  PHE C CA  1 
ATOM   7424  C C   . PHE C 1 201 ? 35.021  34.973  93.026  1.00 117.53 ? 202  PHE C C   1 
ATOM   7425  O O   . PHE C 1 201 ? 35.055  33.743  93.002  1.00 119.13 ? 202  PHE C O   1 
ATOM   7426  C CB  . PHE C 1 201 ? 34.240  35.246  95.393  1.00 98.46  ? 202  PHE C CB  1 
ATOM   7427  C CG  . PHE C 1 201 ? 34.645  35.556  96.808  1.00 89.09  ? 202  PHE C CG  1 
ATOM   7428  C CD1 . PHE C 1 201 ? 35.631  34.813  97.436  1.00 78.46  ? 202  PHE C CD1 1 
ATOM   7429  C CD2 . PHE C 1 201 ? 34.030  36.579  97.515  1.00 88.11  ? 202  PHE C CD2 1 
ATOM   7430  C CE1 . PHE C 1 201 ? 36.005  35.088  98.738  1.00 73.79  ? 202  PHE C CE1 1 
ATOM   7431  C CE2 . PHE C 1 201 ? 34.400  36.859  98.819  1.00 83.19  ? 202  PHE C CE2 1 
ATOM   7432  C CZ  . PHE C 1 201 ? 35.389  36.112  99.430  1.00 77.51  ? 202  PHE C CZ  1 
ATOM   7433  N N   . GLY C 1 202 ? 34.799  35.709  91.941  1.00 123.06 ? 203  GLY C N   1 
ATOM   7434  C CA  . GLY C 1 202 ? 34.616  35.108  90.630  1.00 131.04 ? 203  GLY C CA  1 
ATOM   7435  C C   . GLY C 1 202 ? 33.240  34.514  90.385  1.00 137.77 ? 203  GLY C C   1 
ATOM   7436  O O   . GLY C 1 202 ? 32.231  35.041  90.858  1.00 143.41 ? 203  GLY C O   1 
ATOM   7437  N N   . GLU C 1 203 ? 33.206  33.416  89.631  1.00 136.62 ? 204  GLU C N   1 
ATOM   7438  C CA  . GLU C 1 203 ? 31.961  32.720  89.303  1.00 138.79 ? 204  GLU C CA  1 
ATOM   7439  C C   . GLU C 1 203 ? 31.578  31.723  90.390  1.00 138.69 ? 204  GLU C C   1 
ATOM   7440  O O   . GLU C 1 203 ? 30.483  31.139  90.361  1.00 139.85 ? 204  GLU C O   1 
ATOM   7441  C CB  . GLU C 1 203 ? 32.094  31.973  87.974  1.00 138.59 ? 204  GLU C CB  1 
ATOM   7442  C CG  . GLU C 1 203 ? 32.013  32.866  86.749  1.00 141.67 ? 204  GLU C CG  1 
ATOM   7443  C CD  . GLU C 1 203 ? 30.620  33.419  86.522  1.00 142.60 ? 204  GLU C CD  1 
ATOM   7444  O OE1 . GLU C 1 203 ? 29.633  32.679  86.735  1.00 142.22 ? 204  GLU C OE1 1 
ATOM   7445  O OE2 . GLU C 1 203 ? 30.517  34.600  86.130  1.00 141.69 ? 204  GLU C OE2 1 
ATOM   7446  N N   . ALA C 1 204 ? 32.487  31.526  91.340  1.00 138.27 ? 205  ALA C N   1 
ATOM   7447  C CA  . ALA C 1 204 ? 32.281  30.576  92.427  1.00 135.88 ? 205  ALA C CA  1 
ATOM   7448  C C   . ALA C 1 204 ? 31.010  30.792  93.269  1.00 132.77 ? 205  ALA C C   1 
ATOM   7449  O O   . ALA C 1 204 ? 30.313  29.823  93.558  1.00 136.05 ? 205  ALA C O   1 
ATOM   7450  C CB  . ALA C 1 204 ? 33.526  30.496  93.312  1.00 137.59 ? 205  ALA C CB  1 
ATOM   7451  N N   . PRO C 1 205 ? 30.713  32.045  93.681  1.00 123.57 ? 206  PRO C N   1 
ATOM   7452  C CA  . PRO C 1 205 ? 29.497  32.229  94.486  1.00 117.16 ? 206  PRO C CA  1 
ATOM   7453  C C   . PRO C 1 205 ? 28.225  31.812  93.748  1.00 116.00 ? 206  PRO C C   1 
ATOM   7454  O O   . PRO C 1 205 ? 27.369  31.144  94.333  1.00 116.52 ? 206  PRO C O   1 
ATOM   7455  C CB  . PRO C 1 205 ? 29.478  33.739  94.754  1.00 118.79 ? 206  PRO C CB  1 
ATOM   7456  C CG  . PRO C 1 205 ? 30.883  34.163  94.643  1.00 120.18 ? 206  PRO C CG  1 
ATOM   7457  C CD  . PRO C 1 205 ? 31.482  33.300  93.575  1.00 121.14 ? 206  PRO C CD  1 
ATOM   7458  N N   . ARG C 1 206 ? 28.111  32.194  92.479  1.00 113.98 ? 207  ARG C N   1 
ATOM   7459  C CA  . ARG C 1 206 ? 26.925  31.884  91.689  1.00 103.89 ? 207  ARG C CA  1 
ATOM   7460  C C   . ARG C 1 206 ? 26.809  30.386  91.444  1.00 99.16  ? 207  ARG C C   1 
ATOM   7461  O O   . ARG C 1 206 ? 25.777  29.770  91.754  1.00 96.33  ? 207  ARG C O   1 
ATOM   7462  C CB  . ARG C 1 206 ? 26.957  32.622  90.350  1.00 105.83 ? 207  ARG C CB  1 
ATOM   7463  C CG  . ARG C 1 206 ? 25.887  32.151  89.382  1.00 109.40 ? 207  ARG C CG  1 
ATOM   7464  C CD  . ARG C 1 206 ? 25.935  32.895  88.059  1.00 116.21 ? 207  ARG C CD  1 
ATOM   7465  N NE  . ARG C 1 206 ? 24.925  32.386  87.137  1.00 118.78 ? 207  ARG C NE  1 
ATOM   7466  C CZ  . ARG C 1 206 ? 23.661  32.795  87.115  1.00 116.45 ? 207  ARG C CZ  1 
ATOM   7467  N NH1 . ARG C 1 206 ? 23.250  33.728  87.964  1.00 116.03 ? 207  ARG C NH1 1 
ATOM   7468  N NH2 . ARG C 1 206 ? 22.807  32.274  86.245  1.00 111.51 ? 207  ARG C NH2 1 
ATOM   7469  N N   . GLU C 1 207 ? 27.871  29.806  90.884  1.00 98.24  ? 208  GLU C N   1 
ATOM   7470  C CA  . GLU C 1 207 ? 27.889  28.376  90.594  1.00 97.43  ? 208  GLU C CA  1 
ATOM   7471  C C   . GLU C 1 207 ? 27.562  27.566  91.841  1.00 103.94 ? 208  GLU C C   1 
ATOM   7472  O O   . GLU C 1 207 ? 26.723  26.657  91.806  1.00 118.00 ? 208  GLU C O   1 
ATOM   7473  C CB  . GLU C 1 207 ? 29.254  27.962  90.052  1.00 92.25  ? 208  GLU C CB  1 
ATOM   7474  C CG  . GLU C 1 207 ? 29.498  28.326  88.604  1.00 95.89  ? 208  GLU C CG  1 
ATOM   7475  C CD  . GLU C 1 207 ? 28.915  27.306  87.650  1.00 102.75 ? 208  GLU C CD  1 
ATOM   7476  O OE1 . GLU C 1 207 ? 28.387  26.280  88.127  1.00 109.38 ? 208  GLU C OE1 1 
ATOM   7477  O OE2 . GLU C 1 207 ? 28.987  27.527  86.423  1.00 100.63 ? 208  GLU C OE2 1 
ATOM   7478  N N   . LEU C 1 208 ? 28.213  27.919  92.946  1.00 94.33  ? 209  LEU C N   1 
ATOM   7479  C CA  . LEU C 1 208 ? 27.991  27.235  94.210  1.00 84.22  ? 209  LEU C CA  1 
ATOM   7480  C C   . LEU C 1 208 ? 26.546  27.376  94.662  1.00 81.69  ? 209  LEU C C   1 
ATOM   7481  O O   . LEU C 1 208 ? 25.938  26.397  95.070  1.00 79.55  ? 209  LEU C O   1 
ATOM   7482  C CB  . LEU C 1 208 ? 28.927  27.760  95.297  1.00 73.75  ? 209  LEU C CB  1 
ATOM   7483  C CG  . LEU C 1 208 ? 28.811  27.053  96.648  1.00 60.79  ? 209  LEU C CG  1 
ATOM   7484  C CD1 . LEU C 1 208 ? 29.357  25.634  96.565  1.00 63.01  ? 209  LEU C CD1 1 
ATOM   7485  C CD2 . LEU C 1 208 ? 29.512  27.846  97.738  1.00 51.91  ? 209  LEU C CD2 1 
ATOM   7486  N N   . ARG C 1 209 ? 25.993  28.583  94.579  1.00 76.44  ? 210  ARG C N   1 
ATOM   7487  C CA  . ARG C 1 209 ? 24.625  28.806  95.041  1.00 88.70  ? 210  ARG C CA  1 
ATOM   7488  C C   . ARG C 1 209 ? 23.622  27.964  94.257  1.00 99.06  ? 210  ARG C C   1 
ATOM   7489  O O   . ARG C 1 209 ? 22.888  27.154  94.838  1.00 106.60 ? 210  ARG C O   1 
ATOM   7490  C CB  . ARG C 1 209 ? 24.243  30.285  94.953  1.00 96.69  ? 210  ARG C CB  1 
ATOM   7491  C CG  . ARG C 1 209 ? 23.117  30.680  95.900  1.00 97.34  ? 210  ARG C CG  1 
ATOM   7492  C CD  . ARG C 1 209 ? 22.109  31.611  95.241  1.00 111.76 ? 210  ARG C CD  1 
ATOM   7493  N NE  . ARG C 1 209 ? 22.727  32.813  94.689  1.00 127.19 ? 210  ARG C NE  1 
ATOM   7494  C CZ  . ARG C 1 209 ? 22.594  33.205  93.426  1.00 136.72 ? 210  ARG C CZ  1 
ATOM   7495  N NH1 . ARG C 1 209 ? 21.862  32.490  92.583  1.00 135.95 ? 210  ARG C NH1 1 
ATOM   7496  N NH2 . ARG C 1 209 ? 23.190  34.312  93.005  1.00 143.26 ? 210  ARG C NH2 1 
ATOM   7497  N N   . LEU C 1 210 ? 23.611  28.144  92.937  1.00 100.18 ? 211  LEU C N   1 
ATOM   7498  C CA  . LEU C 1 210 ? 22.672  27.431  92.073  1.00 99.80  ? 211  LEU C CA  1 
ATOM   7499  C C   . LEU C 1 210 ? 22.814  25.916  92.195  1.00 96.20  ? 211  LEU C C   1 
ATOM   7500  O O   . LEU C 1 210 ? 21.835  25.199  92.465  1.00 104.37 ? 211  LEU C O   1 
ATOM   7501  C CB  . LEU C 1 210 ? 22.866  27.852  90.615  1.00 102.64 ? 211  LEU C CB  1 
ATOM   7502  C CG  . LEU C 1 210 ? 22.538  29.307  90.275  1.00 104.99 ? 211  LEU C CG  1 
ATOM   7503  C CD1 . LEU C 1 210 ? 22.639  29.547  88.775  1.00 107.18 ? 211  LEU C CD1 1 
ATOM   7504  C CD2 . LEU C 1 210 ? 21.156  29.676  90.790  1.00 100.40 ? 211  LEU C CD2 1 
ATOM   7505  N N   . ARG C 1 211 ? 24.040  25.433  92.010  1.00 88.01  ? 212  ARG C N   1 
ATOM   7506  C CA  . ARG C 1 211 ? 24.286  23.997  92.064  1.00 88.95  ? 212  ARG C CA  1 
ATOM   7507  C C   . ARG C 1 211 ? 23.935  23.400  93.427  1.00 82.18  ? 212  ARG C C   1 
ATOM   7508  O O   . ARG C 1 211 ? 23.355  22.315  93.497  1.00 82.66  ? 212  ARG C O   1 
ATOM   7509  C CB  . ARG C 1 211 ? 25.728  23.670  91.675  1.00 95.54  ? 212  ARG C CB  1 
ATOM   7510  C CG  . ARG C 1 211 ? 26.036  23.907  90.204  1.00 109.21 ? 212  ARG C CG  1 
ATOM   7511  C CD  . ARG C 1 211 ? 27.271  23.140  89.764  1.00 122.92 ? 212  ARG C CD  1 
ATOM   7512  N NE  . ARG C 1 211 ? 27.484  23.218  88.322  1.00 135.01 ? 212  ARG C NE  1 
ATOM   7513  C CZ  . ARG C 1 211 ? 28.271  22.393  87.639  1.00 138.20 ? 212  ARG C CZ  1 
ATOM   7514  N NH1 . ARG C 1 211 ? 28.917  21.418  88.265  1.00 136.10 ? 212  ARG C NH1 1 
ATOM   7515  N NH2 . ARG C 1 211 ? 28.406  22.538  86.328  1.00 139.52 ? 212  ARG C NH2 1 
ATOM   7516  N N   . ALA C 1 212 ? 24.263  24.113  94.502  1.00 79.23  ? 213  ALA C N   1 
ATOM   7517  C CA  . ALA C 1 212 ? 23.947  23.634  95.844  1.00 68.79  ? 213  ALA C CA  1 
ATOM   7518  C C   . ALA C 1 212 ? 22.447  23.540  96.056  1.00 69.25  ? 213  ALA C C   1 
ATOM   7519  O O   . ALA C 1 212 ? 21.951  22.500  96.475  1.00 73.27  ? 213  ALA C O   1 
ATOM   7520  C CB  . ALA C 1 212 ? 24.576  24.509  96.913  1.00 61.24  ? 213  ALA C CB  1 
ATOM   7521  N N   . THR C 1 213 ? 21.718  24.616  95.768  1.00 69.14  ? 214  THR C N   1 
ATOM   7522  C CA  . THR C 1 213 ? 20.271  24.571  95.972  1.00 84.19  ? 214  THR C CA  1 
ATOM   7523  C C   . THR C 1 213 ? 19.618  23.442  95.156  1.00 85.25  ? 214  THR C C   1 
ATOM   7524  O O   . THR C 1 213 ? 18.911  22.592  95.718  1.00 80.35  ? 214  THR C O   1 
ATOM   7525  C CB  . THR C 1 213 ? 19.575  25.955  95.768  1.00 72.71  ? 214  THR C CB  1 
ATOM   7526  O OG1 . THR C 1 213 ? 18.167  25.826  95.993  1.00 90.89  ? 214  THR C OG1 1 
ATOM   7527  C CG2 . THR C 1 213 ? 19.806  26.513  94.376  1.00 55.62  ? 214  THR C CG2 1 
ATOM   7528  N N   . ARG C 1 214 ? 19.902  23.400  93.854  1.00 80.34  ? 215  ARG C N   1 
ATOM   7529  C CA  . ARG C 1 214 ? 19.352  22.346  93.001  1.00 59.94  ? 215  ARG C CA  1 
ATOM   7530  C C   . ARG C 1 214 ? 19.692  20.939  93.496  1.00 57.73  ? 215  ARG C C   1 
ATOM   7531  O O   . ARG C 1 214 ? 18.800  20.162  93.846  1.00 71.39  ? 215  ARG C O   1 
ATOM   7532  C CB  . ARG C 1 214 ? 19.814  22.501  91.551  1.00 69.08  ? 215  ARG C CB  1 
ATOM   7533  C CG  . ARG C 1 214 ? 19.231  21.441  90.620  1.00 70.96  ? 215  ARG C CG  1 
ATOM   7534  C CD  . ARG C 1 214 ? 20.231  20.993  89.558  1.00 78.03  ? 215  ARG C CD  1 
ATOM   7535  N NE  . ARG C 1 214 ? 21.473  20.499  90.148  1.00 86.12  ? 215  ARG C NE  1 
ATOM   7536  C CZ  . ARG C 1 214 ? 22.631  21.151  90.094  1.00 107.12 ? 215  ARG C CZ  1 
ATOM   7537  N NH1 . ARG C 1 214 ? 22.706  22.322  89.472  1.00 114.87 ? 215  ARG C NH1 1 
ATOM   7538  N NH2 . ARG C 1 214 ? 23.715  20.635  90.657  1.00 116.69 ? 215  ARG C NH2 1 
ATOM   7539  N N   . ALA C 1 215 ? 20.983  20.615  93.506  1.00 55.18  ? 216  ALA C N   1 
ATOM   7540  C CA  . ALA C 1 215 ? 21.435  19.274  93.873  1.00 74.27  ? 216  ALA C CA  1 
ATOM   7541  C C   . ALA C 1 215 ? 20.957  18.842  95.259  1.00 79.42  ? 216  ALA C C   1 
ATOM   7542  O O   . ALA C 1 215 ? 20.485  17.715  95.439  1.00 91.58  ? 216  ALA C O   1 
ATOM   7543  C CB  . ALA C 1 215 ? 22.953  19.174  93.773  1.00 75.71  ? 216  ALA C CB  1 
ATOM   7544  N N   . PHE C 1 216 ? 21.074  19.736  96.236  1.00 64.37  ? 217  PHE C N   1 
ATOM   7545  C CA  . PHE C 1 216 ? 20.679  19.397  97.599  1.00 59.09  ? 217  PHE C CA  1 
ATOM   7546  C C   . PHE C 1 216 ? 19.172  19.188  97.758  1.00 60.08  ? 217  PHE C C   1 
ATOM   7547  O O   . PHE C 1 216 ? 18.757  18.254  98.451  1.00 67.58  ? 217  PHE C O   1 
ATOM   7548  C CB  . PHE C 1 216 ? 21.218  20.407  98.619  1.00 62.31  ? 217  PHE C CB  1 
ATOM   7549  C CG  . PHE C 1 216 ? 22.668  20.199  98.972  1.00 61.72  ? 217  PHE C CG  1 
ATOM   7550  C CD1 . PHE C 1 216 ? 23.037  19.256  99.918  1.00 59.21  ? 217  PHE C CD1 1 
ATOM   7551  C CD2 . PHE C 1 216 ? 23.661  20.946  98.359  1.00 68.31  ? 217  PHE C CD2 1 
ATOM   7552  C CE1 . PHE C 1 216 ? 24.369  19.064  100.244 1.00 62.75  ? 217  PHE C CE1 1 
ATOM   7553  C CE2 . PHE C 1 216 ? 24.992  20.759  98.680  1.00 63.77  ? 217  PHE C CE2 1 
ATOM   7554  C CZ  . PHE C 1 216 ? 25.347  19.817  99.623  1.00 65.22  ? 217  PHE C CZ  1 
ATOM   7555  N N   . VAL C 1 217 ? 18.349  20.024  97.123  1.00 51.97  ? 218  VAL C N   1 
ATOM   7556  C CA  . VAL C 1 217 ? 16.907  19.768  97.195  1.00 55.78  ? 218  VAL C CA  1 
ATOM   7557  C C   . VAL C 1 217 ? 16.527  18.494  96.440  1.00 62.87  ? 218  VAL C C   1 
ATOM   7558  O O   . VAL C 1 217 ? 15.598  17.791  96.836  1.00 65.03  ? 218  VAL C O   1 
ATOM   7559  C CB  . VAL C 1 217 ? 16.022  20.951  96.723  1.00 66.13  ? 218  VAL C CB  1 
ATOM   7560  C CG1 . VAL C 1 217 ? 16.327  22.205  97.520  1.00 75.47  ? 218  VAL C CG1 1 
ATOM   7561  C CG2 . VAL C 1 217 ? 16.165  21.192  95.226  1.00 65.23  ? 218  VAL C CG2 1 
ATOM   7562  N N   . ALA C 1 218 ? 17.254  18.190  95.368  1.00 60.84  ? 219  ALA C N   1 
ATOM   7563  C CA  . ALA C 1 218 ? 17.013  16.962  94.618  1.00 61.54  ? 219  ALA C CA  1 
ATOM   7564  C C   . ALA C 1 218 ? 17.291  15.735  95.486  1.00 59.60  ? 219  ALA C C   1 
ATOM   7565  O O   . ALA C 1 218 ? 16.442  14.848  95.618  1.00 67.85  ? 219  ALA C O   1 
ATOM   7566  C CB  . ALA C 1 218 ? 17.866  16.931  93.360  1.00 64.03  ? 219  ALA C CB  1 
ATOM   7567  N N   . ALA C 1 219 ? 18.480  15.696  96.082  1.00 49.26  ? 220  ALA C N   1 
ATOM   7568  C CA  . ALA C 1 219 ? 18.862  14.596  96.963  1.00 57.96  ? 220  ALA C CA  1 
ATOM   7569  C C   . ALA C 1 219 ? 17.900  14.462  98.141  1.00 59.63  ? 220  ALA C C   1 
ATOM   7570  O O   . ALA C 1 219 ? 17.422  13.361  98.443  1.00 52.97  ? 220  ALA C O   1 
ATOM   7571  C CB  . ALA C 1 219 ? 20.288  14.781  97.459  1.00 57.00  ? 220  ALA C CB  1 
ATOM   7572  N N   . ARG C 1 220 ? 17.615  15.586  98.797  1.00 65.16  ? 221  ARG C N   1 
ATOM   7573  C CA  . ARG C 1 220 ? 16.712  15.590  99.945  1.00 65.23  ? 221  ARG C CA  1 
ATOM   7574  C C   . ARG C 1 220 ? 15.340  15.045  99.565  1.00 68.09  ? 221  ARG C C   1 
ATOM   7575  O O   . ARG C 1 220 ? 14.754  14.249  100.299 1.00 60.70  ? 221  ARG C O   1 
ATOM   7576  C CB  . ARG C 1 220 ? 16.564  16.997  100.531 1.00 49.77  ? 221  ARG C CB  1 
ATOM   7577  C CG  . ARG C 1 220 ? 15.886  17.006  101.895 1.00 51.24  ? 221  ARG C CG  1 
ATOM   7578  C CD  . ARG C 1 220 ? 14.935  18.181  102.080 1.00 69.75  ? 221  ARG C CD  1 
ATOM   7579  N NE  . ARG C 1 220 ? 15.621  19.467  102.145 1.00 76.79  ? 221  ARG C NE  1 
ATOM   7580  C CZ  . ARG C 1 220 ? 15.535  20.407  101.209 1.00 82.04  ? 221  ARG C CZ  1 
ATOM   7581  N NH1 . ARG C 1 220 ? 14.788  20.207  100.132 1.00 75.41  ? 221  ARG C NH1 1 
ATOM   7582  N NH2 . ARG C 1 220 ? 16.194  21.549  101.352 1.00 83.74  ? 221  ARG C NH2 1 
ATOM   7583  N N   . SER C 1 221 ? 14.838  15.474  98.410  1.00 66.76  ? 222  SER C N   1 
ATOM   7584  C CA  . SER C 1 221 ? 13.533  15.032  97.933  1.00 58.86  ? 222  SER C CA  1 
ATOM   7585  C C   . SER C 1 221 ? 13.530  13.547  97.593  1.00 47.07  ? 222  SER C C   1 
ATOM   7586  O O   . SER C 1 221 ? 12.533  12.864  97.806  1.00 44.78  ? 222  SER C O   1 
ATOM   7587  C CB  . SER C 1 221 ? 13.086  15.851  96.721  1.00 57.23  ? 222  SER C CB  1 
ATOM   7588  O OG  . SER C 1 221 ? 12.936  17.219  97.059  1.00 55.28  ? 222  SER C OG  1 
ATOM   7589  N N   . PHE C 1 222 ? 14.646  13.047  97.070  1.00 40.31  ? 223  PHE C N   1 
ATOM   7590  C CA  . PHE C 1 222 ? 14.749  11.627  96.738  1.00 42.09  ? 223  PHE C CA  1 
ATOM   7591  C C   . PHE C 1 222 ? 14.737  10.761  98.001  1.00 39.03  ? 223  PHE C C   1 
ATOM   7592  O O   . PHE C 1 222 ? 13.956  9.805   98.114  1.00 49.16  ? 223  PHE C O   1 
ATOM   7593  C CB  . PHE C 1 222 ? 16.013  11.357  95.921  1.00 41.36  ? 223  PHE C CB  1 
ATOM   7594  C CG  . PHE C 1 222 ? 16.102  9.953   95.386  1.00 55.60  ? 223  PHE C CG  1 
ATOM   7595  C CD1 . PHE C 1 222 ? 15.433  9.599   94.226  1.00 53.32  ? 223  PHE C CD1 1 
ATOM   7596  C CD2 . PHE C 1 222 ? 16.858  8.991   96.039  1.00 65.43  ? 223  PHE C CD2 1 
ATOM   7597  C CE1 . PHE C 1 222 ? 15.511  8.311   93.728  1.00 61.13  ? 223  PHE C CE1 1 
ATOM   7598  C CE2 . PHE C 1 222 ? 16.940  7.699   95.546  1.00 60.93  ? 223  PHE C CE2 1 
ATOM   7599  C CZ  . PHE C 1 222 ? 16.265  7.360   94.389  1.00 67.27  ? 223  PHE C CZ  1 
ATOM   7600  N N   . VAL C 1 223 ? 15.601  11.107  98.951  1.00 45.93  ? 224  VAL C N   1 
ATOM   7601  C CA  . VAL C 1 223 ? 15.662  10.392  100.223 1.00 51.66  ? 224  VAL C CA  1 
ATOM   7602  C C   . VAL C 1 223 ? 14.306  10.426  100.928 1.00 53.75  ? 224  VAL C C   1 
ATOM   7603  O O   . VAL C 1 223 ? 13.794  9.390   101.377 1.00 41.43  ? 224  VAL C O   1 
ATOM   7604  C CB  . VAL C 1 223 ? 16.757  10.971  101.142 1.00 45.80  ? 224  VAL C CB  1 
ATOM   7605  C CG1 . VAL C 1 223 ? 16.620  10.422  102.555 1.00 40.15  ? 224  VAL C CG1 1 
ATOM   7606  C CG2 . VAL C 1 223 ? 18.138  10.671  100.574 1.00 32.76  ? 224  VAL C CG2 1 
ATOM   7607  N N   . GLN C 1 224 ? 13.725  11.622  101.001 1.00 65.20  ? 225  GLN C N   1 
ATOM   7608  C CA  . GLN C 1 224 ? 12.386  11.806  101.550 1.00 61.77  ? 225  GLN C CA  1 
ATOM   7609  C C   . GLN C 1 224 ? 11.383  10.886  100.871 1.00 51.75  ? 225  GLN C C   1 
ATOM   7610  O O   . GLN C 1 224 ? 10.572  10.249  101.536 1.00 52.23  ? 225  GLN C O   1 
ATOM   7611  C CB  . GLN C 1 224 ? 11.925  13.254  101.387 1.00 71.57  ? 225  GLN C CB  1 
ATOM   7612  C CG  . GLN C 1 224 ? 12.184  14.140  102.591 1.00 77.29  ? 225  GLN C CG  1 
ATOM   7613  C CD  . GLN C 1 224 ? 11.500  15.487  102.469 1.00 83.66  ? 225  GLN C CD  1 
ATOM   7614  O OE1 . GLN C 1 224 ? 10.390  15.681  102.966 1.00 94.31  ? 225  GLN C OE1 1 
ATOM   7615  N NE2 . GLN C 1 224 ? 12.158  16.425  101.798 1.00 72.19  ? 225  GLN C NE2 1 
ATOM   7616  N N   . GLY C 1 225 ? 11.449  10.825  99.544  1.00 50.35  ? 226  GLY C N   1 
ATOM   7617  C CA  . GLY C 1 225 ? 10.551  9.994   98.763  1.00 60.46  ? 226  GLY C CA  1 
ATOM   7618  C C   . GLY C 1 225 ? 10.640  8.532   99.150  1.00 54.69  ? 226  GLY C C   1 
ATOM   7619  O O   . GLY C 1 225 ? 9.617   7.881   99.388  1.00 53.06  ? 226  GLY C O   1 
ATOM   7620  N N   . LEU C 1 226 ? 11.865  8.016   99.216  1.00 52.23  ? 227  LEU C N   1 
ATOM   7621  C CA  . LEU C 1 226 ? 12.080  6.638   99.650  1.00 56.61  ? 227  LEU C CA  1 
ATOM   7622  C C   . LEU C 1 226 ? 11.477  6.403   101.037 1.00 58.76  ? 227  LEU C C   1 
ATOM   7623  O O   . LEU C 1 226 ? 10.769  5.410   101.266 1.00 68.80  ? 227  LEU C O   1 
ATOM   7624  C CB  . LEU C 1 226 ? 13.573  6.301   99.655  1.00 54.21  ? 227  LEU C CB  1 
ATOM   7625  C CG  . LEU C 1 226 ? 14.279  6.273   98.298  1.00 39.16  ? 227  LEU C CG  1 
ATOM   7626  C CD1 . LEU C 1 226 ? 15.764  5.994   98.471  1.00 39.56  ? 227  LEU C CD1 1 
ATOM   7627  C CD2 . LEU C 1 226 ? 13.639  5.242   97.377  1.00 29.27  ? 227  LEU C CD2 1 
ATOM   7628  N N   . GLY C 1 227 ? 11.751  7.331   101.951 1.00 51.42  ? 228  GLY C N   1 
ATOM   7629  C CA  . GLY C 1 227 ? 11.229  7.246   103.304 1.00 59.88  ? 228  GLY C CA  1 
ATOM   7630  C C   . GLY C 1 227 ? 9.712   7.195   103.365 1.00 64.84  ? 228  GLY C C   1 
ATOM   7631  O O   . GLY C 1 227 ? 9.132   6.418   104.128 1.00 74.55  ? 228  GLY C O   1 
ATOM   7632  N N   . VAL C 1 228 ? 9.064   8.021   102.551 1.00 52.15  ? 229  VAL C N   1 
ATOM   7633  C CA  . VAL C 1 228 ? 7.608   8.080   102.526 1.00 47.66  ? 229  VAL C CA  1 
ATOM   7634  C C   . VAL C 1 228 ? 7.014   6.807   101.931 1.00 48.11  ? 229  VAL C C   1 
ATOM   7635  O O   . VAL C 1 228 ? 6.045   6.271   102.463 1.00 56.18  ? 229  VAL C O   1 
ATOM   7636  C CB  . VAL C 1 228 ? 7.097   9.329   101.775 1.00 49.33  ? 229  VAL C CB  1 
ATOM   7637  C CG1 . VAL C 1 228 ? 5.598   9.244   101.533 1.00 52.59  ? 229  VAL C CG1 1 
ATOM   7638  C CG2 . VAL C 1 228 ? 7.430   10.579  102.564 1.00 37.43  ? 229  VAL C CG2 1 
ATOM   7639  N N   . ALA C 1 229 ? 7.599   6.319   100.840 1.00 46.07  ? 230  ALA C N   1 
ATOM   7640  C CA  . ALA C 1 229 ? 7.162   5.053   100.252 1.00 45.19  ? 230  ALA C CA  1 
ATOM   7641  C C   . ALA C 1 229 ? 7.230   3.925   101.280 1.00 47.21  ? 230  ALA C C   1 
ATOM   7642  O O   . ALA C 1 229 ? 6.258   3.179   101.469 1.00 55.84  ? 230  ALA C O   1 
ATOM   7643  C CB  . ALA C 1 229 ? 8.001   4.709   99.033  1.00 40.59  ? 230  ALA C CB  1 
ATOM   7644  N N   . SER C 1 230 ? 8.375   3.815   101.950 1.00 50.19  ? 231  SER C N   1 
ATOM   7645  C CA  . SER C 1 230 ? 8.558   2.793   102.978 1.00 60.87  ? 231  SER C CA  1 
ATOM   7646  C C   . SER C 1 230 ? 7.534   2.946   104.105 1.00 58.65  ? 231  SER C C   1 
ATOM   7647  O O   . SER C 1 230 ? 6.995   1.955   104.615 1.00 51.55  ? 231  SER C O   1 
ATOM   7648  C CB  . SER C 1 230 ? 9.981   2.841   103.539 1.00 68.30  ? 231  SER C CB  1 
ATOM   7649  O OG  . SER C 1 230 ? 10.241  1.715   104.361 1.00 82.86  ? 231  SER C OG  1 
ATOM   7650  N N   . ASP C 1 231 ? 7.262   4.194   104.480 1.00 52.64  ? 232  ASP C N   1 
ATOM   7651  C CA  . ASP C 1 231 ? 6.266   4.489   105.506 1.00 63.92  ? 232  ASP C CA  1 
ATOM   7652  C C   . ASP C 1 231 ? 4.879   4.001   105.103 1.00 63.44  ? 232  ASP C C   1 
ATOM   7653  O O   . ASP C 1 231 ? 4.176   3.370   105.895 1.00 60.49  ? 232  ASP C O   1 
ATOM   7654  C CB  . ASP C 1 231 ? 6.224   5.991   105.792 1.00 79.34  ? 232  ASP C CB  1 
ATOM   7655  C CG  . ASP C 1 231 ? 7.029   6.373   107.016 1.00 95.07  ? 232  ASP C CG  1 
ATOM   7656  O OD1 . ASP C 1 231 ? 7.827   5.535   107.485 1.00 95.29  ? 232  ASP C OD1 1 
ATOM   7657  O OD2 . ASP C 1 231 ? 6.865   7.509   107.509 1.00 104.44 ? 232  ASP C OD2 1 
ATOM   7658  N N   . VAL C 1 232 ? 4.495   4.302   103.867 1.00 51.54  ? 233  VAL C N   1 
ATOM   7659  C CA  . VAL C 1 232 ? 3.202   3.902   103.331 1.00 46.49  ? 233  VAL C CA  1 
ATOM   7660  C C   . VAL C 1 232 ? 3.052   2.386   103.322 1.00 49.47  ? 233  VAL C C   1 
ATOM   7661  O O   . VAL C 1 232 ? 2.041   1.857   103.786 1.00 35.83  ? 233  VAL C O   1 
ATOM   7662  C CB  . VAL C 1 232 ? 2.990   4.455   101.908 1.00 43.86  ? 233  VAL C CB  1 
ATOM   7663  C CG1 . VAL C 1 232 ? 1.748   3.845   101.274 1.00 48.78  ? 233  VAL C CG1 1 
ATOM   7664  C CG2 . VAL C 1 232 ? 2.889   5.972   101.945 1.00 41.33  ? 233  VAL C CG2 1 
ATOM   7665  N N   . VAL C 1 233 ? 4.060   1.689   102.802 1.00 56.56  ? 234  VAL C N   1 
ATOM   7666  C CA  . VAL C 1 233 ? 4.033   0.228   102.797 1.00 42.61  ? 234  VAL C CA  1 
ATOM   7667  C C   . VAL C 1 233 ? 3.896   -0.322  104.219 1.00 44.89  ? 234  VAL C C   1 
ATOM   7668  O O   . VAL C 1 233 ? 3.091   -1.226  104.474 1.00 49.90  ? 234  VAL C O   1 
ATOM   7669  C CB  . VAL C 1 233 ? 5.286   -0.367  102.130 1.00 37.21  ? 234  VAL C CB  1 
ATOM   7670  C CG1 . VAL C 1 233 ? 5.242   -1.888  102.173 1.00 32.97  ? 234  VAL C CG1 1 
ATOM   7671  C CG2 . VAL C 1 233 ? 5.398   0.123   100.698 1.00 35.08  ? 234  VAL C CG2 1 
ATOM   7672  N N   . ARG C 1 234 ? 4.668   0.248   105.142 1.00 64.22  ? 235  ARG C N   1 
ATOM   7673  C CA  . ARG C 1 234 ? 4.635   -0.178  106.539 1.00 74.96  ? 235  ARG C CA  1 
ATOM   7674  C C   . ARG C 1 234 ? 3.248   -0.025  107.164 1.00 67.79  ? 235  ARG C C   1 
ATOM   7675  O O   . ARG C 1 234 ? 2.729   -0.960  107.775 1.00 57.73  ? 235  ARG C O   1 
ATOM   7676  C CB  . ARG C 1 234 ? 5.666   0.595   107.368 1.00 80.23  ? 235  ARG C CB  1 
ATOM   7677  C CG  . ARG C 1 234 ? 5.890   0.015   108.759 1.00 83.11  ? 235  ARG C CG  1 
ATOM   7678  C CD  . ARG C 1 234 ? 6.783   0.900   109.617 1.00 86.54  ? 235  ARG C CD  1 
ATOM   7679  N NE  . ARG C 1 234 ? 6.063   2.047   110.164 1.00 90.88  ? 235  ARG C NE  1 
ATOM   7680  C CZ  . ARG C 1 234 ? 6.132   3.279   109.671 1.00 96.75  ? 235  ARG C CZ  1 
ATOM   7681  N NH1 . ARG C 1 234 ? 6.896   3.532   108.618 1.00 93.75  ? 235  ARG C NH1 1 
ATOM   7682  N NH2 . ARG C 1 234 ? 5.440   4.261   110.234 1.00 99.88  ? 235  ARG C NH2 1 
ATOM   7683  N N   . LYS C 1 235 ? 2.655   1.156   107.009 1.00 57.85  ? 236  LYS C N   1 
ATOM   7684  C CA  . LYS C 1 235 ? 1.352   1.447   107.601 1.00 64.39  ? 236  LYS C CA  1 
ATOM   7685  C C   . LYS C 1 235 ? 0.232   0.624   106.967 1.00 62.93  ? 236  LYS C C   1 
ATOM   7686  O O   . LYS C 1 235 ? -0.611  0.063   107.668 1.00 58.66  ? 236  LYS C O   1 
ATOM   7687  C CB  . LYS C 1 235 ? 1.031   2.941   107.488 1.00 80.26  ? 236  LYS C CB  1 
ATOM   7688  C CG  . LYS C 1 235 ? 1.990   3.850   108.245 1.00 98.25  ? 236  LYS C CG  1 
ATOM   7689  C CD  . LYS C 1 235 ? 1.729   5.312   107.910 1.00 106.52 ? 236  LYS C CD  1 
ATOM   7690  C CE  . LYS C 1 235 ? 2.738   6.239   108.573 1.00 108.38 ? 236  LYS C CE  1 
ATOM   7691  N NZ  . LYS C 1 235 ? 2.586   6.273   110.054 1.00 112.58 ? 236  LYS C NZ  1 
ATOM   7692  N N   . VAL C 1 236 ? 0.227   0.563   105.639 1.00 60.16  ? 237  VAL C N   1 
ATOM   7693  C CA  . VAL C 1 236 ? -0.789  -0.181  104.899 1.00 55.13  ? 237  VAL C CA  1 
ATOM   7694  C C   . VAL C 1 236 ? -0.727  -1.675  105.221 1.00 60.81  ? 237  VAL C C   1 
ATOM   7695  O O   . VAL C 1 236 ? -1.757  -2.352  105.271 1.00 61.52  ? 237  VAL C O   1 
ATOM   7696  C CB  . VAL C 1 236 ? -0.662  0.060   103.373 1.00 46.75  ? 237  VAL C CB  1 
ATOM   7697  C CG1 . VAL C 1 236 ? -1.460  -0.965  102.576 1.00 32.81  ? 237  VAL C CG1 1 
ATOM   7698  C CG2 . VAL C 1 236 ? -1.106  1.473   103.024 1.00 48.54  ? 237  VAL C CG2 1 
ATOM   7699  N N   . ALA C 1 237 ? 0.479   -2.176  105.477 1.00 73.28  ? 238  ALA C N   1 
ATOM   7700  C CA  . ALA C 1 237 ? 0.665   -3.590  105.805 1.00 70.05  ? 238  ALA C CA  1 
ATOM   7701  C C   . ALA C 1 237 ? -0.117  -4.046  107.043 1.00 69.44  ? 238  ALA C C   1 
ATOM   7702  O O   . ALA C 1 237 ? -0.315  -5.243  107.248 1.00 73.41  ? 238  ALA C O   1 
ATOM   7703  C CB  . ALA C 1 237 ? 2.145   -3.904  105.976 1.00 59.05  ? 238  ALA C CB  1 
ATOM   7704  N N   . GLN C 1 238 ? -0.558  -3.095  107.863 1.00 63.70  ? 239  GLN C N   1 
ATOM   7705  C CA  . GLN C 1 238 ? -1.259  -3.422  109.102 1.00 75.27  ? 239  GLN C CA  1 
ATOM   7706  C C   . GLN C 1 238 ? -2.778  -3.446  108.949 1.00 86.76  ? 239  GLN C C   1 
ATOM   7707  O O   . GLN C 1 238 ? -3.502  -3.719  109.907 1.00 86.11  ? 239  GLN C O   1 
ATOM   7708  C CB  . GLN C 1 238 ? -0.856  -2.458  110.220 1.00 79.32  ? 239  GLN C CB  1 
ATOM   7709  C CG  . GLN C 1 238 ? 0.589   -2.607  110.661 1.00 96.45  ? 239  GLN C CG  1 
ATOM   7710  C CD  . GLN C 1 238 ? 0.902   -4.008  111.151 1.00 106.92 ? 239  GLN C CD  1 
ATOM   7711  O OE1 . GLN C 1 238 ? 1.928   -4.588  110.795 1.00 103.27 ? 239  GLN C OE1 1 
ATOM   7712  N NE2 . GLN C 1 238 ? 0.018   -4.558  111.977 1.00 111.22 ? 239  GLN C NE2 1 
ATOM   7713  N N   . VAL C 1 239 ? -3.259  -3.157  107.745 1.00 86.19  ? 240  VAL C N   1 
ATOM   7714  C CA  . VAL C 1 239 ? -4.690  -3.207  107.470 1.00 73.75  ? 240  VAL C CA  1 
ATOM   7715  C C   . VAL C 1 239 ? -5.174  -4.655  107.442 1.00 77.31  ? 240  VAL C C   1 
ATOM   7716  O O   . VAL C 1 239 ? -4.708  -5.453  106.629 1.00 81.04  ? 240  VAL C O   1 
ATOM   7717  C CB  . VAL C 1 239 ? -5.032  -2.520  106.136 1.00 61.40  ? 240  VAL C CB  1 
ATOM   7718  C CG1 . VAL C 1 239 ? -6.509  -2.685  105.815 1.00 63.66  ? 240  VAL C CG1 1 
ATOM   7719  C CG2 . VAL C 1 239 ? -4.652  -1.048  106.189 1.00 51.62  ? 240  VAL C CG2 1 
ATOM   7720  N N   . PRO C 1 240 ? -6.111  -4.998  108.339 1.00 77.04  ? 241  PRO C N   1 
ATOM   7721  C CA  . PRO C 1 240 ? -6.614  -6.368  108.469 1.00 57.13  ? 241  PRO C CA  1 
ATOM   7722  C C   . PRO C 1 240 ? -7.582  -6.737  107.352 1.00 58.18  ? 241  PRO C C   1 
ATOM   7723  O O   . PRO C 1 240 ? -8.173  -5.858  106.726 1.00 41.31  ? 241  PRO C O   1 
ATOM   7724  C CB  . PRO C 1 240 ? -7.360  -6.330  109.803 1.00 54.92  ? 241  PRO C CB  1 
ATOM   7725  C CG  . PRO C 1 240 ? -7.858  -4.931  109.890 1.00 56.47  ? 241  PRO C CG  1 
ATOM   7726  C CD  . PRO C 1 240 ? -6.770  -4.081  109.287 1.00 77.07  ? 241  PRO C CD  1 
ATOM   7727  N N   . LEU C 1 241 ? -7.733  -8.035  107.111 1.00 72.78  ? 242  LEU C N   1 
ATOM   7728  C CA  . LEU C 1 241 ? -8.674  -8.536  106.120 1.00 67.69  ? 242  LEU C CA  1 
ATOM   7729  C C   . LEU C 1 241 ? -10.091 -8.508  106.676 1.00 75.30  ? 242  LEU C C   1 
ATOM   7730  O O   . LEU C 1 241 ? -10.306 -8.797  107.853 1.00 81.80  ? 242  LEU C O   1 
ATOM   7731  C CB  . LEU C 1 241 ? -8.311  -9.968  105.734 1.00 58.99  ? 242  LEU C CB  1 
ATOM   7732  C CG  . LEU C 1 241 ? -6.943  -10.188 105.091 1.00 55.74  ? 242  LEU C CG  1 
ATOM   7733  C CD1 . LEU C 1 241 ? -6.613  -11.670 105.046 1.00 68.08  ? 242  LEU C CD1 1 
ATOM   7734  C CD2 . LEU C 1 241 ? -6.914  -9.589  103.696 1.00 45.95  ? 242  LEU C CD2 1 
ATOM   7735  N N   . GLY C 1 242 ? -11.055 -8.164  105.829 1.00 75.19  ? 243  GLY C N   1 
ATOM   7736  C CA  . GLY C 1 242 ? -12.448 -8.157  106.234 1.00 73.89  ? 243  GLY C CA  1 
ATOM   7737  C C   . GLY C 1 242 ? -12.982 -9.568  106.382 1.00 71.88  ? 243  GLY C C   1 
ATOM   7738  O O   . GLY C 1 242 ? -12.485 -10.488 105.732 1.00 75.24  ? 243  GLY C O   1 
ATOM   7739  N N   . PRO C 1 243 ? -13.995 -9.750  107.245 1.00 72.62  ? 244  PRO C N   1 
ATOM   7740  C CA  . PRO C 1 243 ? -14.603 -11.066 107.481 1.00 74.00  ? 244  PRO C CA  1 
ATOM   7741  C C   . PRO C 1 243 ? -15.263 -11.641 106.227 1.00 72.49  ? 244  PRO C C   1 
ATOM   7742  O O   . PRO C 1 243 ? -15.296 -12.860 106.047 1.00 83.85  ? 244  PRO C O   1 
ATOM   7743  C CB  . PRO C 1 243 ? -15.658 -10.779 108.557 1.00 70.35  ? 244  PRO C CB  1 
ATOM   7744  C CG  . PRO C 1 243 ? -15.926 -9.307  108.454 1.00 68.26  ? 244  PRO C CG  1 
ATOM   7745  C CD  . PRO C 1 243 ? -14.616 -8.697  108.067 1.00 67.63  ? 244  PRO C CD  1 
ATOM   7746  N N   . GLU C 1 244 ? -15.780 -10.764 105.373 1.00 69.76  ? 245  GLU C N   1 
ATOM   7747  C CA  . GLU C 1 244 ? -16.377 -11.177 104.109 1.00 76.73  ? 245  GLU C CA  1 
ATOM   7748  C C   . GLU C 1 244 ? -15.292 -11.788 103.232 1.00 78.57  ? 245  GLU C C   1 
ATOM   7749  O O   . GLU C 1 244 ? -15.451 -12.883 102.684 1.00 81.55  ? 245  GLU C O   1 
ATOM   7750  C CB  . GLU C 1 244 ? -17.013 -9.979  103.397 1.00 85.75  ? 245  GLU C CB  1 
ATOM   7751  C CG  . GLU C 1 244 ? -17.724 -8.995  104.317 1.00 102.20 ? 245  GLU C CG  1 
ATOM   7752  C CD  . GLU C 1 244 ? -16.777 -7.987  104.945 1.00 114.95 ? 245  GLU C CD  1 
ATOM   7753  O OE1 . GLU C 1 244 ? -15.622 -7.883  104.479 1.00 112.30 ? 245  GLU C OE1 1 
ATOM   7754  O OE2 . GLU C 1 244 ? -17.187 -7.306  105.908 1.00 120.32 ? 245  GLU C OE2 1 
ATOM   7755  N N   . CYS C 1 245 ? -14.183 -11.064 103.112 1.00 79.52  ? 246  CYS C N   1 
ATOM   7756  C CA  . CYS C 1 245 ? -13.002 -11.556 102.418 1.00 76.86  ? 246  CYS C CA  1 
ATOM   7757  C C   . CYS C 1 245 ? -12.535 -12.877 103.019 1.00 79.74  ? 246  CYS C C   1 
ATOM   7758  O O   . CYS C 1 245 ? -12.075 -13.762 102.303 1.00 85.17  ? 246  CYS C O   1 
ATOM   7759  C CB  . CYS C 1 245 ? -11.878 -10.518 102.477 1.00 63.60  ? 246  CYS C CB  1 
ATOM   7760  S SG  . CYS C 1 245 ? -10.235 -11.146 102.050 1.00 92.67  ? 246  CYS C SG  1 
ATOM   7761  N N   . SER C 1 246 ? -12.661 -13.004 104.337 1.00 70.36  ? 247  SER C N   1 
ATOM   7762  C CA  . SER C 1 246 ? -12.288 -14.231 105.033 1.00 66.65  ? 247  SER C CA  1 
ATOM   7763  C C   . SER C 1 246 ? -13.144 -15.408 104.572 1.00 67.74  ? 247  SER C C   1 
ATOM   7764  O O   . SER C 1 246 ? -12.627 -16.493 104.284 1.00 72.68  ? 247  SER C O   1 
ATOM   7765  C CB  . SER C 1 246 ? -12.407 -14.047 106.548 1.00 70.15  ? 247  SER C CB  1 
ATOM   7766  O OG  . SER C 1 246 ? -12.269 -15.285 107.225 1.00 87.03  ? 247  SER C OG  1 
ATOM   7767  N N   . ARG C 1 247 ? -14.454 -15.184 104.503 1.00 54.70  ? 248  ARG C N   1 
ATOM   7768  C CA  . ARG C 1 247 ? -15.379 -16.186 103.983 1.00 50.31  ? 248  ARG C CA  1 
ATOM   7769  C C   . ARG C 1 247 ? -15.024 -16.582 102.552 1.00 53.37  ? 248  ARG C C   1 
ATOM   7770  O O   . ARG C 1 247 ? -14.879 -17.770 102.243 1.00 71.76  ? 248  ARG C O   1 
ATOM   7771  C CB  . ARG C 1 247 ? -16.821 -15.672 104.040 1.00 61.71  ? 248  ARG C CB  1 
ATOM   7772  C CG  . ARG C 1 247 ? -17.511 -15.895 105.378 1.00 76.93  ? 248  ARG C CG  1 
ATOM   7773  C CD  . ARG C 1 247 ? -18.947 -15.387 105.360 1.00 83.32  ? 248  ARG C CD  1 
ATOM   7774  N NE  . ARG C 1 247 ? -19.030 -13.953 105.627 1.00 88.11  ? 248  ARG C NE  1 
ATOM   7775  C CZ  . ARG C 1 247 ? -19.217 -13.432 106.836 1.00 94.32  ? 248  ARG C CZ  1 
ATOM   7776  N NH1 . ARG C 1 247 ? -19.343 -14.229 107.889 1.00 97.93  ? 248  ARG C NH1 1 
ATOM   7777  N NH2 . ARG C 1 247 ? -19.280 -12.117 106.995 1.00 92.78  ? 248  ARG C NH2 1 
ATOM   7778  N N   . ALA C 1 248 ? -14.882 -15.581 101.688 1.00 44.17  ? 249  ALA C N   1 
ATOM   7779  C CA  . ALA C 1 248 ? -14.564 -15.819 100.282 1.00 45.11  ? 249  ALA C CA  1 
ATOM   7780  C C   . ALA C 1 248 ? -13.267 -16.609 100.107 1.00 53.27  ? 249  ALA C C   1 
ATOM   7781  O O   . ALA C 1 248 ? -13.171 -17.476 99.238  1.00 53.79  ? 249  ALA C O   1 
ATOM   7782  C CB  . ALA C 1 248 ? -14.491 -14.499 99.527  1.00 32.73  ? 249  ALA C CB  1 
ATOM   7783  N N   . VAL C 1 249 ? -12.279 -16.306 100.943 1.00 62.33  ? 250  VAL C N   1 
ATOM   7784  C CA  . VAL C 1 249 ? -10.985 -16.980 100.893 1.00 60.47  ? 250  VAL C CA  1 
ATOM   7785  C C   . VAL C 1 249 ? -11.088 -18.424 101.380 1.00 56.78  ? 250  VAL C C   1 
ATOM   7786  O O   . VAL C 1 249 ? -10.511 -19.332 100.777 1.00 52.95  ? 250  VAL C O   1 
ATOM   7787  C CB  . VAL C 1 249 ? -9.917  -16.208 101.700 1.00 51.70  ? 250  VAL C CB  1 
ATOM   7788  C CG1 . VAL C 1 249 ? -8.725  -17.096 102.017 1.00 42.43  ? 250  VAL C CG1 1 
ATOM   7789  C CG2 . VAL C 1 249 ? -9.478  -14.972 100.930 1.00 53.91  ? 250  VAL C CG2 1 
ATOM   7790  N N   . MET C 1 250 ? -11.830 -18.632 102.465 1.00 53.59  ? 251  MET C N   1 
ATOM   7791  C CA  . MET C 1 250 ? -12.088 -19.980 102.962 1.00 69.21  ? 251  MET C CA  1 
ATOM   7792  C C   . MET C 1 250 ? -12.725 -20.841 101.874 1.00 62.11  ? 251  MET C C   1 
ATOM   7793  O O   . MET C 1 250 ? -12.278 -21.969 101.610 1.00 50.51  ? 251  MET C O   1 
ATOM   7794  C CB  . MET C 1 250 ? -12.997 -19.933 104.191 1.00 74.07  ? 251  MET C CB  1 
ATOM   7795  C CG  . MET C 1 250 ? -13.671 -21.258 104.524 1.00 71.87  ? 251  MET C CG  1 
ATOM   7796  S SD  . MET C 1 250 ? -12.509 -22.616 104.746 1.00 62.09  ? 251  MET C SD  1 
ATOM   7797  C CE  . MET C 1 250 ? -13.640 -23.976 105.021 1.00 40.74  ? 251  MET C CE  1 
ATOM   7798  N N   . LYS C 1 251 ? -13.764 -20.295 101.243 1.00 51.00  ? 252  LYS C N   1 
ATOM   7799  C CA  . LYS C 1 251 ? -14.456 -20.981 100.159 1.00 44.87  ? 252  LYS C CA  1 
ATOM   7800  C C   . LYS C 1 251 ? -13.530 -21.221 98.975  1.00 48.49  ? 252  LYS C C   1 
ATOM   7801  O O   . LYS C 1 251 ? -13.639 -22.230 98.282  1.00 54.50  ? 252  LYS C O   1 
ATOM   7802  C CB  . LYS C 1 251 ? -15.671 -20.171 99.712  1.00 49.52  ? 252  LYS C CB  1 
ATOM   7803  C CG  . LYS C 1 251 ? -16.516 -20.837 98.639  1.00 52.31  ? 252  LYS C CG  1 
ATOM   7804  C CD  . LYS C 1 251 ? -17.746 -19.999 98.325  1.00 57.77  ? 252  LYS C CD  1 
ATOM   7805  C CE  . LYS C 1 251 ? -18.522 -20.567 97.149  1.00 48.37  ? 252  LYS C CE  1 
ATOM   7806  N NZ  . LYS C 1 251 ? -19.726 -19.744 96.850  1.00 46.22  ? 252  LYS C NZ  1 
ATOM   7807  N N   . LEU C 1 252 ? -12.618 -20.284 98.750  1.00 61.93  ? 253  LEU C N   1 
ATOM   7808  C CA  . LEU C 1 252 ? -11.643 -20.408 97.676  1.00 63.35  ? 253  LEU C CA  1 
ATOM   7809  C C   . LEU C 1 252 ? -10.681 -21.567 97.920  1.00 66.49  ? 253  LEU C C   1 
ATOM   7810  O O   . LEU C 1 252 ? -10.304 -22.281 96.989  1.00 74.93  ? 253  LEU C O   1 
ATOM   7811  C CB  . LEU C 1 252 ? -10.852 -19.107 97.534  1.00 61.47  ? 253  LEU C CB  1 
ATOM   7812  C CG  . LEU C 1 252 ? -9.561  -19.165 96.716  1.00 55.81  ? 253  LEU C CG  1 
ATOM   7813  C CD1 . LEU C 1 252 ? -9.859  -19.514 95.268  1.00 54.36  ? 253  LEU C CD1 1 
ATOM   7814  C CD2 . LEU C 1 252 ? -8.799  -17.852 96.810  1.00 51.49  ? 253  LEU C CD2 1 
ATOM   7815  N N   . VAL C 1 253 ? -10.293 -21.753 99.178  1.00 59.35  ? 254  VAL C N   1 
ATOM   7816  C CA  . VAL C 1 253 ? -9.224  -22.692 99.507  1.00 62.94  ? 254  VAL C CA  1 
ATOM   7817  C C   . VAL C 1 253 ? -9.694  -24.080 99.966  1.00 67.78  ? 254  VAL C C   1 
ATOM   7818  O O   . VAL C 1 253 ? -9.483  -25.068 99.259  1.00 69.34  ? 254  VAL C O   1 
ATOM   7819  C CB  . VAL C 1 253 ? -8.236  -22.087 100.533 1.00 55.00  ? 254  VAL C CB  1 
ATOM   7820  C CG1 . VAL C 1 253 ? -7.052  -23.011 100.735 1.00 52.33  ? 254  VAL C CG1 1 
ATOM   7821  C CG2 . VAL C 1 253 ? -7.759  -20.722 100.061 1.00 41.90  ? 254  VAL C CG2 1 
ATOM   7822  N N   . TYR C 1 254 ? -10.324 -24.158 101.136 1.00 67.92  ? 255  TYR C N   1 
ATOM   7823  C CA  . TYR C 1 254 ? -10.580 -25.460 101.763 1.00 74.23  ? 255  TYR C CA  1 
ATOM   7824  C C   . TYR C 1 254 ? -11.979 -26.050 101.539 1.00 82.39  ? 255  TYR C C   1 
ATOM   7825  O O   . TYR C 1 254 ? -12.274 -27.169 101.983 1.00 90.98  ? 255  TYR C O   1 
ATOM   7826  C CB  . TYR C 1 254 ? -10.242 -25.399 103.254 1.00 72.26  ? 255  TYR C CB  1 
ATOM   7827  C CG  . TYR C 1 254 ? -8.773  -25.150 103.514 1.00 80.93  ? 255  TYR C CG  1 
ATOM   7828  C CD1 . TYR C 1 254 ? -7.798  -25.818 102.785 1.00 82.71  ? 255  TYR C CD1 1 
ATOM   7829  C CD2 . TYR C 1 254 ? -8.361  -24.236 104.475 1.00 89.57  ? 255  TYR C CD2 1 
ATOM   7830  C CE1 . TYR C 1 254 ? -6.459  -25.592 103.015 1.00 78.76  ? 255  TYR C CE1 1 
ATOM   7831  C CE2 . TYR C 1 254 ? -7.024  -24.003 104.710 1.00 93.28  ? 255  TYR C CE2 1 
ATOM   7832  C CZ  . TYR C 1 254 ? -6.078  -24.683 103.977 1.00 89.38  ? 255  TYR C CZ  1 
ATOM   7833  O OH  . TYR C 1 254 ? -4.741  -24.454 104.206 1.00 98.21  ? 255  TYR C OH  1 
ATOM   7834  N N   . CYS C 1 255 ? -12.834 -25.315 100.839 1.00 75.33  ? 256  CYS C N   1 
ATOM   7835  C CA  . CYS C 1 255 ? -14.175 -25.802 100.555 1.00 67.79  ? 256  CYS C CA  1 
ATOM   7836  C C   . CYS C 1 255 ? -14.138 -26.905 99.500  1.00 71.32  ? 256  CYS C C   1 
ATOM   7837  O O   . CYS C 1 255 ? -15.065 -27.708 99.397  1.00 69.21  ? 256  CYS C O   1 
ATOM   7838  C CB  . CYS C 1 255 ? -15.076 -24.651 100.122 1.00 46.35  ? 256  CYS C CB  1 
ATOM   7839  S SG  . CYS C 1 255 ? -15.918 -23.866 101.509 1.00 82.39  ? 256  CYS C SG  1 
ATOM   7840  N N   . ALA C 1 256 ? -13.058 -26.944 98.725  1.00 69.50  ? 257  ALA C N   1 
ATOM   7841  C CA  . ALA C 1 256 ? -12.819 -28.048 97.802  1.00 61.55  ? 257  ALA C CA  1 
ATOM   7842  C C   . ALA C 1 256 ? -12.626 -29.338 98.596  1.00 70.50  ? 257  ALA C C   1 
ATOM   7843  O O   . ALA C 1 256 ? -13.157 -30.390 98.237  1.00 80.04  ? 257  ALA C O   1 
ATOM   7844  C CB  . ALA C 1 256 ? -11.591 -27.767 96.942  1.00 66.88  ? 257  ALA C CB  1 
ATOM   7845  N N   . HIS C 1 257 ? -11.851 -29.247 99.673  1.00 71.81  ? 258  HIS C N   1 
ATOM   7846  C CA  . HIS C 1 257 ? -11.633 -30.376 100.566 1.00 77.07  ? 258  HIS C CA  1 
ATOM   7847  C C   . HIS C 1 257 ? -12.940 -30.767 101.251 1.00 79.52  ? 258  HIS C C   1 
ATOM   7848  O O   . HIS C 1 257 ? -13.234 -31.953 101.413 1.00 75.06  ? 258  HIS C O   1 
ATOM   7849  C CB  . HIS C 1 257 ? -10.573 -30.032 101.618 1.00 72.54  ? 258  HIS C CB  1 
ATOM   7850  C CG  . HIS C 1 257 ? -9.238  -29.670 101.041 1.00 87.94  ? 258  HIS C CG  1 
ATOM   7851  N ND1 . HIS C 1 257 ? -8.992  -28.460 100.428 1.00 84.90  ? 258  HIS C ND1 1 
ATOM   7852  C CD2 . HIS C 1 257 ? -8.073  -30.360 100.992 1.00 92.46  ? 258  HIS C CD2 1 
ATOM   7853  C CE1 . HIS C 1 257 ? -7.736  -28.421 100.023 1.00 82.38  ? 258  HIS C CE1 1 
ATOM   7854  N NE2 . HIS C 1 257 ? -7.155  -29.561 100.353 1.00 90.34  ? 258  HIS C NE2 1 
ATOM   7855  N N   . CYS C 1 258 ? -13.715 -29.763 101.651 1.00 74.84  ? 259  CYS C N   1 
ATOM   7856  C CA  . CYS C 1 258 ? -14.975 -30.005 102.348 1.00 66.09  ? 259  CYS C CA  1 
ATOM   7857  C C   . CYS C 1 258 ? -16.050 -30.624 101.457 1.00 72.07  ? 259  CYS C C   1 
ATOM   7858  O O   . CYS C 1 258 ? -16.925 -31.329 101.948 1.00 89.16  ? 259  CYS C O   1 
ATOM   7859  C CB  . CYS C 1 258 ? -15.491 -28.714 102.987 1.00 61.24  ? 259  CYS C CB  1 
ATOM   7860  S SG  . CYS C 1 258 ? -14.846 -28.388 104.646 1.00 93.06  ? 259  CYS C SG  1 
ATOM   7861  N N   . LEU C 1 259 ? -15.996 -30.357 100.155 1.00 60.74  ? 260  LEU C N   1 
ATOM   7862  C CA  . LEU C 1 259 ? -17.014 -30.884 99.245  1.00 67.29  ? 260  LEU C CA  1 
ATOM   7863  C C   . LEU C 1 259 ? -16.619 -32.185 98.546  1.00 83.95  ? 260  LEU C C   1 
ATOM   7864  O O   . LEU C 1 259 ? -17.352 -32.684 97.692  1.00 94.72  ? 260  LEU C O   1 
ATOM   7865  C CB  . LEU C 1 259 ? -17.461 -29.830 98.232  1.00 69.86  ? 260  LEU C CB  1 
ATOM   7866  C CG  . LEU C 1 259 ? -18.496 -28.838 98.768  1.00 74.87  ? 260  LEU C CG  1 
ATOM   7867  C CD1 . LEU C 1 259 ? -19.077 -28.031 97.621  1.00 84.17  ? 260  LEU C CD1 1 
ATOM   7868  C CD2 . LEU C 1 259 ? -19.599 -29.550 99.550  1.00 60.13  ? 260  LEU C CD2 1 
ATOM   7869  N N   . GLY C 1 260 ? -15.456 -32.724 98.898  1.00 87.16  ? 261  GLY C N   1 
ATOM   7870  C CA  . GLY C 1 260 ? -15.050 -34.025 98.397  1.00 90.10  ? 261  GLY C CA  1 
ATOM   7871  C C   . GLY C 1 260 ? -14.055 -34.013 97.251  1.00 83.21  ? 261  GLY C C   1 
ATOM   7872  O O   . GLY C 1 260 ? -13.815 -35.044 96.621  1.00 82.49  ? 261  GLY C O   1 
ATOM   7873  N N   . VAL C 1 261 ? -13.473 -32.852 96.974  1.00 76.34  ? 262  VAL C N   1 
ATOM   7874  C CA  . VAL C 1 261 ? -12.414 -32.759 95.973  1.00 69.76  ? 262  VAL C CA  1 
ATOM   7875  C C   . VAL C 1 261 ? -11.152 -32.115 96.555  1.00 74.07  ? 262  VAL C C   1 
ATOM   7876  O O   . VAL C 1 261 ? -10.775 -31.010 96.168  1.00 78.36  ? 262  VAL C O   1 
ATOM   7877  C CB  . VAL C 1 261 ? -12.879 -31.999 94.709  1.00 62.44  ? 262  VAL C CB  1 
ATOM   7878  C CG1 . VAL C 1 261 ? -13.679 -32.920 93.800  1.00 44.65  ? 262  VAL C CG1 1 
ATOM   7879  C CG2 . VAL C 1 261 ? -13.701 -30.777 95.086  1.00 74.01  ? 262  VAL C CG2 1 
ATOM   7880  N N   . PRO C 1 262 ? -10.488 -32.820 97.483  1.00 76.21  ? 263  PRO C N   1 
ATOM   7881  C CA  . PRO C 1 262 ? -9.363  -32.265 98.245  1.00 82.04  ? 263  PRO C CA  1 
ATOM   7882  C C   . PRO C 1 262 ? -8.121  -32.027 97.392  1.00 82.25  ? 263  PRO C C   1 
ATOM   7883  O O   . PRO C 1 262 ? -7.310  -31.162 97.723  1.00 82.85  ? 263  PRO C O   1 
ATOM   7884  C CB  . PRO C 1 262 ? -9.090  -33.344 99.291  1.00 91.02  ? 263  PRO C CB  1 
ATOM   7885  C CG  . PRO C 1 262 ? -9.521  -34.605 98.637  1.00 77.24  ? 263  PRO C CG  1 
ATOM   7886  C CD  . PRO C 1 262 ? -10.704 -34.247 97.787  1.00 74.80  ? 263  PRO C CD  1 
ATOM   7887  N N   . GLY C 1 263 ? -7.974  -32.788 96.314  1.00 86.45  ? 264  GLY C N   1 
ATOM   7888  C CA  . GLY C 1 263 ? -6.813  -32.662 95.453  1.00 83.18  ? 264  GLY C CA  1 
ATOM   7889  C C   . GLY C 1 263 ? -7.042  -31.727 94.282  1.00 80.01  ? 264  GLY C C   1 
ATOM   7890  O O   . GLY C 1 263 ? -6.307  -31.762 93.295  1.00 74.78  ? 264  GLY C O   1 
ATOM   7891  N N   . ALA C 1 264 ? -8.063  -30.884 94.392  1.00 82.35  ? 265  ALA C N   1 
ATOM   7892  C CA  . ALA C 1 264 ? -8.394  -29.948 93.324  1.00 82.18  ? 265  ALA C CA  1 
ATOM   7893  C C   . ALA C 1 264 ? -7.747  -28.583 93.542  1.00 87.48  ? 265  ALA C C   1 
ATOM   7894  O O   . ALA C 1 264 ? -7.788  -28.031 94.643  1.00 83.01  ? 265  ALA C O   1 
ATOM   7895  C CB  . ALA C 1 264 ? -9.902  -29.807 93.191  1.00 70.29  ? 265  ALA C CB  1 
ATOM   7896  N N   . ARG C 1 265 ? -7.143  -28.048 92.486  1.00 89.33  ? 266  ARG C N   1 
ATOM   7897  C CA  . ARG C 1 265 ? -6.586  -26.703 92.526  1.00 89.65  ? 266  ARG C CA  1 
ATOM   7898  C C   . ARG C 1 265 ? -7.659  -25.676 92.178  1.00 76.71  ? 266  ARG C C   1 
ATOM   7899  O O   . ARG C 1 265 ? -8.484  -25.912 91.295  1.00 71.93  ? 266  ARG C O   1 
ATOM   7900  C CB  . ARG C 1 265 ? -5.405  -26.569 91.560  1.00 99.31  ? 266  ARG C CB  1 
ATOM   7901  C CG  . ARG C 1 265 ? -4.065  -27.035 92.117  1.00 114.87 ? 266  ARG C CG  1 
ATOM   7902  C CD  . ARG C 1 265 ? -3.834  -28.521 91.889  1.00 128.77 ? 266  ARG C CD  1 
ATOM   7903  N NE  . ARG C 1 265 ? -2.482  -28.922 92.275  1.00 141.94 ? 266  ARG C NE  1 
ATOM   7904  C CZ  . ARG C 1 265 ? -1.962  -30.123 92.043  1.00 149.87 ? 266  ARG C CZ  1 
ATOM   7905  N NH1 . ARG C 1 265 ? -2.678  -31.050 91.422  1.00 151.66 ? 266  ARG C NH1 1 
ATOM   7906  N NH2 . ARG C 1 265 ? -0.723  -30.397 92.430  1.00 151.36 ? 266  ARG C NH2 1 
ATOM   7907  N N   . PRO C 1 266 ? -7.657  -24.534 92.884  1.00 58.20  ? 267  PRO C N   1 
ATOM   7908  C CA  . PRO C 1 266 ? -8.585  -23.432 92.608  1.00 59.62  ? 267  PRO C CA  1 
ATOM   7909  C C   . PRO C 1 266 ? -8.363  -22.849 91.217  1.00 57.26  ? 267  PRO C C   1 
ATOM   7910  O O   . PRO C 1 266 ? -7.225  -22.790 90.756  1.00 45.58  ? 267  PRO C O   1 
ATOM   7911  C CB  . PRO C 1 266 ? -8.214  -22.392 93.670  1.00 47.40  ? 267  PRO C CB  1 
ATOM   7912  C CG  . PRO C 1 266 ? -7.577  -23.173 94.764  1.00 47.24  ? 267  PRO C CG  1 
ATOM   7913  C CD  . PRO C 1 266 ? -6.831  -24.274 94.075  1.00 50.55  ? 267  PRO C CD  1 
ATOM   7914  N N   . CYS C 1 267 ? -9.438  -22.429 90.558  1.00 67.24  ? 268  CYS C N   1 
ATOM   7915  C CA  . CYS C 1 267 ? -9.320  -21.782 89.256  1.00 64.87  ? 268  CYS C CA  1 
ATOM   7916  C C   . CYS C 1 267 ? -8.643  -20.426 89.415  1.00 70.98  ? 268  CYS C C   1 
ATOM   7917  O O   . CYS C 1 267 ? -8.998  -19.654 90.304  1.00 84.38  ? 268  CYS C O   1 
ATOM   7918  C CB  . CYS C 1 267 ? -10.695 -21.615 88.611  1.00 60.64  ? 268  CYS C CB  1 
ATOM   7919  S SG  . CYS C 1 267 ? -11.581 -23.166 88.335  1.00 96.01  ? 268  CYS C SG  1 
ATOM   7920  N N   . PRO C 1 268 ? -7.656  -20.139 88.557  1.00 59.32  ? 269  PRO C N   1 
ATOM   7921  C CA  . PRO C 1 268 ? -6.857  -18.910 88.612  1.00 61.57  ? 269  PRO C CA  1 
ATOM   7922  C C   . PRO C 1 268 ? -7.705  -17.638 88.611  1.00 60.78  ? 269  PRO C C   1 
ATOM   7923  O O   . PRO C 1 268 ? -7.438  -16.736 89.402  1.00 65.40  ? 269  PRO C O   1 
ATOM   7924  C CB  . PRO C 1 268 ? -6.015  -18.992 87.338  1.00 59.43  ? 269  PRO C CB  1 
ATOM   7925  C CG  . PRO C 1 268 ? -5.888  -20.442 87.079  1.00 41.67  ? 269  PRO C CG  1 
ATOM   7926  C CD  . PRO C 1 268 ? -7.199  -21.040 87.486  1.00 55.12  ? 269  PRO C CD  1 
ATOM   7927  N N   . ASP C 1 269 ? -8.714  -17.572 87.748  1.00 40.22  ? 270  ASP C N   1 
ATOM   7928  C CA  . ASP C 1 269 ? -9.576  -16.395 87.678  1.00 42.07  ? 270  ASP C CA  1 
ATOM   7929  C C   . ASP C 1 269 ? -10.448 -16.263 88.924  1.00 50.42  ? 270  ASP C C   1 
ATOM   7930  O O   . ASP C 1 269 ? -10.707 -15.156 89.400  1.00 63.12  ? 270  ASP C O   1 
ATOM   7931  C CB  . ASP C 1 269 ? -10.445 -16.435 86.420  1.00 52.32  ? 270  ASP C CB  1 
ATOM   7932  C CG  . ASP C 1 269 ? -9.624  -16.544 85.151  1.00 71.91  ? 270  ASP C CG  1 
ATOM   7933  O OD1 . ASP C 1 269 ? -8.630  -17.301 85.155  1.00 86.95  ? 270  ASP C OD1 1 
ATOM   7934  O OD2 . ASP C 1 269 ? -9.964  -15.872 84.154  1.00 62.45  ? 270  ASP C OD2 1 
ATOM   7935  N N   . TYR C 1 270 ? -10.898 -17.403 89.440  1.00 49.31  ? 271  TYR C N   1 
ATOM   7936  C CA  . TYR C 1 270 ? -11.658 -17.456 90.682  1.00 50.75  ? 271  TYR C CA  1 
ATOM   7937  C C   . TYR C 1 270 ? -10.829 -16.846 91.811  1.00 45.88  ? 271  TYR C C   1 
ATOM   7938  O O   . TYR C 1 270 ? -11.276 -15.924 92.505  1.00 54.41  ? 271  TYR C O   1 
ATOM   7939  C CB  . TYR C 1 270 ? -12.017 -18.914 90.995  1.00 50.40  ? 271  TYR C CB  1 
ATOM   7940  C CG  . TYR C 1 270 ? -12.702 -19.149 92.321  1.00 54.05  ? 271  TYR C CG  1 
ATOM   7941  C CD1 . TYR C 1 270 ? -13.533 -18.189 92.886  1.00 51.96  ? 271  TYR C CD1 1 
ATOM   7942  C CD2 . TYR C 1 270 ? -12.512 -20.337 93.013  1.00 53.15  ? 271  TYR C CD2 1 
ATOM   7943  C CE1 . TYR C 1 270 ? -14.151 -18.407 94.100  1.00 42.57  ? 271  TYR C CE1 1 
ATOM   7944  C CE2 . TYR C 1 270 ? -13.128 -20.564 94.226  1.00 54.09  ? 271  TYR C CE2 1 
ATOM   7945  C CZ  . TYR C 1 270 ? -13.946 -19.595 94.765  1.00 47.29  ? 271  TYR C CZ  1 
ATOM   7946  O OH  . TYR C 1 270 ? -14.562 -19.814 95.974  1.00 47.71  ? 271  TYR C OH  1 
ATOM   7947  N N   . CYS C 1 271 ? -9.613  -17.360 91.972  1.00 34.35  ? 272  CYS C N   1 
ATOM   7948  C CA  . CYS C 1 271 ? -8.672  -16.865 92.969  1.00 48.93  ? 272  CYS C CA  1 
ATOM   7949  C C   . CYS C 1 271 ? -8.402  -15.371 92.791  1.00 56.35  ? 272  CYS C C   1 
ATOM   7950  O O   . CYS C 1 271 ? -8.337  -14.617 93.766  1.00 50.95  ? 272  CYS C O   1 
ATOM   7951  C CB  . CYS C 1 271 ? -7.364  -17.657 92.884  1.00 20.00  ? 272  CYS C CB  1 
ATOM   7952  S SG  . CYS C 1 271 ? -6.120  -17.221 94.120  1.00 76.82  ? 272  CYS C SG  1 
ATOM   7953  N N   . ARG C 1 272 ? -8.245  -14.950 91.539  1.00 52.79  ? 273  ARG C N   1 
ATOM   7954  C CA  . ARG C 1 272 ? -7.970  -13.552 91.231  1.00 42.88  ? 273  ARG C CA  1 
ATOM   7955  C C   . ARG C 1 272 ? -9.128  -12.639 91.619  1.00 46.19  ? 273  ARG C C   1 
ATOM   7956  O O   . ARG C 1 272 ? -8.909  -11.520 92.077  1.00 54.12  ? 273  ARG C O   1 
ATOM   7957  C CB  . ARG C 1 272 ? -7.617  -13.373 89.752  1.00 30.72  ? 273  ARG C CB  1 
ATOM   7958  C CG  . ARG C 1 272 ? -6.136  -13.547 89.451  1.00 38.18  ? 273  ARG C CG  1 
ATOM   7959  C CD  . ARG C 1 272 ? -5.804  -13.148 88.020  1.00 56.30  ? 273  ARG C CD  1 
ATOM   7960  N NE  . ARG C 1 272 ? -5.919  -14.267 87.089  1.00 67.89  ? 273  ARG C NE  1 
ATOM   7961  C CZ  . ARG C 1 272 ? -4.904  -15.052 86.740  1.00 75.08  ? 273  ARG C CZ  1 
ATOM   7962  N NH1 . ARG C 1 272 ? -3.696  -14.839 87.245  1.00 73.41  ? 273  ARG C NH1 1 
ATOM   7963  N NH2 . ARG C 1 272 ? -5.094  -16.049 85.887  1.00 70.54  ? 273  ARG C NH2 1 
ATOM   7964  N N   . ASN C 1 273 ? -10.357 -13.112 91.443  1.00 34.05  ? 274  ASN C N   1 
ATOM   7965  C CA  . ASN C 1 273 ? -11.517 -12.330 91.855  1.00 35.74  ? 274  ASN C CA  1 
ATOM   7966  C C   . ASN C 1 273 ? -11.679 -12.288 93.374  1.00 33.00  ? 274  ASN C C   1 
ATOM   7967  O O   . ASN C 1 273 ? -12.072 -11.260 93.939  1.00 32.49  ? 274  ASN C O   1 
ATOM   7968  C CB  . ASN C 1 273 ? -12.795 -12.832 91.180  1.00 40.07  ? 274  ASN C CB  1 
ATOM   7969  C CG  . ASN C 1 273 ? -13.015 -12.205 89.816  1.00 48.41  ? 274  ASN C CG  1 
ATOM   7970  O OD1 . ASN C 1 273 ? -12.507 -11.120 89.532  1.00 47.09  ? 274  ASN C OD1 1 
ATOM   7971  N ND2 . ASN C 1 273 ? -13.778 -12.882 88.967  1.00 53.58  ? 274  ASN C ND2 1 
ATOM   7972  N N   . VAL C 1 274 ? -11.370 -13.402 94.033  1.00 30.50  ? 275  VAL C N   1 
ATOM   7973  C CA  . VAL C 1 274 ? -11.399 -13.439 95.491  1.00 33.44  ? 275  VAL C CA  1 
ATOM   7974  C C   . VAL C 1 274 ? -10.398 -12.440 96.064  1.00 46.92  ? 275  VAL C C   1 
ATOM   7975  O O   . VAL C 1 274 ? -10.726 -11.649 96.953  1.00 48.73  ? 275  VAL C O   1 
ATOM   7976  C CB  . VAL C 1 274 ? -11.054 -14.838 96.034  1.00 34.76  ? 275  VAL C CB  1 
ATOM   7977  C CG1 . VAL C 1 274 ? -10.944 -14.808 97.552  1.00 31.44  ? 275  VAL C CG1 1 
ATOM   7978  C CG2 . VAL C 1 274 ? -12.090 -15.852 95.600  1.00 52.20  ? 275  VAL C CG2 1 
ATOM   7979  N N   . LEU C 1 275 ? -9.175  -12.477 95.546  1.00 46.13  ? 276  LEU C N   1 
ATOM   7980  C CA  . LEU C 1 275 ? -8.118  -11.601 96.042  1.00 41.00  ? 276  LEU C CA  1 
ATOM   7981  C C   . LEU C 1 275 ? -8.290  -10.143 95.620  1.00 51.88  ? 276  LEU C C   1 
ATOM   7982  O O   . LEU C 1 275 ? -7.834  -9.236  96.313  1.00 58.37  ? 276  LEU C O   1 
ATOM   7983  C CB  . LEU C 1 275 ? -6.739  -12.127 95.643  1.00 33.46  ? 276  LEU C CB  1 
ATOM   7984  C CG  . LEU C 1 275 ? -6.283  -13.372 96.405  1.00 47.45  ? 276  LEU C CG  1 
ATOM   7985  C CD1 . LEU C 1 275 ? -4.822  -13.665 96.119  1.00 42.88  ? 276  LEU C CD1 1 
ATOM   7986  C CD2 . LEU C 1 275 ? -6.519  -13.209 97.900  1.00 51.41  ? 276  LEU C CD2 1 
ATOM   7987  N N   . LYS C 1 276 ? -8.941  -9.915  94.485  1.00 45.01  ? 277  LYS C N   1 
ATOM   7988  C CA  . LYS C 1 276 ? -9.256  -8.549  94.077  1.00 43.31  ? 277  LYS C CA  1 
ATOM   7989  C C   . LYS C 1 276 ? -10.366 -7.997  94.956  1.00 46.07  ? 277  LYS C C   1 
ATOM   7990  O O   . LYS C 1 276 ? -10.456 -6.789  95.179  1.00 59.30  ? 277  LYS C O   1 
ATOM   7991  C CB  . LYS C 1 276 ? -9.647  -8.467  92.598  1.00 36.38  ? 277  LYS C CB  1 
ATOM   7992  C CG  . LYS C 1 276 ? -8.458  -8.382  91.657  1.00 38.31  ? 277  LYS C CG  1 
ATOM   7993  C CD  . LYS C 1 276 ? -8.896  -8.156  90.221  1.00 39.15  ? 277  LYS C CD  1 
ATOM   7994  C CE  . LYS C 1 276 ? -7.690  -8.005  89.306  1.00 40.19  ? 277  LYS C CE  1 
ATOM   7995  N NZ  . LYS C 1 276 ? -8.079  -7.760  87.889  1.00 46.03  ? 277  LYS C NZ  1 
ATOM   7996  N N   . GLY C 1 277 ? -11.210 -8.893  95.455  1.00 47.50  ? 278  GLY C N   1 
ATOM   7997  C CA  . GLY C 1 277 ? -12.239 -8.512  96.401  1.00 41.12  ? 278  GLY C CA  1 
ATOM   7998  C C   . GLY C 1 277 ? -11.635 -8.170  97.750  1.00 38.77  ? 278  GLY C C   1 
ATOM   7999  O O   . GLY C 1 277 ? -12.006 -7.178  98.373  1.00 42.68  ? 278  GLY C O   1 
ATOM   8000  N N   . CYS C 1 278 ? -10.690 -8.990  98.197  1.00 45.55  ? 279  CYS C N   1 
ATOM   8001  C CA  . CYS C 1 278 ? -10.071 -8.796  99.506  1.00 60.23  ? 279  CYS C CA  1 
ATOM   8002  C C   . CYS C 1 278 ? -9.120  -7.597  99.556  1.00 65.60  ? 279  CYS C C   1 
ATOM   8003  O O   . CYS C 1 278 ? -9.098  -6.845  100.530 1.00 74.57  ? 279  CYS C O   1 
ATOM   8004  C CB  . CYS C 1 278 ? -9.332  -10.068 99.931  1.00 62.65  ? 279  CYS C CB  1 
ATOM   8005  S SG  . CYS C 1 278 ? -10.389 -11.529 100.062 1.00 76.84  ? 279  CYS C SG  1 
ATOM   8006  N N   . LEU C 1 279 ? -8.334  -7.432  98.498  1.00 56.96  ? 280  LEU C N   1 
ATOM   8007  C CA  . LEU C 1 279 ? -7.264  -6.433  98.456  1.00 44.33  ? 280  LEU C CA  1 
ATOM   8008  C C   . LEU C 1 279 ? -7.625  -5.088  97.808  1.00 51.51  ? 280  LEU C C   1 
ATOM   8009  O O   . LEU C 1 279 ? -6.747  -4.253  97.604  1.00 50.63  ? 280  LEU C O   1 
ATOM   8010  C CB  . LEU C 1 279 ? -6.009  -7.017  97.797  1.00 27.72  ? 280  LEU C CB  1 
ATOM   8011  C CG  . LEU C 1 279 ? -5.456  -8.289  98.444  1.00 34.10  ? 280  LEU C CG  1 
ATOM   8012  C CD1 . LEU C 1 279 ? -4.272  -8.843  97.661  1.00 38.75  ? 280  LEU C CD1 1 
ATOM   8013  C CD2 . LEU C 1 279 ? -5.075  -8.028  99.894  1.00 28.29  ? 280  LEU C CD2 1 
ATOM   8014  N N   . ALA C 1 280 ? -8.900  -4.892  97.479  1.00 54.88  ? 281  ALA C N   1 
ATOM   8015  C CA  . ALA C 1 280 ? -9.357  -3.717  96.724  1.00 65.77  ? 281  ALA C CA  1 
ATOM   8016  C C   . ALA C 1 280 ? -8.853  -2.366  97.250  1.00 65.79  ? 281  ALA C C   1 
ATOM   8017  O O   . ALA C 1 280 ? -8.292  -1.562  96.488  1.00 83.35  ? 281  ALA C O   1 
ATOM   8018  C CB  . ALA C 1 280 ? -10.873 -3.710  96.649  1.00 76.78  ? 281  ALA C CB  1 
ATOM   8019  N N   . ASN C 1 281 ? -9.062  -2.113  98.540  1.00 41.72  ? 282  ASN C N   1 
ATOM   8020  C CA  . ASN C 1 281 ? -8.584  -0.879  99.157  1.00 50.12  ? 282  ASN C CA  1 
ATOM   8021  C C   . ASN C 1 281 ? -7.084  -0.683  98.958  1.00 44.64  ? 282  ASN C C   1 
ATOM   8022  O O   . ASN C 1 281 ? -6.636  0.413   98.628  1.00 37.87  ? 282  ASN C O   1 
ATOM   8023  C CB  . ASN C 1 281 ? -8.943  -0.823  100.644 1.00 69.02  ? 282  ASN C CB  1 
ATOM   8024  C CG  . ASN C 1 281 ? -10.360 -0.341  100.883 1.00 81.76  ? 282  ASN C CG  1 
ATOM   8025  O OD1 . ASN C 1 281 ? -10.652 0.849   100.754 1.00 75.58  ? 282  ASN C OD1 1 
ATOM   8026  N ND2 . ASN C 1 281 ? -11.247 -1.261  101.248 1.00 89.27  ? 282  ASN C ND2 1 
ATOM   8027  N N   . GLN C 1 282 ? -6.318  -1.753  99.146  1.00 47.85  ? 283  GLN C N   1 
ATOM   8028  C CA  . GLN C 1 282 ? -4.884  -1.724  98.881  1.00 32.98  ? 283  GLN C CA  1 
ATOM   8029  C C   . GLN C 1 282 ? -4.618  -1.382  97.417  1.00 38.33  ? 283  GLN C C   1 
ATOM   8030  O O   . GLN C 1 282 ? -3.696  -0.631  97.101  1.00 51.97  ? 283  GLN C O   1 
ATOM   8031  C CB  . GLN C 1 282 ? -4.238  -3.071  99.226  1.00 31.45  ? 283  GLN C CB  1 
ATOM   8032  C CG  . GLN C 1 282 ? -4.232  -3.419  100.711 1.00 42.53  ? 283  GLN C CG  1 
ATOM   8033  C CD  . GLN C 1 282 ? -5.576  -3.914  101.211 1.00 43.13  ? 283  GLN C CD  1 
ATOM   8034  O OE1 . GLN C 1 282 ? -6.546  -3.979  100.458 1.00 54.80  ? 283  GLN C OE1 1 
ATOM   8035  N NE2 . GLN C 1 282 ? -5.639  -4.268  102.489 1.00 47.61  ? 283  GLN C NE2 1 
ATOM   8036  N N   . ALA C 1 283 ? -5.445  -1.926  96.530  1.00 36.23  ? 284  ALA C N   1 
ATOM   8037  C CA  . ALA C 1 283 ? -5.286  -1.724  95.095  1.00 48.19  ? 284  ALA C CA  1 
ATOM   8038  C C   . ALA C 1 283 ? -5.628  -0.298  94.681  1.00 47.47  ? 284  ALA C C   1 
ATOM   8039  O O   . ALA C 1 283 ? -5.309  0.124   93.569  1.00 52.29  ? 284  ALA C O   1 
ATOM   8040  C CB  . ALA C 1 283 ? -6.133  -2.721  94.318  1.00 57.22  ? 284  ALA C CB  1 
ATOM   8041  N N   . ASP C 1 284 ? -6.284  0.438   95.574  1.00 54.02  ? 285  ASP C N   1 
ATOM   8042  C CA  . ASP C 1 284 ? -6.561  1.854   95.322  1.00 62.04  ? 285  ASP C CA  1 
ATOM   8043  C C   . ASP C 1 284 ? -5.315  2.745   95.375  1.00 57.81  ? 285  ASP C C   1 
ATOM   8044  O O   . ASP C 1 284 ? -5.350  3.891   94.929  1.00 44.52  ? 285  ASP C O   1 
ATOM   8045  C CB  . ASP C 1 284 ? -7.620  2.388   96.287  1.00 61.80  ? 285  ASP C CB  1 
ATOM   8046  C CG  . ASP C 1 284 ? -9.027  2.124   95.805  1.00 64.60  ? 285  ASP C CG  1 
ATOM   8047  O OD1 . ASP C 1 284 ? -9.216  1.956   94.580  1.00 43.81  ? 285  ASP C OD1 1 
ATOM   8048  O OD2 . ASP C 1 284 ? -9.944  2.092   96.650  1.00 78.19  ? 285  ASP C OD2 1 
ATOM   8049  N N   . LEU C 1 285 ? -4.221  2.216   95.914  1.00 67.81  ? 286  LEU C N   1 
ATOM   8050  C CA  . LEU C 1 285 ? -2.979  2.978   96.056  1.00 52.39  ? 286  LEU C CA  1 
ATOM   8051  C C   . LEU C 1 285 ? -2.216  3.106   94.739  1.00 48.51  ? 286  LEU C C   1 
ATOM   8052  O O   . LEU C 1 285 ? -1.233  3.848   94.649  1.00 35.70  ? 286  LEU C O   1 
ATOM   8053  C CB  . LEU C 1 285 ? -2.077  2.321   97.103  1.00 42.46  ? 286  LEU C CB  1 
ATOM   8054  C CG  . LEU C 1 285 ? -2.522  2.399   98.564  1.00 45.57  ? 286  LEU C CG  1 
ATOM   8055  C CD1 . LEU C 1 285 ? -1.845  1.319   99.389  1.00 36.19  ? 286  LEU C CD1 1 
ATOM   8056  C CD2 . LEU C 1 285 ? -2.207  3.769   99.132  1.00 44.50  ? 286  LEU C CD2 1 
ATOM   8057  N N   . ASP C 1 286 ? -2.685  2.387   93.723  1.00 54.47  ? 287  ASP C N   1 
ATOM   8058  C CA  . ASP C 1 286 ? -1.972  2.251   92.454  1.00 49.20  ? 287  ASP C CA  1 
ATOM   8059  C C   . ASP C 1 286 ? -1.556  3.578   91.814  1.00 35.19  ? 287  ASP C C   1 
ATOM   8060  O O   . ASP C 1 286 ? -0.376  3.790   91.526  1.00 44.68  ? 287  ASP C O   1 
ATOM   8061  C CB  . ASP C 1 286 ? -2.811  1.436   91.463  1.00 45.29  ? 287  ASP C CB  1 
ATOM   8062  C CG  . ASP C 1 286 ? -2.034  1.054   90.217  1.00 49.87  ? 287  ASP C CG  1 
ATOM   8063  O OD1 . ASP C 1 286 ? -0.854  0.668   90.347  1.00 59.08  ? 287  ASP C OD1 1 
ATOM   8064  O OD2 . ASP C 1 286 ? -2.601  1.142   89.107  1.00 46.60  ? 287  ASP C OD2 1 
ATOM   8065  N N   . ALA C 1 287 ? -2.525  4.466   91.609  1.00 36.07  ? 288  ALA C N   1 
ATOM   8066  C CA  . ALA C 1 287 ? -2.294  5.724   90.899  1.00 46.32  ? 288  ALA C CA  1 
ATOM   8067  C C   . ALA C 1 287 ? -1.206  6.596   91.529  1.00 48.34  ? 288  ALA C C   1 
ATOM   8068  O O   . ALA C 1 287 ? -0.246  6.988   90.859  1.00 32.65  ? 288  ALA C O   1 
ATOM   8069  C CB  . ALA C 1 287 ? -3.592  6.507   90.779  1.00 33.25  ? 288  ALA C CB  1 
ATOM   8070  N N   . GLU C 1 288 ? -1.360  6.898   92.814  1.00 47.16  ? 289  GLU C N   1 
ATOM   8071  C CA  . GLU C 1 288 ? -0.422  7.780   93.501  1.00 47.62  ? 289  GLU C CA  1 
ATOM   8072  C C   . GLU C 1 288 ? 0.907   7.096   93.818  1.00 52.02  ? 289  GLU C C   1 
ATOM   8073  O O   . GLU C 1 288 ? 1.936   7.764   93.950  1.00 61.99  ? 289  GLU C O   1 
ATOM   8074  C CB  . GLU C 1 288 ? -1.053  8.364   94.768  1.00 45.23  ? 289  GLU C CB  1 
ATOM   8075  C CG  . GLU C 1 288 ? -2.285  9.218   94.499  1.00 56.34  ? 289  GLU C CG  1 
ATOM   8076  C CD  . GLU C 1 288 ? -2.033  10.317  93.479  1.00 63.68  ? 289  GLU C CD  1 
ATOM   8077  O OE1 . GLU C 1 288 ? -0.962  10.958  93.540  1.00 86.74  ? 289  GLU C OE1 1 
ATOM   8078  O OE2 . GLU C 1 288 ? -2.906  10.539  92.614  1.00 51.48  ? 289  GLU C OE2 1 
ATOM   8079  N N   . TRP C 1 289 ? 0.886   5.771   93.942  1.00 36.84  ? 290  TRP C N   1 
ATOM   8080  C CA  . TRP C 1 289 ? 2.126   5.013   94.080  1.00 43.16  ? 290  TRP C CA  1 
ATOM   8081  C C   . TRP C 1 289 ? 2.953   5.171   92.809  1.00 49.59  ? 290  TRP C C   1 
ATOM   8082  O O   . TRP C 1 289 ? 4.147   5.495   92.859  1.00 49.60  ? 290  TRP C O   1 
ATOM   8083  C CB  . TRP C 1 289 ? 1.826   3.535   94.339  1.00 45.44  ? 290  TRP C CB  1 
ATOM   8084  C CG  . TRP C 1 289 ? 3.039   2.656   94.432  1.00 46.44  ? 290  TRP C CG  1 
ATOM   8085  C CD1 . TRP C 1 289 ? 3.559   1.868   93.445  1.00 57.70  ? 290  TRP C CD1 1 
ATOM   8086  C CD2 . TRP C 1 289 ? 3.876   2.461   95.579  1.00 43.13  ? 290  TRP C CD2 1 
ATOM   8087  N NE1 . TRP C 1 289 ? 4.668   1.200   93.905  1.00 48.97  ? 290  TRP C NE1 1 
ATOM   8088  C CE2 . TRP C 1 289 ? 4.883   1.548   95.213  1.00 38.62  ? 290  TRP C CE2 1 
ATOM   8089  C CE3 . TRP C 1 289 ? 3.870   2.975   96.880  1.00 47.16  ? 290  TRP C CE3 1 
ATOM   8090  C CZ2 . TRP C 1 289 ? 5.875   1.135   96.099  1.00 26.17  ? 290  TRP C CZ2 1 
ATOM   8091  C CZ3 . TRP C 1 289 ? 4.857   2.564   97.758  1.00 51.74  ? 290  TRP C CZ3 1 
ATOM   8092  C CH2 . TRP C 1 289 ? 5.845   1.653   97.363  1.00 43.42  ? 290  TRP C CH2 1 
ATOM   8093  N N   . ARG C 1 290 ? 2.302   4.953   91.671  1.00 42.07  ? 291  ARG C N   1 
ATOM   8094  C CA  . ARG C 1 290 ? 2.953   5.111   90.378  1.00 37.50  ? 291  ARG C CA  1 
ATOM   8095  C C   . ARG C 1 290 ? 3.454   6.534   90.180  1.00 43.82  ? 291  ARG C C   1 
ATOM   8096  O O   . ARG C 1 290 ? 4.575   6.739   89.722  1.00 47.62  ? 291  ARG C O   1 
ATOM   8097  C CB  . ARG C 1 290 ? 2.007   4.719   89.245  1.00 33.60  ? 291  ARG C CB  1 
ATOM   8098  C CG  . ARG C 1 290 ? 1.709   3.238   89.197  1.00 43.95  ? 291  ARG C CG  1 
ATOM   8099  C CD  . ARG C 1 290 ? 0.781   2.887   88.053  1.00 34.23  ? 291  ARG C CD  1 
ATOM   8100  N NE  . ARG C 1 290 ? 0.571   1.446   87.978  1.00 52.38  ? 291  ARG C NE  1 
ATOM   8101  C CZ  . ARG C 1 290 ? 1.369   0.610   87.323  1.00 50.03  ? 291  ARG C CZ  1 
ATOM   8102  N NH1 . ARG C 1 290 ? 2.431   1.072   86.676  1.00 63.19  ? 291  ARG C NH1 1 
ATOM   8103  N NH2 . ARG C 1 290 ? 1.103   -0.688  87.312  1.00 48.41  ? 291  ARG C NH2 1 
ATOM   8104  N N   . ASN C 1 291 ? 2.621   7.512   90.526  1.00 45.94  ? 292  ASN C N   1 
ATOM   8105  C CA  . ASN C 1 291 ? 3.003   8.916   90.403  1.00 40.02  ? 292  ASN C CA  1 
ATOM   8106  C C   . ASN C 1 291 ? 4.227   9.270   91.244  1.00 48.53  ? 292  ASN C C   1 
ATOM   8107  O O   . ASN C 1 291 ? 5.162   9.924   90.759  1.00 54.98  ? 292  ASN C O   1 
ATOM   8108  C CB  . ASN C 1 291 ? 1.829   9.828   90.758  1.00 46.44  ? 292  ASN C CB  1 
ATOM   8109  C CG  . ASN C 1 291 ? 0.838   9.963   89.621  1.00 52.86  ? 292  ASN C CG  1 
ATOM   8110  O OD1 . ASN C 1 291 ? 1.197   9.823   88.451  1.00 47.66  ? 292  ASN C OD1 1 
ATOM   8111  N ND2 . ASN C 1 291 ? -0.415  10.242  89.958  1.00 55.40  ? 292  ASN C ND2 1 
ATOM   8112  N N   . LEU C 1 292 ? 4.217   8.830   92.500  1.00 43.92  ? 293  LEU C N   1 
ATOM   8113  C CA  . LEU C 1 292 ? 5.362   9.028   93.379  1.00 47.50  ? 293  LEU C CA  1 
ATOM   8114  C C   . LEU C 1 292 ? 6.622   8.419   92.779  1.00 55.98  ? 293  LEU C C   1 
ATOM   8115  O O   . LEU C 1 292 ? 7.637   9.097   92.659  1.00 56.63  ? 293  LEU C O   1 
ATOM   8116  C CB  . LEU C 1 292 ? 5.118   8.431   94.765  1.00 47.52  ? 293  LEU C CB  1 
ATOM   8117  C CG  . LEU C 1 292 ? 6.377   8.474   95.637  1.00 44.74  ? 293  LEU C CG  1 
ATOM   8118  C CD1 . LEU C 1 292 ? 6.690   9.904   96.059  1.00 50.23  ? 293  LEU C CD1 1 
ATOM   8119  C CD2 . LEU C 1 292 ? 6.267   7.557   96.844  1.00 35.76  ? 293  LEU C CD2 1 
ATOM   8120  N N   . LEU C 1 293 ? 6.551   7.145   92.399  1.00 58.00  ? 294  LEU C N   1 
ATOM   8121  C CA  . LEU C 1 293 ? 7.706   6.458   91.819  1.00 46.76  ? 294  LEU C CA  1 
ATOM   8122  C C   . LEU C 1 293 ? 8.240   7.153   90.565  1.00 53.08  ? 294  LEU C C   1 
ATOM   8123  O O   . LEU C 1 293 ? 9.452   7.298   90.396  1.00 66.38  ? 294  LEU C O   1 
ATOM   8124  C CB  . LEU C 1 293 ? 7.370   4.998   91.508  1.00 42.59  ? 294  LEU C CB  1 
ATOM   8125  C CG  . LEU C 1 293 ? 7.837   3.943   92.515  1.00 35.89  ? 294  LEU C CG  1 
ATOM   8126  C CD1 . LEU C 1 293 ? 7.363   4.262   93.922  1.00 30.51  ? 294  LEU C CD1 1 
ATOM   8127  C CD2 . LEU C 1 293 ? 7.353   2.568   92.093  1.00 51.44  ? 294  LEU C CD2 1 
ATOM   8128  N N   . ASP C 1 294 ? 7.331   7.582   89.694  1.00 51.76  ? 295  ASP C N   1 
ATOM   8129  C CA  . ASP C 1 294 ? 7.709   8.292   88.476  1.00 62.48  ? 295  ASP C CA  1 
ATOM   8130  C C   . ASP C 1 294 ? 8.455   9.577   88.815  1.00 62.30  ? 295  ASP C C   1 
ATOM   8131  O O   . ASP C 1 294 ? 9.485   9.886   88.211  1.00 56.46  ? 295  ASP C O   1 
ATOM   8132  C CB  . ASP C 1 294 ? 6.477   8.613   87.626  1.00 74.30  ? 295  ASP C CB  1 
ATOM   8133  C CG  . ASP C 1 294 ? 5.859   7.375   87.003  1.00 99.47  ? 295  ASP C CG  1 
ATOM   8134  O OD1 . ASP C 1 294 ? 6.589   6.382   86.806  1.00 111.16 ? 295  ASP C OD1 1 
ATOM   8135  O OD2 . ASP C 1 294 ? 4.645   7.397   86.705  1.00 99.32  ? 295  ASP C OD2 1 
ATOM   8136  N N   . SER C 1 295 ? 7.932   10.322  89.784  1.00 61.98  ? 296  SER C N   1 
ATOM   8137  C CA  . SER C 1 295 ? 8.604   11.535  90.237  1.00 57.80  ? 296  SER C CA  1 
ATOM   8138  C C   . SER C 1 295 ? 9.985   11.214  90.815  1.00 60.38  ? 296  SER C C   1 
ATOM   8139  O O   . SER C 1 295 ? 10.946  11.968  90.628  1.00 73.67  ? 296  SER C O   1 
ATOM   8140  C CB  . SER C 1 295 ? 7.747   12.268  91.272  1.00 61.40  ? 296  SER C CB  1 
ATOM   8141  O OG  . SER C 1 295 ? 7.552   11.474  92.430  1.00 76.60  ? 296  SER C OG  1 
ATOM   8142  N N   . MET C 1 296 ? 10.081  10.079  91.501  1.00 47.32  ? 297  MET C N   1 
ATOM   8143  C CA  . MET C 1 296 ? 11.322  9.676   92.150  1.00 49.69  ? 297  MET C CA  1 
ATOM   8144  C C   . MET C 1 296 ? 12.410  9.303   91.150  1.00 53.21  ? 297  MET C C   1 
ATOM   8145  O O   . MET C 1 296 ? 13.579  9.621   91.357  1.00 56.03  ? 297  MET C O   1 
ATOM   8146  C CB  . MET C 1 296 ? 11.080  8.530   93.133  1.00 45.61  ? 297  MET C CB  1 
ATOM   8147  C CG  . MET C 1 296 ? 10.250  8.922   94.343  1.00 56.32  ? 297  MET C CG  1 
ATOM   8148  S SD  . MET C 1 296 ? 10.641  7.919   95.782  1.00 55.95  ? 297  MET C SD  1 
ATOM   8149  C CE  . MET C 1 296 ? 12.396  8.239   95.889  1.00 146.34 ? 297  MET C CE  1 
ATOM   8150  N N   . VAL C 1 297 ? 12.031  8.628   90.070  1.00 49.66  ? 298  VAL C N   1 
ATOM   8151  C CA  . VAL C 1 297 ? 13.000  8.302   89.030  1.00 55.22  ? 298  VAL C CA  1 
ATOM   8152  C C   . VAL C 1 297 ? 13.261  9.524   88.157  1.00 64.00  ? 298  VAL C C   1 
ATOM   8153  O O   . VAL C 1 297 ? 14.264  9.589   87.447  1.00 72.08  ? 298  VAL C O   1 
ATOM   8154  C CB  . VAL C 1 297 ? 12.547  7.118   88.151  1.00 52.16  ? 298  VAL C CB  1 
ATOM   8155  C CG1 . VAL C 1 297 ? 12.112  5.951   89.021  1.00 66.21  ? 298  VAL C CG1 1 
ATOM   8156  C CG2 . VAL C 1 297 ? 11.427  7.538   87.213  1.00 55.12  ? 298  VAL C CG2 1 
ATOM   8157  N N   . LEU C 1 298 ? 12.354  10.493  88.217  1.00 70.10  ? 299  LEU C N   1 
ATOM   8158  C CA  . LEU C 1 298 ? 12.505  11.716  87.441  1.00 72.35  ? 299  LEU C CA  1 
ATOM   8159  C C   . LEU C 1 298 ? 13.480  12.689  88.097  1.00 65.67  ? 299  LEU C C   1 
ATOM   8160  O O   . LEU C 1 298 ? 14.188  13.423  87.407  1.00 74.41  ? 299  LEU C O   1 
ATOM   8161  C CB  . LEU C 1 298 ? 11.148  12.392  87.237  1.00 74.11  ? 299  LEU C CB  1 
ATOM   8162  C CG  . LEU C 1 298 ? 11.075  13.465  86.150  1.00 66.80  ? 299  LEU C CG  1 
ATOM   8163  C CD1 . LEU C 1 298 ? 11.327  12.853  84.781  1.00 54.19  ? 299  LEU C CD1 1 
ATOM   8164  C CD2 . LEU C 1 298 ? 9.731   14.174  86.186  1.00 75.14  ? 299  LEU C CD2 1 
ATOM   8165  N N   . ILE C 1 299 ? 13.515  12.691  89.429  1.00 61.03  ? 300  ILE C N   1 
ATOM   8166  C CA  . ILE C 1 299 ? 14.325  13.655  90.174  1.00 53.41  ? 300  ILE C CA  1 
ATOM   8167  C C   . ILE C 1 299 ? 15.824  13.358  90.082  1.00 64.45  ? 300  ILE C C   1 
ATOM   8168  O O   . ILE C 1 299 ? 16.649  14.223  90.371  1.00 83.62  ? 300  ILE C O   1 
ATOM   8169  C CB  . ILE C 1 299 ? 13.901  13.735  91.666  1.00 56.63  ? 300  ILE C CB  1 
ATOM   8170  C CG1 . ILE C 1 299 ? 14.374  15.050  92.295  1.00 58.91  ? 300  ILE C CG1 1 
ATOM   8171  C CG2 . ILE C 1 299 ? 14.418  12.531  92.443  1.00 59.75  ? 300  ILE C CG2 1 
ATOM   8172  C CD1 . ILE C 1 299 ? 13.880  16.275  91.567  1.00 60.78  ? 300  ILE C CD1 1 
ATOM   8173  N N   . THR C 1 300 ? 16.175  12.139  89.677  1.00 67.85  ? 301  THR C N   1 
ATOM   8174  C CA  . THR C 1 300 ? 17.579  11.745  89.575  1.00 73.20  ? 301  THR C CA  1 
ATOM   8175  C C   . THR C 1 300 ? 18.319  12.576  88.530  1.00 79.06  ? 301  THR C C   1 
ATOM   8176  O O   . THR C 1 300 ? 19.516  12.817  88.664  1.00 96.62  ? 301  THR C O   1 
ATOM   8177  C CB  . THR C 1 300 ? 17.738  10.257  89.228  1.00 77.44  ? 301  THR C CB  1 
ATOM   8178  O OG1 . THR C 1 300 ? 17.154  10.002  87.944  1.00 91.60  ? 301  THR C OG1 1 
ATOM   8179  C CG2 . THR C 1 300 ? 17.073  9.384   90.286  1.00 66.78  ? 301  THR C CG2 1 
ATOM   8180  N N   . ASP C 1 301 ? 17.601  13.015  87.497  1.00 59.48  ? 302  ASP C N   1 
ATOM   8181  C CA  . ASP C 1 301 ? 18.170  13.871  86.453  1.00 74.40  ? 302  ASP C CA  1 
ATOM   8182  C C   . ASP C 1 301 ? 18.849  15.112  87.024  1.00 76.53  ? 302  ASP C C   1 
ATOM   8183  O O   . ASP C 1 301 ? 19.817  15.617  86.466  1.00 63.77  ? 302  ASP C O   1 
ATOM   8184  C CB  . ASP C 1 301 ? 17.078  14.281  85.454  1.00 78.22  ? 302  ASP C CB  1 
ATOM   8185  C CG  . ASP C 1 301 ? 16.651  13.134  84.574  1.00 79.54  ? 302  ASP C CG  1 
ATOM   8186  O OD1 . ASP C 1 301 ? 16.922  11.979  84.963  1.00 76.23  ? 302  ASP C OD1 1 
ATOM   8187  O OD2 . ASP C 1 301 ? 16.042  13.376  83.513  1.00 74.66  ? 302  ASP C OD2 1 
ATOM   8188  N N   . LYS C 1 302 ? 18.326  15.597  88.144  1.00 86.36  ? 303  LYS C N   1 
ATOM   8189  C CA  . LYS C 1 302 ? 18.819  16.814  88.774  1.00 80.65  ? 303  LYS C CA  1 
ATOM   8190  C C   . LYS C 1 302 ? 19.921  16.567  89.812  1.00 98.13  ? 303  LYS C C   1 
ATOM   8191  O O   . LYS C 1 302 ? 20.353  17.498  90.485  1.00 108.07 ? 303  LYS C O   1 
ATOM   8192  C CB  . LYS C 1 302 ? 17.649  17.580  89.404  1.00 59.09  ? 303  LYS C CB  1 
ATOM   8193  C CG  . LYS C 1 302 ? 16.547  17.913  88.414  1.00 61.82  ? 303  LYS C CG  1 
ATOM   8194  C CD  . LYS C 1 302 ? 17.110  18.705  87.249  1.00 65.25  ? 303  LYS C CD  1 
ATOM   8195  C CE  . LYS C 1 302 ? 16.051  18.976  86.197  1.00 67.75  ? 303  LYS C CE  1 
ATOM   8196  N NZ  . LYS C 1 302 ? 16.624  19.646  84.995  1.00 71.20  ? 303  LYS C NZ  1 
ATOM   8197  N N   . PHE C 1 303 ? 20.363  15.319  89.950  1.00 100.38 ? 304  PHE C N   1 
ATOM   8198  C CA  . PHE C 1 303 ? 21.408  14.989  90.925  1.00 106.18 ? 304  PHE C CA  1 
ATOM   8199  C C   . PHE C 1 303 ? 22.720  15.728  90.681  1.00 106.93 ? 304  PHE C C   1 
ATOM   8200  O O   . PHE C 1 303 ? 23.387  16.170  91.619  1.00 90.82  ? 304  PHE C O   1 
ATOM   8201  C CB  . PHE C 1 303 ? 21.678  13.482  90.946  1.00 101.80 ? 304  PHE C CB  1 
ATOM   8202  C CG  . PHE C 1 303 ? 20.785  12.720  91.884  1.00 88.05  ? 304  PHE C CG  1 
ATOM   8203  C CD1 . PHE C 1 303 ? 20.225  13.345  92.983  1.00 76.37  ? 304  PHE C CD1 1 
ATOM   8204  C CD2 . PHE C 1 303 ? 20.500  11.384  91.662  1.00 88.83  ? 304  PHE C CD2 1 
ATOM   8205  C CE1 . PHE C 1 303 ? 19.398  12.654  93.847  1.00 73.79  ? 304  PHE C CE1 1 
ATOM   8206  C CE2 . PHE C 1 303 ? 19.674  10.685  92.519  1.00 89.30  ? 304  PHE C CE2 1 
ATOM   8207  C CZ  . PHE C 1 303 ? 19.121  11.321  93.615  1.00 82.61  ? 304  PHE C CZ  1 
ATOM   8208  N N   . TRP C 1 304 ? 23.086  15.849  89.414  1.00 118.75 ? 305  TRP C N   1 
ATOM   8209  C CA  . TRP C 1 304 ? 24.359  16.434  89.034  1.00 128.48 ? 305  TRP C CA  1 
ATOM   8210  C C   . TRP C 1 304 ? 24.213  17.869  88.557  1.00 129.78 ? 305  TRP C C   1 
ATOM   8211  O O   . TRP C 1 304 ? 24.807  18.794  89.116  1.00 125.28 ? 305  TRP C O   1 
ATOM   8212  C CB  . TRP C 1 304 ? 25.001  15.611  87.923  1.00 129.92 ? 305  TRP C CB  1 
ATOM   8213  C CG  . TRP C 1 304 ? 25.272  14.193  88.288  1.00 124.05 ? 305  TRP C CG  1 
ATOM   8214  C CD1 . TRP C 1 304 ? 26.404  13.697  88.863  1.00 121.10 ? 305  TRP C CD1 1 
ATOM   8215  C CD2 . TRP C 1 304 ? 24.392  13.078  88.094  1.00 129.98 ? 305  TRP C CD2 1 
ATOM   8216  N NE1 . TRP C 1 304 ? 26.285  12.339  89.040  1.00 128.32 ? 305  TRP C NE1 1 
ATOM   8217  C CE2 . TRP C 1 304 ? 25.066  11.937  88.580  1.00 130.92 ? 305  TRP C CE2 1 
ATOM   8218  C CE3 . TRP C 1 304 ? 23.110  12.937  87.562  1.00 131.26 ? 305  TRP C CE3 1 
ATOM   8219  C CZ2 . TRP C 1 304 ? 24.486  10.668  88.545  1.00 125.89 ? 305  TRP C CZ2 1 
ATOM   8220  C CZ3 . TRP C 1 304 ? 22.542  11.677  87.530  1.00 130.42 ? 305  TRP C CZ3 1 
ATOM   8221  C CH2 . TRP C 1 304 ? 23.230  10.559  88.018  1.00 125.32 ? 305  TRP C CH2 1 
ATOM   8222  N N   . GLY C 1 305 ? 23.423  18.031  87.504  1.00 126.17 ? 306  GLY C N   1 
ATOM   8223  C CA  . GLY C 1 305 ? 23.466  19.210  86.663  1.00 124.14 ? 306  GLY C CA  1 
ATOM   8224  C C   . GLY C 1 305 ? 24.090  18.774  85.350  1.00 128.01 ? 306  GLY C C   1 
ATOM   8225  O O   . GLY C 1 305 ? 24.569  17.642  85.240  1.00 129.66 ? 306  GLY C O   1 
ATOM   8226  N N   . THR C 1 306 ? 24.077  19.646  84.347  1.00 129.80 ? 307  THR C N   1 
ATOM   8227  C CA  . THR C 1 306 ? 24.594  19.272  83.032  1.00 129.94 ? 307  THR C CA  1 
ATOM   8228  C C   . THR C 1 306 ? 26.125  19.264  82.995  1.00 134.92 ? 307  THR C C   1 
ATOM   8229  O O   . THR C 1 306 ? 26.740  19.851  82.099  1.00 136.46 ? 307  THR C O   1 
ATOM   8230  C CB  . THR C 1 306 ? 24.035  20.181  81.916  1.00 127.64 ? 307  THR C CB  1 
ATOM   8231  O OG1 . THR C 1 306 ? 24.760  19.951  80.700  1.00 131.46 ? 307  THR C OG1 1 
ATOM   8232  C CG2 . THR C 1 306 ? 24.147  21.650  82.308  1.00 126.55 ? 307  THR C CG2 1 
ATOM   8233  N N   . SER C 1 311 ? 28.183  16.392  90.281  1.00 104.36 ? 312  SER C N   1 
ATOM   8234  C CA  . SER C 1 311 ? 27.392  16.639  91.479  1.00 98.37  ? 312  SER C CA  1 
ATOM   8235  C C   . SER C 1 311 ? 28.260  17.289  92.552  1.00 103.15 ? 312  SER C C   1 
ATOM   8236  O O   . SER C 1 311 ? 29.376  16.849  92.805  1.00 107.95 ? 312  SER C O   1 
ATOM   8237  C CB  . SER C 1 311 ? 26.783  15.335  91.996  1.00 80.46  ? 312  SER C CB  1 
ATOM   8238  O OG  . SER C 1 311 ? 25.895  15.583  93.075  1.00 68.87  ? 312  SER C OG  1 
ATOM   8239  N N   . VAL C 1 312 ? 27.745  18.343  93.175  1.00 97.84  ? 313  VAL C N   1 
ATOM   8240  C CA  . VAL C 1 312 ? 28.564  19.171  94.055  1.00 90.58  ? 313  VAL C CA  1 
ATOM   8241  C C   . VAL C 1 312 ? 28.573  18.720  95.506  1.00 83.14  ? 313  VAL C C   1 
ATOM   8242  O O   . VAL C 1 312 ? 29.389  19.196  96.293  1.00 91.46  ? 313  VAL C O   1 
ATOM   8243  C CB  . VAL C 1 312 ? 28.157  20.643  93.989  1.00 79.87  ? 313  VAL C CB  1 
ATOM   8244  C CG1 . VAL C 1 312 ? 27.906  21.043  92.551  1.00 75.16  ? 313  VAL C CG1 1 
ATOM   8245  C CG2 . VAL C 1 312 ? 26.913  20.886  94.832  1.00 79.31  ? 313  VAL C CG2 1 
ATOM   8246  N N   . ILE C 1 313 ? 27.667  17.806  95.847  1.00 63.42  ? 314  ILE C N   1 
ATOM   8247  C CA  . ILE C 1 313 ? 27.541  17.302  97.216  1.00 63.56  ? 314  ILE C CA  1 
ATOM   8248  C C   . ILE C 1 313 ? 28.889  16.831  97.775  1.00 73.83  ? 314  ILE C C   1 
ATOM   8249  O O   . ILE C 1 313 ? 29.193  17.038  98.949  1.00 66.35  ? 314  ILE C O   1 
ATOM   8250  C CB  . ILE C 1 313 ? 26.467  16.190  97.329  1.00 89.92  ? 314  ILE C CB  1 
ATOM   8251  C CG1 . ILE C 1 313 ? 25.072  16.764  97.071  1.00 78.74  ? 314  ILE C CG1 1 
ATOM   8252  C CG2 . ILE C 1 313 ? 26.492  15.542  98.704  1.00 99.08  ? 314  ILE C CG2 1 
ATOM   8253  C CD1 . ILE C 1 313 ? 24.473  16.326  95.767  1.00 71.91  ? 314  ILE C CD1 1 
ATOM   8254  N N   . GLY C 1 314 ? 29.699  16.216  96.921  1.00 80.66  ? 315  GLY C N   1 
ATOM   8255  C CA  . GLY C 1 314 ? 31.065  15.872  97.275  1.00 85.00  ? 315  GLY C CA  1 
ATOM   8256  C C   . GLY C 1 314 ? 32.098  16.782  96.629  1.00 83.59  ? 315  GLY C C   1 
ATOM   8257  O O   . GLY C 1 314 ? 33.299  16.638  96.865  1.00 82.85  ? 315  GLY C O   1 
ATOM   8258  N N   . SER C 1 315 ? 31.629  17.691  95.778  1.00 75.21  ? 316  SER C N   1 
ATOM   8259  C CA  . SER C 1 315 ? 32.505  18.573  95.004  1.00 69.53  ? 316  SER C CA  1 
ATOM   8260  C C   . SER C 1 315 ? 32.696  20.012  95.523  1.00 87.64  ? 316  SER C C   1 
ATOM   8261  O O   . SER C 1 315 ? 33.381  20.804  94.877  1.00 100.23 ? 316  SER C O   1 
ATOM   8262  C CB  . SER C 1 315 ? 32.056  18.596  93.538  1.00 54.61  ? 316  SER C CB  1 
ATOM   8263  O OG  . SER C 1 315 ? 32.948  19.351  92.738  1.00 72.81  ? 316  SER C OG  1 
ATOM   8264  N N   . VAL C 1 316 ? 32.091  20.354  96.660  1.00 88.23  ? 317  VAL C N   1 
ATOM   8265  C CA  . VAL C 1 316 ? 32.073  21.745  97.154  1.00 88.70  ? 317  VAL C CA  1 
ATOM   8266  C C   . VAL C 1 316 ? 33.448  22.424  97.230  1.00 95.14  ? 317  VAL C C   1 
ATOM   8267  O O   . VAL C 1 316 ? 33.602  23.604  96.875  1.00 99.93  ? 317  VAL C O   1 
ATOM   8268  C CB  . VAL C 1 316 ? 31.409  21.848  98.553  1.00 60.21  ? 317  VAL C CB  1 
ATOM   8269  C CG1 . VAL C 1 316 ? 31.310  23.302  98.997  1.00 56.06  ? 317  VAL C CG1 1 
ATOM   8270  C CG2 . VAL C 1 316 ? 30.034  21.212  98.545  1.00 53.61  ? 317  VAL C CG2 1 
ATOM   8271  N N   . HIS C 1 317 ? 34.440  21.672  97.695  1.00 97.70  ? 318  HIS C N   1 
ATOM   8272  C CA  . HIS C 1 317 ? 35.785  22.202  97.890  1.00 92.29  ? 318  HIS C CA  1 
ATOM   8273  C C   . HIS C 1 317 ? 36.397  22.738  96.598  1.00 84.74  ? 318  HIS C C   1 
ATOM   8274  O O   . HIS C 1 317 ? 37.255  23.616  96.635  1.00 97.23  ? 318  HIS C O   1 
ATOM   8275  C CB  . HIS C 1 317 ? 36.698  21.143  98.513  1.00 91.57  ? 318  HIS C CB  1 
ATOM   8276  C CG  . HIS C 1 317 ? 36.822  19.896  97.696  1.00 91.02  ? 318  HIS C CG  1 
ATOM   8277  N ND1 . HIS C 1 317 ? 36.062  18.772  97.932  1.00 91.74  ? 318  HIS C ND1 1 
ATOM   8278  C CD2 . HIS C 1 317 ? 37.621  19.597  96.643  1.00 93.08  ? 318  HIS C CD2 1 
ATOM   8279  C CE1 . HIS C 1 317 ? 36.385  17.833  97.062  1.00 96.60  ? 318  HIS C CE1 1 
ATOM   8280  N NE2 . HIS C 1 317 ? 37.329  18.307  96.268  1.00 96.25  ? 318  HIS C NE2 1 
ATOM   8281  N N   . THR C 1 318 ? 35.957  22.205  95.462  1.00 71.86  ? 319  THR C N   1 
ATOM   8282  C CA  . THR C 1 318 ? 36.387  22.709  94.162  1.00 83.84  ? 319  THR C CA  1 
ATOM   8283  C C   . THR C 1 318 ? 35.973  24.166  94.011  1.00 82.69  ? 319  THR C C   1 
ATOM   8284  O O   . THR C 1 318 ? 36.770  25.025  93.623  1.00 83.82  ? 319  THR C O   1 
ATOM   8285  C CB  . THR C 1 318 ? 35.761  21.899  93.009  1.00 97.58  ? 319  THR C CB  1 
ATOM   8286  O OG1 . THR C 1 318 ? 36.283  20.565  93.018  1.00 106.38 ? 319  THR C OG1 1 
ATOM   8287  C CG2 . THR C 1 318 ? 36.064  22.548  91.666  1.00 104.25 ? 319  THR C CG2 1 
ATOM   8288  N N   . TRP C 1 319 ? 34.714  24.434  94.336  1.00 85.31  ? 320  TRP C N   1 
ATOM   8289  C CA  . TRP C 1 319 ? 34.152  25.766  94.198  1.00 90.12  ? 320  TRP C CA  1 
ATOM   8290  C C   . TRP C 1 319 ? 34.688  26.713  95.263  1.00 87.60  ? 320  TRP C C   1 
ATOM   8291  O O   . TRP C 1 319 ? 34.820  27.912  95.021  1.00 85.81  ? 320  TRP C O   1 
ATOM   8292  C CB  . TRP C 1 319 ? 32.626  25.701  94.256  1.00 102.97 ? 320  TRP C CB  1 
ATOM   8293  C CG  . TRP C 1 319 ? 32.052  24.653  93.350  1.00 103.67 ? 320  TRP C CG  1 
ATOM   8294  C CD1 . TRP C 1 319 ? 31.367  23.533  93.724  1.00 93.09  ? 320  TRP C CD1 1 
ATOM   8295  C CD2 . TRP C 1 319 ? 32.133  24.614  91.921  1.00 109.56 ? 320  TRP C CD2 1 
ATOM   8296  N NE1 . TRP C 1 319 ? 31.007  22.806  92.615  1.00 95.64  ? 320  TRP C NE1 1 
ATOM   8297  C CE2 . TRP C 1 319 ? 31.467  23.450  91.492  1.00 103.68 ? 320  TRP C CE2 1 
ATOM   8298  C CE3 . TRP C 1 319 ? 32.700  25.457  90.956  1.00 109.21 ? 320  TRP C CE3 1 
ATOM   8299  C CZ2 . TRP C 1 319 ? 31.350  23.102  90.148  1.00 101.26 ? 320  TRP C CZ2 1 
ATOM   8300  C CZ3 . TRP C 1 319 ? 32.585  25.111  89.621  1.00 111.70 ? 320  TRP C CZ3 1 
ATOM   8301  C CH2 . TRP C 1 319 ? 31.916  23.945  89.230  1.00 108.54 ? 320  TRP C CH2 1 
ATOM   8302  N N   . LEU C 1 320 ? 34.998  26.177  96.441  1.00 92.88  ? 321  LEU C N   1 
ATOM   8303  C CA  . LEU C 1 320 ? 35.589  27.004  97.493  1.00 97.05  ? 321  LEU C CA  1 
ATOM   8304  C C   . LEU C 1 320 ? 37.028  27.406  97.153  1.00 103.51 ? 321  LEU C C   1 
ATOM   8305  O O   . LEU C 1 320 ? 37.436  28.554  97.365  1.00 104.00 ? 321  LEU C O   1 
ATOM   8306  C CB  . LEU C 1 320 ? 35.518  26.300  98.851  1.00 87.76  ? 321  LEU C CB  1 
ATOM   8307  C CG  . LEU C 1 320 ? 34.101  26.085  99.392  1.00 84.40  ? 321  LEU C CG  1 
ATOM   8308  C CD1 . LEU C 1 320 ? 34.128  25.583  100.826 1.00 82.64  ? 321  LEU C CD1 1 
ATOM   8309  C CD2 . LEU C 1 320 ? 33.281  27.363  99.285  1.00 83.65  ? 321  LEU C CD2 1 
ATOM   8310  N N   . ALA C 1 321 ? 37.788  26.457  96.614  1.00 103.15 ? 322  ALA C N   1 
ATOM   8311  C CA  . ALA C 1 321 ? 39.152  26.720  96.170  1.00 92.72  ? 322  ALA C CA  1 
ATOM   8312  C C   . ALA C 1 321 ? 39.146  27.714  95.015  1.00 104.70 ? 322  ALA C C   1 
ATOM   8313  O O   . ALA C 1 321 ? 39.962  28.635  94.971  1.00 117.12 ? 322  ALA C O   1 
ATOM   8314  C CB  . ALA C 1 321 ? 39.839  25.428  95.757  1.00 66.40  ? 322  ALA C CB  1 
ATOM   8315  N N   . GLU C 1 322 ? 38.216  27.523  94.084  1.00 99.21  ? 323  GLU C N   1 
ATOM   8316  C CA  . GLU C 1 322 ? 38.044  28.451  92.972  1.00 102.22 ? 323  GLU C CA  1 
ATOM   8317  C C   . GLU C 1 322 ? 37.616  29.828  93.481  1.00 103.71 ? 323  GLU C C   1 
ATOM   8318  O O   . GLU C 1 322 ? 37.885  30.850  92.847  1.00 107.46 ? 323  GLU C O   1 
ATOM   8319  C CB  . GLU C 1 322 ? 37.025  27.898  91.971  1.00 114.53 ? 323  GLU C CB  1 
ATOM   8320  C CG  . GLU C 1 322 ? 36.839  28.742  90.716  1.00 126.55 ? 323  GLU C CG  1 
ATOM   8321  C CD  . GLU C 1 322 ? 35.929  28.078  89.697  1.00 135.09 ? 323  GLU C CD  1 
ATOM   8322  O OE1 . GLU C 1 322 ? 36.075  26.857  89.474  1.00 133.83 ? 323  GLU C OE1 1 
ATOM   8323  O OE2 . GLU C 1 322 ? 35.065  28.774  89.123  1.00 139.69 ? 323  GLU C OE2 1 
ATOM   8324  N N   . ALA C 1 323 ? 36.955  29.849  94.635  1.00 102.95 ? 324  ALA C N   1 
ATOM   8325  C CA  . ALA C 1 323 ? 36.533  31.102  95.252  1.00 105.81 ? 324  ALA C CA  1 
ATOM   8326  C C   . ALA C 1 323 ? 37.720  31.862  95.831  1.00 113.05 ? 324  ALA C C   1 
ATOM   8327  O O   . ALA C 1 323 ? 37.863  33.065  95.613  1.00 119.21 ? 324  ALA C O   1 
ATOM   8328  C CB  . ALA C 1 323 ? 35.493  30.844  96.331  1.00 103.47 ? 324  ALA C CB  1 
ATOM   8329  N N   . ILE C 1 324 ? 38.568  31.153  96.568  1.00 114.21 ? 325  ILE C N   1 
ATOM   8330  C CA  . ILE C 1 324 ? 39.740  31.770  97.185  1.00 119.90 ? 325  ILE C CA  1 
ATOM   8331  C C   . ILE C 1 324 ? 40.788  32.185  96.148  1.00 135.03 ? 325  ILE C C   1 
ATOM   8332  O O   . ILE C 1 324 ? 41.405  33.250  96.266  1.00 141.23 ? 325  ILE C O   1 
ATOM   8333  C CB  . ILE C 1 324 ? 40.354  30.846  98.256  1.00 108.10 ? 325  ILE C CB  1 
ATOM   8334  C CG1 . ILE C 1 324 ? 39.444  30.813  99.485  1.00 94.89  ? 325  ILE C CG1 1 
ATOM   8335  C CG2 . ILE C 1 324 ? 41.748  31.312  98.646  1.00 110.17 ? 325  ILE C CG2 1 
ATOM   8336  C CD1 . ILE C 1 324 ? 39.518  29.524  100.268 1.00 88.91  ? 325  ILE C CD1 1 
ATOM   8337  N N   . ASN C 1 325 ? 40.968  31.354  95.124  1.00 141.85 ? 326  ASN C N   1 
ATOM   8338  C CA  . ASN C 1 325 ? 41.901  31.658  94.040  1.00 148.98 ? 326  ASN C CA  1 
ATOM   8339  C C   . ASN C 1 325 ? 41.592  33.000  93.380  1.00 149.66 ? 326  ASN C C   1 
ATOM   8340  O O   . ASN C 1 325 ? 42.487  33.689  92.890  1.00 155.28 ? 326  ASN C O   1 
ATOM   8341  C CB  . ASN C 1 325 ? 41.895  30.539  92.991  1.00 159.11 ? 326  ASN C CB  1 
ATOM   8342  C CG  . ASN C 1 325 ? 41.302  30.981  91.666  1.00 170.09 ? 326  ASN C CG  1 
ATOM   8343  O OD1 . ASN C 1 325 ? 42.020  31.414  90.765  1.00 174.47 ? 326  ASN C OD1 1 
ATOM   8344  N ND2 . ASN C 1 325 ? 39.984  30.878  91.545  1.00 172.27 ? 326  ASN C ND2 1 
ATOM   8345  N N   . ALA C 1 326 ? 40.314  33.364  93.381  1.00 142.35 ? 327  ALA C N   1 
ATOM   8346  C CA  . ALA C 1 326 ? 39.873  34.622  92.797  1.00 136.24 ? 327  ALA C CA  1 
ATOM   8347  C C   . ALA C 1 326 ? 40.325  35.811  93.638  1.00 133.27 ? 327  ALA C C   1 
ATOM   8348  O O   . ALA C 1 326 ? 40.722  36.841  93.096  1.00 140.18 ? 327  ALA C O   1 
ATOM   8349  C CB  . ALA C 1 326 ? 38.368  34.626  92.634  1.00 131.12 ? 327  ALA C CB  1 
ATOM   8350  N N   . LEU C 1 327 ? 40.267  35.668  94.959  1.00 128.26 ? 328  LEU C N   1 
ATOM   8351  C CA  . LEU C 1 327 ? 40.738  36.720  95.853  1.00 129.92 ? 328  LEU C CA  1 
ATOM   8352  C C   . LEU C 1 327 ? 42.260  36.800  95.860  1.00 128.97 ? 328  LEU C C   1 
ATOM   8353  O O   . LEU C 1 327 ? 42.831  37.866  96.088  1.00 129.62 ? 328  LEU C O   1 
ATOM   8354  C CB  . LEU C 1 327 ? 40.208  36.518  97.275  1.00 123.57 ? 328  LEU C CB  1 
ATOM   8355  C CG  . LEU C 1 327 ? 38.971  37.332  97.662  1.00 114.23 ? 328  LEU C CG  1 
ATOM   8356  C CD1 . LEU C 1 327 ? 38.755  37.307  99.169  1.00 109.03 ? 328  LEU C CD1 1 
ATOM   8357  C CD2 . LEU C 1 327 ? 39.085  38.763  97.159  1.00 110.84 ? 328  LEU C CD2 1 
ATOM   8358  N N   . GLN C 1 328 ? 42.915  35.669  95.615  1.00 122.78 ? 329  GLN C N   1 
ATOM   8359  C CA  . GLN C 1 328 ? 44.373  35.651  95.542  1.00 124.16 ? 329  GLN C CA  1 
ATOM   8360  C C   . GLN C 1 328 ? 44.888  36.271  94.243  1.00 134.25 ? 329  GLN C C   1 
ATOM   8361  O O   . GLN C 1 328 ? 45.909  36.959  94.240  1.00 142.31 ? 329  GLN C O   1 
ATOM   8362  C CB  . GLN C 1 328 ? 44.923  34.234  95.719  1.00 121.19 ? 329  GLN C CB  1 
ATOM   8363  C CG  . GLN C 1 328 ? 44.933  33.753  97.163  1.00 117.86 ? 329  GLN C CG  1 
ATOM   8364  C CD  . GLN C 1 328 ? 46.284  33.205  97.588  1.00 113.70 ? 329  GLN C CD  1 
ATOM   8365  O OE1 . GLN C 1 328 ? 46.734  32.172  97.092  1.00 117.98 ? 329  GLN C OE1 1 
ATOM   8366  N NE2 . GLN C 1 328 ? 46.941  33.901  98.509  1.00 94.94  ? 329  GLN C NE2 1 
ATOM   8367  N N   . ASP C 1 329 ? 44.179  36.028  93.143  1.00 130.66 ? 330  ASP C N   1 
ATOM   8368  C CA  . ASP C 1 329 ? 44.528  36.639  91.863  1.00 128.72 ? 330  ASP C CA  1 
ATOM   8369  C C   . ASP C 1 329 ? 44.175  38.124  91.862  1.00 129.08 ? 330  ASP C C   1 
ATOM   8370  O O   . ASP C 1 329 ? 44.879  38.941  91.267  1.00 138.87 ? 330  ASP C O   1 
ATOM   8371  C CB  . ASP C 1 329 ? 43.825  35.929  90.703  1.00 122.17 ? 330  ASP C CB  1 
ATOM   8372  C CG  . ASP C 1 329 ? 44.409  34.558  90.415  1.00 120.59 ? 330  ASP C CG  1 
ATOM   8373  O OD1 . ASP C 1 329 ? 45.597  34.335  90.729  1.00 118.83 ? 330  ASP C OD1 1 
ATOM   8374  O OD2 . ASP C 1 329 ? 43.680  33.705  89.867  1.00 121.71 ? 330  ASP C OD2 1 
ATOM   8375  N N   . ASN C 1 330 ? 43.083  38.463  92.541  1.00 118.57 ? 331  ASN C N   1 
ATOM   8376  C CA  . ASN C 1 330 ? 42.631  39.847  92.649  1.00 120.70 ? 331  ASN C CA  1 
ATOM   8377  C C   . ASN C 1 330 ? 43.204  40.568  93.866  1.00 123.69 ? 331  ASN C C   1 
ATOM   8378  O O   . ASN C 1 330 ? 42.789  41.680  94.183  1.00 119.61 ? 331  ASN C O   1 
ATOM   8379  C CB  . ASN C 1 330 ? 41.102  39.930  92.651  1.00 120.72 ? 331  ASN C CB  1 
ATOM   8380  C CG  . ASN C 1 330 ? 40.488  39.420  91.360  1.00 125.27 ? 331  ASN C CG  1 
ATOM   8381  O OD1 . ASN C 1 330 ? 41.155  38.769  90.557  1.00 127.70 ? 331  ASN C OD1 1 
ATOM   8382  N ND2 . ASN C 1 330 ? 39.207  39.711  91.158  1.00 124.93 ? 331  ASN C ND2 1 
ATOM   8383  N N   . ARG C 1 331 ? 44.129  39.916  94.566  1.00 129.82 ? 332  ARG C N   1 
ATOM   8384  C CA  . ARG C 1 331 ? 44.815  40.537  95.695  1.00 135.76 ? 332  ARG C CA  1 
ATOM   8385  C C   . ARG C 1 331 ? 45.454  41.859  95.277  1.00 142.84 ? 332  ARG C C   1 
ATOM   8386  O O   . ARG C 1 331 ? 45.479  42.819  96.048  1.00 145.71 ? 332  ARG C O   1 
ATOM   8387  C CB  . ARG C 1 331 ? 45.886  39.598  96.259  1.00 135.08 ? 332  ARG C CB  1 
ATOM   8388  C CG  . ARG C 1 331 ? 46.482  40.054  97.584  1.00 132.35 ? 332  ARG C CG  1 
ATOM   8389  C CD  . ARG C 1 331 ? 47.735  39.263  97.931  1.00 127.30 ? 332  ARG C CD  1 
ATOM   8390  N NE  . ARG C 1 331 ? 48.944  39.890  97.406  1.00 132.31 ? 332  ARG C NE  1 
ATOM   8391  C CZ  . ARG C 1 331 ? 49.788  40.610  98.140  1.00 131.71 ? 332  ARG C CZ  1 
ATOM   8392  N NH1 . ARG C 1 331 ? 49.557  40.786  99.434  1.00 128.58 ? 332  ARG C NH1 1 
ATOM   8393  N NH2 . ARG C 1 331 ? 50.866  41.148  97.584  1.00 126.40 ? 332  ARG C NH2 1 
ATOM   8394  N N   . ASP C 1 332 ? 45.963  41.902  94.049  1.00 143.28 ? 333  ASP C N   1 
ATOM   8395  C CA  . ASP C 1 332 ? 46.574  43.112  93.508  1.00 146.41 ? 333  ASP C CA  1 
ATOM   8396  C C   . ASP C 1 332 ? 45.541  44.121  93.014  1.00 152.62 ? 333  ASP C C   1 
ATOM   8397  O O   . ASP C 1 332 ? 45.713  45.327  93.192  1.00 162.21 ? 333  ASP C O   1 
ATOM   8398  C CB  . ASP C 1 332 ? 47.564  42.774  92.390  1.00 148.72 ? 333  ASP C CB  1 
ATOM   8399  C CG  . ASP C 1 332 ? 49.009  42.945  92.822  1.00 151.53 ? 333  ASP C CG  1 
ATOM   8400  O OD1 . ASP C 1 332 ? 49.312  42.695  94.009  1.00 149.64 ? 333  ASP C OD1 1 
ATOM   8401  O OD2 . ASP C 1 332 ? 49.839  43.338  91.975  1.00 154.54 ? 333  ASP C OD2 1 
ATOM   8402  N N   . THR C 1 333 ? 44.470  43.635  92.392  1.00 148.64 ? 334  THR C N   1 
ATOM   8403  C CA  . THR C 1 333 ? 43.438  44.534  91.891  1.00 144.25 ? 334  THR C CA  1 
ATOM   8404  C C   . THR C 1 333 ? 42.350  44.702  92.940  1.00 149.56 ? 334  THR C C   1 
ATOM   8405  O O   . THR C 1 333 ? 41.525  43.811  93.143  1.00 160.35 ? 334  THR C O   1 
ATOM   8406  C CB  . THR C 1 333 ? 42.800  43.994  90.597  1.00 132.46 ? 334  THR C CB  1 
ATOM   8407  O OG1 . THR C 1 333 ? 43.813  43.807  89.601  1.00 132.19 ? 334  THR C OG1 1 
ATOM   8408  C CG2 . THR C 1 333 ? 41.751  44.965  90.075  1.00 124.77 ? 334  THR C CG2 1 
ATOM   8409  N N   . LEU C 1 334 ? 42.324  45.879  93.556  1.00 144.30 ? 335  LEU C N   1 
ATOM   8410  C CA  . LEU C 1 334 ? 41.469  46.138  94.705  1.00 143.18 ? 335  LEU C CA  1 
ATOM   8411  C C   . LEU C 1 334 ? 41.694  47.565  95.175  1.00 159.42 ? 335  LEU C C   1 
ATOM   8412  O O   . LEU C 1 334 ? 42.733  48.161  94.884  1.00 161.62 ? 335  LEU C O   1 
ATOM   8413  C CB  . LEU C 1 334 ? 41.835  45.187  95.846  1.00 134.12 ? 335  LEU C CB  1 
ATOM   8414  C CG  . LEU C 1 334 ? 40.753  44.267  96.410  1.00 134.16 ? 335  LEU C CG  1 
ATOM   8415  C CD1 . LEU C 1 334 ? 41.377  43.237  97.338  1.00 131.81 ? 335  LEU C CD1 1 
ATOM   8416  C CD2 . LEU C 1 334 ? 39.694  45.074  97.141  1.00 132.57 ? 335  LEU C CD2 1 
ATOM   8417  N N   . THR C 1 335 ? 40.729  48.097  95.921  1.00 165.05 ? 336  THR C N   1 
ATOM   8418  C CA  . THR C 1 335 ? 40.823  49.413  96.553  1.00 164.39 ? 336  THR C CA  1 
ATOM   8419  C C   . THR C 1 335 ? 39.534  49.641  97.341  1.00 157.08 ? 336  THR C C   1 
ATOM   8420  O O   . THR C 1 335 ? 38.516  48.997  97.083  1.00 151.21 ? 336  THR C O   1 
ATOM   8421  C CB  . THR C 1 335 ? 40.985  50.579  95.519  1.00 191.34 ? 336  THR C CB  1 
ATOM   8422  O OG1 . THR C 1 335 ? 42.011  50.267  94.568  1.00 195.18 ? 336  THR C OG1 1 
ATOM   8423  C CG2 . THR C 1 335 ? 41.360  51.889  96.207  1.00 190.81 ? 336  THR C CG2 1 
ATOM   8424  N N   . ALA C 1 336 ? 39.586  50.559  98.300  1.00 151.54 ? 337  ALA C N   1 
ATOM   8425  C CA  . ALA C 1 336 ? 38.402  51.028  99.002  1.00 141.98 ? 337  ALA C CA  1 
ATOM   8426  C C   . ALA C 1 336 ? 38.496  52.546  99.083  1.00 143.91 ? 337  ALA C C   1 
ATOM   8427  O O   . ALA C 1 336 ? 39.569  53.112  98.875  1.00 146.25 ? 337  ALA C O   1 
ATOM   8428  C CB  . ALA C 1 336 ? 38.327  50.419  100.390 1.00 128.74 ? 337  ALA C CB  1 
ATOM   8429  N N   . LYS C 1 337 ? 37.378  53.204  99.372  1.00 138.46 ? 338  LYS C N   1 
ATOM   8430  C CA  . LYS C 1 337 ? 37.361  54.661  99.469  1.00 134.51 ? 338  LYS C CA  1 
ATOM   8431  C C   . LYS C 1 337 ? 38.261  55.156  100.597 1.00 124.08 ? 338  LYS C C   1 
ATOM   8432  O O   . LYS C 1 337 ? 37.788  55.744  101.569 1.00 120.18 ? 338  LYS C O   1 
ATOM   8433  C CB  . LYS C 1 337 ? 35.935  55.176  99.674  1.00 146.05 ? 338  LYS C CB  1 
ATOM   8434  C CG  . LYS C 1 337 ? 35.012  54.961  98.485  1.00 158.71 ? 338  LYS C CG  1 
ATOM   8435  C CD  . LYS C 1 337 ? 33.645  55.580  98.735  1.00 163.91 ? 338  LYS C CD  1 
ATOM   8436  C CE  . LYS C 1 337 ? 32.720  55.388  97.544  1.00 159.95 ? 338  LYS C CE  1 
ATOM   8437  N NZ  . LYS C 1 337 ? 31.378  55.993  97.777  1.00 156.60 ? 338  LYS C NZ  1 
ATOM   8438  N N   . SER C 1 371 ? 31.683  7.832   84.604  1.00 125.10 ? 372  SER C N   1 
ATOM   8439  C CA  . SER C 1 371 ? 30.819  6.917   85.343  1.00 122.93 ? 372  SER C CA  1 
ATOM   8440  C C   . SER C 1 371 ? 31.207  6.857   86.818  1.00 119.41 ? 372  SER C C   1 
ATOM   8441  O O   . SER C 1 371 ? 32.382  6.994   87.164  1.00 124.49 ? 372  SER C O   1 
ATOM   8442  C CB  . SER C 1 371 ? 30.869  5.519   84.726  1.00 124.32 ? 372  SER C CB  1 
ATOM   8443  O OG  . SER C 1 371 ? 30.021  4.626   85.428  1.00 123.60 ? 372  SER C OG  1 
ATOM   8444  N N   . GLY C 1 372 ? 30.223  6.645   87.689  1.00 108.82 ? 373  GLY C N   1 
ATOM   8445  C CA  . GLY C 1 372 ? 30.490  6.668   89.115  1.00 95.07  ? 373  GLY C CA  1 
ATOM   8446  C C   . GLY C 1 372 ? 29.489  5.978   90.026  1.00 81.24  ? 373  GLY C C   1 
ATOM   8447  O O   . GLY C 1 372 ? 28.451  5.465   89.580  1.00 91.05  ? 373  GLY C O   1 
ATOM   8448  N N   . THR C 1 373 ? 29.822  5.974   91.316  1.00 50.45  ? 374  THR C N   1 
ATOM   8449  C CA  . THR C 1 373 ? 29.032  5.320   92.351  1.00 40.47  ? 374  THR C CA  1 
ATOM   8450  C C   . THR C 1 373 ? 27.585  5.783   92.355  1.00 60.19  ? 374  THR C C   1 
ATOM   8451  O O   . THR C 1 373 ? 26.663  4.966   92.389  1.00 74.56  ? 374  THR C O   1 
ATOM   8452  C CB  . THR C 1 373 ? 29.641  5.581   93.746  1.00 31.22  ? 374  THR C CB  1 
ATOM   8453  O OG1 . THR C 1 373 ? 30.941  4.986   93.819  1.00 45.86  ? 374  THR C OG1 1 
ATOM   8454  C CG2 . THR C 1 373 ? 28.776  4.988   94.841  1.00 30.82  ? 374  THR C CG2 1 
ATOM   8455  N N   . LEU C 1 374 ? 27.395  7.097   92.319  1.00 64.44  ? 375  LEU C N   1 
ATOM   8456  C CA  . LEU C 1 374 ? 26.055  7.670   92.348  1.00 68.23  ? 375  LEU C CA  1 
ATOM   8457  C C   . LEU C 1 374 ? 25.229  7.227   91.142  1.00 68.73  ? 375  LEU C C   1 
ATOM   8458  O O   . LEU C 1 374 ? 24.049  6.908   91.275  1.00 73.07  ? 375  LEU C O   1 
ATOM   8459  C CB  . LEU C 1 374 ? 26.113  9.196   92.411  1.00 58.53  ? 375  LEU C CB  1 
ATOM   8460  C CG  . LEU C 1 374 ? 24.747  9.855   92.611  1.00 52.75  ? 375  LEU C CG  1 
ATOM   8461  C CD1 . LEU C 1 374 ? 24.217  9.561   94.008  1.00 55.21  ? 375  LEU C CD1 1 
ATOM   8462  C CD2 . LEU C 1 374 ? 24.812  11.349  92.351  1.00 50.26  ? 375  LEU C CD2 1 
ATOM   8463  N N   . GLU C 1 375 ? 25.860  7.198   89.972  1.00 65.69  ? 376  GLU C N   1 
ATOM   8464  C CA  . GLU C 1 375 ? 25.195  6.754   88.753  1.00 62.60  ? 376  GLU C CA  1 
ATOM   8465  C C   . GLU C 1 375 ? 24.781  5.289   88.879  1.00 68.16  ? 376  GLU C C   1 
ATOM   8466  O O   . GLU C 1 375 ? 23.685  4.904   88.455  1.00 72.12  ? 376  GLU C O   1 
ATOM   8467  C CB  . GLU C 1 375 ? 26.113  6.952   87.544  1.00 60.74  ? 376  GLU C CB  1 
ATOM   8468  C CG  . GLU C 1 375 ? 25.512  6.495   86.223  1.00 76.80  ? 376  GLU C CG  1 
ATOM   8469  C CD  . GLU C 1 375 ? 26.370  6.859   85.024  1.00 91.62  ? 376  GLU C CD  1 
ATOM   8470  O OE1 . GLU C 1 375 ? 27.246  7.739   85.160  1.00 90.51  ? 376  GLU C OE1 1 
ATOM   8471  O OE2 . GLU C 1 375 ? 26.169  6.266   83.942  1.00 98.10  ? 376  GLU C OE2 1 
ATOM   8472  N N   . LYS C 1 376 ? 25.652  4.479   89.474  1.00 60.07  ? 377  LYS C N   1 
ATOM   8473  C CA  . LYS C 1 376 ? 25.332  3.072   89.701  1.00 63.85  ? 377  LYS C CA  1 
ATOM   8474  C C   . LYS C 1 376 ? 24.132  2.899   90.635  1.00 67.58  ? 377  LYS C C   1 
ATOM   8475  O O   . LYS C 1 376 ? 23.205  2.129   90.339  1.00 73.28  ? 377  LYS C O   1 
ATOM   8476  C CB  . LYS C 1 376 ? 26.550  2.333   90.253  1.00 52.20  ? 377  LYS C CB  1 
ATOM   8477  C CG  . LYS C 1 376 ? 27.616  2.052   89.211  1.00 40.66  ? 377  LYS C CG  1 
ATOM   8478  C CD  . LYS C 1 376 ? 28.799  1.318   89.814  1.00 48.08  ? 377  LYS C CD  1 
ATOM   8479  C CE  . LYS C 1 376 ? 29.671  0.710   88.731  1.00 58.80  ? 377  LYS C CE  1 
ATOM   8480  N NZ  . LYS C 1 376 ? 30.059  1.730   87.719  1.00 67.23  ? 377  LYS C NZ  1 
ATOM   8481  N N   . LEU C 1 377 ? 24.156  3.617   91.757  1.00 50.90  ? 378  LEU C N   1 
ATOM   8482  C CA  . LEU C 1 377 ? 23.038  3.617   92.694  1.00 47.86  ? 378  LEU C CA  1 
ATOM   8483  C C   . LEU C 1 377 ? 21.745  4.025   91.998  1.00 59.73  ? 378  LEU C C   1 
ATOM   8484  O O   . LEU C 1 377 ? 20.693  3.436   92.233  1.00 60.40  ? 378  LEU C O   1 
ATOM   8485  C CB  . LEU C 1 377 ? 23.303  4.565   93.863  1.00 38.49  ? 378  LEU C CB  1 
ATOM   8486  C CG  . LEU C 1 377 ? 24.415  4.229   94.854  1.00 41.80  ? 378  LEU C CG  1 
ATOM   8487  C CD1 . LEU C 1 377 ? 24.283  5.113   96.086  1.00 49.11  ? 378  LEU C CD1 1 
ATOM   8488  C CD2 . LEU C 1 377 ? 24.377  2.760   95.234  1.00 41.43  ? 378  LEU C CD2 1 
ATOM   8489  N N   . VAL C 1 378 ? 21.835  5.041   91.145  1.00 59.73  ? 379  VAL C N   1 
ATOM   8490  C CA  . VAL C 1 378 ? 20.673  5.533   90.414  1.00 59.18  ? 379  VAL C CA  1 
ATOM   8491  C C   . VAL C 1 378 ? 20.109  4.464   89.484  1.00 57.22  ? 379  VAL C C   1 
ATOM   8492  O O   . VAL C 1 378 ? 18.894  4.266   89.423  1.00 51.97  ? 379  VAL C O   1 
ATOM   8493  C CB  . VAL C 1 378 ? 20.999  6.814   89.611  1.00 61.70  ? 379  VAL C CB  1 
ATOM   8494  C CG1 . VAL C 1 378 ? 19.933  7.079   88.556  1.00 71.86  ? 379  VAL C CG1 1 
ATOM   8495  C CG2 . VAL C 1 378 ? 21.135  8.006   90.547  1.00 61.88  ? 379  VAL C CG2 1 
ATOM   8496  N N   . SER C 1 379 ? 20.993  3.774   88.769  1.00 52.26  ? 380  SER C N   1 
ATOM   8497  C CA  . SER C 1 379 ? 20.572  2.695   87.879  1.00 47.97  ? 380  SER C CA  1 
ATOM   8498  C C   . SER C 1 379 ? 19.852  1.594   88.656  1.00 53.11  ? 380  SER C C   1 
ATOM   8499  O O   . SER C 1 379 ? 18.769  1.137   88.259  1.00 53.87  ? 380  SER C O   1 
ATOM   8500  C CB  . SER C 1 379 ? 21.772  2.112   87.135  1.00 48.58  ? 380  SER C CB  1 
ATOM   8501  O OG  . SER C 1 379 ? 21.369  1.081   86.251  1.00 71.70  ? 380  SER C OG  1 
ATOM   8502  N N   . GLU C 1 380 ? 20.454  1.180   89.768  1.00 54.99  ? 381  GLU C N   1 
ATOM   8503  C CA  . GLU C 1 380 ? 19.860  0.147   90.614  1.00 66.89  ? 381  GLU C CA  1 
ATOM   8504  C C   . GLU C 1 380 ? 18.484  0.566   91.130  1.00 69.78  ? 381  GLU C C   1 
ATOM   8505  O O   . GLU C 1 380 ? 17.520  -0.206  91.072  1.00 76.01  ? 381  GLU C O   1 
ATOM   8506  C CB  . GLU C 1 380 ? 20.783  -0.174  91.791  1.00 77.88  ? 381  GLU C CB  1 
ATOM   8507  C CG  . GLU C 1 380 ? 20.280  -1.296  92.683  1.00 86.42  ? 381  GLU C CG  1 
ATOM   8508  C CD  . GLU C 1 380 ? 20.171  -2.617  91.947  1.00 97.38  ? 381  GLU C CD  1 
ATOM   8509  O OE1 . GLU C 1 380 ? 20.984  -2.859  91.030  1.00 104.31 ? 381  GLU C OE1 1 
ATOM   8510  O OE2 . GLU C 1 380 ? 19.270  -3.413  92.285  1.00 95.75  ? 381  GLU C OE2 1 
ATOM   8511  N N   . ALA C 1 381 ? 18.406  1.794   91.633  1.00 57.80  ? 382  ALA C N   1 
ATOM   8512  C CA  . ALA C 1 381 ? 17.159  2.353   92.140  1.00 45.49  ? 382  ALA C CA  1 
ATOM   8513  C C   . ALA C 1 381 ? 16.076  2.346   91.069  1.00 44.41  ? 382  ALA C C   1 
ATOM   8514  O O   . ALA C 1 381 ? 14.950  1.920   91.321  1.00 47.85  ? 382  ALA C O   1 
ATOM   8515  C CB  . ALA C 1 381 ? 17.382  3.766   92.663  1.00 32.28  ? 382  ALA C CB  1 
ATOM   8516  N N   . LYS C 1 382 ? 16.424  2.819   89.876  1.00 43.08  ? 383  LYS C N   1 
ATOM   8517  C CA  . LYS C 1 382 ? 15.494  2.825   88.753  1.00 39.68  ? 383  LYS C CA  1 
ATOM   8518  C C   . LYS C 1 382 ? 14.982  1.418   88.470  1.00 47.35  ? 383  LYS C C   1 
ATOM   8519  O O   . LYS C 1 382 ? 13.780  1.215   88.276  1.00 46.20  ? 383  LYS C O   1 
ATOM   8520  C CB  . LYS C 1 382 ? 16.155  3.404   87.501  1.00 39.78  ? 383  LYS C CB  1 
ATOM   8521  C CG  . LYS C 1 382 ? 16.302  4.918   87.499  1.00 44.50  ? 383  LYS C CG  1 
ATOM   8522  C CD  . LYS C 1 382 ? 16.814  5.399   86.149  1.00 53.70  ? 383  LYS C CD  1 
ATOM   8523  C CE  . LYS C 1 382 ? 16.947  6.911   86.100  1.00 62.41  ? 383  LYS C CE  1 
ATOM   8524  N NZ  . LYS C 1 382 ? 17.432  7.366   84.767  1.00 66.86  ? 383  LYS C NZ  1 
ATOM   8525  N N   . ALA C 1 383 ? 15.896  0.451   88.458  1.00 53.43  ? 384  ALA C N   1 
ATOM   8526  C CA  . ALA C 1 383 ? 15.518  -0.945  88.242  1.00 50.97  ? 384  ALA C CA  1 
ATOM   8527  C C   . ALA C 1 383 ? 14.499  -1.425  89.276  1.00 49.73  ? 384  ALA C C   1 
ATOM   8528  O O   . ALA C 1 383 ? 13.439  -1.953  88.921  1.00 42.09  ? 384  ALA C O   1 
ATOM   8529  C CB  . ALA C 1 383 ? 16.747  -1.839  88.253  1.00 45.48  ? 384  ALA C CB  1 
ATOM   8530  N N   . GLN C 1 384 ? 14.820  -1.230  90.552  1.00 42.55  ? 385  GLN C N   1 
ATOM   8531  C CA  . GLN C 1 384 ? 13.946  -1.672  91.636  1.00 46.54  ? 385  GLN C CA  1 
ATOM   8532  C C   . GLN C 1 384 ? 12.567  -1.013  91.580  1.00 65.62  ? 385  GLN C C   1 
ATOM   8533  O O   . GLN C 1 384 ? 11.538  -1.688  91.701  1.00 81.11  ? 385  GLN C O   1 
ATOM   8534  C CB  . GLN C 1 384 ? 14.604  -1.411  92.993  1.00 44.30  ? 385  GLN C CB  1 
ATOM   8535  C CG  . GLN C 1 384 ? 15.920  -2.151  93.199  1.00 57.08  ? 385  GLN C CG  1 
ATOM   8536  C CD  . GLN C 1 384 ? 15.742  -3.657  93.274  1.00 67.21  ? 385  GLN C CD  1 
ATOM   8537  O OE1 . GLN C 1 384 ? 15.461  -4.207  94.339  1.00 68.62  ? 385  GLN C OE1 1 
ATOM   8538  N NE2 . GLN C 1 384 ? 15.909  -4.331  92.142  1.00 66.66  ? 385  GLN C NE2 1 
ATOM   8539  N N   . LEU C 1 385 ? 12.549  0.302   91.387  1.00 48.75  ? 386  LEU C N   1 
ATOM   8540  C CA  . LEU C 1 385 ? 11.294  1.047   91.337  1.00 43.26  ? 386  LEU C CA  1 
ATOM   8541  C C   . LEU C 1 385 ? 10.427  0.637   90.147  1.00 51.65  ? 386  LEU C C   1 
ATOM   8542  O O   . LEU C 1 385 ? 9.226   0.413   90.305  1.00 57.49  ? 386  LEU C O   1 
ATOM   8543  C CB  . LEU C 1 385 ? 11.553  2.557   91.330  1.00 36.82  ? 386  LEU C CB  1 
ATOM   8544  C CG  . LEU C 1 385 ? 12.228  3.114   92.589  1.00 36.83  ? 386  LEU C CG  1 
ATOM   8545  C CD1 . LEU C 1 385 ? 12.473  4.611   92.465  1.00 30.87  ? 386  LEU C CD1 1 
ATOM   8546  C CD2 . LEU C 1 385 ? 11.416  2.800   93.840  1.00 20.53  ? 386  LEU C CD2 1 
ATOM   8547  N N   . ARG C 1 386 ? 11.030  0.531   88.964  1.00 41.35  ? 387  ARG C N   1 
ATOM   8548  C CA  . ARG C 1 386 ? 10.295  0.063   87.791  1.00 43.29  ? 387  ARG C CA  1 
ATOM   8549  C C   . ARG C 1 386 ? 9.759   -1.345  88.018  1.00 57.53  ? 387  ARG C C   1 
ATOM   8550  O O   . ARG C 1 386 ? 8.690   -1.700  87.521  1.00 58.37  ? 387  ARG C O   1 
ATOM   8551  C CB  . ARG C 1 386 ? 11.164  0.093   86.532  1.00 35.20  ? 387  ARG C CB  1 
ATOM   8552  C CG  . ARG C 1 386 ? 11.380  1.478   85.945  1.00 71.65  ? 387  ARG C CG  1 
ATOM   8553  C CD  . ARG C 1 386 ? 11.855  1.390   84.502  1.00 81.62  ? 387  ARG C CD  1 
ATOM   8554  N NE  . ARG C 1 386 ? 12.930  0.414   84.341  1.00 79.19  ? 387  ARG C NE  1 
ATOM   8555  C CZ  . ARG C 1 386 ? 14.216  0.679   84.545  1.00 61.41  ? 387  ARG C CZ  1 
ATOM   8556  N NH1 . ARG C 1 386 ? 14.594  1.894   84.921  1.00 55.60  ? 387  ARG C NH1 1 
ATOM   8557  N NH2 . ARG C 1 386 ? 15.125  -0.271  84.375  1.00 47.37  ? 387  ARG C NH2 1 
ATOM   8558  N N   . ASP C 1 387 ? 10.509  -2.142  88.774  1.00 59.26  ? 388  ASP C N   1 
ATOM   8559  C CA  . ASP C 1 387 ? 10.082  -3.497  89.095  1.00 52.21  ? 388  ASP C CA  1 
ATOM   8560  C C   . ASP C 1 387 ? 8.842   -3.495  89.990  1.00 57.23  ? 388  ASP C C   1 
ATOM   8561  O O   . ASP C 1 387 ? 7.888   -4.234  89.743  1.00 68.62  ? 388  ASP C O   1 
ATOM   8562  C CB  . ASP C 1 387 ? 11.214  -4.265  89.776  1.00 48.52  ? 388  ASP C CB  1 
ATOM   8563  C CG  . ASP C 1 387 ? 10.947  -5.754  89.847  1.00 59.58  ? 388  ASP C CG  1 
ATOM   8564  O OD1 . ASP C 1 387 ? 10.599  -6.343  88.802  1.00 67.50  ? 388  ASP C OD1 1 
ATOM   8565  O OD2 . ASP C 1 387 ? 11.080  -6.335  90.945  1.00 59.69  ? 388  ASP C OD2 1 
ATOM   8566  N N   . VAL C 1 388 ? 8.856   -2.657  91.023  1.00 43.21  ? 389  VAL C N   1 
ATOM   8567  C CA  . VAL C 1 388 ? 7.777   -2.639  92.014  1.00 27.82  ? 389  VAL C CA  1 
ATOM   8568  C C   . VAL C 1 388 ? 6.657   -1.628  91.742  1.00 37.26  ? 389  VAL C C   1 
ATOM   8569  O O   . VAL C 1 388 ? 5.794   -1.410  92.594  1.00 31.46  ? 389  VAL C O   1 
ATOM   8570  C CB  . VAL C 1 388 ? 8.312   -2.443  93.446  1.00 28.86  ? 389  VAL C CB  1 
ATOM   8571  C CG1 . VAL C 1 388 ? 9.333   -3.518  93.772  1.00 29.18  ? 389  VAL C CG1 1 
ATOM   8572  C CG2 . VAL C 1 388 ? 8.912   -1.053  93.608  1.00 42.47  ? 389  VAL C CG2 1 
ATOM   8573  N N   . GLN C 1 389 ? 6.691   -0.987  90.579  1.00 40.78  ? 390  GLN C N   1 
ATOM   8574  C CA  . GLN C 1 389 ? 5.638   -0.046  90.204  1.00 35.29  ? 390  GLN C CA  1 
ATOM   8575  C C   . GLN C 1 389 ? 4.278   -0.734  90.081  1.00 46.94  ? 390  GLN C C   1 
ATOM   8576  O O   . GLN C 1 389 ? 3.236   -0.086  90.163  1.00 58.99  ? 390  GLN C O   1 
ATOM   8577  C CB  . GLN C 1 389 ? 5.981   0.651   88.886  1.00 32.40  ? 390  GLN C CB  1 
ATOM   8578  C CG  . GLN C 1 389 ? 5.668   -0.176  87.649  1.00 26.78  ? 390  GLN C CG  1 
ATOM   8579  C CD  . GLN C 1 389 ? 6.106   0.500   86.367  1.00 46.79  ? 390  GLN C CD  1 
ATOM   8580  O OE1 . GLN C 1 389 ? 7.002   1.345   86.373  1.00 69.27  ? 390  GLN C OE1 1 
ATOM   8581  N NE2 . GLN C 1 389 ? 5.474   0.134   85.259  1.00 38.62  ? 390  GLN C NE2 1 
ATOM   8582  N N   . ASP C 1 390 ? 4.298   -2.050  89.889  1.00 57.58  ? 391  ASP C N   1 
ATOM   8583  C CA  . ASP C 1 390 ? 3.084   -2.821  89.637  1.00 53.06  ? 391  ASP C CA  1 
ATOM   8584  C C   . ASP C 1 390 ? 2.477   -3.404  90.912  1.00 47.12  ? 391  ASP C C   1 
ATOM   8585  O O   . ASP C 1 390 ? 1.462   -4.093  90.858  1.00 60.52  ? 391  ASP C O   1 
ATOM   8586  C CB  . ASP C 1 390 ? 3.380   -3.947  88.634  1.00 59.49  ? 391  ASP C CB  1 
ATOM   8587  C CG  . ASP C 1 390 ? 4.658   -4.717  88.967  1.00 73.93  ? 391  ASP C CG  1 
ATOM   8588  O OD1 . ASP C 1 390 ? 4.873   -5.042  90.154  1.00 82.54  ? 391  ASP C OD1 1 
ATOM   8589  O OD2 . ASP C 1 390 ? 5.456   -4.995  88.044  1.00 61.77  ? 391  ASP C OD2 1 
ATOM   8590  N N   . PHE C 1 391 ? 3.087   -3.090  92.051  1.00 38.39  ? 392  PHE C N   1 
ATOM   8591  C CA  . PHE C 1 391 ? 2.867   -3.808  93.310  1.00 42.93  ? 392  PHE C CA  1 
ATOM   8592  C C   . PHE C 1 391 ? 1.404   -4.002  93.737  1.00 58.58  ? 392  PHE C C   1 
ATOM   8593  O O   . PHE C 1 391 ? 0.937   -5.140  93.911  1.00 70.24  ? 392  PHE C O   1 
ATOM   8594  C CB  . PHE C 1 391 ? 3.646   -3.095  94.424  1.00 31.39  ? 392  PHE C CB  1 
ATOM   8595  C CG  . PHE C 1 391 ? 3.586   -3.787  95.754  1.00 32.09  ? 392  PHE C CG  1 
ATOM   8596  C CD1 . PHE C 1 391 ? 4.321   -4.938  95.986  1.00 26.19  ? 392  PHE C CD1 1 
ATOM   8597  C CD2 . PHE C 1 391 ? 2.810   -3.273  96.781  1.00 30.48  ? 392  PHE C CD2 1 
ATOM   8598  C CE1 . PHE C 1 391 ? 4.271   -5.576  97.213  1.00 29.02  ? 392  PHE C CE1 1 
ATOM   8599  C CE2 . PHE C 1 391 ? 2.756   -3.903  98.011  1.00 30.12  ? 392  PHE C CE2 1 
ATOM   8600  C CZ  . PHE C 1 391 ? 3.487   -5.057  98.227  1.00 35.11  ? 392  PHE C CZ  1 
ATOM   8601  N N   . TRP C 1 392 ? 0.680   -2.896  93.873  1.00 62.44  ? 393  TRP C N   1 
ATOM   8602  C CA  . TRP C 1 392 ? -0.658  -2.923  94.461  1.00 56.07  ? 393  TRP C CA  1 
ATOM   8603  C C   . TRP C 1 392 ? -1.689  -3.661  93.614  1.00 51.70  ? 393  TRP C C   1 
ATOM   8604  O O   . TRP C 1 392 ? -2.578  -4.320  94.151  1.00 65.91  ? 393  TRP C O   1 
ATOM   8605  C CB  . TRP C 1 392 ? -1.134  -1.504  94.780  1.00 43.56  ? 393  TRP C CB  1 
ATOM   8606  C CG  . TRP C 1 392 ? -0.167  -0.760  95.646  1.00 37.56  ? 393  TRP C CG  1 
ATOM   8607  C CD1 . TRP C 1 392 ? 0.679   0.239   95.262  1.00 39.85  ? 393  TRP C CD1 1 
ATOM   8608  C CD2 . TRP C 1 392 ? 0.075   -0.978  97.040  1.00 35.59  ? 393  TRP C CD2 1 
ATOM   8609  N NE1 . TRP C 1 392 ? 1.424   0.665   96.334  1.00 34.17  ? 393  TRP C NE1 1 
ATOM   8610  C CE2 . TRP C 1 392 ? 1.074   -0.067  97.438  1.00 34.65  ? 393  TRP C CE2 1 
ATOM   8611  C CE3 . TRP C 1 392 ? -0.459  -1.851  97.992  1.00 46.70  ? 393  TRP C CE3 1 
ATOM   8612  C CZ2 . TRP C 1 392 ? 1.548   -0.004  98.746  1.00 42.20  ? 393  TRP C CZ2 1 
ATOM   8613  C CZ3 . TRP C 1 392 ? 0.013   -1.788  99.290  1.00 47.46  ? 393  TRP C CZ3 1 
ATOM   8614  C CH2 . TRP C 1 392 ? 1.007   -0.871  99.655  1.00 41.95  ? 393  TRP C CH2 1 
ATOM   8615  N N   . ILE C 1 393 ? -1.580  -3.545  92.295  1.00 36.22  ? 394  ILE C N   1 
ATOM   8616  C CA  . ILE C 1 393 ? -2.460  -4.290  91.402  1.00 41.71  ? 394  ILE C CA  1 
ATOM   8617  C C   . ILE C 1 393 ? -2.001  -5.732  91.188  1.00 44.65  ? 394  ILE C C   1 
ATOM   8618  O O   . ILE C 1 393 ? -2.816  -6.609  90.900  1.00 62.00  ? 394  ILE C O   1 
ATOM   8619  C CB  . ILE C 1 393 ? -2.627  -3.599  90.035  1.00 36.17  ? 394  ILE C CB  1 
ATOM   8620  C CG1 . ILE C 1 393 ? -1.281  -3.484  89.319  1.00 40.89  ? 394  ILE C CG1 1 
ATOM   8621  C CG2 . ILE C 1 393 ? -3.276  -2.237  90.206  1.00 28.21  ? 394  ILE C CG2 1 
ATOM   8622  C CD1 . ILE C 1 393 ? -1.387  -2.925  87.921  1.00 52.49  ? 394  ILE C CD1 1 
ATOM   8623  N N   . SER C 1 394 ? -0.701  -5.976  91.326  1.00 39.01  ? 395  SER C N   1 
ATOM   8624  C CA  . SER C 1 394 ? -0.148  -7.298  91.036  1.00 49.83  ? 395  SER C CA  1 
ATOM   8625  C C   . SER C 1 394 ? -0.189  -8.237  92.237  1.00 49.53  ? 395  SER C C   1 
ATOM   8626  O O   . SER C 1 394 ? 0.065   -9.435  92.096  1.00 27.88  ? 395  SER C O   1 
ATOM   8627  C CB  . SER C 1 394 ? 1.285   -7.191  90.513  1.00 42.27  ? 395  SER C CB  1 
ATOM   8628  O OG  . SER C 1 394 ? 2.180   -6.848  91.555  1.00 38.95  ? 395  SER C OG  1 
ATOM   8629  N N   . LEU C 1 395 ? -0.498  -7.694  93.412  1.00 51.53  ? 396  LEU C N   1 
ATOM   8630  C CA  . LEU C 1 395 ? -0.677  -8.530  94.604  1.00 47.20  ? 396  LEU C CA  1 
ATOM   8631  C C   . LEU C 1 395 ? -1.540  -9.795  94.406  1.00 46.52  ? 396  LEU C C   1 
ATOM   8632  O O   . LEU C 1 395 ? -1.097  -10.888 94.753  1.00 50.41  ? 396  LEU C O   1 
ATOM   8633  C CB  . LEU C 1 395 ? -1.172  -7.704  95.799  1.00 53.32  ? 396  LEU C CB  1 
ATOM   8634  C CG  . LEU C 1 395 ? -0.097  -6.992  96.619  1.00 64.55  ? 396  LEU C CG  1 
ATOM   8635  C CD1 . LEU C 1 395 ? -0.725  -6.092  97.674  1.00 63.76  ? 396  LEU C CD1 1 
ATOM   8636  C CD2 . LEU C 1 395 ? 0.827   -8.010  97.266  1.00 67.52  ? 396  LEU C CD2 1 
ATOM   8637  N N   . PRO C 1 396 ? -2.766  -9.662  93.855  1.00 58.43  ? 397  PRO C N   1 
ATOM   8638  C CA  . PRO C 1 396 ? -3.582  -10.872 93.674  1.00 60.25  ? 397  PRO C CA  1 
ATOM   8639  C C   . PRO C 1 396 ? -2.998  -11.880 92.683  1.00 62.05  ? 397  PRO C C   1 
ATOM   8640  O O   . PRO C 1 396 ? -3.004  -13.079 92.961  1.00 61.54  ? 397  PRO C O   1 
ATOM   8641  C CB  . PRO C 1 396 ? -4.905  -10.323 93.125  1.00 54.45  ? 397  PRO C CB  1 
ATOM   8642  C CG  . PRO C 1 396 ? -4.931  -8.903  93.543  1.00 59.93  ? 397  PRO C CG  1 
ATOM   8643  C CD  . PRO C 1 396 ? -3.510  -8.455  93.453  1.00 61.27  ? 397  PRO C CD  1 
ATOM   8644  N N   . GLY C 1 397 ? -2.502  -11.399 91.547  1.00 61.49  ? 398  GLY C N   1 
ATOM   8645  C CA  . GLY C 1 397 ? -1.992  -12.274 90.505  1.00 58.41  ? 398  GLY C CA  1 
ATOM   8646  C C   . GLY C 1 397 ? -0.743  -13.030 90.919  1.00 58.85  ? 398  GLY C C   1 
ATOM   8647  O O   . GLY C 1 397 ? -0.534  -14.179 90.525  1.00 45.85  ? 398  GLY C O   1 
ATOM   8648  N N   . THR C 1 398 ? 0.092   -12.376 91.718  1.00 67.01  ? 399  THR C N   1 
ATOM   8649  C CA  . THR C 1 398 ? 1.310   -12.992 92.222  1.00 57.99  ? 399  THR C CA  1 
ATOM   8650  C C   . THR C 1 398 ? 0.973   -14.138 93.170  1.00 51.97  ? 399  THR C C   1 
ATOM   8651  O O   . THR C 1 398 ? 1.514   -15.236 93.047  1.00 55.08  ? 399  THR C O   1 
ATOM   8652  C CB  . THR C 1 398 ? 2.193   -11.961 92.955  1.00 50.94  ? 399  THR C CB  1 
ATOM   8653  O OG1 . THR C 1 398 ? 2.548   -10.907 92.050  1.00 55.27  ? 399  THR C OG1 1 
ATOM   8654  C CG2 . THR C 1 398 ? 3.460   -12.617 93.485  1.00 45.30  ? 399  THR C CG2 1 
ATOM   8655  N N   . LEU C 1 399 ? 0.063   -13.879 94.102  1.00 54.39  ? 400  LEU C N   1 
ATOM   8656  C CA  . LEU C 1 399 ? -0.332  -14.874 95.094  1.00 61.58  ? 400  LEU C CA  1 
ATOM   8657  C C   . LEU C 1 399 ? -1.069  -16.065 94.487  1.00 58.50  ? 400  LEU C C   1 
ATOM   8658  O O   . LEU C 1 399 ? -0.950  -17.187 94.976  1.00 54.86  ? 400  LEU C O   1 
ATOM   8659  C CB  . LEU C 1 399 ? -1.189  -14.224 96.182  1.00 61.41  ? 400  LEU C CB  1 
ATOM   8660  C CG  . LEU C 1 399 ? -0.417  -13.367 97.187  1.00 71.15  ? 400  LEU C CG  1 
ATOM   8661  C CD1 . LEU C 1 399 ? -1.363  -12.583 98.082  1.00 70.42  ? 400  LEU C CD1 1 
ATOM   8662  C CD2 . LEU C 1 399 ? 0.500   -14.249 98.017  1.00 78.57  ? 400  LEU C CD2 1 
ATOM   8663  N N   . CYS C 1 400 ? -1.829  -15.822 93.424  1.00 47.39  ? 401  CYS C N   1 
ATOM   8664  C CA  . CYS C 1 400 ? -2.601  -16.885 92.786  1.00 68.58  ? 401  CYS C CA  1 
ATOM   8665  C C   . CYS C 1 400 ? -1.765  -17.767 91.863  1.00 80.18  ? 401  CYS C C   1 
ATOM   8666  O O   . CYS C 1 400 ? -2.069  -18.947 91.678  1.00 78.05  ? 401  CYS C O   1 
ATOM   8667  C CB  . CYS C 1 400 ? -3.795  -16.307 92.026  1.00 65.42  ? 401  CYS C CB  1 
ATOM   8668  S SG  . CYS C 1 400 ? -5.141  -15.766 93.096  1.00 61.92  ? 401  CYS C SG  1 
ATOM   8669  N N   . SER C 1 401 ? -0.717  -17.195 91.283  1.00 91.01  ? 402  SER C N   1 
ATOM   8670  C CA  . SER C 1 401 ? 0.122   -17.931 90.346  1.00 99.69  ? 402  SER C CA  1 
ATOM   8671  C C   . SER C 1 401 ? 1.301   -18.587 91.062  1.00 110.42 ? 402  SER C C   1 
ATOM   8672  O O   . SER C 1 401 ? 2.117   -19.270 90.442  1.00 116.91 ? 402  SER C O   1 
ATOM   8673  C CB  . SER C 1 401 ? 0.618   -17.004 89.233  1.00 86.92  ? 402  SER C CB  1 
ATOM   8674  O OG  . SER C 1 401 ? 1.095   -17.748 88.123  1.00 85.33  ? 402  SER C OG  1 
ATOM   8675  N N   . GLU C 1 402 ? 1.379   -18.378 92.373  1.00 108.75 ? 403  GLU C N   1 
ATOM   8676  C CA  . GLU C 1 402 ? 2.478   -18.908 93.172  1.00 110.41 ? 403  GLU C CA  1 
ATOM   8677  C C   . GLU C 1 402 ? 1.992   -19.845 94.275  1.00 110.36 ? 403  GLU C C   1 
ATOM   8678  O O   . GLU C 1 402 ? 2.188   -21.058 94.203  1.00 105.18 ? 403  GLU C O   1 
ATOM   8679  C CB  . GLU C 1 402 ? 3.291   -17.760 93.779  1.00 113.83 ? 403  GLU C CB  1 
ATOM   8680  C CG  . GLU C 1 402 ? 4.370   -18.188 94.761  1.00 122.04 ? 403  GLU C CG  1 
ATOM   8681  C CD  . GLU C 1 402 ? 5.083   -17.005 95.393  1.00 130.92 ? 403  GLU C CD  1 
ATOM   8682  O OE1 . GLU C 1 402 ? 5.355   -16.020 94.675  1.00 126.48 ? 403  GLU C OE1 1 
ATOM   8683  O OE2 . GLU C 1 402 ? 5.365   -17.058 96.609  1.00 136.69 ? 403  GLU C OE2 1 
ATOM   8684  N N   . LYS C 1 403 ? 1.355   -19.273 95.291  1.00 110.33 ? 404  LYS C N   1 
ATOM   8685  C CA  . LYS C 1 403 ? 0.967   -20.023 96.482  1.00 103.76 ? 404  LYS C CA  1 
ATOM   8686  C C   . LYS C 1 403 ? -0.302  -20.856 96.291  1.00 94.31  ? 404  LYS C C   1 
ATOM   8687  O O   . LYS C 1 403 ? -0.369  -22.007 96.723  1.00 80.84  ? 404  LYS C O   1 
ATOM   8688  C CB  . LYS C 1 403 ? 0.778   -19.065 97.662  1.00 99.33  ? 404  LYS C CB  1 
ATOM   8689  C CG  . LYS C 1 403 ? 1.879   -18.020 97.800  1.00 96.52  ? 404  LYS C CG  1 
ATOM   8690  C CD  . LYS C 1 403 ? 3.130   -18.588 98.451  1.00 90.12  ? 404  LYS C CD  1 
ATOM   8691  C CE  . LYS C 1 403 ? 2.932   -18.795 99.949  1.00 84.41  ? 404  LYS C CE  1 
ATOM   8692  N NZ  . LYS C 1 403 ? 4.174   -19.317 100.593 1.00 79.65  ? 404  LYS C NZ  1 
ATOM   8693  N N   . MET C 1 404 ? -1.305  -20.269 95.646  1.00 106.00 ? 405  MET C N   1 
ATOM   8694  C CA  . MET C 1 404 ? -2.620  -20.895 95.549  1.00 109.35 ? 405  MET C CA  1 
ATOM   8695  C C   . MET C 1 404 ? -2.980  -21.273 94.115  1.00 97.89  ? 405  MET C C   1 
ATOM   8696  O O   . MET C 1 404 ? -3.982  -21.947 93.875  1.00 74.65  ? 405  MET C O   1 
ATOM   8697  C CB  . MET C 1 404 ? -3.685  -19.962 96.130  1.00 108.14 ? 405  MET C CB  1 
ATOM   8698  C CG  . MET C 1 404 ? -3.315  -19.388 97.489  1.00 109.20 ? 405  MET C CG  1 
ATOM   8699  S SD  . MET C 1 404 ? -4.452  -18.114 98.067  1.00 85.90  ? 405  MET C SD  1 
ATOM   8700  C CE  . MET C 1 404 ? -3.624  -17.585 99.566  1.00 55.76  ? 405  MET C CE  1 
ATOM   8701  N N   . ARG C 1 413 ? -11.460 -29.068 85.332  1.00 65.77  ? 414  ARG C N   1 
ATOM   8702  C CA  . ARG C 1 413 ? -10.048 -29.186 85.682  1.00 88.43  ? 414  ARG C CA  1 
ATOM   8703  C C   . ARG C 1 413 ? -9.733  -28.569 87.044  1.00 89.29  ? 414  ARG C C   1 
ATOM   8704  O O   . ARG C 1 413 ? -8.827  -29.031 87.743  1.00 78.25  ? 414  ARG C O   1 
ATOM   8705  C CB  . ARG C 1 413 ? -9.168  -28.545 84.602  1.00 100.56 ? 414  ARG C CB  1 
ATOM   8706  C CG  . ARG C 1 413 ? -8.815  -29.469 83.442  1.00 110.56 ? 414  ARG C CG  1 
ATOM   8707  C CD  . ARG C 1 413 ? -7.716  -30.455 83.825  1.00 117.38 ? 414  ARG C CD  1 
ATOM   8708  N NE  . ARG C 1 413 ? -6.437  -29.792 84.068  1.00 114.58 ? 414  ARG C NE  1 
ATOM   8709  C CZ  . ARG C 1 413 ? -5.471  -29.668 83.162  1.00 111.15 ? 414  ARG C CZ  1 
ATOM   8710  N NH1 . ARG C 1 413 ? -5.630  -30.166 81.943  1.00 116.12 ? 414  ARG C NH1 1 
ATOM   8711  N NH2 . ARG C 1 413 ? -4.341  -29.048 83.476  1.00 103.18 ? 414  ARG C NH2 1 
ATOM   8712  N N   . CYS C 1 414 ? -10.480 -27.534 87.424  1.00 87.44  ? 415  CYS C N   1 
ATOM   8713  C CA  . CYS C 1 414 ? -10.155 -26.784 88.635  1.00 74.05  ? 415  CYS C CA  1 
ATOM   8714  C C   . CYS C 1 414 ? -11.366 -26.519 89.529  1.00 71.41  ? 415  CYS C C   1 
ATOM   8715  O O   . CYS C 1 414 ? -12.510 -26.698 89.117  1.00 79.68  ? 415  CYS C O   1 
ATOM   8716  C CB  . CYS C 1 414 ? -9.471  -25.464 88.272  1.00 59.70  ? 415  CYS C CB  1 
ATOM   8717  S SG  . CYS C 1 414 ? -10.437 -24.391 87.188  1.00 142.64 ? 415  CYS C SG  1 
ATOM   8718  N N   . TRP C 1 415 ? -11.098 -26.080 90.755  1.00 62.64  ? 416  TRP C N   1 
ATOM   8719  C CA  . TRP C 1 415 ? -12.151 -25.800 91.724  1.00 61.59  ? 416  TRP C CA  1 
ATOM   8720  C C   . TRP C 1 415 ? -12.684 -24.380 91.555  1.00 71.07  ? 416  TRP C C   1 
ATOM   8721  O O   . TRP C 1 415 ? -11.957 -23.406 91.743  1.00 79.77  ? 416  TRP C O   1 
ATOM   8722  C CB  . TRP C 1 415 ? -11.616 -26.006 93.145  1.00 57.67  ? 416  TRP C CB  1 
ATOM   8723  C CG  . TRP C 1 415 ? -12.492 -25.461 94.237  1.00 69.31  ? 416  TRP C CG  1 
ATOM   8724  C CD1 . TRP C 1 415 ? -12.322 -24.288 94.915  1.00 79.28  ? 416  TRP C CD1 1 
ATOM   8725  C CD2 . TRP C 1 415 ? -13.666 -26.074 94.785  1.00 75.00  ? 416  TRP C CD2 1 
ATOM   8726  N NE1 . TRP C 1 415 ? -13.318 -24.132 95.849  1.00 77.46  ? 416  TRP C NE1 1 
ATOM   8727  C CE2 . TRP C 1 415 ? -14.155 -25.213 95.790  1.00 68.93  ? 416  TRP C CE2 1 
ATOM   8728  C CE3 . TRP C 1 415 ? -14.350 -27.264 94.525  1.00 84.88  ? 416  TRP C CE3 1 
ATOM   8729  C CZ2 . TRP C 1 415 ? -15.297 -25.506 96.530  1.00 72.61  ? 416  TRP C CZ2 1 
ATOM   8730  C CZ3 . TRP C 1 415 ? -15.484 -27.552 95.262  1.00 81.07  ? 416  TRP C CZ3 1 
ATOM   8731  C CH2 . TRP C 1 415 ? -15.946 -26.677 96.252  1.00 77.20  ? 416  TRP C CH2 1 
ATOM   8732  N N   . ASN C 1 416 ? -13.960 -24.275 91.197  1.00 62.04  ? 417  ASN C N   1 
ATOM   8733  C CA  . ASN C 1 416 ? -14.598 -22.983 90.958  1.00 53.59  ? 417  ASN C CA  1 
ATOM   8734  C C   . ASN C 1 416 ? -15.394 -22.445 92.145  1.00 58.38  ? 417  ASN C C   1 
ATOM   8735  O O   . ASN C 1 416 ? -16.044 -21.406 92.042  1.00 64.97  ? 417  ASN C O   1 
ATOM   8736  C CB  . ASN C 1 416 ? -15.479 -23.041 89.708  1.00 57.45  ? 417  ASN C CB  1 
ATOM   8737  C CG  . ASN C 1 416 ? -16.458 -24.199 89.735  1.00 67.74  ? 417  ASN C CG  1 
ATOM   8738  O OD1 . ASN C 1 416 ? -17.010 -24.540 90.782  1.00 60.80  ? 417  ASN C OD1 1 
ATOM   8739  N ND2 . ASN C 1 416 ? -16.673 -24.815 88.579  1.00 78.25  ? 417  ASN C ND2 1 
ATOM   8740  N N   . GLY C 1 417 ? -15.359 -23.162 93.263  1.00 51.06  ? 418  GLY C N   1 
ATOM   8741  C CA  . GLY C 1 417 ? -16.090 -22.751 94.449  1.00 60.46  ? 418  GLY C CA  1 
ATOM   8742  C C   . GLY C 1 417 ? -17.359 -23.552 94.655  1.00 68.92  ? 418  GLY C C   1 
ATOM   8743  O O   . GLY C 1 417 ? -17.884 -23.631 95.766  1.00 68.51  ? 418  GLY C O   1 
ATOM   8744  N N   . MET C 1 418 ? -17.852 -24.150 93.577  1.00 68.32  ? 419  MET C N   1 
ATOM   8745  C CA  . MET C 1 418 ? -19.024 -25.014 93.646  1.00 67.02  ? 419  MET C CA  1 
ATOM   8746  C C   . MET C 1 418 ? -18.615 -26.475 93.515  1.00 72.95  ? 419  MET C C   1 
ATOM   8747  O O   . MET C 1 418 ? -18.830 -27.277 94.425  1.00 74.25  ? 419  MET C O   1 
ATOM   8748  C CB  . MET C 1 418 ? -20.050 -24.641 92.574  1.00 66.85  ? 419  MET C CB  1 
ATOM   8749  C CG  . MET C 1 418 ? -20.851 -23.382 92.895  1.00 69.98  ? 419  MET C CG  1 
ATOM   8750  S SD  . MET C 1 418 ? -22.343 -23.213 91.893  1.00 151.16 ? 419  MET C SD  1 
ATOM   8751  C CE  . MET C 1 418 ? -21.640 -22.957 90.266  1.00 41.58  ? 419  MET C CE  1 
ATOM   8752  N N   . ALA C 1 419 ? -18.033 -26.815 92.371  1.00 75.97  ? 420  ALA C N   1 
ATOM   8753  C CA  . ALA C 1 419 ? -17.535 -28.164 92.134  1.00 78.12  ? 420  ALA C CA  1 
ATOM   8754  C C   . ALA C 1 419 ? -16.293 -28.118 91.246  1.00 80.99  ? 420  ALA C C   1 
ATOM   8755  O O   . ALA C 1 419 ? -15.747 -27.046 90.989  1.00 92.45  ? 420  ALA C O   1 
ATOM   8756  C CB  . ALA C 1 419 ? -18.616 -29.014 91.493  1.00 77.01  ? 420  ALA C CB  1 
ATOM   8757  N N   . ARG C 1 420 ? -15.831 -29.279 90.794  1.00 69.31  ? 421  ARG C N   1 
ATOM   8758  C CA  . ARG C 1 420 ? -14.756 -29.321 89.810  1.00 56.31  ? 421  ARG C CA  1 
ATOM   8759  C C   . ARG C 1 420 ? -15.320 -28.912 88.453  1.00 63.85  ? 421  ARG C C   1 
ATOM   8760  O O   . ARG C 1 420 ? -16.453 -29.251 88.114  1.00 82.66  ? 421  ARG C O   1 
ATOM   8761  C CB  . ARG C 1 420 ? -14.109 -30.709 89.754  1.00 67.72  ? 421  ARG C CB  1 
ATOM   8762  C CG  . ARG C 1 420 ? -12.736 -30.772 90.417  1.00 80.29  ? 421  ARG C CG  1 
ATOM   8763  C CD  . ARG C 1 420 ? -12.207 -32.202 90.535  1.00 99.85  ? 421  ARG C CD  1 
ATOM   8764  N NE  . ARG C 1 420 ? -12.056 -32.864 89.241  1.00 116.36 ? 421  ARG C NE  1 
ATOM   8765  C CZ  . ARG C 1 420 ? -11.349 -33.975 89.047  1.00 121.09 ? 421  ARG C CZ  1 
ATOM   8766  N NH1 . ARG C 1 420 ? -10.715 -34.549 90.062  1.00 125.27 ? 421  ARG C NH1 1 
ATOM   8767  N NH2 . ARG C 1 420 ? -11.269 -34.509 87.836  1.00 114.34 ? 421  ARG C NH2 1 
ATOM   8768  N N   . GLY C 1 421 ? -14.527 -28.180 87.681  1.00 64.71  ? 422  GLY C N   1 
ATOM   8769  C CA  . GLY C 1 421 ? -14.996 -27.598 86.438  1.00 62.76  ? 422  GLY C CA  1 
ATOM   8770  C C   . GLY C 1 421 ? -14.151 -26.405 86.044  1.00 78.45  ? 422  GLY C C   1 
ATOM   8771  O O   . GLY C 1 421 ? -12.969 -26.325 86.398  1.00 102.31 ? 422  GLY C O   1 
ATOM   8772  N N   . ARG C 1 422 ? -14.745 -25.492 85.285  1.00 68.64  ? 423  ARG C N   1 
ATOM   8773  C CA  . ARG C 1 422 ? -14.061 -24.264 84.897  1.00 81.21  ? 423  ARG C CA  1 
ATOM   8774  C C   . ARG C 1 422 ? -14.825 -23.017 85.352  1.00 81.59  ? 423  ARG C C   1 
ATOM   8775  O O   . ARG C 1 422 ? -16.039 -23.062 85.564  1.00 78.85  ? 423  ARG C O   1 
ATOM   8776  C CB  . ARG C 1 422 ? -13.812 -24.245 83.387  1.00 93.49  ? 423  ARG C CB  1 
ATOM   8777  C CG  . ARG C 1 422 ? -15.073 -24.338 82.545  1.00 110.81 ? 423  ARG C CG  1 
ATOM   8778  C CD  . ARG C 1 422 ? -14.769 -24.861 81.149  1.00 127.79 ? 423  ARG C CD  1 
ATOM   8779  N NE  . ARG C 1 422 ? -15.842 -24.558 80.205  1.00 139.90 ? 423  ARG C NE  1 
ATOM   8780  C CZ  . ARG C 1 422 ? -15.831 -23.520 79.375  1.00 144.30 ? 423  ARG C CZ  1 
ATOM   8781  N NH1 . ARG C 1 422 ? -14.801 -22.685 79.371  1.00 146.14 ? 423  ARG C NH1 1 
ATOM   8782  N NH2 . ARG C 1 422 ? -16.846 -23.315 78.546  1.00 144.81 ? 423  ARG C NH2 1 
ATOM   8783  N N   . TYR C 1 423 ? -14.103 -21.908 85.493  1.00 78.08  ? 424  TYR C N   1 
ATOM   8784  C CA  . TYR C 1 423 ? -14.654 -20.686 86.073  1.00 73.00  ? 424  TYR C CA  1 
ATOM   8785  C C   . TYR C 1 423 ? -15.213 -19.742 85.008  1.00 76.14  ? 424  TYR C C   1 
ATOM   8786  O O   . TYR C 1 423 ? -14.471 -19.168 84.212  1.00 83.03  ? 424  TYR C O   1 
ATOM   8787  C CB  . TYR C 1 423 ? -13.574 -19.980 86.895  1.00 65.58  ? 424  TYR C CB  1 
ATOM   8788  C CG  . TYR C 1 423 ? -14.061 -18.806 87.712  1.00 60.18  ? 424  TYR C CG  1 
ATOM   8789  C CD1 . TYR C 1 423 ? -14.762 -19.000 88.895  1.00 54.99  ? 424  TYR C CD1 1 
ATOM   8790  C CD2 . TYR C 1 423 ? -13.804 -17.502 87.310  1.00 55.25  ? 424  TYR C CD2 1 
ATOM   8791  C CE1 . TYR C 1 423 ? -15.202 -17.929 89.649  1.00 50.88  ? 424  TYR C CE1 1 
ATOM   8792  C CE2 . TYR C 1 423 ? -14.240 -16.426 88.057  1.00 55.91  ? 424  TYR C CE2 1 
ATOM   8793  C CZ  . TYR C 1 423 ? -14.938 -16.644 89.226  1.00 59.65  ? 424  TYR C CZ  1 
ATOM   8794  O OH  . TYR C 1 423 ? -15.374 -15.573 89.972  1.00 64.11  ? 424  TYR C OH  1 
ATOM   8795  N N   . LEU C 1 424 ? -16.532 -19.594 85.007  1.00 70.15  ? 425  LEU C N   1 
ATOM   8796  C CA  . LEU C 1 424 ? -17.241 -18.760 84.033  1.00 74.96  ? 425  LEU C CA  1 
ATOM   8797  C C   . LEU C 1 424 ? -17.058 -17.232 84.133  1.00 75.01  ? 425  LEU C C   1 
ATOM   8798  O O   . LEU C 1 424 ? -16.811 -16.583 83.118  1.00 72.16  ? 425  LEU C O   1 
ATOM   8799  C CB  . LEU C 1 424 ? -18.723 -19.134 83.971  1.00 76.77  ? 425  LEU C CB  1 
ATOM   8800  C CG  . LEU C 1 424 ? -19.008 -20.568 83.520  1.00 69.54  ? 425  LEU C CG  1 
ATOM   8801  C CD1 . LEU C 1 424 ? -20.495 -20.765 83.273  1.00 62.31  ? 425  LEU C CD1 1 
ATOM   8802  C CD2 . LEU C 1 424 ? -18.198 -20.914 82.277  1.00 64.63  ? 425  LEU C CD2 1 
ATOM   8803  N N   . PRO C 1 425 ? -17.218 -16.648 85.341  1.00 70.00  ? 426  PRO C N   1 
ATOM   8804  C CA  . PRO C 1 425 ? -17.139 -15.182 85.426  1.00 66.39  ? 426  PRO C CA  1 
ATOM   8805  C C   . PRO C 1 425 ? -15.795 -14.609 84.975  1.00 74.70  ? 426  PRO C C   1 
ATOM   8806  O O   . PRO C 1 425 ? -14.751 -15.225 85.197  1.00 62.33  ? 426  PRO C O   1 
ATOM   8807  C CB  . PRO C 1 425 ? -17.343 -14.906 86.920  1.00 49.39  ? 426  PRO C CB  1 
ATOM   8808  C CG  . PRO C 1 425 ? -18.089 -16.083 87.422  1.00 48.81  ? 426  PRO C CG  1 
ATOM   8809  C CD  . PRO C 1 425 ? -17.557 -17.245 86.646  1.00 55.65  ? 426  PRO C CD  1 
ATOM   8810  N N   . GLU C 1 426 ? -15.836 -13.441 84.341  1.00 84.41  ? 427  GLU C N   1 
ATOM   8811  C CA  . GLU C 1 426 ? -14.624 -12.750 83.918  1.00 80.11  ? 427  GLU C CA  1 
ATOM   8812  C C   . GLU C 1 426 ? -13.983 -12.031 85.102  1.00 74.72  ? 427  GLU C C   1 
ATOM   8813  O O   . GLU C 1 426 ? -14.666 -11.667 86.060  1.00 68.32  ? 427  GLU C O   1 
ATOM   8814  C CB  . GLU C 1 426 ? -14.935 -11.752 82.801  1.00 85.19  ? 427  GLU C CB  1 
ATOM   8815  C CG  . GLU C 1 426 ? -15.887 -10.642 83.214  1.00 95.51  ? 427  GLU C CG  1 
ATOM   8816  C CD  . GLU C 1 426 ? -16.149 -9.650  82.099  1.00 101.51 ? 427  GLU C CD  1 
ATOM   8817  O OE1 . GLU C 1 426 ? -15.702 -9.900  80.959  1.00 99.94  ? 427  GLU C OE1 1 
ATOM   8818  O OE2 . GLU C 1 426 ? -16.802 -8.620  82.363  1.00 104.11 ? 427  GLU C OE2 1 
ATOM   8819  N N   . VAL C 1 427 ? -12.672 -11.828 85.032  1.00 69.23  ? 428  VAL C N   1 
ATOM   8820  C CA  . VAL C 1 427 ? -11.937 -11.208 86.130  1.00 70.96  ? 428  VAL C CA  1 
ATOM   8821  C C   . VAL C 1 427 ? -12.289 -9.729  86.286  1.00 69.63  ? 428  VAL C C   1 
ATOM   8822  O O   . VAL C 1 427 ? -12.394 -8.995  85.303  1.00 77.58  ? 428  VAL C O   1 
ATOM   8823  C CB  . VAL C 1 427 ? -10.415 -11.364 85.948  1.00 70.48  ? 428  VAL C CB  1 
ATOM   8824  C CG1 . VAL C 1 427 ? -9.687  -11.013 87.238  1.00 63.67  ? 428  VAL C CG1 1 
ATOM   8825  C CG2 . VAL C 1 427 ? -10.080 -12.784 85.522  1.00 76.07  ? 428  VAL C CG2 1 
ATOM   8826  N N   . MET C 1 428 ? -12.471 -9.304  87.532  1.00 53.50  ? 429  MET C N   1 
ATOM   8827  C CA  . MET C 1 428 ? -12.846 -7.930  87.840  1.00 51.77  ? 429  MET C CA  1 
ATOM   8828  C C   . MET C 1 428 ? -11.694 -6.957  87.623  1.00 58.13  ? 429  MET C C   1 
ATOM   8829  O O   . MET C 1 428 ? -10.531 -7.355  87.561  1.00 65.71  ? 429  MET C O   1 
ATOM   8830  C CB  . MET C 1 428 ? -13.346 -7.825  89.283  1.00 56.48  ? 429  MET C CB  1 
ATOM   8831  C CG  . MET C 1 428 ? -14.591 -8.649  89.591  1.00 58.87  ? 429  MET C CG  1 
ATOM   8832  S SD  . MET C 1 428 ? -16.143 -7.788  89.263  1.00 93.36  ? 429  MET C SD  1 
ATOM   8833  C CE  . MET C 1 428 ? -16.369 -8.084  87.511  1.00 48.56  ? 429  MET C CE  1 
ATOM   8834  N N   . GLY C 1 429 ? -12.029 -5.678  87.492  1.00 53.21  ? 430  GLY C N   1 
ATOM   8835  C CA  . GLY C 1 429 ? -11.027 -4.633  87.413  1.00 49.10  ? 430  GLY C CA  1 
ATOM   8836  C C   . GLY C 1 429 ? -10.396 -4.397  88.772  1.00 57.71  ? 430  GLY C C   1 
ATOM   8837  O O   . GLY C 1 429 ? -10.741 -5.064  89.747  1.00 65.40  ? 430  GLY C O   1 
ATOM   8838  N N   . ASP C 1 430 ? -9.478  -3.441  88.846  1.00 63.11  ? 431  ASP C N   1 
ATOM   8839  C CA  . ASP C 1 430 ? -8.746  -3.194  90.082  1.00 55.19  ? 431  ASP C CA  1 
ATOM   8840  C C   . ASP C 1 430 ? -9.299  -1.985  90.827  1.00 47.54  ? 431  ASP C C   1 
ATOM   8841  O O   . ASP C 1 430 ? -9.768  -1.029  90.210  1.00 47.88  ? 431  ASP C O   1 
ATOM   8842  C CB  . ASP C 1 430 ? -7.256  -3.003  89.792  1.00 50.85  ? 431  ASP C CB  1 
ATOM   8843  C CG  . ASP C 1 430 ? -6.659  -4.170  89.033  1.00 64.53  ? 431  ASP C CG  1 
ATOM   8844  O OD1 . ASP C 1 430 ? -6.711  -4.153  87.785  1.00 68.96  ? 431  ASP C OD1 1 
ATOM   8845  O OD2 . ASP C 1 430 ? -6.139  -5.104  89.681  1.00 77.19  ? 431  ASP C OD2 1 
ATOM   8846  N N   . GLY C 1 431 ? -9.248  -2.038  92.154  1.00 42.55  ? 432  GLY C N   1 
ATOM   8847  C CA  . GLY C 1 431 ? -9.736  -0.949  92.980  1.00 51.52  ? 432  GLY C CA  1 
ATOM   8848  C C   . GLY C 1 431 ? -11.027 -1.275  93.702  1.00 65.16  ? 432  GLY C C   1 
ATOM   8849  O O   . GLY C 1 431 ? -11.680 -2.277  93.411  1.00 73.32  ? 432  GLY C O   1 
ATOM   8850  N N   . LEU C 1 432 ? -11.394 -0.419  94.650  1.00 70.00  ? 433  LEU C N   1 
ATOM   8851  C CA  . LEU C 1 432 ? -12.571 -0.643  95.481  1.00 71.29  ? 433  LEU C CA  1 
ATOM   8852  C C   . LEU C 1 432 ? -13.862 -0.628  94.665  1.00 71.30  ? 433  LEU C C   1 
ATOM   8853  O O   . LEU C 1 432 ? -14.659 -1.563  94.737  1.00 72.48  ? 433  LEU C O   1 
ATOM   8854  C CB  . LEU C 1 432 ? -12.638 0.406   96.596  1.00 56.49  ? 433  LEU C CB  1 
ATOM   8855  C CG  . LEU C 1 432 ? -13.631 0.163   97.738  1.00 56.15  ? 433  LEU C CG  1 
ATOM   8856  C CD1 . LEU C 1 432 ? -13.305 -1.114  98.501  1.00 49.30  ? 433  LEU C CD1 1 
ATOM   8857  C CD2 . LEU C 1 432 ? -13.658 1.349   98.685  1.00 57.92  ? 433  LEU C CD2 1 
ATOM   8858  N N   . ALA C 1 433 ? -14.048 0.430   93.879  1.00 65.98  ? 434  ALA C N   1 
ATOM   8859  C CA  . ALA C 1 433 ? -15.287 0.654   93.136  1.00 58.82  ? 434  ALA C CA  1 
ATOM   8860  C C   . ALA C 1 433 ? -15.610 -0.465  92.146  1.00 54.80  ? 434  ALA C C   1 
ATOM   8861  O O   . ALA C 1 433 ? -16.771 -0.685  91.799  1.00 45.69  ? 434  ALA C O   1 
ATOM   8862  C CB  . ALA C 1 433 ? -15.227 1.994   92.416  1.00 29.16  ? 434  ALA C CB  1 
ATOM   8863  N N   . ASN C 1 434 ? -14.578 -1.168  91.694  1.00 48.67  ? 435  ASN C N   1 
ATOM   8864  C CA  . ASN C 1 434 ? -14.760 -2.239  90.722  1.00 37.93  ? 435  ASN C CA  1 
ATOM   8865  C C   . ASN C 1 434 ? -15.207 -3.547  91.366  1.00 48.00  ? 435  ASN C C   1 
ATOM   8866  O O   . ASN C 1 434 ? -15.519 -4.513  90.671  1.00 55.41  ? 435  ASN C O   1 
ATOM   8867  C CB  . ASN C 1 434 ? -13.479 -2.458  89.918  1.00 56.05  ? 435  ASN C CB  1 
ATOM   8868  C CG  . ASN C 1 434 ? -13.108 -1.254  89.077  1.00 60.02  ? 435  ASN C CG  1 
ATOM   8869  O OD1 . ASN C 1 434 ? -13.510 -1.144  87.919  1.00 42.76  ? 435  ASN C OD1 1 
ATOM   8870  N ND2 . ASN C 1 434 ? -12.339 -0.342  89.659  1.00 71.84  ? 435  ASN C ND2 1 
ATOM   8871  N N   . GLN C 1 435 ? -15.241 -3.572  92.694  1.00 54.36  ? 436  GLN C N   1 
ATOM   8872  C CA  . GLN C 1 435 ? -15.621 -4.780  93.420  1.00 50.68  ? 436  GLN C CA  1 
ATOM   8873  C C   . GLN C 1 435 ? -17.103 -4.813  93.780  1.00 59.47  ? 436  GLN C C   1 
ATOM   8874  O O   . GLN C 1 435 ? -17.555 -5.711  94.489  1.00 77.67  ? 436  GLN C O   1 
ATOM   8875  C CB  . GLN C 1 435 ? -14.755 -4.961  94.667  1.00 40.35  ? 436  GLN C CB  1 
ATOM   8876  C CG  . GLN C 1 435 ? -13.269 -4.957  94.364  1.00 34.93  ? 436  GLN C CG  1 
ATOM   8877  C CD  . GLN C 1 435 ? -12.922 -5.816  93.166  1.00 44.33  ? 436  GLN C CD  1 
ATOM   8878  O OE1 . GLN C 1 435 ? -13.154 -7.025  93.167  1.00 68.17  ? 436  GLN C OE1 1 
ATOM   8879  N NE2 . GLN C 1 435 ? -12.368 -5.193  92.133  1.00 30.23  ? 436  GLN C NE2 1 
ATOM   8880  N N   . ILE C 1 436 ? -17.852 -3.825  93.301  1.00 60.26  ? 437  ILE C N   1 
ATOM   8881  C CA  . ILE C 1 436 ? -19.279 -3.745  93.586  1.00 62.77  ? 437  ILE C CA  1 
ATOM   8882  C C   . ILE C 1 436 ? -20.028 -4.971  93.051  1.00 69.54  ? 437  ILE C C   1 
ATOM   8883  O O   . ILE C 1 436 ? -20.885 -5.533  93.735  1.00 77.23  ? 437  ILE C O   1 
ATOM   8884  C CB  . ILE C 1 436 ? -19.887 -2.428  93.045  1.00 53.05  ? 437  ILE C CB  1 
ATOM   8885  C CG1 . ILE C 1 436 ? -21.385 -2.360  93.337  1.00 61.39  ? 437  ILE C CG1 1 
ATOM   8886  C CG2 . ILE C 1 436 ? -19.607 -2.265  91.556  1.00 43.83  ? 437  ILE C CG2 1 
ATOM   8887  C CD1 . ILE C 1 436 ? -22.023 -1.058  92.912  1.00 45.42  ? 437  ILE C CD1 1 
ATOM   8888  N N   . ASN C 1 437 ? -19.681 -5.391  91.838  1.00 67.59  ? 438  ASN C N   1 
ATOM   8889  C CA  . ASN C 1 437 ? -20.285 -6.561  91.204  1.00 67.79  ? 438  ASN C CA  1 
ATOM   8890  C C   . ASN C 1 437 ? -19.483 -7.850  91.374  1.00 71.87  ? 438  ASN C C   1 
ATOM   8891  O O   . ASN C 1 437 ? -19.804 -8.870  90.763  1.00 65.69  ? 438  ASN C O   1 
ATOM   8892  C CB  . ASN C 1 437 ? -20.565 -6.296  89.724  1.00 62.88  ? 438  ASN C CB  1 
ATOM   8893  C CG  . ASN C 1 437 ? -21.753 -5.381  89.515  1.00 66.93  ? 438  ASN C CG  1 
ATOM   8894  O OD1 . ASN C 1 437 ? -22.602 -5.237  90.396  1.00 55.94  ? 438  ASN C OD1 1 
ATOM   8895  N ND2 . ASN C 1 437 ? -21.825 -4.762  88.344  1.00 68.04  ? 438  ASN C ND2 1 
ATOM   8896  N N   . ASN C 1 438 ? -18.427 -7.787  92.179  1.00 77.12  ? 439  ASN C N   1 
ATOM   8897  C CA  . ASN C 1 438 ? -17.554 -8.935  92.403  1.00 66.62  ? 439  ASN C CA  1 
ATOM   8898  C C   . ASN C 1 438 ? -18.328 -10.156 92.898  1.00 50.76  ? 439  ASN C C   1 
ATOM   8899  O O   . ASN C 1 438 ? -18.937 -10.123 93.966  1.00 48.65  ? 439  ASN C O   1 
ATOM   8900  C CB  . ASN C 1 438 ? -16.449 -8.567  93.396  1.00 61.63  ? 439  ASN C CB  1 
ATOM   8901  C CG  . ASN C 1 438 ? -15.456 -9.688  93.608  1.00 63.99  ? 439  ASN C CG  1 
ATOM   8902  O OD1 . ASN C 1 438 ? -15.670 -10.574 94.434  1.00 75.95  ? 439  ASN C OD1 1 
ATOM   8903  N ND2 . ASN C 1 438 ? -14.355 -9.651  92.867  1.00 62.05  ? 439  ASN C ND2 1 
ATOM   8904  N N   . PRO C 1 439 ? -18.300 -11.242 92.113  1.00 50.10  ? 440  PRO C N   1 
ATOM   8905  C CA  . PRO C 1 439 ? -19.097 -12.448 92.371  1.00 55.76  ? 440  PRO C CA  1 
ATOM   8906  C C   . PRO C 1 439 ? -18.740 -13.167 93.672  1.00 60.75  ? 440  PRO C C   1 
ATOM   8907  O O   . PRO C 1 439 ? -19.636 -13.601 94.396  1.00 71.80  ? 440  PRO C O   1 
ATOM   8908  C CB  . PRO C 1 439 ? -18.778 -13.341 91.166  1.00 41.83  ? 440  PRO C CB  1 
ATOM   8909  C CG  . PRO C 1 439 ? -17.463 -12.863 90.675  1.00 48.22  ? 440  PRO C CG  1 
ATOM   8910  C CD  . PRO C 1 439 ? -17.460 -11.385 90.912  1.00 53.30  ? 440  PRO C CD  1 
ATOM   8911  N N   . GLU C 1 440 ? -17.449 -13.298 93.954  1.00 54.93  ? 441  GLU C N   1 
ATOM   8912  C CA  . GLU C 1 440 ? -16.992 -14.063 95.110  1.00 56.30  ? 441  GLU C CA  1 
ATOM   8913  C C   . GLU C 1 440 ? -17.043 -13.289 96.425  1.00 56.20  ? 441  GLU C C   1 
ATOM   8914  O O   . GLU C 1 440 ? -17.321 -13.865 97.477  1.00 55.79  ? 441  GLU C O   1 
ATOM   8915  C CB  . GLU C 1 440 ? -15.584 -14.608 94.865  1.00 59.24  ? 441  GLU C CB  1 
ATOM   8916  C CG  . GLU C 1 440 ? -15.391 -15.189 93.471  1.00 62.90  ? 441  GLU C CG  1 
ATOM   8917  C CD  . GLU C 1 440 ? -16.481 -16.178 93.085  1.00 56.01  ? 441  GLU C CD  1 
ATOM   8918  O OE1 . GLU C 1 440 ? -16.919 -16.964 93.952  1.00 47.94  ? 441  GLU C OE1 1 
ATOM   8919  O OE2 . GLU C 1 440 ? -16.902 -16.167 91.909  1.00 56.05  ? 441  GLU C OE2 1 
ATOM   8920  N N   . VAL C 1 441 ? -16.771 -11.989 96.362  1.00 54.13  ? 442  VAL C N   1 
ATOM   8921  C CA  . VAL C 1 441 ? -16.704 -11.161 97.563  1.00 58.50  ? 442  VAL C CA  1 
ATOM   8922  C C   . VAL C 1 441 ? -17.741 -10.045 97.534  1.00 55.35  ? 442  VAL C C   1 
ATOM   8923  O O   . VAL C 1 441 ? -17.903 -9.367  96.521  1.00 56.91  ? 442  VAL C O   1 
ATOM   8924  C CB  . VAL C 1 441 ? -15.311 -10.514 97.725  1.00 54.30  ? 442  VAL C CB  1 
ATOM   8925  C CG1 . VAL C 1 441 ? -15.170 -9.899  99.110  1.00 47.44  ? 442  VAL C CG1 1 
ATOM   8926  C CG2 . VAL C 1 441 ? -14.214 -11.535 97.479  1.00 45.58  ? 442  VAL C CG2 1 
ATOM   8927  N N   . GLU C 1 442 ? -18.436 -9.852  98.652  1.00 58.92  ? 443  GLU C N   1 
ATOM   8928  C CA  . GLU C 1 442 ? -19.349 -8.724  98.791  1.00 61.93  ? 443  GLU C CA  1 
ATOM   8929  C C   . GLU C 1 442 ? -18.590 -7.542  99.376  1.00 59.49  ? 443  GLU C C   1 
ATOM   8930  O O   . GLU C 1 442 ? -18.158 -7.578  100.529 1.00 68.73  ? 443  GLU C O   1 
ATOM   8931  C CB  . GLU C 1 442 ? -20.529 -9.086  99.697  1.00 74.84  ? 443  GLU C CB  1 
ATOM   8932  C CG  . GLU C 1 442 ? -21.615 -9.907  99.019  1.00 86.98  ? 443  GLU C CG  1 
ATOM   8933  C CD  . GLU C 1 442 ? -22.425 -9.097  98.023  1.00 93.04  ? 443  GLU C CD  1 
ATOM   8934  O OE1 . GLU C 1 442 ? -22.898 -8.002  98.393  1.00 94.89  ? 443  GLU C OE1 1 
ATOM   8935  O OE2 . GLU C 1 442 ? -22.587 -9.552  96.870  1.00 94.28  ? 443  GLU C OE2 1 
ATOM   8936  N N   . VAL C 1 443 ? -18.437 -6.491  98.577  1.00 48.58  ? 444  VAL C N   1 
ATOM   8937  C CA  . VAL C 1 443 ? -17.638 -5.339  98.974  1.00 55.23  ? 444  VAL C CA  1 
ATOM   8938  C C   . VAL C 1 443 ? -18.474 -4.065  98.994  1.00 66.02  ? 444  VAL C C   1 
ATOM   8939  O O   . VAL C 1 443 ? -19.205 -3.777  98.047  1.00 79.55  ? 444  VAL C O   1 
ATOM   8940  C CB  . VAL C 1 443 ? -16.433 -5.140  98.025  1.00 51.35  ? 444  VAL C CB  1 
ATOM   8941  C CG1 . VAL C 1 443 ? -15.627 -3.919  98.431  1.00 46.32  ? 444  VAL C CG1 1 
ATOM   8942  C CG2 . VAL C 1 443 ? -15.550 -6.379  98.012  1.00 41.70  ? 444  VAL C CG2 1 
ATOM   8943  N N   . ASP C 1 444 ? -18.360 -3.301  100.077 1.00 67.20  ? 445  ASP C N   1 
ATOM   8944  C CA  . ASP C 1 444 ? -19.056 -2.027  100.178 1.00 73.77  ? 445  ASP C CA  1 
ATOM   8945  C C   . ASP C 1 444 ? -18.118 -0.940  99.674  1.00 62.96  ? 445  ASP C C   1 
ATOM   8946  O O   . ASP C 1 444 ? -17.118 -0.627  100.315 1.00 64.85  ? 445  ASP C O   1 
ATOM   8947  C CB  . ASP C 1 444 ? -19.448 -1.752  101.631 1.00 87.05  ? 445  ASP C CB  1 
ATOM   8948  C CG  . ASP C 1 444 ? -20.533 -0.697  101.758 1.00 94.30  ? 445  ASP C CG  1 
ATOM   8949  O OD1 . ASP C 1 444 ? -20.742 0.068   100.793 1.00 104.99 ? 445  ASP C OD1 1 
ATOM   8950  O OD2 . ASP C 1 444 ? -21.178 -0.631  102.826 1.00 81.40  ? 445  ASP C OD2 1 
ATOM   8951  N N   . ILE C 1 445 ? -18.450 -0.363  98.524  1.00 59.55  ? 446  ILE C N   1 
ATOM   8952  C CA  . ILE C 1 445 ? -17.563 0.590   97.870  1.00 49.32  ? 446  ILE C CA  1 
ATOM   8953  C C   . ILE C 1 445 ? -17.796 2.008   98.375  1.00 60.64  ? 446  ILE C C   1 
ATOM   8954  O O   . ILE C 1 445 ? -17.018 2.917   98.083  1.00 51.97  ? 446  ILE C O   1 
ATOM   8955  C CB  . ILE C 1 445 ? -17.728 0.556   96.337  1.00 42.11  ? 446  ILE C CB  1 
ATOM   8956  C CG1 . ILE C 1 445 ? -19.028 1.246   95.918  1.00 42.50  ? 446  ILE C CG1 1 
ATOM   8957  C CG2 . ILE C 1 445 ? -17.692 -0.877  95.832  1.00 41.31  ? 446  ILE C CG2 1 
ATOM   8958  C CD1 . ILE C 1 445 ? -19.207 1.347   94.418  1.00 38.51  ? 446  ILE C CD1 1 
ATOM   8959  N N   . THR C 1 446 ? -18.867 2.188   99.141  1.00 70.31  ? 447  THR C N   1 
ATOM   8960  C CA  . THR C 1 446 ? -19.219 3.504   99.658  1.00 71.73  ? 447  THR C CA  1 
ATOM   8961  C C   . THR C 1 446 ? -18.348 3.889   100.849 1.00 72.56  ? 447  THR C C   1 
ATOM   8962  O O   . THR C 1 446 ? -18.110 5.071   101.094 1.00 76.31  ? 447  THR C O   1 
ATOM   8963  C CB  . THR C 1 446 ? -20.702 3.576   100.059 1.00 68.27  ? 447  THR C CB  1 
ATOM   8964  O OG1 . THR C 1 446 ? -20.936 2.736   101.196 1.00 66.11  ? 447  THR C OG1 1 
ATOM   8965  C CG2 . THR C 1 446 ? -21.584 3.121   98.905  1.00 72.99  ? 447  THR C CG2 1 
ATOM   8966  N N   . LYS C 1 447 ? -17.877 2.889   101.590 1.00 78.28  ? 448  LYS C N   1 
ATOM   8967  C CA  . LYS C 1 447 ? -16.984 3.147   102.714 1.00 91.06  ? 448  LYS C CA  1 
ATOM   8968  C C   . LYS C 1 447 ? -15.577 2.585   102.475 1.00 95.91  ? 448  LYS C C   1 
ATOM   8969  O O   . LYS C 1 447 ? -15.351 1.379   102.585 1.00 105.32 ? 448  LYS C O   1 
ATOM   8970  C CB  . LYS C 1 447 ? -17.585 2.579   104.004 1.00 94.22  ? 448  LYS C CB  1 
ATOM   8971  C CG  . LYS C 1 447 ? -18.216 1.203   103.840 1.00 95.57  ? 448  LYS C CG  1 
ATOM   8972  C CD  . LYS C 1 447 ? -18.738 0.662   105.161 1.00 101.97 ? 448  LYS C CD  1 
ATOM   8973  C CE  . LYS C 1 447 ? -19.935 1.456   105.655 1.00 101.65 ? 448  LYS C CE  1 
ATOM   8974  N NZ  . LYS C 1 447 ? -20.500 0.871   106.902 1.00 97.35  ? 448  LYS C NZ  1 
ATOM   8975  N N   . PRO C 1 448 ? -14.623 3.478   102.159 1.00 89.10  ? 449  PRO C N   1 
ATOM   8976  C CA  . PRO C 1 448 ? -13.197 3.196   101.951 1.00 79.66  ? 449  PRO C CA  1 
ATOM   8977  C C   . PRO C 1 448 ? -12.450 2.983   103.262 1.00 82.31  ? 449  PRO C C   1 
ATOM   8978  O O   . PRO C 1 448 ? -12.973 3.319   104.324 1.00 85.31  ? 449  PRO C O   1 
ATOM   8979  C CB  . PRO C 1 448 ? -12.683 4.470   101.264 1.00 78.71  ? 449  PRO C CB  1 
ATOM   8980  C CG  . PRO C 1 448 ? -13.915 5.200   100.797 1.00 84.65  ? 449  PRO C CG  1 
ATOM   8981  C CD  . PRO C 1 448 ? -14.953 4.868   101.812 1.00 92.88  ? 449  PRO C CD  1 
ATOM   8982  N N   . ASP C 1 449 ? -11.247 2.421   103.186 1.00 80.20  ? 450  ASP C N   1 
ATOM   8983  C CA  . ASP C 1 449 ? -10.386 2.322   104.359 1.00 80.11  ? 450  ASP C CA  1 
ATOM   8984  C C   . ASP C 1 449 ? -9.635  3.640   104.556 1.00 84.11  ? 450  ASP C C   1 
ATOM   8985  O O   . ASP C 1 449 ? -8.881  4.094   103.682 1.00 77.97  ? 450  ASP C O   1 
ATOM   8986  C CB  . ASP C 1 449 ? -9.418  1.139   104.232 1.00 85.80  ? 450  ASP C CB  1 
ATOM   8987  C CG  . ASP C 1 449 ? -8.708  0.811   105.538 1.00 97.57  ? 450  ASP C CG  1 
ATOM   8988  O OD1 . ASP C 1 449 ? -8.041  1.700   106.103 1.00 105.09 ? 450  ASP C OD1 1 
ATOM   8989  O OD2 . ASP C 1 449 ? -8.811  -0.345  105.998 1.00 99.82  ? 450  ASP C OD2 1 
ATOM   8990  N N   . MET C 1 450 ? -9.851  4.246   105.719 1.00 92.64  ? 451  MET C N   1 
ATOM   8991  C CA  . MET C 1 450 ? -9.322  5.571   106.013 1.00 98.31  ? 451  MET C CA  1 
ATOM   8992  C C   . MET C 1 450 ? -7.799  5.598   106.064 1.00 82.90  ? 451  MET C C   1 
ATOM   8993  O O   . MET C 1 450 ? -7.182  6.568   105.633 1.00 77.26  ? 451  MET C O   1 
ATOM   8994  C CB  . MET C 1 450 ? -9.908  6.101   107.322 1.00 109.57 ? 451  MET C CB  1 
ATOM   8995  C CG  . MET C 1 450 ? -11.406 6.391   107.268 1.00 114.95 ? 451  MET C CG  1 
ATOM   8996  S SD  . MET C 1 450 ? -11.873 7.637   106.044 1.00 90.54  ? 451  MET C SD  1 
ATOM   8997  C CE  . MET C 1 450 ? -12.508 6.604   104.724 1.00 146.59 ? 451  MET C CE  1 
ATOM   8998  N N   . THR C 1 451 ? -7.198  4.537   106.595 1.00 69.10  ? 452  THR C N   1 
ATOM   8999  C CA  . THR C 1 451 ? -5.742  4.431   106.648 1.00 70.26  ? 452  THR C CA  1 
ATOM   9000  C C   . THR C 1 451 ? -5.157  4.504   105.240 1.00 71.99  ? 452  THR C C   1 
ATOM   9001  O O   . THR C 1 451 ? -4.247  5.299   104.963 1.00 84.87  ? 452  THR C O   1 
ATOM   9002  C CB  . THR C 1 451 ? -5.297  3.114   107.316 1.00 51.69  ? 452  THR C CB  1 
ATOM   9003  O OG1 . THR C 1 451 ? -5.816  3.054   108.650 1.00 44.61  ? 452  THR C OG1 1 
ATOM   9004  C CG2 . THR C 1 451 ? -3.780  3.019   107.358 1.00 41.76  ? 452  THR C CG2 1 
ATOM   9005  N N   . ILE C 1 452 ? -5.703  3.673   104.356 1.00 53.42  ? 453  ILE C N   1 
ATOM   9006  C CA  . ILE C 1 452 ? -5.319  3.666   102.952 1.00 49.58  ? 453  ILE C CA  1 
ATOM   9007  C C   . ILE C 1 452 ? -5.480  5.052   102.335 1.00 60.05  ? 453  ILE C C   1 
ATOM   9008  O O   . ILE C 1 452 ? -4.594  5.518   101.619 1.00 65.23  ? 453  ILE C O   1 
ATOM   9009  C CB  . ILE C 1 452 ? -6.156  2.661   102.143 1.00 42.46  ? 453  ILE C CB  1 
ATOM   9010  C CG1 . ILE C 1 452 ? -6.133  1.283   102.808 1.00 56.46  ? 453  ILE C CG1 1 
ATOM   9011  C CG2 . ILE C 1 452 ? -5.652  2.591   100.713 1.00 26.55  ? 453  ILE C CG2 1 
ATOM   9012  C CD1 . ILE C 1 452 ? -4.760  0.665   102.878 1.00 70.31  ? 453  ILE C CD1 1 
ATOM   9013  N N   . ARG C 1 453 ? -6.602  5.711   102.622 1.00 61.67  ? 454  ARG C N   1 
ATOM   9014  C CA  . ARG C 1 453 ? -6.835  7.060   102.103 1.00 74.73  ? 454  ARG C CA  1 
ATOM   9015  C C   . ARG C 1 453 ? -5.748  8.041   102.545 1.00 70.71  ? 454  ARG C C   1 
ATOM   9016  O O   . ARG C 1 453 ? -5.223  8.813   101.731 1.00 64.39  ? 454  ARG C O   1 
ATOM   9017  C CB  . ARG C 1 453 ? -8.207  7.574   102.542 1.00 86.70  ? 454  ARG C CB  1 
ATOM   9018  C CG  . ARG C 1 453 ? -9.381  6.859   101.894 1.00 96.48  ? 454  ARG C CG  1 
ATOM   9019  C CD  . ARG C 1 453 ? -9.303  6.945   100.383 1.00 99.13  ? 454  ARG C CD  1 
ATOM   9020  N NE  . ARG C 1 453 ? -9.130  8.320   99.928  1.00 107.46 ? 454  ARG C NE  1 
ATOM   9021  C CZ  . ARG C 1 453 ? -8.944  8.665   98.659  1.00 106.83 ? 454  ARG C CZ  1 
ATOM   9022  N NH1 . ARG C 1 453 ? -8.908  7.733   97.717  1.00 103.35 ? 454  ARG C NH1 1 
ATOM   9023  N NH2 . ARG C 1 453 ? -8.794  9.941   98.332  1.00 100.62 ? 454  ARG C NH2 1 
ATOM   9024  N N   . GLN C 1 454 ? -5.422  8.004   103.835 1.00 69.06  ? 455  GLN C N   1 
ATOM   9025  C CA  . GLN C 1 454 ? -4.370  8.843   104.397 1.00 70.63  ? 455  GLN C CA  1 
ATOM   9026  C C   . GLN C 1 454 ? -3.070  8.615   103.648 1.00 70.54  ? 455  GLN C C   1 
ATOM   9027  O O   . GLN C 1 454 ? -2.400  9.567   103.239 1.00 68.75  ? 455  GLN C O   1 
ATOM   9028  C CB  . GLN C 1 454 ? -4.165  8.530   105.879 1.00 73.37  ? 455  GLN C CB  1 
ATOM   9029  C CG  . GLN C 1 454 ? -5.352  8.861   106.766 1.00 91.03  ? 455  GLN C CG  1 
ATOM   9030  C CD  . GLN C 1 454 ? -5.235  8.226   108.136 1.00 105.40 ? 455  GLN C CD  1 
ATOM   9031  O OE1 . GLN C 1 454 ? -4.174  7.728   108.509 1.00 116.15 ? 455  GLN C OE1 1 
ATOM   9032  N NE2 . GLN C 1 454 ? -6.329  8.233   108.890 1.00 104.92 ? 455  GLN C NE2 1 
ATOM   9033  N N   . GLN C 1 455 ? -2.727  7.344   103.458 1.00 50.46  ? 456  GLN C N   1 
ATOM   9034  C CA  . GLN C 1 455 ? -1.496  6.997   102.761 1.00 48.27  ? 456  GLN C CA  1 
ATOM   9035  C C   . GLN C 1 455 ? -1.498  7.499   101.317 1.00 63.79  ? 456  GLN C C   1 
ATOM   9036  O O   . GLN C 1 455 ? -0.461  7.937   100.805 1.00 81.36  ? 456  GLN C O   1 
ATOM   9037  C CB  . GLN C 1 455 ? -1.252  5.490   102.816 1.00 54.00  ? 456  GLN C CB  1 
ATOM   9038  C CG  . GLN C 1 455 ? -1.146  4.952   104.231 1.00 58.61  ? 456  GLN C CG  1 
ATOM   9039  C CD  . GLN C 1 455 ? -0.296  5.835   105.121 1.00 64.20  ? 456  GLN C CD  1 
ATOM   9040  O OE1 . GLN C 1 455 ? 0.891   6.037   104.863 1.00 70.84  ? 456  GLN C OE1 1 
ATOM   9041  N NE2 . GLN C 1 455 ? -0.904  6.376   106.170 1.00 60.00  ? 456  GLN C NE2 1 
ATOM   9042  N N   . ILE C 1 456 ? -2.660  7.445   100.671 1.00 43.81  ? 457  ILE C N   1 
ATOM   9043  C CA  . ILE C 1 456 ? -2.814  8.007   99.333  1.00 44.49  ? 457  ILE C CA  1 
ATOM   9044  C C   . ILE C 1 456 ? -2.463  9.491   99.362  1.00 49.75  ? 457  ILE C C   1 
ATOM   9045  O O   . ILE C 1 456 ? -1.700  9.978   98.519  1.00 47.71  ? 457  ILE C O   1 
ATOM   9046  C CB  . ILE C 1 456 ? -4.250  7.836   98.797  1.00 35.70  ? 457  ILE C CB  1 
ATOM   9047  C CG1 . ILE C 1 456 ? -4.598  6.355   98.653  1.00 39.67  ? 457  ILE C CG1 1 
ATOM   9048  C CG2 . ILE C 1 456 ? -4.405  8.531   97.458  1.00 31.98  ? 457  ILE C CG2 1 
ATOM   9049  C CD1 . ILE C 1 456 ? -6.039  6.093   98.275  1.00 53.99  ? 457  ILE C CD1 1 
ATOM   9050  N N   . MET C 1 457 ? -3.012  10.200  100.348 1.00 62.19  ? 458  MET C N   1 
ATOM   9051  C CA  . MET C 1 457 ? -2.712  11.621  100.512 1.00 71.55  ? 458  MET C CA  1 
ATOM   9052  C C   . MET C 1 457 ? -1.222  11.878  100.703 1.00 72.12  ? 458  MET C C   1 
ATOM   9053  O O   . MET C 1 457 ? -0.672  12.797  100.105 1.00 58.33  ? 458  MET C O   1 
ATOM   9054  C CB  . MET C 1 457 ? -3.497  12.230  101.676 1.00 64.19  ? 458  MET C CB  1 
ATOM   9055  C CG  . MET C 1 457 ? -4.838  12.819  101.279 1.00 58.32  ? 458  MET C CG  1 
ATOM   9056  S SD  . MET C 1 457 ? -5.457  13.975  102.513 1.00 170.97 ? 458  MET C SD  1 
ATOM   9057  C CE  . MET C 1 457 ? -5.277  13.007  104.010 1.00 35.55  ? 458  MET C CE  1 
ATOM   9058  N N   . GLN C 1 458 ? -0.575  11.066  101.534 1.00 70.79  ? 459  GLN C N   1 
ATOM   9059  C CA  . GLN C 1 458 ? 0.856   11.218  101.779 1.00 56.62  ? 459  GLN C CA  1 
ATOM   9060  C C   . GLN C 1 458 ? 1.653   11.050  100.486 1.00 53.05  ? 459  GLN C C   1 
ATOM   9061  O O   . GLN C 1 458 ? 2.558   11.845  100.190 1.00 70.34  ? 459  GLN C O   1 
ATOM   9062  C CB  . GLN C 1 458 ? 1.337   10.217  102.834 1.00 47.92  ? 459  GLN C CB  1 
ATOM   9063  C CG  . GLN C 1 458 ? 0.587   10.275  104.164 1.00 55.23  ? 459  GLN C CG  1 
ATOM   9064  C CD  . GLN C 1 458 ? 0.979   11.461  105.034 1.00 68.99  ? 459  GLN C CD  1 
ATOM   9065  O OE1 . GLN C 1 458 ? 1.142   12.582  104.550 1.00 81.43  ? 459  GLN C OE1 1 
ATOM   9066  N NE2 . GLN C 1 458 ? 1.129   11.215  106.330 1.00 58.14  ? 459  GLN C NE2 1 
ATOM   9067  N N   . LEU C 1 459 ? 1.306   10.016  99.720  1.00 33.06  ? 460  LEU C N   1 
ATOM   9068  C CA  . LEU C 1 459 ? 1.919   9.791   98.415  1.00 40.57  ? 460  LEU C CA  1 
ATOM   9069  C C   . LEU C 1 459 ? 1.761   11.017  97.524  1.00 44.66  ? 460  LEU C C   1 
ATOM   9070  O O   . LEU C 1 459 ? 2.724   11.473  96.901  1.00 53.76  ? 460  LEU C O   1 
ATOM   9071  C CB  . LEU C 1 459 ? 1.304   8.570   97.729  1.00 47.12  ? 460  LEU C CB  1 
ATOM   9072  C CG  . LEU C 1 459 ? 1.610   7.207   98.349  1.00 51.95  ? 460  LEU C CG  1 
ATOM   9073  C CD1 . LEU C 1 459 ? 0.999   6.091   97.519  1.00 54.79  ? 460  LEU C CD1 1 
ATOM   9074  C CD2 . LEU C 1 459 ? 3.108   7.015   98.486  1.00 48.91  ? 460  LEU C CD2 1 
ATOM   9075  N N   . LYS C 1 460 ? 0.544   11.552  97.478  1.00 38.21  ? 461  LYS C N   1 
ATOM   9076  C CA  . LYS C 1 460 ? 0.258   12.731  96.667  1.00 49.81  ? 461  LYS C CA  1 
ATOM   9077  C C   . LYS C 1 460 ? 1.105   13.931  97.103  1.00 49.74  ? 461  LYS C C   1 
ATOM   9078  O O   . LYS C 1 460 ? 1.612   14.681  96.266  1.00 49.67  ? 461  LYS C O   1 
ATOM   9079  C CB  . LYS C 1 460 ? -1.233  13.070  96.734  1.00 62.52  ? 461  LYS C CB  1 
ATOM   9080  C CG  . LYS C 1 460 ? -1.770  13.789  95.506  1.00 76.54  ? 461  LYS C CG  1 
ATOM   9081  C CD  . LYS C 1 460 ? -3.292  13.824  95.515  1.00 87.14  ? 461  LYS C CD  1 
ATOM   9082  C CE  . LYS C 1 460 ? -3.877  12.419  95.569  1.00 91.89  ? 461  LYS C CE  1 
ATOM   9083  N NZ  . LYS C 1 460 ? -5.368  12.428  95.549  1.00 89.71  ? 461  LYS C NZ  1 
ATOM   9084  N N   . ILE C 1 461 ? 1.266   14.094  98.414  1.00 49.82  ? 462  ILE C N   1 
ATOM   9085  C CA  . ILE C 1 461 ? 2.056   15.188  98.978  1.00 56.76  ? 462  ILE C CA  1 
ATOM   9086  C C   . ILE C 1 461 ? 3.529   15.101  98.585  1.00 65.52  ? 462  ILE C C   1 
ATOM   9087  O O   . ILE C 1 461 ? 4.095   16.061  98.050  1.00 63.46  ? 462  ILE C O   1 
ATOM   9088  C CB  . ILE C 1 461 ? 1.961   15.224  100.519 1.00 54.01  ? 462  ILE C CB  1 
ATOM   9089  C CG1 . ILE C 1 461 ? 0.547   15.600  100.967 1.00 49.46  ? 462  ILE C CG1 1 
ATOM   9090  C CG2 . ILE C 1 461 ? 2.967   16.209  101.093 1.00 48.63  ? 462  ILE C CG2 1 
ATOM   9091  C CD1 . ILE C 1 461 ? 0.357   15.566  102.469 1.00 38.74  ? 462  ILE C CD1 1 
ATOM   9092  N N   . MET C 1 462 ? 4.150   13.954  98.857  1.00 56.42  ? 463  MET C N   1 
ATOM   9093  C CA  . MET C 1 462 ? 5.561   13.777  98.522  1.00 51.83  ? 463  MET C CA  1 
ATOM   9094  C C   . MET C 1 462 ? 5.769   13.916  97.014  1.00 43.53  ? 463  MET C C   1 
ATOM   9095  O O   . MET C 1 462 ? 6.769   14.486  96.564  1.00 48.65  ? 463  MET C O   1 
ATOM   9096  C CB  . MET C 1 462 ? 6.088   12.432  99.037  1.00 62.08  ? 463  MET C CB  1 
ATOM   9097  C CG  . MET C 1 462 ? 7.579   12.187  98.800  1.00 51.34  ? 463  MET C CG  1 
ATOM   9098  S SD  . MET C 1 462 ? 8.672   13.532  99.318  1.00 65.76  ? 463  MET C SD  1 
ATOM   9099  C CE  . MET C 1 462 ? 8.292   13.669  101.061 1.00 54.24  ? 463  MET C CE  1 
ATOM   9100  N N   . THR C 1 463 ? 4.809   13.414  96.241  1.00 35.97  ? 464  THR C N   1 
ATOM   9101  C CA  . THR C 1 463 ? 4.835   13.580  94.792  1.00 47.78  ? 464  THR C CA  1 
ATOM   9102  C C   . THR C 1 463 ? 4.856   15.059  94.424  1.00 60.83  ? 464  THR C C   1 
ATOM   9103  O O   . THR C 1 463 ? 5.618   15.478  93.552  1.00 71.75  ? 464  THR C O   1 
ATOM   9104  C CB  . THR C 1 463 ? 3.618   12.919  94.120  1.00 50.99  ? 464  THR C CB  1 
ATOM   9105  O OG1 . THR C 1 463 ? 3.560   11.537  94.488  1.00 56.58  ? 464  THR C OG1 1 
ATOM   9106  C CG2 . THR C 1 463 ? 3.715   13.030  92.605  1.00 42.93  ? 464  THR C CG2 1 
ATOM   9107  N N   . ASN C 1 464 ? 4.019   15.846  95.096  1.00 66.74  ? 465  ASN C N   1 
ATOM   9108  C CA  . ASN C 1 464 ? 3.997   17.290  94.882  1.00 85.26  ? 465  ASN C CA  1 
ATOM   9109  C C   . ASN C 1 464 ? 5.358   17.914  95.180  1.00 73.20  ? 465  ASN C C   1 
ATOM   9110  O O   . ASN C 1 464 ? 5.873   18.708  94.388  1.00 58.39  ? 465  ASN C O   1 
ATOM   9111  C CB  . ASN C 1 464 ? 2.910   17.948  95.736  1.00 106.63 ? 465  ASN C CB  1 
ATOM   9112  C CG  . ASN C 1 464 ? 2.787   19.439  95.477  1.00 116.01 ? 465  ASN C CG  1 
ATOM   9113  O OD1 . ASN C 1 464 ? 2.839   19.888  94.332  1.00 112.03 ? 465  ASN C OD1 1 
ATOM   9114  N ND2 . ASN C 1 464 ? 2.632   20.216  96.545  1.00 116.79 ? 465  ASN C ND2 1 
ATOM   9115  N N   . ARG C 1 465 ? 5.936   17.544  96.321  1.00 68.57  ? 466  ARG C N   1 
ATOM   9116  C CA  . ARG C 1 465 ? 7.275   18.003  96.684  1.00 58.96  ? 466  ARG C CA  1 
ATOM   9117  C C   . ARG C 1 465 ? 8.294   17.717  95.583  1.00 61.38  ? 466  ARG C C   1 
ATOM   9118  O O   . ARG C 1 465 ? 9.117   18.574  95.251  1.00 78.53  ? 466  ARG C O   1 
ATOM   9119  C CB  . ARG C 1 465 ? 7.744   17.362  97.994  1.00 49.75  ? 466  ARG C CB  1 
ATOM   9120  C CG  . ARG C 1 465 ? 7.112   17.937  99.251  1.00 51.07  ? 466  ARG C CG  1 
ATOM   9121  C CD  . ARG C 1 465 ? 7.906   17.536  100.488 1.00 58.78  ? 466  ARG C CD  1 
ATOM   9122  N NE  . ARG C 1 465 ? 7.363   18.129  101.707 1.00 85.77  ? 466  ARG C NE  1 
ATOM   9123  C CZ  . ARG C 1 465 ? 6.693   17.452  102.635 1.00 102.26 ? 466  ARG C CZ  1 
ATOM   9124  N NH1 . ARG C 1 465 ? 6.490   16.149  102.491 1.00 107.71 ? 466  ARG C NH1 1 
ATOM   9125  N NH2 . ARG C 1 465 ? 6.233   18.076  103.711 1.00 100.45 ? 466  ARG C NH2 1 
ATOM   9126  N N   . LEU C 1 466 ? 8.235   16.516  95.012  1.00 41.59  ? 467  LEU C N   1 
ATOM   9127  C CA  . LEU C 1 466 ? 9.205   16.131  93.988  1.00 51.49  ? 467  LEU C CA  1 
ATOM   9128  C C   . LEU C 1 466 ? 8.988   16.816  92.643  1.00 57.42  ? 467  LEU C C   1 
ATOM   9129  O O   . LEU C 1 466 ? 9.951   17.164  91.965  1.00 62.74  ? 467  LEU C O   1 
ATOM   9130  C CB  . LEU C 1 466 ? 9.253   14.615  93.803  1.00 59.87  ? 467  LEU C CB  1 
ATOM   9131  C CG  . LEU C 1 466 ? 10.336  13.934  94.637  1.00 65.22  ? 467  LEU C CG  1 
ATOM   9132  C CD1 . LEU C 1 466 ? 9.936   13.886  96.097  1.00 48.85  ? 467  LEU C CD1 1 
ATOM   9133  C CD2 . LEU C 1 466 ? 10.630  12.547  94.111  1.00 83.40  ? 467  LEU C CD2 1 
ATOM   9134  N N   . ARG C 1 467 ? 7.734   16.997  92.243  1.00 64.14  ? 468  ARG C N   1 
ATOM   9135  C CA  . ARG C 1 467 ? 7.456   17.699  90.993  1.00 72.71  ? 468  ARG C CA  1 
ATOM   9136  C C   . ARG C 1 467 ? 7.901   19.146  91.120  1.00 73.20  ? 468  ARG C C   1 
ATOM   9137  O O   . ARG C 1 467 ? 8.488   19.726  90.195  1.00 71.10  ? 468  ARG C O   1 
ATOM   9138  C CB  . ARG C 1 467 ? 5.969   17.640  90.647  1.00 83.37  ? 468  ARG C CB  1 
ATOM   9139  C CG  . ARG C 1 467 ? 5.429   16.233  90.459  1.00 95.24  ? 468  ARG C CG  1 
ATOM   9140  C CD  . ARG C 1 467 ? 4.140   16.232  89.638  1.00 106.32 ? 468  ARG C CD  1 
ATOM   9141  N NE  . ARG C 1 467 ? 3.309   15.061  89.910  1.00 110.17 ? 468  ARG C NE  1 
ATOM   9142  C CZ  . ARG C 1 467 ? 2.246   14.716  89.190  1.00 114.40 ? 468  ARG C CZ  1 
ATOM   9143  N NH1 . ARG C 1 467 ? 1.890   15.446  88.142  1.00 115.75 ? 468  ARG C NH1 1 
ATOM   9144  N NH2 . ARG C 1 467 ? 1.543   13.637  89.513  1.00 112.40 ? 468  ARG C NH2 1 
ATOM   9145  N N   . SER C 1 468 ? 7.626   19.721  92.288  1.00 80.56  ? 469  SER C N   1 
ATOM   9146  C CA  . SER C 1 468 ? 8.022   21.099  92.572  1.00 80.88  ? 469  SER C CA  1 
ATOM   9147  C C   . SER C 1 468 ? 9.536   21.256  92.524  1.00 73.42  ? 469  SER C C   1 
ATOM   9148  O O   . SER C 1 468 ? 10.066  22.125  91.827  1.00 72.98  ? 469  SER C O   1 
ATOM   9149  C CB  . SER C 1 468 ? 7.498   21.548  93.934  1.00 82.24  ? 469  SER C CB  1 
ATOM   9150  O OG  . SER C 1 468 ? 7.868   22.887  94.223  1.00 90.24  ? 469  SER C OG  1 
ATOM   9151  N N   . ALA C 1 469 ? 10.225  20.376  93.243  1.00 73.42  ? 470  ALA C N   1 
ATOM   9152  C CA  . ALA C 1 469 ? 11.681  20.422  93.336  1.00 60.74  ? 470  ALA C CA  1 
ATOM   9153  C C   . ALA C 1 469 ? 12.315  20.220  91.964  1.00 66.84  ? 470  ALA C C   1 
ATOM   9154  O O   . ALA C 1 469 ? 13.275  20.902  91.612  1.00 87.42  ? 470  ALA C O   1 
ATOM   9155  C CB  . ALA C 1 469 ? 12.183  19.371  94.309  1.00 52.56  ? 470  ALA C CB  1 
ATOM   9156  N N   . TYR C 1 470 ? 11.758  19.298  91.184  1.00 70.28  ? 471  TYR C N   1 
ATOM   9157  C CA  . TYR C 1 470 ? 12.237  19.052  89.826  1.00 67.49  ? 471  TYR C CA  1 
ATOM   9158  C C   . TYR C 1 470 ? 12.067  20.296  88.965  1.00 71.80  ? 471  TYR C C   1 
ATOM   9159  O O   . TYR C 1 470 ? 12.950  20.642  88.184  1.00 64.65  ? 471  TYR C O   1 
ATOM   9160  C CB  . TYR C 1 470 ? 11.499  17.873  89.187  1.00 65.81  ? 471  TYR C CB  1 
ATOM   9161  C CG  . TYR C 1 470 ? 11.996  17.527  87.800  1.00 69.41  ? 471  TYR C CG  1 
ATOM   9162  C CD1 . TYR C 1 470 ? 13.033  16.623  87.621  1.00 70.22  ? 471  TYR C CD1 1 
ATOM   9163  C CD2 . TYR C 1 470 ? 11.431  18.108  86.671  1.00 68.48  ? 471  TYR C CD2 1 
ATOM   9164  C CE1 . TYR C 1 470 ? 13.493  16.304  86.357  1.00 76.64  ? 471  TYR C CE1 1 
ATOM   9165  C CE2 . TYR C 1 470 ? 11.885  17.796  85.404  1.00 69.29  ? 471  TYR C CE2 1 
ATOM   9166  C CZ  . TYR C 1 470 ? 12.915  16.893  85.253  1.00 77.52  ? 471  TYR C CZ  1 
ATOM   9167  O OH  . TYR C 1 470 ? 13.370  16.578  83.994  1.00 87.09  ? 471  TYR C OH  1 
ATOM   9168  N N   . ASN C 1 471 ? 10.928  20.966  89.112  1.00 89.77  ? 472  ASN C N   1 
ATOM   9169  C CA  . ASN C 1 471 ? 10.686  22.207  88.382  1.00 102.54 ? 472  ASN C CA  1 
ATOM   9170  C C   . ASN C 1 471 ? 11.509  23.372  88.926  1.00 116.70 ? 472  ASN C C   1 
ATOM   9171  O O   . ASN C 1 471 ? 11.544  24.450  88.331  1.00 125.41 ? 472  ASN C O   1 
ATOM   9172  C CB  . ASN C 1 471 ? 9.199   22.560  88.391  1.00 96.73  ? 472  ASN C CB  1 
ATOM   9173  C CG  . ASN C 1 471 ? 8.373   21.614  87.545  1.00 101.31 ? 472  ASN C CG  1 
ATOM   9174  O OD1 . ASN C 1 471 ? 8.827   21.136  86.506  1.00 97.37  ? 472  ASN C OD1 1 
ATOM   9175  N ND2 . ASN C 1 471 ? 7.152   21.339  87.987  1.00 105.57 ? 472  ASN C ND2 1 
ATOM   9176  N N   . GLY C 1 472 ? 12.168  23.147  90.059  1.00 113.47 ? 473  GLY C N   1 
ATOM   9177  C CA  . GLY C 1 472 ? 12.999  24.163  90.677  1.00 115.46 ? 473  GLY C CA  1 
ATOM   9178  C C   . GLY C 1 472 ? 12.191  25.255  91.350  1.00 128.29 ? 473  GLY C C   1 
ATOM   9179  O O   . GLY C 1 472 ? 12.485  26.440  91.193  1.00 136.65 ? 473  GLY C O   1 
ATOM   9180  N N   . ASN C 1 473 ? 11.172  24.856  92.103  1.00 129.42 ? 474  ASN C N   1 
ATOM   9181  C CA  . ASN C 1 473 ? 10.320  25.809  92.803  1.00 125.02 ? 474  ASN C CA  1 
ATOM   9182  C C   . ASN C 1 473 ? 10.482  25.721  94.316  1.00 117.39 ? 474  ASN C C   1 
ATOM   9183  O O   . ASN C 1 473 ? 10.856  24.677  94.849  1.00 110.55 ? 474  ASN C O   1 
ATOM   9184  C CB  . ASN C 1 473 ? 8.855   25.598  92.419  1.00 128.25 ? 474  ASN C CB  1 
ATOM   9185  C CG  . ASN C 1 473 ? 8.629   25.675  90.922  1.00 135.26 ? 474  ASN C CG  1 
ATOM   9186  O OD1 . ASN C 1 473 ? 9.387   26.323  90.200  1.00 137.24 ? 474  ASN C OD1 1 
ATOM   9187  N ND2 . ASN C 1 473 ? 7.580   25.013  90.447  1.00 137.55 ? 474  ASN C ND2 1 
ATOM   9188  N N   . SER D 1 28  ? -30.384 48.948  52.955  1.00 117.68 ? 29   SER D N   1 
ATOM   9189  C CA  . SER D 1 28  ? -29.782 47.628  53.105  1.00 123.26 ? 29   SER D CA  1 
ATOM   9190  C C   . SER D 1 28  ? -30.179 46.715  51.950  1.00 116.80 ? 29   SER D C   1 
ATOM   9191  O O   . SER D 1 28  ? -30.263 47.153  50.803  1.00 126.33 ? 29   SER D O   1 
ATOM   9192  C CB  . SER D 1 28  ? -30.207 47.001  54.435  1.00 128.55 ? 29   SER D CB  1 
ATOM   9193  O OG  . SER D 1 28  ? -29.964 47.888  55.516  1.00 136.58 ? 29   SER D OG  1 
ATOM   9194  N N   . ARG D 1 29  ? -30.407 45.442  52.268  1.00 97.31  ? 30   ARG D N   1 
ATOM   9195  C CA  . ARG D 1 29  ? -30.895 44.451  51.307  1.00 93.59  ? 30   ARG D CA  1 
ATOM   9196  C C   . ARG D 1 29  ? -29.983 44.263  50.096  1.00 95.18  ? 30   ARG D C   1 
ATOM   9197  O O   . ARG D 1 29  ? -30.436 43.852  49.027  1.00 91.50  ? 30   ARG D O   1 
ATOM   9198  C CB  . ARG D 1 29  ? -32.317 44.787  50.850  1.00 92.23  ? 30   ARG D CB  1 
ATOM   9199  C CG  . ARG D 1 29  ? -33.317 44.906  51.984  1.00 92.09  ? 30   ARG D CG  1 
ATOM   9200  C CD  . ARG D 1 29  ? -34.704 45.232  51.459  1.00 85.95  ? 30   ARG D CD  1 
ATOM   9201  N NE  . ARG D 1 29  ? -35.650 45.494  52.539  1.00 78.37  ? 30   ARG D NE  1 
ATOM   9202  C CZ  . ARG D 1 29  ? -36.921 45.831  52.349  1.00 80.06  ? 30   ARG D CZ  1 
ATOM   9203  N NH1 . ARG D 1 29  ? -37.399 45.948  51.117  1.00 77.07  ? 30   ARG D NH1 1 
ATOM   9204  N NH2 . ARG D 1 29  ? -37.715 46.053  53.388  1.00 86.19  ? 30   ARG D NH2 1 
ATOM   9205  N N   . SER D 1 30  ? -28.701 44.562  50.268  1.00 95.69  ? 31   SER D N   1 
ATOM   9206  C CA  . SER D 1 30  ? -27.724 44.327  49.216  1.00 100.86 ? 31   SER D CA  1 
ATOM   9207  C C   . SER D 1 30  ? -27.079 42.960  49.412  1.00 108.25 ? 31   SER D C   1 
ATOM   9208  O O   . SER D 1 30  ? -26.590 42.646  50.495  1.00 112.41 ? 31   SER D O   1 
ATOM   9209  C CB  . SER D 1 30  ? -26.657 45.420  49.211  1.00 109.21 ? 31   SER D CB  1 
ATOM   9210  O OG  . SER D 1 30  ? -25.714 45.192  48.178  1.00 116.25 ? 31   SER D OG  1 
ATOM   9211  N N   . CYS D 1 31  ? -27.083 42.150  48.361  1.00 109.71 ? 32   CYS D N   1 
ATOM   9212  C CA  . CYS D 1 31  ? -26.556 40.792  48.440  1.00 105.63 ? 32   CYS D CA  1 
ATOM   9213  C C   . CYS D 1 31  ? -25.070 40.705  48.085  1.00 105.61 ? 32   CYS D C   1 
ATOM   9214  O O   . CYS D 1 31  ? -24.513 39.613  47.993  1.00 107.89 ? 32   CYS D O   1 
ATOM   9215  C CB  . CYS D 1 31  ? -27.377 39.850  47.557  1.00 103.75 ? 32   CYS D CB  1 
ATOM   9216  S SG  . CYS D 1 31  ? -29.020 39.465  48.213  1.00 103.49 ? 32   CYS D SG  1 
ATOM   9217  N N   . GLY D 1 32  ? -24.445 41.860  47.875  1.00 102.37 ? 33   GLY D N   1 
ATOM   9218  C CA  . GLY D 1 32  ? -23.049 41.932  47.472  1.00 97.50  ? 33   GLY D CA  1 
ATOM   9219  C C   . GLY D 1 32  ? -22.049 41.183  48.338  1.00 85.94  ? 33   GLY D C   1 
ATOM   9220  O O   . GLY D 1 32  ? -21.135 40.538  47.814  1.00 78.48  ? 33   GLY D O   1 
ATOM   9221  N N   . GLU D 1 33  ? -22.210 41.266  49.656  1.00 79.95  ? 34   GLU D N   1 
ATOM   9222  C CA  . GLU D 1 33  ? -21.280 40.615  50.576  1.00 78.24  ? 34   GLU D CA  1 
ATOM   9223  C C   . GLU D 1 33  ? -21.376 39.098  50.466  1.00 79.70  ? 34   GLU D C   1 
ATOM   9224  O O   . GLU D 1 33  ? -20.362 38.410  50.332  1.00 81.59  ? 34   GLU D O   1 
ATOM   9225  C CB  . GLU D 1 33  ? -21.535 41.055  52.018  1.00 80.51  ? 34   GLU D CB  1 
ATOM   9226  C CG  . GLU D 1 33  ? -20.676 40.319  53.039  1.00 88.79  ? 34   GLU D CG  1 
ATOM   9227  C CD  . GLU D 1 33  ? -20.979 40.723  54.467  1.00 99.99  ? 34   GLU D CD  1 
ATOM   9228  O OE1 . GLU D 1 33  ? -21.573 41.802  54.663  1.00 108.79 ? 34   GLU D OE1 1 
ATOM   9229  O OE2 . GLU D 1 33  ? -20.622 39.961  55.392  1.00 93.61  ? 34   GLU D OE2 1 
ATOM   9230  N N   . VAL D 1 34  ? -22.602 38.582  50.518  1.00 80.32  ? 35   VAL D N   1 
ATOM   9231  C CA  . VAL D 1 34  ? -22.842 37.156  50.320  1.00 69.06  ? 35   VAL D CA  1 
ATOM   9232  C C   . VAL D 1 34  ? -22.372 36.714  48.931  1.00 80.05  ? 35   VAL D C   1 
ATOM   9233  O O   . VAL D 1 34  ? -21.954 35.573  48.747  1.00 84.85  ? 35   VAL D O   1 
ATOM   9234  C CB  . VAL D 1 34  ? -24.338 36.801  50.516  1.00 60.77  ? 35   VAL D CB  1 
ATOM   9235  C CG1 . VAL D 1 34  ? -24.574 35.315  50.306  1.00 48.44  ? 35   VAL D CG1 1 
ATOM   9236  C CG2 . VAL D 1 34  ? -24.806 37.217  51.909  1.00 71.35  ? 35   VAL D CG2 1 
ATOM   9237  N N   . ARG D 1 35  ? -22.432 37.627  47.964  1.00 90.47  ? 36   ARG D N   1 
ATOM   9238  C CA  . ARG D 1 35  ? -21.956 37.363  46.610  1.00 97.58  ? 36   ARG D CA  1 
ATOM   9239  C C   . ARG D 1 35  ? -20.446 37.161  46.639  1.00 100.93 ? 36   ARG D C   1 
ATOM   9240  O O   . ARG D 1 35  ? -19.907 36.276  45.956  1.00 105.91 ? 36   ARG D O   1 
ATOM   9241  C CB  . ARG D 1 35  ? -22.299 38.528  45.678  1.00 109.12 ? 36   ARG D CB  1 
ATOM   9242  C CG  . ARG D 1 35  ? -21.677 38.425  44.287  1.00 117.51 ? 36   ARG D CG  1 
ATOM   9243  C CD  . ARG D 1 35  ? -21.377 39.800  43.711  1.00 121.17 ? 36   ARG D CD  1 
ATOM   9244  N NE  . ARG D 1 35  ? -20.165 40.374  44.292  1.00 123.91 ? 36   ARG D NE  1 
ATOM   9245  C CZ  . ARG D 1 35  ? -19.012 40.510  43.642  1.00 123.61 ? 36   ARG D CZ  1 
ATOM   9246  N NH1 . ARG D 1 35  ? -18.909 40.130  42.375  1.00 125.25 ? 36   ARG D NH1 1 
ATOM   9247  N NH2 . ARG D 1 35  ? -17.960 41.039  44.254  1.00 114.59 ? 36   ARG D NH2 1 
ATOM   9248  N N   . GLN D 1 36  ? -19.770 37.977  47.446  1.00 104.92 ? 37   GLN D N   1 
ATOM   9249  C CA  . GLN D 1 36  ? -18.318 37.909  47.563  1.00 112.99 ? 37   GLN D CA  1 
ATOM   9250  C C   . GLN D 1 36  ? -17.862 36.647  48.298  1.00 107.33 ? 37   GLN D C   1 
ATOM   9251  O O   . GLN D 1 36  ? -16.947 35.951  47.842  1.00 109.70 ? 37   GLN D O   1 
ATOM   9252  C CB  . GLN D 1 36  ? -17.783 39.157  48.274  1.00 119.85 ? 37   GLN D CB  1 
ATOM   9253  C CG  . GLN D 1 36  ? -16.276 39.153  48.474  1.00 127.39 ? 37   GLN D CG  1 
ATOM   9254  C CD  . GLN D 1 36  ? -15.740 40.483  48.964  1.00 143.25 ? 37   GLN D CD  1 
ATOM   9255  O OE1 . GLN D 1 36  ? -16.385 41.521  48.819  1.00 149.99 ? 37   GLN D OE1 1 
ATOM   9256  N NE2 . GLN D 1 36  ? -14.549 40.457  49.548  1.00 147.34 ? 37   GLN D NE2 1 
ATOM   9257  N N   . ILE D 1 37  ? -18.497 36.353  49.430  1.00 96.54  ? 38   ILE D N   1 
ATOM   9258  C CA  . ILE D 1 37  ? -18.155 35.164  50.214  1.00 90.12  ? 38   ILE D CA  1 
ATOM   9259  C C   . ILE D 1 37  ? -18.516 33.875  49.458  1.00 85.51  ? 38   ILE D C   1 
ATOM   9260  O O   . ILE D 1 37  ? -17.885 32.827  49.645  1.00 78.43  ? 38   ILE D O   1 
ATOM   9261  C CB  . ILE D 1 37  ? -18.817 35.205  51.613  1.00 85.08  ? 38   ILE D CB  1 
ATOM   9262  C CG1 . ILE D 1 37  ? -18.517 36.541  52.300  1.00 77.20  ? 38   ILE D CG1 1 
ATOM   9263  C CG2 . ILE D 1 37  ? -18.336 34.053  52.484  1.00 71.79  ? 38   ILE D CG2 1 
ATOM   9264  C CD1 . ILE D 1 37  ? -19.006 36.622  53.727  1.00 71.01  ? 38   ILE D CD1 1 
ATOM   9265  N N   . TYR D 1 38  ? -19.529 33.976  48.598  1.00 79.75  ? 39   TYR D N   1 
ATOM   9266  C CA  . TYR D 1 38  ? -19.911 32.902  47.688  1.00 74.61  ? 39   TYR D CA  1 
ATOM   9267  C C   . TYR D 1 38  ? -18.814 32.728  46.642  1.00 97.23  ? 39   TYR D C   1 
ATOM   9268  O O   . TYR D 1 38  ? -18.522 31.607  46.210  1.00 103.82 ? 39   TYR D O   1 
ATOM   9269  C CB  . TYR D 1 38  ? -21.244 33.250  47.017  1.00 70.17  ? 39   TYR D CB  1 
ATOM   9270  C CG  . TYR D 1 38  ? -21.924 32.105  46.307  1.00 75.03  ? 39   TYR D CG  1 
ATOM   9271  C CD1 . TYR D 1 38  ? -22.380 30.997  47.011  1.00 76.63  ? 39   TYR D CD1 1 
ATOM   9272  C CD2 . TYR D 1 38  ? -22.125 32.137  44.934  1.00 79.50  ? 39   TYR D CD2 1 
ATOM   9273  C CE1 . TYR D 1 38  ? -23.001 29.949  46.365  1.00 77.18  ? 39   TYR D CE1 1 
ATOM   9274  C CE2 . TYR D 1 38  ? -22.746 31.098  44.283  1.00 80.98  ? 39   TYR D CE2 1 
ATOM   9275  C CZ  . TYR D 1 38  ? -23.181 30.006  45.002  1.00 75.07  ? 39   TYR D CZ  1 
ATOM   9276  O OH  . TYR D 1 38  ? -23.800 28.967  44.352  1.00 66.90  ? 39   TYR D OH  1 
ATOM   9277  N N   . GLY D 1 39  ? -18.205 33.846  46.247  1.00 103.28 ? 40   GLY D N   1 
ATOM   9278  C CA  . GLY D 1 39  ? -17.079 33.817  45.330  1.00 109.36 ? 40   GLY D CA  1 
ATOM   9279  C C   . GLY D 1 39  ? -15.863 33.154  45.947  1.00 113.66 ? 40   GLY D C   1 
ATOM   9280  O O   . GLY D 1 39  ? -15.118 32.452  45.266  1.00 112.50 ? 40   GLY D O   1 
ATOM   9281  N N   . ALA D 1 40  ? -15.671 33.365  47.245  1.00 114.94 ? 41   ALA D N   1 
ATOM   9282  C CA  . ALA D 1 40  ? -14.570 32.729  47.965  1.00 108.25 ? 41   ALA D CA  1 
ATOM   9283  C C   . ALA D 1 40  ? -14.738 31.209  48.030  1.00 101.77 ? 41   ALA D C   1 
ATOM   9284  O O   . ALA D 1 40  ? -13.778 30.476  48.274  1.00 92.71  ? 41   ALA D O   1 
ATOM   9285  C CB  . ALA D 1 40  ? -14.455 33.309  49.362  1.00 107.70 ? 41   ALA D CB  1 
ATOM   9286  N N   . LYS D 1 41  ? -15.964 30.741  47.813  1.00 102.77 ? 42   LYS D N   1 
ATOM   9287  C CA  . LYS D 1 41  ? -16.252 29.309  47.829  1.00 100.67 ? 42   LYS D CA  1 
ATOM   9288  C C   . LYS D 1 41  ? -16.122 28.692  46.438  1.00 100.37 ? 42   LYS D C   1 
ATOM   9289  O O   . LYS D 1 41  ? -16.334 27.492  46.255  1.00 100.01 ? 42   LYS D O   1 
ATOM   9290  C CB  . LYS D 1 41  ? -17.638 29.043  48.422  1.00 102.02 ? 42   LYS D CB  1 
ATOM   9291  C CG  . LYS D 1 41  ? -17.768 29.464  49.879  1.00 104.05 ? 42   LYS D CG  1 
ATOM   9292  C CD  . LYS D 1 41  ? -16.745 28.751  50.751  1.00 101.67 ? 42   LYS D CD  1 
ATOM   9293  C CE  . LYS D 1 41  ? -16.699 29.339  52.153  1.00 99.45  ? 42   LYS D CE  1 
ATOM   9294  N NZ  . LYS D 1 41  ? -16.322 30.780  52.149  1.00 104.73 ? 42   LYS D NZ  1 
ATOM   9295  N N   . GLY D 1 42  ? -15.769 29.527  45.465  1.00 102.69 ? 43   GLY D N   1 
ATOM   9296  C CA  . GLY D 1 42  ? -15.435 29.062  44.131  1.00 105.20 ? 43   GLY D CA  1 
ATOM   9297  C C   . GLY D 1 42  ? -16.603 28.736  43.222  1.00 105.08 ? 43   GLY D C   1 
ATOM   9298  O O   . GLY D 1 42  ? -16.440 28.013  42.240  1.00 96.37  ? 43   GLY D O   1 
ATOM   9299  N N   . PHE D 1 43  ? -17.781 29.264  43.539  1.00 111.38 ? 44   PHE D N   1 
ATOM   9300  C CA  . PHE D 1 43  ? -18.953 29.044  42.700  1.00 111.37 ? 44   PHE D CA  1 
ATOM   9301  C C   . PHE D 1 43  ? -19.163 30.194  41.723  1.00 121.86 ? 44   PHE D C   1 
ATOM   9302  O O   . PHE D 1 43  ? -18.418 31.174  41.733  1.00 124.41 ? 44   PHE D O   1 
ATOM   9303  C CB  . PHE D 1 43  ? -20.200 28.846  43.562  1.00 100.86 ? 44   PHE D CB  1 
ATOM   9304  C CG  . PHE D 1 43  ? -20.184 27.581  44.368  1.00 98.91  ? 44   PHE D CG  1 
ATOM   9305  C CD1 . PHE D 1 43  ? -20.531 26.372  43.789  1.00 93.20  ? 44   PHE D CD1 1 
ATOM   9306  C CD2 . PHE D 1 43  ? -19.823 27.599  45.705  1.00 99.71  ? 44   PHE D CD2 1 
ATOM   9307  C CE1 . PHE D 1 43  ? -20.516 25.204  44.527  1.00 88.79  ? 44   PHE D CE1 1 
ATOM   9308  C CE2 . PHE D 1 43  ? -19.807 26.434  46.449  1.00 95.08  ? 44   PHE D CE2 1 
ATOM   9309  C CZ  . PHE D 1 43  ? -20.154 25.235  45.860  1.00 90.00  ? 44   PHE D CZ  1 
ATOM   9310  N N   . SER D 1 44  ? -20.187 30.072  40.884  1.00 128.14 ? 45   SER D N   1 
ATOM   9311  C CA  . SER D 1 44  ? -20.500 31.102  39.901  1.00 130.23 ? 45   SER D CA  1 
ATOM   9312  C C   . SER D 1 44  ? -21.331 32.214  40.527  1.00 121.05 ? 45   SER D C   1 
ATOM   9313  O O   . SER D 1 44  ? -22.243 31.952  41.310  1.00 112.87 ? 45   SER D O   1 
ATOM   9314  C CB  . SER D 1 44  ? -21.239 30.501  38.704  1.00 135.07 ? 45   SER D CB  1 
ATOM   9315  O OG  . SER D 1 44  ? -20.424 29.570  38.014  1.00 138.42 ? 45   SER D OG  1 
ATOM   9316  N N   . LEU D 1 45  ? -21.012 33.455  40.174  1.00 117.81 ? 46   LEU D N   1 
ATOM   9317  C CA  . LEU D 1 45  ? -21.687 34.613  40.750  1.00 105.89 ? 46   LEU D CA  1 
ATOM   9318  C C   . LEU D 1 45  ? -22.963 34.969  39.992  1.00 103.91 ? 46   LEU D C   1 
ATOM   9319  O O   . LEU D 1 45  ? -23.628 35.953  40.309  1.00 111.75 ? 46   LEU D O   1 
ATOM   9320  C CB  . LEU D 1 45  ? -20.743 35.816  40.813  1.00 96.33  ? 46   LEU D CB  1 
ATOM   9321  C CG  . LEU D 1 45  ? -19.436 35.584  41.575  1.00 90.70  ? 46   LEU D CG  1 
ATOM   9322  C CD1 . LEU D 1 45  ? -18.688 36.891  41.776  1.00 86.47  ? 46   LEU D CD1 1 
ATOM   9323  C CD2 . LEU D 1 45  ? -19.691 34.895  42.910  1.00 90.23  ? 46   LEU D CD2 1 
ATOM   9324  N N   . SER D 1 46  ? -23.293 34.169  38.983  1.00 105.32 ? 47   SER D N   1 
ATOM   9325  C CA  . SER D 1 46  ? -24.532 34.358  38.238  1.00 116.91 ? 47   SER D CA  1 
ATOM   9326  C C   . SER D 1 46  ? -25.705 33.745  38.997  1.00 115.97 ? 47   SER D C   1 
ATOM   9327  O O   . SER D 1 46  ? -26.867 34.019  38.694  1.00 116.72 ? 47   SER D O   1 
ATOM   9328  C CB  . SER D 1 46  ? -24.423 33.735  36.846  1.00 125.29 ? 47   SER D CB  1 
ATOM   9329  O OG  . SER D 1 46  ? -24.218 32.336  36.926  1.00 127.91 ? 47   SER D OG  1 
ATOM   9330  N N   . ASP D 1 47  ? -25.388 32.915  39.986  1.00 112.28 ? 48   ASP D N   1 
ATOM   9331  C CA  . ASP D 1 47  ? -26.402 32.244  40.793  1.00 112.38 ? 48   ASP D CA  1 
ATOM   9332  C C   . ASP D 1 47  ? -26.962 33.145  41.892  1.00 102.53 ? 48   ASP D C   1 
ATOM   9333  O O   . ASP D 1 47  ? -28.018 32.860  42.457  1.00 95.98  ? 48   ASP D O   1 
ATOM   9334  C CB  . ASP D 1 47  ? -25.833 30.964  41.412  1.00 114.12 ? 48   ASP D CB  1 
ATOM   9335  C CG  . ASP D 1 47  ? -25.521 29.901  40.376  1.00 113.55 ? 48   ASP D CG  1 
ATOM   9336  O OD1 . ASP D 1 47  ? -25.299 30.257  39.199  1.00 118.05 ? 48   ASP D OD1 1 
ATOM   9337  O OD2 . ASP D 1 47  ? -25.496 28.706  40.741  1.00 105.82 ? 48   ASP D OD2 1 
ATOM   9338  N N   . VAL D 1 48  ? -26.252 34.228  42.196  1.00 99.78  ? 49   VAL D N   1 
ATOM   9339  C CA  . VAL D 1 48  ? -26.668 35.135  43.263  1.00 98.69  ? 49   VAL D CA  1 
ATOM   9340  C C   . VAL D 1 48  ? -27.311 36.419  42.737  1.00 101.78 ? 49   VAL D C   1 
ATOM   9341  O O   . VAL D 1 48  ? -26.717 37.135  41.930  1.00 103.67 ? 49   VAL D O   1 
ATOM   9342  C CB  . VAL D 1 48  ? -25.496 35.482  44.216  1.00 92.64  ? 49   VAL D CB  1 
ATOM   9343  C CG1 . VAL D 1 48  ? -24.248 35.853  43.431  1.00 93.86  ? 49   VAL D CG1 1 
ATOM   9344  C CG2 . VAL D 1 48  ? -25.893 36.598  45.173  1.00 83.52  ? 49   VAL D CG2 1 
ATOM   9345  N N   . PRO D 1 49  ? -28.540 36.705  43.194  1.00 105.76 ? 50   PRO D N   1 
ATOM   9346  C CA  . PRO D 1 49  ? -29.267 37.925  42.823  1.00 113.16 ? 50   PRO D CA  1 
ATOM   9347  C C   . PRO D 1 49  ? -28.641 39.171  43.445  1.00 114.98 ? 50   PRO D C   1 
ATOM   9348  O O   . PRO D 1 49  ? -27.907 39.067  44.427  1.00 106.33 ? 50   PRO D O   1 
ATOM   9349  C CB  . PRO D 1 49  ? -30.663 37.687  43.404  1.00 109.21 ? 50   PRO D CB  1 
ATOM   9350  C CG  . PRO D 1 49  ? -30.442 36.749  44.538  1.00 105.44 ? 50   PRO D CG  1 
ATOM   9351  C CD  . PRO D 1 49  ? -29.324 35.850  44.102  1.00 100.80 ? 50   PRO D CD  1 
ATOM   9352  N N   . GLN D 1 50  ? -28.933 40.335  42.873  1.00 121.47 ? 51   GLN D N   1 
ATOM   9353  C CA  . GLN D 1 50  ? -28.362 41.591  43.349  1.00 112.86 ? 51   GLN D CA  1 
ATOM   9354  C C   . GLN D 1 50  ? -29.058 42.101  44.609  1.00 91.25  ? 51   GLN D C   1 
ATOM   9355  O O   . GLN D 1 50  ? -28.460 42.816  45.414  1.00 86.67  ? 51   GLN D O   1 
ATOM   9356  C CB  . GLN D 1 50  ? -28.393 42.660  42.249  1.00 118.46 ? 51   GLN D CB  1 
ATOM   9357  C CG  . GLN D 1 50  ? -29.766 42.914  41.633  1.00 124.25 ? 51   GLN D CG  1 
ATOM   9358  C CD  . GLN D 1 50  ? -30.146 41.882  40.585  1.00 125.69 ? 51   GLN D CD  1 
ATOM   9359  O OE1 . GLN D 1 50  ? -30.452 40.734  40.909  1.00 120.57 ? 51   GLN D OE1 1 
ATOM   9360  N NE2 . GLN D 1 50  ? -30.127 42.288  39.321  1.00 126.56 ? 51   GLN D NE2 1 
ATOM   9361  N N   . ALA D 1 51  ? -30.322 41.727  44.777  1.00 73.45  ? 52   ALA D N   1 
ATOM   9362  C CA  . ALA D 1 51  ? -31.092 42.134  45.945  1.00 76.30  ? 52   ALA D CA  1 
ATOM   9363  C C   . ALA D 1 51  ? -31.731 40.926  46.619  1.00 82.87  ? 52   ALA D C   1 
ATOM   9364  O O   . ALA D 1 51  ? -31.792 39.843  46.036  1.00 98.98  ? 52   ALA D O   1 
ATOM   9365  C CB  . ALA D 1 51  ? -32.154 43.145  45.552  1.00 88.46  ? 52   ALA D CB  1 
ATOM   9366  N N   . GLU D 1 52  ? -32.200 41.115  47.849  1.00 67.79  ? 53   GLU D N   1 
ATOM   9367  C CA  . GLU D 1 52  ? -32.852 40.043  48.594  1.00 58.35  ? 53   GLU D CA  1 
ATOM   9368  C C   . GLU D 1 52  ? -34.084 39.528  47.862  1.00 64.81  ? 53   GLU D C   1 
ATOM   9369  O O   . GLU D 1 52  ? -34.759 40.277  47.157  1.00 85.95  ? 53   GLU D O   1 
ATOM   9370  C CB  . GLU D 1 52  ? -33.242 40.514  49.995  1.00 47.50  ? 53   GLU D CB  1 
ATOM   9371  C CG  . GLU D 1 52  ? -32.066 40.859  50.888  1.00 57.33  ? 53   GLU D CG  1 
ATOM   9372  C CD  . GLU D 1 52  ? -32.475 41.037  52.336  1.00 62.50  ? 53   GLU D CD  1 
ATOM   9373  O OE1 . GLU D 1 52  ? -33.659 40.799  52.651  1.00 61.14  ? 53   GLU D OE1 1 
ATOM   9374  O OE2 . GLU D 1 52  ? -31.613 41.413  53.159  1.00 55.23  ? 53   GLU D OE2 1 
ATOM   9375  N N   . ILE D 1 53  ? -34.367 38.242  48.031  1.00 56.79  ? 54   ILE D N   1 
ATOM   9376  C CA  . ILE D 1 53  ? -35.507 37.616  47.378  1.00 60.00  ? 54   ILE D CA  1 
ATOM   9377  C C   . ILE D 1 53  ? -36.409 36.978  48.438  1.00 67.73  ? 54   ILE D C   1 
ATOM   9378  O O   . ILE D 1 53  ? -36.087 37.011  49.625  1.00 64.58  ? 54   ILE D O   1 
ATOM   9379  C CB  . ILE D 1 53  ? -35.030 36.565  46.341  1.00 78.38  ? 54   ILE D CB  1 
ATOM   9380  C CG1 . ILE D 1 53  ? -35.982 36.504  45.143  1.00 93.36  ? 54   ILE D CG1 1 
ATOM   9381  C CG2 . ILE D 1 53  ? -34.798 35.201  46.994  1.00 71.61  ? 54   ILE D CG2 1 
ATOM   9382  C CD1 . ILE D 1 53  ? -35.847 37.686  44.200  1.00 100.93 ? 54   ILE D CD1 1 
ATOM   9383  N N   . SER D 1 54  ? -37.536 36.409  48.017  1.00 85.34  ? 55   SER D N   1 
ATOM   9384  C CA  . SER D 1 54  ? -38.439 35.734  48.947  1.00 99.60  ? 55   SER D CA  1 
ATOM   9385  C C   . SER D 1 54  ? -37.827 34.419  49.423  1.00 104.84 ? 55   SER D C   1 
ATOM   9386  O O   . SER D 1 54  ? -37.218 33.692  48.640  1.00 101.21 ? 55   SER D O   1 
ATOM   9387  C CB  . SER D 1 54  ? -39.802 35.487  48.298  1.00 103.55 ? 55   SER D CB  1 
ATOM   9388  O OG  . SER D 1 54  ? -39.679 34.656  47.157  1.00 108.98 ? 55   SER D OG  1 
ATOM   9389  N N   . GLY D 1 55  ? -37.989 34.119  50.708  1.00 105.86 ? 56   GLY D N   1 
ATOM   9390  C CA  . GLY D 1 55  ? -37.316 32.983  51.312  1.00 100.55 ? 56   GLY D CA  1 
ATOM   9391  C C   . GLY D 1 55  ? -38.153 31.753  51.611  1.00 106.06 ? 56   GLY D C   1 
ATOM   9392  O O   . GLY D 1 55  ? -37.751 30.914  52.416  1.00 108.55 ? 56   GLY D O   1 
ATOM   9393  N N   . GLU D 1 56  ? -39.312 31.635  50.974  1.00 108.76 ? 57   GLU D N   1 
ATOM   9394  C CA  . GLU D 1 56  ? -40.166 30.469  51.187  1.00 107.70 ? 57   GLU D CA  1 
ATOM   9395  C C   . GLU D 1 56  ? -39.687 29.243  50.411  1.00 97.65  ? 57   GLU D C   1 
ATOM   9396  O O   . GLU D 1 56  ? -40.217 28.146  50.585  1.00 88.72  ? 57   GLU D O   1 
ATOM   9397  C CB  . GLU D 1 56  ? -41.624 30.782  50.840  1.00 119.66 ? 57   GLU D CB  1 
ATOM   9398  C CG  . GLU D 1 56  ? -42.356 31.585  51.903  1.00 133.98 ? 57   GLU D CG  1 
ATOM   9399  C CD  . GLU D 1 56  ? -43.849 31.665  51.647  1.00 148.42 ? 57   GLU D CD  1 
ATOM   9400  O OE1 . GLU D 1 56  ? -44.294 31.208  50.573  1.00 152.55 ? 57   GLU D OE1 1 
ATOM   9401  O OE2 . GLU D 1 56  ? -44.580 32.181  52.520  1.00 153.01 ? 57   GLU D OE2 1 
ATOM   9402  N N   . HIS D 1 57  ? -38.684 29.431  49.559  1.00 96.01  ? 58   HIS D N   1 
ATOM   9403  C CA  . HIS D 1 57  ? -38.143 28.332  48.765  1.00 94.73  ? 58   HIS D CA  1 
ATOM   9404  C C   . HIS D 1 57  ? -37.007 27.610  49.485  1.00 99.52  ? 58   HIS D C   1 
ATOM   9405  O O   . HIS D 1 57  ? -36.524 26.577  49.021  1.00 101.81 ? 58   HIS D O   1 
ATOM   9406  C CB  . HIS D 1 57  ? -37.661 28.838  47.402  1.00 93.17  ? 58   HIS D CB  1 
ATOM   9407  C CG  . HIS D 1 57  ? -36.524 29.810  47.484  1.00 102.66 ? 58   HIS D CG  1 
ATOM   9408  N ND1 . HIS D 1 57  ? -35.238 29.430  47.801  1.00 108.69 ? 58   HIS D ND1 1 
ATOM   9409  C CD2 . HIS D 1 57  ? -36.482 31.149  47.286  1.00 112.26 ? 58   HIS D CD2 1 
ATOM   9410  C CE1 . HIS D 1 57  ? -34.453 30.491  47.798  1.00 111.24 ? 58   HIS D CE1 1 
ATOM   9411  N NE2 . HIS D 1 57  ? -35.183 31.548  47.488  1.00 113.02 ? 58   HIS D NE2 1 
ATOM   9412  N N   . LEU D 1 58  ? -36.584 28.159  50.619  1.00 97.38  ? 59   LEU D N   1 
ATOM   9413  C CA  . LEU D 1 58  ? -35.466 27.598  51.370  1.00 89.14  ? 59   LEU D CA  1 
ATOM   9414  C C   . LEU D 1 58  ? -35.825 26.260  52.008  1.00 81.83  ? 59   LEU D C   1 
ATOM   9415  O O   . LEU D 1 58  ? -36.816 26.150  52.730  1.00 66.31  ? 59   LEU D O   1 
ATOM   9416  C CB  . LEU D 1 58  ? -34.999 28.583  52.445  1.00 84.91  ? 59   LEU D CB  1 
ATOM   9417  C CG  . LEU D 1 58  ? -34.440 29.921  51.954  1.00 75.40  ? 59   LEU D CG  1 
ATOM   9418  C CD1 . LEU D 1 58  ? -34.207 30.868  53.122  1.00 56.89  ? 59   LEU D CD1 1 
ATOM   9419  C CD2 . LEU D 1 58  ? -33.155 29.710  51.167  1.00 68.01  ? 59   LEU D CD2 1 
ATOM   9420  N N   . ARG D 1 59  ? -35.012 25.244  51.734  1.00 90.06  ? 60   ARG D N   1 
ATOM   9421  C CA  . ARG D 1 59  ? -35.206 23.927  52.330  1.00 92.26  ? 60   ARG D CA  1 
ATOM   9422  C C   . ARG D 1 59  ? -34.601 23.865  53.726  1.00 93.54  ? 60   ARG D C   1 
ATOM   9423  O O   . ARG D 1 59  ? -35.318 23.788  54.725  1.00 96.82  ? 60   ARG D O   1 
ATOM   9424  C CB  . ARG D 1 59  ? -34.581 22.833  51.460  1.00 94.99  ? 60   ARG D CB  1 
ATOM   9425  C CG  . ARG D 1 59  ? -35.217 22.660  50.089  1.00 101.33 ? 60   ARG D CG  1 
ATOM   9426  C CD  . ARG D 1 59  ? -34.799 21.342  49.437  1.00 108.49 ? 60   ARG D CD  1 
ATOM   9427  N NE  . ARG D 1 59  ? -33.360 21.258  49.193  1.00 119.18 ? 60   ARG D NE  1 
ATOM   9428  C CZ  . ARG D 1 59  ? -32.505 20.585  49.959  1.00 118.11 ? 60   ARG D CZ  1 
ATOM   9429  N NH1 . ARG D 1 59  ? -32.940 19.931  51.028  1.00 112.26 ? 60   ARG D NH1 1 
ATOM   9430  N NH2 . ARG D 1 59  ? -31.214 20.566  49.657  1.00 114.63 ? 60   ARG D NH2 1 
ATOM   9431  N N   . ILE D 1 60  ? -33.273 23.893  53.783  1.00 87.65  ? 61   ILE D N   1 
ATOM   9432  C CA  . ILE D 1 60  ? -32.547 23.767  55.041  1.00 72.73  ? 61   ILE D CA  1 
ATOM   9433  C C   . ILE D 1 60  ? -32.635 25.017  55.915  1.00 58.19  ? 61   ILE D C   1 
ATOM   9434  O O   . ILE D 1 60  ? -32.995 24.938  57.090  1.00 57.84  ? 61   ILE D O   1 
ATOM   9435  C CB  . ILE D 1 60  ? -31.062 23.452  54.785  1.00 60.55  ? 61   ILE D CB  1 
ATOM   9436  C CG1 . ILE D 1 60  ? -30.934 22.327  53.755  1.00 57.41  ? 61   ILE D CG1 1 
ATOM   9437  C CG2 . ILE D 1 60  ? -30.368 23.092  56.089  1.00 36.43  ? 61   ILE D CG2 1 
ATOM   9438  C CD1 . ILE D 1 60  ? -29.680 22.409  52.915  1.00 58.51  ? 61   ILE D CD1 1 
ATOM   9439  N N   . CYS D 1 61  ? -32.306 26.166  55.334  1.00 58.73  ? 62   CYS D N   1 
ATOM   9440  C CA  . CYS D 1 61  ? -32.271 27.419  56.081  1.00 62.19  ? 62   CYS D CA  1 
ATOM   9441  C C   . CYS D 1 61  ? -33.669 27.881  56.482  1.00 67.12  ? 62   CYS D C   1 
ATOM   9442  O O   . CYS D 1 61  ? -34.635 27.642  55.755  1.00 62.39  ? 62   CYS D O   1 
ATOM   9443  C CB  . CYS D 1 61  ? -31.564 28.505  55.266  1.00 48.99  ? 62   CYS D CB  1 
ATOM   9444  S SG  . CYS D 1 61  ? -29.806 28.196  54.991  1.00 99.59  ? 62   CYS D SG  1 
ATOM   9445  N N   . PRO D 1 62  ? -33.778 28.536  57.651  1.00 71.60  ? 63   PRO D N   1 
ATOM   9446  C CA  . PRO D 1 62  ? -35.049 29.085  58.135  1.00 71.80  ? 63   PRO D CA  1 
ATOM   9447  C C   . PRO D 1 62  ? -35.669 30.016  57.102  1.00 71.96  ? 63   PRO D C   1 
ATOM   9448  O O   . PRO D 1 62  ? -34.987 30.906  56.594  1.00 66.74  ? 63   PRO D O   1 
ATOM   9449  C CB  . PRO D 1 62  ? -34.633 29.881  59.373  1.00 62.15  ? 63   PRO D CB  1 
ATOM   9450  C CG  . PRO D 1 62  ? -33.403 29.194  59.857  1.00 65.42  ? 63   PRO D CG  1 
ATOM   9451  C CD  . PRO D 1 62  ? -32.685 28.743  58.619  1.00 67.02  ? 63   PRO D CD  1 
ATOM   9452  N N   . GLN D 1 63  ? -36.947 29.814  56.802  1.00 71.63  ? 64   GLN D N   1 
ATOM   9453  C CA  . GLN D 1 63  ? -37.603 30.583  55.754  1.00 68.00  ? 64   GLN D CA  1 
ATOM   9454  C C   . GLN D 1 63  ? -37.772 32.045  56.150  1.00 78.12  ? 64   GLN D C   1 
ATOM   9455  O O   . GLN D 1 63  ? -38.338 32.364  57.195  1.00 88.14  ? 64   GLN D O   1 
ATOM   9456  C CB  . GLN D 1 63  ? -38.945 29.952  55.373  1.00 71.98  ? 64   GLN D CB  1 
ATOM   9457  C CG  . GLN D 1 63  ? -38.806 28.616  54.657  1.00 84.97  ? 64   GLN D CG  1 
ATOM   9458  C CD  . GLN D 1 63  ? -40.137 28.046  54.205  1.00 98.44  ? 64   GLN D CD  1 
ATOM   9459  O OE1 . GLN D 1 63  ? -41.192 28.408  54.727  1.00 108.57 ? 64   GLN D OE1 1 
ATOM   9460  N NE2 . GLN D 1 63  ? -40.093 27.149  53.226  1.00 93.97  ? 64   GLN D NE2 1 
ATOM   9461  N N   . GLY D 1 64  ? -37.265 32.925  55.294  1.00 73.01  ? 65   GLY D N   1 
ATOM   9462  C CA  . GLY D 1 64  ? -37.260 34.354  55.538  1.00 71.09  ? 65   GLY D CA  1 
ATOM   9463  C C   . GLY D 1 64  ? -36.447 35.007  54.441  1.00 79.09  ? 65   GLY D C   1 
ATOM   9464  O O   . GLY D 1 64  ? -35.775 34.310  53.681  1.00 75.28  ? 65   GLY D O   1 
ATOM   9465  N N   . TYR D 1 65  ? -36.501 36.332  54.353  1.00 86.62  ? 66   TYR D N   1 
ATOM   9466  C CA  . TYR D 1 65  ? -35.821 37.051  53.277  1.00 86.45  ? 66   TYR D CA  1 
ATOM   9467  C C   . TYR D 1 65  ? -34.328 36.737  53.221  1.00 72.63  ? 66   TYR D C   1 
ATOM   9468  O O   . TYR D 1 65  ? -33.614 36.856  54.217  1.00 56.40  ? 66   TYR D O   1 
ATOM   9469  C CB  . TYR D 1 65  ? -36.079 38.554  53.383  1.00 90.53  ? 66   TYR D CB  1 
ATOM   9470  C CG  . TYR D 1 65  ? -37.536 38.897  53.186  1.00 89.01  ? 66   TYR D CG  1 
ATOM   9471  C CD1 . TYR D 1 65  ? -38.093 38.921  51.915  1.00 83.57  ? 66   TYR D CD1 1 
ATOM   9472  C CD2 . TYR D 1 65  ? -38.360 39.172  54.269  1.00 81.16  ? 66   TYR D CD2 1 
ATOM   9473  C CE1 . TYR D 1 65  ? -39.425 39.219  51.726  1.00 80.26  ? 66   TYR D CE1 1 
ATOM   9474  C CE2 . TYR D 1 65  ? -39.695 39.474  54.090  1.00 78.85  ? 66   TYR D CE2 1 
ATOM   9475  C CZ  . TYR D 1 65  ? -40.221 39.497  52.816  1.00 82.58  ? 66   TYR D CZ  1 
ATOM   9476  O OH  . TYR D 1 65  ? -41.550 39.795  52.630  1.00 90.67  ? 66   TYR D OH  1 
ATOM   9477  N N   . THR D 1 66  ? -33.873 36.328  52.041  1.00 64.65  ? 67   THR D N   1 
ATOM   9478  C CA  . THR D 1 66  ? -32.548 35.744  51.891  1.00 66.97  ? 67   THR D CA  1 
ATOM   9479  C C   . THR D 1 66  ? -31.804 36.234  50.655  1.00 77.44  ? 67   THR D C   1 
ATOM   9480  O O   . THR D 1 66  ? -32.412 36.684  49.684  1.00 80.18  ? 67   THR D O   1 
ATOM   9481  C CB  . THR D 1 66  ? -32.641 34.213  51.805  1.00 65.96  ? 67   THR D CB  1 
ATOM   9482  O OG1 . THR D 1 66  ? -31.349 33.672  51.504  1.00 69.15  ? 67   THR D OG1 1 
ATOM   9483  C CG2 . THR D 1 66  ? -33.620 33.804  50.715  1.00 60.40  ? 67   THR D CG2 1 
ATOM   9484  N N   . CYS D 1 67  ? -30.479 36.139  50.705  1.00 75.45  ? 68   CYS D N   1 
ATOM   9485  C CA  . CYS D 1 67  ? -29.637 36.446  49.556  1.00 71.03  ? 68   CYS D CA  1 
ATOM   9486  C C   . CYS D 1 67  ? -29.284 35.180  48.783  1.00 66.58  ? 68   CYS D C   1 
ATOM   9487  O O   . CYS D 1 67  ? -28.610 35.238  47.755  1.00 68.93  ? 68   CYS D O   1 
ATOM   9488  C CB  . CYS D 1 67  ? -28.361 37.164  49.999  1.00 61.24  ? 68   CYS D CB  1 
ATOM   9489  S SG  . CYS D 1 67  ? -28.524 38.960  50.119  1.00 126.71 ? 68   CYS D SG  1 
ATOM   9490  N N   . CYS D 1 68  ? -29.754 34.040  49.282  1.00 58.23  ? 69   CYS D N   1 
ATOM   9491  C CA  . CYS D 1 68  ? -29.418 32.745  48.701  1.00 63.21  ? 69   CYS D CA  1 
ATOM   9492  C C   . CYS D 1 68  ? -30.593 32.129  47.956  1.00 59.49  ? 69   CYS D C   1 
ATOM   9493  O O   . CYS D 1 68  ? -31.709 32.073  48.476  1.00 60.48  ? 69   CYS D O   1 
ATOM   9494  C CB  . CYS D 1 68  ? -28.965 31.774  49.797  1.00 59.82  ? 69   CYS D CB  1 
ATOM   9495  S SG  . CYS D 1 68  ? -27.586 32.345  50.813  1.00 83.30  ? 69   CYS D SG  1 
ATOM   9496  N N   . THR D 1 69  ? -30.339 31.654  46.742  1.00 70.12  ? 70   THR D N   1 
ATOM   9497  C CA  . THR D 1 69  ? -31.324 30.854  46.031  1.00 90.98  ? 70   THR D CA  1 
ATOM   9498  C C   . THR D 1 69  ? -31.186 29.399  46.471  1.00 113.98 ? 70   THR D C   1 
ATOM   9499  O O   . THR D 1 69  ? -30.307 29.070  47.274  1.00 128.73 ? 70   THR D O   1 
ATOM   9500  C CB  . THR D 1 69  ? -31.155 30.956  44.501  1.00 90.02  ? 70   THR D CB  1 
ATOM   9501  O OG1 . THR D 1 69  ? -32.144 30.148  43.851  1.00 88.32  ? 70   THR D OG1 1 
ATOM   9502  C CG2 . THR D 1 69  ? -29.775 30.493  44.076  1.00 91.27  ? 70   THR D CG2 1 
ATOM   9503  N N   . SER D 1 70  ? -32.047 28.529  45.950  1.00 118.24 ? 71   SER D N   1 
ATOM   9504  C CA  . SER D 1 70  ? -32.010 27.116  46.313  1.00 118.23 ? 71   SER D CA  1 
ATOM   9505  C C   . SER D 1 70  ? -30.700 26.474  45.866  1.00 112.40 ? 71   SER D C   1 
ATOM   9506  O O   . SER D 1 70  ? -30.149 25.621  46.563  1.00 104.71 ? 71   SER D O   1 
ATOM   9507  C CB  . SER D 1 70  ? -33.210 26.371  45.722  1.00 119.05 ? 71   SER D CB  1 
ATOM   9508  O OG  . SER D 1 70  ? -33.271 26.524  44.315  1.00 124.35 ? 71   SER D OG  1 
ATOM   9509  N N   . GLU D 1 71  ? -30.204 26.902  44.708  1.00 113.75 ? 72   GLU D N   1 
ATOM   9510  C CA  . GLU D 1 71  ? -28.917 26.444  44.198  1.00 117.76 ? 72   GLU D CA  1 
ATOM   9511  C C   . GLU D 1 71  ? -27.794 26.778  45.174  1.00 115.35 ? 72   GLU D C   1 
ATOM   9512  O O   . GLU D 1 71  ? -26.998 25.911  45.544  1.00 117.20 ? 72   GLU D O   1 
ATOM   9513  C CB  . GLU D 1 71  ? -28.633 27.076  42.834  1.00 123.63 ? 72   GLU D CB  1 
ATOM   9514  C CG  . GLU D 1 71  ? -29.318 26.378  41.672  1.00 134.74 ? 72   GLU D CG  1 
ATOM   9515  C CD  . GLU D 1 71  ? -28.734 25.005  41.398  1.00 143.39 ? 72   GLU D CD  1 
ATOM   9516  O OE1 . GLU D 1 71  ? -27.758 24.918  40.623  1.00 143.40 ? 72   GLU D OE1 1 
ATOM   9517  O OE2 . GLU D 1 71  ? -29.244 24.012  41.960  1.00 143.04 ? 72   GLU D OE2 1 
ATOM   9518  N N   . MET D 1 72  ? -27.743 28.041  45.591  1.00 111.88 ? 73   MET D N   1 
ATOM   9519  C CA  . MET D 1 72  ? -26.747 28.500  46.552  1.00 111.10 ? 73   MET D CA  1 
ATOM   9520  C C   . MET D 1 72  ? -26.869 27.752  47.874  1.00 95.73  ? 73   MET D C   1 
ATOM   9521  O O   . MET D 1 72  ? -25.866 27.473  48.532  1.00 90.99  ? 73   MET D O   1 
ATOM   9522  C CB  . MET D 1 72  ? -26.880 30.006  46.792  1.00 122.36 ? 73   MET D CB  1 
ATOM   9523  C CG  . MET D 1 72  ? -26.528 30.864  45.592  1.00 133.68 ? 73   MET D CG  1 
ATOM   9524  S SD  . MET D 1 72  ? -26.822 32.616  45.896  1.00 106.65 ? 73   MET D SD  1 
ATOM   9525  C CE  . MET D 1 72  ? -25.666 32.928  47.227  1.00 35.71  ? 73   MET D CE  1 
ATOM   9526  N N   . GLU D 1 73  ? -28.100 27.425  48.257  1.00 79.78  ? 74   GLU D N   1 
ATOM   9527  C CA  . GLU D 1 73  ? -28.327 26.684  49.490  1.00 71.01  ? 74   GLU D CA  1 
ATOM   9528  C C   . GLU D 1 73  ? -27.738 25.278  49.395  1.00 84.84  ? 74   GLU D C   1 
ATOM   9529  O O   . GLU D 1 73  ? -27.014 24.840  50.293  1.00 92.38  ? 74   GLU D O   1 
ATOM   9530  C CB  . GLU D 1 73  ? -29.818 26.614  49.814  1.00 52.33  ? 74   GLU D CB  1 
ATOM   9531  C CG  . GLU D 1 73  ? -30.109 26.144  51.229  1.00 58.63  ? 74   GLU D CG  1 
ATOM   9532  C CD  . GLU D 1 73  ? -31.588 25.943  51.486  1.00 71.78  ? 74   GLU D CD  1 
ATOM   9533  O OE1 . GLU D 1 73  ? -32.348 25.809  50.504  1.00 84.53  ? 74   GLU D OE1 1 
ATOM   9534  O OE2 . GLU D 1 73  ? -31.991 25.920  52.668  1.00 61.99  ? 74   GLU D OE2 1 
ATOM   9535  N N   . GLU D 1 74  ? -28.050 24.581  48.303  1.00 88.32  ? 75   GLU D N   1 
ATOM   9536  C CA  . GLU D 1 74  ? -27.501 23.249  48.054  1.00 91.78  ? 75   GLU D CA  1 
ATOM   9537  C C   . GLU D 1 74  ? -25.977 23.282  48.077  1.00 79.36  ? 75   GLU D C   1 
ATOM   9538  O O   . GLU D 1 74  ? -25.333 22.501  48.785  1.00 81.17  ? 75   GLU D O   1 
ATOM   9539  C CB  . GLU D 1 74  ? -27.965 22.720  46.695  1.00 107.40 ? 75   GLU D CB  1 
ATOM   9540  C CG  . GLU D 1 74  ? -29.465 22.527  46.557  1.00 118.60 ? 75   GLU D CG  1 
ATOM   9541  C CD  . GLU D 1 74  ? -29.873 22.179  45.137  1.00 124.78 ? 75   GLU D CD  1 
ATOM   9542  O OE1 . GLU D 1 74  ? -28.995 21.768  44.348  1.00 123.85 ? 75   GLU D OE1 1 
ATOM   9543  O OE2 . GLU D 1 74  ? -31.069 22.325  44.807  1.00 126.14 ? 75   GLU D OE2 1 
ATOM   9544  N N   . ASN D 1 75  ? -25.414 24.202  47.299  1.00 68.86  ? 76   ASN D N   1 
ATOM   9545  C CA  . ASN D 1 75  ? -23.967 24.331  47.165  1.00 74.51  ? 76   ASN D CA  1 
ATOM   9546  C C   . ASN D 1 75  ? -23.254 24.635  48.479  1.00 75.26  ? 76   ASN D C   1 
ATOM   9547  O O   . ASN D 1 75  ? -22.211 24.050  48.776  1.00 81.46  ? 76   ASN D O   1 
ATOM   9548  C CB  . ASN D 1 75  ? -23.632 25.403  46.127  1.00 80.17  ? 76   ASN D CB  1 
ATOM   9549  C CG  . ASN D 1 75  ? -24.126 25.043  44.742  1.00 85.01  ? 76   ASN D CG  1 
ATOM   9550  O OD1 . ASN D 1 75  ? -24.819 24.042  44.559  1.00 76.84  ? 76   ASN D OD1 1 
ATOM   9551  N ND2 . ASN D 1 75  ? -23.779 25.863  43.756  1.00 94.46  ? 76   ASN D ND2 1 
ATOM   9552  N N   . LEU D 1 76  ? -23.816 25.547  49.264  1.00 70.39  ? 77   LEU D N   1 
ATOM   9553  C CA  . LEU D 1 76  ? -23.234 25.895  50.555  1.00 74.95  ? 77   LEU D CA  1 
ATOM   9554  C C   . LEU D 1 76  ? -23.358 24.741  51.549  1.00 75.42  ? 77   LEU D C   1 
ATOM   9555  O O   . LEU D 1 76  ? -22.457 24.512  52.360  1.00 79.85  ? 77   LEU D O   1 
ATOM   9556  C CB  . LEU D 1 76  ? -23.868 27.170  51.113  1.00 75.40  ? 77   LEU D CB  1 
ATOM   9557  C CG  . LEU D 1 76  ? -23.407 28.470  50.450  1.00 68.03  ? 77   LEU D CG  1 
ATOM   9558  C CD1 . LEU D 1 76  ? -24.286 29.637  50.871  1.00 64.90  ? 77   LEU D CD1 1 
ATOM   9559  C CD2 . LEU D 1 76  ? -21.947 28.751  50.780  1.00 59.52  ? 77   LEU D CD2 1 
ATOM   9560  N N   . ALA D 1 77  ? -24.472 24.017  51.479  1.00 65.38  ? 78   ALA D N   1 
ATOM   9561  C CA  . ALA D 1 77  ? -24.658 22.825  52.302  1.00 57.61  ? 78   ALA D CA  1 
ATOM   9562  C C   . ALA D 1 77  ? -23.568 21.796  52.010  1.00 68.76  ? 78   ALA D C   1 
ATOM   9563  O O   . ALA D 1 77  ? -22.891 21.305  52.927  1.00 70.88  ? 78   ALA D O   1 
ATOM   9564  C CB  . ALA D 1 77  ? -26.034 22.228  52.066  1.00 34.73  ? 78   ALA D CB  1 
ATOM   9565  N N   . ASN D 1 78  ? -23.401 21.479  50.727  1.00 64.60  ? 79   ASN D N   1 
ATOM   9566  C CA  . ASN D 1 78  ? -22.350 20.564  50.300  1.00 67.75  ? 79   ASN D CA  1 
ATOM   9567  C C   . ASN D 1 78  ? -20.984 21.055  50.760  1.00 66.99  ? 79   ASN D C   1 
ATOM   9568  O O   . ASN D 1 78  ? -20.159 20.270  51.224  1.00 75.24  ? 79   ASN D O   1 
ATOM   9569  C CB  . ASN D 1 78  ? -22.366 20.367  48.780  1.00 70.85  ? 79   ASN D CB  1 
ATOM   9570  C CG  . ASN D 1 78  ? -21.303 19.387  48.306  1.00 86.59  ? 79   ASN D CG  1 
ATOM   9571  O OD1 . ASN D 1 78  ? -20.699 18.680  49.113  1.00 99.42  ? 79   ASN D OD1 1 
ATOM   9572  N ND2 . ASN D 1 78  ? -21.058 19.354  46.994  1.00 98.67  ? 79   ASN D ND2 1 
ATOM   9573  N N   . ARG D 1 79  ? -20.753 22.357  50.634  1.00 56.52  ? 80   ARG D N   1 
ATOM   9574  C CA  . ARG D 1 79  ? -19.501 22.951  51.087  1.00 61.48  ? 80   ARG D CA  1 
ATOM   9575  C C   . ARG D 1 79  ? -19.231 22.674  52.564  1.00 66.11  ? 80   ARG D C   1 
ATOM   9576  O O   . ARG D 1 79  ? -18.234 22.039  52.900  1.00 74.41  ? 80   ARG D O   1 
ATOM   9577  C CB  . ARG D 1 79  ? -19.446 24.449  50.777  1.00 70.94  ? 80   ARG D CB  1 
ATOM   9578  C CG  . ARG D 1 79  ? -18.081 25.093  51.019  1.00 74.96  ? 80   ARG D CG  1 
ATOM   9579  C CD  . ARG D 1 79  ? -16.918 24.193  50.588  1.00 81.52  ? 80   ARG D CD  1 
ATOM   9580  N NE  . ARG D 1 79  ? -17.066 23.663  49.233  1.00 97.21  ? 80   ARG D NE  1 
ATOM   9581  C CZ  . ARG D 1 79  ? -16.575 24.239  48.141  1.00 105.61 ? 80   ARG D CZ  1 
ATOM   9582  N NH1 . ARG D 1 79  ? -15.896 25.374  48.234  1.00 107.52 ? 80   ARG D NH1 1 
ATOM   9583  N NH2 . ARG D 1 79  ? -16.764 23.677  46.954  1.00 103.98 ? 80   ARG D NH2 1 
ATOM   9584  N N   . SER D 1 80  ? -20.113 23.160  53.435  1.00 70.11  ? 81   SER D N   1 
ATOM   9585  C CA  . SER D 1 80  ? -19.978 22.938  54.876  1.00 68.15  ? 81   SER D CA  1 
ATOM   9586  C C   . SER D 1 80  ? -19.760 21.463  55.214  1.00 62.67  ? 81   SER D C   1 
ATOM   9587  O O   . SER D 1 80  ? -18.898 21.125  56.036  1.00 58.47  ? 81   SER D O   1 
ATOM   9588  C CB  . SER D 1 80  ? -21.203 23.475  55.622  1.00 64.23  ? 81   SER D CB  1 
ATOM   9589  O OG  . SER D 1 80  ? -22.385 22.816  55.206  1.00 77.74  ? 81   SER D OG  1 
ATOM   9590  N N   . HIS D 1 81  ? -20.532 20.591  54.568  1.00 63.14  ? 82   HIS D N   1 
ATOM   9591  C CA  . HIS D 1 81  ? -20.388 19.148  54.751  1.00 50.94  ? 82   HIS D CA  1 
ATOM   9592  C C   . HIS D 1 81  ? -18.970 18.671  54.417  1.00 54.77  ? 82   HIS D C   1 
ATOM   9593  O O   . HIS D 1 81  ? -18.340 17.940  55.191  1.00 47.45  ? 82   HIS D O   1 
ATOM   9594  C CB  . HIS D 1 81  ? -21.416 18.412  53.887  1.00 59.63  ? 82   HIS D CB  1 
ATOM   9595  C CG  . HIS D 1 81  ? -21.349 16.920  54.000  1.00 75.39  ? 82   HIS D CG  1 
ATOM   9596  N ND1 . HIS D 1 81  ? -21.124 16.103  52.914  1.00 78.93  ? 82   HIS D ND1 1 
ATOM   9597  C CD2 . HIS D 1 81  ? -21.481 16.101  55.069  1.00 79.70  ? 82   HIS D CD2 1 
ATOM   9598  C CE1 . HIS D 1 81  ? -21.119 14.842  53.309  1.00 78.86  ? 82   HIS D CE1 1 
ATOM   9599  N NE2 . HIS D 1 81  ? -21.332 14.813  54.612  1.00 81.07  ? 82   HIS D NE2 1 
ATOM   9600  N N   . ALA D 1 82  ? -18.473 19.104  53.262  1.00 54.32  ? 83   ALA D N   1 
ATOM   9601  C CA  . ALA D 1 82  ? -17.140 18.733  52.802  1.00 49.93  ? 83   ALA D CA  1 
ATOM   9602  C C   . ALA D 1 82  ? -16.051 19.255  53.735  1.00 59.97  ? 83   ALA D C   1 
ATOM   9603  O O   . ALA D 1 82  ? -15.043 18.586  53.957  1.00 81.83  ? 83   ALA D O   1 
ATOM   9604  C CB  . ALA D 1 82  ? -16.909 19.238  51.385  1.00 48.34  ? 83   ALA D CB  1 
ATOM   9605  N N   . GLU D 1 83  ? -16.260 20.450  54.277  1.00 42.99  ? 84   GLU D N   1 
ATOM   9606  C CA  . GLU D 1 83  ? -15.297 21.055  55.189  1.00 52.16  ? 84   GLU D CA  1 
ATOM   9607  C C   . GLU D 1 83  ? -15.232 20.282  56.503  1.00 53.29  ? 84   GLU D C   1 
ATOM   9608  O O   . GLU D 1 83  ? -14.143 20.027  57.035  1.00 56.67  ? 84   GLU D O   1 
ATOM   9609  C CB  . GLU D 1 83  ? -15.648 22.523  55.436  1.00 66.36  ? 84   GLU D CB  1 
ATOM   9610  C CG  . GLU D 1 83  ? -15.523 23.401  54.196  1.00 75.31  ? 84   GLU D CG  1 
ATOM   9611  C CD  . GLU D 1 83  ? -16.130 24.780  54.385  1.00 83.00  ? 84   GLU D CD  1 
ATOM   9612  O OE1 . GLU D 1 83  ? -16.870 24.977  55.372  1.00 75.51  ? 84   GLU D OE1 1 
ATOM   9613  O OE2 . GLU D 1 83  ? -15.868 25.667  53.545  1.00 89.62  ? 84   GLU D OE2 1 
ATOM   9614  N N   . LEU D 1 84  ? -16.400 19.902  57.018  1.00 51.23  ? 85   LEU D N   1 
ATOM   9615  C CA  . LEU D 1 84  ? -16.466 19.079  58.223  1.00 43.30  ? 85   LEU D CA  1 
ATOM   9616  C C   . LEU D 1 84  ? -15.761 17.741  58.000  1.00 53.47  ? 85   LEU D C   1 
ATOM   9617  O O   . LEU D 1 84  ? -14.936 17.307  58.820  1.00 56.36  ? 85   LEU D O   1 
ATOM   9618  C CB  . LEU D 1 84  ? -17.920 18.847  58.634  1.00 23.29  ? 85   LEU D CB  1 
ATOM   9619  C CG  . LEU D 1 84  ? -18.121 18.078  59.941  1.00 36.98  ? 85   LEU D CG  1 
ATOM   9620  C CD1 . LEU D 1 84  ? -17.425 18.793  61.084  1.00 46.96  ? 85   LEU D CD1 1 
ATOM   9621  C CD2 . LEU D 1 84  ? -19.596 17.901  60.247  1.00 27.10  ? 85   LEU D CD2 1 
ATOM   9622  N N   . GLU D 1 85  ? -16.084 17.097  56.880  1.00 58.98  ? 86   GLU D N   1 
ATOM   9623  C CA  . GLU D 1 85  ? -15.446 15.834  56.516  1.00 70.22  ? 86   GLU D CA  1 
ATOM   9624  C C   . GLU D 1 85  ? -13.931 15.977  56.425  1.00 62.90  ? 86   GLU D C   1 
ATOM   9625  O O   . GLU D 1 85  ? -13.189 15.083  56.833  1.00 73.64  ? 86   GLU D O   1 
ATOM   9626  C CB  . GLU D 1 85  ? -16.002 15.301  55.194  1.00 79.48  ? 86   GLU D CB  1 
ATOM   9627  C CG  . GLU D 1 85  ? -17.018 14.182  55.356  1.00 86.02  ? 86   GLU D CG  1 
ATOM   9628  C CD  . GLU D 1 85  ? -17.437 13.581  54.028  1.00 93.44  ? 86   GLU D CD  1 
ATOM   9629  O OE1 . GLU D 1 85  ? -16.856 13.963  52.990  1.00 84.60  ? 86   GLU D OE1 1 
ATOM   9630  O OE2 . GLU D 1 85  ? -18.347 12.726  54.023  1.00 101.27 ? 86   GLU D OE2 1 
ATOM   9631  N N   . THR D 1 86  ? -13.481 17.108  55.892  1.00 53.22  ? 87   THR D N   1 
ATOM   9632  C CA  . THR D 1 86  ? -12.055 17.392  55.787  1.00 64.40  ? 87   THR D CA  1 
ATOM   9633  C C   . THR D 1 86  ? -11.415 17.489  57.167  1.00 58.26  ? 87   THR D C   1 
ATOM   9634  O O   . THR D 1 86  ? -10.339 16.931  57.399  1.00 62.80  ? 87   THR D O   1 
ATOM   9635  C CB  . THR D 1 86  ? -11.788 18.689  54.996  1.00 68.31  ? 87   THR D CB  1 
ATOM   9636  O OG1 . THR D 1 86  ? -12.205 18.514  53.637  1.00 82.27  ? 87   THR D OG1 1 
ATOM   9637  C CG2 . THR D 1 86  ? -10.308 19.038  55.022  1.00 55.04  ? 87   THR D CG2 1 
ATOM   9638  N N   . ALA D 1 87  ? -12.081 18.190  58.082  1.00 52.86  ? 88   ALA D N   1 
ATOM   9639  C CA  . ALA D 1 87  ? -11.584 18.310  59.451  1.00 45.00  ? 88   ALA D CA  1 
ATOM   9640  C C   . ALA D 1 87  ? -11.432 16.939  60.105  1.00 55.85  ? 88   ALA D C   1 
ATOM   9641  O O   . ALA D 1 87  ? -10.370 16.615  60.660  1.00 84.36  ? 88   ALA D O   1 
ATOM   9642  C CB  . ALA D 1 87  ? -12.504 19.191  60.275  1.00 46.88  ? 88   ALA D CB  1 
ATOM   9643  N N   . LEU D 1 88  ? -12.494 16.138  60.030  1.00 47.10  ? 89   LEU D N   1 
ATOM   9644  C CA  . LEU D 1 88  ? -12.462 14.777  60.568  1.00 49.48  ? 89   LEU D CA  1 
ATOM   9645  C C   . LEU D 1 88  ? -11.306 13.974  59.977  1.00 50.25  ? 89   LEU D C   1 
ATOM   9646  O O   . LEU D 1 88  ? -10.551 13.316  60.701  1.00 53.70  ? 89   LEU D O   1 
ATOM   9647  C CB  . LEU D 1 88  ? -13.782 14.053  60.298  1.00 48.88  ? 89   LEU D CB  1 
ATOM   9648  C CG  . LEU D 1 88  ? -15.020 14.575  61.026  1.00 53.80  ? 89   LEU D CG  1 
ATOM   9649  C CD1 . LEU D 1 88  ? -16.220 13.692  60.720  1.00 51.96  ? 89   LEU D CD1 1 
ATOM   9650  C CD2 . LEU D 1 88  ? -14.769 14.650  62.525  1.00 45.50  ? 89   LEU D CD2 1 
ATOM   9651  N N   . ARG D 1 89  ? -11.177 14.049  58.655  1.00 45.98  ? 90   ARG D N   1 
ATOM   9652  C CA  . ARG D 1 89  ? -10.108 13.374  57.931  1.00 52.34  ? 90   ARG D CA  1 
ATOM   9653  C C   . ARG D 1 89  ? -8.734  13.752  58.475  1.00 60.03  ? 90   ARG D C   1 
ATOM   9654  O O   . ARG D 1 89  ? -7.907  12.881  58.738  1.00 81.55  ? 90   ARG D O   1 
ATOM   9655  C CB  . ARG D 1 89  ? -10.190 13.705  56.440  1.00 59.00  ? 90   ARG D CB  1 
ATOM   9656  C CG  . ARG D 1 89  ? -9.107  13.054  55.598  1.00 76.77  ? 90   ARG D CG  1 
ATOM   9657  C CD  . ARG D 1 89  ? -9.224  13.450  54.133  1.00 100.30 ? 90   ARG D CD  1 
ATOM   9658  N NE  . ARG D 1 89  ? -10.552 13.168  53.591  1.00 113.71 ? 90   ARG D NE  1 
ATOM   9659  C CZ  . ARG D 1 89  ? -11.425 14.100  53.221  1.00 114.18 ? 90   ARG D CZ  1 
ATOM   9660  N NH1 . ARG D 1 89  ? -11.111 15.384  53.323  1.00 109.01 ? 90   ARG D NH1 1 
ATOM   9661  N NH2 . ARG D 1 89  ? -12.610 13.749  52.741  1.00 114.24 ? 90   ARG D NH2 1 
ATOM   9662  N N   . ASP D 1 90  ? -8.500  15.050  58.650  1.00 39.00  ? 91   ASP D N   1 
ATOM   9663  C CA  . ASP D 1 90  ? -7.225  15.537  59.172  1.00 55.43  ? 91   ASP D CA  1 
ATOM   9664  C C   . ASP D 1 90  ? -6.934  15.002  60.574  1.00 64.10  ? 91   ASP D C   1 
ATOM   9665  O O   . ASP D 1 90  ? -5.851  14.457  60.830  1.00 59.56  ? 91   ASP D O   1 
ATOM   9666  C CB  . ASP D 1 90  ? -7.196  17.068  59.174  1.00 64.17  ? 91   ASP D CB  1 
ATOM   9667  C CG  . ASP D 1 90  ? -7.216  17.653  57.774  1.00 83.99  ? 91   ASP D CG  1 
ATOM   9668  O OD1 . ASP D 1 90  ? -7.513  16.902  56.820  1.00 87.89  ? 91   ASP D OD1 1 
ATOM   9669  O OD2 . ASP D 1 90  ? -6.940  18.863  57.627  1.00 84.22  ? 91   ASP D OD2 1 
ATOM   9670  N N   . SER D 1 91  ? -7.905  15.157  61.474  1.00 58.55  ? 92   SER D N   1 
ATOM   9671  C CA  . SER D 1 91  ? -7.762  14.681  62.851  1.00 58.43  ? 92   SER D CA  1 
ATOM   9672  C C   . SER D 1 91  ? -7.400  13.192  62.897  1.00 55.55  ? 92   SER D C   1 
ATOM   9673  O O   . SER D 1 91  ? -6.393  12.781  63.508  1.00 54.79  ? 92   SER D O   1 
ATOM   9674  C CB  . SER D 1 91  ? -9.060  14.933  63.624  1.00 41.03  ? 92   SER D CB  1 
ATOM   9675  O OG  . SER D 1 91  ? -8.935  14.560  64.985  1.00 54.31  ? 92   SER D OG  1 
ATOM   9676  N N   . SER D 1 92  ? -8.227  12.394  62.226  1.00 48.02  ? 93   SER D N   1 
ATOM   9677  C CA  . SER D 1 92  ? -8.026  10.955  62.153  1.00 50.56  ? 93   SER D CA  1 
ATOM   9678  C C   . SER D 1 92  ? -6.661  10.606  61.563  1.00 47.74  ? 93   SER D C   1 
ATOM   9679  O O   . SER D 1 92  ? -6.009  9.661   62.013  1.00 45.01  ? 93   SER D O   1 
ATOM   9680  C CB  . SER D 1 92  ? -9.142  10.303  61.336  1.00 48.22  ? 93   SER D CB  1 
ATOM   9681  O OG  . SER D 1 92  ? -8.997  8.894   61.316  1.00 57.65  ? 93   SER D OG  1 
ATOM   9682  N N   . ARG D 1 93  ? -6.232  11.373  60.563  1.00 44.18  ? 94   ARG D N   1 
ATOM   9683  C CA  . ARG D 1 93  ? -4.920  11.167  59.953  1.00 45.60  ? 94   ARG D CA  1 
ATOM   9684  C C   . ARG D 1 93  ? -3.788  11.390  60.952  1.00 40.13  ? 94   ARG D C   1 
ATOM   9685  O O   . ARG D 1 93  ? -2.846  10.595  61.018  1.00 49.41  ? 94   ARG D O   1 
ATOM   9686  C CB  . ARG D 1 93  ? -4.731  12.053  58.715  1.00 38.52  ? 94   ARG D CB  1 
ATOM   9687  C CG  . ARG D 1 93  ? -5.011  11.335  57.398  1.00 47.82  ? 94   ARG D CG  1 
ATOM   9688  C CD  . ARG D 1 93  ? -4.519  12.123  56.188  1.00 72.80  ? 94   ARG D CD  1 
ATOM   9689  N NE  . ARG D 1 93  ? -5.438  13.189  55.794  1.00 91.62  ? 94   ARG D NE  1 
ATOM   9690  C CZ  . ARG D 1 93  ? -5.227  14.483  56.013  1.00 91.24  ? 94   ARG D CZ  1 
ATOM   9691  N NH1 . ARG D 1 93  ? -4.121  14.885  56.625  1.00 80.15  ? 94   ARG D NH1 1 
ATOM   9692  N NH2 . ARG D 1 93  ? -6.121  15.377  55.615  1.00 88.25  ? 94   ARG D NH2 1 
ATOM   9693  N N   . VAL D 1 94  ? -3.881  12.465  61.731  1.00 29.32  ? 95   VAL D N   1 
ATOM   9694  C CA  . VAL D 1 94  ? -2.884  12.731  62.766  1.00 42.38  ? 95   VAL D CA  1 
ATOM   9695  C C   . VAL D 1 94  ? -2.806  11.561  63.748  1.00 45.01  ? 95   VAL D C   1 
ATOM   9696  O O   . VAL D 1 94  ? -1.712  11.052  64.055  1.00 51.94  ? 95   VAL D O   1 
ATOM   9697  C CB  . VAL D 1 94  ? -3.188  14.042  63.526  1.00 38.30  ? 95   VAL D CB  1 
ATOM   9698  C CG1 . VAL D 1 94  ? -2.292  14.178  64.748  1.00 25.02  ? 95   VAL D CG1 1 
ATOM   9699  C CG2 . VAL D 1 94  ? -3.023  15.240  62.605  1.00 20.51  ? 95   VAL D CG2 1 
ATOM   9700  N N   . LEU D 1 95  ? -3.973  11.123  64.218  1.00 37.02  ? 96   LEU D N   1 
ATOM   9701  C CA  . LEU D 1 95  ? -4.036  9.978   65.130  1.00 35.43  ? 96   LEU D CA  1 
ATOM   9702  C C   . LEU D 1 95  ? -3.380  8.716   64.552  1.00 42.18  ? 96   LEU D C   1 
ATOM   9703  O O   . LEU D 1 95  ? -2.585  8.036   65.226  1.00 40.78  ? 96   LEU D O   1 
ATOM   9704  C CB  . LEU D 1 95  ? -5.487  9.686   65.511  1.00 29.56  ? 96   LEU D CB  1 
ATOM   9705  C CG  . LEU D 1 95  ? -5.679  8.592   66.559  1.00 35.56  ? 96   LEU D CG  1 
ATOM   9706  C CD1 . LEU D 1 95  ? -4.814  8.866   67.775  1.00 32.95  ? 96   LEU D CD1 1 
ATOM   9707  C CD2 . LEU D 1 95  ? -7.135  8.499   66.957  1.00 33.75  ? 96   LEU D CD2 1 
ATOM   9708  N N   . GLN D 1 96  ? -3.713  8.414   63.299  1.00 38.44  ? 97   GLN D N   1 
ATOM   9709  C CA  . GLN D 1 96  ? -3.152  7.255   62.612  1.00 58.05  ? 97   GLN D CA  1 
ATOM   9710  C C   . GLN D 1 96  ? -1.636  7.353   62.508  1.00 64.74  ? 97   GLN D C   1 
ATOM   9711  O O   . GLN D 1 96  ? -0.933  6.357   62.680  1.00 57.65  ? 97   GLN D O   1 
ATOM   9712  C CB  . GLN D 1 96  ? -3.758  7.100   61.215  1.00 70.07  ? 97   GLN D CB  1 
ATOM   9713  C CG  . GLN D 1 96  ? -5.207  6.647   61.210  1.00 81.15  ? 97   GLN D CG  1 
ATOM   9714  C CD  . GLN D 1 96  ? -5.704  6.311   59.818  1.00 89.22  ? 97   GLN D CD  1 
ATOM   9715  O OE1 . GLN D 1 96  ? -5.272  5.330   59.211  1.00 85.53  ? 97   GLN D OE1 1 
ATOM   9716  N NE2 . GLN D 1 96  ? -6.617  7.126   59.303  1.00 87.58  ? 97   GLN D NE2 1 
ATOM   9717  N N   . ALA D 1 97  ? -1.141  8.555   62.224  1.00 65.53  ? 98   ALA D N   1 
ATOM   9718  C CA  . ALA D 1 97  ? 0.296   8.790   62.130  1.00 59.69  ? 98   ALA D CA  1 
ATOM   9719  C C   . ALA D 1 97  ? 0.984   8.490   63.458  1.00 54.14  ? 98   ALA D C   1 
ATOM   9720  O O   . ALA D 1 97  ? 2.010   7.798   63.495  1.00 63.57  ? 98   ALA D O   1 
ATOM   9721  C CB  . ALA D 1 97  ? 0.574   10.219  61.699  1.00 66.41  ? 98   ALA D CB  1 
ATOM   9722  N N   . MET D 1 98  ? 0.413   9.008   64.544  1.00 45.56  ? 99   MET D N   1 
ATOM   9723  C CA  . MET D 1 98  ? 0.952   8.744   65.879  1.00 44.77  ? 99   MET D CA  1 
ATOM   9724  C C   . MET D 1 98  ? 1.020   7.242   66.177  1.00 60.39  ? 99   MET D C   1 
ATOM   9725  O O   . MET D 1 98  ? 2.095   6.701   66.502  1.00 72.80  ? 99   MET D O   1 
ATOM   9726  C CB  . MET D 1 98  ? 0.119   9.464   66.946  1.00 32.07  ? 99   MET D CB  1 
ATOM   9727  C CG  . MET D 1 98  ? 0.693   9.391   68.360  1.00 33.69  ? 99   MET D CG  1 
ATOM   9728  S SD  . MET D 1 98  ? 0.230   7.912   69.289  1.00 54.81  ? 99   MET D SD  1 
ATOM   9729  C CE  . MET D 1 98  ? -1.499  8.237   69.620  1.00 46.86  ? 99   MET D CE  1 
ATOM   9730  N N   . LEU D 1 99  ? -0.127  6.574   66.063  1.00 46.06  ? 100  LEU D N   1 
ATOM   9731  C CA  . LEU D 1 99  ? -0.196  5.139   66.341  1.00 40.27  ? 100  LEU D CA  1 
ATOM   9732  C C   . LEU D 1 99  ? 0.781   4.332   65.484  1.00 41.21  ? 100  LEU D C   1 
ATOM   9733  O O   . LEU D 1 99  ? 1.435   3.411   65.977  1.00 45.71  ? 100  LEU D O   1 
ATOM   9734  C CB  . LEU D 1 99  ? -1.623  4.615   66.163  1.00 36.27  ? 100  LEU D CB  1 
ATOM   9735  C CG  . LEU D 1 99  ? -2.634  5.055   67.224  1.00 38.65  ? 100  LEU D CG  1 
ATOM   9736  C CD1 . LEU D 1 99  ? -4.037  4.593   66.861  1.00 35.50  ? 100  LEU D CD1 1 
ATOM   9737  C CD2 . LEU D 1 99  ? -2.237  4.539   68.602  1.00 22.80  ? 100  LEU D CD2 1 
ATOM   9738  N N   . ALA D 1 100 ? 0.883   4.691   64.206  1.00 30.35  ? 101  ALA D N   1 
ATOM   9739  C CA  . ALA D 1 100 ? 1.805   4.026   63.290  1.00 37.26  ? 101  ALA D CA  1 
ATOM   9740  C C   . ALA D 1 100 ? 3.250   4.177   63.756  1.00 58.34  ? 101  ALA D C   1 
ATOM   9741  O O   . ALA D 1 100 ? 4.006   3.199   63.794  1.00 72.81  ? 101  ALA D O   1 
ATOM   9742  C CB  . ALA D 1 100 ? 1.643   4.572   61.881  1.00 14.12  ? 101  ALA D CB  1 
ATOM   9743  N N   . THR D 1 101 ? 3.626   5.406   64.107  1.00 46.82  ? 102  THR D N   1 
ATOM   9744  C CA  . THR D 1 101 ? 4.966   5.673   64.626  1.00 51.54  ? 102  THR D CA  1 
ATOM   9745  C C   . THR D 1 101 ? 5.283   4.794   65.835  1.00 54.82  ? 102  THR D C   1 
ATOM   9746  O O   . THR D 1 101 ? 6.323   4.123   65.872  1.00 56.47  ? 102  THR D O   1 
ATOM   9747  C CB  . THR D 1 101 ? 5.146   7.156   65.002  1.00 34.89  ? 102  THR D CB  1 
ATOM   9748  O OG1 . THR D 1 101 ? 5.178   7.948   63.809  1.00 39.71  ? 102  THR D OG1 1 
ATOM   9749  C CG2 . THR D 1 101 ? 6.442   7.361   65.769  1.00 26.05  ? 102  THR D CG2 1 
ATOM   9750  N N   . GLN D 1 102 ? 4.378   4.790   66.813  1.00 53.93  ? 103  GLN D N   1 
ATOM   9751  C CA  . GLN D 1 102 ? 4.552   3.954   68.003  1.00 46.41  ? 103  GLN D CA  1 
ATOM   9752  C C   . GLN D 1 102 ? 4.741   2.480   67.635  1.00 49.89  ? 103  GLN D C   1 
ATOM   9753  O O   . GLN D 1 102 ? 5.652   1.799   68.141  1.00 52.07  ? 103  GLN D O   1 
ATOM   9754  C CB  . GLN D 1 102 ? 3.353   4.107   68.941  1.00 39.74  ? 103  GLN D CB  1 
ATOM   9755  C CG  . GLN D 1 102 ? 3.171   5.509   69.496  1.00 49.69  ? 103  GLN D CG  1 
ATOM   9756  C CD  . GLN D 1 102 ? 4.315   5.931   70.396  1.00 62.29  ? 103  GLN D CD  1 
ATOM   9757  O OE1 . GLN D 1 102 ? 4.880   5.116   71.125  1.00 72.63  ? 103  GLN D OE1 1 
ATOM   9758  N NE2 . GLN D 1 102 ? 4.667   7.211   70.344  1.00 50.32  ? 103  GLN D NE2 1 
ATOM   9759  N N   . LEU D 1 103 ? 3.876   2.005   66.741  1.00 53.19  ? 104  LEU D N   1 
ATOM   9760  C CA  . LEU D 1 103 ? 3.889   0.619   66.291  1.00 51.29  ? 104  LEU D CA  1 
ATOM   9761  C C   . LEU D 1 103 ? 5.248   0.231   65.723  1.00 52.36  ? 104  LEU D C   1 
ATOM   9762  O O   . LEU D 1 103 ? 5.890   -0.716  66.199  1.00 61.79  ? 104  LEU D O   1 
ATOM   9763  C CB  . LEU D 1 103 ? 2.810   0.407   65.227  1.00 54.19  ? 104  LEU D CB  1 
ATOM   9764  C CG  . LEU D 1 103 ? 2.608   -1.035  64.768  1.00 49.58  ? 104  LEU D CG  1 
ATOM   9765  C CD1 . LEU D 1 103 ? 2.301   -1.888  65.969  1.00 51.93  ? 104  LEU D CD1 1 
ATOM   9766  C CD2 . LEU D 1 103 ? 1.494   -1.148  63.738  1.00 39.80  ? 104  LEU D CD2 1 
ATOM   9767  N N   . ARG D 1 104 ? 5.681   0.977   64.710  1.00 45.09  ? 105  ARG D N   1 
ATOM   9768  C CA  . ARG D 1 104 ? 6.971   0.739   64.072  1.00 33.37  ? 105  ARG D CA  1 
ATOM   9769  C C   . ARG D 1 104 ? 8.102   0.759   65.095  1.00 39.59  ? 105  ARG D C   1 
ATOM   9770  O O   . ARG D 1 104 ? 8.965   -0.124  65.090  1.00 48.79  ? 105  ARG D O   1 
ATOM   9771  C CB  . ARG D 1 104 ? 7.223   1.769   62.969  1.00 40.18  ? 105  ARG D CB  1 
ATOM   9772  C CG  . ARG D 1 104 ? 8.563   1.620   62.265  1.00 73.42  ? 105  ARG D CG  1 
ATOM   9773  C CD  . ARG D 1 104 ? 8.582   2.393   60.954  1.00 97.62  ? 105  ARG D CD  1 
ATOM   9774  N NE  . ARG D 1 104 ? 8.208   3.793   61.132  1.00 110.44 ? 105  ARG D NE  1 
ATOM   9775  C CZ  . ARG D 1 104 ? 9.073   4.803   61.159  1.00 113.02 ? 105  ARG D CZ  1 
ATOM   9776  N NH1 . ARG D 1 104 ? 10.370  4.573   61.013  1.00 115.59 ? 105  ARG D NH1 1 
ATOM   9777  N NH2 . ARG D 1 104 ? 8.638   6.044   61.328  1.00 114.30 ? 105  ARG D NH2 1 
ATOM   9778  N N   . SER D 1 105 ? 8.077   1.756   65.978  1.00 32.24  ? 106  SER D N   1 
ATOM   9779  C CA  . SER D 1 105 ? 9.079   1.880   67.038  1.00 39.49  ? 106  SER D CA  1 
ATOM   9780  C C   . SER D 1 105 ? 9.221   0.607   67.869  1.00 48.13  ? 106  SER D C   1 
ATOM   9781  O O   . SER D 1 105 ? 10.281  -0.034  67.865  1.00 65.31  ? 106  SER D O   1 
ATOM   9782  C CB  . SER D 1 105 ? 8.758   3.063   67.956  1.00 36.46  ? 106  SER D CB  1 
ATOM   9783  O OG  . SER D 1 105 ? 8.845   4.292   67.258  1.00 43.68  ? 106  SER D OG  1 
ATOM   9784  N N   . PHE D 1 106 ? 8.157   0.240   68.578  1.00 34.02  ? 107  PHE D N   1 
ATOM   9785  C CA  . PHE D 1 106 ? 8.223   -0.926  69.459  1.00 31.83  ? 107  PHE D CA  1 
ATOM   9786  C C   . PHE D 1 106 ? 8.520   -2.228  68.714  1.00 35.89  ? 107  PHE D C   1 
ATOM   9787  O O   . PHE D 1 106 ? 9.335   -3.039  69.170  1.00 36.79  ? 107  PHE D O   1 
ATOM   9788  C CB  . PHE D 1 106 ? 6.946   -1.059  70.288  1.00 34.77  ? 107  PHE D CB  1 
ATOM   9789  C CG  . PHE D 1 106 ? 6.871   -0.096  71.434  1.00 33.03  ? 107  PHE D CG  1 
ATOM   9790  C CD1 . PHE D 1 106 ? 6.330   1.166   71.262  1.00 20.91  ? 107  PHE D CD1 1 
ATOM   9791  C CD2 . PHE D 1 106 ? 7.344   -0.453  72.685  1.00 31.20  ? 107  PHE D CD2 1 
ATOM   9792  C CE1 . PHE D 1 106 ? 6.260   2.052   72.318  1.00 33.44  ? 107  PHE D CE1 1 
ATOM   9793  C CE2 . PHE D 1 106 ? 7.277   0.429   73.745  1.00 23.54  ? 107  PHE D CE2 1 
ATOM   9794  C CZ  . PHE D 1 106 ? 6.734   1.683   73.561  1.00 25.13  ? 107  PHE D CZ  1 
ATOM   9795  N N   . ASP D 1 107 ? 7.870   -2.421  67.569  1.00 43.52  ? 108  ASP D N   1 
ATOM   9796  C CA  . ASP D 1 107 ? 8.078   -3.633  66.781  1.00 52.18  ? 108  ASP D CA  1 
ATOM   9797  C C   . ASP D 1 107 ? 9.547   -3.788  66.381  1.00 52.66  ? 108  ASP D C   1 
ATOM   9798  O O   . ASP D 1 107 ? 10.174  -4.832  66.630  1.00 74.39  ? 108  ASP D O   1 
ATOM   9799  C CB  . ASP D 1 107 ? 7.185   -3.621  65.538  1.00 55.34  ? 108  ASP D CB  1 
ATOM   9800  C CG  . ASP D 1 107 ? 7.238   -4.925  64.769  1.00 56.52  ? 108  ASP D CG  1 
ATOM   9801  O OD1 . ASP D 1 107 ? 7.339   -5.991  65.411  1.00 62.47  ? 108  ASP D OD1 1 
ATOM   9802  O OD2 . ASP D 1 107 ? 7.180   -4.884  63.522  1.00 56.51  ? 108  ASP D OD2 1 
ATOM   9803  N N   . ASP D 1 108 ? 10.094  -2.737  65.776  1.00 47.60  ? 109  ASP D N   1 
ATOM   9804  C CA  . ASP D 1 108 ? 11.496  -2.737  65.374  1.00 49.28  ? 109  ASP D CA  1 
ATOM   9805  C C   . ASP D 1 108 ? 12.429  -2.927  66.564  1.00 46.11  ? 109  ASP D C   1 
ATOM   9806  O O   . ASP D 1 108 ? 13.479  -3.553  66.433  1.00 66.25  ? 109  ASP D O   1 
ATOM   9807  C CB  . ASP D 1 108 ? 11.856  -1.459  64.613  1.00 36.51  ? 109  ASP D CB  1 
ATOM   9808  C CG  . ASP D 1 108 ? 11.338  -1.466  63.192  1.00 58.28  ? 109  ASP D CG  1 
ATOM   9809  O OD1 . ASP D 1 108 ? 11.046  -2.564  62.672  1.00 57.97  ? 109  ASP D OD1 1 
ATOM   9810  O OD2 . ASP D 1 108 ? 11.228  -0.376  62.593  1.00 70.08  ? 109  ASP D OD2 1 
ATOM   9811  N N   . HIS D 1 109 ? 12.047  -2.392  67.720  1.00 31.81  ? 110  HIS D N   1 
ATOM   9812  C CA  . HIS D 1 109 ? 12.849  -2.579  68.925  1.00 31.91  ? 110  HIS D CA  1 
ATOM   9813  C C   . HIS D 1 109 ? 12.902  -4.046  69.354  1.00 47.17  ? 110  HIS D C   1 
ATOM   9814  O O   . HIS D 1 109 ? 13.969  -4.564  69.684  1.00 49.81  ? 110  HIS D O   1 
ATOM   9815  C CB  . HIS D 1 109 ? 12.329  -1.720  70.076  1.00 32.13  ? 110  HIS D CB  1 
ATOM   9816  C CG  . HIS D 1 109 ? 13.163  -1.814  71.315  1.00 37.05  ? 110  HIS D CG  1 
ATOM   9817  N ND1 . HIS D 1 109 ? 14.522  -1.582  71.313  1.00 30.00  ? 110  HIS D ND1 1 
ATOM   9818  C CD2 . HIS D 1 109 ? 12.836  -2.121  72.592  1.00 37.92  ? 110  HIS D CD2 1 
ATOM   9819  C CE1 . HIS D 1 109 ? 14.995  -1.738  72.536  1.00 45.19  ? 110  HIS D CE1 1 
ATOM   9820  N NE2 . HIS D 1 109 ? 13.992  -2.066  73.331  1.00 46.83  ? 110  HIS D NE2 1 
ATOM   9821  N N   . PHE D 1 110 ? 11.750  -4.710  69.358  1.00 41.77  ? 111  PHE D N   1 
ATOM   9822  C CA  . PHE D 1 110 ? 11.696  -6.118  69.750  1.00 41.15  ? 111  PHE D CA  1 
ATOM   9823  C C   . PHE D 1 110 ? 12.483  -6.997  68.780  1.00 48.94  ? 111  PHE D C   1 
ATOM   9824  O O   . PHE D 1 110 ? 13.292  -7.850  69.196  1.00 58.67  ? 111  PHE D O   1 
ATOM   9825  C CB  . PHE D 1 110 ? 10.245  -6.587  69.860  1.00 20.53  ? 111  PHE D CB  1 
ATOM   9826  C CG  . PHE D 1 110 ? 9.465   -5.871  70.921  1.00 23.31  ? 111  PHE D CG  1 
ATOM   9827  C CD1 . PHE D 1 110 ? 10.071  -5.518  72.114  1.00 33.42  ? 111  PHE D CD1 1 
ATOM   9828  C CD2 . PHE D 1 110 ? 8.138   -5.536  70.723  1.00 17.13  ? 111  PHE D CD2 1 
ATOM   9829  C CE1 . PHE D 1 110 ? 9.367   -4.854  73.096  1.00 32.77  ? 111  PHE D CE1 1 
ATOM   9830  C CE2 . PHE D 1 110 ? 7.428   -4.868  71.702  1.00 35.28  ? 111  PHE D CE2 1 
ATOM   9831  C CZ  . PHE D 1 110 ? 8.044   -4.528  72.891  1.00 28.30  ? 111  PHE D CZ  1 
ATOM   9832  N N   . GLN D 1 111 ? 12.253  -6.776  67.488  1.00 37.23  ? 112  GLN D N   1 
ATOM   9833  C CA  . GLN D 1 111 ? 13.015  -7.478  66.461  1.00 55.03  ? 112  GLN D CA  1 
ATOM   9834  C C   . GLN D 1 111 ? 14.516  -7.265  66.664  1.00 65.34  ? 112  GLN D C   1 
ATOM   9835  O O   . GLN D 1 111 ? 15.312  -8.203  66.543  1.00 63.75  ? 112  GLN D O   1 
ATOM   9836  C CB  . GLN D 1 111 ? 12.591  -7.019  65.065  1.00 45.41  ? 112  GLN D CB  1 
ATOM   9837  C CG  . GLN D 1 111 ? 11.159  -7.388  64.705  1.00 51.18  ? 112  GLN D CG  1 
ATOM   9838  C CD  . GLN D 1 111 ? 10.806  -7.031  63.273  1.00 64.59  ? 112  GLN D CD  1 
ATOM   9839  O OE1 . GLN D 1 111 ? 11.464  -6.200  62.647  1.00 73.69  ? 112  GLN D OE1 1 
ATOM   9840  N NE2 . GLN D 1 111 ? 9.765   -7.664  62.745  1.00 65.48  ? 112  GLN D NE2 1 
ATOM   9841  N N   . HIS D 1 112 ? 14.888  -6.031  66.997  1.00 60.41  ? 113  HIS D N   1 
ATOM   9842  C CA  . HIS D 1 112 ? 16.281  -5.692  67.265  1.00 57.05  ? 113  HIS D CA  1 
ATOM   9843  C C   . HIS D 1 112 ? 16.830  -6.450  68.464  1.00 56.05  ? 113  HIS D C   1 
ATOM   9844  O O   . HIS D 1 112 ? 17.979  -6.873  68.457  1.00 66.45  ? 113  HIS D O   1 
ATOM   9845  C CB  . HIS D 1 112 ? 16.446  -4.190  67.493  1.00 53.68  ? 113  HIS D CB  1 
ATOM   9846  C CG  . HIS D 1 112 ? 17.100  -3.474  66.353  1.00 69.96  ? 113  HIS D CG  1 
ATOM   9847  N ND1 . HIS D 1 112 ? 16.403  -3.048  65.243  1.00 77.00  ? 113  HIS D ND1 1 
ATOM   9848  C CD2 . HIS D 1 112 ? 18.389  -3.112  66.151  1.00 83.77  ? 113  HIS D CD2 1 
ATOM   9849  C CE1 . HIS D 1 112 ? 17.234  -2.452  64.407  1.00 84.20  ? 113  HIS D CE1 1 
ATOM   9850  N NE2 . HIS D 1 112 ? 18.445  -2.478  64.934  1.00 91.42  ? 113  HIS D NE2 1 
ATOM   9851  N N   . LEU D 1 113 ? 16.011  -6.611  69.497  1.00 36.16  ? 114  LEU D N   1 
ATOM   9852  C CA  . LEU D 1 113 ? 16.426  -7.348  70.685  1.00 36.22  ? 114  LEU D CA  1 
ATOM   9853  C C   . LEU D 1 113 ? 16.726  -8.801  70.337  1.00 52.34  ? 114  LEU D C   1 
ATOM   9854  O O   . LEU D 1 113 ? 17.779  -9.343  70.710  1.00 46.41  ? 114  LEU D O   1 
ATOM   9855  C CB  . LEU D 1 113 ? 15.347  -7.270  71.766  1.00 47.48  ? 114  LEU D CB  1 
ATOM   9856  C CG  . LEU D 1 113 ? 15.612  -6.318  72.933  1.00 51.41  ? 114  LEU D CG  1 
ATOM   9857  C CD1 . LEU D 1 113 ? 16.148  -4.989  72.435  1.00 52.19  ? 114  LEU D CD1 1 
ATOM   9858  C CD2 . LEU D 1 113 ? 14.339  -6.114  73.736  1.00 55.98  ? 114  LEU D CD2 1 
ATOM   9859  N N   . LEU D 1 114 ? 15.808  -9.431  69.609  1.00 57.38  ? 115  LEU D N   1 
ATOM   9860  C CA  . LEU D 1 114 ? 16.019  -10.823 69.222  1.00 48.70  ? 115  LEU D CA  1 
ATOM   9861  C C   . LEU D 1 114 ? 17.260  -10.982 68.339  1.00 45.62  ? 115  LEU D C   1 
ATOM   9862  O O   . LEU D 1 114 ? 18.109  -11.843 68.597  1.00 50.42  ? 115  LEU D O   1 
ATOM   9863  C CB  . LEU D 1 114 ? 14.785  -11.399 68.527  1.00 47.42  ? 115  LEU D CB  1 
ATOM   9864  C CG  . LEU D 1 114 ? 14.768  -12.923 68.391  1.00 41.81  ? 115  LEU D CG  1 
ATOM   9865  C CD1 . LEU D 1 114 ? 14.984  -13.582 69.745  1.00 36.05  ? 115  LEU D CD1 1 
ATOM   9866  C CD2 . LEU D 1 114 ? 13.464  -13.395 67.776  1.00 44.58  ? 115  LEU D CD2 1 
ATOM   9867  N N   . ASN D 1 115 ? 17.372  -10.146 67.309  1.00 33.69  ? 116  ASN D N   1 
ATOM   9868  C CA  . ASN D 1 115 ? 18.535  -10.193 66.420  1.00 43.84  ? 116  ASN D CA  1 
ATOM   9869  C C   . ASN D 1 115 ? 19.854  -9.905  67.144  1.00 51.14  ? 116  ASN D C   1 
ATOM   9870  O O   . ASN D 1 115 ? 20.913  -10.412 66.760  1.00 44.68  ? 116  ASN D O   1 
ATOM   9871  C CB  . ASN D 1 115 ? 18.355  -9.242  65.234  1.00 43.62  ? 116  ASN D CB  1 
ATOM   9872  C CG  . ASN D 1 115 ? 17.307  -9.728  64.249  1.00 48.46  ? 116  ASN D CG  1 
ATOM   9873  O OD1 . ASN D 1 115 ? 16.328  -10.368 64.634  1.00 56.34  ? 116  ASN D OD1 1 
ATOM   9874  N ND2 . ASN D 1 115 ? 17.518  -9.436  62.968  1.00 60.23  ? 116  ASN D ND2 1 
ATOM   9875  N N   . ASP D 1 116 ? 19.775  -9.093  68.193  1.00 54.61  ? 117  ASP D N   1 
ATOM   9876  C CA  . ASP D 1 116 ? 20.924  -8.799  69.040  1.00 57.94  ? 117  ASP D CA  1 
ATOM   9877  C C   . ASP D 1 116 ? 21.332  -10.046 69.796  1.00 59.50  ? 117  ASP D C   1 
ATOM   9878  O O   . ASP D 1 116 ? 22.522  -10.339 69.931  1.00 66.21  ? 117  ASP D O   1 
ATOM   9879  C CB  . ASP D 1 116 ? 20.595  -7.688  70.037  1.00 58.28  ? 117  ASP D CB  1 
ATOM   9880  C CG  . ASP D 1 116 ? 21.052  -6.326  69.563  1.00 59.61  ? 117  ASP D CG  1 
ATOM   9881  O OD1 . ASP D 1 116 ? 21.306  -6.169  68.350  1.00 58.72  ? 117  ASP D OD1 1 
ATOM   9882  O OD2 . ASP D 1 116 ? 21.154  -5.409  70.406  1.00 67.63  ? 117  ASP D OD2 1 
ATOM   9883  N N   . SER D 1 117 ? 20.338  -10.774 70.300  1.00 59.98  ? 118  SER D N   1 
ATOM   9884  C CA  . SER D 1 117 ? 20.611  -12.032 70.982  1.00 56.15  ? 118  SER D CA  1 
ATOM   9885  C C   . SER D 1 117 ? 21.268  -13.031 70.034  1.00 52.95  ? 118  SER D C   1 
ATOM   9886  O O   . SER D 1 117 ? 22.229  -13.709 70.404  1.00 45.32  ? 118  SER D O   1 
ATOM   9887  C CB  . SER D 1 117 ? 19.332  -12.627 71.571  1.00 56.93  ? 118  SER D CB  1 
ATOM   9888  O OG  . SER D 1 117 ? 19.612  -13.821 72.280  1.00 51.96  ? 118  SER D OG  1 
ATOM   9889  N N   . GLU D 1 118 ? 20.759  -13.113 68.807  1.00 46.82  ? 119  GLU D N   1 
ATOM   9890  C CA  . GLU D 1 118 ? 21.311  -14.054 67.834  1.00 48.18  ? 119  GLU D CA  1 
ATOM   9891  C C   . GLU D 1 118 ? 22.741  -13.689 67.430  1.00 57.77  ? 119  GLU D C   1 
ATOM   9892  O O   . GLU D 1 118 ? 23.595  -14.566 67.290  1.00 60.36  ? 119  GLU D O   1 
ATOM   9893  C CB  . GLU D 1 118 ? 20.419  -14.160 66.596  1.00 46.19  ? 119  GLU D CB  1 
ATOM   9894  C CG  . GLU D 1 118 ? 20.637  -15.440 65.799  1.00 51.58  ? 119  GLU D CG  1 
ATOM   9895  C CD  . GLU D 1 118 ? 19.923  -15.429 64.461  1.00 68.07  ? 119  GLU D CD  1 
ATOM   9896  O OE1 . GLU D 1 118 ? 20.023  -14.413 63.742  1.00 77.10  ? 119  GLU D OE1 1 
ATOM   9897  O OE2 . GLU D 1 118 ? 19.261  -16.435 64.128  1.00 69.87  ? 119  GLU D OE2 1 
ATOM   9898  N N   . ARG D 1 119 ? 22.999  -12.397 67.243  1.00 74.72  ? 120  ARG D N   1 
ATOM   9899  C CA  . ARG D 1 119 ? 24.348  -11.930 66.928  1.00 61.34  ? 120  ARG D CA  1 
ATOM   9900  C C   . ARG D 1 119 ? 25.314  -12.235 68.066  1.00 56.62  ? 120  ARG D C   1 
ATOM   9901  O O   . ARG D 1 119 ? 26.417  -12.743 67.841  1.00 52.65  ? 120  ARG D O   1 
ATOM   9902  C CB  . ARG D 1 119 ? 24.352  -10.431 66.629  1.00 56.30  ? 120  ARG D CB  1 
ATOM   9903  C CG  . ARG D 1 119 ? 24.199  -10.089 65.158  1.00 66.59  ? 120  ARG D CG  1 
ATOM   9904  C CD  . ARG D 1 119 ? 24.288  -8.588  64.935  1.00 76.83  ? 120  ARG D CD  1 
ATOM   9905  N NE  . ARG D 1 119 ? 23.166  -7.881  65.543  1.00 76.96  ? 120  ARG D NE  1 
ATOM   9906  C CZ  . ARG D 1 119 ? 22.031  -7.605  64.911  1.00 69.39  ? 120  ARG D CZ  1 
ATOM   9907  N NH1 . ARG D 1 119 ? 21.868  -7.973  63.647  1.00 58.17  ? 120  ARG D NH1 1 
ATOM   9908  N NH2 . ARG D 1 119 ? 21.059  -6.958  65.539  1.00 75.47  ? 120  ARG D NH2 1 
ATOM   9909  N N   . THR D 1 120 ? 24.889  -11.916 69.286  1.00 52.93  ? 121  THR D N   1 
ATOM   9910  C CA  . THR D 1 120 ? 25.682  -12.198 70.475  1.00 45.58  ? 121  THR D CA  1 
ATOM   9911  C C   . THR D 1 120 ? 25.990  -13.687 70.554  1.00 57.53  ? 121  THR D C   1 
ATOM   9912  O O   . THR D 1 120 ? 27.094  -14.078 70.923  1.00 56.80  ? 121  THR D O   1 
ATOM   9913  C CB  . THR D 1 120 ? 24.956  -11.752 71.758  1.00 47.68  ? 121  THR D CB  1 
ATOM   9914  O OG1 . THR D 1 120 ? 24.663  -10.352 71.679  1.00 46.28  ? 121  THR D OG1 1 
ATOM   9915  C CG2 . THR D 1 120 ? 25.818  -12.015 72.985  1.00 48.48  ? 121  THR D CG2 1 
ATOM   9916  N N   . LEU D 1 121 ? 25.015  -14.513 70.187  1.00 78.49  ? 122  LEU D N   1 
ATOM   9917  C CA  . LEU D 1 121 ? 25.211  -15.960 70.161  1.00 82.32  ? 122  LEU D CA  1 
ATOM   9918  C C   . LEU D 1 121 ? 26.267  -16.360 69.133  1.00 70.81  ? 122  LEU D C   1 
ATOM   9919  O O   . LEU D 1 121 ? 27.187  -17.116 69.441  1.00 75.71  ? 122  LEU D O   1 
ATOM   9920  C CB  . LEU D 1 121 ? 23.888  -16.681 69.879  1.00 73.65  ? 122  LEU D CB  1 
ATOM   9921  C CG  . LEU D 1 121 ? 23.898  -18.213 69.854  1.00 64.84  ? 122  LEU D CG  1 
ATOM   9922  C CD1 . LEU D 1 121 ? 22.631  -18.765 70.490  1.00 58.14  ? 122  LEU D CD1 1 
ATOM   9923  C CD2 . LEU D 1 121 ? 24.039  -18.732 68.431  1.00 69.45  ? 122  LEU D CD2 1 
ATOM   9924  N N   . GLN D 1 122 ? 26.132  -15.845 67.914  1.00 59.27  ? 123  GLN D N   1 
ATOM   9925  C CA  . GLN D 1 122 ? 27.067  -16.166 66.838  1.00 59.99  ? 123  GLN D CA  1 
ATOM   9926  C C   . GLN D 1 122 ? 28.502  -15.737 67.149  1.00 71.70  ? 123  GLN D C   1 
ATOM   9927  O O   . GLN D 1 122 ? 29.456  -16.397 66.736  1.00 75.35  ? 123  GLN D O   1 
ATOM   9928  C CB  . GLN D 1 122 ? 26.609  -15.539 65.518  1.00 54.59  ? 123  GLN D CB  1 
ATOM   9929  C CG  . GLN D 1 122 ? 25.334  -16.143 64.952  1.00 60.71  ? 123  GLN D CG  1 
ATOM   9930  C CD  . GLN D 1 122 ? 24.930  -15.519 63.629  1.00 73.44  ? 123  GLN D CD  1 
ATOM   9931  O OE1 . GLN D 1 122 ? 25.493  -14.508 63.209  1.00 84.86  ? 123  GLN D OE1 1 
ATOM   9932  N NE2 . GLN D 1 122 ? 23.953  -16.123 62.963  1.00 69.20  ? 123  GLN D NE2 1 
ATOM   9933  N N   . ALA D 1 123 ? 28.652  -14.630 67.871  1.00 72.41  ? 124  ALA D N   1 
ATOM   9934  C CA  . ALA D 1 123 ? 29.976  -14.137 68.240  1.00 59.85  ? 124  ALA D CA  1 
ATOM   9935  C C   . ALA D 1 123 ? 30.561  -14.891 69.434  1.00 62.49  ? 124  ALA D C   1 
ATOM   9936  O O   . ALA D 1 123 ? 31.763  -15.150 69.487  1.00 66.64  ? 124  ALA D O   1 
ATOM   9937  C CB  . ALA D 1 123 ? 29.925  -12.644 68.528  1.00 57.94  ? 124  ALA D CB  1 
ATOM   9938  N N   . THR D 1 124 ? 29.702  -15.225 70.393  1.00 65.56  ? 125  THR D N   1 
ATOM   9939  C CA  . THR D 1 124 ? 30.119  -15.862 71.643  1.00 63.02  ? 125  THR D CA  1 
ATOM   9940  C C   . THR D 1 124 ? 30.388  -17.371 71.551  1.00 72.91  ? 125  THR D C   1 
ATOM   9941  O O   . THR D 1 124 ? 31.409  -17.854 72.044  1.00 76.19  ? 125  THR D O   1 
ATOM   9942  C CB  . THR D 1 124 ? 29.099  -15.564 72.778  1.00 71.49  ? 125  THR D CB  1 
ATOM   9943  O OG1 . THR D 1 124 ? 29.544  -14.434 73.537  1.00 73.44  ? 125  THR D OG1 1 
ATOM   9944  C CG2 . THR D 1 124 ? 28.925  -16.752 73.709  1.00 74.02  ? 125  THR D CG2 1 
ATOM   9945  N N   . PHE D 1 125 ? 29.481  -18.102 70.909  1.00 72.19  ? 126  PHE D N   1 
ATOM   9946  C CA  . PHE D 1 125 ? 29.481  -19.570 70.974  1.00 70.37  ? 126  PHE D CA  1 
ATOM   9947  C C   . PHE D 1 125 ? 30.719  -20.321 70.442  1.00 70.58  ? 126  PHE D C   1 
ATOM   9948  O O   . PHE D 1 125 ? 31.197  -21.240 71.108  1.00 62.18  ? 126  PHE D O   1 
ATOM   9949  C CB  . PHE D 1 125 ? 28.191  -20.157 70.378  1.00 56.65  ? 126  PHE D CB  1 
ATOM   9950  C CG  . PHE D 1 125 ? 27.019  -20.152 71.328  1.00 62.59  ? 126  PHE D CG  1 
ATOM   9951  C CD1 . PHE D 1 125 ? 26.965  -19.265 72.389  1.00 61.97  ? 126  PHE D CD1 1 
ATOM   9952  C CD2 . PHE D 1 125 ? 25.975  -21.048 71.163  1.00 74.25  ? 126  PHE D CD2 1 
ATOM   9953  C CE1 . PHE D 1 125 ? 25.890  -19.263 73.261  1.00 52.25  ? 126  PHE D CE1 1 
ATOM   9954  C CE2 . PHE D 1 125 ? 24.898  -21.053 72.032  1.00 71.08  ? 126  PHE D CE2 1 
ATOM   9955  C CZ  . PHE D 1 125 ? 24.856  -20.159 73.081  1.00 56.01  ? 126  PHE D CZ  1 
ATOM   9956  N N   . PRO D 1 126 ? 31.233  -19.955 69.249  1.00 70.30  ? 127  PRO D N   1 
ATOM   9957  C CA  . PRO D 1 126 ? 32.394  -20.690 68.724  1.00 68.02  ? 127  PRO D CA  1 
ATOM   9958  C C   . PRO D 1 126 ? 33.602  -20.697 69.663  1.00 64.11  ? 127  PRO D C   1 
ATOM   9959  O O   . PRO D 1 126 ? 34.408  -21.625 69.612  1.00 70.57  ? 127  PRO D O   1 
ATOM   9960  C CB  . PRO D 1 126 ? 32.734  -19.931 67.440  1.00 72.10  ? 127  PRO D CB  1 
ATOM   9961  C CG  . PRO D 1 126 ? 31.442  -19.348 67.007  1.00 67.04  ? 127  PRO D CG  1 
ATOM   9962  C CD  . PRO D 1 126 ? 30.737  -18.965 68.274  1.00 63.06  ? 127  PRO D CD  1 
ATOM   9963  N N   . GLY D 1 127 ? 33.734  -19.666 70.489  1.00 68.35  ? 128  GLY D N   1 
ATOM   9964  C CA  . GLY D 1 127 ? 34.773  -19.635 71.502  1.00 66.51  ? 128  GLY D CA  1 
ATOM   9965  C C   . GLY D 1 127 ? 34.446  -20.501 72.704  1.00 69.18  ? 128  GLY D C   1 
ATOM   9966  O O   . GLY D 1 127 ? 35.280  -21.278 73.169  1.00 79.02  ? 128  GLY D O   1 
ATOM   9967  N N   . ALA D 1 128 ? 33.223  -20.367 73.206  1.00 71.34  ? 129  ALA D N   1 
ATOM   9968  C CA  . ALA D 1 128 ? 32.791  -21.091 74.397  1.00 75.22  ? 129  ALA D CA  1 
ATOM   9969  C C   . ALA D 1 128 ? 32.598  -22.570 74.102  1.00 75.93  ? 129  ALA D C   1 
ATOM   9970  O O   . ALA D 1 128 ? 32.919  -23.428 74.924  1.00 73.07  ? 129  ALA D O   1 
ATOM   9971  C CB  . ALA D 1 128 ? 31.504  -20.493 74.938  1.00 87.83  ? 129  ALA D CB  1 
ATOM   9972  N N   . PHE D 1 129 ? 32.061  -22.860 72.923  1.00 81.52  ? 130  PHE D N   1 
ATOM   9973  C CA  . PHE D 1 129 ? 31.798  -24.234 72.527  1.00 80.19  ? 130  PHE D CA  1 
ATOM   9974  C C   . PHE D 1 129 ? 32.469  -24.543 71.196  1.00 85.62  ? 130  PHE D C   1 
ATOM   9975  O O   . PHE D 1 129 ? 32.783  -23.644 70.421  1.00 105.42 ? 130  PHE D O   1 
ATOM   9976  C CB  . PHE D 1 129 ? 30.291  -24.484 72.438  1.00 75.69  ? 130  PHE D CB  1 
ATOM   9977  C CG  . PHE D 1 129 ? 29.509  -23.882 73.572  1.00 62.72  ? 130  PHE D CG  1 
ATOM   9978  C CD1 . PHE D 1 129 ? 29.473  -24.495 74.813  1.00 53.98  ? 130  PHE D CD1 1 
ATOM   9979  C CD2 . PHE D 1 129 ? 28.808  -22.700 73.393  1.00 57.04  ? 130  PHE D CD2 1 
ATOM   9980  C CE1 . PHE D 1 129 ? 28.753  -23.940 75.856  1.00 50.83  ? 130  PHE D CE1 1 
ATOM   9981  C CE2 . PHE D 1 129 ? 28.088  -22.140 74.431  1.00 52.09  ? 130  PHE D CE2 1 
ATOM   9982  C CZ  . PHE D 1 129 ? 28.060  -22.761 75.665  1.00 46.54  ? 130  PHE D CZ  1 
ATOM   9983  N N   . GLY D 1 130 ? 32.678  -25.827 70.940  1.00 70.53  ? 131  GLY D N   1 
ATOM   9984  C CA  . GLY D 1 130 ? 33.347  -26.290 69.739  1.00 79.62  ? 131  GLY D CA  1 
ATOM   9985  C C   . GLY D 1 130 ? 32.354  -26.646 68.654  1.00 73.92  ? 131  GLY D C   1 
ATOM   9986  O O   . GLY D 1 130 ? 31.339  -25.964 68.465  1.00 61.88  ? 131  GLY D O   1 
ATOM   9987  N N   . GLU D 1 131 ? 32.662  -27.710 67.917  1.00 84.99  ? 132  GLU D N   1 
ATOM   9988  C CA  . GLU D 1 131 ? 31.740  -28.253 66.924  1.00 89.39  ? 132  GLU D CA  1 
ATOM   9989  C C   . GLU D 1 131 ? 30.379  -28.553 67.546  1.00 73.95  ? 132  GLU D C   1 
ATOM   9990  O O   . GLU D 1 131 ? 29.389  -28.708 66.830  1.00 66.75  ? 132  GLU D O   1 
ATOM   9991  C CB  . GLU D 1 131 ? 32.302  -29.525 66.285  1.00 100.42 ? 132  GLU D CB  1 
ATOM   9992  C CG  . GLU D 1 131 ? 33.698  -29.386 65.701  1.00 107.40 ? 132  GLU D CG  1 
ATOM   9993  C CD  . GLU D 1 131 ? 34.789  -29.687 66.712  1.00 110.04 ? 132  GLU D CD  1 
ATOM   9994  O OE1 . GLU D 1 131 ? 34.660  -29.270 67.883  1.00 107.13 ? 132  GLU D OE1 1 
ATOM   9995  O OE2 . GLU D 1 131 ? 35.778  -30.349 66.335  1.00 110.96 ? 132  GLU D OE2 1 
ATOM   9996  N N   . LEU D 1 132 ? 30.346  -28.651 68.875  1.00 65.02  ? 133  LEU D N   1 
ATOM   9997  C CA  . LEU D 1 132 ? 29.098  -28.735 69.618  1.00 76.29  ? 133  LEU D CA  1 
ATOM   9998  C C   . LEU D 1 132 ? 28.156  -27.637 69.149  1.00 83.34  ? 133  LEU D C   1 
ATOM   9999  O O   . LEU D 1 132 ? 27.007  -27.905 68.805  1.00 85.42  ? 133  LEU D O   1 
ATOM   10000 C CB  . LEU D 1 132 ? 29.354  -28.581 71.119  1.00 69.30  ? 133  LEU D CB  1 
ATOM   10001 C CG  . LEU D 1 132 ? 30.192  -29.652 71.821  1.00 60.94  ? 133  LEU D CG  1 
ATOM   10002 C CD1 . LEU D 1 132 ? 30.155  -29.455 73.329  1.00 47.58  ? 133  LEU D CD1 1 
ATOM   10003 C CD2 . LEU D 1 132 ? 29.711  -31.045 71.449  1.00 62.39  ? 133  LEU D CD2 1 
ATOM   10004 N N   . TYR D 1 133 ? 28.640  -26.398 69.139  1.00 79.67  ? 134  TYR D N   1 
ATOM   10005 C CA  . TYR D 1 133 ? 27.874  -25.311 68.541  1.00 81.22  ? 134  TYR D CA  1 
ATOM   10006 C C   . TYR D 1 133 ? 27.990  -25.246 67.023  1.00 74.43  ? 134  TYR D C   1 
ATOM   10007 O O   . TYR D 1 133 ? 26.982  -25.150 66.323  1.00 82.80  ? 134  TYR D O   1 
ATOM   10008 C CB  . TYR D 1 133 ? 28.274  -23.951 69.113  1.00 92.87  ? 134  TYR D CB  1 
ATOM   10009 C CG  . TYR D 1 133 ? 27.788  -22.809 68.245  1.00 92.16  ? 134  TYR D CG  1 
ATOM   10010 C CD1 . TYR D 1 133 ? 26.435  -22.508 68.158  1.00 89.79  ? 134  TYR D CD1 1 
ATOM   10011 C CD2 . TYR D 1 133 ? 28.677  -22.051 67.492  1.00 83.38  ? 134  TYR D CD2 1 
ATOM   10012 C CE1 . TYR D 1 133 ? 25.981  -21.478 67.360  1.00 87.12  ? 134  TYR D CE1 1 
ATOM   10013 C CE2 . TYR D 1 133 ? 28.230  -21.017 66.690  1.00 81.79  ? 134  TYR D CE2 1 
ATOM   10014 C CZ  . TYR D 1 133 ? 26.882  -20.736 66.630  1.00 89.41  ? 134  TYR D CZ  1 
ATOM   10015 O OH  . TYR D 1 133 ? 26.429  -19.708 65.835  1.00 93.30  ? 134  TYR D OH  1 
ATOM   10016 N N   . THR D 1 134 ? 29.219  -25.295 66.518  1.00 65.48  ? 135  THR D N   1 
ATOM   10017 C CA  . THR D 1 134 ? 29.457  -24.911 65.126  1.00 69.41  ? 135  THR D CA  1 
ATOM   10018 C C   . THR D 1 134 ? 28.860  -25.872 64.101  1.00 65.55  ? 135  THR D C   1 
ATOM   10019 O O   . THR D 1 134 ? 28.463  -25.454 63.015  1.00 64.57  ? 135  THR D O   1 
ATOM   10020 C CB  . THR D 1 134 ? 30.956  -24.679 64.832  1.00 68.12  ? 135  THR D CB  1 
ATOM   10021 O OG1 . THR D 1 134 ? 31.664  -25.922 64.890  1.00 67.93  ? 135  THR D OG1 1 
ATOM   10022 C CG2 . THR D 1 134 ? 31.549  -23.703 65.843  1.00 64.12  ? 135  THR D CG2 1 
ATOM   10023 N N   . GLN D 1 135 ? 28.796  -27.155 64.440  1.00 77.83  ? 136  GLN D N   1 
ATOM   10024 C CA  . GLN D 1 135 ? 28.186  -28.128 63.543  1.00 90.67  ? 136  GLN D CA  1 
ATOM   10025 C C   . GLN D 1 135 ? 26.666  -28.116 63.697  1.00 92.90  ? 136  GLN D C   1 
ATOM   10026 O O   . GLN D 1 135 ? 25.937  -28.542 62.802  1.00 96.81  ? 136  GLN D O   1 
ATOM   10027 C CB  . GLN D 1 135 ? 28.741  -29.529 63.810  1.00 100.00 ? 136  GLN D CB  1 
ATOM   10028 C CG  . GLN D 1 135 ? 28.514  -30.518 62.679  1.00 110.66 ? 136  GLN D CG  1 
ATOM   10029 C CD  . GLN D 1 135 ? 29.326  -30.187 61.440  1.00 116.01 ? 136  GLN D CD  1 
ATOM   10030 O OE1 . GLN D 1 135 ? 30.331  -29.480 61.511  1.00 115.92 ? 136  GLN D OE1 1 
ATOM   10031 N NE2 . GLN D 1 135 ? 28.890  -30.698 60.295  1.00 118.25 ? 136  GLN D NE2 1 
ATOM   10032 N N   . ASN D 1 136 ? 26.201  -27.630 64.844  1.00 91.18  ? 137  ASN D N   1 
ATOM   10033 C CA  . ASN D 1 136 ? 24.773  -27.559 65.148  1.00 92.44  ? 137  ASN D CA  1 
ATOM   10034 C C   . ASN D 1 136 ? 24.134  -26.188 64.907  1.00 87.19  ? 137  ASN D C   1 
ATOM   10035 O O   . ASN D 1 136 ? 22.955  -25.992 65.197  1.00 82.99  ? 137  ASN D O   1 
ATOM   10036 C CB  . ASN D 1 136 ? 24.518  -28.013 66.586  1.00 91.60  ? 137  ASN D CB  1 
ATOM   10037 C CG  . ASN D 1 136 ? 25.098  -29.384 66.871  1.00 84.45  ? 137  ASN D CG  1 
ATOM   10038 O OD1 . ASN D 1 136 ? 25.150  -30.242 65.991  1.00 80.46  ? 137  ASN D OD1 1 
ATOM   10039 N ND2 . ASN D 1 136 ? 25.543  -29.594 68.104  1.00 77.92  ? 137  ASN D ND2 1 
ATOM   10040 N N   . ALA D 1 137 ? 24.922  -25.248 64.390  1.00 85.56  ? 138  ALA D N   1 
ATOM   10041 C CA  . ALA D 1 137 ? 24.516  -23.845 64.269  1.00 82.19  ? 138  ALA D CA  1 
ATOM   10042 C C   . ALA D 1 137 ? 23.166  -23.614 63.579  1.00 85.32  ? 138  ALA D C   1 
ATOM   10043 O O   . ALA D 1 137 ? 22.402  -22.721 63.969  1.00 83.33  ? 138  ALA D O   1 
ATOM   10044 C CB  . ALA D 1 137 ? 25.611  -23.044 63.574  1.00 73.11  ? 138  ALA D CB  1 
ATOM   10045 N N   . ARG D 1 138 ? 22.874  -24.419 62.561  1.00 84.20  ? 139  ARG D N   1 
ATOM   10046 C CA  . ARG D 1 138 ? 21.632  -24.272 61.807  1.00 79.59  ? 139  ARG D CA  1 
ATOM   10047 C C   . ARG D 1 138 ? 20.405  -24.523 62.682  1.00 71.07  ? 139  ARG D C   1 
ATOM   10048 O O   . ARG D 1 138 ? 19.347  -23.938 62.460  1.00 77.33  ? 139  ARG D O   1 
ATOM   10049 C CB  . ARG D 1 138 ? 21.615  -25.195 60.584  1.00 85.82  ? 139  ARG D CB  1 
ATOM   10050 C CG  . ARG D 1 138 ? 20.401  -24.994 59.688  1.00 95.25  ? 139  ARG D CG  1 
ATOM   10051 C CD  . ARG D 1 138 ? 20.444  -25.878 58.453  1.00 112.89 ? 139  ARG D CD  1 
ATOM   10052 N NE  . ARG D 1 138 ? 19.260  -25.688 57.619  1.00 127.12 ? 139  ARG D NE  1 
ATOM   10053 C CZ  . ARG D 1 138 ? 19.052  -26.301 56.458  1.00 137.86 ? 139  ARG D CZ  1 
ATOM   10054 N NH1 . ARG D 1 138 ? 19.953  -27.150 55.983  1.00 144.11 ? 139  ARG D NH1 1 
ATOM   10055 N NH2 . ARG D 1 138 ? 17.943  -26.063 55.772  1.00 136.83 ? 139  ARG D NH2 1 
ATOM   10056 N N   . ALA D 1 139 ? 20.554  -25.389 63.681  1.00 65.36  ? 140  ALA D N   1 
ATOM   10057 C CA  . ALA D 1 139 ? 19.465  -25.670 64.609  1.00 67.74  ? 140  ALA D CA  1 
ATOM   10058 C C   . ALA D 1 139 ? 19.146  -24.441 65.453  1.00 69.72  ? 140  ALA D C   1 
ATOM   10059 O O   . ALA D 1 139 ? 17.981  -24.151 65.727  1.00 75.84  ? 140  ALA D O   1 
ATOM   10060 C CB  . ALA D 1 139 ? 19.808  -26.855 65.496  1.00 54.86  ? 140  ALA D CB  1 
ATOM   10061 N N   . PHE D 1 140 ? 20.188  -23.721 65.858  1.00 57.23  ? 141  PHE D N   1 
ATOM   10062 C CA  . PHE D 1 140 ? 20.024  -22.504 66.646  1.00 62.60  ? 141  PHE D CA  1 
ATOM   10063 C C   . PHE D 1 140 ? 19.431  -21.376 65.806  1.00 63.56  ? 141  PHE D C   1 
ATOM   10064 O O   . PHE D 1 140 ? 18.522  -20.663 66.248  1.00 54.82  ? 141  PHE D O   1 
ATOM   10065 C CB  . PHE D 1 140 ? 21.363  -22.072 67.245  1.00 57.33  ? 141  PHE D CB  1 
ATOM   10066 C CG  . PHE D 1 140 ? 21.914  -23.039 68.254  1.00 56.96  ? 141  PHE D CG  1 
ATOM   10067 C CD1 . PHE D 1 140 ? 21.562  -22.942 69.591  1.00 52.27  ? 141  PHE D CD1 1 
ATOM   10068 C CD2 . PHE D 1 140 ? 22.782  -24.046 67.866  1.00 57.25  ? 141  PHE D CD2 1 
ATOM   10069 C CE1 . PHE D 1 140 ? 22.067  -23.830 70.522  1.00 52.43  ? 141  PHE D CE1 1 
ATOM   10070 C CE2 . PHE D 1 140 ? 23.290  -24.937 68.792  1.00 59.95  ? 141  PHE D CE2 1 
ATOM   10071 C CZ  . PHE D 1 140 ? 22.932  -24.829 70.122  1.00 57.88  ? 141  PHE D CZ  1 
ATOM   10072 N N   . ARG D 1 141 ? 19.954  -21.221 64.593  1.00 60.24  ? 142  ARG D N   1 
ATOM   10073 C CA  . ARG D 1 141 ? 19.416  -20.256 63.640  1.00 57.92  ? 142  ARG D CA  1 
ATOM   10074 C C   . ARG D 1 141 ? 17.925  -20.506 63.397  1.00 71.72  ? 142  ARG D C   1 
ATOM   10075 O O   . ARG D 1 141 ? 17.110  -19.575 63.405  1.00 81.18  ? 142  ARG D O   1 
ATOM   10076 C CB  . ARG D 1 141 ? 20.212  -20.316 62.333  1.00 49.58  ? 142  ARG D CB  1 
ATOM   10077 C CG  . ARG D 1 141 ? 19.472  -19.840 61.095  1.00 67.60  ? 142  ARG D CG  1 
ATOM   10078 C CD  . ARG D 1 141 ? 20.455  -19.508 59.978  1.00 85.69  ? 142  ARG D CD  1 
ATOM   10079 N NE  . ARG D 1 141 ? 21.642  -20.361 60.021  1.00 100.63 ? 142  ARG D NE  1 
ATOM   10080 C CZ  . ARG D 1 141 ? 21.811  -21.450 59.278  1.00 105.76 ? 142  ARG D CZ  1 
ATOM   10081 N NH1 . ARG D 1 141 ? 20.870  -21.826 58.424  1.00 115.60 ? 142  ARG D NH1 1 
ATOM   10082 N NH2 . ARG D 1 141 ? 22.925  -22.163 59.387  1.00 84.66  ? 142  ARG D NH2 1 
ATOM   10083 N N   . ASP D 1 142 ? 17.576  -21.775 63.212  1.00 70.27  ? 143  ASP D N   1 
ATOM   10084 C CA  . ASP D 1 142 ? 16.186  -22.170 63.019  1.00 62.63  ? 143  ASP D CA  1 
ATOM   10085 C C   . ASP D 1 142 ? 15.346  -21.935 64.270  1.00 55.26  ? 143  ASP D C   1 
ATOM   10086 O O   . ASP D 1 142 ? 14.162  -21.623 64.169  1.00 62.46  ? 143  ASP D O   1 
ATOM   10087 C CB  . ASP D 1 142 ? 16.090  -23.633 62.580  1.00 73.53  ? 143  ASP D CB  1 
ATOM   10088 C CG  . ASP D 1 142 ? 16.467  -23.830 61.126  1.00 83.05  ? 143  ASP D CG  1 
ATOM   10089 O OD1 . ASP D 1 142 ? 17.322  -23.070 60.622  1.00 82.82  ? 143  ASP D OD1 1 
ATOM   10090 O OD2 . ASP D 1 142 ? 15.906  -24.743 60.485  1.00 87.38  ? 143  ASP D OD2 1 
ATOM   10091 N N   . LEU D 1 143 ? 15.953  -22.085 65.445  1.00 43.95  ? 144  LEU D N   1 
ATOM   10092 C CA  . LEU D 1 143 ? 15.246  -21.815 66.694  1.00 44.67  ? 144  LEU D CA  1 
ATOM   10093 C C   . LEU D 1 143 ? 14.884  -20.340 66.783  1.00 61.04  ? 144  LEU D C   1 
ATOM   10094 O O   . LEU D 1 143 ? 13.757  -19.985 67.136  1.00 60.91  ? 144  LEU D O   1 
ATOM   10095 C CB  . LEU D 1 143 ? 16.081  -22.221 67.908  1.00 33.49  ? 144  LEU D CB  1 
ATOM   10096 C CG  . LEU D 1 143 ? 15.483  -21.800 69.254  1.00 34.83  ? 144  LEU D CG  1 
ATOM   10097 C CD1 . LEU D 1 143 ? 14.115  -22.435 69.462  1.00 49.03  ? 144  LEU D CD1 1 
ATOM   10098 C CD2 . LEU D 1 143 ? 16.416  -22.147 70.401  1.00 36.80  ? 144  LEU D CD2 1 
ATOM   10099 N N   . TYR D 1 144 ? 15.845  -19.481 66.457  1.00 68.99  ? 145  TYR D N   1 
ATOM   10100 C CA  . TYR D 1 144 ? 15.584  -18.047 66.422  1.00 66.87  ? 145  TYR D CA  1 
ATOM   10101 C C   . TYR D 1 144 ? 14.505  -17.710 65.397  1.00 60.63  ? 145  TYR D C   1 
ATOM   10102 O O   . TYR D 1 144 ? 13.644  -16.866 65.652  1.00 77.34  ? 145  TYR D O   1 
ATOM   10103 C CB  . TYR D 1 144 ? 16.866  -17.258 66.142  1.00 59.35  ? 145  TYR D CB  1 
ATOM   10104 C CG  . TYR D 1 144 ? 17.636  -16.891 67.392  1.00 54.07  ? 145  TYR D CG  1 
ATOM   10105 C CD1 . TYR D 1 144 ? 18.562  -17.765 67.943  1.00 61.07  ? 145  TYR D CD1 1 
ATOM   10106 C CD2 . TYR D 1 144 ? 17.432  -15.670 68.022  1.00 59.26  ? 145  TYR D CD2 1 
ATOM   10107 C CE1 . TYR D 1 144 ? 19.266  -17.433 69.086  1.00 64.05  ? 145  TYR D CE1 1 
ATOM   10108 C CE2 . TYR D 1 144 ? 18.130  -15.329 69.165  1.00 63.59  ? 145  TYR D CE2 1 
ATOM   10109 C CZ  . TYR D 1 144 ? 19.046  -16.214 69.692  1.00 55.53  ? 145  TYR D CZ  1 
ATOM   10110 O OH  . TYR D 1 144 ? 19.744  -15.880 70.830  1.00 42.57  ? 145  TYR D OH  1 
ATOM   10111 N N   . SER D 1 145 ? 14.548  -18.375 64.246  1.00 45.51  ? 146  SER D N   1 
ATOM   10112 C CA  . SER D 1 145 ? 13.521  -18.177 63.225  1.00 53.02  ? 146  SER D CA  1 
ATOM   10113 C C   . SER D 1 145 ? 12.129  -18.534 63.749  1.00 65.72  ? 146  SER D C   1 
ATOM   10114 O O   . SER D 1 145 ? 11.168  -17.778 63.562  1.00 77.19  ? 146  SER D O   1 
ATOM   10115 C CB  . SER D 1 145 ? 13.842  -18.989 61.969  1.00 44.97  ? 146  SER D CB  1 
ATOM   10116 O OG  . SER D 1 145 ? 14.984  -18.471 61.309  1.00 53.32  ? 146  SER D OG  1 
ATOM   10117 N N   . GLU D 1 146 ? 12.029  -19.683 64.410  1.00 57.17  ? 147  GLU D N   1 
ATOM   10118 C CA  . GLU D 1 146 ? 10.775  -20.120 65.012  1.00 56.63  ? 147  GLU D CA  1 
ATOM   10119 C C   . GLU D 1 146 ? 10.296  -19.122 66.061  1.00 61.89  ? 147  GLU D C   1 
ATOM   10120 O O   . GLU D 1 146 ? 9.098   -18.872 66.184  1.00 59.12  ? 147  GLU D O   1 
ATOM   10121 C CB  . GLU D 1 146 ? 10.928  -21.507 65.638  1.00 59.02  ? 147  GLU D CB  1 
ATOM   10122 C CG  . GLU D 1 146 ? 11.229  -22.614 64.641  1.00 72.72  ? 147  GLU D CG  1 
ATOM   10123 C CD  . GLU D 1 146 ? 10.090  -22.854 63.671  1.00 76.09  ? 147  GLU D CD  1 
ATOM   10124 O OE1 . GLU D 1 146 ? 8.919   -22.754 64.092  1.00 80.76  ? 147  GLU D OE1 1 
ATOM   10125 O OE2 . GLU D 1 146 ? 10.366  -23.143 62.487  1.00 72.71  ? 147  GLU D OE2 1 
ATOM   10126 N N   . LEU D 1 147 ? 11.235  -18.556 66.813  1.00 66.86  ? 148  LEU D N   1 
ATOM   10127 C CA  . LEU D 1 147 ? 10.904  -17.529 67.797  1.00 67.76  ? 148  LEU D CA  1 
ATOM   10128 C C   . LEU D 1 147 ? 10.340  -16.278 67.125  1.00 68.73  ? 148  LEU D C   1 
ATOM   10129 O O   . LEU D 1 147 ? 9.403   -15.658 67.633  1.00 67.57  ? 148  LEU D O   1 
ATOM   10130 C CB  . LEU D 1 147 ? 12.125  -17.168 68.645  1.00 65.83  ? 148  LEU D CB  1 
ATOM   10131 C CG  . LEU D 1 147 ? 12.603  -18.215 69.654  1.00 59.85  ? 148  LEU D CG  1 
ATOM   10132 C CD1 . LEU D 1 147 ? 13.764  -17.673 70.472  1.00 66.16  ? 148  LEU D CD1 1 
ATOM   10133 C CD2 . LEU D 1 147 ? 11.466  -18.653 70.563  1.00 35.49  ? 148  LEU D CD2 1 
ATOM   10134 N N   . ARG D 1 148 ? 10.918  -15.910 65.983  1.00 59.78  ? 149  ARG D N   1 
ATOM   10135 C CA  . ARG D 1 148 ? 10.404  -14.792 65.201  1.00 55.62  ? 149  ARG D CA  1 
ATOM   10136 C C   . ARG D 1 148 ? 8.980   -15.081 64.748  1.00 61.92  ? 149  ARG D C   1 
ATOM   10137 O O   . ARG D 1 148 ? 8.116   -14.205 64.791  1.00 60.50  ? 149  ARG D O   1 
ATOM   10138 C CB  . ARG D 1 148 ? 11.293  -14.513 63.986  1.00 46.04  ? 149  ARG D CB  1 
ATOM   10139 C CG  . ARG D 1 148 ? 12.671  -13.983 64.335  1.00 59.44  ? 149  ARG D CG  1 
ATOM   10140 C CD  . ARG D 1 148 ? 13.443  -13.557 63.098  1.00 56.59  ? 149  ARG D CD  1 
ATOM   10141 N NE  . ARG D 1 148 ? 14.797  -13.126 63.434  1.00 53.65  ? 149  ARG D NE  1 
ATOM   10142 C CZ  . ARG D 1 148 ? 15.847  -13.940 63.488  1.00 70.96  ? 149  ARG D CZ  1 
ATOM   10143 N NH1 . ARG D 1 148 ? 15.701  -15.231 63.223  1.00 81.12  ? 149  ARG D NH1 1 
ATOM   10144 N NH2 . ARG D 1 148 ? 17.043  -13.463 63.805  1.00 70.63  ? 149  ARG D NH2 1 
ATOM   10145 N N   . LEU D 1 149 ? 8.742   -16.317 64.320  1.00 59.38  ? 150  LEU D N   1 
ATOM   10146 C CA  . LEU D 1 149 ? 7.410   -16.728 63.890  1.00 46.52  ? 150  LEU D CA  1 
ATOM   10147 C C   . LEU D 1 149 ? 6.420   -16.675 65.049  1.00 50.46  ? 150  LEU D C   1 
ATOM   10148 O O   . LEU D 1 149 ? 5.247   -16.345 64.863  1.00 47.51  ? 150  LEU D O   1 
ATOM   10149 C CB  . LEU D 1 149 ? 7.451   -18.131 63.286  1.00 45.24  ? 150  LEU D CB  1 
ATOM   10150 C CG  . LEU D 1 149 ? 8.264   -18.264 61.998  1.00 56.70  ? 150  LEU D CG  1 
ATOM   10151 C CD1 . LEU D 1 149 ? 8.316   -19.711 61.535  1.00 67.28  ? 150  LEU D CD1 1 
ATOM   10152 C CD2 . LEU D 1 149 ? 7.683   -17.371 60.914  1.00 56.11  ? 150  LEU D CD2 1 
ATOM   10153 N N   . TYR D 1 150 ? 6.902   -16.995 66.246  1.00 47.16  ? 151  TYR D N   1 
ATOM   10154 C CA  . TYR D 1 150 ? 6.078   -16.941 67.446  1.00 46.29  ? 151  TYR D CA  1 
ATOM   10155 C C   . TYR D 1 150 ? 5.701   -15.502 67.775  1.00 60.42  ? 151  TYR D C   1 
ATOM   10156 O O   . TYR D 1 150 ? 4.549   -15.210 68.093  1.00 55.05  ? 151  TYR D O   1 
ATOM   10157 C CB  . TYR D 1 150 ? 6.811   -17.575 68.630  1.00 38.80  ? 151  TYR D CB  1 
ATOM   10158 C CG  . TYR D 1 150 ? 5.990   -17.627 69.899  1.00 50.61  ? 151  TYR D CG  1 
ATOM   10159 C CD1 . TYR D 1 150 ? 4.891   -18.467 70.000  1.00 52.86  ? 151  TYR D CD1 1 
ATOM   10160 C CD2 . TYR D 1 150 ? 6.318   -16.846 70.999  1.00 60.43  ? 151  TYR D CD2 1 
ATOM   10161 C CE1 . TYR D 1 150 ? 4.133   -18.524 71.151  1.00 53.60  ? 151  TYR D CE1 1 
ATOM   10162 C CE2 . TYR D 1 150 ? 5.566   -16.898 72.160  1.00 70.29  ? 151  TYR D CE2 1 
ATOM   10163 C CZ  . TYR D 1 150 ? 4.475   -17.740 72.229  1.00 66.67  ? 151  TYR D CZ  1 
ATOM   10164 O OH  . TYR D 1 150 ? 3.719   -17.803 73.376  1.00 65.25  ? 151  TYR D OH  1 
ATOM   10165 N N   . TYR D 1 151 ? 6.681   -14.607 67.693  1.00 71.50  ? 152  TYR D N   1 
ATOM   10166 C CA  . TYR D 1 151 ? 6.450   -13.193 67.969  1.00 49.53  ? 152  TYR D CA  1 
ATOM   10167 C C   . TYR D 1 151 ? 5.527   -12.558 66.931  1.00 50.39  ? 152  TYR D C   1 
ATOM   10168 O O   . TYR D 1 151 ? 4.749   -11.658 67.248  1.00 56.81  ? 152  TYR D O   1 
ATOM   10169 C CB  . TYR D 1 151 ? 7.779   -12.436 68.039  1.00 31.06  ? 152  TYR D CB  1 
ATOM   10170 C CG  . TYR D 1 151 ? 7.637   -10.933 67.938  1.00 35.40  ? 152  TYR D CG  1 
ATOM   10171 C CD1 . TYR D 1 151 ? 7.246   -10.176 69.035  1.00 36.89  ? 152  TYR D CD1 1 
ATOM   10172 C CD2 . TYR D 1 151 ? 7.897   -10.272 66.744  1.00 37.39  ? 152  TYR D CD2 1 
ATOM   10173 C CE1 . TYR D 1 151 ? 7.114   -8.801  68.943  1.00 35.80  ? 152  TYR D CE1 1 
ATOM   10174 C CE2 . TYR D 1 151 ? 7.768   -8.900  66.643  1.00 38.52  ? 152  TYR D CE2 1 
ATOM   10175 C CZ  . TYR D 1 151 ? 7.377   -8.169  67.745  1.00 42.87  ? 152  TYR D CZ  1 
ATOM   10176 O OH  . TYR D 1 151 ? 7.249   -6.802  67.645  1.00 51.93  ? 152  TYR D OH  1 
ATOM   10177 N N   . ARG D 1 152 ? 5.616   -13.032 65.691  1.00 53.60  ? 153  ARG D N   1 
ATOM   10178 C CA  . ARG D 1 152 ? 4.777   -12.511 64.614  1.00 65.09  ? 153  ARG D CA  1 
ATOM   10179 C C   . ARG D 1 152 ? 3.329   -12.982 64.728  1.00 77.81  ? 153  ARG D C   1 
ATOM   10180 O O   . ARG D 1 152 ? 2.426   -12.378 64.149  1.00 76.83  ? 153  ARG D O   1 
ATOM   10181 C CB  . ARG D 1 152 ? 5.350   -12.883 63.245  1.00 59.80  ? 153  ARG D CB  1 
ATOM   10182 C CG  . ARG D 1 152 ? 6.545   -12.047 62.816  1.00 55.49  ? 153  ARG D CG  1 
ATOM   10183 C CD  . ARG D 1 152 ? 7.003   -12.441 61.422  1.00 66.73  ? 153  ARG D CD  1 
ATOM   10184 N NE  . ARG D 1 152 ? 5.894   -12.441 60.471  1.00 81.24  ? 153  ARG D NE  1 
ATOM   10185 C CZ  . ARG D 1 152 ? 5.980   -12.881 59.220  1.00 98.86  ? 153  ARG D CZ  1 
ATOM   10186 N NH1 . ARG D 1 152 ? 7.127   -13.363 58.761  1.00 104.15 ? 153  ARG D NH1 1 
ATOM   10187 N NH2 . ARG D 1 152 ? 4.917   -12.843 58.428  1.00 104.40 ? 153  ARG D NH2 1 
ATOM   10188 N N   . GLY D 1 153 ? 3.111   -14.059 65.476  1.00 82.92  ? 154  GLY D N   1 
ATOM   10189 C CA  . GLY D 1 153 ? 1.769   -14.560 65.714  1.00 73.60  ? 154  GLY D CA  1 
ATOM   10190 C C   . GLY D 1 153 ? 1.419   -15.812 64.933  1.00 80.29  ? 154  GLY D C   1 
ATOM   10191 O O   . GLY D 1 153 ? 0.351   -16.390 65.130  1.00 90.25  ? 154  GLY D O   1 
ATOM   10192 N N   . ALA D 1 154 ? 2.318   -16.234 64.050  1.00 76.43  ? 155  ALA D N   1 
ATOM   10193 C CA  . ALA D 1 154 ? 2.081   -17.412 63.220  1.00 69.33  ? 155  ALA D CA  1 
ATOM   10194 C C   . ALA D 1 154 ? 2.014   -18.700 64.039  1.00 90.04  ? 155  ALA D C   1 
ATOM   10195 O O   . ALA D 1 154 ? 1.036   -19.444 63.960  1.00 95.94  ? 155  ALA D O   1 
ATOM   10196 C CB  . ALA D 1 154 ? 3.148   -17.524 62.139  1.00 58.91  ? 155  ALA D CB  1 
ATOM   10197 N N   . ASN D 1 155 ? 3.053   -18.959 64.825  1.00 100.18 ? 156  ASN D N   1 
ATOM   10198 C CA  . ASN D 1 155 ? 3.119   -20.185 65.616  1.00 104.50 ? 156  ASN D CA  1 
ATOM   10199 C C   . ASN D 1 155 ? 2.623   -20.016 67.048  1.00 110.89 ? 156  ASN D C   1 
ATOM   10200 O O   . ASN D 1 155 ? 3.078   -19.137 67.772  1.00 116.81 ? 156  ASN D O   1 
ATOM   10201 C CB  . ASN D 1 155 ? 4.543   -20.748 65.628  1.00 103.96 ? 156  ASN D CB  1 
ATOM   10202 C CG  . ASN D 1 155 ? 4.920   -21.411 64.318  1.00 106.64 ? 156  ASN D CG  1 
ATOM   10203 O OD1 . ASN D 1 155 ? 5.458   -20.770 63.415  1.00 104.73 ? 156  ASN D OD1 1 
ATOM   10204 N ND2 . ASN D 1 155 ? 4.640   -22.705 64.208  1.00 110.14 ? 156  ASN D ND2 1 
ATOM   10205 N N   . LEU D 1 156 ? 1.663   -20.847 67.435  1.00 118.62 ? 157  LEU D N   1 
ATOM   10206 C CA  . LEU D 1 156 ? 1.247   -20.963 68.829  1.00 128.93 ? 157  LEU D CA  1 
ATOM   10207 C C   . LEU D 1 156 ? 1.960   -22.148 69.479  1.00 130.73 ? 157  LEU D C   1 
ATOM   10208 O O   . LEU D 1 156 ? 1.686   -22.510 70.623  1.00 129.97 ? 157  LEU D O   1 
ATOM   10209 C CB  . LEU D 1 156 ? -0.273  -21.109 68.932  1.00 132.27 ? 157  LEU D CB  1 
ATOM   10210 C CG  . LEU D 1 156 ? -1.080  -19.938 68.364  1.00 127.37 ? 157  LEU D CG  1 
ATOM   10211 C CD1 . LEU D 1 156 ? -2.568  -20.122 68.628  1.00 128.89 ? 157  LEU D CD1 1 
ATOM   10212 C CD2 . LEU D 1 156 ? -0.588  -18.612 68.931  1.00 117.54 ? 157  LEU D CD2 1 
ATOM   10213 N N   . HIS D 1 157 ? 2.891   -22.732 68.731  1.00 134.60 ? 158  HIS D N   1 
ATOM   10214 C CA  . HIS D 1 157 ? 3.464   -24.045 69.024  1.00 138.34 ? 158  HIS D CA  1 
ATOM   10215 C C   . HIS D 1 157 ? 4.661   -24.037 69.971  1.00 125.24 ? 158  HIS D C   1 
ATOM   10216 O O   . HIS D 1 157 ? 5.315   -25.066 70.133  1.00 128.42 ? 158  HIS D O   1 
ATOM   10217 C CB  . HIS D 1 157 ? 3.863   -24.755 67.725  1.00 149.21 ? 158  HIS D CB  1 
ATOM   10218 C CG  . HIS D 1 157 ? 2.700   -25.204 66.897  1.00 159.82 ? 158  HIS D CG  1 
ATOM   10219 N ND1 . HIS D 1 157 ? 2.851   -25.752 65.641  1.00 164.37 ? 158  HIS D ND1 1 
ATOM   10220 C CD2 . HIS D 1 157 ? 1.370   -25.191 67.145  1.00 162.63 ? 158  HIS D CD2 1 
ATOM   10221 C CE1 . HIS D 1 157 ? 1.662   -26.054 65.150  1.00 166.51 ? 158  HIS D CE1 1 
ATOM   10222 N NE2 . HIS D 1 157 ? 0.747   -25.725 66.042  1.00 164.46 ? 158  HIS D NE2 1 
ATOM   10223 N N   . LEU D 1 158 ? 4.942   -22.888 70.583  1.00 104.24 ? 159  LEU D N   1 
ATOM   10224 C CA  . LEU D 1 158 ? 6.196   -22.654 71.308  1.00 91.49  ? 159  LEU D CA  1 
ATOM   10225 C C   . LEU D 1 158 ? 6.647   -23.814 72.203  1.00 97.70  ? 159  LEU D C   1 
ATOM   10226 O O   . LEU D 1 158 ? 7.838   -24.128 72.255  1.00 110.07 ? 159  LEU D O   1 
ATOM   10227 C CB  . LEU D 1 158 ? 6.086   -21.379 72.149  1.00 75.89  ? 159  LEU D CB  1 
ATOM   10228 C CG  . LEU D 1 158 ? 7.393   -20.820 72.715  1.00 63.38  ? 159  LEU D CG  1 
ATOM   10229 C CD1 . LEU D 1 158 ? 8.258   -20.263 71.595  1.00 60.28  ? 159  LEU D CD1 1 
ATOM   10230 C CD2 . LEU D 1 158 ? 7.124   -19.759 73.774  1.00 43.92  ? 159  LEU D CD2 1 
ATOM   10231 N N   . GLU D 1 159 ? 5.705   -24.455 72.889  1.00 89.64  ? 160  GLU D N   1 
ATOM   10232 C CA  . GLU D 1 159 ? 6.027   -25.637 73.687  1.00 78.82  ? 160  GLU D CA  1 
ATOM   10233 C C   . GLU D 1 159 ? 6.583   -26.770 72.826  1.00 73.85  ? 160  GLU D C   1 
ATOM   10234 O O   . GLU D 1 159 ? 7.660   -27.295 73.104  1.00 64.56  ? 160  GLU D O   1 
ATOM   10235 C CB  . GLU D 1 159 ? 4.809   -26.126 74.476  1.00 78.55  ? 160  GLU D CB  1 
ATOM   10236 C CG  . GLU D 1 159 ? 5.004   -27.504 75.098  1.00 86.69  ? 160  GLU D CG  1 
ATOM   10237 C CD  . GLU D 1 159 ? 3.978   -27.819 76.170  1.00 104.10 ? 160  GLU D CD  1 
ATOM   10238 O OE1 . GLU D 1 159 ? 2.884   -28.317 75.827  1.00 112.78 ? 160  GLU D OE1 1 
ATOM   10239 O OE2 . GLU D 1 159 ? 4.272   -27.574 77.359  1.00 107.10 ? 160  GLU D OE2 1 
ATOM   10240 N N   . GLU D 1 160 ? 5.845   -27.139 71.782  1.00 79.48  ? 161  GLU D N   1 
ATOM   10241 C CA  . GLU D 1 160 ? 6.269   -28.205 70.877  1.00 86.54  ? 161  GLU D CA  1 
ATOM   10242 C C   . GLU D 1 160 ? 7.585   -27.868 70.183  1.00 96.14  ? 161  GLU D C   1 
ATOM   10243 O O   . GLU D 1 160 ? 8.445   -28.732 70.006  1.00 109.67 ? 161  GLU D O   1 
ATOM   10244 C CB  . GLU D 1 160 ? 5.194   -28.480 69.823  1.00 86.70  ? 161  GLU D CB  1 
ATOM   10245 C CG  . GLU D 1 160 ? 3.887   -29.014 70.380  1.00 100.97 ? 161  GLU D CG  1 
ATOM   10246 C CD  . GLU D 1 160 ? 2.903   -29.384 69.287  1.00 115.28 ? 161  GLU D CD  1 
ATOM   10247 O OE1 . GLU D 1 160 ? 3.250   -29.227 68.097  1.00 113.24 ? 161  GLU D OE1 1 
ATOM   10248 O OE2 . GLU D 1 160 ? 1.785   -29.833 69.616  1.00 123.94 ? 161  GLU D OE2 1 
ATOM   10249 N N   . THR D 1 161 ? 7.730   -26.606 69.793  1.00 86.81  ? 162  THR D N   1 
ATOM   10250 C CA  . THR D 1 161 ? 8.927   -26.139 69.107  1.00 80.18  ? 162  THR D CA  1 
ATOM   10251 C C   . THR D 1 161 ? 10.153  -26.274 70.005  1.00 71.98  ? 162  THR D C   1 
ATOM   10252 O O   . THR D 1 161 ? 11.158  -26.877 69.616  1.00 69.42  ? 162  THR D O   1 
ATOM   10253 C CB  . THR D 1 161 ? 8.782   -24.671 68.665  1.00 85.06  ? 162  THR D CB  1 
ATOM   10254 O OG1 . THR D 1 161 ? 7.567   -24.512 67.921  1.00 85.50  ? 162  THR D OG1 1 
ATOM   10255 C CG2 . THR D 1 161 ? 9.957   -24.256 67.799  1.00 82.19  ? 162  THR D CG2 1 
ATOM   10256 N N   . LEU D 1 162 ? 10.059  -25.714 71.208  1.00 64.17  ? 163  LEU D N   1 
ATOM   10257 C CA  . LEU D 1 162 ? 11.151  -25.792 72.172  1.00 69.62  ? 163  LEU D CA  1 
ATOM   10258 C C   . LEU D 1 162 ? 11.476  -27.241 72.537  1.00 66.16  ? 163  LEU D C   1 
ATOM   10259 O O   . LEU D 1 162 ? 12.645  -27.621 72.608  1.00 66.60  ? 163  LEU D O   1 
ATOM   10260 C CB  . LEU D 1 162 ? 10.827  -24.979 73.430  1.00 65.09  ? 163  LEU D CB  1 
ATOM   10261 C CG  . LEU D 1 162 ? 10.801  -23.455 73.272  1.00 58.52  ? 163  LEU D CG  1 
ATOM   10262 C CD1 . LEU D 1 162 ? 10.362  -22.780 74.564  1.00 52.66  ? 163  LEU D CD1 1 
ATOM   10263 C CD2 . LEU D 1 162 ? 12.160  -22.933 72.827  1.00 52.65  ? 163  LEU D CD2 1 
ATOM   10264 N N   . ALA D 1 163 ? 10.439  -28.045 72.752  1.00 62.12  ? 164  ALA D N   1 
ATOM   10265 C CA  . ALA D 1 163 ? 10.610  -29.452 73.104  1.00 58.64  ? 164  ALA D CA  1 
ATOM   10266 C C   . ALA D 1 163 ? 11.356  -30.227 72.020  1.00 60.90  ? 164  ALA D C   1 
ATOM   10267 O O   . ALA D 1 163 ? 12.315  -30.953 72.308  1.00 65.70  ? 164  ALA D O   1 
ATOM   10268 C CB  . ALA D 1 163 ? 9.262   -30.098 73.382  1.00 52.96  ? 164  ALA D CB  1 
ATOM   10269 N N   . GLU D 1 164 ? 10.909  -30.076 70.777  1.00 48.71  ? 165  GLU D N   1 
ATOM   10270 C CA  . GLU D 1 164 ? 11.544  -30.760 69.657  1.00 69.63  ? 165  GLU D CA  1 
ATOM   10271 C C   . GLU D 1 164 ? 12.984  -30.296 69.490  1.00 72.49  ? 165  GLU D C   1 
ATOM   10272 O O   . GLU D 1 164 ? 13.889  -31.109 69.261  1.00 77.55  ? 165  GLU D O   1 
ATOM   10273 C CB  . GLU D 1 164 ? 10.766  -30.531 68.362  1.00 80.98  ? 165  GLU D CB  1 
ATOM   10274 C CG  . GLU D 1 164 ? 11.396  -31.199 67.153  1.00 100.27 ? 165  GLU D CG  1 
ATOM   10275 C CD  . GLU D 1 164 ? 10.538  -31.085 65.912  1.00 122.96 ? 165  GLU D CD  1 
ATOM   10276 O OE1 . GLU D 1 164 ? 9.472   -30.438 65.981  1.00 130.24 ? 165  GLU D OE1 1 
ATOM   10277 O OE2 . GLU D 1 164 ? 10.929  -31.648 64.868  1.00 130.35 ? 165  GLU D OE2 1 
ATOM   10278 N N   . PHE D 1 165 ? 13.186  -28.987 69.613  1.00 62.91  ? 166  PHE D N   1 
ATOM   10279 C CA  . PHE D 1 165 ? 14.523  -28.409 69.553  1.00 62.11  ? 166  PHE D CA  1 
ATOM   10280 C C   . PHE D 1 165 ? 15.455  -29.063 70.567  1.00 68.14  ? 166  PHE D C   1 
ATOM   10281 O O   . PHE D 1 165 ? 16.527  -29.550 70.208  1.00 68.45  ? 166  PHE D O   1 
ATOM   10282 C CB  . PHE D 1 165 ? 14.476  -26.899 69.791  1.00 57.33  ? 166  PHE D CB  1 
ATOM   10283 C CG  . PHE D 1 165 ? 15.811  -26.303 70.139  1.00 53.46  ? 166  PHE D CG  1 
ATOM   10284 C CD1 . PHE D 1 165 ? 16.767  -26.094 69.159  1.00 46.78  ? 166  PHE D CD1 1 
ATOM   10285 C CD2 . PHE D 1 165 ? 16.111  -25.958 71.448  1.00 49.33  ? 166  PHE D CD2 1 
ATOM   10286 C CE1 . PHE D 1 165 ? 17.998  -25.551 69.479  1.00 48.06  ? 166  PHE D CE1 1 
ATOM   10287 C CE2 . PHE D 1 165 ? 17.340  -25.416 71.773  1.00 37.24  ? 166  PHE D CE2 1 
ATOM   10288 C CZ  . PHE D 1 165 ? 18.284  -25.212 70.787  1.00 44.20  ? 166  PHE D CZ  1 
ATOM   10289 N N   . TRP D 1 166 ? 15.039  -29.075 71.831  1.00 64.89  ? 167  TRP D N   1 
ATOM   10290 C CA  . TRP D 1 166 ? 15.853  -29.664 72.891  1.00 67.90  ? 167  TRP D CA  1 
ATOM   10291 C C   . TRP D 1 166 ? 16.099  -31.148 72.659  1.00 74.08  ? 167  TRP D C   1 
ATOM   10292 O O   . TRP D 1 166 ? 17.178  -31.654 72.960  1.00 74.68  ? 167  TRP D O   1 
ATOM   10293 C CB  . TRP D 1 166 ? 15.221  -29.444 74.268  1.00 60.52  ? 167  TRP D CB  1 
ATOM   10294 C CG  . TRP D 1 166 ? 15.289  -28.026 74.743  1.00 64.33  ? 167  TRP D CG  1 
ATOM   10295 C CD1 . TRP D 1 166 ? 14.240  -27.227 75.090  1.00 70.85  ? 167  TRP D CD1 1 
ATOM   10296 C CD2 . TRP D 1 166 ? 16.469  -27.233 74.918  1.00 70.86  ? 167  TRP D CD2 1 
ATOM   10297 N NE1 . TRP D 1 166 ? 14.691  -25.989 75.473  1.00 72.92  ? 167  TRP D NE1 1 
ATOM   10298 C CE2 . TRP D 1 166 ? 16.060  -25.967 75.375  1.00 71.33  ? 167  TRP D CE2 1 
ATOM   10299 C CE3 . TRP D 1 166 ? 17.836  -27.473 74.733  1.00 79.32  ? 167  TRP D CE3 1 
ATOM   10300 C CZ2 . TRP D 1 166 ? 16.961  -24.942 75.651  1.00 64.78  ? 167  TRP D CZ2 1 
ATOM   10301 C CZ3 . TRP D 1 166 ? 18.730  -26.455 75.007  1.00 76.18  ? 167  TRP D CZ3 1 
ATOM   10302 C CH2 . TRP D 1 166 ? 18.289  -25.206 75.460  1.00 69.15  ? 167  TRP D CH2 1 
ATOM   10303 N N   . ALA D 1 167 ? 15.097  -31.838 72.124  1.00 77.53  ? 168  ALA D N   1 
ATOM   10304 C CA  . ALA D 1 167 ? 15.225  -33.261 71.830  1.00 69.90  ? 168  ALA D CA  1 
ATOM   10305 C C   . ALA D 1 167 ? 16.322  -33.524 70.799  1.00 74.77  ? 168  ALA D C   1 
ATOM   10306 O O   . ALA D 1 167 ? 17.260  -34.292 71.050  1.00 88.21  ? 168  ALA D O   1 
ATOM   10307 C CB  . ALA D 1 167 ? 13.895  -33.820 71.347  1.00 68.30  ? 168  ALA D CB  1 
ATOM   10308 N N   . ARG D 1 168 ? 16.203  -32.879 69.642  1.00 66.87  ? 169  ARG D N   1 
ATOM   10309 C CA  . ARG D 1 168 ? 17.157  -33.089 68.557  1.00 80.24  ? 169  ARG D CA  1 
ATOM   10310 C C   . ARG D 1 168 ? 18.557  -32.609 68.938  1.00 77.56  ? 169  ARG D C   1 
ATOM   10311 O O   . ARG D 1 168 ? 19.561  -33.251 68.606  1.00 58.89  ? 169  ARG D O   1 
ATOM   10312 C CB  . ARG D 1 168 ? 16.675  -32.400 67.280  1.00 91.79  ? 169  ARG D CB  1 
ATOM   10313 C CG  . ARG D 1 168 ? 16.623  -33.316 66.068  1.00 105.25 ? 169  ARG D CG  1 
ATOM   10314 C CD  . ARG D 1 168 ? 15.466  -32.957 65.150  1.00 114.97 ? 169  ARG D CD  1 
ATOM   10315 N NE  . ARG D 1 168 ? 15.361  -33.881 64.024  1.00 125.01 ? 169  ARG D NE  1 
ATOM   10316 C CZ  . ARG D 1 168 ? 14.339  -33.911 63.175  1.00 131.24 ? 169  ARG D CZ  1 
ATOM   10317 N NH1 . ARG D 1 168 ? 13.325  -33.069 63.324  1.00 131.50 ? 169  ARG D NH1 1 
ATOM   10318 N NH2 . ARG D 1 168 ? 14.328  -34.786 62.178  1.00 131.34 ? 169  ARG D NH2 1 
ATOM   10319 N N   . LEU D 1 169 ? 18.612  -31.485 69.647  1.00 83.09  ? 170  LEU D N   1 
ATOM   10320 C CA  . LEU D 1 169 ? 19.879  -30.959 70.139  1.00 76.54  ? 170  LEU D CA  1 
ATOM   10321 C C   . LEU D 1 169 ? 20.538  -31.959 71.079  1.00 76.51  ? 170  LEU D C   1 
ATOM   10322 O O   . LEU D 1 169 ? 21.744  -32.180 71.011  1.00 90.22  ? 170  LEU D O   1 
ATOM   10323 C CB  . LEU D 1 169 ? 19.677  -29.629 70.865  1.00 63.98  ? 170  LEU D CB  1 
ATOM   10324 C CG  . LEU D 1 169 ? 20.966  -28.917 71.284  1.00 43.11  ? 170  LEU D CG  1 
ATOM   10325 C CD1 . LEU D 1 169 ? 21.688  -28.353 70.068  1.00 30.67  ? 170  LEU D CD1 1 
ATOM   10326 C CD2 . LEU D 1 169 ? 20.692  -27.825 72.306  1.00 39.03  ? 170  LEU D CD2 1 
ATOM   10327 N N   . LEU D 1 170 ? 19.738  -32.562 71.954  1.00 63.83  ? 171  LEU D N   1 
ATOM   10328 C CA  . LEU D 1 170 ? 20.244  -33.562 72.887  1.00 66.77  ? 171  LEU D CA  1 
ATOM   10329 C C   . LEU D 1 170 ? 20.789  -34.775 72.149  1.00 74.38  ? 171  LEU D C   1 
ATOM   10330 O O   . LEU D 1 170 ? 21.856  -35.285 72.493  1.00 67.92  ? 171  LEU D O   1 
ATOM   10331 C CB  . LEU D 1 170 ? 19.156  -34.000 73.867  1.00 62.49  ? 171  LEU D CB  1 
ATOM   10332 C CG  . LEU D 1 170 ? 19.538  -35.165 74.782  1.00 56.91  ? 171  LEU D CG  1 
ATOM   10333 C CD1 . LEU D 1 170 ? 20.724  -34.799 75.661  1.00 64.72  ? 171  LEU D CD1 1 
ATOM   10334 C CD2 . LEU D 1 170 ? 18.355  -35.584 75.626  1.00 49.75  ? 171  LEU D CD2 1 
ATOM   10335 N N   . GLU D 1 171 ? 20.054  -35.234 71.139  1.00 78.64  ? 172  GLU D N   1 
ATOM   10336 C CA  . GLU D 1 171 ? 20.508  -36.370 70.340  1.00 75.82  ? 172  GLU D CA  1 
ATOM   10337 C C   . GLU D 1 171 ? 21.857  -36.081 69.679  1.00 77.58  ? 172  GLU D C   1 
ATOM   10338 O O   . GLU D 1 171 ? 22.822  -36.838 69.852  1.00 75.35  ? 172  GLU D O   1 
ATOM   10339 C CB  . GLU D 1 171 ? 19.468  -36.743 69.281  1.00 77.24  ? 172  GLU D CB  1 
ATOM   10340 C CG  . GLU D 1 171 ? 18.134  -37.201 69.847  1.00 89.03  ? 172  GLU D CG  1 
ATOM   10341 C CD  . GLU D 1 171 ? 17.193  -37.714 68.774  1.00 100.71 ? 172  GLU D CD  1 
ATOM   10342 O OE1 . GLU D 1 171 ? 17.621  -37.813 67.604  1.00 106.81 ? 172  GLU D OE1 1 
ATOM   10343 O OE2 . GLU D 1 171 ? 16.027  -38.020 69.101  1.00 97.15  ? 172  GLU D OE2 1 
ATOM   10344 N N   . ARG D 1 172 ? 21.921  -34.977 68.937  1.00 81.24  ? 173  ARG D N   1 
ATOM   10345 C CA  . ARG D 1 172 ? 23.152  -34.592 68.249  1.00 81.45  ? 173  ARG D CA  1 
ATOM   10346 C C   . ARG D 1 172 ? 24.331  -34.381 69.204  1.00 68.43  ? 173  ARG D C   1 
ATOM   10347 O O   . ARG D 1 172 ? 25.460  -34.772 68.903  1.00 58.65  ? 173  ARG D O   1 
ATOM   10348 C CB  . ARG D 1 172 ? 22.932  -33.332 67.408  1.00 95.66  ? 173  ARG D CB  1 
ATOM   10349 C CG  . ARG D 1 172 ? 22.056  -33.540 66.182  1.00 111.05 ? 173  ARG D CG  1 
ATOM   10350 C CD  . ARG D 1 172 ? 22.005  -32.286 65.320  1.00 125.12 ? 173  ARG D CD  1 
ATOM   10351 N NE  . ARG D 1 172 ? 23.340  -31.839 64.932  1.00 141.32 ? 173  ARG D NE  1 
ATOM   10352 C CZ  . ARG D 1 172 ? 23.996  -32.281 63.863  1.00 149.60 ? 173  ARG D CZ  1 
ATOM   10353 N NH1 . ARG D 1 172 ? 23.439  -33.185 63.068  1.00 155.00 ? 173  ARG D NH1 1 
ATOM   10354 N NH2 . ARG D 1 172 ? 25.209  -31.821 63.588  1.00 147.29 ? 173  ARG D NH2 1 
ATOM   10355 N N   . LEU D 1 173 ? 24.063  -33.766 70.353  1.00 67.84  ? 174  LEU D N   1 
ATOM   10356 C CA  . LEU D 1 173 ? 25.118  -33.443 71.313  1.00 68.36  ? 174  LEU D CA  1 
ATOM   10357 C C   . LEU D 1 173 ? 25.630  -34.666 72.066  1.00 68.43  ? 174  LEU D C   1 
ATOM   10358 O O   . LEU D 1 173 ? 26.808  -34.737 72.402  1.00 58.98  ? 174  LEU D O   1 
ATOM   10359 C CB  . LEU D 1 173 ? 24.664  -32.357 72.296  1.00 64.21  ? 174  LEU D CB  1 
ATOM   10360 C CG  . LEU D 1 173 ? 24.709  -30.921 71.770  1.00 66.44  ? 174  LEU D CG  1 
ATOM   10361 C CD1 . LEU D 1 173 ? 24.347  -29.924 72.863  1.00 80.26  ? 174  LEU D CD1 1 
ATOM   10362 C CD2 . LEU D 1 173 ? 26.080  -30.614 71.187  1.00 59.81  ? 174  LEU D CD2 1 
ATOM   10363 N N   . PHE D 1 174 ? 24.745  -35.619 72.340  1.00 82.44  ? 175  PHE D N   1 
ATOM   10364 C CA  . PHE D 1 174 ? 25.161  -36.864 72.970  1.00 69.27  ? 175  PHE D CA  1 
ATOM   10365 C C   . PHE D 1 174 ? 25.989  -37.654 71.972  1.00 64.37  ? 175  PHE D C   1 
ATOM   10366 O O   . PHE D 1 174 ? 27.054  -38.195 72.310  1.00 65.84  ? 175  PHE D O   1 
ATOM   10367 C CB  . PHE D 1 174 ? 23.953  -37.687 73.405  1.00 53.67  ? 175  PHE D CB  1 
ATOM   10368 C CG  . PHE D 1 174 ? 24.285  -38.767 74.393  1.00 59.35  ? 175  PHE D CG  1 
ATOM   10369 C CD1 . PHE D 1 174 ? 24.332  -38.494 75.752  1.00 66.95  ? 175  PHE D CD1 1 
ATOM   10370 C CD2 . PHE D 1 174 ? 24.555  -40.052 73.963  1.00 71.45  ? 175  PHE D CD2 1 
ATOM   10371 C CE1 . PHE D 1 174 ? 24.641  -39.489 76.662  1.00 73.74  ? 175  PHE D CE1 1 
ATOM   10372 C CE2 . PHE D 1 174 ? 24.863  -41.048 74.865  1.00 80.49  ? 175  PHE D CE2 1 
ATOM   10373 C CZ  . PHE D 1 174 ? 24.907  -40.768 76.216  1.00 80.33  ? 175  PHE D CZ  1 
ATOM   10374 N N   . LYS D 1 175 ? 25.495  -37.700 70.737  1.00 58.55  ? 176  LYS D N   1 
ATOM   10375 C CA  . LYS D 1 175 ? 26.187  -38.391 69.660  1.00 54.70  ? 176  LYS D CA  1 
ATOM   10376 C C   . LYS D 1 175 ? 27.568  -37.789 69.409  1.00 52.99  ? 176  LYS D C   1 
ATOM   10377 O O   . LYS D 1 175 ? 28.489  -38.496 69.008  1.00 59.03  ? 176  LYS D O   1 
ATOM   10378 C CB  . LYS D 1 175 ? 25.347  -38.342 68.387  1.00 61.34  ? 176  LYS D CB  1 
ATOM   10379 C CG  . LYS D 1 175 ? 25.778  -39.328 67.316  1.00 77.85  ? 176  LYS D CG  1 
ATOM   10380 C CD  . LYS D 1 175 ? 24.719  -39.444 66.230  1.00 92.99  ? 176  LYS D CD  1 
ATOM   10381 C CE  . LYS D 1 175 ? 25.036  -40.572 65.265  1.00 97.93  ? 176  LYS D CE  1 
ATOM   10382 N NZ  . LYS D 1 175 ? 23.942  -40.781 64.278  1.00 91.88  ? 176  LYS D NZ  1 
ATOM   10383 N N   . GLN D 1 176 ? 27.708  -36.486 69.644  1.00 66.32  ? 177  GLN D N   1 
ATOM   10384 C CA  . GLN D 1 176 ? 29.000  -35.813 69.486  1.00 74.28  ? 177  GLN D CA  1 
ATOM   10385 C C   . GLN D 1 176 ? 29.934  -36.016 70.679  1.00 81.51  ? 177  GLN D C   1 
ATOM   10386 O O   . GLN D 1 176 ? 31.133  -36.240 70.508  1.00 85.63  ? 177  GLN D O   1 
ATOM   10387 C CB  . GLN D 1 176 ? 28.808  -34.318 69.227  1.00 86.17  ? 177  GLN D CB  1 
ATOM   10388 C CG  . GLN D 1 176 ? 28.372  -33.981 67.812  1.00 101.10 ? 177  GLN D CG  1 
ATOM   10389 C CD  . GLN D 1 176 ? 28.291  -32.488 67.573  1.00 97.00  ? 177  GLN D CD  1 
ATOM   10390 O OE1 . GLN D 1 176 ? 28.416  -31.694 68.504  1.00 92.35  ? 177  GLN D OE1 1 
ATOM   10391 N NE2 . GLN D 1 176 ? 28.086  -32.098 66.321  1.00 94.26  ? 177  GLN D NE2 1 
ATOM   10392 N N   . LEU D 1 177 ? 29.381  -35.935 71.885  1.00 81.73  ? 178  LEU D N   1 
ATOM   10393 C CA  . LEU D 1 177 ? 30.168  -36.118 73.099  1.00 84.71  ? 178  LEU D CA  1 
ATOM   10394 C C   . LEU D 1 177 ? 30.657  -37.554 73.237  1.00 88.38  ? 178  LEU D C   1 
ATOM   10395 O O   . LEU D 1 177 ? 31.606  -37.824 73.979  1.00 80.69  ? 178  LEU D O   1 
ATOM   10396 C CB  . LEU D 1 177 ? 29.369  -35.713 74.335  1.00 81.95  ? 178  LEU D CB  1 
ATOM   10397 C CG  . LEU D 1 177 ? 29.266  -34.208 74.563  1.00 82.18  ? 178  LEU D CG  1 
ATOM   10398 C CD1 . LEU D 1 177 ? 28.602  -33.933 75.899  1.00 85.33  ? 178  LEU D CD1 1 
ATOM   10399 C CD2 . LEU D 1 177 ? 30.643  -33.561 74.495  1.00 74.24  ? 178  LEU D CD2 1 
ATOM   10400 N N   . HIS D 1 178 ? 30.003  -38.472 72.527  1.00 88.22  ? 179  HIS D N   1 
ATOM   10401 C CA  . HIS D 1 178 ? 30.485  -39.848 72.444  1.00 82.21  ? 179  HIS D CA  1 
ATOM   10402 C C   . HIS D 1 178 ? 30.673  -40.240 70.978  1.00 89.92  ? 179  HIS D C   1 
ATOM   10403 O O   . HIS D 1 178 ? 29.864  -40.984 70.418  1.00 91.67  ? 179  HIS D O   1 
ATOM   10404 C CB  . HIS D 1 178 ? 29.516  -40.806 73.140  1.00 76.12  ? 179  HIS D CB  1 
ATOM   10405 C CG  . HIS D 1 178 ? 29.297  -40.502 74.592  1.00 72.13  ? 179  HIS D CG  1 
ATOM   10406 N ND1 . HIS D 1 178 ? 30.271  -40.688 75.548  1.00 68.92  ? 179  HIS D ND1 1 
ATOM   10407 C CD2 . HIS D 1 178 ? 28.208  -40.039 75.250  1.00 68.22  ? 179  HIS D CD2 1 
ATOM   10408 C CE1 . HIS D 1 178 ? 29.796  -40.344 76.732  1.00 64.69  ? 179  HIS D CE1 1 
ATOM   10409 N NE2 . HIS D 1 178 ? 28.545  -39.948 76.579  1.00 64.84  ? 179  HIS D NE2 1 
ATOM   10410 N N   . PRO D 1 179 ? 31.750  -39.733 70.353  1.00 87.63  ? 180  PRO D N   1 
ATOM   10411 C CA  . PRO D 1 179 ? 32.030  -39.936 68.927  1.00 89.29  ? 180  PRO D CA  1 
ATOM   10412 C C   . PRO D 1 179 ? 32.421  -41.378 68.610  1.00 99.12  ? 180  PRO D C   1 
ATOM   10413 O O   . PRO D 1 179 ? 32.242  -41.831 67.478  1.00 105.56 ? 180  PRO D O   1 
ATOM   10414 C CB  . PRO D 1 179 ? 33.217  -39.002 68.676  1.00 86.69  ? 180  PRO D CB  1 
ATOM   10415 C CG  . PRO D 1 179 ? 33.920  -38.948 69.979  1.00 82.78  ? 180  PRO D CG  1 
ATOM   10416 C CD  . PRO D 1 179 ? 32.834  -38.988 71.019  1.00 84.92  ? 180  PRO D CD  1 
ATOM   10417 N N   . GLN D 1 180 ? 32.949  -42.082 69.606  1.00 95.69  ? 181  GLN D N   1 
ATOM   10418 C CA  . GLN D 1 180 ? 33.411  -43.455 69.428  1.00 91.69  ? 181  GLN D CA  1 
ATOM   10419 C C   . GLN D 1 180 ? 32.258  -44.453 69.419  1.00 88.67  ? 181  GLN D C   1 
ATOM   10420 O O   . GLN D 1 180 ? 32.345  -45.511 68.795  1.00 102.30 ? 181  GLN D O   1 
ATOM   10421 C CB  . GLN D 1 180 ? 34.403  -43.821 70.532  1.00 100.46 ? 181  GLN D CB  1 
ATOM   10422 C CG  . GLN D 1 180 ? 33.904  -43.490 71.927  1.00 108.17 ? 181  GLN D CG  1 
ATOM   10423 C CD  . GLN D 1 180 ? 34.867  -43.907 73.020  1.00 119.88 ? 181  GLN D CD  1 
ATOM   10424 O OE1 . GLN D 1 180 ? 36.083  -43.920 72.825  1.00 121.85 ? 181  GLN D OE1 1 
ATOM   10425 N NE2 . GLN D 1 180 ? 34.323  -44.258 74.180  1.00 122.65 ? 181  GLN D NE2 1 
ATOM   10426 N N   . LEU D 1 181 ? 31.179  -44.106 70.114  1.00 82.67  ? 182  LEU D N   1 
ATOM   10427 C CA  . LEU D 1 181 ? 30.039  -45.002 70.279  1.00 85.99  ? 182  LEU D CA  1 
ATOM   10428 C C   . LEU D 1 181 ? 29.226  -45.183 68.999  1.00 94.49  ? 182  LEU D C   1 
ATOM   10429 O O   . LEU D 1 181 ? 29.104  -44.264 68.189  1.00 93.07  ? 182  LEU D O   1 
ATOM   10430 C CB  . LEU D 1 181 ? 29.124  -44.495 71.399  1.00 84.51  ? 182  LEU D CB  1 
ATOM   10431 C CG  . LEU D 1 181 ? 29.386  -44.935 72.843  1.00 78.49  ? 182  LEU D CG  1 
ATOM   10432 C CD1 . LEU D 1 181 ? 30.788  -44.575 73.296  1.00 79.52  ? 182  LEU D CD1 1 
ATOM   10433 C CD2 . LEU D 1 181 ? 28.356  -44.312 73.772  1.00 78.45  ? 182  LEU D CD2 1 
ATOM   10434 N N   . LEU D 1 182 ? 28.674  -46.380 68.826  1.00 106.87 ? 183  LEU D N   1 
ATOM   10435 C CA  . LEU D 1 182 ? 27.719  -46.642 67.757  1.00 120.27 ? 183  LEU D CA  1 
ATOM   10436 C C   . LEU D 1 182 ? 26.306  -46.451 68.290  1.00 122.42 ? 183  LEU D C   1 
ATOM   10437 O O   . LEU D 1 182 ? 25.877  -47.161 69.200  1.00 128.71 ? 183  LEU D O   1 
ATOM   10438 C CB  . LEU D 1 182 ? 27.883  -48.063 67.214  1.00 132.66 ? 183  LEU D CB  1 
ATOM   10439 C CG  . LEU D 1 182 ? 26.721  -48.623 66.384  1.00 137.94 ? 183  LEU D CG  1 
ATOM   10440 C CD1 . LEU D 1 182 ? 26.523  -47.835 65.096  1.00 133.52 ? 183  LEU D CD1 1 
ATOM   10441 C CD2 . LEU D 1 182 ? 26.926  -50.104 66.089  1.00 143.27 ? 183  LEU D CD2 1 
ATOM   10442 N N   . LEU D 1 183 ? 25.586  -45.489 67.725  1.00 116.61 ? 184  LEU D N   1 
ATOM   10443 C CA  . LEU D 1 183 ? 24.225  -45.213 68.163  1.00 111.46 ? 184  LEU D CA  1 
ATOM   10444 C C   . LEU D 1 183 ? 23.230  -45.353 67.014  1.00 121.23 ? 184  LEU D C   1 
ATOM   10445 O O   . LEU D 1 183 ? 22.934  -44.380 66.319  1.00 126.62 ? 184  LEU D O   1 
ATOM   10446 C CB  . LEU D 1 183 ? 24.130  -43.828 68.806  1.00 97.93  ? 184  LEU D CB  1 
ATOM   10447 C CG  . LEU D 1 183 ? 24.971  -43.644 70.072  1.00 92.39  ? 184  LEU D CG  1 
ATOM   10448 C CD1 . LEU D 1 183 ? 24.839  -42.228 70.604  1.00 89.74  ? 184  LEU D CD1 1 
ATOM   10449 C CD2 . LEU D 1 183 ? 24.578  -44.657 71.137  1.00 93.64  ? 184  LEU D CD2 1 
ATOM   10450 N N   . PRO D 1 184 ? 22.705  -46.576 66.826  1.00 126.45 ? 185  PRO D N   1 
ATOM   10451 C CA  . PRO D 1 184 ? 21.739  -46.972 65.792  1.00 126.15 ? 185  PRO D CA  1 
ATOM   10452 C C   . PRO D 1 184 ? 20.429  -46.191 65.859  1.00 119.14 ? 185  PRO D C   1 
ATOM   10453 O O   . PRO D 1 184 ? 19.618  -46.322 64.949  1.00 120.76 ? 185  PRO D O   1 
ATOM   10454 C CB  . PRO D 1 184 ? 21.489  -48.455 66.090  1.00 134.58 ? 185  PRO D CB  1 
ATOM   10455 C CG  . PRO D 1 184 ? 21.876  -48.632 67.511  1.00 138.36 ? 185  PRO D CG  1 
ATOM   10456 C CD  . PRO D 1 184 ? 23.029  -47.704 67.716  1.00 136.14 ? 185  PRO D CD  1 
ATOM   10457 N N   . ASP D 1 185 ? 20.232  -45.452 66.950  1.00 114.51 ? 186  ASP D N   1 
ATOM   10458 C CA  . ASP D 1 185 ? 19.062  -44.599 67.228  1.00 122.63 ? 186  ASP D CA  1 
ATOM   10459 C C   . ASP D 1 185 ? 17.885  -45.328 67.879  1.00 125.98 ? 186  ASP D C   1 
ATOM   10460 O O   . ASP D 1 185 ? 16.950  -44.692 68.382  1.00 125.16 ? 186  ASP D O   1 
ATOM   10461 C CB  . ASP D 1 185 ? 18.642  -43.701 66.037  1.00 128.57 ? 186  ASP D CB  1 
ATOM   10462 C CG  . ASP D 1 185 ? 17.561  -44.325 65.153  1.00 126.33 ? 186  ASP D CG  1 
ATOM   10463 O OD1 . ASP D 1 185 ? 16.410  -44.488 65.612  1.00 129.41 ? 186  ASP D OD1 1 
ATOM   10464 O OD2 . ASP D 1 185 ? 17.852  -44.609 63.971  1.00 120.95 ? 186  ASP D OD2 1 
ATOM   10465 N N   . ASP D 1 186 ? 17.957  -46.655 67.909  1.00 133.74 ? 187  ASP D N   1 
ATOM   10466 C CA  . ASP D 1 186 ? 17.099  -47.422 68.795  1.00 136.47 ? 187  ASP D CA  1 
ATOM   10467 C C   . ASP D 1 186 ? 17.525  -47.039 70.202  1.00 124.32 ? 187  ASP D C   1 
ATOM   10468 O O   . ASP D 1 186 ? 16.711  -46.971 71.121  1.00 116.96 ? 187  ASP D O   1 
ATOM   10469 C CB  . ASP D 1 186 ? 17.295  -48.922 68.577  1.00 151.38 ? 187  ASP D CB  1 
ATOM   10470 C CG  . ASP D 1 186 ? 16.043  -49.604 68.062  1.00 161.88 ? 187  ASP D CG  1 
ATOM   10471 O OD1 . ASP D 1 186 ? 14.962  -48.983 68.129  1.00 154.84 ? 187  ASP D OD1 1 
ATOM   10472 O OD2 . ASP D 1 186 ? 16.140  -50.760 67.596  1.00 173.29 ? 187  ASP D OD2 1 
ATOM   10473 N N   . TYR D 1 187 ? 18.821  -46.779 70.343  1.00 113.40 ? 188  TYR D N   1 
ATOM   10474 C CA  . TYR D 1 187 ? 19.410  -46.309 71.585  1.00 94.47  ? 188  TYR D CA  1 
ATOM   10475 C C   . TYR D 1 187 ? 19.048  -44.844 71.808  1.00 89.43  ? 188  TYR D C   1 
ATOM   10476 O O   . TYR D 1 187 ? 18.829  -44.417 72.939  1.00 92.05  ? 188  TYR D O   1 
ATOM   10477 C CB  . TYR D 1 187 ? 20.930  -46.462 71.513  1.00 80.71  ? 188  TYR D CB  1 
ATOM   10478 C CG  . TYR D 1 187 ? 21.631  -46.448 72.851  1.00 77.31  ? 188  TYR D CG  1 
ATOM   10479 C CD1 . TYR D 1 187 ? 21.827  -45.260 73.542  1.00 79.51  ? 188  TYR D CD1 1 
ATOM   10480 C CD2 . TYR D 1 187 ? 22.111  -47.622 73.414  1.00 80.41  ? 188  TYR D CD2 1 
ATOM   10481 C CE1 . TYR D 1 187 ? 22.469  -45.244 74.760  1.00 83.01  ? 188  TYR D CE1 1 
ATOM   10482 C CE2 . TYR D 1 187 ? 22.756  -47.616 74.631  1.00 81.30  ? 188  TYR D CE2 1 
ATOM   10483 C CZ  . TYR D 1 187 ? 22.932  -46.425 75.299  1.00 79.76  ? 188  TYR D CZ  1 
ATOM   10484 O OH  . TYR D 1 187 ? 23.574  -46.416 76.512  1.00 71.98  ? 188  TYR D OH  1 
ATOM   10485 N N   . LEU D 1 188 ? 18.991  -44.075 70.723  1.00 85.45  ? 189  LEU D N   1 
ATOM   10486 C CA  . LEU D 1 188 ? 18.703  -42.644 70.815  1.00 80.78  ? 189  LEU D CA  1 
ATOM   10487 C C   . LEU D 1 188 ? 17.277  -42.352 71.267  1.00 80.96  ? 189  LEU D C   1 
ATOM   10488 O O   . LEU D 1 188 ? 17.045  -41.383 71.988  1.00 84.68  ? 189  LEU D O   1 
ATOM   10489 C CB  . LEU D 1 188 ? 18.991  -41.925 69.494  1.00 68.81  ? 189  LEU D CB  1 
ATOM   10490 C CG  . LEU D 1 188 ? 20.459  -41.716 69.120  1.00 65.93  ? 189  LEU D CG  1 
ATOM   10491 C CD1 . LEU D 1 188 ? 20.572  -41.064 67.751  1.00 59.11  ? 189  LEU D CD1 1 
ATOM   10492 C CD2 . LEU D 1 188 ? 21.171  -40.880 70.173  1.00 49.67  ? 189  LEU D CD2 1 
ATOM   10493 N N   . ASP D 1 189 ? 16.323  -43.175 70.836  1.00 76.96  ? 190  ASP D N   1 
ATOM   10494 C CA  . ASP D 1 189 ? 14.942  -43.012 71.289  1.00 84.89  ? 190  ASP D CA  1 
ATOM   10495 C C   . ASP D 1 189 ? 14.829  -43.262 72.791  1.00 87.88  ? 190  ASP D C   1 
ATOM   10496 O O   . ASP D 1 189 ? 14.197  -42.486 73.521  1.00 84.51  ? 190  ASP D O   1 
ATOM   10497 C CB  . ASP D 1 189 ? 13.997  -43.933 70.515  1.00 92.10  ? 190  ASP D CB  1 
ATOM   10498 C CG  . ASP D 1 189 ? 13.787  -43.477 69.083  1.00 95.71  ? 190  ASP D CG  1 
ATOM   10499 O OD1 . ASP D 1 189 ? 14.727  -42.889 68.508  1.00 106.17 ? 190  ASP D OD1 1 
ATOM   10500 O OD2 . ASP D 1 189 ? 12.685  -43.698 68.537  1.00 86.78  ? 190  ASP D OD2 1 
ATOM   10501 N N   . CYS D 1 190 ? 15.454  -44.345 73.244  1.00 92.64  ? 191  CYS D N   1 
ATOM   10502 C CA  . CYS D 1 190 ? 15.476  -44.684 74.660  1.00 91.79  ? 191  CYS D CA  1 
ATOM   10503 C C   . CYS D 1 190 ? 16.164  -43.576 75.446  1.00 86.51  ? 191  CYS D C   1 
ATOM   10504 O O   . CYS D 1 190 ? 15.766  -43.253 76.562  1.00 88.52  ? 191  CYS D O   1 
ATOM   10505 C CB  . CYS D 1 190 ? 16.195  -46.016 74.878  1.00 83.70  ? 191  CYS D CB  1 
ATOM   10506 S SG  . CYS D 1 190 ? 16.560  -46.387 76.606  1.00 96.45  ? 191  CYS D SG  1 
ATOM   10507 N N   . LEU D 1 191 ? 17.199  -42.998 74.845  1.00 76.69  ? 192  LEU D N   1 
ATOM   10508 C CA  . LEU D 1 191 ? 17.934  -41.888 75.437  1.00 78.99  ? 192  LEU D CA  1 
ATOM   10509 C C   . LEU D 1 191 ? 17.024  -40.680 75.611  1.00 69.08  ? 192  LEU D C   1 
ATOM   10510 O O   . LEU D 1 191 ? 17.044  -40.014 76.649  1.00 60.58  ? 192  LEU D O   1 
ATOM   10511 C CB  . LEU D 1 191 ? 19.124  -41.518 74.551  1.00 71.61  ? 192  LEU D CB  1 
ATOM   10512 C CG  . LEU D 1 191 ? 19.826  -40.187 74.818  1.00 63.71  ? 192  LEU D CG  1 
ATOM   10513 C CD1 . LEU D 1 191 ? 20.414  -40.168 76.214  1.00 72.07  ? 192  LEU D CD1 1 
ATOM   10514 C CD2 . LEU D 1 191 ? 20.905  -39.936 73.776  1.00 59.96  ? 192  LEU D CD2 1 
ATOM   10515 N N   . GLY D 1 192 ? 16.222  -40.408 74.587  1.00 65.16  ? 193  GLY D N   1 
ATOM   10516 C CA  . GLY D 1 192 ? 15.254  -39.331 74.641  1.00 68.42  ? 193  GLY D CA  1 
ATOM   10517 C C   . GLY D 1 192 ? 14.202  -39.596 75.698  1.00 81.81  ? 193  GLY D C   1 
ATOM   10518 O O   . GLY D 1 192 ? 13.613  -38.666 76.247  1.00 101.81 ? 193  GLY D O   1 
ATOM   10519 N N   . LYS D 1 193 ? 13.956  -40.872 75.978  1.00 75.56  ? 194  LYS D N   1 
ATOM   10520 C CA  . LYS D 1 193 ? 13.022  -41.239 77.037  1.00 74.68  ? 194  LYS D CA  1 
ATOM   10521 C C   . LYS D 1 193 ? 13.652  -41.138 78.432  1.00 70.61  ? 194  LYS D C   1 
ATOM   10522 O O   . LYS D 1 193 ? 12.952  -40.917 79.419  1.00 54.10  ? 194  LYS D O   1 
ATOM   10523 C CB  . LYS D 1 193 ? 12.431  -42.625 76.777  1.00 70.58  ? 194  LYS D CB  1 
ATOM   10524 C CG  . LYS D 1 193 ? 11.457  -42.646 75.607  1.00 67.31  ? 194  LYS D CG  1 
ATOM   10525 C CD  . LYS D 1 193 ? 11.597  -43.913 74.784  1.00 89.39  ? 194  LYS D CD  1 
ATOM   10526 C CE  . LYS D 1 193 ? 10.669  -43.898 73.579  1.00 95.49  ? 194  LYS D CE  1 
ATOM   10527 N NZ  . LYS D 1 193 ? 10.799  -45.141 72.767  1.00 93.94  ? 194  LYS D NZ  1 
ATOM   10528 N N   . GLN D 1 194 ? 14.972  -41.286 78.504  1.00 79.11  ? 195  GLN D N   1 
ATOM   10529 C CA  . GLN D 1 194 ? 15.710  -41.103 79.754  1.00 81.54  ? 195  GLN D CA  1 
ATOM   10530 C C   . GLN D 1 194 ? 15.905  -39.616 80.030  1.00 80.30  ? 195  GLN D C   1 
ATOM   10531 O O   . GLN D 1 194 ? 16.174  -39.206 81.164  1.00 66.47  ? 195  GLN D O   1 
ATOM   10532 C CB  . GLN D 1 194 ? 17.077  -41.788 79.678  1.00 71.08  ? 195  GLN D CB  1 
ATOM   10533 C CG  . GLN D 1 194 ? 17.033  -43.307 79.625  1.00 75.04  ? 195  GLN D CG  1 
ATOM   10534 C CD  . GLN D 1 194 ? 16.737  -43.933 80.973  1.00 73.81  ? 195  GLN D CD  1 
ATOM   10535 O OE1 . GLN D 1 194 ? 15.584  -44.007 81.396  1.00 60.82  ? 195  GLN D OE1 1 
ATOM   10536 N NE2 . GLN D 1 194 ? 17.781  -44.387 81.657  1.00 72.01  ? 195  GLN D NE2 1 
ATOM   10537 N N   . ALA D 1 195 ? 15.764  -38.818 78.976  1.00 80.95  ? 196  ALA D N   1 
ATOM   10538 C CA  . ALA D 1 195 ? 15.978  -37.377 79.035  1.00 81.05  ? 196  ALA D CA  1 
ATOM   10539 C C   . ALA D 1 195 ? 15.127  -36.676 80.090  1.00 78.54  ? 196  ALA D C   1 
ATOM   10540 O O   . ALA D 1 195 ? 15.642  -35.905 80.897  1.00 88.70  ? 196  ALA D O   1 
ATOM   10541 C CB  . ALA D 1 195 ? 15.730  -36.762 77.671  1.00 87.26  ? 196  ALA D CB  1 
ATOM   10542 N N   . GLU D 1 196 ? 13.824  -36.939 80.077  1.00 66.26  ? 197  GLU D N   1 
ATOM   10543 C CA  . GLU D 1 196 ? 12.904  -36.254 80.983  1.00 82.92  ? 197  GLU D CA  1 
ATOM   10544 C C   . GLU D 1 196 ? 13.177  -36.562 82.455  1.00 80.72  ? 197  GLU D C   1 
ATOM   10545 O O   . GLU D 1 196 ? 12.980  -35.712 83.323  1.00 89.50  ? 197  GLU D O   1 
ATOM   10546 C CB  . GLU D 1 196 ? 11.447  -36.573 80.633  1.00 103.96 ? 197  GLU D CB  1 
ATOM   10547 C CG  . GLU D 1 196 ? 10.955  -35.914 79.349  1.00 118.96 ? 197  GLU D CG  1 
ATOM   10548 C CD  . GLU D 1 196 ? 10.877  -34.399 79.455  1.00 124.47 ? 197  GLU D CD  1 
ATOM   10549 O OE1 . GLU D 1 196 ? 10.732  -33.887 80.586  1.00 123.66 ? 197  GLU D OE1 1 
ATOM   10550 O OE2 . GLU D 1 196 ? 10.960  -33.720 78.409  1.00 122.52 ? 197  GLU D OE2 1 
ATOM   10551 N N   . ALA D 1 197 ? 13.627  -37.780 82.732  1.00 81.10  ? 198  ALA D N   1 
ATOM   10552 C CA  . ALA D 1 197 ? 13.925  -38.184 84.100  1.00 84.08  ? 198  ALA D CA  1 
ATOM   10553 C C   . ALA D 1 197 ? 15.276  -37.653 84.569  1.00 91.95  ? 198  ALA D C   1 
ATOM   10554 O O   . ALA D 1 197 ? 15.408  -37.181 85.699  1.00 95.10  ? 198  ALA D O   1 
ATOM   10555 C CB  . ALA D 1 197 ? 13.882  -39.695 84.224  1.00 78.65  ? 198  ALA D CB  1 
ATOM   10556 N N   . LEU D 1 198 ? 16.277  -37.734 83.696  1.00 89.56  ? 199  LEU D N   1 
ATOM   10557 C CA  . LEU D 1 198 ? 17.645  -37.372 84.066  1.00 85.80  ? 199  LEU D CA  1 
ATOM   10558 C C   . LEU D 1 198 ? 17.915  -35.868 84.064  1.00 88.01  ? 199  LEU D C   1 
ATOM   10559 O O   . LEU D 1 198 ? 18.765  -35.389 84.816  1.00 91.73  ? 199  LEU D O   1 
ATOM   10560 C CB  . LEU D 1 198 ? 18.647  -38.082 83.157  1.00 86.35  ? 199  LEU D CB  1 
ATOM   10561 C CG  . LEU D 1 198 ? 18.633  -39.607 83.246  1.00 91.12  ? 199  LEU D CG  1 
ATOM   10562 C CD1 . LEU D 1 198 ? 19.739  -40.199 82.391  1.00 97.84  ? 199  LEU D CD1 1 
ATOM   10563 C CD2 . LEU D 1 198 ? 18.761  -40.059 84.692  1.00 87.11  ? 199  LEU D CD2 1 
ATOM   10564 N N   . ARG D 1 199 ? 17.190  -35.139 83.219  1.00 85.69  ? 200  ARG D N   1 
ATOM   10565 C CA  . ARG D 1 199 ? 17.364  -33.693 83.061  1.00 81.19  ? 200  ARG D CA  1 
ATOM   10566 C C   . ARG D 1 199 ? 18.804  -33.319 82.704  1.00 75.69  ? 200  ARG D C   1 
ATOM   10567 O O   . ARG D 1 199 ? 19.507  -32.709 83.510  1.00 72.53  ? 200  ARG D O   1 
ATOM   10568 C CB  . ARG D 1 199 ? 16.926  -32.957 84.330  1.00 86.84  ? 200  ARG D CB  1 
ATOM   10569 C CG  . ARG D 1 199 ? 15.592  -33.428 84.877  1.00 99.67  ? 200  ARG D CG  1 
ATOM   10570 C CD  . ARG D 1 199 ? 15.525  -33.265 86.384  1.00 118.96 ? 200  ARG D CD  1 
ATOM   10571 N NE  . ARG D 1 199 ? 14.468  -34.086 86.966  1.00 134.50 ? 200  ARG D NE  1 
ATOM   10572 C CZ  . ARG D 1 199 ? 13.230  -33.661 87.193  1.00 143.22 ? 200  ARG D CZ  1 
ATOM   10573 N NH1 . ARG D 1 199 ? 12.889  -32.414 86.894  1.00 144.41 ? 200  ARG D NH1 1 
ATOM   10574 N NH2 . ARG D 1 199 ? 12.333  -34.481 87.723  1.00 146.22 ? 200  ARG D NH2 1 
ATOM   10575 N N   . PRO D 1 200 ? 19.244  -33.681 81.488  1.00 65.21  ? 201  PRO D N   1 
ATOM   10576 C CA  . PRO D 1 200 ? 20.627  -33.438 81.064  1.00 53.51  ? 201  PRO D CA  1 
ATOM   10577 C C   . PRO D 1 200 ? 20.942  -31.957 80.860  1.00 68.80  ? 201  PRO D C   1 
ATOM   10578 O O   . PRO D 1 200 ? 22.101  -31.557 80.984  1.00 68.41  ? 201  PRO D O   1 
ATOM   10579 C CB  . PRO D 1 200 ? 20.715  -34.185 79.730  1.00 43.28  ? 201  PRO D CB  1 
ATOM   10580 C CG  . PRO D 1 200 ? 19.327  -34.191 79.213  1.00 53.72  ? 201  PRO D CG  1 
ATOM   10581 C CD  . PRO D 1 200 ? 18.445  -34.311 80.421  1.00 59.46  ? 201  PRO D CD  1 
ATOM   10582 N N   . PHE D 1 201 ? 19.928  -31.163 80.538  1.00 74.93  ? 202  PHE D N   1 
ATOM   10583 C CA  . PHE D 1 201 ? 20.118  -29.748 80.233  1.00 58.33  ? 202  PHE D CA  1 
ATOM   10584 C C   . PHE D 1 201 ? 19.923  -28.812 81.428  1.00 55.09  ? 202  PHE D C   1 
ATOM   10585 O O   . PHE D 1 201 ? 20.175  -27.613 81.323  1.00 68.28  ? 202  PHE D O   1 
ATOM   10586 C CB  . PHE D 1 201 ? 19.211  -29.331 79.078  1.00 49.89  ? 202  PHE D CB  1 
ATOM   10587 C CG  . PHE D 1 201 ? 19.695  -29.774 77.725  1.00 44.94  ? 202  PHE D CG  1 
ATOM   10588 C CD1 . PHE D 1 201 ? 20.999  -29.532 77.334  1.00 40.90  ? 202  PHE D CD1 1 
ATOM   10589 C CD2 . PHE D 1 201 ? 18.846  -30.428 76.845  1.00 43.47  ? 202  PHE D CD2 1 
ATOM   10590 C CE1 . PHE D 1 201 ? 21.450  -29.929 76.093  1.00 47.65  ? 202  PHE D CE1 1 
ATOM   10591 C CE2 . PHE D 1 201 ? 19.294  -30.830 75.598  1.00 41.81  ? 202  PHE D CE2 1 
ATOM   10592 C CZ  . PHE D 1 201 ? 20.598  -30.580 75.224  1.00 41.72  ? 202  PHE D CZ  1 
ATOM   10593 N N   . GLY D 1 202 ? 19.465  -29.351 82.555  1.00 50.09  ? 203  GLY D N   1 
ATOM   10594 C CA  . GLY D 1 202 ? 19.246  -28.543 83.745  1.00 47.07  ? 203  GLY D CA  1 
ATOM   10595 C C   . GLY D 1 202 ? 17.909  -27.820 83.778  1.00 67.29  ? 203  GLY D C   1 
ATOM   10596 O O   . GLY D 1 202 ? 16.972  -28.194 83.075  1.00 76.19  ? 203  GLY D O   1 
ATOM   10597 N N   . GLU D 1 203 ? 17.822  -26.778 84.603  1.00 79.88  ? 204  GLU D N   1 
ATOM   10598 C CA  . GLU D 1 203 ? 16.592  -25.998 84.733  1.00 93.69  ? 204  GLU D CA  1 
ATOM   10599 C C   . GLU D 1 203 ? 16.429  -25.006 83.585  1.00 97.37  ? 204  GLU D C   1 
ATOM   10600 O O   . GLU D 1 203 ? 15.327  -24.492 83.341  1.00 110.64 ? 204  GLU D O   1 
ATOM   10601 C CB  . GLU D 1 203 ? 16.565  -25.244 86.066  1.00 100.89 ? 204  GLU D CB  1 
ATOM   10602 C CG  . GLU D 1 203 ? 16.491  -26.137 87.301  1.00 108.67 ? 204  GLU D CG  1 
ATOM   10603 C CD  . GLU D 1 203 ? 16.330  -25.346 88.591  1.00 120.26 ? 204  GLU D CD  1 
ATOM   10604 O OE1 . GLU D 1 203 ? 16.202  -24.103 88.522  1.00 119.14 ? 204  GLU D OE1 1 
ATOM   10605 O OE2 . GLU D 1 203 ? 16.329  -25.969 89.675  1.00 127.27 ? 204  GLU D OE2 1 
ATOM   10606 N N   . ALA D 1 204 ? 17.532  -24.747 82.890  1.00 86.42  ? 205  ALA D N   1 
ATOM   10607 C CA  . ALA D 1 204 ? 17.581  -23.766 81.808  1.00 87.70  ? 205  ALA D CA  1 
ATOM   10608 C C   . ALA D 1 204 ? 16.468  -23.864 80.745  1.00 92.57  ? 205  ALA D C   1 
ATOM   10609 O O   . ALA D 1 204 ? 15.895  -22.837 80.372  1.00 106.91 ? 205  ALA D O   1 
ATOM   10610 C CB  . ALA D 1 204 ? 18.973  -23.756 81.157  1.00 89.37  ? 205  ALA D CB  1 
ATOM   10611 N N   . PRO D 1 205 ? 16.162  -25.083 80.247  1.00 80.62  ? 206  PRO D N   1 
ATOM   10612 C CA  . PRO D 1 205 ? 15.091  -25.150 79.245  1.00 75.03  ? 206  PRO D CA  1 
ATOM   10613 C C   . PRO D 1 205 ? 13.726  -24.718 79.784  1.00 73.29  ? 206  PRO D C   1 
ATOM   10614 O O   . PRO D 1 205 ? 12.981  -24.049 79.069  1.00 78.28  ? 206  PRO D O   1 
ATOM   10615 C CB  . PRO D 1 205 ? 15.056  -26.636 78.868  1.00 70.17  ? 206  PRO D CB  1 
ATOM   10616 C CG  . PRO D 1 205 ? 16.418  -27.121 79.141  1.00 75.46  ? 206  PRO D CG  1 
ATOM   10617 C CD  . PRO D 1 205 ? 16.865  -26.374 80.364  1.00 76.96  ? 206  PRO D CD  1 
ATOM   10618 N N   . ARG D 1 206 ? 13.406  -25.090 81.020  1.00 69.62  ? 207  ARG D N   1 
ATOM   10619 C CA  . ARG D 1 206 ? 12.113  -24.733 81.599  1.00 67.99  ? 207  ARG D CA  1 
ATOM   10620 C C   . ARG D 1 206 ? 12.036  -23.237 81.895  1.00 78.49  ? 207  ARG D C   1 
ATOM   10621 O O   . ARG D 1 206 ? 11.035  -22.578 81.566  1.00 93.09  ? 207  ARG D O   1 
ATOM   10622 C CB  . ARG D 1 206 ? 11.823  -25.548 82.864  1.00 73.42  ? 207  ARG D CB  1 
ATOM   10623 C CG  . ARG D 1 206 ? 10.453  -25.263 83.460  1.00 83.11  ? 207  ARG D CG  1 
ATOM   10624 C CD  . ARG D 1 206 ? 9.992   -26.372 84.391  1.00 98.92  ? 207  ARG D CD  1 
ATOM   10625 N NE  . ARG D 1 206 ? 8.555   -26.289 84.641  1.00 106.90 ? 207  ARG D NE  1 
ATOM   10626 C CZ  . ARG D 1 206 ? 8.006   -25.595 85.632  1.00 101.92 ? 207  ARG D CZ  1 
ATOM   10627 N NH1 . ARG D 1 206 ? 8.773   -24.920 86.478  1.00 101.31 ? 207  ARG D NH1 1 
ATOM   10628 N NH2 . ARG D 1 206 ? 6.688   -25.576 85.777  1.00 91.22  ? 207  ARG D NH2 1 
ATOM   10629 N N   . GLU D 1 207 ? 13.089  -22.705 82.512  1.00 69.74  ? 208  GLU D N   1 
ATOM   10630 C CA  . GLU D 1 207 ? 13.154  -21.273 82.781  1.00 65.74  ? 208  GLU D CA  1 
ATOM   10631 C C   . GLU D 1 207 ? 12.975  -20.504 81.474  1.00 71.98  ? 208  GLU D C   1 
ATOM   10632 O O   . GLU D 1 207 ? 12.209  -19.531 81.404  1.00 88.61  ? 208  GLU D O   1 
ATOM   10633 C CB  . GLU D 1 207 ? 14.489  -20.924 83.435  1.00 71.06  ? 208  GLU D CB  1 
ATOM   10634 C CG  . GLU D 1 207 ? 14.587  -19.502 83.964  1.00 92.62  ? 208  GLU D CG  1 
ATOM   10635 C CD  . GLU D 1 207 ? 15.897  -19.245 84.689  1.00 102.83 ? 208  GLU D CD  1 
ATOM   10636 O OE1 . GLU D 1 207 ? 16.813  -20.086 84.575  1.00 111.63 ? 208  GLU D OE1 1 
ATOM   10637 O OE2 . GLU D 1 207 ? 16.013  -18.208 85.377  1.00 100.54 ? 208  GLU D OE2 1 
ATOM   10638 N N   . LEU D 1 208 ? 13.658  -20.973 80.433  1.00 56.58  ? 209  LEU D N   1 
ATOM   10639 C CA  . LEU D 1 208 ? 13.533  -20.384 79.107  1.00 53.40  ? 209  LEU D CA  1 
ATOM   10640 C C   . LEU D 1 208 ? 12.102  -20.453 78.591  1.00 67.18  ? 209  LEU D C   1 
ATOM   10641 O O   . LEU D 1 208 ? 11.591  -19.474 78.063  1.00 75.65  ? 209  LEU D O   1 
ATOM   10642 C CB  . LEU D 1 208 ? 14.470  -21.061 78.107  1.00 51.40  ? 209  LEU D CB  1 
ATOM   10643 C CG  . LEU D 1 208 ? 14.371  -20.507 76.682  1.00 43.82  ? 209  LEU D CG  1 
ATOM   10644 C CD1 . LEU D 1 208 ? 14.794  -19.044 76.639  1.00 40.41  ? 209  LEU D CD1 1 
ATOM   10645 C CD2 . LEU D 1 208 ? 15.191  -21.337 75.710  1.00 36.41  ? 209  LEU D CD2 1 
ATOM   10646 N N   . ARG D 1 209 ? 11.455  -21.603 78.747  1.00 66.22  ? 210  ARG D N   1 
ATOM   10647 C CA  . ARG D 1 209 ? 10.088  -21.766 78.257  1.00 55.89  ? 210  ARG D CA  1 
ATOM   10648 C C   . ARG D 1 209 ? 9.147   -20.758 78.905  1.00 64.94  ? 210  ARG D C   1 
ATOM   10649 O O   . ARG D 1 209 ? 8.444   -20.013 78.205  1.00 82.59  ? 210  ARG D O   1 
ATOM   10650 C CB  . ARG D 1 209 ? 9.578   -23.185 78.505  1.00 48.74  ? 210  ARG D CB  1 
ATOM   10651 C CG  . ARG D 1 209 ? 8.311   -23.518 77.734  1.00 69.27  ? 210  ARG D CG  1 
ATOM   10652 C CD  . ARG D 1 209 ? 7.728   -24.858 78.157  1.00 85.38  ? 210  ARG D CD  1 
ATOM   10653 N NE  . ARG D 1 209 ? 7.172   -24.817 79.507  1.00 101.70 ? 210  ARG D NE  1 
ATOM   10654 C CZ  . ARG D 1 209 ? 5.962   -24.350 79.804  1.00 112.12 ? 210  ARG D CZ  1 
ATOM   10655 N NH1 . ARG D 1 209 ? 5.177   -23.874 78.847  1.00 111.85 ? 210  ARG D NH1 1 
ATOM   10656 N NH2 . ARG D 1 209 ? 5.538   -24.354 81.060  1.00 113.65 ? 210  ARG D NH2 1 
ATOM   10657 N N   . LEU D 1 210 ? 9.153   -20.725 80.237  1.00 53.00  ? 211  LEU D N   1 
ATOM   10658 C CA  . LEU D 1 210 ? 8.303   -19.799 80.981  1.00 64.48  ? 211  LEU D CA  1 
ATOM   10659 C C   . LEU D 1 210 ? 8.557   -18.347 80.578  1.00 80.20  ? 211  LEU D C   1 
ATOM   10660 O O   . LEU D 1 210 ? 7.648   -17.642 80.102  1.00 94.52  ? 211  LEU D O   1 
ATOM   10661 C CB  . LEU D 1 210 ? 8.539   -19.950 82.487  1.00 61.64  ? 211  LEU D CB  1 
ATOM   10662 C CG  . LEU D 1 210 ? 8.369   -21.336 83.111  1.00 67.04  ? 211  LEU D CG  1 
ATOM   10663 C CD1 . LEU D 1 210 ? 8.584   -21.280 84.619  1.00 60.10  ? 211  LEU D CD1 1 
ATOM   10664 C CD2 . LEU D 1 210 ? 7.001   -21.910 82.784  1.00 74.64  ? 211  LEU D CD2 1 
ATOM   10665 N N   . ARG D 1 211 ? 9.806   -17.916 80.746  1.00 69.01  ? 212  ARG D N   1 
ATOM   10666 C CA  . ARG D 1 211 ? 10.156  -16.513 80.550  1.00 62.65  ? 212  ARG D CA  1 
ATOM   10667 C C   . ARG D 1 211 ? 9.967   -16.038 79.108  1.00 56.85  ? 212  ARG D C   1 
ATOM   10668 O O   . ARG D 1 211 ? 9.464   -14.935 78.870  1.00 49.58  ? 212  ARG D O   1 
ATOM   10669 C CB  . ARG D 1 211 ? 11.583  -16.250 81.030  1.00 65.23  ? 212  ARG D CB  1 
ATOM   10670 C CG  . ARG D 1 211 ? 11.777  -16.532 82.509  1.00 66.61  ? 212  ARG D CG  1 
ATOM   10671 C CD  . ARG D 1 211 ? 13.096  -15.982 83.019  1.00 74.40  ? 212  ARG D CD  1 
ATOM   10672 N NE  . ARG D 1 211 ? 13.221  -16.136 84.466  1.00 77.61  ? 212  ARG D NE  1 
ATOM   10673 C CZ  . ARG D 1 211 ? 14.224  -15.645 85.187  1.00 81.25  ? 212  ARG D CZ  1 
ATOM   10674 N NH1 . ARG D 1 211 ? 15.195  -14.962 84.598  1.00 81.20  ? 212  ARG D NH1 1 
ATOM   10675 N NH2 . ARG D 1 211 ? 14.254  -15.834 86.499  1.00 81.50  ? 212  ARG D NH2 1 
ATOM   10676 N N   . ALA D 1 212 ? 10.360  -16.872 78.150  1.00 42.67  ? 213  ALA D N   1 
ATOM   10677 C CA  . ALA D 1 212 ? 10.163  -16.545 76.740  1.00 49.76  ? 213  ALA D CA  1 
ATOM   10678 C C   . ALA D 1 212 ? 8.679   -16.464 76.394  1.00 61.48  ? 213  ALA D C   1 
ATOM   10679 O O   . ALA D 1 212 ? 8.261   -15.552 75.687  1.00 68.76  ? 213  ALA D O   1 
ATOM   10680 C CB  . ALA D 1 212 ? 10.871  -17.545 75.839  1.00 41.98  ? 213  ALA D CB  1 
ATOM   10681 N N   . THR D 1 213 ? 7.885   -17.409 76.898  1.00 61.06  ? 214  THR D N   1 
ATOM   10682 C CA  . THR D 1 213 ? 6.438   -17.374 76.676  1.00 70.97  ? 214  THR D CA  1 
ATOM   10683 C C   . THR D 1 213 ? 5.836   -16.050 77.154  1.00 64.97  ? 214  THR D C   1 
ATOM   10684 O O   . THR D 1 213 ? 5.188   -15.327 76.372  1.00 69.43  ? 214  THR D O   1 
ATOM   10685 C CB  . THR D 1 213 ? 5.719   -18.536 77.386  1.00 72.86  ? 214  THR D CB  1 
ATOM   10686 O OG1 . THR D 1 213 ? 6.364   -19.773 77.061  1.00 67.92  ? 214  THR D OG1 1 
ATOM   10687 C CG2 . THR D 1 213 ? 4.265   -18.604 76.953  1.00 70.63  ? 214  THR D CG2 1 
ATOM   10688 N N   . ARG D 1 214 ? 6.071   -15.734 78.429  1.00 48.61  ? 215  ARG D N   1 
ATOM   10689 C CA  . ARG D 1 214 ? 5.601   -14.480 79.017  1.00 56.96  ? 215  ARG D CA  1 
ATOM   10690 C C   . ARG D 1 214 ? 6.028   -13.251 78.209  1.00 61.91  ? 215  ARG D C   1 
ATOM   10691 O O   . ARG D 1 214 ? 5.190   -12.496 77.702  1.00 62.07  ? 215  ARG D O   1 
ATOM   10692 C CB  . ARG D 1 214 ? 6.131   -14.337 80.441  1.00 54.13  ? 215  ARG D CB  1 
ATOM   10693 C CG  . ARG D 1 214 ? 5.593   -15.333 81.454  1.00 62.12  ? 215  ARG D CG  1 
ATOM   10694 C CD  . ARG D 1 214 ? 6.116   -14.970 82.831  1.00 87.84  ? 215  ARG D CD  1 
ATOM   10695 N NE  . ARG D 1 214 ? 6.058   -16.081 83.772  1.00 113.84 ? 215  ARG D NE  1 
ATOM   10696 C CZ  . ARG D 1 214 ? 6.702   -16.094 84.934  1.00 123.33 ? 215  ARG D CZ  1 
ATOM   10697 N NH1 . ARG D 1 214 ? 7.451   -15.057 85.286  1.00 122.59 ? 215  ARG D NH1 1 
ATOM   10698 N NH2 . ARG D 1 214 ? 6.604   -17.142 85.740  1.00 126.13 ? 215  ARG D NH2 1 
ATOM   10699 N N   . ALA D 1 215 ? 7.342   -13.045 78.118  1.00 56.21  ? 216  ALA D N   1 
ATOM   10700 C CA  . ALA D 1 215 ? 7.886   -11.874 77.438  1.00 54.42  ? 216  ALA D CA  1 
ATOM   10701 C C   . ALA D 1 215 ? 7.374   -11.720 76.006  1.00 55.18  ? 216  ALA D C   1 
ATOM   10702 O O   . ALA D 1 215 ? 6.900   -10.640 75.619  1.00 72.95  ? 216  ALA D O   1 
ATOM   10703 C CB  . ALA D 1 215 ? 9.411   -11.908 77.458  1.00 52.75  ? 216  ALA D CB  1 
ATOM   10704 N N   . PHE D 1 216 ? 7.468   -12.796 75.227  1.00 27.16  ? 217  PHE D N   1 
ATOM   10705 C CA  . PHE D 1 216 ? 7.048   -12.755 73.829  1.00 37.69  ? 217  PHE D CA  1 
ATOM   10706 C C   . PHE D 1 216 ? 5.572   -12.396 73.686  1.00 51.46  ? 217  PHE D C   1 
ATOM   10707 O O   . PHE D 1 216 ? 5.220   -11.557 72.849  1.00 64.81  ? 217  PHE D O   1 
ATOM   10708 C CB  . PHE D 1 216 ? 7.346   -14.073 73.108  1.00 33.64  ? 217  PHE D CB  1 
ATOM   10709 C CG  . PHE D 1 216 ? 8.737   -14.163 72.545  1.00 55.51  ? 217  PHE D CG  1 
ATOM   10710 C CD1 . PHE D 1 216 ? 9.086   -13.461 71.402  1.00 67.15  ? 217  PHE D CD1 1 
ATOM   10711 C CD2 . PHE D 1 216 ? 9.694   -14.960 73.151  1.00 60.23  ? 217  PHE D CD2 1 
ATOM   10712 C CE1 . PHE D 1 216 ? 10.370  -13.549 70.885  1.00 68.74  ? 217  PHE D CE1 1 
ATOM   10713 C CE2 . PHE D 1 216 ? 10.970  -15.050 72.641  1.00 52.54  ? 217  PHE D CE2 1 
ATOM   10714 C CZ  . PHE D 1 216 ? 11.310  -14.345 71.508  1.00 51.39  ? 217  PHE D CZ  1 
ATOM   10715 N N   . VAL D 1 217 ? 4.707   -13.003 74.501  1.00 48.38  ? 218  VAL D N   1 
ATOM   10716 C CA  . VAL D 1 217 ? 3.287   -12.686 74.366  1.00 52.81  ? 218  VAL D CA  1 
ATOM   10717 C C   . VAL D 1 217 ? 2.995   -11.264 74.823  1.00 58.45  ? 218  VAL D C   1 
ATOM   10718 O O   . VAL D 1 217 ? 2.084   -10.624 74.308  1.00 72.97  ? 218  VAL D O   1 
ATOM   10719 C CB  . VAL D 1 217 ? 2.353   -13.691 75.082  1.00 56.71  ? 218  VAL D CB  1 
ATOM   10720 C CG1 . VAL D 1 217 ? 2.573   -15.095 74.541  1.00 64.50  ? 218  VAL D CG1 1 
ATOM   10721 C CG2 . VAL D 1 217 ? 2.545   -13.644 76.586  1.00 58.01  ? 218  VAL D CG2 1 
ATOM   10722 N N   . ALA D 1 218 ? 3.770   -10.766 75.782  1.00 56.97  ? 219  ALA D N   1 
ATOM   10723 C CA  . ALA D 1 218 ? 3.587   -9.392  76.235  1.00 51.55  ? 219  ALA D CA  1 
ATOM   10724 C C   . ALA D 1 218 ? 3.891   -8.411  75.103  1.00 57.66  ? 219  ALA D C   1 
ATOM   10725 O O   . ALA D 1 218 ? 3.045   -7.585  74.726  1.00 59.49  ? 219  ALA D O   1 
ATOM   10726 C CB  . ALA D 1 218 ? 4.462   -9.109  77.440  1.00 41.37  ? 219  ALA D CB  1 
ATOM   10727 N N   . ALA D 1 219 ? 5.102   -8.525  74.559  1.00 59.30  ? 220  ALA D N   1 
ATOM   10728 C CA  . ALA D 1 219 ? 5.549   -7.655  73.474  1.00 55.45  ? 220  ALA D CA  1 
ATOM   10729 C C   . ALA D 1 219 ? 4.601   -7.724  72.279  1.00 45.85  ? 220  ALA D C   1 
ATOM   10730 O O   . ALA D 1 219 ? 4.147   -6.690  71.748  1.00 57.10  ? 220  ALA D O   1 
ATOM   10731 C CB  . ALA D 1 219 ? 6.958   -8.035  73.054  1.00 60.09  ? 220  ALA D CB  1 
ATOM   10732 N N   . ARG D 1 220 ? 4.305   -8.955  71.871  1.00 41.90  ? 221  ARG D N   1 
ATOM   10733 C CA  . ARG D 1 220 ? 3.419   -9.206  70.745  1.00 45.71  ? 221  ARG D CA  1 
ATOM   10734 C C   . ARG D 1 220 ? 2.036   -8.601  70.974  1.00 44.86  ? 221  ARG D C   1 
ATOM   10735 O O   . ARG D 1 220 ? 1.457   -8.014  70.064  1.00 43.23  ? 221  ARG D O   1 
ATOM   10736 C CB  . ARG D 1 220 ? 3.304   -10.708 70.480  1.00 39.77  ? 221  ARG D CB  1 
ATOM   10737 C CG  . ARG D 1 220 ? 2.292   -11.065 69.412  1.00 58.99  ? 221  ARG D CG  1 
ATOM   10738 C CD  . ARG D 1 220 ? 1.405   -12.206 69.867  1.00 70.71  ? 221  ARG D CD  1 
ATOM   10739 N NE  . ARG D 1 220 ? 1.972   -13.513 69.555  1.00 69.95  ? 221  ARG D NE  1 
ATOM   10740 C CZ  . ARG D 1 220 ? 1.626   -14.636 70.173  1.00 68.27  ? 221  ARG D CZ  1 
ATOM   10741 N NH1 . ARG D 1 220 ? 0.726   -14.605 71.147  1.00 54.19  ? 221  ARG D NH1 1 
ATOM   10742 N NH2 . ARG D 1 220 ? 2.186   -15.787 69.825  1.00 84.59  ? 221  ARG D NH2 1 
ATOM   10743 N N   . SER D 1 221 ? 1.517   -8.733  72.193  1.00 41.34  ? 222  SER D N   1 
ATOM   10744 C CA  . SER D 1 221 ? 0.207   -8.178  72.523  1.00 37.81  ? 222  SER D CA  1 
ATOM   10745 C C   . SER D 1 221 ? 0.199   -6.656  72.478  1.00 44.66  ? 222  SER D C   1 
ATOM   10746 O O   . SER D 1 221 ? -0.788  -6.058  72.058  1.00 51.32  ? 222  SER D O   1 
ATOM   10747 C CB  . SER D 1 221 ? -0.269  -8.660  73.894  1.00 28.30  ? 222  SER D CB  1 
ATOM   10748 O OG  . SER D 1 221 ? -0.429  -10.066 73.902  1.00 42.82  ? 222  SER D OG  1 
ATOM   10749 N N   . PHE D 1 222 ? 1.289   -6.030  72.915  1.00 44.20  ? 223  PHE D N   1 
ATOM   10750 C CA  . PHE D 1 222 ? 1.394   -4.571  72.855  1.00 35.08  ? 223  PHE D CA  1 
ATOM   10751 C C   . PHE D 1 222 ? 1.361   -4.093  71.402  1.00 40.36  ? 223  PHE D C   1 
ATOM   10752 O O   . PHE D 1 222 ? 0.569   -3.206  71.031  1.00 40.69  ? 223  PHE D O   1 
ATOM   10753 C CB  . PHE D 1 222 ? 2.678   -4.099  73.545  1.00 36.67  ? 223  PHE D CB  1 
ATOM   10754 C CG  . PHE D 1 222 ? 2.773   -2.605  73.711  1.00 46.30  ? 223  PHE D CG  1 
ATOM   10755 C CD1 . PHE D 1 222 ? 2.129   -1.966  74.758  1.00 37.04  ? 223  PHE D CD1 1 
ATOM   10756 C CD2 . PHE D 1 222 ? 3.524   -1.842  72.830  1.00 50.76  ? 223  PHE D CD2 1 
ATOM   10757 C CE1 . PHE D 1 222 ? 2.221   -0.595  74.916  1.00 27.48  ? 223  PHE D CE1 1 
ATOM   10758 C CE2 . PHE D 1 222 ? 3.620   -0.470  72.983  1.00 35.58  ? 223  PHE D CE2 1 
ATOM   10759 C CZ  . PHE D 1 222 ? 2.968   0.153   74.027  1.00 26.11  ? 223  PHE D CZ  1 
ATOM   10760 N N   . VAL D 1 223 ? 2.219   -4.698  70.582  1.00 30.63  ? 224  VAL D N   1 
ATOM   10761 C CA  . VAL D 1 223 ? 2.282   -4.367  69.158  1.00 26.10  ? 224  VAL D CA  1 
ATOM   10762 C C   . VAL D 1 223 ? 0.936   -4.583  68.454  1.00 39.81  ? 224  VAL D C   1 
ATOM   10763 O O   . VAL D 1 223 ? 0.443   -3.707  67.727  1.00 39.66  ? 224  VAL D O   1 
ATOM   10764 C CB  . VAL D 1 223 ? 3.381   -5.194  68.458  1.00 26.63  ? 224  VAL D CB  1 
ATOM   10765 C CG1 . VAL D 1 223 ? 3.263   -5.100  66.948  1.00 18.83  ? 224  VAL D CG1 1 
ATOM   10766 C CG2 . VAL D 1 223 ? 4.754   -4.740  68.925  1.00 18.72  ? 224  VAL D CG2 1 
ATOM   10767 N N   . GLN D 1 224 ? 0.342   -5.751  68.686  1.00 43.82  ? 225  GLN D N   1 
ATOM   10768 C CA  . GLN D 1 224 ? -0.973  -6.075  68.143  1.00 46.00  ? 225  GLN D CA  1 
ATOM   10769 C C   . GLN D 1 224 ? -2.006  -5.052  68.585  1.00 42.00  ? 225  GLN D C   1 
ATOM   10770 O O   . GLN D 1 224 ? -2.895  -4.684  67.820  1.00 39.92  ? 225  GLN D O   1 
ATOM   10771 C CB  . GLN D 1 224 ? -1.420  -7.470  68.588  1.00 58.85  ? 225  GLN D CB  1 
ATOM   10772 C CG  . GLN D 1 224 ? -0.781  -8.615  67.822  1.00 70.79  ? 225  GLN D CG  1 
ATOM   10773 C CD  . GLN D 1 224 ? -1.446  -9.946  68.114  1.00 81.21  ? 225  GLN D CD  1 
ATOM   10774 O OE1 . GLN D 1 224 ? -2.514  -9.997  68.724  1.00 86.62  ? 225  GLN D OE1 1 
ATOM   10775 N NE2 . GLN D 1 224 ? -0.817  -11.032 67.678  1.00 72.75  ? 225  GLN D NE2 1 
ATOM   10776 N N   . GLY D 1 225 ? -1.882  -4.603  69.829  1.00 32.61  ? 226  GLY D N   1 
ATOM   10777 C CA  . GLY D 1 225 ? -2.780  -3.608  70.378  1.00 39.88  ? 226  GLY D CA  1 
ATOM   10778 C C   . GLY D 1 225 ? -2.721  -2.322  69.583  1.00 50.66  ? 226  GLY D C   1 
ATOM   10779 O O   . GLY D 1 225 ? -3.755  -1.811  69.134  1.00 46.71  ? 226  GLY D O   1 
ATOM   10780 N N   . LEU D 1 226 ? -1.509  -1.799  69.406  1.00 50.40  ? 227  LEU D N   1 
ATOM   10781 C CA  . LEU D 1 226 ? -1.319  -0.589  68.607  1.00 37.22  ? 227  LEU D CA  1 
ATOM   10782 C C   . LEU D 1 226 ? -1.895  -0.750  67.199  1.00 41.92  ? 227  LEU D C   1 
ATOM   10783 O O   . LEU D 1 226 ? -2.592  0.140   66.688  1.00 53.95  ? 227  LEU D O   1 
ATOM   10784 C CB  . LEU D 1 226 ? 0.162   -0.216  68.535  1.00 44.25  ? 227  LEU D CB  1 
ATOM   10785 C CG  . LEU D 1 226 ? 0.812   0.237   69.843  1.00 46.93  ? 227  LEU D CG  1 
ATOM   10786 C CD1 . LEU D 1 226 ? 2.295   0.498   69.638  1.00 34.55  ? 227  LEU D CD1 1 
ATOM   10787 C CD2 . LEU D 1 226 ? 0.114   1.476   70.387  1.00 37.17  ? 227  LEU D CD2 1 
ATOM   10788 N N   . GLY D 1 227 ? -1.610  -1.896  66.582  1.00 38.74  ? 228  GLY D N   1 
ATOM   10789 C CA  . GLY D 1 227 ? -2.135  -2.193  65.260  1.00 46.88  ? 228  GLY D CA  1 
ATOM   10790 C C   . GLY D 1 227 ? -3.653  -2.156  65.197  1.00 45.09  ? 228  GLY D C   1 
ATOM   10791 O O   . GLY D 1 227 ? -4.237  -1.574  64.277  1.00 53.30  ? 228  GLY D O   1 
ATOM   10792 N N   . VAL D 1 228 ? -4.295  -2.772  66.185  1.00 37.59  ? 229  VAL D N   1 
ATOM   10793 C CA  . VAL D 1 228 ? -5.752  -2.803  66.248  1.00 43.31  ? 229  VAL D CA  1 
ATOM   10794 C C   . VAL D 1 228 ? -6.329  -1.403  66.422  1.00 45.13  ? 229  VAL D C   1 
ATOM   10795 O O   . VAL D 1 228 ? -7.277  -1.036  65.730  1.00 59.74  ? 229  VAL D O   1 
ATOM   10796 C CB  . VAL D 1 228 ? -6.264  -3.748  67.359  1.00 39.29  ? 229  VAL D CB  1 
ATOM   10797 C CG1 . VAL D 1 228 ? -7.685  -3.393  67.766  1.00 26.74  ? 229  VAL D CG1 1 
ATOM   10798 C CG2 . VAL D 1 228 ? -6.192  -5.187  66.889  1.00 41.26  ? 229  VAL D CG2 1 
ATOM   10799 N N   . ALA D 1 229 ? -5.751  -0.624  67.332  1.00 38.13  ? 230  ALA D N   1 
ATOM   10800 C CA  . ALA D 1 229 ? -6.175  0.764   67.508  1.00 30.24  ? 230  ALA D CA  1 
ATOM   10801 C C   . ALA D 1 229 ? -6.112  1.518   66.180  1.00 26.59  ? 230  ALA D C   1 
ATOM   10802 O O   . ALA D 1 229 ? -7.059  2.217   65.803  1.00 31.97  ? 230  ALA D O   1 
ATOM   10803 C CB  . ALA D 1 229 ? -5.326  1.456   68.560  1.00 27.68  ? 230  ALA D CB  1 
ATOM   10804 N N   . SER D 1 230 ? -5.002  1.356   65.463  1.00 29.53  ? 231  SER D N   1 
ATOM   10805 C CA  . SER D 1 230 ? -4.851  1.989   64.153  1.00 38.63  ? 231  SER D CA  1 
ATOM   10806 C C   . SER D 1 230 ? -5.958  1.579   63.178  1.00 35.30  ? 231  SER D C   1 
ATOM   10807 O O   . SER D 1 230 ? -6.611  2.434   62.562  1.00 43.68  ? 231  SER D O   1 
ATOM   10808 C CB  . SER D 1 230 ? -3.483  1.660   63.552  1.00 49.27  ? 231  SER D CB  1 
ATOM   10809 O OG  . SER D 1 230 ? -3.321  2.274   62.285  1.00 66.64  ? 231  SER D OG  1 
ATOM   10810 N N   . ASP D 1 231 ? -6.167  0.271   63.048  1.00 39.08  ? 232  ASP D N   1 
ATOM   10811 C CA  . ASP D 1 231 ? -7.172  -0.256  62.125  1.00 56.88  ? 232  ASP D CA  1 
ATOM   10812 C C   . ASP D 1 231 ? -8.571  0.262   62.448  1.00 53.28  ? 232  ASP D C   1 
ATOM   10813 O O   . ASP D 1 231 ? -9.326  0.650   61.551  1.00 47.60  ? 232  ASP D O   1 
ATOM   10814 C CB  . ASP D 1 231 ? -7.161  -1.785  62.133  1.00 70.96  ? 232  ASP D CB  1 
ATOM   10815 C CG  . ASP D 1 231 ? -5.864  -2.360  61.605  1.00 85.72  ? 232  ASP D CG  1 
ATOM   10816 O OD1 . ASP D 1 231 ? -5.179  -1.660  60.830  1.00 95.15  ? 232  ASP D OD1 1 
ATOM   10817 O OD2 . ASP D 1 231 ? -5.529  -3.509  61.963  1.00 81.77  ? 232  ASP D OD2 1 
ATOM   10818 N N   . VAL D 1 232 ? -8.903  0.271   63.734  1.00 39.41  ? 233  VAL D N   1 
ATOM   10819 C CA  . VAL D 1 232 ? -10.176 0.803   64.198  1.00 31.24  ? 233  VAL D CA  1 
ATOM   10820 C C   . VAL D 1 232 ? -10.325 2.261   63.783  1.00 43.50  ? 233  VAL D C   1 
ATOM   10821 O O   . VAL D 1 232 ? -11.343 2.642   63.200  1.00 55.18  ? 233  VAL D O   1 
ATOM   10822 C CB  . VAL D 1 232 ? -10.312 0.686   65.730  1.00 28.29  ? 233  VAL D CB  1 
ATOM   10823 C CG1 . VAL D 1 232 ? -11.470 1.533   66.234  1.00 27.83  ? 233  VAL D CG1 1 
ATOM   10824 C CG2 . VAL D 1 232 ? -10.490 -0.767  66.136  1.00 33.90  ? 233  VAL D CG2 1 
ATOM   10825 N N   . VAL D 1 233 ? -9.304  3.067   64.067  1.00 40.52  ? 234  VAL D N   1 
ATOM   10826 C CA  . VAL D 1 233 ? -9.333  4.482   63.692  1.00 34.94  ? 234  VAL D CA  1 
ATOM   10827 C C   . VAL D 1 233 ? -9.585  4.687   62.196  1.00 41.28  ? 234  VAL D C   1 
ATOM   10828 O O   . VAL D 1 233 ? -10.439 5.486   61.811  1.00 51.37  ? 234  VAL D O   1 
ATOM   10829 C CB  . VAL D 1 233 ? -8.041  5.214   64.106  1.00 29.66  ? 234  VAL D CB  1 
ATOM   10830 C CG1 . VAL D 1 233 ? -8.013  6.620   63.526  1.00 21.17  ? 234  VAL D CG1 1 
ATOM   10831 C CG2 . VAL D 1 233 ? -7.932  5.262   65.618  1.00 34.21  ? 234  VAL D CG2 1 
ATOM   10832 N N   . ARG D 1 234 ? -8.856  3.951   61.361  1.00 44.26  ? 235  ARG D N   1 
ATOM   10833 C CA  . ARG D 1 234 ? -9.027  4.056   59.911  1.00 45.52  ? 235  ARG D CA  1 
ATOM   10834 C C   . ARG D 1 234 ? -10.439 3.664   59.455  1.00 45.29  ? 235  ARG D C   1 
ATOM   10835 O O   . ARG D 1 234 ? -11.132 4.439   58.772  1.00 56.41  ? 235  ARG D O   1 
ATOM   10836 C CB  . ARG D 1 234 ? -7.981  3.197   59.195  1.00 51.44  ? 235  ARG D CB  1 
ATOM   10837 C CG  . ARG D 1 234 ? -8.117  3.167   57.681  1.00 60.95  ? 235  ARG D CG  1 
ATOM   10838 C CD  . ARG D 1 234 ? -7.086  2.237   57.057  1.00 67.76  ? 235  ARG D CD  1 
ATOM   10839 N NE  . ARG D 1 234 ? -7.147  0.892   57.625  1.00 77.31  ? 235  ARG D NE  1 
ATOM   10840 C CZ  . ARG D 1 234 ? -7.848  -0.111  57.106  1.00 77.96  ? 235  ARG D CZ  1 
ATOM   10841 N NH1 . ARG D 1 234 ? -8.551  0.069   55.996  1.00 73.64  ? 235  ARG D NH1 1 
ATOM   10842 N NH2 . ARG D 1 234 ? -7.843  -1.299  57.696  1.00 77.50  ? 235  ARG D NH2 1 
ATOM   10843 N N   . LYS D 1 235 ? -10.855 2.460   59.842  1.00 54.81  ? 236  LYS D N   1 
ATOM   10844 C CA  . LYS D 1 235 ? -12.165 1.930   59.469  1.00 55.97  ? 236  LYS D CA  1 
ATOM   10845 C C   . LYS D 1 235 ? -13.302 2.865   59.876  1.00 40.46  ? 236  LYS D C   1 
ATOM   10846 O O   . LYS D 1 235 ? -14.198 3.145   59.080  1.00 32.01  ? 236  LYS D O   1 
ATOM   10847 C CB  . LYS D 1 235 ? -12.380 0.542   60.080  1.00 58.40  ? 236  LYS D CB  1 
ATOM   10848 C CG  . LYS D 1 235 ? -11.472 -0.540  59.514  1.00 61.00  ? 236  LYS D CG  1 
ATOM   10849 C CD  . LYS D 1 235 ? -11.690 -1.865  60.229  1.00 67.60  ? 236  LYS D CD  1 
ATOM   10850 C CE  . LYS D 1 235 ? -10.728 -2.934  59.737  1.00 65.51  ? 236  LYS D CE  1 
ATOM   10851 N NZ  . LYS D 1 235 ? -10.892 -4.211  60.485  1.00 63.02  ? 236  LYS D NZ  1 
ATOM   10852 N N   . VAL D 1 236 ? -13.256 3.348   61.113  1.00 32.08  ? 237  VAL D N   1 
ATOM   10853 C CA  . VAL D 1 236 ? -14.260 4.285   61.605  1.00 24.07  ? 237  VAL D CA  1 
ATOM   10854 C C   . VAL D 1 236 ? -14.183 5.600   60.833  1.00 37.28  ? 237  VAL D C   1 
ATOM   10855 O O   . VAL D 1 236 ? -15.205 6.226   60.549  1.00 36.78  ? 237  VAL D O   1 
ATOM   10856 C CB  . VAL D 1 236 ? -14.095 4.540   63.120  1.00 28.60  ? 237  VAL D CB  1 
ATOM   10857 C CG1 . VAL D 1 236 ? -14.994 5.675   63.587  1.00 15.09  ? 237  VAL D CG1 1 
ATOM   10858 C CG2 . VAL D 1 236 ? -14.393 3.270   63.899  1.00 42.65  ? 237  VAL D CG2 1 
ATOM   10859 N N   . ALA D 1 237 ? -12.967 6.005   60.478  1.00 50.60  ? 238  ALA D N   1 
ATOM   10860 C CA  . ALA D 1 237 ? -12.761 7.220   59.693  1.00 44.54  ? 238  ALA D CA  1 
ATOM   10861 C C   . ALA D 1 237 ? -13.397 7.110   58.313  1.00 43.82  ? 238  ALA D C   1 
ATOM   10862 O O   . ALA D 1 237 ? -13.702 8.121   57.681  1.00 50.68  ? 238  ALA D O   1 
ATOM   10863 C CB  . ALA D 1 237 ? -11.281 7.533   59.566  1.00 39.38  ? 238  ALA D CB  1 
ATOM   10864 N N   . GLN D 1 238 ? -13.587 5.882   57.841  1.00 45.74  ? 239  GLN D N   1 
ATOM   10865 C CA  . GLN D 1 238 ? -14.286 5.672   56.571  1.00 63.25  ? 239  GLN D CA  1 
ATOM   10866 C C   . GLN D 1 238 ? -15.802 5.907   56.632  1.00 73.01  ? 239  GLN D C   1 
ATOM   10867 O O   . GLN D 1 238 ? -16.460 6.008   55.594  1.00 72.06  ? 239  GLN D O   1 
ATOM   10868 C CB  . GLN D 1 238 ? -13.994 4.278   56.013  1.00 72.33  ? 239  GLN D CB  1 
ATOM   10869 C CG  . GLN D 1 238 ? -12.680 4.195   55.265  1.00 85.89  ? 239  GLN D CG  1 
ATOM   10870 C CD  . GLN D 1 238 ? -12.578 5.246   54.179  1.00 91.14  ? 239  GLN D CD  1 
ATOM   10871 O OE1 . GLN D 1 238 ? -11.849 6.228   54.317  1.00 83.12  ? 239  GLN D OE1 1 
ATOM   10872 N NE2 . GLN D 1 238 ? -13.317 5.049   53.093  1.00 93.96  ? 239  GLN D NE2 1 
ATOM   10873 N N   . VAL D 1 239 ? -16.351 5.997   57.840  1.00 74.41  ? 240  VAL D N   1 
ATOM   10874 C CA  . VAL D 1 239 ? -17.792 6.182   58.019  1.00 69.46  ? 240  VAL D CA  1 
ATOM   10875 C C   . VAL D 1 239 ? -18.259 7.572   57.586  1.00 77.31  ? 240  VAL D C   1 
ATOM   10876 O O   . VAL D 1 239 ? -17.709 8.582   58.029  1.00 80.35  ? 240  VAL D O   1 
ATOM   10877 C CB  . VAL D 1 239 ? -18.218 5.926   59.480  1.00 63.21  ? 240  VAL D CB  1 
ATOM   10878 C CG1 . VAL D 1 239 ? -19.632 6.430   59.726  1.00 54.41  ? 240  VAL D CG1 1 
ATOM   10879 C CG2 . VAL D 1 239 ? -18.101 4.445   59.814  1.00 65.79  ? 240  VAL D CG2 1 
ATOM   10880 N N   . PRO D 1 240 ? -19.281 7.622   56.715  1.00 63.98  ? 241  PRO D N   1 
ATOM   10881 C CA  . PRO D 1 240 ? -19.833 8.865   56.162  1.00 55.72  ? 241  PRO D CA  1 
ATOM   10882 C C   . PRO D 1 240 ? -20.674 9.651   57.165  1.00 66.99  ? 241  PRO D C   1 
ATOM   10883 O O   . PRO D 1 240 ? -20.811 9.247   58.321  1.00 69.26  ? 241  PRO D O   1 
ATOM   10884 C CB  . PRO D 1 240 ? -20.732 8.373   55.018  1.00 41.32  ? 241  PRO D CB  1 
ATOM   10885 C CG  . PRO D 1 240 ? -20.338 6.950   54.777  1.00 50.15  ? 241  PRO D CG  1 
ATOM   10886 C CD  . PRO D 1 240 ? -19.900 6.436   56.104  1.00 54.19  ? 241  PRO D CD  1 
ATOM   10887 N N   . LEU D 1 241 ? -21.230 10.770  56.711  1.00 74.53  ? 242  LEU D N   1 
ATOM   10888 C CA  . LEU D 1 241 ? -22.133 11.575  57.526  1.00 72.67  ? 242  LEU D CA  1 
ATOM   10889 C C   . LEU D 1 241 ? -23.546 11.527  56.955  1.00 77.00  ? 242  LEU D C   1 
ATOM   10890 O O   . LEU D 1 241 ? -23.736 11.578  55.740  1.00 78.39  ? 242  LEU D O   1 
ATOM   10891 C CB  . LEU D 1 241 ? -21.649 13.025  57.599  1.00 67.09  ? 242  LEU D CB  1 
ATOM   10892 C CG  . LEU D 1 241 ? -20.411 13.304  58.452  1.00 63.90  ? 242  LEU D CG  1 
ATOM   10893 C CD1 . LEU D 1 241 ? -20.051 14.779  58.392  1.00 58.20  ? 242  LEU D CD1 1 
ATOM   10894 C CD2 . LEU D 1 241 ? -20.638 12.863  59.891  1.00 61.24  ? 242  LEU D CD2 1 
ATOM   10895 N N   . GLY D 1 242 ? -24.534 11.430  57.839  1.00 81.42  ? 243  GLY D N   1 
ATOM   10896 C CA  . GLY D 1 242 ? -25.921 11.328  57.424  1.00 79.37  ? 243  GLY D CA  1 
ATOM   10897 C C   . GLY D 1 242 ? -26.481 12.624  56.871  1.00 73.38  ? 243  GLY D C   1 
ATOM   10898 O O   . GLY D 1 242 ? -25.991 13.705  57.200  1.00 79.39  ? 243  GLY D O   1 
ATOM   10899 N N   . PRO D 1 243 ? -27.510 12.517  56.016  1.00 66.40  ? 244  PRO D N   1 
ATOM   10900 C CA  . PRO D 1 243 ? -28.182 13.669  55.403  1.00 65.42  ? 244  PRO D CA  1 
ATOM   10901 C C   . PRO D 1 243 ? -28.756 14.635  56.434  1.00 57.31  ? 244  PRO D C   1 
ATOM   10902 O O   . PRO D 1 243 ? -28.717 15.846  56.216  1.00 66.21  ? 244  PRO D O   1 
ATOM   10903 C CB  . PRO D 1 243 ? -29.315 13.023  54.602  1.00 57.13  ? 244  PRO D CB  1 
ATOM   10904 C CG  . PRO D 1 243 ? -28.822 11.650  54.302  1.00 63.20  ? 244  PRO D CG  1 
ATOM   10905 C CD  . PRO D 1 243 ? -28.046 11.239  55.517  1.00 63.21  ? 244  PRO D CD  1 
ATOM   10906 N N   . GLU D 1 244 ? -29.286 14.109  57.533  1.00 43.73  ? 245  GLU D N   1 
ATOM   10907 C CA  . GLU D 1 244 ? -29.823 14.955  58.593  1.00 55.90  ? 245  GLU D CA  1 
ATOM   10908 C C   . GLU D 1 244 ? -28.704 15.740  59.270  1.00 60.78  ? 245  GLU D C   1 
ATOM   10909 O O   . GLU D 1 244 ? -28.871 16.912  59.620  1.00 78.11  ? 245  GLU D O   1 
ATOM   10910 C CB  . GLU D 1 244 ? -30.594 14.119  59.617  1.00 64.90  ? 245  GLU D CB  1 
ATOM   10911 C CG  . GLU D 1 244 ? -31.838 13.452  59.050  1.00 82.62  ? 245  GLU D CG  1 
ATOM   10912 C CD  . GLU D 1 244 ? -32.814 14.450  58.444  1.00 88.68  ? 245  GLU D CD  1 
ATOM   10913 O OE1 . GLU D 1 244 ? -33.077 15.493  59.080  1.00 87.35  ? 245  GLU D OE1 1 
ATOM   10914 O OE2 . GLU D 1 244 ? -33.315 14.193  57.329  1.00 77.90  ? 245  GLU D OE2 1 
ATOM   10915 N N   . CYS D 1 245 ? -27.560 15.084  59.446  1.00 59.41  ? 246  CYS D N   1 
ATOM   10916 C CA  . CYS D 1 245 ? -26.374 15.740  59.979  1.00 56.42  ? 246  CYS D CA  1 
ATOM   10917 C C   . CYS D 1 245 ? -25.900 16.842  59.039  1.00 61.94  ? 246  CYS D C   1 
ATOM   10918 O O   . CYS D 1 245 ? -25.547 17.934  59.480  1.00 53.62  ? 246  CYS D O   1 
ATOM   10919 C CB  . CYS D 1 245 ? -25.252 14.727  60.212  1.00 44.64  ? 246  CYS D CB  1 
ATOM   10920 S SG  . CYS D 1 245 ? -23.644 15.474  60.573  1.00 80.85  ? 246  CYS D SG  1 
ATOM   10921 N N   . SER D 1 246 ? -25.894 16.546  57.742  1.00 63.17  ? 247  SER D N   1 
ATOM   10922 C CA  . SER D 1 246 ? -25.502 17.521  56.728  1.00 63.52  ? 247  SER D CA  1 
ATOM   10923 C C   . SER D 1 246 ? -26.408 18.747  56.773  1.00 56.22  ? 247  SER D C   1 
ATOM   10924 O O   . SER D 1 246 ? -25.937 19.884  56.726  1.00 59.88  ? 247  SER D O   1 
ATOM   10925 C CB  . SER D 1 246 ? -25.540 16.891  55.335  1.00 65.65  ? 247  SER D CB  1 
ATOM   10926 O OG  . SER D 1 246 ? -25.475 17.881  54.321  1.00 73.71  ? 247  SER D OG  1 
ATOM   10927 N N   . ARG D 1 247 ? -27.710 18.492  56.860  1.00 57.59  ? 248  ARG D N   1 
ATOM   10928 C CA  . ARG D 1 247 ? -28.721 19.531  57.019  1.00 46.12  ? 248  ARG D CA  1 
ATOM   10929 C C   . ARG D 1 247 ? -28.414 20.410  58.235  1.00 45.09  ? 248  ARG D C   1 
ATOM   10930 O O   . ARG D 1 247 ? -28.178 21.616  58.100  1.00 54.16  ? 248  ARG D O   1 
ATOM   10931 C CB  . ARG D 1 247 ? -30.106 18.881  57.137  1.00 66.14  ? 248  ARG D CB  1 
ATOM   10932 C CG  . ARG D 1 247 ? -31.272 19.832  57.365  1.00 93.56  ? 248  ARG D CG  1 
ATOM   10933 C CD  . ARG D 1 247 ? -31.661 19.886  58.835  1.00 105.27 ? 248  ARG D CD  1 
ATOM   10934 N NE  . ARG D 1 247 ? -31.711 18.556  59.437  1.00 111.48 ? 248  ARG D NE  1 
ATOM   10935 C CZ  . ARG D 1 247 ? -31.726 18.331  60.747  1.00 107.79 ? 248  ARG D CZ  1 
ATOM   10936 N NH1 . ARG D 1 247 ? -31.692 19.350  61.595  1.00 109.08 ? 248  ARG D NH1 1 
ATOM   10937 N NH2 . ARG D 1 247 ? -31.770 17.088  61.210  1.00 91.53  ? 248  ARG D NH2 1 
ATOM   10938 N N   . ALA D 1 248 ? -28.419 19.797  59.417  1.00 41.81  ? 249  ALA D N   1 
ATOM   10939 C CA  . ALA D 1 248 ? -28.148 20.510  60.667  1.00 51.55  ? 249  ALA D CA  1 
ATOM   10940 C C   . ALA D 1 248 ? -26.850 21.319  60.617  1.00 51.11  ? 249  ALA D C   1 
ATOM   10941 O O   . ALA D 1 248 ? -26.766 22.416  61.173  1.00 50.38  ? 249  ALA D O   1 
ATOM   10942 C CB  . ALA D 1 248 ? -28.123 19.536  61.838  1.00 49.13  ? 249  ALA D CB  1 
ATOM   10943 N N   . VAL D 1 249 ? -25.845 20.770  59.942  1.00 53.58  ? 250  VAL D N   1 
ATOM   10944 C CA  . VAL D 1 249 ? -24.576 21.459  59.748  1.00 56.78  ? 250  VAL D CA  1 
ATOM   10945 C C   . VAL D 1 249 ? -24.748 22.691  58.855  1.00 52.93  ? 250  VAL D C   1 
ATOM   10946 O O   . VAL D 1 249 ? -24.181 23.752  59.131  1.00 51.21  ? 250  VAL D O   1 
ATOM   10947 C CB  . VAL D 1 249 ? -23.496 20.499  59.182  1.00 47.74  ? 250  VAL D CB  1 
ATOM   10948 C CG1 . VAL D 1 249 ? -22.522 21.230  58.266  1.00 51.56  ? 250  VAL D CG1 1 
ATOM   10949 C CG2 . VAL D 1 249 ? -22.759 19.807  60.320  1.00 48.98  ? 250  VAL D CG2 1 
ATOM   10950 N N   . MET D 1 250 ? -25.543 22.550  57.796  1.00 47.10  ? 251  MET D N   1 
ATOM   10951 C CA  . MET D 1 250 ? -25.821 23.666  56.895  1.00 59.57  ? 251  MET D CA  1 
ATOM   10952 C C   . MET D 1 250 ? -26.536 24.798  57.629  1.00 67.39  ? 251  MET D C   1 
ATOM   10953 O O   . MET D 1 250 ? -26.244 25.976  57.413  1.00 57.49  ? 251  MET D O   1 
ATOM   10954 C CB  . MET D 1 250 ? -26.639 23.208  55.684  1.00 56.65  ? 251  MET D CB  1 
ATOM   10955 C CG  . MET D 1 250 ? -27.175 24.350  54.834  1.00 60.56  ? 251  MET D CG  1 
ATOM   10956 S SD  . MET D 1 250 ? -25.902 25.527  54.334  1.00 66.74  ? 251  MET D SD  1 
ATOM   10957 C CE  . MET D 1 250 ? -26.862 26.675  53.354  1.00 64.10  ? 251  MET D CE  1 
ATOM   10958 N N   . LYS D 1 251 ? -27.467 24.437  58.506  1.00 67.79  ? 252  LYS D N   1 
ATOM   10959 C CA  . LYS D 1 251 ? -28.109 25.438  59.348  1.00 60.46  ? 252  LYS D CA  1 
ATOM   10960 C C   . LYS D 1 251 ? -27.100 26.057  60.311  1.00 53.62  ? 252  LYS D C   1 
ATOM   10961 O O   . LYS D 1 251 ? -27.162 27.248  60.609  1.00 53.05  ? 252  LYS D O   1 
ATOM   10962 C CB  . LYS D 1 251 ? -29.282 24.837  60.128  1.00 65.94  ? 252  LYS D CB  1 
ATOM   10963 C CG  . LYS D 1 251 ? -30.017 25.848  61.002  1.00 69.39  ? 252  LYS D CG  1 
ATOM   10964 C CD  . LYS D 1 251 ? -31.215 25.235  61.713  1.00 74.03  ? 252  LYS D CD  1 
ATOM   10965 C CE  . LYS D 1 251 ? -31.909 26.263  62.596  1.00 71.59  ? 252  LYS D CE  1 
ATOM   10966 N NZ  . LYS D 1 251 ? -33.092 25.695  63.299  1.00 81.49  ? 252  LYS D NZ  1 
ATOM   10967 N N   . LEU D 1 252 ? -26.162 25.243  60.783  1.00 67.90  ? 253  LEU D N   1 
ATOM   10968 C CA  . LEU D 1 252 ? -25.167 25.691  61.753  1.00 59.69  ? 253  LEU D CA  1 
ATOM   10969 C C   . LEU D 1 252 ? -24.201 26.727  61.182  1.00 62.41  ? 253  LEU D C   1 
ATOM   10970 O O   . LEU D 1 252 ? -23.830 27.683  61.864  1.00 61.94  ? 253  LEU D O   1 
ATOM   10971 C CB  . LEU D 1 252 ? -24.371 24.494  62.283  1.00 49.89  ? 253  LEU D CB  1 
ATOM   10972 C CG  . LEU D 1 252 ? -23.166 24.795  63.180  1.00 40.97  ? 253  LEU D CG  1 
ATOM   10973 C CD1 . LEU D 1 252 ? -23.614 25.218  64.568  1.00 27.00  ? 253  LEU D CD1 1 
ATOM   10974 C CD2 . LEU D 1 252 ? -22.226 23.601  63.255  1.00 36.04  ? 253  LEU D CD2 1 
ATOM   10975 N N   . VAL D 1 25