data_4AEJ
# 
_entry.id   4AEJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4AEJ         
PDBE  EBI-50878    
WWPDB D_1290050878 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4AE2 unspecified 'CRYSTAL STRUCTURE OF HUMAN FIBRILLAR PROCOLLAGEN TYPE III C-PROPEPTIDE TRIMER' 
PDB 2V53 unspecified 'CRYSTAL STRUCTURE OF A SPARC-COLLAGEN COMPLEX'                                 
PDB 4AK3 unspecified 'CRYSTAL STRUCTURE OF HUMAN FIBRILLAR PROCOLLAGEN TYPE III C-PROPEPTIDE TRIMER' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4AEJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-11 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bourhis, J.M.'  1 
'Mariano, N.'    2 
'Zhao, Y.'       3 
'Harlos, K.'     4 
'Jones, E.Y.'    5 
'Moali, C.'      6 
'Aghajari, N.'   7 
'Hulmes, D.J.S.' 8 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural Basis of Fibrillar Collagen Trimerization and Related Genetic Disorders.'   Nat.Struct.Mol.Biol.       19 1031 
? 2012 ? US 1545-9993 ? ? 23001006 10.1038/NSMB.2389         
1       'Production and Crystallization of the C-Propeptide Trimer from Human Procollagen III.' 'Acta Crystallogr.,Sect.F' 68 1209 
? 2012 ? DK 1744-3091 ? ? 23027749 10.1107/S1744309112035294 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourhis, J.M.'  1  ? 
primary 'Mariano, N.'    2  ? 
primary 'Zhao, Y.'       3  ? 
primary 'Harlos, K.'     4  ? 
primary 'Exposito, J.'   5  ? 
primary 'Jones, E.Y.'    6  ? 
primary 'Moali, C.'      7  ? 
primary 'Aghajari, N.'   8  ? 
primary 'Hulmes, D.J.S.' 9  ? 
1       'Bourhis, J.'    10 ? 
1       'Mariano, N.'    11 ? 
1       'Zhao, Y.'       12 ? 
1       'Walter, T.S.'   13 ? 
1       'El Omari, K.'   14 ? 
1       'Delolme, F.'    15 ? 
1       'Moali, C.'      16 ? 
1       'Hulmes, D.J.S.' 17 ? 
1       'Aghajari, N.'   18 ? 
# 
_cell.entry_id           4AEJ 
_cell.length_a           83.930 
_cell.length_b           89.270 
_cell.length_c           101.460 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4AEJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'COLLAGEN ALPHA-1(III) CHAIN' 29096.707 3   ? YES 'CPROPEPTIDE OF PROCOLLAGEN III, RESIDUES 1222-1466' ? 
2 non-polymer syn 'CALCIUM ION'                 40.078    3   ? ?   ?                                                    ? 
3 non-polymer syn GLYCEROL                      92.094    7   ? ?   ?                                                    ? 
4 water       nat water                         18.015    179 ? ?   ?                                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROCOLLAGEN III' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;ETGHHHHHHSADEP(MSE)DFKINTDEI(MSE)TSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPN
QGCKLDAIKVFCN(MSE)ETGETCISANPLNVPRKHWWTDSSAEKKHVWFGES(MSE)DGGFQFSYGNPELPEDVLDVQL
AFLRLLSSRASQQITYHCKNSIAY(MSE)DQASGNVKKALKL(MSE)GSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSK
TVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ETGHHHHHHSADEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAI
KVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQQITY
HCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIG
GPDQEFGVDVGPVCFL
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   THR n 
1 3   GLY n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  SER n 
1 11  ALA n 
1 12  ASP n 
1 13  GLU n 
1 14  PRO n 
1 15  MSE n 
1 16  ASP n 
1 17  PHE n 
1 18  LYS n 
1 19  ILE n 
1 20  ASN n 
1 21  THR n 
1 22  ASP n 
1 23  GLU n 
1 24  ILE n 
1 25  MSE n 
1 26  THR n 
1 27  SER n 
1 28  LEU n 
1 29  LYS n 
1 30  SER n 
1 31  VAL n 
1 32  ASN n 
1 33  GLY n 
1 34  GLN n 
1 35  ILE n 
1 36  GLU n 
1 37  SER n 
1 38  LEU n 
1 39  ILE n 
1 40  SER n 
1 41  PRO n 
1 42  ASP n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  LYS n 
1 47  ASN n 
1 48  PRO n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  CYS n 
1 53  ARG n 
1 54  ASP n 
1 55  LEU n 
1 56  LYS n 
1 57  PHE n 
1 58  CYS n 
1 59  HIS n 
1 60  PRO n 
1 61  GLU n 
1 62  LEU n 
1 63  LYS n 
1 64  SER n 
1 65  GLY n 
1 66  GLU n 
1 67  TYR n 
1 68  TRP n 
1 69  VAL n 
1 70  ASP n 
1 71  PRO n 
1 72  ASN n 
1 73  GLN n 
1 74  GLY n 
1 75  CYS n 
1 76  LYS n 
1 77  LEU n 
1 78  ASP n 
1 79  ALA n 
1 80  ILE n 
1 81  LYS n 
1 82  VAL n 
1 83  PHE n 
1 84  CYS n 
1 85  ASN n 
1 86  MSE n 
1 87  GLU n 
1 88  THR n 
1 89  GLY n 
1 90  GLU n 
1 91  THR n 
1 92  CYS n 
1 93  ILE n 
1 94  SER n 
1 95  ALA n 
1 96  ASN n 
1 97  PRO n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 PRO n 
1 102 ARG n 
1 103 LYS n 
1 104 HIS n 
1 105 TRP n 
1 106 TRP n 
1 107 THR n 
1 108 ASP n 
1 109 SER n 
1 110 SER n 
1 111 ALA n 
1 112 GLU n 
1 113 LYS n 
1 114 LYS n 
1 115 HIS n 
1 116 VAL n 
1 117 TRP n 
1 118 PHE n 
1 119 GLY n 
1 120 GLU n 
1 121 SER n 
1 122 MSE n 
1 123 ASP n 
1 124 GLY n 
1 125 GLY n 
1 126 PHE n 
1 127 GLN n 
1 128 PHE n 
1 129 SER n 
1 130 TYR n 
1 131 GLY n 
1 132 ASN n 
1 133 PRO n 
1 134 GLU n 
1 135 LEU n 
1 136 PRO n 
1 137 GLU n 
1 138 ASP n 
1 139 VAL n 
1 140 LEU n 
1 141 ASP n 
1 142 VAL n 
1 143 GLN n 
1 144 LEU n 
1 145 ALA n 
1 146 PHE n 
1 147 LEU n 
1 148 ARG n 
1 149 LEU n 
1 150 LEU n 
1 151 SER n 
1 152 SER n 
1 153 ARG n 
1 154 ALA n 
1 155 SER n 
1 156 GLN n 
1 157 GLN n 
1 158 ILE n 
1 159 THR n 
1 160 TYR n 
1 161 HIS n 
1 162 CYS n 
1 163 LYS n 
1 164 ASN n 
1 165 SER n 
1 166 ILE n 
1 167 ALA n 
1 168 TYR n 
1 169 MSE n 
1 170 ASP n 
1 171 GLN n 
1 172 ALA n 
1 173 SER n 
1 174 GLY n 
1 175 ASN n 
1 176 VAL n 
1 177 LYS n 
1 178 LYS n 
1 179 ALA n 
1 180 LEU n 
1 181 LYS n 
1 182 LEU n 
1 183 MSE n 
1 184 GLY n 
1 185 SER n 
1 186 ASN n 
1 187 GLU n 
1 188 GLY n 
1 189 GLU n 
1 190 PHE n 
1 191 LYS n 
1 192 ALA n 
1 193 GLU n 
1 194 GLY n 
1 195 ASN n 
1 196 SER n 
1 197 LYS n 
1 198 PHE n 
1 199 THR n 
1 200 TYR n 
1 201 THR n 
1 202 VAL n 
1 203 LEU n 
1 204 GLU n 
1 205 ASP n 
1 206 GLY n 
1 207 CYS n 
1 208 THR n 
1 209 LYS n 
1 210 HIS n 
1 211 THR n 
1 212 GLY n 
1 213 GLU n 
1 214 TRP n 
1 215 SER n 
1 216 LYS n 
1 217 THR n 
1 218 VAL n 
1 219 PHE n 
1 220 GLU n 
1 221 TYR n 
1 222 ARG n 
1 223 THR n 
1 224 ARG n 
1 225 LYS n 
1 226 ALA n 
1 227 VAL n 
1 228 ARG n 
1 229 LEU n 
1 230 PRO n 
1 231 ILE n 
1 232 VAL n 
1 233 ASP n 
1 234 ILE n 
1 235 ALA n 
1 236 PRO n 
1 237 TYR n 
1 238 ASP n 
1 239 ILE n 
1 240 GLY n 
1 241 GLY n 
1 242 PRO n 
1 243 ASP n 
1 244 GLN n 
1 245 GLU n 
1 246 PHE n 
1 247 GLY n 
1 248 VAL n 
1 249 ASP n 
1 250 VAL n 
1 251 GLY n 
1 252 PRO n 
1 253 VAL n 
1 254 CYS n 
1 255 PHE n 
1 256 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293T 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHLSEC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CO3A1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P02461 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4AEJ A 12 ? 256 ? P02461 1222 ? 1466 ? 1 245 
2 1 4AEJ B 12 ? 256 ? P02461 1222 ? 1466 ? 1 245 
3 1 4AEJ C 12 ? 256 ? P02461 1222 ? 1466 ? 1 245 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4AEJ GLU A 1   ? UNP P02461 ?   ?    'expression tag'      -10 1  
1 4AEJ THR A 2   ? UNP P02461 ?   ?    'expression tag'      -9  2  
1 4AEJ GLY A 3   ? UNP P02461 ?   ?    'expression tag'      -8  3  
1 4AEJ HIS A 4   ? UNP P02461 ?   ?    'expression tag'      -7  4  
1 4AEJ HIS A 5   ? UNP P02461 ?   ?    'expression tag'      -6  5  
1 4AEJ HIS A 6   ? UNP P02461 ?   ?    'expression tag'      -5  6  
1 4AEJ HIS A 7   ? UNP P02461 ?   ?    'expression tag'      -4  7  
1 4AEJ HIS A 8   ? UNP P02461 ?   ?    'expression tag'      -3  8  
1 4AEJ HIS A 9   ? UNP P02461 ?   ?    'expression tag'      -2  9  
1 4AEJ SER A 10  ? UNP P02461 ?   ?    'expression tag'      -1  10 
1 4AEJ ALA A 11  ? UNP P02461 ?   ?    'expression tag'      0   11 
1 4AEJ GLN A 143 ? UNP P02461 HIS 1353 variant               132 12 
1 4AEJ GLN A 157 ? UNP P02461 ASN 1367 'engineered mutation' 146 13 
2 4AEJ GLU B 1   ? UNP P02461 ?   ?    'expression tag'      -10 14 
2 4AEJ THR B 2   ? UNP P02461 ?   ?    'expression tag'      -9  15 
2 4AEJ GLY B 3   ? UNP P02461 ?   ?    'expression tag'      -8  16 
2 4AEJ HIS B 4   ? UNP P02461 ?   ?    'expression tag'      -7  17 
2 4AEJ HIS B 5   ? UNP P02461 ?   ?    'expression tag'      -6  18 
2 4AEJ HIS B 6   ? UNP P02461 ?   ?    'expression tag'      -5  19 
2 4AEJ HIS B 7   ? UNP P02461 ?   ?    'expression tag'      -4  20 
2 4AEJ HIS B 8   ? UNP P02461 ?   ?    'expression tag'      -3  21 
2 4AEJ HIS B 9   ? UNP P02461 ?   ?    'expression tag'      -2  22 
2 4AEJ SER B 10  ? UNP P02461 ?   ?    'expression tag'      -1  23 
2 4AEJ ALA B 11  ? UNP P02461 ?   ?    'expression tag'      0   24 
2 4AEJ GLN B 143 ? UNP P02461 HIS 1353 variant               132 25 
2 4AEJ GLN B 157 ? UNP P02461 ASN 1367 'engineered mutation' 146 26 
3 4AEJ GLU C 1   ? UNP P02461 ?   ?    'expression tag'      -10 27 
3 4AEJ THR C 2   ? UNP P02461 ?   ?    'expression tag'      -9  28 
3 4AEJ GLY C 3   ? UNP P02461 ?   ?    'expression tag'      -8  29 
3 4AEJ HIS C 4   ? UNP P02461 ?   ?    'expression tag'      -7  30 
3 4AEJ HIS C 5   ? UNP P02461 ?   ?    'expression tag'      -6  31 
3 4AEJ HIS C 6   ? UNP P02461 ?   ?    'expression tag'      -5  32 
3 4AEJ HIS C 7   ? UNP P02461 ?   ?    'expression tag'      -4  33 
3 4AEJ HIS C 8   ? UNP P02461 ?   ?    'expression tag'      -3  34 
3 4AEJ HIS C 9   ? UNP P02461 ?   ?    'expression tag'      -2  35 
3 4AEJ SER C 10  ? UNP P02461 ?   ?    'expression tag'      -1  36 
3 4AEJ ALA C 11  ? UNP P02461 ?   ?    'expression tag'      0   37 
3 4AEJ GLN C 143 ? UNP P02461 HIS 1353 variant               132 38 
3 4AEJ GLN C 157 ? UNP P02461 ASN 1367 'engineered mutation' 146 39 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                               'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'    ?                               'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE         ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE        ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                               'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ?                               'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4AEJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   46.5 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG 3350, 0.2 M NACL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2011-07-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9796 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             0.9796 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4AEJ 
_reflns.observed_criterion_sigma_I   4.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             101.50 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   38676 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.21 
_reflns_shell.d_res_low              2.27 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.81 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.00 
_reflns_shell.pdbx_redundancy        14.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4AEJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     36672 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.41 
_refine.ls_d_res_high                            2.21 
_refine.ls_percent_reflns_obs                    99.97 
_refine.ls_R_factor_obs                          0.20308 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20125 
_refine.ls_R_factor_R_free                       0.23686 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1932 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.924 
_refine.B_iso_mean                               33.634 
_refine.aniso_B[1][1]                            0.02 
_refine.aniso_B[2][2]                            -0.01 
_refine.aniso_B[3][3]                            -0.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.263 
_refine.pdbx_overall_ESU_R_Free                  0.202 
_refine.overall_SU_ML                            0.143 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.650 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5028 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         45 
_refine_hist.number_atoms_solvent             179 
_refine_hist.number_atoms_total               5252 
_refine_hist.d_res_high                       2.21 
_refine_hist.d_res_low                        39.41 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.020  ? 5214 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.312  1.959  ? 7055 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.391  5.000  ? 639  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.991 24.298 ? 242  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.188 15.000 ? 804  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.887 15.000 ? 27   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.086  0.200  ? 735  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 4011 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.215 
_refine_ls_shell.d_res_low                        2.272 
_refine_ls_shell.number_reflns_R_work             2493 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.304 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             112 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4AEJ 
_struct.title                     'Crystal structure of Human fibrillar procollagen type III C- propeptide trimer' 
_struct.pdbx_descriptor           'COLLAGEN ALPHA-1(III) CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4AEJ 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'STRUCTURAL PROTEIN, EXTRACELLULAR, MATRIX, FIBROSIS, TRIMER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 2 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 51  ? HIS A 59  ? ASN A 40  HIS A 48  1 ? 9  
HELX_P HELX_P2  2  CYS A 75  ? ALA A 79  ? CYS A 64  ALA A 68  5 ? 5  
HELX_P HELX_P3  3  TRP A 117 ? MSE A 122 ? TRP A 106 MSE A 111 1 ? 6  
HELX_P HELX_P4  4  PRO A 136 ? SER A 151 ? PRO A 125 SER A 140 1 ? 16 
HELX_P HELX_P5  5  LYS A 225 ? LEU A 229 ? LYS A 214 LEU A 218 5 ? 5  
HELX_P HELX_P6  6  ASN B 51  ? HIS B 59  ? ASN B 40  HIS B 48  1 ? 9  
HELX_P HELX_P7  7  CYS B 75  ? ALA B 79  ? CYS B 64  ALA B 68  5 ? 5  
HELX_P HELX_P8  8  TRP B 117 ? MSE B 122 ? TRP B 106 MSE B 111 1 ? 6  
HELX_P HELX_P9  9  PRO B 136 ? SER B 151 ? PRO B 125 SER B 140 1 ? 16 
HELX_P HELX_P10 10 LYS B 225 ? LEU B 229 ? LYS B 214 LEU B 218 5 ? 5  
HELX_P HELX_P11 11 ASN C 51  ? HIS C 59  ? ASN C 40  HIS C 48  1 ? 9  
HELX_P HELX_P12 12 CYS C 75  ? ALA C 79  ? CYS C 64  ALA C 68  5 ? 5  
HELX_P HELX_P13 13 TRP C 117 ? MSE C 122 ? TRP C 106 MSE C 111 1 ? 6  
HELX_P HELX_P14 14 PRO C 136 ? LEU C 150 ? PRO C 125 LEU C 139 1 ? 15 
HELX_P HELX_P15 15 ASN C 195 ? PHE C 198 ? ASN C 184 PHE C 187 5 ? 4  
HELX_P HELX_P16 16 LYS C 225 ? LEU C 229 ? LYS C 214 LEU C 218 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 52  SG ? ? ? 1_555 A CYS 84  SG  ? ? A CYS 41  A CYS 73   1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2  disulf ?    ? A CYS 58  SG ? ? ? 1_555 C CYS 75  SG  ? ? A CYS 47  C CYS 64   1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf3  disulf ?    ? A CYS 75  SG ? ? ? 1_555 B CYS 58  SG  ? ? A CYS 64  B CYS 47   1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf4  disulf ?    ? A CYS 92  SG ? ? ? 1_555 A CYS 254 SG  ? ? A CYS 81  A CYS 243  1_555 ? ? ? ? ? ? ? 2.130 ? 
disulf5  disulf ?    ? A CYS 162 SG ? ? ? 1_555 A CYS 207 SG  ? ? A CYS 151 A CYS 196  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf6  disulf ?    ? B CYS 52  SG ? ? ? 1_555 B CYS 84  SG  ? ? B CYS 41  B CYS 73   1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf7  disulf ?    ? B CYS 75  SG ? ? ? 1_555 C CYS 58  SG  ? ? B CYS 64  C CYS 47   1_555 ? ? ? ? ? ? ? 2.070 ? 
disulf8  disulf ?    ? B CYS 92  SG ? ? ? 1_555 B CYS 254 SG  ? ? B CYS 81  B CYS 243  1_555 ? ? ? ? ? ? ? 2.159 ? 
disulf9  disulf ?    ? B CYS 162 SG ? ? ? 1_555 B CYS 207 SG  ? ? B CYS 151 B CYS 196  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf10 disulf ?    ? C CYS 52  SG ? ? ? 1_555 C CYS 84  SG  ? ? C CYS 41  C CYS 73   1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf11 disulf ?    ? C CYS 92  SG ? ? ? 1_555 C CYS 254 SG  ? ? C CYS 81  C CYS 243  1_555 ? ? ? ? ? ? ? 2.064 ? 
disulf12 disulf ?    ? C CYS 162 SG ? ? ? 1_555 C CYS 207 SG  ? ? C CYS 151 C CYS 196  1_555 ? ? ? ? ? ? ? 2.031 ? 
covale1  covale both ? A MSE 86  N  ? ? ? 1_555 A ASN 85  C   ? ? A MSE 75  A ASN 74   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2  covale both ? A MSE 86  C  ? ? ? 1_555 A GLU 87  N   ? ? A MSE 75  A GLU 76   1_555 ? ? ? ? ? ? ? 1.325 ? 
covale3  covale both ? A MSE 122 N  ? ? ? 1_555 A SER 121 C   ? ? A MSE 111 A SER 110  1_555 ? ? ? ? ? ? ? 1.324 ? 
covale4  covale both ? A MSE 122 C  ? ? ? 1_555 A ASP 123 N   ? ? A MSE 111 A ASP 112  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale5  covale both ? A MSE 169 N  ? ? ? 1_555 A TYR 168 C   ? ? A MSE 158 A TYR 157  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6  covale both ? A MSE 169 C  ? ? ? 1_555 A ASP 170 N   ? ? A MSE 158 A ASP 159  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale7  covale both ? A MSE 183 N  ? ? ? 1_555 A LEU 182 C   ? ? A MSE 172 A LEU 171  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale8  covale both ? A MSE 183 C  ? ? ? 1_555 A GLY 184 N   ? ? A MSE 172 A GLY 173  1_555 ? ? ? ? ? ? ? 1.326 ? 
metalc1  metalc ?    ? D CA  .   CA ? ? ? 1_555 N HOH .   O   ? ? A CA  246 A HOH 2025 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc2  metalc ?    ? D CA  .   CA ? ? ? 1_555 A ASP 70  OD1 ? ? A CA  246 A ASP 59   1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc3  metalc ?    ? D CA  .   CA ? ? ? 1_555 A ASP 70  OD2 ? ? A CA  246 A ASP 59   1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc4  metalc ?    ? D CA  .   CA ? ? ? 1_555 A ASN 72  OD1 ? ? A CA  246 A ASN 61   1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc5  metalc ?    ? D CA  .   CA ? ? ? 1_555 A GLN 73  O   ? ? A CA  246 A GLN 62   1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc6  metalc ?    ? D CA  .   CA ? ? ? 1_555 A CYS 75  O   ? ? A CA  246 A CYS 64   1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc7  metalc ?    ? D CA  .   CA ? ? ? 1_555 A ASP 78  OD1 ? ? A CA  246 A ASP 67   1_555 ? ? ? ? ? ? ? 2.315 ? 
covale9  covale both ? B MSE 86  N  ? ? ? 1_555 B ASN 85  C   ? ? B MSE 75  B ASN 74   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale10 covale both ? B MSE 86  C  ? ? ? 1_555 B GLU 87  N   ? ? B MSE 75  B GLU 76   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale11 covale both ? B MSE 122 N  ? ? ? 1_555 B SER 121 C   ? ? B MSE 111 B SER 110  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale12 covale both ? B MSE 122 C  ? ? ? 1_555 B ASP 123 N   ? ? B MSE 111 B ASP 112  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale13 covale both ? B MSE 169 N  ? ? ? 1_555 B TYR 168 C   ? ? B MSE 158 B TYR 157  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale14 covale both ? B MSE 169 C  ? ? ? 1_555 B ASP 170 N   ? ? B MSE 158 B ASP 159  1_555 ? ? ? ? ? ? ? 1.311 ? 
covale15 covale both ? B MSE 183 N  A ? ? 1_555 B LEU 182 C   ? ? B MSE 172 B LEU 171  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale16 covale both ? B MSE 183 C  B ? ? 1_555 B GLY 184 N   ? ? B MSE 172 B GLY 173  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale17 covale both ? B MSE 183 N  B ? ? 1_555 B LEU 182 C   ? ? B MSE 172 B LEU 171  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale18 covale both ? B MSE 183 C  A ? ? 1_555 B GLY 184 N   ? ? B MSE 172 B GLY 173  1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc8  metalc ?    ? J CA  .   CA ? ? ? 1_555 B GLN 73  O   ? ? B CA  246 B GLN 62   1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc9  metalc ?    ? J CA  .   CA ? ? ? 1_555 O HOH .   O   ? ? B CA  246 B HOH 2021 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc10 metalc ?    ? J CA  .   CA ? ? ? 1_555 B ASP 70  OD2 ? ? B CA  246 B ASP 59   1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc11 metalc ?    ? J CA  .   CA ? ? ? 1_555 B ASN 72  OD1 ? ? B CA  246 B ASN 61   1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc12 metalc ?    ? J CA  .   CA ? ? ? 1_555 B ASP 78  OD1 ? ? B CA  246 B ASP 67   1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc13 metalc ?    ? J CA  .   CA ? ? ? 1_555 B ASP 70  OD1 ? ? B CA  246 B ASP 59   1_555 ? ? ? ? ? ? ? 2.371 ? 
metalc14 metalc ?    ? J CA  .   CA ? ? ? 1_555 B CYS 75  O   ? ? B CA  246 B CYS 64   1_555 ? ? ? ? ? ? ? 2.342 ? 
covale19 covale both ? C MSE 86  C  ? ? ? 1_555 C GLU 87  N   ? ? C MSE 75  C GLU 76   1_555 ? ? ? ? ? ? ? 1.325 ? 
covale20 covale both ? C MSE 86  N  ? ? ? 1_555 C ASN 85  C   ? ? C MSE 75  C ASN 74   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale21 covale both ? C MSE 122 C  ? ? ? 1_555 C ASP 123 N   ? ? C MSE 111 C ASP 112  1_555 ? ? ? ? ? ? ? 1.338 ? 
covale22 covale both ? C MSE 122 N  ? ? ? 1_555 C SER 121 C   ? ? C MSE 111 C SER 110  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale23 covale both ? C MSE 169 C  ? ? ? 1_555 C ASP 170 N   ? ? C MSE 158 C ASP 159  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale24 covale both ? C MSE 169 N  ? ? ? 1_555 C TYR 168 C   ? ? C MSE 158 C TYR 157  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale25 covale both ? C MSE 183 C  ? ? ? 1_555 C GLY 184 N   ? ? C MSE 172 C GLY 173  1_555 ? ? ? ? ? ? ? 1.319 ? 
covale26 covale both ? C MSE 183 N  ? ? ? 1_555 C LEU 182 C   ? ? C MSE 172 C LEU 171  1_555 ? ? ? ? ? ? ? 1.324 ? 
metalc15 metalc ?    ? M CA  .   CA ? ? ? 1_555 C ASP 70  OD2 ? ? C CA  246 C ASP 59   1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc16 metalc ?    ? M CA  .   CA ? ? ? 1_555 C GLN 73  O   ? ? C CA  246 C GLN 62   1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc17 metalc ?    ? M CA  .   CA ? ? ? 1_555 C CYS 75  O   ? ? C CA  246 C CYS 64   1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc18 metalc ?    ? M CA  .   CA ? ? ? 1_555 C ASP 78  OD1 ? ? C CA  246 C ASP 67   1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc19 metalc ?    ? M CA  .   CA ? ? ? 1_555 C ASN 72  OD1 ? ? C CA  246 C ASN 61   1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc20 metalc ?    ? M CA  .   CA ? ? ? 1_555 N HOH .   O   ? ? C CA  246 A HOH 2012 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc21 metalc ?    ? M CA  .   CA ? ? ? 1_555 C ASP 70  OD1 ? ? C CA  246 C ASP 59   1_555 ? ? ? ? ? ? ? 2.465 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 96  A . ? ASN 85  A PRO 97  A ? PRO 86  A 1 -8.26  
2 LEU 229 A . ? LEU 218 A PRO 230 A ? PRO 219 A 1 1.89   
3 ASN 96  B . ? ASN 85  B PRO 97  B ? PRO 86  B 1 -4.93  
4 LEU 229 B . ? LEU 218 B PRO 230 B ? PRO 219 B 1 -0.39  
5 ASN 96  C . ? ASN 85  C PRO 97  C ? PRO 86  C 1 -2.60  
6 LEU 229 C . ? LEU 218 C PRO 230 C ? PRO 219 C 1 6.37   
7 ILE 239 C . ? ILE 228 C GLY 240 C ? GLY 229 C 1 -17.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 5 ? 
AC ? 2 ? 
AD ? 3 ? 
BA ? 7 ? 
BB ? 7 ? 
BC ? 3 ? 
CA ? 7 ? 
CB ? 5 ? 
CC ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CA 5 6 ? anti-parallel 
CA 6 7 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? parallel      
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 65  ? VAL A 69  ? GLY A 54  VAL A 58  
AA 2 ILE A 80  ? ASN A 85  ? ILE A 69  ASN A 74  
AA 3 GLU A 90  ? ILE A 93  ? GLU A 79  ILE A 82  
AA 4 GLU A 245 ? PHE A 255 ? GLU A 234 PHE A 244 
AA 5 ALA A 154 ? LYS A 163 ? ALA A 143 LYS A 152 
AA 6 TRP A 214 ? THR A 223 ? TRP A 203 THR A 212 
AA 7 THR A 201 ? ASP A 205 ? THR A 190 ASP A 194 
AB 1 GLY A 65  ? VAL A 69  ? GLY A 54  VAL A 58  
AB 2 ILE A 80  ? ASN A 85  ? ILE A 69  ASN A 74  
AB 3 GLU A 90  ? ILE A 93  ? GLU A 79  ILE A 82  
AB 4 GLU A 245 ? PHE A 255 ? GLU A 234 PHE A 244 
AB 5 ASN A 99  ? LYS A 103 ? ASN A 88  LYS A 92  
AC 1 ALA A 95  ? ASN A 96  ? ALA A 84  ASN A 85  
AC 2 SER A 129 ? TYR A 130 ? SER A 118 TYR A 119 
AD 1 GLU A 189 ? PHE A 190 ? GLU A 178 PHE A 179 
AD 2 LYS A 181 ? MSE A 183 ? LYS A 170 MSE A 172 
AD 3 ASP A 233 ? ALA A 235 ? ASP A 222 ALA A 224 
BA 1 GLY B 65  ? VAL B 69  ? GLY B 54  VAL B 58  
BA 2 ILE B 80  ? ASN B 85  ? ILE B 69  ASN B 74  
BA 3 GLU B 90  ? ILE B 93  ? GLU B 79  ILE B 82  
BA 4 VAL B 253 ? PHE B 255 ? VAL B 242 PHE B 244 
BA 5 ALA B 154 ? LYS B 163 ? ALA B 143 LYS B 152 
BA 6 GLU B 245 ? VAL B 250 ? GLU B 234 VAL B 239 
BA 7 ASN B 99  ? LYS B 103 ? ASN B 88  LYS B 92  
BB 1 GLY B 65  ? VAL B 69  ? GLY B 54  VAL B 58  
BB 2 ILE B 80  ? ASN B 85  ? ILE B 69  ASN B 74  
BB 3 GLU B 90  ? ILE B 93  ? GLU B 79  ILE B 82  
BB 4 VAL B 253 ? PHE B 255 ? VAL B 242 PHE B 244 
BB 5 ALA B 154 ? LYS B 163 ? ALA B 143 LYS B 152 
BB 6 TRP B 214 ? THR B 223 ? TRP B 203 THR B 212 
BB 7 THR B 201 ? ASP B 205 ? THR B 190 ASP B 194 
BC 1 GLU B 189 ? PHE B 190 ? GLU B 178 PHE B 179 
BC 2 LYS B 181 ? MSE B 183 ? LYS B 170 MSE B 172 
BC 3 ASP B 233 ? ALA B 235 ? ASP B 222 ALA B 224 
CA 1 GLY C 65  ? VAL C 69  ? GLY C 54  VAL C 58  
CA 2 ILE C 80  ? ASN C 85  ? ILE C 69  ASN C 74  
CA 3 GLU C 90  ? ILE C 93  ? GLU C 79  ILE C 82  
CA 4 GLU C 245 ? PHE C 255 ? GLU C 234 PHE C 244 
CA 5 ALA C 154 ? LYS C 163 ? ALA C 143 LYS C 152 
CA 6 TRP C 214 ? THR C 223 ? TRP C 203 THR C 212 
CA 7 THR C 201 ? ASP C 205 ? THR C 190 ASP C 194 
CB 1 GLY C 65  ? VAL C 69  ? GLY C 54  VAL C 58  
CB 2 ILE C 80  ? ASN C 85  ? ILE C 69  ASN C 74  
CB 3 GLU C 90  ? ILE C 93  ? GLU C 79  ILE C 82  
CB 4 GLU C 245 ? PHE C 255 ? GLU C 234 PHE C 244 
CB 5 ASN C 99  ? LYS C 103 ? ASN C 88  LYS C 92  
CC 1 GLU C 189 ? PHE C 190 ? GLU C 178 PHE C 179 
CC 2 LYS C 181 ? MSE C 183 ? LYS C 170 MSE C 172 
CC 3 ASP C 233 ? ALA C 235 ? ASP C 222 ALA C 224 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 69  ? N VAL A 58  O ILE A 80  ? O ILE A 69  
AA 2 3 N ASN A 85  ? N ASN A 74  O GLU A 90  ? O GLU A 79  
AA 3 4 N ILE A 93  ? N ILE A 82  O VAL A 253 ? O VAL A 242 
AA 4 5 N CYS A 254 ? N CYS A 243 O SER A 155 ? O SER A 144 
AA 5 6 N CYS A 162 ? N CYS A 151 O SER A 215 ? O SER A 204 
AA 6 7 N GLU A 220 ? N GLU A 209 O THR A 201 ? O THR A 190 
AB 1 2 N VAL A 69  ? N VAL A 58  O ILE A 80  ? O ILE A 69  
AB 2 3 N ASN A 85  ? N ASN A 74  O GLU A 90  ? O GLU A 79  
AB 3 4 N ILE A 93  ? N ILE A 82  O VAL A 253 ? O VAL A 242 
AB 4 5 N VAL A 248 ? N VAL A 237 O VAL A 100 ? O VAL A 89  
AC 1 2 N ASN A 96  ? N ASN A 85  O SER A 129 ? O SER A 118 
AD 1 2 N PHE A 190 ? N PHE A 179 O LEU A 182 ? O LEU A 171 
AD 2 3 N MSE A 183 ? N MSE A 172 O ASP A 233 ? O ASP A 222 
BA 1 2 N VAL B 69  ? N VAL B 58  O ILE B 80  ? O ILE B 69  
BA 2 3 N ASN B 85  ? N ASN B 74  O GLU B 90  ? O GLU B 79  
BA 3 4 N ILE B 93  ? N ILE B 82  O VAL B 253 ? O VAL B 242 
BA 4 5 N CYS B 254 ? N CYS B 243 O SER B 155 ? O SER B 144 
BA 5 6 N LYS B 163 ? N LYS B 152 O GLU B 245 ? O GLU B 234 
BA 6 7 N VAL B 248 ? N VAL B 237 O VAL B 100 ? O VAL B 89  
BB 1 2 N VAL B 69  ? N VAL B 58  O ILE B 80  ? O ILE B 69  
BB 2 3 N ASN B 85  ? N ASN B 74  O GLU B 90  ? O GLU B 79  
BB 3 4 N ILE B 93  ? N ILE B 82  O VAL B 253 ? O VAL B 242 
BB 4 5 N CYS B 254 ? N CYS B 243 O SER B 155 ? O SER B 144 
BB 5 6 N CYS B 162 ? N CYS B 151 O SER B 215 ? O SER B 204 
BB 6 7 N GLU B 220 ? N GLU B 209 O THR B 201 ? O THR B 190 
BC 1 2 N PHE B 190 ? N PHE B 179 O LEU B 182 ? O LEU B 171 
BC 2 3 N MSE B 183 ? N MSE B 172 O ASP B 233 ? O ASP B 222 
CA 1 2 N VAL C 69  ? N VAL C 58  O ILE C 80  ? O ILE C 69  
CA 2 3 N ASN C 85  ? N ASN C 74  O GLU C 90  ? O GLU C 79  
CA 3 4 N ILE C 93  ? N ILE C 82  O VAL C 253 ? O VAL C 242 
CA 4 5 N CYS C 254 ? N CYS C 243 O SER C 155 ? O SER C 144 
CA 5 6 N CYS C 162 ? N CYS C 151 O SER C 215 ? O SER C 204 
CA 6 7 N GLU C 220 ? N GLU C 209 O THR C 201 ? O THR C 190 
CB 1 2 N VAL C 69  ? N VAL C 58  O ILE C 80  ? O ILE C 69  
CB 2 3 N ASN C 85  ? N ASN C 74  O GLU C 90  ? O GLU C 79  
CB 3 4 N ILE C 93  ? N ILE C 82  O VAL C 253 ? O VAL C 242 
CB 4 5 N VAL C 248 ? N VAL C 237 O VAL C 100 ? O VAL C 89  
CC 1 2 N PHE C 190 ? N PHE C 179 O LEU C 182 ? O LEU C 171 
CC 2 3 N MSE C 183 ? N MSE C 172 O ASP C 233 ? O ASP C 222 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 246'   
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 246'   
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA C 246'   
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1246' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1247' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1248' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL B 1246' 
AC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 1249' 
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 1250' 
BC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE GOL B 1247' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 70  ? ASP A 59   . ? 1_555 ? 
2  AC1 6 ASN A 72  ? ASN A 61   . ? 1_555 ? 
3  AC1 6 GLN A 73  ? GLN A 62   . ? 1_555 ? 
4  AC1 6 CYS A 75  ? CYS A 64   . ? 1_555 ? 
5  AC1 6 ASP A 78  ? ASP A 67   . ? 1_555 ? 
6  AC1 6 HOH N .   ? HOH A 2025 . ? 1_555 ? 
7  AC2 6 ASP B 70  ? ASP B 59   . ? 1_555 ? 
8  AC2 6 ASN B 72  ? ASN B 61   . ? 1_555 ? 
9  AC2 6 GLN B 73  ? GLN B 62   . ? 1_555 ? 
10 AC2 6 CYS B 75  ? CYS B 64   . ? 1_555 ? 
11 AC2 6 ASP B 78  ? ASP B 67   . ? 1_555 ? 
12 AC2 6 HOH O .   ? HOH B 2021 . ? 1_555 ? 
13 AC3 6 HOH N .   ? HOH A 2012 . ? 1_555 ? 
14 AC3 6 ASP C 70  ? ASP C 59   . ? 1_555 ? 
15 AC3 6 ASN C 72  ? ASN C 61   . ? 1_555 ? 
16 AC3 6 GLN C 73  ? GLN C 62   . ? 1_555 ? 
17 AC3 6 CYS C 75  ? CYS C 64   . ? 1_555 ? 
18 AC3 6 ASP C 78  ? ASP C 67   . ? 1_555 ? 
19 AC4 6 PHE A 83  ? PHE A 72   . ? 1_555 ? 
20 AC4 6 ASN A 85  ? ASN A 74   . ? 1_555 ? 
21 AC4 6 GLU A 90  ? GLU A 79   . ? 1_555 ? 
22 AC4 6 CYS A 92  ? CYS A 81   . ? 1_555 ? 
23 AC4 6 HOH N .   ? HOH A 2052 . ? 1_555 ? 
24 AC4 6 LEU B 203 ? LEU B 192  . ? 3_555 ? 
25 AC5 6 LYS A 63  ? LYS A 52   . ? 1_555 ? 
26 AC5 6 SER A 64  ? SER A 53   . ? 1_555 ? 
27 AC5 6 HOH N .   ? HOH A 2018 . ? 1_555 ? 
28 AC5 6 TYR B 168 ? TYR B 157  . ? 3_555 ? 
29 AC5 6 THR B 201 ? THR B 190  . ? 3_555 ? 
30 AC5 6 VAL B 202 ? VAL B 191  . ? 3_555 ? 
31 AC6 7 LEU A 203 ? LEU A 192  . ? 1_555 ? 
32 AC6 7 GLU A 204 ? GLU A 193  . ? 1_555 ? 
33 AC6 7 GOL H .   ? GOL A 1249 . ? 1_555 ? 
34 AC6 7 GOL I .   ? GOL A 1250 . ? 1_555 ? 
35 AC6 7 HOH N .   ? HOH A 2068 . ? 1_555 ? 
36 AC6 7 PRO B 252 ? PRO B 241  . ? 3_555 ? 
37 AC6 7 HOH O .   ? HOH B 2055 . ? 3_555 ? 
38 AC7 6 SER B 129 ? SER B 118  . ? 1_555 ? 
39 AC7 6 TYR B 130 ? TYR B 119  . ? 1_555 ? 
40 AC7 6 GLU B 137 ? GLU B 126  . ? 1_555 ? 
41 AC7 6 LEU B 140 ? LEU B 129  . ? 1_555 ? 
42 AC7 6 ASP B 141 ? ASP B 130  . ? 1_555 ? 
43 AC7 6 LEU B 144 ? LEU B 133  . ? 1_555 ? 
44 AC8 7 GLU A 204 ? GLU A 193  . ? 1_555 ? 
45 AC8 7 LYS A 216 ? LYS A 205  . ? 1_555 ? 
46 AC8 7 GOL G .   ? GOL A 1248 . ? 1_555 ? 
47 AC8 7 ILE B 158 ? ILE B 147  . ? 3_555 ? 
48 AC8 7 THR B 159 ? THR B 148  . ? 3_555 ? 
49 AC8 7 ASP B 249 ? ASP B 238  . ? 3_555 ? 
50 AC8 7 GLY B 251 ? GLY B 240  . ? 3_555 ? 
51 AC9 6 LEU A 203 ? LEU A 192  . ? 1_555 ? 
52 AC9 6 GOL G .   ? GOL A 1248 . ? 1_555 ? 
53 AC9 6 PHE B 83  ? PHE B 72   . ? 3_555 ? 
54 AC9 6 ASN B 85  ? ASN B 74   . ? 3_555 ? 
55 AC9 6 GLU B 90  ? GLU B 79   . ? 3_555 ? 
56 AC9 6 CYS B 92  ? CYS B 81   . ? 3_555 ? 
57 BC1 9 HIS B 115 ? HIS B 104  . ? 1_555 ? 
58 BC1 9 LYS B 191 ? LYS B 180  . ? 1_555 ? 
59 BC1 9 ALA B 192 ? ALA B 181  . ? 1_555 ? 
60 BC1 9 GLU B 193 ? GLU B 182  . ? 1_555 ? 
61 BC1 9 HOH O .   ? HOH B 2033 . ? 1_555 ? 
62 BC1 9 HOH O .   ? HOH B 2045 . ? 1_555 ? 
63 BC1 9 HOH O .   ? HOH B 2061 . ? 1_555 ? 
64 BC1 9 HOH O .   ? HOH B 2063 . ? 1_555 ? 
65 BC1 9 HOH O .   ? HOH B 2076 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4AEJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4AEJ 
_atom_sites.fract_transf_matrix[1][1]   0.011915 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011202 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009856 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 40  ? -25.815 6.424   33.605  1.00 58.01 ? 29   SER A N   1 
ATOM   2    C  CA  . SER A 1 40  ? -24.645 5.861   32.868  1.00 61.67 ? 29   SER A CA  1 
ATOM   3    C  C   . SER A 1 40  ? -23.546 5.376   33.836  1.00 59.27 ? 29   SER A C   1 
ATOM   4    O  O   . SER A 1 40  ? -23.529 5.785   34.995  1.00 63.34 ? 29   SER A O   1 
ATOM   5    C  CB  . SER A 1 40  ? -24.102 6.885   31.855  1.00 65.70 ? 29   SER A CB  1 
ATOM   6    O  OG  . SER A 1 40  ? -23.575 8.039   32.490  1.00 66.55 ? 29   SER A OG  1 
ATOM   7    N  N   . PRO A 1 41  ? -22.634 4.495   33.367  1.00 53.92 ? 30   PRO A N   1 
ATOM   8    C  CA  . PRO A 1 41  ? -21.641 3.874   34.251  1.00 50.09 ? 30   PRO A CA  1 
ATOM   9    C  C   . PRO A 1 41  ? -20.841 4.853   35.120  1.00 47.17 ? 30   PRO A C   1 
ATOM   10   O  O   . PRO A 1 41  ? -20.500 5.946   34.683  1.00 48.41 ? 30   PRO A O   1 
ATOM   11   C  CB  . PRO A 1 41  ? -20.720 3.146   33.272  1.00 49.45 ? 30   PRO A CB  1 
ATOM   12   C  CG  . PRO A 1 41  ? -21.604 2.801   32.132  1.00 49.21 ? 30   PRO A CG  1 
ATOM   13   C  CD  . PRO A 1 41  ? -22.511 3.989   31.985  1.00 53.10 ? 30   PRO A CD  1 
ATOM   14   N  N   . ASP A 1 42  ? -20.545 4.455   36.349  1.00 42.09 ? 31   ASP A N   1 
ATOM   15   C  CA  . ASP A 1 42  ? -19.939 5.383   37.279  1.00 39.70 ? 31   ASP A CA  1 
ATOM   16   C  C   . ASP A 1 42  ? -18.473 5.101   37.615  1.00 35.56 ? 31   ASP A C   1 
ATOM   17   O  O   . ASP A 1 42  ? -17.861 5.869   38.334  1.00 37.17 ? 31   ASP A O   1 
ATOM   18   C  CB  . ASP A 1 42  ? -20.817 5.564   38.538  1.00 39.36 ? 31   ASP A CB  1 
ATOM   19   C  CG  . ASP A 1 42  ? -20.923 4.310   39.385  1.00 40.83 ? 31   ASP A CG  1 
ATOM   20   O  OD1 . ASP A 1 42  ? -20.256 3.292   39.087  1.00 39.89 ? 31   ASP A OD1 1 
ATOM   21   O  OD2 . ASP A 1 42  ? -21.683 4.352   40.380  1.00 42.29 ? 31   ASP A OD2 1 
ATOM   22   N  N   . GLY A 1 43  ? -17.913 4.014   37.088  1.00 32.96 ? 32   GLY A N   1 
ATOM   23   C  CA  . GLY A 1 43  ? -16.493 3.722   37.280  1.00 29.36 ? 32   GLY A CA  1 
ATOM   24   C  C   . GLY A 1 43  ? -16.188 2.884   38.508  1.00 28.75 ? 32   GLY A C   1 
ATOM   25   O  O   . GLY A 1 43  ? -15.014 2.653   38.853  1.00 26.09 ? 32   GLY A O   1 
ATOM   26   N  N   . SER A 1 44  ? -17.242 2.435   39.183  1.00 29.16 ? 33   SER A N   1 
ATOM   27   C  CA  . SER A 1 44  ? -17.107 1.465   40.280  1.00 29.84 ? 33   SER A CA  1 
ATOM   28   C  C   . SER A 1 44  ? -16.833 0.102   39.663  1.00 28.82 ? 33   SER A C   1 
ATOM   29   O  O   . SER A 1 44  ? -17.051 -0.097  38.453  1.00 27.18 ? 33   SER A O   1 
ATOM   30   C  CB  . SER A 1 44  ? -18.413 1.384   41.086  1.00 32.34 ? 33   SER A CB  1 
ATOM   31   O  OG  . SER A 1 44  ? -19.528 1.145   40.222  1.00 31.51 ? 33   SER A OG  1 
ATOM   32   N  N   . ARG A 1 45  ? -16.364 -0.825  40.490  1.00 27.39 ? 34   ARG A N   1 
ATOM   33   C  CA  . ARG A 1 45  ? -16.131 -2.197  40.062  1.00 28.70 ? 34   ARG A CA  1 
ATOM   34   C  C   . ARG A 1 45  ? -17.356 -2.848  39.426  1.00 29.33 ? 34   ARG A C   1 
ATOM   35   O  O   . ARG A 1 45  ? -17.220 -3.545  38.434  1.00 28.78 ? 34   ARG A O   1 
ATOM   36   C  CB  . ARG A 1 45  ? -15.626 -3.044  41.230  1.00 29.37 ? 34   ARG A CB  1 
ATOM   37   C  CG  . ARG A 1 45  ? -15.198 -4.446  40.842  1.00 30.15 ? 34   ARG A CG  1 
ATOM   38   C  CD  . ARG A 1 45  ? -14.407 -5.101  41.972  1.00 30.48 ? 34   ARG A CD  1 
ATOM   39   N  NE  . ARG A 1 45  ? -13.721 -6.304  41.510  1.00 32.78 ? 34   ARG A NE  1 
ATOM   40   C  CZ  . ARG A 1 45  ? -12.812 -6.975  42.215  1.00 35.88 ? 34   ARG A CZ  1 
ATOM   41   N  NH1 . ARG A 1 45  ? -12.457 -6.566  43.432  1.00 35.42 ? 34   ARG A NH1 1 
ATOM   42   N  NH2 . ARG A 1 45  ? -12.245 -8.057  41.697  1.00 36.14 ? 34   ARG A NH2 1 
ATOM   43   N  N   . LYS A 1 46  ? -18.545 -2.621  39.990  1.00 30.70 ? 35   LYS A N   1 
ATOM   44   C  CA  . LYS A 1 46  ? -19.771 -3.258  39.482  1.00 33.28 ? 35   LYS A CA  1 
ATOM   45   C  C   . LYS A 1 46  ? -20.341 -2.521  38.287  1.00 31.89 ? 35   LYS A C   1 
ATOM   46   O  O   . LYS A 1 46  ? -21.132 -3.067  37.533  1.00 33.85 ? 35   LYS A O   1 
ATOM   47   C  CB  . LYS A 1 46  ? -20.849 -3.373  40.581  1.00 36.52 ? 35   LYS A CB  1 
ATOM   48   C  CG  . LYS A 1 46  ? -20.610 -4.496  41.586  1.00 39.35 ? 35   LYS A CG  1 
ATOM   49   C  CD  . LYS A 1 46  ? -21.516 -4.356  42.811  1.00 39.39 ? 35   LYS A CD  1 
ATOM   50   N  N   . ASN A 1 47  ? -19.938 -1.276  38.104  1.00 30.65 ? 36   ASN A N   1 
ATOM   51   C  CA  . ASN A 1 47  ? -20.431 -0.488  36.985  1.00 29.85 ? 36   ASN A CA  1 
ATOM   52   C  C   . ASN A 1 47  ? -19.282 0.265   36.266  1.00 27.87 ? 36   ASN A C   1 
ATOM   53   O  O   . ASN A 1 47  ? -19.200 1.484   36.331  1.00 26.91 ? 36   ASN A O   1 
ATOM   54   C  CB  . ASN A 1 47  ? -21.493 0.466   37.528  1.00 33.02 ? 36   ASN A CB  1 
ATOM   55   C  CG  . ASN A 1 47  ? -22.316 1.126   36.441  1.00 37.18 ? 36   ASN A CG  1 
ATOM   56   O  OD1 . ASN A 1 47  ? -22.280 0.719   35.280  1.00 42.92 ? 36   ASN A OD1 1 
ATOM   57   N  ND2 . ASN A 1 47  ? -23.064 2.162   36.814  1.00 36.95 ? 36   ASN A ND2 1 
ATOM   58   N  N   . PRO A 1 48  ? -18.365 -0.467  35.606  1.00 26.02 ? 37   PRO A N   1 
ATOM   59   C  CA  . PRO A 1 48  ? -17.225 0.227   34.970  1.00 24.03 ? 37   PRO A CA  1 
ATOM   60   C  C   . PRO A 1 48  ? -17.582 1.077   33.744  1.00 24.83 ? 37   PRO A C   1 
ATOM   61   O  O   . PRO A 1 48  ? -18.502 0.743   32.989  1.00 24.40 ? 37   PRO A O   1 
ATOM   62   C  CB  . PRO A 1 48  ? -16.297 -0.918  34.560  1.00 23.31 ? 37   PRO A CB  1 
ATOM   63   C  CG  . PRO A 1 48  ? -17.209 -2.104  34.399  1.00 25.11 ? 37   PRO A CG  1 
ATOM   64   C  CD  . PRO A 1 48  ? -18.256 -1.936  35.475  1.00 25.10 ? 37   PRO A CD  1 
ATOM   65   N  N   . ALA A 1 49  ? -16.861 2.181   33.577  1.00 22.73 ? 38   ALA A N   1 
ATOM   66   C  CA  . ALA A 1 49  ? -16.942 2.997   32.380  1.00 23.02 ? 38   ALA A CA  1 
ATOM   67   C  C   . ALA A 1 49  ? -16.033 2.379   31.313  1.00 22.50 ? 38   ALA A C   1 
ATOM   68   O  O   . ALA A 1 49  ? -15.133 1.601   31.632  1.00 23.18 ? 38   ALA A O   1 
ATOM   69   C  CB  . ALA A 1 49  ? -16.513 4.424   32.687  1.00 22.41 ? 38   ALA A CB  1 
ATOM   70   N  N   . ARG A 1 50  ? -16.264 2.710   30.051  1.00 22.44 ? 39   ARG A N   1 
ATOM   71   C  CA  . ARG A 1 50  ? -15.419 2.189   28.975  1.00 22.84 ? 39   ARG A CA  1 
ATOM   72   C  C   . ARG A 1 50  ? -13.946 2.589   29.161  1.00 23.18 ? 39   ARG A C   1 
ATOM   73   O  O   . ARG A 1 50  ? -13.044 1.768   28.961  1.00 23.13 ? 39   ARG A O   1 
ATOM   74   C  CB  . ARG A 1 50  ? -15.930 2.672   27.629  1.00 23.36 ? 39   ARG A CB  1 
ATOM   75   C  CG  . ARG A 1 50  ? -15.233 2.055   26.420  1.00 23.91 ? 39   ARG A CG  1 
ATOM   76   C  CD  . ARG A 1 50  ? -15.791 2.665   25.148  1.00 24.21 ? 39   ARG A CD  1 
ATOM   77   N  NE  . ARG A 1 50  ? -15.507 4.101   25.076  1.00 24.93 ? 39   ARG A NE  1 
ATOM   78   C  CZ  . ARG A 1 50  ? -14.418 4.622   24.511  1.00 27.21 ? 39   ARG A CZ  1 
ATOM   79   N  NH1 . ARG A 1 50  ? -13.493 3.829   23.965  1.00 24.79 ? 39   ARG A NH1 1 
ATOM   80   N  NH2 . ARG A 1 50  ? -14.248 5.944   24.487  1.00 26.77 ? 39   ARG A NH2 1 
ATOM   81   N  N   . ASN A 1 51  ? -13.719 3.850   29.539  1.00 22.17 ? 40   ASN A N   1 
ATOM   82   C  CA  . ASN A 1 51  ? -12.378 4.391   29.819  1.00 20.81 ? 40   ASN A CA  1 
ATOM   83   C  C   . ASN A 1 51  ? -12.501 5.720   30.577  1.00 21.19 ? 40   ASN A C   1 
ATOM   84   O  O   . ASN A 1 51  ? -13.615 6.189   30.830  1.00 21.02 ? 40   ASN A O   1 
ATOM   85   C  CB  . ASN A 1 51  ? -11.514 4.498   28.541  1.00 20.88 ? 40   ASN A CB  1 
ATOM   86   C  CG  . ASN A 1 51  ? -11.976 5.593   27.580  1.00 21.84 ? 40   ASN A CG  1 
ATOM   87   O  OD1 . ASN A 1 51  ? -12.840 6.427   27.902  1.00 21.78 ? 40   ASN A OD1 1 
ATOM   88   N  ND2 . ASN A 1 51  ? -11.381 5.609   26.392  1.00 20.57 ? 40   ASN A ND2 1 
ATOM   89   N  N   . CYS A 1 52  ? -11.382 6.327   30.969  1.00 20.78 ? 41   CYS A N   1 
ATOM   90   C  CA  . CYS A 1 52  ? -11.473 7.527   31.790  1.00 20.79 ? 41   CYS A CA  1 
ATOM   91   C  C   . CYS A 1 52  ? -12.073 8.713   31.023  1.00 21.54 ? 41   CYS A C   1 
ATOM   92   O  O   . CYS A 1 52  ? -12.759 9.560   31.615  1.00 20.39 ? 41   CYS A O   1 
ATOM   93   C  CB  . CYS A 1 52  ? -10.121 7.878   32.392  1.00 19.46 ? 41   CYS A CB  1 
ATOM   94   S  SG  . CYS A 1 52  ? -9.520  6.580   33.486  1.00 18.36 ? 41   CYS A SG  1 
ATOM   95   N  N   . ARG A 1 53  ? -11.834 8.746   29.712  1.00 21.73 ? 42   ARG A N   1 
ATOM   96   C  CA  . ARG A 1 53  ? -12.302 9.832   28.855  1.00 23.15 ? 42   ARG A CA  1 
ATOM   97   C  C   . ARG A 1 53  ? -13.828 9.872   28.798  1.00 24.64 ? 42   ARG A C   1 
ATOM   98   O  O   . ARG A 1 53  ? -14.428 10.936  28.895  1.00 24.09 ? 42   ARG A O   1 
ATOM   99   C  CB  . ARG A 1 53  ? -11.703 9.742   27.437  1.00 22.62 ? 42   ARG A CB  1 
ATOM   100  C  CG  . ARG A 1 53  ? -11.987 10.960  26.576  1.00 23.94 ? 42   ARG A CG  1 
ATOM   101  C  CD  . ARG A 1 53  ? -11.245 12.143  27.181  1.00 24.30 ? 42   ARG A CD  1 
ATOM   102  N  NE  . ARG A 1 53  ? -11.589 13.455  26.652  1.00 25.61 ? 42   ARG A NE  1 
ATOM   103  C  CZ  . ARG A 1 53  ? -12.624 14.193  27.043  1.00 25.52 ? 42   ARG A CZ  1 
ATOM   104  N  NH1 . ARG A 1 53  ? -13.498 13.730  27.918  1.00 27.12 ? 42   ARG A NH1 1 
ATOM   105  N  NH2 . ARG A 1 53  ? -12.796 15.399  26.527  1.00 26.52 ? 42   ARG A NH2 1 
ATOM   106  N  N   . ASP A 1 54  ? -14.440 8.703   28.650  1.00 26.36 ? 43   ASP A N   1 
ATOM   107  C  CA  . ASP A 1 54  ? -15.889 8.577   28.728  1.00 28.17 ? 43   ASP A CA  1 
ATOM   108  C  C   . ASP A 1 54  ? -16.423 8.965   30.078  1.00 29.73 ? 43   ASP A C   1 
ATOM   109  O  O   . ASP A 1 54  ? -17.472 9.596   30.164  1.00 32.10 ? 43   ASP A O   1 
ATOM   110  C  CB  . ASP A 1 54  ? -16.323 7.143   28.475  1.00 28.80 ? 43   ASP A CB  1 
ATOM   111  C  CG  . ASP A 1 54  ? -16.315 6.786   27.023  1.00 28.72 ? 43   ASP A CG  1 
ATOM   112  O  OD1 . ASP A 1 54  ? -15.517 7.366   26.260  1.00 30.27 ? 43   ASP A OD1 1 
ATOM   113  O  OD2 . ASP A 1 54  ? -17.109 5.913   26.648  1.00 31.22 ? 43   ASP A OD2 1 
ATOM   114  N  N   . LEU A 1 55  ? -15.722 8.550   31.127  1.00 29.29 ? 44   LEU A N   1 
ATOM   115  C  CA  . LEU A 1 55  ? -16.146 8.825   32.492  1.00 29.51 ? 44   LEU A CA  1 
ATOM   116  C  C   . LEU A 1 55  ? -16.111 10.332  32.783  1.00 30.23 ? 44   LEU A C   1 
ATOM   117  O  O   . LEU A 1 55  ? -16.998 10.852  33.451  1.00 32.02 ? 44   LEU A O   1 
ATOM   118  C  CB  . LEU A 1 55  ? -15.297 8.019   33.490  1.00 29.43 ? 44   LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 55  ? -15.795 7.951   34.937  1.00 29.91 ? 44   LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 55  ? -17.119 7.201   35.045  1.00 29.76 ? 44   LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 55  ? -14.741 7.318   35.824  1.00 29.28 ? 44   LEU A CD2 1 
ATOM   122  N  N   . LYS A 1 56  ? -15.095 11.023  32.272  1.00 28.73 ? 45   LYS A N   1 
ATOM   123  C  CA  . LYS A 1 56  ? -15.019 12.470  32.346  1.00 30.35 ? 45   LYS A CA  1 
ATOM   124  C  C   . LYS A 1 56  ? -16.178 13.131  31.597  1.00 33.99 ? 45   LYS A C   1 
ATOM   125  O  O   . LYS A 1 56  ? -16.788 14.079  32.094  1.00 34.35 ? 45   LYS A O   1 
ATOM   126  C  CB  . LYS A 1 56  ? -13.682 12.955  31.774  1.00 30.16 ? 45   LYS A CB  1 
ATOM   127  C  CG  . LYS A 1 56  ? -13.479 14.471  31.748  1.00 29.23 ? 45   LYS A CG  1 
ATOM   128  C  CD  . LYS A 1 56  ? -12.115 14.822  31.159  1.00 28.51 ? 45   LYS A CD  1 
ATOM   129  C  CE  . LYS A 1 56  ? -12.035 16.280  30.726  1.00 29.56 ? 45   LYS A CE  1 
ATOM   130  N  NZ  . LYS A 1 56  ? -12.102 17.207  31.875  1.00 29.13 ? 45   LYS A NZ  1 
ATOM   131  N  N   . PHE A 1 57  ? -16.466 12.625  30.401  1.00 32.73 ? 46   PHE A N   1 
ATOM   132  C  CA  . PHE A 1 57  ? -17.513 13.169  29.565  1.00 35.10 ? 46   PHE A CA  1 
ATOM   133  C  C   . PHE A 1 57  ? -18.885 13.055  30.200  1.00 36.66 ? 46   PHE A C   1 
ATOM   134  O  O   . PHE A 1 57  ? -19.662 14.005  30.179  1.00 37.99 ? 46   PHE A O   1 
ATOM   135  C  CB  . PHE A 1 57  ? -17.536 12.455  28.216  1.00 34.72 ? 46   PHE A CB  1 
ATOM   136  C  CG  . PHE A 1 57  ? -17.733 13.381  27.071  1.00 36.40 ? 46   PHE A CG  1 
ATOM   137  C  CD1 . PHE A 1 57  ? -18.961 14.000  26.866  1.00 38.20 ? 46   PHE A CD1 1 
ATOM   138  C  CD2 . PHE A 1 57  ? -16.689 13.669  26.216  1.00 37.10 ? 46   PHE A CD2 1 
ATOM   139  C  CE1 . PHE A 1 57  ? -19.147 14.868  25.807  1.00 38.08 ? 46   PHE A CE1 1 
ATOM   140  C  CE2 . PHE A 1 57  ? -16.862 14.543  25.162  1.00 36.94 ? 46   PHE A CE2 1 
ATOM   141  C  CZ  . PHE A 1 57  ? -18.090 15.142  24.958  1.00 38.49 ? 46   PHE A CZ  1 
ATOM   142  N  N   . CYS A 1 58  ? -19.156 11.883  30.768  1.00 37.38 ? 47   CYS A N   1 
ATOM   143  C  CA  . CYS A 1 58  ? -20.458 11.516  31.311  1.00 37.34 ? 47   CYS A CA  1 
ATOM   144  C  C   . CYS A 1 58  ? -20.634 11.943  32.791  1.00 39.61 ? 47   CYS A C   1 
ATOM   145  O  O   . CYS A 1 58  ? -21.765 12.002  33.292  1.00 40.52 ? 47   CYS A O   1 
ATOM   146  C  CB  . CYS A 1 58  ? -20.664 9.990   31.139  1.00 36.97 ? 47   CYS A CB  1 
ATOM   147  S  SG  . CYS A 1 58  ? -21.792 9.405   29.831  1.00 39.32 ? 47   CYS A SG  1 
ATOM   148  N  N   . HIS A 1 59  ? -19.527 12.218  33.491  1.00 39.65 ? 48   HIS A N   1 
ATOM   149  C  CA  . HIS A 1 59  ? -19.551 12.624  34.907  1.00 36.36 ? 48   HIS A CA  1 
ATOM   150  C  C   . HIS A 1 59  ? -18.509 13.678  35.195  1.00 34.80 ? 48   HIS A C   1 
ATOM   151  O  O   . HIS A 1 59  ? -17.490 13.401  35.847  1.00 32.75 ? 48   HIS A O   1 
ATOM   152  C  CB  . HIS A 1 59  ? -19.308 11.429  35.820  1.00 40.96 ? 48   HIS A CB  1 
ATOM   153  C  CG  . HIS A 1 59  ? -20.483 10.492  35.961  1.00 46.59 ? 48   HIS A CG  1 
ATOM   154  N  ND1 . HIS A 1 59  ? -20.851 9.633   34.984  1.00 49.71 ? 48   HIS A ND1 1 
ATOM   155  C  CD2 . HIS A 1 59  ? -21.351 10.263  37.035  1.00 48.17 ? 48   HIS A CD2 1 
ATOM   156  C  CE1 . HIS A 1 59  ? -21.915 8.908   35.402  1.00 51.82 ? 48   HIS A CE1 1 
ATOM   157  N  NE2 . HIS A 1 59  ? -22.218 9.294   36.658  1.00 49.70 ? 48   HIS A NE2 1 
ATOM   158  N  N   . PRO A 1 60  ? -18.742 14.920  34.744  1.00 34.67 ? 49   PRO A N   1 
ATOM   159  C  CA  . PRO A 1 60  ? -17.662 15.902  34.860  1.00 33.88 ? 49   PRO A CA  1 
ATOM   160  C  C   . PRO A 1 60  ? -17.358 16.288  36.314  1.00 33.79 ? 49   PRO A C   1 
ATOM   161  O  O   . PRO A 1 60  ? -16.389 16.994  36.560  1.00 32.38 ? 49   PRO A O   1 
ATOM   162  C  CB  . PRO A 1 60  ? -18.185 17.118  34.074  1.00 33.84 ? 49   PRO A CB  1 
ATOM   163  C  CG  . PRO A 1 60  ? -19.485 16.702  33.451  1.00 34.07 ? 49   PRO A CG  1 
ATOM   164  C  CD  . PRO A 1 60  ? -19.987 15.521  34.234  1.00 35.26 ? 49   PRO A CD  1 
ATOM   165  N  N   . GLU A 1 61  ? -18.170 15.813  37.257  1.00 33.87 ? 50   GLU A N   1 
ATOM   166  C  CA  . GLU A 1 61  ? -17.973 16.121  38.675  1.00 34.24 ? 50   GLU A CA  1 
ATOM   167  C  C   . GLU A 1 61  ? -16.958 15.196  39.332  1.00 32.57 ? 50   GLU A C   1 
ATOM   168  O  O   . GLU A 1 61  ? -16.426 15.496  40.394  1.00 32.88 ? 50   GLU A O   1 
ATOM   169  C  CB  . GLU A 1 61  ? -19.308 16.089  39.447  1.00 35.49 ? 50   GLU A CB  1 
ATOM   170  C  CG  . GLU A 1 61  ? -19.832 14.701  39.798  1.00 38.47 ? 50   GLU A CG  1 
ATOM   171  C  CD  . GLU A 1 61  ? -20.433 13.961  38.610  1.00 42.32 ? 50   GLU A CD  1 
ATOM   172  O  OE1 . GLU A 1 61  ? -20.564 14.567  37.524  1.00 44.22 ? 50   GLU A OE1 1 
ATOM   173  O  OE2 . GLU A 1 61  ? -20.790 12.769  38.766  1.00 45.04 ? 50   GLU A OE2 1 
ATOM   174  N  N   . LEU A 1 62  ? -16.687 14.061  38.710  1.00 32.40 ? 51   LEU A N   1 
ATOM   175  C  CA  . LEU A 1 62  ? -15.767 13.113  39.321  1.00 30.00 ? 51   LEU A CA  1 
ATOM   176  C  C   . LEU A 1 62  ? -14.324 13.640  39.294  1.00 28.36 ? 51   LEU A C   1 
ATOM   177  O  O   . LEU A 1 62  ? -13.920 14.357  38.371  1.00 28.74 ? 51   LEU A O   1 
ATOM   178  C  CB  . LEU A 1 62  ? -15.906 11.716  38.692  1.00 30.77 ? 51   LEU A CB  1 
ATOM   179  C  CG  . LEU A 1 62  ? -17.162 10.898  39.056  1.00 30.33 ? 51   LEU A CG  1 
ATOM   180  C  CD1 . LEU A 1 62  ? -17.229 9.637   38.208  1.00 31.15 ? 51   LEU A CD1 1 
ATOM   181  C  CD2 . LEU A 1 62  ? -17.246 10.545  40.541  1.00 28.50 ? 51   LEU A CD2 1 
ATOM   182  N  N   . LYS A 1 63  ? -13.565 13.302  40.324  1.00 26.35 ? 52   LYS A N   1 
ATOM   183  C  CA  . LYS A 1 63  ? -12.229 13.820  40.478  1.00 26.66 ? 52   LYS A CA  1 
ATOM   184  C  C   . LYS A 1 63  ? -11.204 12.733  40.216  1.00 26.36 ? 52   LYS A C   1 
ATOM   185  O  O   . LYS A 1 63  ? -11.551 11.542  40.228  1.00 23.94 ? 52   LYS A O   1 
ATOM   186  C  CB  . LYS A 1 63  ? -12.074 14.410  41.873  1.00 28.50 ? 52   LYS A CB  1 
ATOM   187  C  CG  . LYS A 1 63  ? -12.529 15.872  41.918  1.00 31.71 ? 52   LYS A CG  1 
ATOM   188  C  CD  . LYS A 1 63  ? -12.907 16.307  43.316  1.00 33.86 ? 52   LYS A CD  1 
ATOM   189  C  CE  . LYS A 1 63  ? -12.993 17.828  43.413  1.00 37.18 ? 52   LYS A CE  1 
ATOM   190  N  NZ  . LYS A 1 63  ? -14.138 18.407  42.655  1.00 39.65 ? 52   LYS A NZ  1 
ATOM   191  N  N   . SER A 1 64  ? -9.951  13.141  39.992  1.00 23.00 ? 53   SER A N   1 
ATOM   192  C  CA  . SER A 1 64  ? -8.903  12.211  39.614  1.00 22.72 ? 53   SER A CA  1 
ATOM   193  C  C   . SER A 1 64  ? -8.719  11.159  40.690  1.00 23.57 ? 53   SER A C   1 
ATOM   194  O  O   . SER A 1 64  ? -8.734  11.481  41.883  1.00 23.17 ? 53   SER A O   1 
ATOM   195  C  CB  . SER A 1 64  ? -7.591  12.942  39.328  1.00 20.79 ? 53   SER A CB  1 
ATOM   196  O  OG  . SER A 1 64  ? -7.767  13.797  38.208  1.00 20.11 ? 53   SER A OG  1 
ATOM   197  N  N   . GLY A 1 65  ? -8.572  9.902   40.270  1.00 21.51 ? 54   GLY A N   1 
ATOM   198  C  CA  . GLY A 1 65  ? -8.393  8.810   41.221  1.00 22.45 ? 54   GLY A CA  1 
ATOM   199  C  C   . GLY A 1 65  ? -8.635  7.436   40.633  1.00 23.86 ? 54   GLY A C   1 
ATOM   200  O  O   . GLY A 1 65  ? -8.726  7.269   39.409  1.00 23.07 ? 54   GLY A O   1 
ATOM   201  N  N   . GLU A 1 66  ? -8.740  6.458   41.522  1.00 23.36 ? 55   GLU A N   1 
ATOM   202  C  CA  . GLU A 1 66  ? -8.901  5.071   41.153  1.00 23.96 ? 55   GLU A CA  1 
ATOM   203  C  C   . GLU A 1 66  ? -10.327 4.797   40.660  1.00 23.57 ? 55   GLU A C   1 
ATOM   204  O  O   . GLU A 1 66  ? -11.307 5.137   41.338  1.00 23.27 ? 55   GLU A O   1 
ATOM   205  C  CB  . GLU A 1 66  ? -8.488  4.177   42.333  1.00 25.83 ? 55   GLU A CB  1 
ATOM   206  C  CG  . GLU A 1 66  ? -8.757  2.687   42.161  1.00 30.64 ? 55   GLU A CG  1 
ATOM   207  C  CD  . GLU A 1 66  ? -8.027  1.827   43.193  1.00 33.23 ? 55   GLU A CD  1 
ATOM   208  O  OE1 . GLU A 1 66  ? -6.825  1.549   43.014  1.00 35.09 ? 55   GLU A OE1 1 
ATOM   209  O  OE2 . GLU A 1 66  ? -8.653  1.417   44.192  1.00 38.33 ? 55   GLU A OE2 1 
ATOM   210  N  N   . TYR A 1 67  ? -10.437 4.245   39.447  1.00 22.04 ? 56   TYR A N   1 
ATOM   211  C  CA  . TYR A 1 67  ? -11.706 3.746   38.917  1.00 21.73 ? 56   TYR A CA  1 
ATOM   212  C  C   . TYR A 1 67  ? -11.536 2.414   38.170  1.00 22.13 ? 56   TYR A C   1 
ATOM   213  O  O   . TYR A 1 67  ? -10.414 1.937   37.963  1.00 21.22 ? 56   TYR A O   1 
ATOM   214  C  CB  . TYR A 1 67  ? -12.346 4.749   37.969  1.00 21.75 ? 56   TYR A CB  1 
ATOM   215  C  CG  . TYR A 1 67  ? -12.674 6.077   38.599  1.00 21.63 ? 56   TYR A CG  1 
ATOM   216  C  CD1 . TYR A 1 67  ? -11.737 7.096   38.614  1.00 21.23 ? 56   TYR A CD1 1 
ATOM   217  C  CD2 . TYR A 1 67  ? -13.922 6.314   39.177  1.00 21.31 ? 56   TYR A CD2 1 
ATOM   218  C  CE1 . TYR A 1 67  ? -12.021 8.329   39.189  1.00 22.73 ? 56   TYR A CE1 1 
ATOM   219  C  CE2 . TYR A 1 67  ? -14.218 7.537   39.765  1.00 21.38 ? 56   TYR A CE2 1 
ATOM   220  C  CZ  . TYR A 1 67  ? -13.252 8.546   39.763  1.00 21.88 ? 56   TYR A CZ  1 
ATOM   221  O  OH  . TYR A 1 67  ? -13.510 9.778   40.315  1.00 23.38 ? 56   TYR A OH  1 
ATOM   222  N  N   . TRP A 1 68  ? -12.669 1.824   37.790  1.00 20.85 ? 57   TRP A N   1 
ATOM   223  C  CA  . TRP A 1 68  ? -12.698 0.595   37.019  1.00 21.05 ? 57   TRP A CA  1 
ATOM   224  C  C   . TRP A 1 68  ? -13.187 0.925   35.653  1.00 20.41 ? 57   TRP A C   1 
ATOM   225  O  O   . TRP A 1 68  ? -14.200 1.602   35.501  1.00 20.11 ? 57   TRP A O   1 
ATOM   226  C  CB  . TRP A 1 68  ? -13.605 -0.442  37.670  1.00 22.64 ? 57   TRP A CB  1 
ATOM   227  C  CG  . TRP A 1 68  ? -13.026 -0.981  38.948  1.00 23.44 ? 57   TRP A CG  1 
ATOM   228  C  CD1 . TRP A 1 68  ? -13.031 -0.374  40.209  1.00 23.40 ? 57   TRP A CD1 1 
ATOM   229  C  CD2 . TRP A 1 68  ? -12.319 -2.253  39.136  1.00 24.09 ? 57   TRP A CD2 1 
ATOM   230  N  NE1 . TRP A 1 68  ? -12.392 -1.165  41.122  1.00 24.30 ? 57   TRP A NE1 1 
ATOM   231  C  CE2 . TRP A 1 68  ? -11.936 -2.300  40.552  1.00 23.89 ? 57   TRP A CE2 1 
ATOM   232  C  CE3 . TRP A 1 68  ? -11.965 -3.314  38.304  1.00 23.77 ? 57   TRP A CE3 1 
ATOM   233  C  CZ2 . TRP A 1 68  ? -11.252 -3.385  41.095  1.00 24.56 ? 57   TRP A CZ2 1 
ATOM   234  C  CZ3 . TRP A 1 68  ? -11.278 -4.401  38.865  1.00 23.28 ? 57   TRP A CZ3 1 
ATOM   235  C  CH2 . TRP A 1 68  ? -10.933 -4.434  40.226  1.00 23.39 ? 57   TRP A CH2 1 
ATOM   236  N  N   . VAL A 1 69  ? -12.439 0.487   34.644  1.00 19.96 ? 58   VAL A N   1 
ATOM   237  C  CA  . VAL A 1 69  ? -12.827 0.714   33.263  1.00 19.60 ? 58   VAL A CA  1 
ATOM   238  C  C   . VAL A 1 69  ? -12.822 -0.610  32.517  1.00 20.06 ? 58   VAL A C   1 
ATOM   239  O  O   . VAL A 1 69  ? -12.162 -1.579  32.940  1.00 20.10 ? 58   VAL A O   1 
ATOM   240  C  CB  . VAL A 1 69  ? -11.913 1.746   32.555  1.00 19.84 ? 58   VAL A CB  1 
ATOM   241  C  CG1 . VAL A 1 69  ? -11.905 3.091   33.303  1.00 19.66 ? 58   VAL A CG1 1 
ATOM   242  C  CG2 . VAL A 1 69  ? -10.493 1.208   32.400  1.00 17.56 ? 58   VAL A CG2 1 
ATOM   243  N  N   . ASP A 1 70  ? -13.567 -0.652  31.416  1.00 20.72 ? 59   ASP A N   1 
ATOM   244  C  CA  . ASP A 1 70  ? -13.765 -1.884  30.655  1.00 20.52 ? 59   ASP A CA  1 
ATOM   245  C  C   . ASP A 1 70  ? -13.723 -1.602  29.158  1.00 18.59 ? 59   ASP A C   1 
ATOM   246  O  O   . ASP A 1 70  ? -14.754 -1.526  28.526  1.00 18.34 ? 59   ASP A O   1 
ATOM   247  C  CB  . ASP A 1 70  ? -15.113 -2.498  31.023  1.00 22.46 ? 59   ASP A CB  1 
ATOM   248  C  CG  . ASP A 1 70  ? -15.251 -3.920  30.536  1.00 23.43 ? 59   ASP A CG  1 
ATOM   249  O  OD1 . ASP A 1 70  ? -14.225 -4.619  30.439  1.00 24.63 ? 59   ASP A OD1 1 
ATOM   250  O  OD2 . ASP A 1 70  ? -16.380 -4.352  30.251  1.00 24.53 ? 59   ASP A OD2 1 
ATOM   251  N  N   . PRO A 1 71  ? -12.518 -1.436  28.599  1.00 18.44 ? 60   PRO A N   1 
ATOM   252  C  CA  . PRO A 1 71  ? -12.371 -0.967  27.213  1.00 17.96 ? 60   PRO A CA  1 
ATOM   253  C  C   . PRO A 1 71  ? -13.021 -1.913  26.207  1.00 18.56 ? 60   PRO A C   1 
ATOM   254  O  O   . PRO A 1 71  ? -13.575 -1.466  25.225  1.00 17.41 ? 60   PRO A O   1 
ATOM   255  C  CB  . PRO A 1 71  ? -10.855 -0.935  27.002  1.00 17.80 ? 60   PRO A CB  1 
ATOM   256  C  CG  . PRO A 1 71  ? -10.268 -0.831  28.391  1.00 18.30 ? 60   PRO A CG  1 
ATOM   257  C  CD  . PRO A 1 71  ? -11.227 -1.513  29.319  1.00 17.72 ? 60   PRO A CD  1 
ATOM   258  N  N   . ASN A 1 72  ? -12.974 -3.210  26.465  1.00 19.10 ? 61   ASN A N   1 
ATOM   259  C  CA  . ASN A 1 72  ? -13.540 -4.149  25.519  1.00 19.98 ? 61   ASN A CA  1 
ATOM   260  C  C   . ASN A 1 72  ? -15.062 -4.276  25.662  1.00 20.87 ? 61   ASN A C   1 
ATOM   261  O  O   . ASN A 1 72  ? -15.695 -4.978  24.869  1.00 21.80 ? 61   ASN A O   1 
ATOM   262  C  CB  . ASN A 1 72  ? -12.809 -5.503  25.569  1.00 19.24 ? 61   ASN A CB  1 
ATOM   263  C  CG  . ASN A 1 72  ? -13.064 -6.273  26.869  1.00 19.91 ? 61   ASN A CG  1 
ATOM   264  O  OD1 . ASN A 1 72  ? -13.902 -5.877  27.686  1.00 19.55 ? 61   ASN A OD1 1 
ATOM   265  N  ND2 . ASN A 1 72  ? -12.357 -7.390  27.048  1.00 18.20 ? 61   ASN A ND2 1 
ATOM   266  N  N   . GLN A 1 73  ? -15.643 -3.577  26.647  1.00 20.90 ? 62   GLN A N   1 
ATOM   267  C  CA  . GLN A 1 73  ? -17.095 -3.655  26.934  1.00 21.59 ? 62   GLN A CA  1 
ATOM   268  C  C   . GLN A 1 73  ? -17.595 -5.124  27.038  1.00 21.33 ? 62   GLN A C   1 
ATOM   269  O  O   . GLN A 1 73  ? -16.939 -5.949  27.667  1.00 21.38 ? 62   GLN A O   1 
ATOM   270  C  CB  . GLN A 1 73  ? -17.916 -2.818  25.930  1.00 20.94 ? 62   GLN A CB  1 
ATOM   271  C  CG  . GLN A 1 73  ? -17.627 -1.323  25.953  1.00 21.36 ? 62   GLN A CG  1 
ATOM   272  C  CD  . GLN A 1 73  ? -18.219 -0.624  27.170  1.00 21.72 ? 62   GLN A CD  1 
ATOM   273  O  OE1 . GLN A 1 73  ? -19.320 -0.060  27.125  1.00 23.61 ? 62   GLN A OE1 1 
ATOM   274  N  NE2 . GLN A 1 73  ? -17.507 -0.669  28.254  1.00 21.31 ? 62   GLN A NE2 1 
ATOM   275  N  N   . GLY A 1 74  ? -18.741 -5.453  26.450  1.00 23.19 ? 63   GLY A N   1 
ATOM   276  C  CA  . GLY A 1 74  ? -19.321 -6.799  26.608  1.00 24.89 ? 63   GLY A CA  1 
ATOM   277  C  C   . GLY A 1 74  ? -19.494 -7.171  28.078  1.00 26.14 ? 63   GLY A C   1 
ATOM   278  O  O   . GLY A 1 74  ? -20.049 -6.393  28.852  1.00 25.42 ? 63   GLY A O   1 
ATOM   279  N  N   . CYS A 1 75  ? -18.968 -8.330  28.475  1.00 26.69 ? 64   CYS A N   1 
ATOM   280  C  CA  . CYS A 1 75  ? -19.015 -8.773  29.885  1.00 27.85 ? 64   CYS A CA  1 
ATOM   281  C  C   . CYS A 1 75  ? -18.234 -7.833  30.843  1.00 26.64 ? 64   CYS A C   1 
ATOM   282  O  O   . CYS A 1 75  ? -17.060 -7.519  30.629  1.00 22.96 ? 64   CYS A O   1 
ATOM   283  C  CB  . CYS A 1 75  ? -18.539 -10.240 30.019  1.00 30.12 ? 64   CYS A CB  1 
ATOM   284  S  SG  . CYS A 1 75  ? -18.366 -10.971 31.686  1.00 30.47 ? 64   CYS A SG  1 
ATOM   285  N  N   . LYS A 1 76  ? -18.910 -7.421  31.908  1.00 27.12 ? 65   LYS A N   1 
ATOM   286  C  CA  . LYS A 1 76  ? -18.338 -6.523  32.900  1.00 29.35 ? 65   LYS A CA  1 
ATOM   287  C  C   . LYS A 1 76  ? -17.237 -7.089  33.774  1.00 27.90 ? 65   LYS A C   1 
ATOM   288  O  O   . LYS A 1 76  ? -16.510 -6.329  34.393  1.00 28.52 ? 65   LYS A O   1 
ATOM   289  C  CB  . LYS A 1 76  ? -19.438 -5.910  33.762  1.00 32.02 ? 65   LYS A CB  1 
ATOM   290  C  CG  . LYS A 1 76  ? -19.925 -4.606  33.155  1.00 36.94 ? 65   LYS A CG  1 
ATOM   291  C  CD  . LYS A 1 76  ? -21.357 -4.249  33.527  1.00 40.67 ? 65   LYS A CD  1 
ATOM   292  C  CE  . LYS A 1 76  ? -21.940 -3.314  32.469  1.00 42.70 ? 65   LYS A CE  1 
ATOM   293  N  NZ  . LYS A 1 76  ? -23.427 -3.285  32.534  1.00 45.48 ? 65   LYS A NZ  1 
ATOM   294  N  N   . LEU A 1 77  ? -17.075 -8.411  33.783  1.00 26.64 ? 66   LEU A N   1 
ATOM   295  C  CA  . LEU A 1 77  ? -16.247 -9.075  34.791  1.00 26.55 ? 66   LEU A CA  1 
ATOM   296  C  C   . LEU A 1 77  ? -14.738 -8.996  34.577  1.00 25.53 ? 66   LEU A C   1 
ATOM   297  O  O   . LEU A 1 77  ? -13.968 -9.292  35.489  1.00 27.29 ? 66   LEU A O   1 
ATOM   298  C  CB  . LEU A 1 77  ? -16.687 -10.544 34.963  1.00 27.51 ? 66   LEU A CB  1 
ATOM   299  C  CG  . LEU A 1 77  ? -18.134 -10.811 35.411  1.00 28.66 ? 66   LEU A CG  1 
ATOM   300  C  CD1 . LEU A 1 77  ? -18.378 -12.308 35.544  1.00 31.60 ? 66   LEU A CD1 1 
ATOM   301  C  CD2 . LEU A 1 77  ? -18.487 -10.120 36.716  1.00 28.64 ? 66   LEU A CD2 1 
ATOM   302  N  N   . ASP A 1 78  ? -14.302 -8.621  33.381  1.00 22.80 ? 67   ASP A N   1 
ATOM   303  C  CA  . ASP A 1 78  ? -12.881 -8.524  33.130  1.00 21.59 ? 67   ASP A CA  1 
ATOM   304  C  C   . ASP A 1 78  ? -12.394 -7.078  33.162  1.00 20.89 ? 67   ASP A C   1 
ATOM   305  O  O   . ASP A 1 78  ? -11.375 -6.751  32.565  1.00 23.56 ? 67   ASP A O   1 
ATOM   306  C  CB  . ASP A 1 78  ? -12.518 -9.211  31.801  1.00 21.75 ? 67   ASP A CB  1 
ATOM   307  C  CG  . ASP A 1 78  ? -13.233 -8.595  30.581  1.00 22.05 ? 67   ASP A CG  1 
ATOM   308  O  OD1 . ASP A 1 78  ? -14.119 -7.726  30.737  1.00 22.26 ? 67   ASP A OD1 1 
ATOM   309  O  OD2 . ASP A 1 78  ? -12.905 -9.002  29.447  1.00 22.61 ? 67   ASP A OD2 1 
ATOM   310  N  N   . ALA A 1 79  ? -13.128 -6.215  33.851  1.00 21.06 ? 68   ALA A N   1 
ATOM   311  C  CA  . ALA A 1 79  ? -12.788 -4.798  33.932  1.00 21.26 ? 68   ALA A CA  1 
ATOM   312  C  C   . ALA A 1 79  ? -11.485 -4.613  34.689  1.00 22.01 ? 68   ALA A C   1 
ATOM   313  O  O   . ALA A 1 79  ? -11.118 -5.444  35.520  1.00 21.10 ? 68   ALA A O   1 
ATOM   314  C  CB  . ALA A 1 79  ? -13.921 -4.005  34.582  1.00 21.75 ? 68   ALA A CB  1 
ATOM   315  N  N   . ILE A 1 80  ? -10.769 -3.543  34.353  1.00 22.34 ? 69   ILE A N   1 
ATOM   316  C  CA  . ILE A 1 80  ? -9.479  -3.258  34.963  1.00 22.25 ? 69   ILE A CA  1 
ATOM   317  C  C   . ILE A 1 80  ? -9.492  -2.018  35.860  1.00 21.44 ? 69   ILE A C   1 
ATOM   318  O  O   . ILE A 1 80  ? -10.313 -1.105  35.703  1.00 20.53 ? 69   ILE A O   1 
ATOM   319  C  CB  . ILE A 1 80  ? -8.351  -3.166  33.908  1.00 22.93 ? 69   ILE A CB  1 
ATOM   320  C  CG1 . ILE A 1 80  ? -8.694  -2.117  32.851  1.00 22.48 ? 69   ILE A CG1 1 
ATOM   321  C  CG2 . ILE A 1 80  ? -8.111  -4.544  33.272  1.00 23.13 ? 69   ILE A CG2 1 
ATOM   322  C  CD1 . ILE A 1 80  ? -7.507  -1.633  32.043  1.00 22.54 ? 69   ILE A CD1 1 
ATOM   323  N  N   . LYS A 1 81  ? -8.575  -2.010  36.815  1.00 22.45 ? 70   LYS A N   1 
ATOM   324  C  CA  . LYS A 1 81  ? -8.504  -0.954  37.819  1.00 22.85 ? 70   LYS A CA  1 
ATOM   325  C  C   . LYS A 1 81  ? -7.463  0.021   37.332  1.00 20.98 ? 70   LYS A C   1 
ATOM   326  O  O   . LYS A 1 81  ? -6.351  -0.383  37.019  1.00 19.07 ? 70   LYS A O   1 
ATOM   327  C  CB  . LYS A 1 81  ? -8.030  -1.561  39.140  1.00 25.82 ? 70   LYS A CB  1 
ATOM   328  C  CG  . LYS A 1 81  ? -8.291  -0.734  40.377  1.00 28.05 ? 70   LYS A CG  1 
ATOM   329  C  CD  . LYS A 1 81  ? -7.300  -1.118  41.467  1.00 33.87 ? 70   LYS A CD  1 
ATOM   330  C  CE  . LYS A 1 81  ? -7.696  -2.332  42.292  1.00 37.41 ? 70   LYS A CE  1 
ATOM   331  N  NZ  . LYS A 1 81  ? -6.573  -2.679  43.220  1.00 39.34 ? 70   LYS A NZ  1 
ATOM   332  N  N   . VAL A 1 82  ? -7.807  1.298   37.256  1.00 19.81 ? 71   VAL A N   1 
ATOM   333  C  CA  . VAL A 1 82  ? -6.869  2.263   36.711  1.00 20.33 ? 71   VAL A CA  1 
ATOM   334  C  C   . VAL A 1 82  ? -6.873  3.556   37.521  1.00 20.60 ? 71   VAL A C   1 
ATOM   335  O  O   . VAL A 1 82  ? -7.749  3.763   38.358  1.00 21.85 ? 71   VAL A O   1 
ATOM   336  C  CB  . VAL A 1 82  ? -7.194  2.588   35.216  1.00 20.48 ? 71   VAL A CB  1 
ATOM   337  C  CG1 . VAL A 1 82  ? -7.175  1.326   34.350  1.00 19.73 ? 71   VAL A CG1 1 
ATOM   338  C  CG2 . VAL A 1 82  ? -8.526  3.322   35.106  1.00 19.19 ? 71   VAL A CG2 1 
ATOM   339  N  N   . PHE A 1 83  ? -5.907  4.430   37.248  1.00 19.85 ? 72   PHE A N   1 
ATOM   340  C  CA  . PHE A 1 83  ? -5.979  5.828   37.700  1.00 19.83 ? 72   PHE A CA  1 
ATOM   341  C  C   . PHE A 1 83  ? -6.539  6.642   36.553  1.00 19.27 ? 72   PHE A C   1 
ATOM   342  O  O   . PHE A 1 83  ? -6.063  6.509   35.415  1.00 20.05 ? 72   PHE A O   1 
ATOM   343  C  CB  . PHE A 1 83  ? -4.605  6.364   38.127  1.00 19.74 ? 72   PHE A CB  1 
ATOM   344  C  CG  . PHE A 1 83  ? -4.602  7.842   38.464  1.00 20.56 ? 72   PHE A CG  1 
ATOM   345  C  CD1 . PHE A 1 83  ? -4.994  8.292   39.727  1.00 20.27 ? 72   PHE A CD1 1 
ATOM   346  C  CD2 . PHE A 1 83  ? -4.209  8.792   37.513  1.00 20.51 ? 72   PHE A CD2 1 
ATOM   347  C  CE1 . PHE A 1 83  ? -5.013  9.652   40.031  1.00 21.36 ? 72   PHE A CE1 1 
ATOM   348  C  CE2 . PHE A 1 83  ? -4.226  10.149  37.823  1.00 21.57 ? 72   PHE A CE2 1 
ATOM   349  C  CZ  . PHE A 1 83  ? -4.623  10.581  39.086  1.00 20.78 ? 72   PHE A CZ  1 
ATOM   350  N  N   . CYS A 1 84  ? -7.574  7.432   36.836  1.00 18.79 ? 73   CYS A N   1 
ATOM   351  C  CA  . CYS A 1 84  ? -8.120  8.377   35.869  1.00 19.97 ? 73   CYS A CA  1 
ATOM   352  C  C   . CYS A 1 84  ? -7.631  9.777   36.236  1.00 21.23 ? 73   CYS A C   1 
ATOM   353  O  O   . CYS A 1 84  ? -7.921  10.275  37.322  1.00 20.95 ? 73   CYS A O   1 
ATOM   354  C  CB  . CYS A 1 84  ? -9.655  8.407   35.831  1.00 18.65 ? 73   CYS A CB  1 
ATOM   355  S  SG  . CYS A 1 84  ? -10.504 6.935   35.215  1.00 18.09 ? 73   CYS A SG  1 
ATOM   356  N  N   . ASN A 1 85  ? -6.895  10.401  35.319  1.00 22.23 ? 74   ASN A N   1 
ATOM   357  C  CA  . ASN A 1 85  ? -6.647  11.825  35.404  1.00 22.68 ? 74   ASN A CA  1 
ATOM   358  C  C   . ASN A 1 85  ? -7.840  12.544  34.814  1.00 22.85 ? 74   ASN A C   1 
ATOM   359  O  O   . ASN A 1 85  ? -7.994  12.547  33.611  1.00 24.52 ? 74   ASN A O   1 
ATOM   360  C  CB  . ASN A 1 85  ? -5.373  12.184  34.642  1.00 21.31 ? 74   ASN A CB  1 
ATOM   361  C  CG  . ASN A 1 85  ? -4.990  13.635  34.816  1.00 19.73 ? 74   ASN A CG  1 
ATOM   362  O  OD1 . ASN A 1 85  ? -5.842  14.519  34.816  1.00 19.96 ? 74   ASN A OD1 1 
ATOM   363  N  ND2 . ASN A 1 85  ? -3.710  13.887  34.944  1.00 19.29 ? 74   ASN A ND2 1 
HETATM 364  N  N   . MSE A 1 86  ? -8.669  13.162  35.653  1.00 24.70 ? 75   MSE A N   1 
HETATM 365  C  CA  . MSE A 1 86  ? -9.921  13.778  35.196  1.00 26.80 ? 75   MSE A CA  1 
HETATM 366  C  C   . MSE A 1 86  ? -9.739  15.188  34.694  1.00 28.51 ? 75   MSE A C   1 
HETATM 367  O  O   . MSE A 1 86  ? -10.662 15.767  34.129  1.00 29.09 ? 75   MSE A O   1 
HETATM 368  C  CB  . MSE A 1 86  ? -11.035 13.738  36.245  1.00 28.68 ? 75   MSE A CB  1 
HETATM 369  C  CG  . MSE A 1 86  ? -11.349 12.306  36.668  1.00 30.75 ? 75   MSE A CG  1 
HETATM 370  SE SE  . MSE A 1 86  ? -12.124 11.315  35.149  1.00 35.40 ? 75   MSE A SE  1 
HETATM 371  C  CE  . MSE A 1 86  ? -13.985 11.743  35.590  1.00 37.21 ? 75   MSE A CE  1 
ATOM   372  N  N   . GLU A 1 87  ? -8.554  15.750  34.885  1.00 27.68 ? 76   GLU A N   1 
ATOM   373  C  CA  . GLU A 1 87  ? -8.193  16.955  34.186  1.00 29.23 ? 76   GLU A CA  1 
ATOM   374  C  C   . GLU A 1 87  ? -7.934  16.656  32.693  1.00 28.72 ? 76   GLU A C   1 
ATOM   375  O  O   . GLU A 1 87  ? -8.463  17.330  31.826  1.00 28.88 ? 76   GLU A O   1 
ATOM   376  C  CB  . GLU A 1 87  ? -6.980  17.587  34.867  1.00 31.90 ? 76   GLU A CB  1 
ATOM   377  C  CG  . GLU A 1 87  ? -6.092  18.434  33.968  1.00 38.58 ? 76   GLU A CG  1 
ATOM   378  C  CD  . GLU A 1 87  ? -6.641  19.821  33.736  1.00 45.61 ? 76   GLU A CD  1 
ATOM   379  O  OE1 . GLU A 1 87  ? -7.803  20.103  34.133  1.00 45.62 ? 76   GLU A OE1 1 
ATOM   380  O  OE2 . GLU A 1 87  ? -5.889  20.635  33.155  1.00 52.37 ? 76   GLU A OE2 1 
ATOM   381  N  N   . THR A 1 88  ? -7.130  15.642  32.386  1.00 27.30 ? 77   THR A N   1 
ATOM   382  C  CA  . THR A 1 88  ? -6.766  15.395  30.982  1.00 25.13 ? 77   THR A CA  1 
ATOM   383  C  C   . THR A 1 88  ? -7.682  14.368  30.318  1.00 25.11 ? 77   THR A C   1 
ATOM   384  O  O   . THR A 1 88  ? -7.763  14.320  29.104  1.00 24.57 ? 77   THR A O   1 
ATOM   385  C  CB  . THR A 1 88  ? -5.335  14.879  30.840  1.00 24.33 ? 77   THR A CB  1 
ATOM   386  O  OG1 . THR A 1 88  ? -5.216  13.654  31.577  1.00 23.02 ? 77   THR A OG1 1 
ATOM   387  C  CG2 . THR A 1 88  ? -4.305  15.919  31.358  1.00 23.57 ? 77   THR A CG2 1 
ATOM   388  N  N   . GLY A 1 89  ? -8.360  13.541  31.114  1.00 24.46 ? 78   GLY A N   1 
ATOM   389  C  CA  . GLY A 1 89  ? -9.120  12.409  30.564  1.00 22.84 ? 78   GLY A CA  1 
ATOM   390  C  C   . GLY A 1 89  ? -8.316  11.127  30.330  1.00 21.85 ? 78   GLY A C   1 
ATOM   391  O  O   . GLY A 1 89  ? -8.835  10.155  29.783  1.00 22.46 ? 78   GLY A O   1 
ATOM   392  N  N   . GLU A 1 90  ? -7.063  11.093  30.761  1.00 20.35 ? 79   GLU A N   1 
ATOM   393  C  CA  . GLU A 1 90  ? -6.220  9.940   30.480  1.00 20.22 ? 79   GLU A CA  1 
ATOM   394  C  C   . GLU A 1 90  ? -6.498  8.735   31.367  1.00 19.81 ? 79   GLU A C   1 
ATOM   395  O  O   . GLU A 1 90  ? -6.781  8.883   32.566  1.00 19.06 ? 79   GLU A O   1 
ATOM   396  C  CB  . GLU A 1 90  ? -4.771  10.305  30.642  1.00 20.50 ? 79   GLU A CB  1 
ATOM   397  C  CG  . GLU A 1 90  ? -4.265  11.394  29.710  1.00 21.42 ? 79   GLU A CG  1 
ATOM   398  C  CD  . GLU A 1 90  ? -2.906  11.888  30.169  1.00 22.25 ? 79   GLU A CD  1 
ATOM   399  O  OE1 . GLU A 1 90  ? -2.858  12.629  31.170  1.00 21.15 ? 79   GLU A OE1 1 
ATOM   400  O  OE2 . GLU A 1 90  ? -1.884  11.495  29.559  1.00 24.33 ? 79   GLU A OE2 1 
ATOM   401  N  N   . THR A 1 91  ? -6.398  7.544   30.766  1.00 19.23 ? 80   THR A N   1 
ATOM   402  C  CA  . THR A 1 91  ? -6.554  6.266   31.461  1.00 18.24 ? 80   THR A CA  1 
ATOM   403  C  C   . THR A 1 91  ? -5.164  5.726   31.733  1.00 17.86 ? 80   THR A C   1 
ATOM   404  O  O   . THR A 1 91  ? -4.456  5.338   30.803  1.00 18.03 ? 80   THR A O   1 
ATOM   405  C  CB  . THR A 1 91  ? -7.332  5.247   30.584  1.00 18.34 ? 80   THR A CB  1 
ATOM   406  O  OG1 . THR A 1 91  ? -8.597  5.805   30.199  1.00 17.63 ? 80   THR A OG1 1 
ATOM   407  C  CG2 . THR A 1 91  ? -7.542  3.926   31.334  1.00 17.36 ? 80   THR A CG2 1 
ATOM   408  N  N   . CYS A 1 92  ? -4.762  5.694   32.995  1.00 18.25 ? 81   CYS A N   1 
ATOM   409  C  CA  . CYS A 1 92  ? -3.380  5.332   33.331  1.00 18.47 ? 81   CYS A CA  1 
ATOM   410  C  C   . CYS A 1 92  ? -3.283  3.962   34.012  1.00 19.59 ? 81   CYS A C   1 
ATOM   411  O  O   . CYS A 1 92  ? -3.821  3.752   35.106  1.00 21.06 ? 81   CYS A O   1 
ATOM   412  C  CB  . CYS A 1 92  ? -2.708  6.451   34.153  1.00 17.40 ? 81   CYS A CB  1 
ATOM   413  S  SG  . CYS A 1 92  ? -2.598  8.055   33.301  1.00 16.67 ? 81   CYS A SG  1 
ATOM   414  N  N   . ILE A 1 93  ? -2.593  3.024   33.362  1.00 20.17 ? 82   ILE A N   1 
ATOM   415  C  CA  . ILE A 1 93  ? -2.491  1.664   33.889  1.00 20.33 ? 82   ILE A CA  1 
ATOM   416  C  C   . ILE A 1 93  ? -1.105  1.399   34.435  1.00 20.96 ? 82   ILE A C   1 
ATOM   417  O  O   . ILE A 1 93  ? -0.108  1.531   33.716  1.00 20.27 ? 82   ILE A O   1 
ATOM   418  C  CB  . ILE A 1 93  ? -2.838  0.614   32.807  1.00 21.66 ? 82   ILE A CB  1 
ATOM   419  C  CG1 . ILE A 1 93  ? -4.145  1.015   32.106  1.00 20.94 ? 82   ILE A CG1 1 
ATOM   420  C  CG2 . ILE A 1 93  ? -2.953  -0.777  33.437  1.00 20.66 ? 82   ILE A CG2 1 
ATOM   421  C  CD1 . ILE A 1 93  ? -4.349  0.266   30.815  1.00 24.01 ? 82   ILE A CD1 1 
ATOM   422  N  N   . SER A 1 94  ? -1.057  1.033   35.714  1.00 21.39 ? 83   SER A N   1 
ATOM   423  C  CA  . SER A 1 94  ? 0.204   0.756   36.409  1.00 22.76 ? 83   SER A CA  1 
ATOM   424  C  C   . SER A 1 94  ? 0.826   -0.543  35.965  1.00 24.67 ? 83   SER A C   1 
ATOM   425  O  O   . SER A 1 94  ? 0.125   -1.540  35.684  1.00 24.93 ? 83   SER A O   1 
ATOM   426  C  CB  . SER A 1 94  ? 0.003   0.713   37.919  1.00 21.33 ? 83   SER A CB  1 
ATOM   427  O  OG  . SER A 1 94  ? -0.597  1.920   38.346  1.00 20.95 ? 83   SER A OG  1 
ATOM   428  N  N   . ALA A 1 95  ? 2.145   -0.512  35.893  1.00 25.90 ? 84   ALA A N   1 
ATOM   429  C  CA  . ALA A 1 95  ? 2.956   -1.667  35.619  1.00 28.08 ? 84   ALA A CA  1 
ATOM   430  C  C   . ALA A 1 95  ? 2.964   -2.589  36.814  1.00 30.74 ? 84   ALA A C   1 
ATOM   431  O  O   . ALA A 1 95  ? 2.856   -2.150  37.945  1.00 31.88 ? 84   ALA A O   1 
ATOM   432  C  CB  . ALA A 1 95  ? 4.364   -1.246  35.271  1.00 26.61 ? 84   ALA A CB  1 
ATOM   433  N  N   . ASN A 1 96  ? 3.069   -3.875  36.542  1.00 33.75 ? 85   ASN A N   1 
ATOM   434  C  CA  . ASN A 1 96  ? 3.237   -4.862  37.575  1.00 38.10 ? 85   ASN A CA  1 
ATOM   435  C  C   . ASN A 1 96  ? 4.455   -5.707  37.298  1.00 38.67 ? 85   ASN A C   1 
ATOM   436  O  O   . ASN A 1 96  ? 4.474   -6.408  36.312  1.00 42.76 ? 85   ASN A O   1 
ATOM   437  C  CB  . ASN A 1 96  ? 2.030   -5.770  37.578  1.00 41.79 ? 85   ASN A CB  1 
ATOM   438  C  CG  . ASN A 1 96  ? 1.589   -6.121  38.962  1.00 47.16 ? 85   ASN A CG  1 
ATOM   439  O  OD1 . ASN A 1 96  ? 2.160   -6.993  39.597  1.00 51.36 ? 85   ASN A OD1 1 
ATOM   440  N  ND2 . ASN A 1 96  ? 0.576   -5.427  39.451  1.00 51.09 ? 85   ASN A ND2 1 
ATOM   441  N  N   . PRO A 1 97  ? 5.448   -5.707  38.179  1.00 37.97 ? 86   PRO A N   1 
ATOM   442  C  CA  . PRO A 1 97  ? 5.544   -4.815  39.337  1.00 37.83 ? 86   PRO A CA  1 
ATOM   443  C  C   . PRO A 1 97  ? 5.923   -3.384  38.971  1.00 37.18 ? 86   PRO A C   1 
ATOM   444  O  O   . PRO A 1 97  ? 6.360   -3.118  37.865  1.00 35.49 ? 86   PRO A O   1 
ATOM   445  C  CB  . PRO A 1 97  ? 6.663   -5.445  40.159  1.00 36.64 ? 86   PRO A CB  1 
ATOM   446  C  CG  . PRO A 1 97  ? 7.514   -6.124  39.161  1.00 37.33 ? 86   PRO A CG  1 
ATOM   447  C  CD  . PRO A 1 97  ? 6.585   -6.635  38.104  1.00 38.14 ? 86   PRO A CD  1 
ATOM   448  N  N   . LEU A 1 98  ? 5.725   -2.479  39.915  1.00 36.85 ? 87   LEU A N   1 
ATOM   449  C  CA  . LEU A 1 98  ? 5.957   -1.048  39.714  1.00 38.92 ? 87   LEU A CA  1 
ATOM   450  C  C   . LEU A 1 98  ? 7.398   -0.683  39.408  1.00 40.45 ? 87   LEU A C   1 
ATOM   451  O  O   . LEU A 1 98  ? 7.669   0.318   38.728  1.00 37.26 ? 87   LEU A O   1 
ATOM   452  C  CB  . LEU A 1 98  ? 5.518   -0.270  40.952  1.00 39.17 ? 87   LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 98  ? 4.015   -0.189  41.233  1.00 41.96 ? 87   LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 98  ? 3.758   0.508   42.563  1.00 42.24 ? 87   LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 98  ? 3.270   0.514   40.100  1.00 42.10 ? 87   LEU A CD2 1 
ATOM   456  N  N   . ASN A 1 99  ? 8.328   -1.479  39.923  1.00 40.71 ? 88   ASN A N   1 
ATOM   457  C  CA  . ASN A 1 99  ? 9.733   -1.132  39.788  1.00 40.97 ? 88   ASN A CA  1 
ATOM   458  C  C   . ASN A 1 99  ? 10.761  -2.257  39.825  1.00 39.61 ? 88   ASN A C   1 
ATOM   459  O  O   . ASN A 1 99  ? 10.509  -3.366  40.298  1.00 37.21 ? 88   ASN A O   1 
ATOM   460  C  CB  . ASN A 1 99  ? 10.116  -0.023  40.789  1.00 45.81 ? 88   ASN A CB  1 
ATOM   461  C  CG  . ASN A 1 99  ? 10.007  -0.458  42.228  1.00 46.05 ? 88   ASN A CG  1 
ATOM   462  O  OD1 . ASN A 1 99  ? 10.764  -1.305  42.695  1.00 47.99 ? 88   ASN A OD1 1 
ATOM   463  N  ND2 . ASN A 1 99  ? 9.078   0.148   42.952  1.00 51.19 ? 88   ASN A ND2 1 
ATOM   464  N  N   . VAL A 1 100 ? 11.928  -1.924  39.291  1.00 38.75 ? 89   VAL A N   1 
ATOM   465  C  CA  . VAL A 1 100 ? 13.117  -2.736  39.367  1.00 36.10 ? 89   VAL A CA  1 
ATOM   466  C  C   . VAL A 1 100 ? 13.936  -2.180  40.517  1.00 36.79 ? 89   VAL A C   1 
ATOM   467  O  O   . VAL A 1 100 ? 14.371  -1.028  40.455  1.00 36.94 ? 89   VAL A O   1 
ATOM   468  C  CB  . VAL A 1 100 ? 13.921  -2.628  38.073  1.00 32.85 ? 89   VAL A CB  1 
ATOM   469  C  CG1 . VAL A 1 100 ? 15.208  -3.418  38.181  1.00 33.65 ? 89   VAL A CG1 1 
ATOM   470  C  CG2 . VAL A 1 100 ? 13.083  -3.111  36.905  1.00 33.26 ? 89   VAL A CG2 1 
ATOM   471  N  N   . PRO A 1 101 ? 14.125  -2.987  41.584  1.00 37.01 ? 90   PRO A N   1 
ATOM   472  C  CA  . PRO A 1 101 ? 14.897  -2.561  42.745  1.00 35.61 ? 90   PRO A CA  1 
ATOM   473  C  C   . PRO A 1 101 ? 16.350  -2.260  42.374  1.00 35.73 ? 90   PRO A C   1 
ATOM   474  O  O   . PRO A 1 101 ? 16.885  -2.860  41.436  1.00 35.71 ? 90   PRO A O   1 
ATOM   475  C  CB  . PRO A 1 101 ? 14.806  -3.768  43.692  1.00 37.75 ? 90   PRO A CB  1 
ATOM   476  C  CG  . PRO A 1 101 ? 14.509  -4.933  42.804  1.00 38.83 ? 90   PRO A CG  1 
ATOM   477  C  CD  . PRO A 1 101 ? 13.619  -4.367  41.736  1.00 37.93 ? 90   PRO A CD  1 
ATOM   478  N  N   . ARG A 1 102 ? 16.961  -1.321  43.094  1.00 35.96 ? 91   ARG A N   1 
ATOM   479  C  CA  . ARG A 1 102 ? 18.357  -0.929  42.882  1.00 39.49 ? 91   ARG A CA  1 
ATOM   480  C  C   . ARG A 1 102 ? 19.339  -2.066  43.174  1.00 42.78 ? 91   ARG A C   1 
ATOM   481  O  O   . ARG A 1 102 ? 19.327  -2.629  44.267  1.00 43.46 ? 91   ARG A O   1 
ATOM   482  C  CB  . ARG A 1 102 ? 18.707  0.267   43.777  1.00 39.24 ? 91   ARG A CB  1 
ATOM   483  C  CG  . ARG A 1 102 ? 17.800  1.476   43.612  1.00 40.09 ? 91   ARG A CG  1 
ATOM   484  C  CD  . ARG A 1 102 ? 18.251  2.670   44.434  1.00 39.02 ? 91   ARG A CD  1 
ATOM   485  N  NE  . ARG A 1 102 ? 17.207  3.685   44.421  1.00 43.87 ? 91   ARG A NE  1 
ATOM   486  C  CZ  . ARG A 1 102 ? 17.330  4.940   44.864  1.00 45.90 ? 91   ARG A CZ  1 
ATOM   487  N  NH1 . ARG A 1 102 ? 18.469  5.388   45.377  1.00 45.33 ? 91   ARG A NH1 1 
ATOM   488  N  NH2 . ARG A 1 102 ? 16.290  5.759   44.790  1.00 46.76 ? 91   ARG A NH2 1 
ATOM   489  N  N   . LYS A 1 103 ? 20.182  -2.411  42.201  1.00 46.11 ? 92   LYS A N   1 
ATOM   490  C  CA  . LYS A 1 103 ? 21.301  -3.321  42.470  1.00 49.87 ? 92   LYS A CA  1 
ATOM   491  C  C   . LYS A 1 103 ? 22.339  -3.436  41.348  1.00 50.95 ? 92   LYS A C   1 
ATOM   492  O  O   . LYS A 1 103 ? 22.207  -2.812  40.287  1.00 45.10 ? 92   LYS A O   1 
ATOM   493  C  CB  . LYS A 1 103 ? 20.813  -4.707  42.941  1.00 52.87 ? 92   LYS A CB  1 
ATOM   494  C  CG  . LYS A 1 103 ? 20.021  -5.535  41.947  1.00 51.28 ? 92   LYS A CG  1 
ATOM   495  C  CD  . LYS A 1 103 ? 19.243  -6.608  42.706  1.00 55.20 ? 92   LYS A CD  1 
ATOM   496  C  CE  . LYS A 1 103 ? 19.037  -7.879  41.894  1.00 53.15 ? 92   LYS A CE  1 
ATOM   497  N  NZ  . LYS A 1 103 ? 20.304  -8.619  41.632  1.00 57.15 ? 92   LYS A NZ  1 
ATOM   498  N  N   . HIS A 1 104 ? 23.392  -4.206  41.623  1.00 49.81 ? 93   HIS A N   1 
ATOM   499  C  CA  . HIS A 1 104 ? 24.381  -4.564  40.621  1.00 52.63 ? 93   HIS A CA  1 
ATOM   500  C  C   . HIS A 1 104 ? 23.806  -5.684  39.803  1.00 56.19 ? 93   HIS A C   1 
ATOM   501  O  O   . HIS A 1 104 ? 24.021  -6.866  40.092  1.00 61.45 ? 93   HIS A O   1 
ATOM   502  C  CB  . HIS A 1 104 ? 25.707  -4.963  41.275  1.00 54.23 ? 93   HIS A CB  1 
ATOM   503  C  CG  . HIS A 1 104 ? 26.786  -5.325  40.283  1.00 55.41 ? 93   HIS A CG  1 
ATOM   504  N  ND1 . HIS A 1 104 ? 27.498  -4.398  39.616  1.00 57.14 ? 93   HIS A ND1 1 
ATOM   505  C  CD2 . HIS A 1 104 ? 27.250  -6.565  39.845  1.00 58.73 ? 93   HIS A CD2 1 
ATOM   506  C  CE1 . HIS A 1 104 ? 28.374  -5.007  38.793  1.00 57.11 ? 93   HIS A CE1 1 
ATOM   507  N  NE2 . HIS A 1 104 ? 28.227  -6.332  38.938  1.00 59.68 ? 93   HIS A NE2 1 
ATOM   508  N  N   . TRP A 1 105 ? 23.051  -5.311  38.777  1.00 52.39 ? 94   TRP A N   1 
ATOM   509  C  CA  . TRP A 1 105 ? 22.260  -6.251  37.997  1.00 48.14 ? 94   TRP A CA  1 
ATOM   510  C  C   . TRP A 1 105 ? 23.061  -7.060  37.029  1.00 47.61 ? 94   TRP A C   1 
ATOM   511  O  O   . TRP A 1 105 ? 22.686  -8.172  36.692  1.00 49.62 ? 94   TRP A O   1 
ATOM   512  C  CB  . TRP A 1 105 ? 21.172  -5.493  37.235  1.00 45.71 ? 94   TRP A CB  1 
ATOM   513  C  CG  . TRP A 1 105 ? 19.974  -5.164  38.087  1.00 41.77 ? 94   TRP A CG  1 
ATOM   514  C  CD1 . TRP A 1 105 ? 19.676  -3.954  38.698  1.00 42.01 ? 94   TRP A CD1 1 
ATOM   515  C  CD2 . TRP A 1 105 ? 18.898  -6.068  38.482  1.00 41.12 ? 94   TRP A CD2 1 
ATOM   516  N  NE1 . TRP A 1 105 ? 18.512  -4.040  39.411  1.00 40.58 ? 94   TRP A NE1 1 
ATOM   517  C  CE2 . TRP A 1 105 ? 17.993  -5.282  39.327  1.00 41.17 ? 94   TRP A CE2 1 
ATOM   518  C  CE3 . TRP A 1 105 ? 18.592  -7.407  38.222  1.00 41.23 ? 94   TRP A CE3 1 
ATOM   519  C  CZ2 . TRP A 1 105 ? 16.838  -5.829  39.881  1.00 40.57 ? 94   TRP A CZ2 1 
ATOM   520  C  CZ3 . TRP A 1 105 ? 17.428  -7.944  38.779  1.00 40.24 ? 94   TRP A CZ3 1 
ATOM   521  C  CH2 . TRP A 1 105 ? 16.570  -7.172  39.586  1.00 41.37 ? 94   TRP A CH2 1 
ATOM   522  N  N   . TRP A 1 106 ? 24.136  -6.479  36.530  1.00 47.73 ? 95   TRP A N   1 
ATOM   523  C  CA  . TRP A 1 106 ? 24.858  -7.052  35.429  1.00 48.75 ? 95   TRP A CA  1 
ATOM   524  C  C   . TRP A 1 106 ? 26.332  -6.971  35.661  1.00 53.24 ? 95   TRP A C   1 
ATOM   525  O  O   . TRP A 1 106 ? 26.816  -6.022  36.290  1.00 54.41 ? 95   TRP A O   1 
ATOM   526  C  CB  . TRP A 1 106 ? 24.482  -6.285  34.181  1.00 48.37 ? 95   TRP A CB  1 
ATOM   527  C  CG  . TRP A 1 106 ? 25.193  -6.690  32.925  1.00 47.34 ? 95   TRP A CG  1 
ATOM   528  C  CD1 . TRP A 1 106 ? 26.188  -5.998  32.258  1.00 46.57 ? 95   TRP A CD1 1 
ATOM   529  C  CD2 . TRP A 1 106 ? 24.955  -7.881  32.116  1.00 46.43 ? 95   TRP A CD2 1 
ATOM   530  N  NE1 . TRP A 1 106 ? 26.577  -6.665  31.135  1.00 48.56 ? 95   TRP A NE1 1 
ATOM   531  C  CE2 . TRP A 1 106 ? 25.877  -7.801  30.992  1.00 47.31 ? 95   TRP A CE2 1 
ATOM   532  C  CE3 . TRP A 1 106 ? 24.110  -8.962  32.210  1.00 45.20 ? 95   TRP A CE3 1 
ATOM   533  C  CZ2 . TRP A 1 106 ? 25.931  -8.771  30.025  1.00 46.93 ? 95   TRP A CZ2 1 
ATOM   534  C  CZ3 . TRP A 1 106 ? 24.171  -9.934  31.226  1.00 46.43 ? 95   TRP A CZ3 1 
ATOM   535  C  CH2 . TRP A 1 106 ? 25.061  -9.840  30.161  1.00 47.85 ? 95   TRP A CH2 1 
ATOM   536  N  N   . THR A 1 107 ? 27.081  -7.950  35.165  1.00 57.92 ? 96   THR A N   1 
ATOM   537  C  CA  . THR A 1 107 ? 28.531  -7.918  35.302  1.00 59.83 ? 96   THR A CA  1 
ATOM   538  C  C   . THR A 1 107 ? 29.247  -8.175  33.996  1.00 59.87 ? 96   THR A C   1 
ATOM   539  O  O   . THR A 1 107 ? 28.836  -9.013  33.211  1.00 57.79 ? 96   THR A O   1 
ATOM   540  C  CB  . THR A 1 107 ? 29.035  -8.940  36.317  1.00 58.44 ? 96   THR A CB  1 
ATOM   541  O  OG1 . THR A 1 107 ? 28.628  -10.241 35.895  1.00 60.18 ? 96   THR A OG1 1 
ATOM   542  C  CG2 . THR A 1 107 ? 28.467  -8.649  37.673  1.00 57.53 ? 96   THR A CG2 1 
ATOM   543  N  N   . ASP A 1 108 ? 30.337  -7.451  33.783  1.00 64.43 ? 97   ASP A N   1 
ATOM   544  C  CA  . ASP A 1 108 ? 31.157  -7.631  32.576  1.00 65.43 ? 97   ASP A CA  1 
ATOM   545  C  C   . ASP A 1 108 ? 31.855  -6.332  32.176  1.00 65.16 ? 97   ASP A C   1 
ATOM   546  O  O   . ASP A 1 108 ? 33.051  -6.325  31.882  1.00 67.16 ? 97   ASP A O   1 
ATOM   547  C  CB  . ASP A 1 108 ? 30.309  -8.172  31.422  1.00 65.23 ? 97   ASP A CB  1 
ATOM   548  C  CG  . ASP A 1 108 ? 30.976  -8.022  30.083  1.00 67.87 ? 97   ASP A CG  1 
ATOM   549  O  OD1 . ASP A 1 108 ? 31.927  -8.785  29.797  1.00 69.57 ? 97   ASP A OD1 1 
ATOM   550  O  OD2 . ASP A 1 108 ? 30.531  -7.144  29.313  1.00 66.77 ? 97   ASP A OD2 1 
ATOM   551  N  N   . LYS A 1 113 ? 31.499  -3.016  25.734  1.00 57.68 ? 102  LYS A N   1 
ATOM   552  C  CA  . LYS A 1 113 ? 30.340  -2.350  26.324  1.00 57.04 ? 102  LYS A CA  1 
ATOM   553  C  C   . LYS A 1 113 ? 29.220  -2.332  25.291  1.00 58.04 ? 102  LYS A C   1 
ATOM   554  O  O   . LYS A 1 113 ? 29.435  -1.926  24.142  1.00 57.43 ? 102  LYS A O   1 
ATOM   555  C  CB  . LYS A 1 113 ? 30.703  -0.922  26.751  1.00 57.97 ? 102  LYS A CB  1 
ATOM   556  C  CG  . LYS A 1 113 ? 30.104  -0.461  28.074  1.00 53.61 ? 102  LYS A CG  1 
ATOM   557  C  CD  . LYS A 1 113 ? 30.953  -0.901  29.261  1.00 52.02 ? 102  LYS A CD  1 
ATOM   558  C  CE  . LYS A 1 113 ? 30.568  -0.166  30.537  1.00 52.64 ? 102  LYS A CE  1 
ATOM   559  N  NZ  . LYS A 1 113 ? 31.199  -0.746  31.760  1.00 49.09 ? 102  LYS A NZ  1 
ATOM   560  N  N   . LYS A 1 114 ? 28.035  -2.792  25.698  1.00 56.06 ? 103  LYS A N   1 
ATOM   561  C  CA  . LYS A 1 114 ? 26.877  -2.887  24.802  1.00 52.05 ? 103  LYS A CA  1 
ATOM   562  C  C   . LYS A 1 114 ? 25.551  -2.829  25.570  1.00 49.53 ? 103  LYS A C   1 
ATOM   563  O  O   . LYS A 1 114 ? 25.526  -3.005  26.797  1.00 49.84 ? 103  LYS A O   1 
ATOM   564  C  CB  . LYS A 1 114 ? 26.945  -4.171  23.969  1.00 50.07 ? 103  LYS A CB  1 
ATOM   565  N  N   . HIS A 1 115 ? 24.458  -2.581  24.844  1.00 43.77 ? 104  HIS A N   1 
ATOM   566  C  CA  . HIS A 1 115 ? 23.115  -2.600  25.430  1.00 43.15 ? 104  HIS A CA  1 
ATOM   567  C  C   . HIS A 1 115 ? 22.742  -3.985  25.890  1.00 41.83 ? 104  HIS A C   1 
ATOM   568  O  O   . HIS A 1 115 ? 22.921  -4.960  25.166  1.00 38.28 ? 104  HIS A O   1 
ATOM   569  C  CB  . HIS A 1 115 ? 22.065  -2.100  24.433  1.00 41.20 ? 104  HIS A CB  1 
ATOM   570  C  CG  . HIS A 1 115 ? 22.258  -0.671  24.007  1.00 41.11 ? 104  HIS A CG  1 
ATOM   571  N  ND1 . HIS A 1 115 ? 21.924  0.367   24.791  1.00 41.35 ? 104  HIS A ND1 1 
ATOM   572  C  CD2 . HIS A 1 115 ? 22.761  -0.128  22.829  1.00 42.30 ? 104  HIS A CD2 1 
ATOM   573  C  CE1 . HIS A 1 115 ? 22.207  1.518   24.154  1.00 40.92 ? 104  HIS A CE1 1 
ATOM   574  N  NE2 . HIS A 1 115 ? 22.713  1.215   22.951  1.00 42.34 ? 104  HIS A NE2 1 
ATOM   575  N  N   . VAL A 1 116 ? 22.214  -4.083  27.102  1.00 42.62 ? 105  VAL A N   1 
ATOM   576  C  CA  . VAL A 1 116 ? 21.738  -5.358  27.619  1.00 40.89 ? 105  VAL A CA  1 
ATOM   577  C  C   . VAL A 1 116 ? 20.291  -5.204  28.027  1.00 40.59 ? 105  VAL A C   1 
ATOM   578  O  O   . VAL A 1 116 ? 19.986  -4.398  28.911  1.00 38.83 ? 105  VAL A O   1 
ATOM   579  C  CB  . VAL A 1 116 ? 22.516  -5.825  28.870  1.00 41.53 ? 105  VAL A CB  1 
ATOM   580  C  CG1 . VAL A 1 116 ? 22.101  -7.253  29.226  1.00 42.08 ? 105  VAL A CG1 1 
ATOM   581  C  CG2 . VAL A 1 116 ? 24.021  -5.741  28.662  1.00 39.76 ? 105  VAL A CG2 1 
ATOM   582  N  N   . TRP A 1 117 ? 19.410  -5.982  27.401  1.00 38.49 ? 106  TRP A N   1 
ATOM   583  C  CA  . TRP A 1 117 ? 18.012  -6.015  27.796  1.00 37.07 ? 106  TRP A CA  1 
ATOM   584  C  C   . TRP A 1 117 ? 17.848  -6.616  29.154  1.00 38.87 ? 106  TRP A C   1 
ATOM   585  O  O   . TRP A 1 117 ? 18.279  -7.744  29.394  1.00 39.97 ? 106  TRP A O   1 
ATOM   586  C  CB  . TRP A 1 117 ? 17.186  -6.765  26.765  1.00 37.22 ? 106  TRP A CB  1 
ATOM   587  C  CG  . TRP A 1 117 ? 17.102  -6.002  25.475  1.00 36.78 ? 106  TRP A CG  1 
ATOM   588  C  CD1 . TRP A 1 117 ? 17.690  -6.319  24.259  1.00 37.30 ? 106  TRP A CD1 1 
ATOM   589  C  CD2 . TRP A 1 117 ? 16.399  -4.728  25.240  1.00 37.42 ? 106  TRP A CD2 1 
ATOM   590  N  NE1 . TRP A 1 117 ? 17.404  -5.368  23.308  1.00 39.60 ? 106  TRP A NE1 1 
ATOM   591  C  CE2 . TRP A 1 117 ? 16.633  -4.385  23.827  1.00 38.39 ? 106  TRP A CE2 1 
ATOM   592  C  CE3 . TRP A 1 117 ? 15.623  -3.875  26.024  1.00 37.14 ? 106  TRP A CE3 1 
ATOM   593  C  CZ2 . TRP A 1 117 ? 16.113  -3.232  23.252  1.00 37.43 ? 106  TRP A CZ2 1 
ATOM   594  C  CZ3 . TRP A 1 117 ? 15.106  -2.707  25.431  1.00 36.48 ? 106  TRP A CZ3 1 
ATOM   595  C  CH2 . TRP A 1 117 ? 15.350  -2.395  24.082  1.00 35.95 ? 106  TRP A CH2 1 
ATOM   596  N  N   . PHE A 1 118 ? 17.245  -5.852  30.062  1.00 36.56 ? 107  PHE A N   1 
ATOM   597  C  CA  . PHE A 1 118 ? 16.987  -6.293  31.433  1.00 38.97 ? 107  PHE A CA  1 
ATOM   598  C  C   . PHE A 1 118 ? 16.149  -7.565  31.468  1.00 42.42 ? 107  PHE A C   1 
ATOM   599  O  O   . PHE A 1 118 ? 16.505  -8.529  32.155  1.00 44.36 ? 107  PHE A O   1 
ATOM   600  C  CB  . PHE A 1 118 ? 16.275  -5.188  32.222  1.00 37.11 ? 107  PHE A CB  1 
ATOM   601  C  CG  . PHE A 1 118 ? 15.782  -5.614  33.587  1.00 36.44 ? 107  PHE A CG  1 
ATOM   602  C  CD1 . PHE A 1 118 ? 16.649  -5.657  34.672  1.00 33.82 ? 107  PHE A CD1 1 
ATOM   603  C  CD2 . PHE A 1 118 ? 14.441  -5.935  33.792  1.00 34.62 ? 107  PHE A CD2 1 
ATOM   604  C  CE1 . PHE A 1 118 ? 16.200  -6.026  35.930  1.00 34.47 ? 107  PHE A CE1 1 
ATOM   605  C  CE2 . PHE A 1 118 ? 13.982  -6.300  35.052  1.00 34.81 ? 107  PHE A CE2 1 
ATOM   606  C  CZ  . PHE A 1 118 ? 14.864  -6.348  36.123  1.00 35.97 ? 107  PHE A CZ  1 
ATOM   607  N  N   . GLY A 1 119 ? 15.045  -7.551  30.721  1.00 42.34 ? 108  GLY A N   1 
ATOM   608  C  CA  . GLY A 1 119 ? 14.105  -8.661  30.670  1.00 44.36 ? 108  GLY A CA  1 
ATOM   609  C  C   . GLY A 1 119 ? 14.581  -9.871  29.884  1.00 47.92 ? 108  GLY A C   1 
ATOM   610  O  O   . GLY A 1 119 ? 14.391  -10.994 30.332  1.00 50.45 ? 108  GLY A O   1 
ATOM   611  N  N   . GLU A 1 120 ? 15.195  -9.650  28.721  1.00 46.57 ? 109  GLU A N   1 
ATOM   612  C  CA  . GLU A 1 120 ? 15.662  -10.746 27.866  1.00 47.85 ? 109  GLU A CA  1 
ATOM   613  C  C   . GLU A 1 120 ? 16.954  -11.435 28.321  1.00 49.42 ? 109  GLU A C   1 
ATOM   614  O  O   . GLU A 1 120 ? 17.218  -12.561 27.911  1.00 52.89 ? 109  GLU A O   1 
ATOM   615  C  CB  . GLU A 1 120 ? 15.861  -10.268 26.422  1.00 49.00 ? 109  GLU A CB  1 
ATOM   616  C  CG  . GLU A 1 120 ? 14.585  -9.937  25.655  1.00 52.06 ? 109  GLU A CG  1 
ATOM   617  C  CD  . GLU A 1 120 ? 14.847  -9.501  24.217  1.00 55.17 ? 109  GLU A CD  1 
ATOM   618  O  OE1 . GLU A 1 120 ? 15.955  -9.764  23.698  1.00 56.09 ? 109  GLU A OE1 1 
ATOM   619  O  OE2 . GLU A 1 120 ? 13.948  -8.889  23.596  1.00 55.20 ? 109  GLU A OE2 1 
ATOM   620  N  N   . SER A 1 121 ? 17.761  -10.779 29.150  1.00 46.39 ? 110  SER A N   1 
ATOM   621  C  CA  . SER A 1 121 ? 19.156  -11.207 29.321  1.00 44.06 ? 110  SER A CA  1 
ATOM   622  C  C   . SER A 1 121 ? 19.780  -11.154 30.703  1.00 41.95 ? 110  SER A C   1 
ATOM   623  O  O   . SER A 1 121 ? 20.888  -11.638 30.874  1.00 47.65 ? 110  SER A O   1 
ATOM   624  C  CB  . SER A 1 121 ? 20.056  -10.417 28.377  1.00 42.08 ? 110  SER A CB  1 
ATOM   625  O  OG  . SER A 1 121 ? 19.645  -10.606 27.040  1.00 46.62 ? 110  SER A OG  1 
HETATM 626  N  N   . MSE A 1 122 ? 19.106  -10.563 31.678  1.00 41.02 ? 111  MSE A N   1 
HETATM 627  C  CA  . MSE A 1 122 ? 19.715  -10.388 32.998  1.00 43.38 ? 111  MSE A CA  1 
HETATM 628  C  C   . MSE A 1 122 ? 19.124  -11.332 34.015  1.00 44.81 ? 111  MSE A C   1 
HETATM 629  O  O   . MSE A 1 122 ? 17.967  -11.764 33.901  1.00 41.03 ? 111  MSE A O   1 
HETATM 630  C  CB  . MSE A 1 122 ? 19.648  -8.923  33.461  1.00 45.45 ? 111  MSE A CB  1 
HETATM 631  C  CG  . MSE A 1 122 ? 20.287  -7.965  32.440  1.00 48.54 ? 111  MSE A CG  1 
HETATM 632  SE SE  . MSE A 1 122 ? 20.515  -6.094  33.074  1.00 52.76 ? 111  MSE A SE  1 
HETATM 633  C  CE  . MSE A 1 122 ? 19.863  -6.298  34.907  1.00 52.06 ? 111  MSE A CE  1 
ATOM   634  N  N   . ASP A 1 123 ? 19.926  -11.647 35.029  1.00 45.66 ? 112  ASP A N   1 
ATOM   635  C  CA  . ASP A 1 123 ? 19.551  -12.608 36.049  1.00 47.58 ? 112  ASP A CA  1 
ATOM   636  C  C   . ASP A 1 123 ? 18.533  -12.018 36.998  1.00 48.08 ? 112  ASP A C   1 
ATOM   637  O  O   . ASP A 1 123 ? 18.827  -11.077 37.754  1.00 50.01 ? 112  ASP A O   1 
ATOM   638  C  CB  . ASP A 1 123 ? 20.786  -13.114 36.803  1.00 51.19 ? 112  ASP A CB  1 
ATOM   639  C  CG  . ASP A 1 123 ? 21.606  -14.095 35.979  1.00 56.29 ? 112  ASP A CG  1 
ATOM   640  O  OD1 . ASP A 1 123 ? 21.013  -15.057 35.425  1.00 55.99 ? 112  ASP A OD1 1 
ATOM   641  O  OD2 . ASP A 1 123 ? 22.841  -13.901 35.884  1.00 60.60 ? 112  ASP A OD2 1 
ATOM   642  N  N   . GLY A 1 124 ? 17.330  -12.581 36.954  1.00 45.14 ? 113  GLY A N   1 
ATOM   643  C  CA  . GLY A 1 124 ? 16.202  -12.023 37.690  1.00 44.01 ? 113  GLY A CA  1 
ATOM   644  C  C   . GLY A 1 124 ? 15.470  -11.025 36.819  1.00 41.80 ? 113  GLY A C   1 
ATOM   645  O  O   . GLY A 1 124 ? 14.514  -10.398 37.261  1.00 41.12 ? 113  GLY A O   1 
ATOM   646  N  N   . GLY A 1 125 ? 15.925  -10.895 35.573  1.00 42.25 ? 114  GLY A N   1 
ATOM   647  C  CA  . GLY A 1 125 ? 15.304  -10.004 34.601  1.00 42.30 ? 114  GLY A CA  1 
ATOM   648  C  C   . GLY A 1 125 ? 13.860  -10.388 34.353  1.00 43.34 ? 114  GLY A C   1 
ATOM   649  O  O   . GLY A 1 125 ? 13.487  -11.546 34.530  1.00 44.59 ? 114  GLY A O   1 
ATOM   650  N  N   . PHE A 1 126 ? 13.049  -9.405  33.970  1.00 40.37 ? 115  PHE A N   1 
ATOM   651  C  CA  . PHE A 1 126 ? 11.655  -9.628  33.611  1.00 37.61 ? 115  PHE A CA  1 
ATOM   652  C  C   . PHE A 1 126 ? 11.138  -8.482  32.751  1.00 37.99 ? 115  PHE A C   1 
ATOM   653  O  O   . PHE A 1 126 ? 11.581  -7.331  32.881  1.00 34.00 ? 115  PHE A O   1 
ATOM   654  C  CB  . PHE A 1 126 ? 10.767  -9.793  34.860  1.00 38.01 ? 115  PHE A CB  1 
ATOM   655  C  CG  . PHE A 1 126 ? 10.804  -8.624  35.806  1.00 36.99 ? 115  PHE A CG  1 
ATOM   656  C  CD1 . PHE A 1 126 ? 9.898   -7.571  35.672  1.00 38.18 ? 115  PHE A CD1 1 
ATOM   657  C  CD2 . PHE A 1 126 ? 11.725  -8.584  36.855  1.00 37.90 ? 115  PHE A CD2 1 
ATOM   658  C  CE1 . PHE A 1 126 ? 9.926   -6.489  36.548  1.00 37.15 ? 115  PHE A CE1 1 
ATOM   659  C  CE2 . PHE A 1 126 ? 11.754  -7.507  37.740  1.00 37.36 ? 115  PHE A CE2 1 
ATOM   660  C  CZ  . PHE A 1 126 ? 10.858  -6.456  37.581  1.00 36.51 ? 115  PHE A CZ  1 
ATOM   661  N  N   . GLN A 1 127 ? 10.195  -8.801  31.877  1.00 36.05 ? 116  GLN A N   1 
ATOM   662  C  CA  . GLN A 1 127 ? 9.528   -7.783  31.110  1.00 36.62 ? 116  GLN A CA  1 
ATOM   663  C  C   . GLN A 1 127 ? 8.381   -7.184  31.918  1.00 36.44 ? 116  GLN A C   1 
ATOM   664  O  O   . GLN A 1 127 ? 7.861   -7.805  32.870  1.00 34.62 ? 116  GLN A O   1 
ATOM   665  C  CB  . GLN A 1 127 ? 9.078   -8.336  29.765  1.00 39.27 ? 116  GLN A CB  1 
ATOM   666  C  CG  . GLN A 1 127 ? 10.261  -8.562  28.836  1.00 43.09 ? 116  GLN A CG  1 
ATOM   667  C  CD  . GLN A 1 127 ? 9.847   -8.922  27.426  1.00 45.59 ? 116  GLN A CD  1 
ATOM   668  O  OE1 . GLN A 1 127 ? 9.045   -9.832  27.216  1.00 49.50 ? 116  GLN A OE1 1 
ATOM   669  N  NE2 . GLN A 1 127 ? 10.404  -8.217  26.448  1.00 47.51 ? 116  GLN A NE2 1 
ATOM   670  N  N   . PHE A 1 128 ? 8.013   -5.960  31.559  1.00 32.56 ? 117  PHE A N   1 
ATOM   671  C  CA  . PHE A 1 128 ? 7.015   -5.250  32.311  1.00 31.12 ? 117  PHE A CA  1 
ATOM   672  C  C   . PHE A 1 128 ? 5.643   -5.633  31.795  1.00 29.95 ? 117  PHE A C   1 
ATOM   673  O  O   . PHE A 1 128 ? 5.422   -5.713  30.592  1.00 29.59 ? 117  PHE A O   1 
ATOM   674  C  CB  . PHE A 1 128 ? 7.231   -3.731  32.203  1.00 32.19 ? 117  PHE A CB  1 
ATOM   675  C  CG  . PHE A 1 128 ? 8.646   -3.296  32.446  1.00 31.56 ? 117  PHE A CG  1 
ATOM   676  C  CD1 . PHE A 1 128 ? 9.353   -3.753  33.558  1.00 31.15 ? 117  PHE A CD1 1 
ATOM   677  C  CD2 . PHE A 1 128 ? 9.271   -2.415  31.566  1.00 31.73 ? 117  PHE A CD2 1 
ATOM   678  C  CE1 . PHE A 1 128 ? 10.667  -3.359  33.770  1.00 33.22 ? 117  PHE A CE1 1 
ATOM   679  C  CE2 . PHE A 1 128 ? 10.582  -2.002  31.780  1.00 31.51 ? 117  PHE A CE2 1 
ATOM   680  C  CZ  . PHE A 1 128 ? 11.283  -2.477  32.880  1.00 32.68 ? 117  PHE A CZ  1 
ATOM   681  N  N   . SER A 1 129 ? 4.713   -5.878  32.701  1.00 28.79 ? 118  SER A N   1 
ATOM   682  C  CA  . SER A 1 129 ? 3.349   -6.073  32.264  1.00 29.40 ? 118  SER A CA  1 
ATOM   683  C  C   . SER A 1 129 ? 2.371   -5.153  33.008  1.00 27.73 ? 118  SER A C   1 
ATOM   684  O  O   . SER A 1 129 ? 2.743   -4.440  33.950  1.00 26.27 ? 118  SER A O   1 
ATOM   685  C  CB  . SER A 1 129 ? 2.936   -7.553  32.321  1.00 31.27 ? 118  SER A CB  1 
ATOM   686  O  OG  . SER A 1 129 ? 2.990   -8.010  33.646  1.00 35.46 ? 118  SER A OG  1 
ATOM   687  N  N   . TYR A 1 130 ? 1.125   -5.166  32.553  1.00 25.74 ? 119  TYR A N   1 
ATOM   688  C  CA  . TYR A 1 130 ? 0.165   -4.165  32.935  1.00 26.41 ? 119  TYR A CA  1 
ATOM   689  C  C   . TYR A 1 130 ? -1.212  -4.788  33.168  1.00 26.50 ? 119  TYR A C   1 
ATOM   690  O  O   . TYR A 1 130 ? -1.609  -5.708  32.457  1.00 28.51 ? 119  TYR A O   1 
ATOM   691  C  CB  . TYR A 1 130 ? 0.137   -3.079  31.853  1.00 24.47 ? 119  TYR A CB  1 
ATOM   692  C  CG  . TYR A 1 130 ? 1.508   -2.434  31.636  1.00 23.24 ? 119  TYR A CG  1 
ATOM   693  C  CD1 . TYR A 1 130 ? 2.488   -3.058  30.870  1.00 22.87 ? 119  TYR A CD1 1 
ATOM   694  C  CD2 . TYR A 1 130 ? 1.825   -1.210  32.223  1.00 23.40 ? 119  TYR A CD2 1 
ATOM   695  C  CE1 . TYR A 1 130 ? 3.744   -2.490  30.700  1.00 22.31 ? 119  TYR A CE1 1 
ATOM   696  C  CE2 . TYR A 1 130 ? 3.075   -0.631  32.055  1.00 22.27 ? 119  TYR A CE2 1 
ATOM   697  C  CZ  . TYR A 1 130 ? 4.027   -1.271  31.288  1.00 21.85 ? 119  TYR A CZ  1 
ATOM   698  O  OH  . TYR A 1 130 ? 5.267   -0.698  31.131  1.00 20.56 ? 119  TYR A OH  1 
ATOM   699  N  N   . GLY A 1 131 ? -1.912  -4.300  34.188  1.00 26.06 ? 120  GLY A N   1 
ATOM   700  C  CA  . GLY A 1 131 ? -3.288  -4.690  34.454  1.00 28.22 ? 120  GLY A CA  1 
ATOM   701  C  C   . GLY A 1 131 ? -3.421  -5.628  35.638  1.00 29.03 ? 120  GLY A C   1 
ATOM   702  O  O   . GLY A 1 131 ? -2.466  -6.341  35.981  1.00 29.53 ? 120  GLY A O   1 
ATOM   703  N  N   . ASN A 1 132 ? -4.607  -5.629  36.246  1.00 29.00 ? 121  ASN A N   1 
ATOM   704  C  CA  . ASN A 1 132 ? -4.939  -6.515  37.374  1.00 31.07 ? 121  ASN A CA  1 
ATOM   705  C  C   . ASN A 1 132 ? -4.333  -7.906  37.213  1.00 31.94 ? 121  ASN A C   1 
ATOM   706  O  O   . ASN A 1 132 ? -4.709  -8.628  36.296  1.00 30.98 ? 121  ASN A O   1 
ATOM   707  C  CB  . ASN A 1 132 ? -6.459  -6.682  37.481  1.00 30.94 ? 121  ASN A CB  1 
ATOM   708  C  CG  . ASN A 1 132 ? -7.190  -5.370  37.626  1.00 31.09 ? 121  ASN A CG  1 
ATOM   709  O  OD1 . ASN A 1 132 ? -6.977  -4.425  36.853  1.00 30.67 ? 121  ASN A OD1 1 
ATOM   710  N  ND2 . ASN A 1 132 ? -8.081  -5.305  38.621  1.00 30.99 ? 121  ASN A ND2 1 
ATOM   711  N  N   . PRO A 1 133 ? -3.384  -8.274  38.089  1.00 33.93 ? 122  PRO A N   1 
ATOM   712  C  CA  . PRO A 1 133 ? -2.708  -9.590  38.030  1.00 34.44 ? 122  PRO A CA  1 
ATOM   713  C  C   . PRO A 1 133 ? -3.631  -10.822 38.223  1.00 33.30 ? 122  PRO A C   1 
ATOM   714  O  O   . PRO A 1 133 ? -3.264  -11.925 37.824  1.00 32.98 ? 122  PRO A O   1 
ATOM   715  C  CB  . PRO A 1 133 ? -1.684  -9.517  39.181  1.00 35.43 ? 122  PRO A CB  1 
ATOM   716  C  CG  . PRO A 1 133 ? -1.536  -8.051  39.470  1.00 36.66 ? 122  PRO A CG  1 
ATOM   717  C  CD  . PRO A 1 133 ? -2.880  -7.444  39.197  1.00 33.61 ? 122  PRO A CD  1 
ATOM   718  N  N   . GLU A 1 134 ? -4.802  -10.646 38.825  1.00 32.12 ? 123  GLU A N   1 
ATOM   719  C  CA  . GLU A 1 134 ? -5.731  -11.767 38.992  1.00 34.40 ? 123  GLU A CA  1 
ATOM   720  C  C   . GLU A 1 134 ? -6.412  -12.179 37.666  1.00 35.12 ? 123  GLU A C   1 
ATOM   721  O  O   . GLU A 1 134 ? -7.013  -13.250 37.583  1.00 36.24 ? 123  GLU A O   1 
ATOM   722  C  CB  . GLU A 1 134 ? -6.776  -11.470 40.088  1.00 34.38 ? 123  GLU A CB  1 
ATOM   723  C  CG  . GLU A 1 134 ? -7.849  -10.443 39.707  1.00 36.49 ? 123  GLU A CG  1 
ATOM   724  C  CD  . GLU A 1 134 ? -7.394  -8.982  39.836  1.00 36.31 ? 123  GLU A CD  1 
ATOM   725  O  OE1 . GLU A 1 134 ? -6.170  -8.705  39.806  1.00 35.77 ? 123  GLU A OE1 1 
ATOM   726  O  OE2 . GLU A 1 134 ? -8.274  -8.099  39.948  1.00 35.10 ? 123  GLU A OE2 1 
ATOM   727  N  N   . LEU A 1 135 ? -6.305  -11.338 36.635  1.00 32.95 ? 124  LEU A N   1 
ATOM   728  C  CA  . LEU A 1 135 ? -6.909  -11.641 35.338  1.00 32.21 ? 124  LEU A CA  1 
ATOM   729  C  C   . LEU A 1 135 ? -5.941  -12.415 34.456  1.00 30.73 ? 124  LEU A C   1 
ATOM   730  O  O   . LEU A 1 135 ? -4.736  -12.169 34.503  1.00 32.05 ? 124  LEU A O   1 
ATOM   731  C  CB  . LEU A 1 135 ? -7.361  -10.359 34.636  1.00 31.92 ? 124  LEU A CB  1 
ATOM   732  C  CG  . LEU A 1 135 ? -8.501  -9.595  35.314  1.00 33.52 ? 124  LEU A CG  1 
ATOM   733  C  CD1 . LEU A 1 135 ? -8.620  -8.192  34.733  1.00 33.28 ? 124  LEU A CD1 1 
ATOM   734  C  CD2 . LEU A 1 135 ? -9.826  -10.333 35.187  1.00 32.95 ? 124  LEU A CD2 1 
ATOM   735  N  N   . PRO A 1 136 ? -6.455  -13.368 33.655  1.00 30.68 ? 125  PRO A N   1 
ATOM   736  C  CA  . PRO A 1 136 ? -5.592  -14.141 32.746  1.00 29.53 ? 125  PRO A CA  1 
ATOM   737  C  C   . PRO A 1 136 ? -4.914  -13.228 31.738  1.00 30.75 ? 125  PRO A C   1 
ATOM   738  O  O   . PRO A 1 136 ? -5.457  -12.167 31.383  1.00 30.68 ? 125  PRO A O   1 
ATOM   739  C  CB  . PRO A 1 136 ? -6.572  -15.032 31.991  1.00 29.99 ? 125  PRO A CB  1 
ATOM   740  C  CG  . PRO A 1 136 ? -7.807  -15.078 32.840  1.00 31.45 ? 125  PRO A CG  1 
ATOM   741  C  CD  . PRO A 1 136 ? -7.872  -13.761 33.550  1.00 29.44 ? 125  PRO A CD  1 
ATOM   742  N  N   . GLU A 1 137 ? -3.755  -13.652 31.256  1.00 30.38 ? 126  GLU A N   1 
ATOM   743  C  CA  . GLU A 1 137 ? -2.942  -12.822 30.410  1.00 31.49 ? 126  GLU A CA  1 
ATOM   744  C  C   . GLU A 1 137 ? -3.600  -12.507 29.042  1.00 30.34 ? 126  GLU A C   1 
ATOM   745  O  O   . GLU A 1 137 ? -3.395  -11.421 28.505  1.00 29.61 ? 126  GLU A O   1 
ATOM   746  C  CB  . GLU A 1 137 ? -1.574  -13.467 30.220  1.00 36.58 ? 126  GLU A CB  1 
ATOM   747  C  CG  . GLU A 1 137 ? -0.507  -12.485 29.746  1.00 43.71 ? 126  GLU A CG  1 
ATOM   748  C  CD  . GLU A 1 137 ? 0.574   -13.151 28.920  1.00 49.76 ? 126  GLU A CD  1 
ATOM   749  O  OE1 . GLU A 1 137 ? 1.154   -14.156 29.393  1.00 51.92 ? 126  GLU A OE1 1 
ATOM   750  O  OE2 . GLU A 1 137 ? 0.839   -12.669 27.796  1.00 54.75 ? 126  GLU A OE2 1 
ATOM   751  N  N   . ASP A 1 138 ? -4.370  -13.443 28.481  1.00 26.43 ? 127  ASP A N   1 
ATOM   752  C  CA  . ASP A 1 138 ? -5.005  -13.199 27.178  1.00 26.44 ? 127  ASP A CA  1 
ATOM   753  C  C   . ASP A 1 138 ? -6.032  -12.079 27.292  1.00 23.99 ? 127  ASP A C   1 
ATOM   754  O  O   . ASP A 1 138 ? -6.156  -11.249 26.401  1.00 23.64 ? 127  ASP A O   1 
ATOM   755  C  CB  . ASP A 1 138 ? -5.669  -14.459 26.618  1.00 27.61 ? 127  ASP A CB  1 
ATOM   756  C  CG  . ASP A 1 138 ? -6.717  -15.043 27.558  1.00 29.89 ? 127  ASP A CG  1 
ATOM   757  O  OD1 . ASP A 1 138 ? -6.301  -15.686 28.550  1.00 31.64 ? 127  ASP A OD1 1 
ATOM   758  O  OD2 . ASP A 1 138 ? -7.942  -14.859 27.319  1.00 28.86 ? 127  ASP A OD2 1 
ATOM   759  N  N   . VAL A 1 139 ? -6.728  -12.059 28.425  1.00 22.59 ? 128  VAL A N   1 
ATOM   760  C  CA  . VAL A 1 139 ? -7.767  -11.082 28.731  1.00 22.34 ? 128  VAL A CA  1 
ATOM   761  C  C   . VAL A 1 139 ? -7.159  -9.679  28.883  1.00 22.43 ? 128  VAL A C   1 
ATOM   762  O  O   . VAL A 1 139 ? -7.724  -8.693  28.384  1.00 21.91 ? 128  VAL A O   1 
ATOM   763  C  CB  . VAL A 1 139 ? -8.549  -11.534 29.988  1.00 22.29 ? 128  VAL A CB  1 
ATOM   764  C  CG1 . VAL A 1 139 ? -9.332  -10.401 30.635  1.00 22.10 ? 128  VAL A CG1 1 
ATOM   765  C  CG2 . VAL A 1 139 ? -9.464  -12.693 29.636  1.00 22.92 ? 128  VAL A CG2 1 
ATOM   766  N  N   . LEU A 1 140 ? -6.004  -9.599  29.554  1.00 22.47 ? 129  LEU A N   1 
ATOM   767  C  CA  . LEU A 1 140 ? -5.280  -8.338  29.697  1.00 23.61 ? 129  LEU A CA  1 
ATOM   768  C  C   . LEU A 1 140 ? -4.766  -7.838  28.351  1.00 24.39 ? 129  LEU A C   1 
ATOM   769  O  O   . LEU A 1 140 ? -4.842  -6.637  28.069  1.00 24.63 ? 129  LEU A O   1 
ATOM   770  C  CB  . LEU A 1 140 ? -4.111  -8.461  30.686  1.00 22.76 ? 129  LEU A CB  1 
ATOM   771  C  CG  . LEU A 1 140 ? -4.509  -8.657  32.154  1.00 23.54 ? 129  LEU A CG  1 
ATOM   772  C  CD1 . LEU A 1 140 ? -3.257  -8.794  33.018  1.00 23.56 ? 129  LEU A CD1 1 
ATOM   773  C  CD2 . LEU A 1 140 ? -5.388  -7.515  32.641  1.00 22.87 ? 129  LEU A CD2 1 
ATOM   774  N  N   . ASP A 1 141 ? -4.221  -8.752  27.542  1.00 23.79 ? 130  ASP A N   1 
ATOM   775  C  CA  . ASP A 1 141 ? -3.799  -8.421  26.183  1.00 24.69 ? 130  ASP A CA  1 
ATOM   776  C  C   . ASP A 1 141 ? -4.921  -7.736  25.439  1.00 22.49 ? 130  ASP A C   1 
ATOM   777  O  O   . ASP A 1 141 ? -4.688  -6.737  24.788  1.00 21.61 ? 130  ASP A O   1 
ATOM   778  C  CB  . ASP A 1 141 ? -3.383  -9.672  25.395  1.00 28.37 ? 130  ASP A CB  1 
ATOM   779  C  CG  . ASP A 1 141 ? -2.019  -10.182 25.799  1.00 32.80 ? 130  ASP A CG  1 
ATOM   780  O  OD1 . ASP A 1 141 ? -1.283  -9.423  26.458  1.00 36.79 ? 130  ASP A OD1 1 
ATOM   781  O  OD2 . ASP A 1 141 ? -1.675  -11.338 25.456  1.00 37.63 ? 130  ASP A OD2 1 
ATOM   782  N  N   . VAL A 1 142 ? -6.128  -8.298  25.536  1.00 20.25 ? 131  VAL A N   1 
ATOM   783  C  CA  . VAL A 1 142 ? -7.292  -7.742  24.855  1.00 19.02 ? 131  VAL A CA  1 
ATOM   784  C  C   . VAL A 1 142 ? -7.683  -6.365  25.412  1.00 19.07 ? 131  VAL A C   1 
ATOM   785  O  O   . VAL A 1 142 ? -7.991  -5.450  24.651  1.00 18.68 ? 131  VAL A O   1 
ATOM   786  C  CB  . VAL A 1 142 ? -8.491  -8.710  24.882  1.00 17.90 ? 131  VAL A CB  1 
ATOM   787  C  CG1 . VAL A 1 142 ? -9.738  -8.032  24.341  1.00 17.99 ? 131  VAL A CG1 1 
ATOM   788  C  CG2 . VAL A 1 142 ? -8.173  -9.954  24.066  1.00 18.11 ? 131  VAL A CG2 1 
ATOM   789  N  N   . GLN A 1 143 ? -7.657  -6.202  26.729  1.00 19.10 ? 132  GLN A N   1 
ATOM   790  C  CA  . GLN A 1 143 ? -8.042  -4.908  27.279  1.00 20.70 ? 132  GLN A CA  1 
ATOM   791  C  C   . GLN A 1 143 ? -7.042  -3.855  26.806  1.00 21.65 ? 132  GLN A C   1 
ATOM   792  O  O   . GLN A 1 143 ? -7.445  -2.782  26.362  1.00 21.30 ? 132  GLN A O   1 
ATOM   793  C  CB  . GLN A 1 143 ? -8.185  -4.944  28.805  1.00 20.72 ? 132  GLN A CB  1 
ATOM   794  C  CG  . GLN A 1 143 ? -9.378  -5.781  29.276  1.00 21.19 ? 132  GLN A CG  1 
ATOM   795  C  CD  . GLN A 1 143 ? -10.726 -5.081  29.127  1.00 21.92 ? 132  GLN A CD  1 
ATOM   796  O  OE1 . GLN A 1 143 ? -10.990 -4.415  28.126  1.00 21.98 ? 132  GLN A OE1 1 
ATOM   797  N  NE2 . GLN A 1 143 ? -11.598 -5.238  30.135  1.00 22.19 ? 132  GLN A NE2 1 
ATOM   798  N  N   . LEU A 1 144 ? -5.748  -4.184  26.847  1.00 21.57 ? 133  LEU A N   1 
ATOM   799  C  CA  . LEU A 1 144 ? -4.714  -3.271  26.341  1.00 21.58 ? 133  LEU A CA  1 
ATOM   800  C  C   . LEU A 1 144 ? -4.851  -3.030  24.855  1.00 20.69 ? 133  LEU A C   1 
ATOM   801  O  O   . LEU A 1 144 ? -4.658  -1.912  24.395  1.00 21.19 ? 133  LEU A O   1 
ATOM   802  C  CB  . LEU A 1 144 ? -3.294  -3.788  26.645  1.00 22.35 ? 133  LEU A CB  1 
ATOM   803  C  CG  . LEU A 1 144 ? -2.638  -3.356  27.953  1.00 22.64 ? 133  LEU A CG  1 
ATOM   804  C  CD1 . LEU A 1 144 ? -2.252  -1.884  27.886  1.00 22.83 ? 133  LEU A CD1 1 
ATOM   805  C  CD2 . LEU A 1 144 ? -3.580  -3.596  29.122  1.00 22.05 ? 133  LEU A CD2 1 
ATOM   806  N  N   . ALA A 1 145 ? -5.187  -4.067  24.096  1.00 20.31 ? 134  ALA A N   1 
ATOM   807  C  CA  . ALA A 1 145 ? -5.292  -3.915  22.643  1.00 19.59 ? 134  ALA A CA  1 
ATOM   808  C  C   . ALA A 1 145 ? -6.370  -2.893  22.293  1.00 19.22 ? 134  ALA A C   1 
ATOM   809  O  O   . ALA A 1 145 ? -6.172  -2.050  21.412  1.00 20.01 ? 134  ALA A O   1 
ATOM   810  C  CB  . ALA A 1 145 ? -5.571  -5.253  21.978  1.00 19.84 ? 134  ALA A CB  1 
ATOM   811  N  N   . PHE A 1 146 ? -7.487  -2.936  23.015  1.00 18.53 ? 135  PHE A N   1 
ATOM   812  C  CA  . PHE A 1 146 ? -8.571  -1.973  22.810  1.00 19.13 ? 135  PHE A CA  1 
ATOM   813  C  C   . PHE A 1 146 ? -8.073  -0.541  23.023  1.00 19.37 ? 135  PHE A C   1 
ATOM   814  O  O   . PHE A 1 146 ? -8.390  0.351   22.246  1.00 20.12 ? 135  PHE A O   1 
ATOM   815  C  CB  . PHE A 1 146 ? -9.798  -2.293  23.706  1.00 17.99 ? 135  PHE A CB  1 
ATOM   816  C  CG  . PHE A 1 146 ? -10.850 -3.153  23.020  1.00 17.81 ? 135  PHE A CG  1 
ATOM   817  C  CD1 . PHE A 1 146 ? -10.744 -4.555  23.030  1.00 17.36 ? 135  PHE A CD1 1 
ATOM   818  C  CD2 . PHE A 1 146 ? -11.919 -2.567  22.331  1.00 16.98 ? 135  PHE A CD2 1 
ATOM   819  C  CE1 . PHE A 1 146 ? -11.688 -5.356  22.390  1.00 16.74 ? 135  PHE A CE1 1 
ATOM   820  C  CE2 . PHE A 1 146 ? -12.860 -3.364  21.677  1.00 16.75 ? 135  PHE A CE2 1 
ATOM   821  C  CZ  . PHE A 1 146 ? -12.754 -4.759  21.720  1.00 17.00 ? 135  PHE A CZ  1 
ATOM   822  N  N   . LEU A 1 147 ? -7.284  -0.334  24.067  1.00 19.65 ? 136  LEU A N   1 
ATOM   823  C  CA  . LEU A 1 147 ? -6.753  0.986   24.358  1.00 20.78 ? 136  LEU A CA  1 
ATOM   824  C  C   . LEU A 1 147 ? -5.689  1.387   23.358  1.00 20.87 ? 136  LEU A C   1 
ATOM   825  O  O   . LEU A 1 147 ? -5.698  2.490   22.889  1.00 22.95 ? 136  LEU A O   1 
ATOM   826  C  CB  . LEU A 1 147 ? -6.186  1.033   25.771  1.00 20.88 ? 136  LEU A CB  1 
ATOM   827  C  CG  . LEU A 1 147 ? -7.235  0.940   26.871  1.00 21.03 ? 136  LEU A CG  1 
ATOM   828  C  CD1 . LEU A 1 147 ? -6.569  0.547   28.177  1.00 21.26 ? 136  LEU A CD1 1 
ATOM   829  C  CD2 . LEU A 1 147 ? -7.997  2.247   27.012  1.00 21.23 ? 136  LEU A CD2 1 
ATOM   830  N  N   . ARG A 1 148 ? -4.788  0.469   23.029  1.00 21.46 ? 137  ARG A N   1 
ATOM   831  C  CA  . ARG A 1 148 ? -3.692  0.714   22.094  1.00 20.77 ? 137  ARG A CA  1 
ATOM   832  C  C   . ARG A 1 148 ? -4.183  0.985   20.663  1.00 22.79 ? 137  ARG A C   1 
ATOM   833  O  O   . ARG A 1 148 ? -3.684  1.881   19.991  1.00 23.53 ? 137  ARG A O   1 
ATOM   834  C  CB  . ARG A 1 148 ? -2.724  -0.481  22.098  1.00 18.68 ? 137  ARG A CB  1 
ATOM   835  C  CG  . ARG A 1 148 ? -1.948  -0.677  23.406  1.00 18.15 ? 137  ARG A CG  1 
ATOM   836  C  CD  . ARG A 1 148 ? -1.271  -2.064  23.498  1.00 17.84 ? 137  ARG A CD  1 
ATOM   837  N  NE  . ARG A 1 148 ? -0.304  -2.220  22.420  1.00 17.99 ? 137  ARG A NE  1 
ATOM   838  C  CZ  . ARG A 1 148 ? -0.391  -3.145  21.469  1.00 18.39 ? 137  ARG A CZ  1 
ATOM   839  N  NH1 . ARG A 1 148 ? -1.359  -4.048  21.510  1.00 19.12 ? 137  ARG A NH1 1 
ATOM   840  N  NH2 . ARG A 1 148 ? 0.503   -3.182  20.494  1.00 17.55 ? 137  ARG A NH2 1 
ATOM   841  N  N   . LEU A 1 149 ? -5.159  0.211   20.205  1.00 22.57 ? 138  LEU A N   1 
ATOM   842  C  CA  . LEU A 1 149 ? -5.679  0.383   18.862  1.00 24.01 ? 138  LEU A CA  1 
ATOM   843  C  C   . LEU A 1 149 ? -6.520  1.664   18.720  1.00 23.72 ? 138  LEU A C   1 
ATOM   844  O  O   . LEU A 1 149 ? -6.466  2.326   17.685  1.00 21.93 ? 138  LEU A O   1 
ATOM   845  C  CB  . LEU A 1 149 ? -6.513  -0.849  18.435  1.00 25.93 ? 138  LEU A CB  1 
ATOM   846  C  CG  . LEU A 1 149 ? -6.900  -0.883  16.947  1.00 29.54 ? 138  LEU A CG  1 
ATOM   847  C  CD1 . LEU A 1 149 ? -5.635  -1.028  16.087  1.00 29.72 ? 138  LEU A CD1 1 
ATOM   848  C  CD2 . LEU A 1 149 ? -7.915  -1.984  16.630  1.00 28.25 ? 138  LEU A CD2 1 
ATOM   849  N  N   . LEU A 1 150 ? -7.276  2.015   19.759  1.00 23.29 ? 139  LEU A N   1 
ATOM   850  C  CA  . LEU A 1 150 ? -8.405  2.939   19.580  1.00 23.89 ? 139  LEU A CA  1 
ATOM   851  C  C   . LEU A 1 150 ? -8.353  4.239   20.415  1.00 24.63 ? 139  LEU A C   1 
ATOM   852  O  O   . LEU A 1 150 ? -9.356  4.972   20.489  1.00 25.50 ? 139  LEU A O   1 
ATOM   853  C  CB  . LEU A 1 150 ? -9.732  2.168   19.800  1.00 22.64 ? 139  LEU A CB  1 
ATOM   854  C  CG  . LEU A 1 150 ? -9.960  1.000   18.827  1.00 21.78 ? 139  LEU A CG  1 
ATOM   855  C  CD1 . LEU A 1 150 ? -10.857 -0.069  19.441  1.00 22.25 ? 139  LEU A CD1 1 
ATOM   856  C  CD2 . LEU A 1 150 ? -10.513 1.485   17.486  1.00 20.90 ? 139  LEU A CD2 1 
ATOM   857  N  N   . SER A 1 151 ? -7.201  4.522   21.033  1.00 23.63 ? 140  SER A N   1 
ATOM   858  C  CA  . SER A 1 151 ? -6.989  5.806   21.735  1.00 23.35 ? 140  SER A CA  1 
ATOM   859  C  C   . SER A 1 151 ? -6.490  6.849   20.729  1.00 23.62 ? 140  SER A C   1 
ATOM   860  O  O   . SER A 1 151 ? -5.945  6.482   19.695  1.00 23.12 ? 140  SER A O   1 
ATOM   861  C  CB  . SER A 1 151 ? -5.968  5.629   22.859  1.00 23.00 ? 140  SER A CB  1 
ATOM   862  O  OG  . SER A 1 151 ? -6.499  4.817   23.908  1.00 21.55 ? 140  SER A OG  1 
ATOM   863  N  N   . SER A 1 152 ? -6.662  8.139   21.000  1.00 23.44 ? 141  SER A N   1 
ATOM   864  C  CA  . SER A 1 152 ? -6.038  9.139   20.122  1.00 24.09 ? 141  SER A CA  1 
ATOM   865  C  C   . SER A 1 152 ? -4.544  9.204   20.320  1.00 24.32 ? 141  SER A C   1 
ATOM   866  O  O   . SER A 1 152 ? -3.833  9.517   19.380  1.00 25.00 ? 141  SER A O   1 
ATOM   867  C  CB  . SER A 1 152 ? -6.633  10.537  20.307  1.00 25.11 ? 141  SER A CB  1 
ATOM   868  O  OG  . SER A 1 152 ? -6.812  10.831  21.671  1.00 27.44 ? 141  SER A OG  1 
ATOM   869  N  N   . ARG A 1 153 ? -4.086  8.972   21.533  1.00 23.71 ? 142  ARG A N   1 
ATOM   870  C  CA  . ARG A 1 153 ? -2.677  9.060   21.886  1.00 25.07 ? 142  ARG A CA  1 
ATOM   871  C  C   . ARG A 1 153 ? -2.320  8.334   23.184  1.00 22.11 ? 142  ARG A C   1 
ATOM   872  O  O   . ARG A 1 153 ? -3.180  7.886   23.891  1.00 20.95 ? 142  ARG A O   1 
ATOM   873  C  CB  . ARG A 1 153 ? -2.176  10.502  21.873  1.00 29.70 ? 142  ARG A CB  1 
ATOM   874  C  CG  . ARG A 1 153 ? -2.790  11.409  22.905  1.00 38.67 ? 142  ARG A CG  1 
ATOM   875  C  CD  . ARG A 1 153 ? -2.895  12.845  22.418  1.00 46.81 ? 142  ARG A CD  1 
ATOM   876  N  NE  . ARG A 1 153 ? -3.840  13.009  21.304  1.00 51.33 ? 142  ARG A NE  1 
ATOM   877  C  CZ  . ARG A 1 153 ? -4.663  14.041  21.152  1.00 50.93 ? 142  ARG A CZ  1 
ATOM   878  N  NH1 . ARG A 1 153 ? -4.668  15.025  22.024  1.00 49.94 ? 142  ARG A NH1 1 
ATOM   879  N  NH2 . ARG A 1 153 ? -5.472  14.102  20.123  1.00 54.85 ? 142  ARG A NH2 1 
ATOM   880  N  N   . ALA A 1 154 ? -1.039  8.183   23.452  1.00 20.94 ? 143  ALA A N   1 
ATOM   881  C  CA  . ALA A 1 154 ? -0.554  7.499   24.660  1.00 20.33 ? 143  ALA A CA  1 
ATOM   882  C  C   . ALA A 1 154 ? 0.810   8.036   25.078  1.00 19.35 ? 143  ALA A C   1 
ATOM   883  O  O   . ALA A 1 154 ? 1.555   8.590   24.260  1.00 18.49 ? 143  ALA A O   1 
ATOM   884  C  CB  . ALA A 1 154 ? -0.475  5.994   24.442  1.00 19.72 ? 143  ALA A CB  1 
ATOM   885  N  N   . SER A 1 155 ? 1.148   7.853   26.346  1.00 18.41 ? 144  SER A N   1 
ATOM   886  C  CA  . SER A 1 155 ? 2.450   8.271   26.825  1.00 18.96 ? 144  SER A CA  1 
ATOM   887  C  C   . SER A 1 155 ? 2.822   7.418   27.999  1.00 18.29 ? 144  SER A C   1 
ATOM   888  O  O   . SER A 1 155 ? 1.963   6.842   28.671  1.00 17.74 ? 144  SER A O   1 
ATOM   889  C  CB  . SER A 1 155 ? 2.456   9.751   27.248  1.00 19.51 ? 144  SER A CB  1 
ATOM   890  O  OG  . SER A 1 155 ? 1.548   9.937   28.328  1.00 21.42 ? 144  SER A OG  1 
ATOM   891  N  N   . GLN A 1 156 ? 4.118   7.362   28.252  1.00 17.97 ? 145  GLN A N   1 
ATOM   892  C  CA  . GLN A 1 156 ? 4.632   6.654   29.395  1.00 18.49 ? 145  GLN A CA  1 
ATOM   893  C  C   . GLN A 1 156 ? 5.948   7.224   29.784  1.00 18.48 ? 145  GLN A C   1 
ATOM   894  O  O   . GLN A 1 156 ? 6.771   7.562   28.908  1.00 18.06 ? 145  GLN A O   1 
ATOM   895  C  CB  . GLN A 1 156 ? 4.827   5.175   29.090  1.00 17.53 ? 145  GLN A CB  1 
ATOM   896  C  CG  . GLN A 1 156 ? 4.934   4.354   30.354  1.00 17.25 ? 145  GLN A CG  1 
ATOM   897  C  CD  . GLN A 1 156 ? 4.982   2.868   30.050  1.00 17.52 ? 145  GLN A CD  1 
ATOM   898  O  OE1 . GLN A 1 156 ? 4.811   2.445   28.891  1.00 15.75 ? 145  GLN A OE1 1 
ATOM   899  N  NE2 . GLN A 1 156 ? 5.225   2.070   31.086  1.00 16.64 ? 145  GLN A NE2 1 
ATOM   900  N  N   . GLN A 1 157 ? 6.138   7.332   31.095  1.00 19.19 ? 146  GLN A N   1 
ATOM   901  C  CA  . GLN A 1 157 ? 7.436   7.719   31.653  1.00 22.04 ? 146  GLN A CA  1 
ATOM   902  C  C   . GLN A 1 157 ? 8.124   6.547   32.298  1.00 21.36 ? 146  GLN A C   1 
ATOM   903  O  O   . GLN A 1 157 ? 7.472   5.715   32.909  1.00 20.81 ? 146  GLN A O   1 
ATOM   904  C  CB  . GLN A 1 157 ? 7.271   8.806   32.696  1.00 22.05 ? 146  GLN A CB  1 
ATOM   905  C  CG  . GLN A 1 157 ? 7.100   10.169  32.086  1.00 24.38 ? 146  GLN A CG  1 
ATOM   906  C  CD  . GLN A 1 157 ? 6.779   11.201  33.138  1.00 26.21 ? 146  GLN A CD  1 
ATOM   907  O  OE1 . GLN A 1 157 ? 7.318   11.167  34.259  1.00 26.11 ? 146  GLN A OE1 1 
ATOM   908  N  NE2 . GLN A 1 157 ? 5.890   12.111  32.794  1.00 25.62 ? 146  GLN A NE2 1 
ATOM   909  N  N   . ILE A 1 158 ? 9.444   6.511   32.159  1.00 22.65 ? 147  ILE A N   1 
ATOM   910  C  CA  . ILE A 1 158 ? 10.304  5.573   32.885  1.00 23.42 ? 147  ILE A CA  1 
ATOM   911  C  C   . ILE A 1 158 ? 11.370  6.378   33.593  1.00 23.30 ? 147  ILE A C   1 
ATOM   912  O  O   . ILE A 1 158 ? 11.938  7.294   33.002  1.00 24.07 ? 147  ILE A O   1 
ATOM   913  C  CB  . ILE A 1 158 ? 11.021  4.606   31.914  1.00 24.82 ? 147  ILE A CB  1 
ATOM   914  C  CG1 . ILE A 1 158 ? 10.014  3.908   31.017  1.00 26.38 ? 147  ILE A CG1 1 
ATOM   915  C  CG2 . ILE A 1 158 ? 11.828  3.559   32.682  1.00 25.46 ? 147  ILE A CG2 1 
ATOM   916  C  CD1 . ILE A 1 158 ? 9.105   2.922   31.730  1.00 26.73 ? 147  ILE A CD1 1 
ATOM   917  N  N   . THR A 1 159 ? 11.654  6.032   34.846  1.00 23.35 ? 148  THR A N   1 
ATOM   918  C  CA  . THR A 1 159 ? 12.739  6.656   35.606  1.00 23.81 ? 148  THR A CA  1 
ATOM   919  C  C   . THR A 1 159 ? 13.844  5.609   35.797  1.00 24.79 ? 148  THR A C   1 
ATOM   920  O  O   . THR A 1 159 ? 13.586  4.511   36.276  1.00 23.95 ? 148  THR A O   1 
ATOM   921  C  CB  . THR A 1 159 ? 12.254  7.161   36.988  1.00 23.86 ? 148  THR A CB  1 
ATOM   922  O  OG1 . THR A 1 159 ? 11.226  8.131   36.808  1.00 24.14 ? 148  THR A OG1 1 
ATOM   923  C  CG2 . THR A 1 159 ? 13.381  7.800   37.782  1.00 23.21 ? 148  THR A CG2 1 
ATOM   924  N  N   . TYR A 1 160 ? 15.056  5.951   35.377  1.00 25.48 ? 149  TYR A N   1 
ATOM   925  C  CA  . TYR A 1 160 ? 16.236  5.125   35.587  1.00 27.15 ? 149  TYR A CA  1 
ATOM   926  C  C   . TYR A 1 160 ? 17.012  5.709   36.770  1.00 28.14 ? 149  TYR A C   1 
ATOM   927  O  O   . TYR A 1 160 ? 17.486  6.856   36.714  1.00 28.21 ? 149  TYR A O   1 
ATOM   928  C  CB  . TYR A 1 160 ? 17.074  5.153   34.317  1.00 28.66 ? 149  TYR A CB  1 
ATOM   929  C  CG  . TYR A 1 160 ? 18.351  4.343   34.314  1.00 29.04 ? 149  TYR A CG  1 
ATOM   930  C  CD1 . TYR A 1 160 ? 18.331  2.976   34.031  1.00 30.91 ? 149  TYR A CD1 1 
ATOM   931  C  CD2 . TYR A 1 160 ? 19.586  4.950   34.544  1.00 29.44 ? 149  TYR A CD2 1 
ATOM   932  C  CE1 . TYR A 1 160 ? 19.505  2.228   33.994  1.00 30.68 ? 149  TYR A CE1 1 
ATOM   933  C  CE2 . TYR A 1 160 ? 20.766  4.218   34.507  1.00 30.06 ? 149  TYR A CE2 1 
ATOM   934  C  CZ  . TYR A 1 160 ? 20.716  2.855   34.236  1.00 31.27 ? 149  TYR A CZ  1 
ATOM   935  O  OH  . TYR A 1 160 ? 21.869  2.117   34.197  1.00 31.86 ? 149  TYR A OH  1 
ATOM   936  N  N   . HIS A 1 161 ? 17.102  4.945   37.856  1.00 28.38 ? 150  HIS A N   1 
ATOM   937  C  CA  . HIS A 1 161 ? 17.922  5.339   39.015  1.00 28.83 ? 150  HIS A CA  1 
ATOM   938  C  C   . HIS A 1 161 ? 19.320  4.838   38.787  1.00 29.09 ? 150  HIS A C   1 
ATOM   939  O  O   . HIS A 1 161 ? 19.514  3.684   38.433  1.00 29.52 ? 150  HIS A O   1 
ATOM   940  C  CB  . HIS A 1 161 ? 17.362  4.778   40.314  1.00 27.57 ? 150  HIS A CB  1 
ATOM   941  C  CG  . HIS A 1 161 ? 16.014  5.335   40.694  1.00 28.00 ? 150  HIS A CG  1 
ATOM   942  N  ND1 . HIS A 1 161 ? 15.870  6.485   41.404  1.00 29.61 ? 150  HIS A ND1 1 
ATOM   943  C  CD2 . HIS A 1 161 ? 14.727  4.845   40.481  1.00 27.22 ? 150  HIS A CD2 1 
ATOM   944  C  CE1 . HIS A 1 161 ? 14.565  6.730   41.609  1.00 26.91 ? 150  HIS A CE1 1 
ATOM   945  N  NE2 . HIS A 1 161 ? 13.864  5.726   41.050  1.00 28.35 ? 150  HIS A NE2 1 
ATOM   946  N  N   . CYS A 1 162 ? 20.306  5.706   38.982  1.00 30.70 ? 151  CYS A N   1 
ATOM   947  C  CA  . CYS A 1 162 ? 21.685  5.433   38.563  1.00 30.61 ? 151  CYS A CA  1 
ATOM   948  C  C   . CYS A 1 162 ? 22.714  5.702   39.663  1.00 31.30 ? 151  CYS A C   1 
ATOM   949  O  O   . CYS A 1 162 ? 22.644  6.709   40.391  1.00 29.22 ? 151  CYS A O   1 
ATOM   950  C  CB  . CYS A 1 162 ? 22.044  6.311   37.362  1.00 27.85 ? 151  CYS A CB  1 
ATOM   951  S  SG  . CYS A 1 162 ? 21.858  8.076   37.725  1.00 27.71 ? 151  CYS A SG  1 
ATOM   952  N  N   . LYS A 1 163 ? 23.665  4.784   39.760  1.00 35.54 ? 152  LYS A N   1 
ATOM   953  C  CA  . LYS A 1 163 ? 24.879  4.973   40.541  1.00 37.13 ? 152  LYS A CA  1 
ATOM   954  C  C   . LYS A 1 163 ? 26.027  4.549   39.639  1.00 36.31 ? 152  LYS A C   1 
ATOM   955  O  O   . LYS A 1 163 ? 26.098  3.390   39.218  1.00 34.07 ? 152  LYS A O   1 
ATOM   956  C  CB  . LYS A 1 163 ? 24.846  4.125   41.812  1.00 42.49 ? 152  LYS A CB  1 
ATOM   957  C  CG  . LYS A 1 163 ? 26.071  4.306   42.713  1.00 47.76 ? 152  LYS A CG  1 
ATOM   958  C  CD  . LYS A 1 163 ? 26.184  3.177   43.728  1.00 49.18 ? 152  LYS A CD  1 
ATOM   959  C  CE  . LYS A 1 163 ? 27.408  3.351   44.607  1.00 52.43 ? 152  LYS A CE  1 
ATOM   960  N  NZ  . LYS A 1 163 ? 27.503  2.275   45.631  1.00 56.96 ? 152  LYS A NZ  1 
ATOM   961  N  N   . ASN A 1 164 ? 26.899  5.506   39.327  1.00 35.42 ? 153  ASN A N   1 
ATOM   962  C  CA  . ASN A 1 164 ? 28.004  5.316   38.383  1.00 35.87 ? 153  ASN A CA  1 
ATOM   963  C  C   . ASN A 1 164 ? 27.577  4.752   37.035  1.00 34.91 ? 153  ASN A C   1 
ATOM   964  O  O   . ASN A 1 164 ? 28.266  3.895   36.465  1.00 37.15 ? 153  ASN A O   1 
ATOM   965  C  CB  . ASN A 1 164 ? 29.142  4.478   39.001  1.00 37.99 ? 153  ASN A CB  1 
ATOM   966  C  CG  . ASN A 1 164 ? 29.698  5.090   40.282  1.00 40.64 ? 153  ASN A CG  1 
ATOM   967  O  OD1 . ASN A 1 164 ? 29.822  4.416   41.308  1.00 43.50 ? 153  ASN A OD1 1 
ATOM   968  N  ND2 . ASN A 1 164 ? 30.021  6.368   40.233  1.00 43.76 ? 153  ASN A ND2 1 
ATOM   969  N  N   . SER A 1 165 ? 26.449  5.234   36.512  1.00 32.94 ? 154  SER A N   1 
ATOM   970  C  CA  . SER A 1 165 ? 25.947  4.732   35.237  1.00 30.25 ? 154  SER A CA  1 
ATOM   971  C  C   . SER A 1 165 ? 25.281  5.833   34.421  1.00 31.77 ? 154  SER A C   1 
ATOM   972  O  O   . SER A 1 165 ? 24.253  6.374   34.828  1.00 31.97 ? 154  SER A O   1 
ATOM   973  C  CB  . SER A 1 165 ? 24.947  3.600   35.487  1.00 29.65 ? 154  SER A CB  1 
ATOM   974  O  OG  . SER A 1 165 ? 24.421  3.082   34.278  1.00 28.55 ? 154  SER A OG  1 
ATOM   975  N  N   . ILE A 1 166 ? 25.860  6.149   33.268  1.00 30.52 ? 155  ILE A N   1 
ATOM   976  C  CA  . ILE A 1 166 ? 25.242  7.085   32.323  1.00 30.65 ? 155  ILE A CA  1 
ATOM   977  C  C   . ILE A 1 166 ? 23.912  6.513   31.837  1.00 29.93 ? 155  ILE A C   1 
ATOM   978  O  O   . ILE A 1 166 ? 23.830  5.320   31.496  1.00 29.99 ? 155  ILE A O   1 
ATOM   979  C  CB  . ILE A 1 166 ? 26.131  7.323   31.075  1.00 29.26 ? 155  ILE A CB  1 
ATOM   980  C  CG1 . ILE A 1 166 ? 27.557  7.754   31.461  1.00 30.80 ? 155  ILE A CG1 1 
ATOM   981  C  CG2 . ILE A 1 166 ? 25.476  8.295   30.108  1.00 28.70 ? 155  ILE A CG2 1 
ATOM   982  C  CD1 . ILE A 1 166 ? 27.650  8.803   32.543  1.00 31.04 ? 155  ILE A CD1 1 
ATOM   983  N  N   . ALA A 1 167 ? 22.889  7.367   31.787  1.00 27.72 ? 156  ALA A N   1 
ATOM   984  C  CA  . ALA A 1 167 ? 21.567  6.996   31.257  1.00 24.71 ? 156  ALA A CA  1 
ATOM   985  C  C   . ALA A 1 167 ? 21.287  7.617   29.912  1.00 24.06 ? 156  ALA A C   1 
ATOM   986  O  O   . ALA A 1 167 ? 20.673  7.002   29.043  1.00 25.32 ? 156  ALA A O   1 
ATOM   987  C  CB  . ALA A 1 167 ? 20.484  7.419   32.238  1.00 23.50 ? 156  ALA A CB  1 
ATOM   988  N  N   . TYR A 1 168 ? 21.698  8.864   29.732  1.00 24.66 ? 157  TYR A N   1 
ATOM   989  C  CA  . TYR A 1 168 ? 21.414  9.547   28.479  1.00 25.38 ? 157  TYR A CA  1 
ATOM   990  C  C   . TYR A 1 168 ? 22.653  10.271  27.990  1.00 26.69 ? 157  TYR A C   1 
ATOM   991  O  O   . TYR A 1 168 ? 23.350  9.768   27.133  1.00 27.87 ? 157  TYR A O   1 
ATOM   992  C  CB  . TYR A 1 168 ? 20.219  10.494  28.630  1.00 22.87 ? 157  TYR A CB  1 
ATOM   993  C  CG  . TYR A 1 168 ? 19.912  11.350  27.403  1.00 23.23 ? 157  TYR A CG  1 
ATOM   994  C  CD1 . TYR A 1 168 ? 19.460  10.777  26.208  1.00 22.20 ? 157  TYR A CD1 1 
ATOM   995  C  CD2 . TYR A 1 168 ? 20.033  12.745  27.462  1.00 22.66 ? 157  TYR A CD2 1 
ATOM   996  C  CE1 . TYR A 1 168 ? 19.164  11.567  25.103  1.00 22.88 ? 157  TYR A CE1 1 
ATOM   997  C  CE2 . TYR A 1 168 ? 19.722  13.540  26.376  1.00 22.52 ? 157  TYR A CE2 1 
ATOM   998  C  CZ  . TYR A 1 168 ? 19.295  12.952  25.202  1.00 22.79 ? 157  TYR A CZ  1 
ATOM   999  O  OH  . TYR A 1 168 ? 19.013  13.761  24.145  1.00 21.41 ? 157  TYR A OH  1 
HETATM 1000 N  N   . MSE A 1 169 ? 22.931  11.434  28.572  1.00 28.52 ? 158  MSE A N   1 
HETATM 1001 C  CA  . MSE A 1 169 ? 24.092  12.228  28.223  1.00 31.08 ? 158  MSE A CA  1 
HETATM 1002 C  C   . MSE A 1 169 ? 25.292  11.829  29.059  1.00 30.13 ? 158  MSE A C   1 
HETATM 1003 O  O   . MSE A 1 169 ? 25.181  11.625  30.270  1.00 27.12 ? 158  MSE A O   1 
HETATM 1004 C  CB  . MSE A 1 169 ? 23.663  13.664  28.524  1.00 30.95 ? 158  MSE A CB  1 
HETATM 1005 C  CG  . MSE A 1 169 ? 24.790  14.675  28.455  1.00 38.01 ? 158  MSE A CG  1 
HETATM 1006 SE SE  . MSE A 1 169 ? 25.108  15.044  26.549  1.00 47.08 ? 158  MSE A SE  1 
HETATM 1007 C  CE  . MSE A 1 169 ? 23.837  16.551  26.430  1.00 42.32 ? 158  MSE A CE  1 
ATOM   1008 N  N   . ASP A 1 170 ? 26.444  11.724  28.407  1.00 31.42 ? 159  ASP A N   1 
ATOM   1009 C  CA  . ASP A 1 170 ? 27.733  11.539  29.084  1.00 33.90 ? 159  ASP A CA  1 
ATOM   1010 C  C   . ASP A 1 170 ? 28.355  12.932  29.191  1.00 35.33 ? 159  ASP A C   1 
ATOM   1011 O  O   . ASP A 1 170 ? 28.687  13.525  28.166  1.00 35.40 ? 159  ASP A O   1 
ATOM   1012 C  CB  . ASP A 1 170 ? 28.627  10.619  28.236  1.00 36.42 ? 159  ASP A CB  1 
ATOM   1013 C  CG  . ASP A 1 170 ? 29.978  10.268  28.910  1.00 37.37 ? 159  ASP A CG  1 
ATOM   1014 O  OD1 . ASP A 1 170 ? 30.667  11.139  29.489  1.00 39.05 ? 159  ASP A OD1 1 
ATOM   1015 O  OD2 . ASP A 1 170 ? 30.363  9.090   28.827  1.00 39.80 ? 159  ASP A OD2 1 
ATOM   1016 N  N   A GLN A 1 171 ? 28.492  13.472  30.390  0.50 37.38 ? 160  GLN A N   1 
ATOM   1017 N  N   B GLN A 1 171 ? 28.517  13.487  30.380  0.50 37.38 ? 160  GLN A N   1 
ATOM   1018 C  CA  A GLN A 1 171 ? 29.004  14.832  30.522  0.50 42.11 ? 160  GLN A CA  1 
ATOM   1019 C  CA  B GLN A 1 171 ? 29.021  14.840  30.535  0.50 42.11 ? 160  GLN A CA  1 
ATOM   1020 C  C   A GLN A 1 171 ? 30.437  14.998  30.025  0.50 44.21 ? 160  GLN A C   1 
ATOM   1021 C  C   B GLN A 1 171 ? 30.449  15.009  30.032  0.50 44.21 ? 160  GLN A C   1 
ATOM   1022 O  O   A GLN A 1 171 ? 30.755  15.999  29.402  0.50 44.22 ? 160  GLN A O   1 
ATOM   1023 O  O   B GLN A 1 171 ? 30.756  15.985  29.366  0.50 44.22 ? 160  GLN A O   1 
ATOM   1024 C  CB  A GLN A 1 171 ? 28.848  15.368  31.943  0.50 46.01 ? 160  GLN A CB  1 
ATOM   1025 C  CB  B GLN A 1 171 ? 28.920  15.279  31.989  0.50 46.01 ? 160  GLN A CB  1 
ATOM   1026 C  CG  A GLN A 1 171 ? 28.477  16.843  32.019  0.50 49.72 ? 160  GLN A CG  1 
ATOM   1027 C  CG  B GLN A 1 171 ? 29.157  16.753  32.205  0.50 49.72 ? 160  GLN A CG  1 
ATOM   1028 C  CD  A GLN A 1 171 ? 27.147  17.182  31.340  0.50 57.36 ? 160  GLN A CD  1 
ATOM   1029 C  CD  B GLN A 1 171 ? 30.282  17.013  33.177  0.50 57.36 ? 160  GLN A CD  1 
ATOM   1030 O  OE1 A GLN A 1 171 ? 26.085  16.703  31.738  0.50 61.87 ? 160  GLN A OE1 1 
ATOM   1031 O  OE1 B GLN A 1 171 ? 30.064  17.515  34.274  0.50 61.87 ? 160  GLN A OE1 1 
ATOM   1032 N  NE2 A GLN A 1 171 ? 27.208  18.028  30.316  0.50 57.99 ? 160  GLN A NE2 1 
ATOM   1033 N  NE2 B GLN A 1 171 ? 31.495  16.672  32.775  0.50 57.99 ? 160  GLN A NE2 1 
ATOM   1034 N  N   . ALA A 1 172 ? 31.294  14.021  30.295  1.00 42.71 ? 161  ALA A N   1 
ATOM   1035 C  CA  . ALA A 1 172 ? 32.683  14.111  29.874  1.00 44.81 ? 161  ALA A CA  1 
ATOM   1036 C  C   . ALA A 1 172 ? 32.885  14.169  28.365  1.00 43.74 ? 161  ALA A C   1 
ATOM   1037 O  O   . ALA A 1 172 ? 33.659  14.973  27.880  1.00 46.68 ? 161  ALA A O   1 
ATOM   1038 C  CB  . ALA A 1 172 ? 33.477  12.962  30.457  1.00 44.23 ? 161  ALA A CB  1 
ATOM   1039 N  N   . SER A 1 173 ? 32.174  13.339  27.623  1.00 42.24 ? 162  SER A N   1 
ATOM   1040 C  CA  . SER A 1 173 ? 32.255  13.370  26.155  1.00 39.22 ? 162  SER A CA  1 
ATOM   1041 C  C   . SER A 1 173 ? 31.330  14.408  25.531  1.00 37.42 ? 162  SER A C   1 
ATOM   1042 O  O   . SER A 1 173 ? 31.627  14.945  24.474  1.00 38.34 ? 162  SER A O   1 
ATOM   1043 C  CB  . SER A 1 173 ? 31.932  12.002  25.565  1.00 39.94 ? 162  SER A CB  1 
ATOM   1044 O  OG  . SER A 1 173 ? 30.539  11.736  25.674  1.00 44.77 ? 162  SER A OG  1 
ATOM   1045 N  N   . GLY A 1 174 ? 30.196  14.665  26.171  1.00 35.06 ? 163  GLY A N   1 
ATOM   1046 C  CA  . GLY A 1 174 ? 29.197  15.580  25.617  1.00 33.80 ? 163  GLY A CA  1 
ATOM   1047 C  C   . GLY A 1 174 ? 28.293  14.933  24.574  1.00 33.31 ? 163  GLY A C   1 
ATOM   1048 O  O   . GLY A 1 174 ? 27.697  15.619  23.744  1.00 34.24 ? 163  GLY A O   1 
ATOM   1049 N  N   . ASN A 1 175 ? 28.180  13.612  24.603  1.00 29.74 ? 164  ASN A N   1 
ATOM   1050 C  CA  . ASN A 1 175 ? 27.286  12.934  23.679  1.00 29.60 ? 164  ASN A CA  1 
ATOM   1051 C  C   . ASN A 1 175 ? 26.305  11.960  24.339  1.00 27.78 ? 164  ASN A C   1 
ATOM   1052 O  O   . ASN A 1 175 ? 26.393  11.675  25.529  1.00 28.47 ? 164  ASN A O   1 
ATOM   1053 C  CB  . ASN A 1 175 ? 28.085  12.240  22.559  1.00 28.42 ? 164  ASN A CB  1 
ATOM   1054 C  CG  . ASN A 1 175 ? 28.908  11.058  23.059  1.00 29.24 ? 164  ASN A CG  1 
ATOM   1055 O  OD1 . ASN A 1 175 ? 28.437  10.242  23.855  1.00 29.32 ? 164  ASN A OD1 1 
ATOM   1056 N  ND2 . ASN A 1 175 ? 30.146  10.960  22.583  1.00 29.06 ? 164  ASN A ND2 1 
ATOM   1057 N  N   . VAL A 1 176 ? 25.400  11.427  23.530  1.00 28.05 ? 165  VAL A N   1 
ATOM   1058 C  CA  . VAL A 1 176 ? 24.399  10.475  23.993  1.00 27.83 ? 165  VAL A CA  1 
ATOM   1059 C  C   . VAL A 1 176 ? 24.592  9.057   23.404  1.00 29.74 ? 165  VAL A C   1 
ATOM   1060 O  O   . VAL A 1 176 ? 23.639  8.255   23.355  1.00 27.61 ? 165  VAL A O   1 
ATOM   1061 C  CB  . VAL A 1 176 ? 22.979  10.995  23.681  1.00 26.75 ? 165  VAL A CB  1 
ATOM   1062 C  CG1 . VAL A 1 176 ? 22.716  12.312  24.413  1.00 25.04 ? 165  VAL A CG1 1 
ATOM   1063 C  CG2 . VAL A 1 176 ? 22.769  11.138  22.172  1.00 24.71 ? 165  VAL A CG2 1 
ATOM   1064 N  N   . LYS A 1 177 ? 25.824  8.742   22.985  1.00 30.63 ? 166  LYS A N   1 
ATOM   1065 C  CA  . LYS A 1 177 ? 26.147  7.416   22.432  1.00 32.12 ? 166  LYS A CA  1 
ATOM   1066 C  C   . LYS A 1 177 ? 25.979  6.283   23.454  1.00 33.40 ? 166  LYS A C   1 
ATOM   1067 O  O   . LYS A 1 177 ? 25.692  5.155   23.077  1.00 34.96 ? 166  LYS A O   1 
ATOM   1068 C  CB  . LYS A 1 177 ? 27.561  7.392   21.823  1.00 33.99 ? 166  LYS A CB  1 
ATOM   1069 C  CG  . LYS A 1 177 ? 27.668  8.154   20.505  1.00 34.87 ? 166  LYS A CG  1 
ATOM   1070 N  N   . LYS A 1 178 ? 26.135  6.599   24.740  1.00 33.89 ? 167  LYS A N   1 
ATOM   1071 C  CA  . LYS A 1 178 ? 25.939  5.634   25.827  1.00 34.89 ? 167  LYS A CA  1 
ATOM   1072 C  C   . LYS A 1 178 ? 24.505  5.586   26.390  1.00 33.75 ? 167  LYS A C   1 
ATOM   1073 O  O   . LYS A 1 178 ? 24.257  4.945   27.416  1.00 32.41 ? 167  LYS A O   1 
ATOM   1074 C  CB  . LYS A 1 178 ? 26.932  5.920   26.964  1.00 37.60 ? 167  LYS A CB  1 
ATOM   1075 C  CG  . LYS A 1 178 ? 28.398  5.747   26.571  1.00 39.87 ? 167  LYS A CG  1 
ATOM   1076 C  CD  . LYS A 1 178 ? 29.315  6.016   27.755  1.00 41.55 ? 167  LYS A CD  1 
ATOM   1077 C  CE  . LYS A 1 178 ? 30.776  5.950   27.336  1.00 43.02 ? 167  LYS A CE  1 
ATOM   1078 N  NZ  . LYS A 1 178 ? 31.647  6.429   28.442  1.00 44.86 ? 167  LYS A NZ  1 
ATOM   1079 N  N   . ALA A 1 179 ? 23.576  6.261   25.712  1.00 31.99 ? 168  ALA A N   1 
ATOM   1080 C  CA  . ALA A 1 179 ? 22.181  6.361   26.156  1.00 29.52 ? 168  ALA A CA  1 
ATOM   1081 C  C   . ALA A 1 179 ? 21.472  5.018   26.107  1.00 29.47 ? 168  ALA A C   1 
ATOM   1082 O  O   . ALA A 1 179 ? 21.564  4.298   25.114  1.00 27.24 ? 168  ALA A O   1 
ATOM   1083 C  CB  . ALA A 1 179 ? 21.423  7.377   25.306  1.00 29.14 ? 168  ALA A CB  1 
ATOM   1084 N  N   . LEU A 1 180 ? 20.741  4.697   27.175  1.00 27.84 ? 169  LEU A N   1 
ATOM   1085 C  CA  . LEU A 1 180 ? 19.916  3.492   27.201  1.00 25.96 ? 169  LEU A CA  1 
ATOM   1086 C  C   . LEU A 1 180 ? 18.829  3.471   26.118  1.00 26.34 ? 169  LEU A C   1 
ATOM   1087 O  O   . LEU A 1 180 ? 18.587  4.467   25.447  1.00 26.73 ? 169  LEU A O   1 
ATOM   1088 C  CB  . LEU A 1 180 ? 19.318  3.296   28.589  1.00 26.61 ? 169  LEU A CB  1 
ATOM   1089 C  CG  . LEU A 1 180 ? 18.372  4.344   29.172  1.00 25.99 ? 169  LEU A CG  1 
ATOM   1090 C  CD1 . LEU A 1 180 ? 16.967  4.193   28.601  1.00 25.00 ? 169  LEU A CD1 1 
ATOM   1091 C  CD2 . LEU A 1 180 ? 18.343  4.180   30.676  1.00 27.56 ? 169  LEU A CD2 1 
ATOM   1092 N  N   . LYS A 1 181 ? 18.208  2.310   25.939  1.00 27.11 ? 170  LYS A N   1 
ATOM   1093 C  CA  . LYS A 1 181 ? 17.185  2.078   24.933  1.00 27.45 ? 170  LYS A CA  1 
ATOM   1094 C  C   . LYS A 1 181 ? 15.954  1.534   25.639  1.00 27.78 ? 170  LYS A C   1 
ATOM   1095 O  O   . LYS A 1 181 ? 16.066  0.937   26.714  1.00 26.95 ? 170  LYS A O   1 
ATOM   1096 C  CB  . LYS A 1 181 ? 17.646  1.000   23.956  1.00 30.63 ? 170  LYS A CB  1 
ATOM   1097 C  CG  . LYS A 1 181 ? 18.672  1.444   22.922  1.00 35.94 ? 170  LYS A CG  1 
ATOM   1098 C  CD  . LYS A 1 181 ? 18.661  0.546   21.680  1.00 36.03 ? 170  LYS A CD  1 
ATOM   1099 C  CE  . LYS A 1 181 ? 19.362  -0.797  21.889  1.00 36.77 ? 170  LYS A CE  1 
ATOM   1100 N  NZ  . LYS A 1 181 ? 19.194  -1.595  20.643  1.00 36.43 ? 170  LYS A NZ  1 
ATOM   1101 N  N   . LEU A 1 182 ? 14.787  1.715   25.026  1.00 27.28 ? 171  LEU A N   1 
ATOM   1102 C  CA  . LEU A 1 182 ? 13.546  1.148   25.565  1.00 27.69 ? 171  LEU A CA  1 
ATOM   1103 C  C   . LEU A 1 182 ? 12.850  0.251   24.552  1.00 27.39 ? 171  LEU A C   1 
ATOM   1104 O  O   . LEU A 1 182 ? 12.979  0.441   23.348  1.00 28.03 ? 171  LEU A O   1 
ATOM   1105 C  CB  . LEU A 1 182 ? 12.593  2.262   26.033  1.00 25.80 ? 171  LEU A CB  1 
ATOM   1106 C  CG  . LEU A 1 182 ? 13.123  3.198   27.137  1.00 25.84 ? 171  LEU A CG  1 
ATOM   1107 C  CD1 . LEU A 1 182 ? 12.253  4.446   27.281  1.00 26.26 ? 171  LEU A CD1 1 
ATOM   1108 C  CD2 . LEU A 1 182 ? 13.220  2.484   28.463  1.00 23.60 ? 171  LEU A CD2 1 
HETATM 1109 N  N   . MSE A 1 183 ? 12.097  -0.720  25.054  1.00 28.89 ? 172  MSE A N   1 
HETATM 1110 C  CA  . MSE A 1 183 ? 11.332  -1.619  24.203  1.00 30.67 ? 172  MSE A CA  1 
HETATM 1111 C  C   . MSE A 1 183 ? 9.838   -1.364  24.243  1.00 30.12 ? 172  MSE A C   1 
HETATM 1112 O  O   . MSE A 1 183 ? 9.186   -1.496  25.290  1.00 30.08 ? 172  MSE A O   1 
HETATM 1113 C  CB  . MSE A 1 183 ? 11.650  -3.039  24.649  1.00 36.24 ? 172  MSE A CB  1 
HETATM 1114 C  CG  . MSE A 1 183 ? 10.826  -4.047  23.866  1.00 42.73 ? 172  MSE A CG  1 
HETATM 1115 SE SE  . MSE A 1 183 ? 11.714  -4.377  22.153  1.00 63.84 ? 172  MSE A SE  1 
HETATM 1116 C  CE  . MSE A 1 183 ? 11.329  -2.740  21.172  1.00 49.57 ? 172  MSE A CE  1 
ATOM   1117 N  N   . GLY A 1 184 ? 9.276   -1.044  23.085  1.00 29.13 ? 173  GLY A N   1 
ATOM   1118 C  CA  . GLY A 1 184 ? 7.842   -0.830  22.954  1.00 31.09 ? 173  GLY A CA  1 
ATOM   1119 C  C   . GLY A 1 184 ? 7.070   -2.096  22.637  1.00 32.26 ? 173  GLY A C   1 
ATOM   1120 O  O   . GLY A 1 184 ? 7.616   -3.186  22.681  1.00 31.11 ? 173  GLY A O   1 
ATOM   1121 N  N   . SER A 1 185 ? 5.804   -1.930  22.277  1.00 33.30 ? 174  SER A N   1 
ATOM   1122 C  CA  . SER A 1 185 ? 4.876   -3.034  22.177  1.00 36.83 ? 174  SER A CA  1 
ATOM   1123 C  C   . SER A 1 185 ? 4.652   -3.555  20.769  1.00 41.68 ? 174  SER A C   1 
ATOM   1124 O  O   . SER A 1 185 ? 4.064   -4.621  20.613  1.00 47.45 ? 174  SER A O   1 
ATOM   1125 C  CB  . SER A 1 185 ? 3.543   -2.657  22.815  1.00 34.86 ? 174  SER A CB  1 
ATOM   1126 O  OG  . SER A 1 185 ? 3.600   -2.848  24.219  1.00 32.97 ? 174  SER A OG  1 
ATOM   1127 N  N   . ASN A 1 186 ? 5.100   -2.818  19.754  1.00 43.56 ? 175  ASN A N   1 
ATOM   1128 C  CA  . ASN A 1 186 ? 5.108   -3.349  18.381  1.00 48.40 ? 175  ASN A CA  1 
ATOM   1129 C  C   . ASN A 1 186 ? 6.497   -3.810  17.950  1.00 50.02 ? 175  ASN A C   1 
ATOM   1130 O  O   . ASN A 1 186 ? 6.898   -3.588  16.815  1.00 52.65 ? 175  ASN A O   1 
ATOM   1131 C  CB  . ASN A 1 186 ? 4.537   -2.338  17.376  1.00 47.65 ? 175  ASN A CB  1 
ATOM   1132 C  CG  . ASN A 1 186 ? 3.191   -2.768  16.822  1.00 48.34 ? 175  ASN A CG  1 
ATOM   1133 O  OD1 . ASN A 1 186 ? 2.671   -3.826  17.175  1.00 49.64 ? 175  ASN A OD1 1 
ATOM   1134 N  ND2 . ASN A 1 186 ? 2.622   -1.951  15.943  1.00 46.50 ? 175  ASN A ND2 1 
ATOM   1135 N  N   . GLU A 1 187 ? 7.215   -4.443  18.878  1.00 51.19 ? 176  GLU A N   1 
ATOM   1136 C  CA  . GLU A 1 187 ? 8.639   -4.791  18.732  1.00 52.28 ? 176  GLU A CA  1 
ATOM   1137 C  C   . GLU A 1 187 ? 9.573   -3.620  18.342  1.00 54.18 ? 176  GLU A C   1 
ATOM   1138 O  O   . GLU A 1 187 ? 10.755  -3.840  18.052  1.00 58.15 ? 176  GLU A O   1 
ATOM   1139 C  CB  . GLU A 1 187 ? 8.815   -5.979  17.778  1.00 53.86 ? 176  GLU A CB  1 
ATOM   1140 N  N   . GLY A 1 188 ? 9.051   -2.390  18.345  1.00 48.66 ? 177  GLY A N   1 
ATOM   1141 C  CA  . GLY A 1 188 ? 9.844   -1.200  18.024  1.00 45.19 ? 177  GLY A CA  1 
ATOM   1142 C  C   . GLY A 1 188 ? 10.637  -0.689  19.219  1.00 41.71 ? 177  GLY A C   1 
ATOM   1143 O  O   . GLY A 1 188 ? 10.185  -0.794  20.351  1.00 45.40 ? 177  GLY A O   1 
ATOM   1144 N  N   . GLU A 1 189 ? 11.823  -0.144  18.972  1.00 39.28 ? 178  GLU A N   1 
ATOM   1145 C  CA  . GLU A 1 189 ? 12.689  0.397   20.029  1.00 36.92 ? 178  GLU A CA  1 
ATOM   1146 C  C   . GLU A 1 189 ? 12.565  1.907   20.140  1.00 33.07 ? 178  GLU A C   1 
ATOM   1147 O  O   . GLU A 1 189 ? 12.378  2.579   19.132  1.00 35.37 ? 178  GLU A O   1 
ATOM   1148 C  CB  . GLU A 1 189 ? 14.149  0.043   19.748  1.00 37.32 ? 178  GLU A CB  1 
ATOM   1149 C  CG  . GLU A 1 189 ? 14.519  -1.375  20.147  1.00 38.02 ? 178  GLU A CG  1 
ATOM   1150 C  CD  . GLU A 1 189 ? 15.886  -1.796  19.646  1.00 39.24 ? 178  GLU A CD  1 
ATOM   1151 O  OE1 . GLU A 1 189 ? 16.549  -1.022  18.925  1.00 42.65 ? 178  GLU A OE1 1 
ATOM   1152 O  OE2 . GLU A 1 189 ? 16.296  -2.921  19.957  1.00 41.95 ? 178  GLU A OE2 1 
ATOM   1153 N  N   . PHE A 1 190 ? 12.673  2.435   21.358  1.00 28.41 ? 179  PHE A N   1 
ATOM   1154 C  CA  . PHE A 1 190 ? 12.723  3.886   21.546  1.00 26.75 ? 179  PHE A CA  1 
ATOM   1155 C  C   . PHE A 1 190 ? 14.146  4.249   21.928  1.00 25.18 ? 179  PHE A C   1 
ATOM   1156 O  O   . PHE A 1 190 ? 14.728  3.616   22.792  1.00 23.85 ? 179  PHE A O   1 
ATOM   1157 C  CB  . PHE A 1 190 ? 11.713  4.382   22.610  1.00 24.72 ? 179  PHE A CB  1 
ATOM   1158 C  CG  . PHE A 1 190 ? 10.330  3.822   22.434  1.00 23.22 ? 179  PHE A CG  1 
ATOM   1159 C  CD1 . PHE A 1 190 ? 9.700   3.862   21.191  1.00 22.90 ? 179  PHE A CD1 1 
ATOM   1160 C  CD2 . PHE A 1 190 ? 9.659   3.247   23.503  1.00 23.10 ? 179  PHE A CD2 1 
ATOM   1161 C  CE1 . PHE A 1 190 ? 8.431   3.331   21.022  1.00 22.74 ? 179  PHE A CE1 1 
ATOM   1162 C  CE2 . PHE A 1 190 ? 8.388   2.717   23.343  1.00 23.24 ? 179  PHE A CE2 1 
ATOM   1163 C  CZ  . PHE A 1 190 ? 7.775   2.753   22.101  1.00 23.27 ? 179  PHE A CZ  1 
ATOM   1164 N  N   . LYS A 1 191 ? 14.693  5.271   21.281  1.00 25.63 ? 180  LYS A N   1 
ATOM   1165 C  CA  . LYS A 1 191 ? 16.116  5.565   21.387  1.00 27.44 ? 180  LYS A CA  1 
ATOM   1166 C  C   . LYS A 1 191 ? 16.408  7.060   21.531  1.00 26.39 ? 180  LYS A C   1 
ATOM   1167 O  O   . LYS A 1 191 ? 15.544  7.888   21.286  1.00 27.17 ? 180  LYS A O   1 
ATOM   1168 C  CB  . LYS A 1 191 ? 16.840  5.016   20.146  1.00 28.24 ? 180  LYS A CB  1 
ATOM   1169 C  CG  . LYS A 1 191 ? 16.877  3.502   20.054  1.00 28.51 ? 180  LYS A CG  1 
ATOM   1170 C  CD  . LYS A 1 191 ? 18.050  3.035   19.196  1.00 30.48 ? 180  LYS A CD  1 
ATOM   1171 C  CE  . LYS A 1 191 ? 17.732  3.070   17.709  1.00 32.03 ? 180  LYS A CE  1 
ATOM   1172 N  NZ  . LYS A 1 191 ? 18.786  2.328   16.958  1.00 36.32 ? 180  LYS A NZ  1 
ATOM   1173 N  N   . ALA A 1 192 ? 17.637  7.389   21.914  1.00 26.05 ? 181  ALA A N   1 
ATOM   1174 C  CA  . ALA A 1 192 ? 18.090  8.774   21.984  1.00 26.11 ? 181  ALA A CA  1 
ATOM   1175 C  C   . ALA A 1 192 ? 18.098  9.447   20.614  1.00 26.47 ? 181  ALA A C   1 
ATOM   1176 O  O   . ALA A 1 192 ? 17.834  10.640  20.503  1.00 24.27 ? 181  ALA A O   1 
ATOM   1177 C  CB  . ALA A 1 192 ? 19.471  8.836   22.601  1.00 25.61 ? 181  ALA A CB  1 
ATOM   1178 N  N   . GLU A 1 193 ? 18.415  8.674   19.576  1.00 28.77 ? 182  GLU A N   1 
ATOM   1179 C  CA  . GLU A 1 193 ? 18.538  9.200   18.213  1.00 31.55 ? 182  GLU A CA  1 
ATOM   1180 C  C   . GLU A 1 193 ? 17.933  8.240   17.198  1.00 32.74 ? 182  GLU A C   1 
ATOM   1181 O  O   . GLU A 1 193 ? 17.503  7.132   17.550  1.00 32.11 ? 182  GLU A O   1 
ATOM   1182 C  CB  . GLU A 1 193 ? 20.006  9.435   17.875  1.00 34.77 ? 182  GLU A CB  1 
ATOM   1183 C  CG  . GLU A 1 193 ? 20.626  10.600  18.631  1.00 38.08 ? 182  GLU A CG  1 
ATOM   1184 C  CD  . GLU A 1 193 ? 22.105  10.767  18.348  1.00 39.28 ? 182  GLU A CD  1 
ATOM   1185 O  OE1 . GLU A 1 193 ? 22.913  10.024  18.935  1.00 38.28 ? 182  GLU A OE1 1 
ATOM   1186 O  OE2 . GLU A 1 193 ? 22.462  11.664  17.557  1.00 42.55 ? 182  GLU A OE2 1 
ATOM   1187 N  N   . GLY A 1 194 ? 17.922  8.670   15.937  1.00 34.41 ? 183  GLY A N   1 
ATOM   1188 C  CA  . GLY A 1 194 ? 17.452  7.854   14.833  1.00 33.50 ? 183  GLY A CA  1 
ATOM   1189 C  C   . GLY A 1 194 ? 16.105  8.351   14.385  1.00 37.13 ? 183  GLY A C   1 
ATOM   1190 O  O   . GLY A 1 194 ? 15.764  9.514   14.606  1.00 40.22 ? 183  GLY A O   1 
ATOM   1191 N  N   . ASN A 1 195 ? 15.290  7.437   13.890  1.00 38.52 ? 184  ASN A N   1 
ATOM   1192 C  CA  . ASN A 1 195 ? 14.029  7.829   13.336  1.00 39.10 ? 184  ASN A CA  1 
ATOM   1193 C  C   . ASN A 1 195 ? 13.354  8.619   14.422  1.00 38.71 ? 184  ASN A C   1 
ATOM   1194 O  O   . ASN A 1 195 ? 13.112  8.132   15.510  1.00 35.72 ? 184  ASN A O   1 
ATOM   1195 C  CB  . ASN A 1 195 ? 13.225  6.562   13.045  1.00 40.61 ? 184  ASN A CB  1 
ATOM   1196 C  CG  . ASN A 1 195 ? 11.853  6.843   12.479  1.00 42.90 ? 184  ASN A CG  1 
ATOM   1197 O  OD1 . ASN A 1 195 ? 11.360  7.958   12.533  1.00 43.94 ? 184  ASN A OD1 1 
ATOM   1198 N  ND2 . ASN A 1 195 ? 11.229  5.819   11.935  1.00 41.98 ? 184  ASN A ND2 1 
ATOM   1199 N  N   . SER A 1 196 ? 13.007  9.842   14.074  1.00 39.01 ? 185  SER A N   1 
ATOM   1200 C  CA  . SER A 1 196 ? 12.397  10.785  15.002  1.00 38.01 ? 185  SER A CA  1 
ATOM   1201 C  C   . SER A 1 196 ? 10.970  10.396  15.434  1.00 35.44 ? 185  SER A C   1 
ATOM   1202 O  O   . SER A 1 196 ? 10.418  10.981  16.355  1.00 36.94 ? 185  SER A O   1 
ATOM   1203 C  CB  . SER A 1 196 ? 12.450  12.211  14.429  1.00 38.68 ? 185  SER A CB  1 
ATOM   1204 O  OG  . SER A 1 196 ? 11.355  12.479  13.575  1.00 41.46 ? 185  SER A OG  1 
ATOM   1205 N  N   . LYS A 1 197 ? 10.388  9.399   14.779  1.00 33.56 ? 186  LYS A N   1 
ATOM   1206 C  CA  . LYS A 1 197 ? 9.120   8.832   15.221  1.00 33.24 ? 186  LYS A CA  1 
ATOM   1207 C  C   . LYS A 1 197 ? 9.293   7.881   16.413  1.00 31.62 ? 186  LYS A C   1 
ATOM   1208 O  O   . LYS A 1 197 ? 8.343   7.600   17.133  1.00 30.98 ? 186  LYS A O   1 
ATOM   1209 C  CB  . LYS A 1 197 ? 8.424   8.110   14.058  1.00 36.35 ? 186  LYS A CB  1 
ATOM   1210 C  CG  . LYS A 1 197 ? 7.754   9.042   13.055  1.00 36.45 ? 186  LYS A CG  1 
ATOM   1211 N  N   . PHE A 1 198 ? 10.507  7.386   16.612  1.00 29.30 ? 187  PHE A N   1 
ATOM   1212 C  CA  . PHE A 1 198 ? 10.776  6.394   17.642  1.00 29.97 ? 187  PHE A CA  1 
ATOM   1213 C  C   . PHE A 1 198 ? 11.804  6.849   18.684  1.00 28.43 ? 187  PHE A C   1 
ATOM   1214 O  O   . PHE A 1 198 ? 12.318  6.031   19.435  1.00 30.32 ? 187  PHE A O   1 
ATOM   1215 C  CB  . PHE A 1 198 ? 11.174  5.052   17.012  1.00 32.01 ? 187  PHE A CB  1 
ATOM   1216 C  CG  . PHE A 1 198 ? 10.037  4.359   16.287  1.00 33.88 ? 187  PHE A CG  1 
ATOM   1217 C  CD1 . PHE A 1 198 ? 9.641   4.772   15.019  1.00 34.82 ? 187  PHE A CD1 1 
ATOM   1218 C  CD2 . PHE A 1 198 ? 9.369   3.279   16.877  1.00 37.09 ? 187  PHE A CD2 1 
ATOM   1219 C  CE1 . PHE A 1 198 ? 8.587   4.147   14.354  1.00 36.08 ? 187  PHE A CE1 1 
ATOM   1220 C  CE2 . PHE A 1 198 ? 8.325   2.637   16.216  1.00 37.34 ? 187  PHE A CE2 1 
ATOM   1221 C  CZ  . PHE A 1 198 ? 7.928   3.077   14.951  1.00 37.01 ? 187  PHE A CZ  1 
ATOM   1222 N  N   . THR A 1 199 ? 12.086  8.152   18.738  1.00 26.02 ? 188  THR A N   1 
ATOM   1223 C  CA  . THR A 1 199 ? 12.946  8.695   19.787  1.00 25.89 ? 188  THR A CA  1 
ATOM   1224 C  C   . THR A 1 199 ? 12.136  9.058   21.049  1.00 24.32 ? 188  THR A C   1 
ATOM   1225 O  O   . THR A 1 199 ? 11.039  9.597   20.969  1.00 23.61 ? 188  THR A O   1 
ATOM   1226 C  CB  . THR A 1 199 ? 13.710  9.958   19.328  1.00 26.67 ? 188  THR A CB  1 
ATOM   1227 O  OG1 . THR A 1 199 ? 12.779  10.924  18.842  1.00 26.83 ? 188  THR A OG1 1 
ATOM   1228 C  CG2 . THR A 1 199 ? 14.714  9.626   18.209  1.00 26.85 ? 188  THR A CG2 1 
ATOM   1229 N  N   . TYR A 1 200 ? 12.691  8.773   22.213  1.00 22.73 ? 189  TYR A N   1 
ATOM   1230 C  CA  . TYR A 1 200 ? 12.080  9.228   23.442  1.00 23.15 ? 189  TYR A CA  1 
ATOM   1231 C  C   . TYR A 1 200 ? 12.498  10.665  23.715  1.00 22.81 ? 189  TYR A C   1 
ATOM   1232 O  O   . TYR A 1 200 ? 13.327  11.191  22.988  1.00 22.93 ? 189  TYR A O   1 
ATOM   1233 C  CB  . TYR A 1 200 ? 12.436  8.298   24.598  1.00 21.63 ? 189  TYR A CB  1 
ATOM   1234 C  CG  . TYR A 1 200 ? 13.908  8.020   24.801  1.00 22.01 ? 189  TYR A CG  1 
ATOM   1235 C  CD1 . TYR A 1 200 ? 14.808  9.053   25.082  1.00 21.83 ? 189  TYR A CD1 1 
ATOM   1236 C  CD2 . TYR A 1 200 ? 14.399  6.710   24.774  1.00 21.72 ? 189  TYR A CD2 1 
ATOM   1237 C  CE1 . TYR A 1 200 ? 16.146  8.798   25.295  1.00 20.69 ? 189  TYR A CE1 1 
ATOM   1238 C  CE2 . TYR A 1 200 ? 15.743  6.447   24.997  1.00 21.68 ? 189  TYR A CE2 1 
ATOM   1239 C  CZ  . TYR A 1 200 ? 16.608  7.498   25.256  1.00 21.85 ? 189  TYR A CZ  1 
ATOM   1240 O  OH  . TYR A 1 200 ? 17.947  7.254   25.487  1.00 22.89 ? 189  TYR A OH  1 
ATOM   1241 N  N   . THR A 1 201 ? 11.915  11.314  24.723  1.00 21.62 ? 190  THR A N   1 
ATOM   1242 C  CA  . THR A 1 201 ? 12.482  12.581  25.185  1.00 23.21 ? 190  THR A CA  1 
ATOM   1243 C  C   . THR A 1 201 ? 12.949  12.444  26.630  1.00 22.79 ? 190  THR A C   1 
ATOM   1244 O  O   . THR A 1 201 ? 12.520  11.541  27.349  1.00 24.41 ? 190  THR A O   1 
ATOM   1245 C  CB  . THR A 1 201 ? 11.528  13.797  25.047  1.00 24.64 ? 190  THR A CB  1 
ATOM   1246 O  OG1 . THR A 1 201 ? 10.459  13.677  25.988  1.00 24.99 ? 190  THR A OG1 1 
ATOM   1247 C  CG2 . THR A 1 201 ? 10.963  13.946  23.609  1.00 23.82 ? 190  THR A CG2 1 
ATOM   1248 N  N   . VAL A 1 202 ? 13.833  13.340  27.047  1.00 21.21 ? 191  VAL A N   1 
ATOM   1249 C  CA  . VAL A 1 202 ? 14.429  13.281  28.384  1.00 19.89 ? 191  VAL A CA  1 
ATOM   1250 C  C   . VAL A 1 202 ? 13.903  14.481  29.199  1.00 19.50 ? 191  VAL A C   1 
ATOM   1251 O  O   . VAL A 1 202 ? 14.038  15.636  28.776  1.00 18.93 ? 191  VAL A O   1 
ATOM   1252 C  CB  . VAL A 1 202 ? 15.968  13.266  28.270  1.00 20.29 ? 191  VAL A CB  1 
ATOM   1253 C  CG1 . VAL A 1 202 ? 16.641  13.342  29.632  1.00 19.81 ? 191  VAL A CG1 1 
ATOM   1254 C  CG2 . VAL A 1 202 ? 16.424  12.008  27.527  1.00 20.38 ? 191  VAL A CG2 1 
ATOM   1255 N  N   . LEU A 1 203 ? 13.284  14.196  30.344  1.00 18.53 ? 192  LEU A N   1 
ATOM   1256 C  CA  . LEU A 1 203 ? 12.613  15.226  31.142  1.00 19.26 ? 192  LEU A CA  1 
ATOM   1257 C  C   . LEU A 1 203 ? 13.520  15.773  32.257  1.00 19.19 ? 192  LEU A C   1 
ATOM   1258 O  O   . LEU A 1 203 ? 13.277  16.846  32.780  1.00 18.51 ? 192  LEU A O   1 
ATOM   1259 C  CB  . LEU A 1 203 ? 11.289  14.690  31.725  1.00 18.16 ? 192  LEU A CB  1 
ATOM   1260 C  CG  . LEU A 1 203 ? 10.187  14.197  30.753  1.00 19.60 ? 192  LEU A CG  1 
ATOM   1261 C  CD1 . LEU A 1 203 ? 8.933   13.806  31.535  1.00 19.35 ? 192  LEU A CD1 1 
ATOM   1262 C  CD2 . LEU A 1 203 ? 9.825   15.209  29.654  1.00 17.79 ? 192  LEU A CD2 1 
ATOM   1263 N  N   . GLU A 1 204 ? 14.534  15.005  32.628  1.00 20.21 ? 193  GLU A N   1 
ATOM   1264 C  CA  . GLU A 1 204 ? 15.581  15.429  33.562  1.00 22.61 ? 193  GLU A CA  1 
ATOM   1265 C  C   . GLU A 1 204 ? 16.709  14.392  33.486  1.00 24.10 ? 193  GLU A C   1 
ATOM   1266 O  O   . GLU A 1 204 ? 16.449  13.210  33.201  1.00 24.92 ? 193  GLU A O   1 
ATOM   1267 C  CB  . GLU A 1 204 ? 15.052  15.576  34.997  1.00 24.25 ? 193  GLU A CB  1 
ATOM   1268 C  CG  . GLU A 1 204 ? 14.658  14.281  35.674  1.00 26.27 ? 193  GLU A CG  1 
ATOM   1269 C  CD  . GLU A 1 204 ? 14.229  14.467  37.124  1.00 30.48 ? 193  GLU A CD  1 
ATOM   1270 O  OE1 . GLU A 1 204 ? 13.023  14.714  37.351  1.00 32.48 ? 193  GLU A OE1 1 
ATOM   1271 O  OE2 . GLU A 1 204 ? 15.085  14.338  38.046  1.00 31.16 ? 193  GLU A OE2 1 
ATOM   1272 N  N   . ASP A 1 205 ? 17.949  14.823  33.714  1.00 24.68 ? 194  ASP A N   1 
ATOM   1273 C  CA  . ASP A 1 205 ? 19.106  13.938  33.511  1.00 25.65 ? 194  ASP A CA  1 
ATOM   1274 C  C   . ASP A 1 205 ? 20.185  14.214  34.550  1.00 28.19 ? 194  ASP A C   1 
ATOM   1275 O  O   . ASP A 1 205 ? 21.047  15.083  34.354  1.00 28.36 ? 194  ASP A O   1 
ATOM   1276 C  CB  . ASP A 1 205 ? 19.644  14.075  32.079  1.00 24.36 ? 194  ASP A CB  1 
ATOM   1277 C  CG  . ASP A 1 205 ? 20.661  12.993  31.714  1.00 24.60 ? 194  ASP A CG  1 
ATOM   1278 O  OD1 . ASP A 1 205 ? 20.935  12.117  32.549  1.00 24.81 ? 194  ASP A OD1 1 
ATOM   1279 O  OD2 . ASP A 1 205 ? 21.204  13.017  30.585  1.00 22.41 ? 194  ASP A OD2 1 
ATOM   1280 N  N   . GLY A 1 206 ? 20.114  13.480  35.664  1.00 28.67 ? 195  GLY A N   1 
ATOM   1281 C  CA  . GLY A 1 206 ? 21.100  13.581  36.749  1.00 28.04 ? 195  GLY A CA  1 
ATOM   1282 C  C   . GLY A 1 206 ? 22.111  12.435  36.751  1.00 27.54 ? 195  GLY A C   1 
ATOM   1283 O  O   . GLY A 1 206 ? 22.839  12.245  37.715  1.00 28.82 ? 195  GLY A O   1 
ATOM   1284 N  N   . CYS A 1 207 ? 22.159  11.675  35.666  1.00 26.17 ? 196  CYS A N   1 
ATOM   1285 C  CA  . CYS A 1 207 ? 23.005  10.493  35.593  1.00 26.22 ? 196  CYS A CA  1 
ATOM   1286 C  C   . CYS A 1 207 ? 24.236  10.716  34.730  1.00 27.10 ? 196  CYS A C   1 
ATOM   1287 O  O   . CYS A 1 207 ? 24.851  9.752   34.299  1.00 28.09 ? 196  CYS A O   1 
ATOM   1288 C  CB  . CYS A 1 207 ? 22.203  9.302   35.037  1.00 24.62 ? 196  CYS A CB  1 
ATOM   1289 S  SG  . CYS A 1 207 ? 20.862  8.786   36.096  1.00 20.87 ? 196  CYS A SG  1 
ATOM   1290 N  N   . THR A 1 208 ? 24.607  11.980  34.500  1.00 27.88 ? 197  THR A N   1 
ATOM   1291 C  CA  . THR A 1 208 ? 25.609  12.332  33.466  1.00 28.49 ? 197  THR A CA  1 
ATOM   1292 C  C   . THR A 1 208 ? 27.079  12.036  33.840  1.00 30.15 ? 197  THR A C   1 
ATOM   1293 O  O   . THR A 1 208 ? 27.922  11.911  32.947  1.00 32.13 ? 197  THR A O   1 
ATOM   1294 C  CB  . THR A 1 208 ? 25.480  13.809  32.991  1.00 27.00 ? 197  THR A CB  1 
ATOM   1295 O  OG1 . THR A 1 208 ? 25.849  14.692  34.059  1.00 24.56 ? 197  THR A OG1 1 
ATOM   1296 C  CG2 . THR A 1 208 ? 24.040  14.134  32.533  1.00 24.94 ? 197  THR A CG2 1 
ATOM   1297 N  N   . LYS A 1 209 ? 27.383  11.934  35.134  1.00 32.77 ? 198  LYS A N   1 
ATOM   1298 C  CA  . LYS A 1 209 ? 28.749  11.588  35.622  1.00 35.38 ? 198  LYS A CA  1 
ATOM   1299 C  C   . LYS A 1 209 ? 28.727  10.377  36.542  1.00 34.86 ? 198  LYS A C   1 
ATOM   1300 O  O   . LYS A 1 209 ? 27.741  10.162  37.240  1.00 35.04 ? 198  LYS A O   1 
ATOM   1301 C  CB  . LYS A 1 209 ? 29.323  12.734  36.463  1.00 36.68 ? 198  LYS A CB  1 
ATOM   1302 C  CG  . LYS A 1 209 ? 29.700  14.006  35.733  1.00 39.25 ? 198  LYS A CG  1 
ATOM   1303 C  CD  . LYS A 1 209 ? 29.841  15.149  36.734  1.00 39.25 ? 198  LYS A CD  1 
ATOM   1304 N  N   . HIS A 1 210 ? 29.820  9.615   36.595  1.00 37.97 ? 199  HIS A N   1 
ATOM   1305 C  CA  . HIS A 1 210 ? 29.999  8.630   37.678  1.00 38.79 ? 199  HIS A CA  1 
ATOM   1306 C  C   . HIS A 1 210 ? 30.412  9.388   38.898  1.00 38.55 ? 199  HIS A C   1 
ATOM   1307 O  O   . HIS A 1 210 ? 31.430  10.051  38.876  1.00 41.69 ? 199  HIS A O   1 
ATOM   1308 C  CB  . HIS A 1 210 ? 31.033  7.553   37.326  1.00 37.82 ? 199  HIS A CB  1 
ATOM   1309 C  CG  . HIS A 1 210 ? 30.672  6.720   36.107  1.00 38.85 ? 199  HIS A CG  1 
ATOM   1310 N  ND1 . HIS A 1 210 ? 31.494  5.778   35.602  1.00 38.05 ? 199  HIS A ND1 1 
ATOM   1311 C  CD2 . HIS A 1 210 ? 29.542  6.736   35.278  1.00 40.80 ? 199  HIS A CD2 1 
ATOM   1312 C  CE1 . HIS A 1 210 ? 30.922  5.207   34.521  1.00 38.92 ? 199  HIS A CE1 1 
ATOM   1313 N  NE2 . HIS A 1 210 ? 29.725  5.792   34.324  1.00 38.92 ? 199  HIS A NE2 1 
ATOM   1314 N  N   . THR A 1 211 ? 29.619  9.335   39.967  1.00 40.42 ? 200  THR A N   1 
ATOM   1315 C  CA  . THR A 1 211 ? 29.918  10.121  41.179  1.00 41.14 ? 200  THR A CA  1 
ATOM   1316 C  C   . THR A 1 211 ? 29.908  9.283   42.457  1.00 41.44 ? 200  THR A C   1 
ATOM   1317 O  O   . THR A 1 211 ? 30.063  9.825   43.552  1.00 39.51 ? 200  THR A O   1 
ATOM   1318 C  CB  . THR A 1 211 ? 28.915  11.283  41.433  1.00 41.27 ? 200  THR A CB  1 
ATOM   1319 O  OG1 . THR A 1 211 ? 27.673  10.760  41.935  1.00 39.87 ? 200  THR A OG1 1 
ATOM   1320 C  CG2 . THR A 1 211 ? 28.679  12.144  40.196  1.00 41.33 ? 200  THR A CG2 1 
ATOM   1321 N  N   . GLY A 1 212 ? 29.677  7.983   42.327  1.00 42.60 ? 201  GLY A N   1 
ATOM   1322 C  CA  . GLY A 1 212 ? 29.548  7.116   43.499  1.00 44.23 ? 201  GLY A CA  1 
ATOM   1323 C  C   . GLY A 1 212 ? 28.287  7.365   44.318  1.00 45.12 ? 201  GLY A C   1 
ATOM   1324 O  O   . GLY A 1 212 ? 28.023  6.654   45.288  1.00 47.32 ? 201  GLY A O   1 
ATOM   1325 N  N   . GLU A 1 213 ? 27.516  8.384   43.934  1.00 44.55 ? 202  GLU A N   1 
ATOM   1326 C  CA  . GLU A 1 213 ? 26.226  8.677   44.554  1.00 43.02 ? 202  GLU A CA  1 
ATOM   1327 C  C   . GLU A 1 213 ? 25.065  8.214   43.664  1.00 39.71 ? 202  GLU A C   1 
ATOM   1328 O  O   . GLU A 1 213 ? 25.259  7.912   42.495  1.00 36.99 ? 202  GLU A O   1 
ATOM   1329 C  CB  . GLU A 1 213 ? 26.115  10.176  44.876  1.00 47.01 ? 202  GLU A CB  1 
ATOM   1330 C  CG  . GLU A 1 213 ? 27.086  10.653  45.953  1.00 52.50 ? 202  GLU A CG  1 
ATOM   1331 C  CD  . GLU A 1 213 ? 26.690  10.191  47.347  1.00 55.82 ? 202  GLU A CD  1 
ATOM   1332 O  OE1 . GLU A 1 213 ? 25.863  10.881  47.979  1.00 60.52 ? 202  GLU A OE1 1 
ATOM   1333 O  OE2 . GLU A 1 213 ? 27.193  9.143   47.816  1.00 55.46 ? 202  GLU A OE2 1 
ATOM   1334 N  N   . TRP A 1 214 ? 23.865  8.152   44.235  1.00 39.10 ? 203  TRP A N   1 
ATOM   1335 C  CA  . TRP A 1 214 ? 22.643  7.797   43.494  1.00 37.44 ? 203  TRP A CA  1 
ATOM   1336 C  C   . TRP A 1 214 ? 21.960  8.992   42.891  1.00 34.81 ? 203  TRP A C   1 
ATOM   1337 O  O   . TRP A 1 214 ? 21.828  10.015  43.539  1.00 35.26 ? 203  TRP A O   1 
ATOM   1338 C  CB  . TRP A 1 214 ? 21.661  7.080   44.417  1.00 36.42 ? 203  TRP A CB  1 
ATOM   1339 C  CG  . TRP A 1 214 ? 22.009  5.627   44.595  1.00 36.33 ? 203  TRP A CG  1 
ATOM   1340 C  CD1 . TRP A 1 214 ? 22.743  5.044   45.632  1.00 34.26 ? 203  TRP A CD1 1 
ATOM   1341 C  CD2 . TRP A 1 214 ? 21.673  4.517   43.687  1.00 35.25 ? 203  TRP A CD2 1 
ATOM   1342 N  NE1 . TRP A 1 214 ? 22.881  3.693   45.428  1.00 34.94 ? 203  TRP A NE1 1 
ATOM   1343 C  CE2 . TRP A 1 214 ? 22.262  3.308   44.286  1.00 34.51 ? 203  TRP A CE2 1 
ATOM   1344 C  CE3 . TRP A 1 214 ? 20.968  4.408   42.482  1.00 33.38 ? 203  TRP A CE3 1 
ATOM   1345 C  CZ2 . TRP A 1 214 ? 22.133  2.061   43.697  1.00 32.78 ? 203  TRP A CZ2 1 
ATOM   1346 C  CZ3 . TRP A 1 214 ? 20.852  3.144   41.895  1.00 33.35 ? 203  TRP A CZ3 1 
ATOM   1347 C  CH2 . TRP A 1 214 ? 21.417  1.998   42.495  1.00 34.81 ? 203  TRP A CH2 1 
ATOM   1348 N  N   . SER A 1 215 ? 21.510  8.868   41.646  1.00 33.04 ? 204  SER A N   1 
ATOM   1349 C  CA  . SER A 1 215 ? 20.674  9.897   41.020  1.00 30.74 ? 204  SER A CA  1 
ATOM   1350 C  C   . SER A 1 215 ? 19.650  9.245   40.069  1.00 29.63 ? 204  SER A C   1 
ATOM   1351 O  O   . SER A 1 215 ? 19.454  8.027   40.089  1.00 28.94 ? 204  SER A O   1 
ATOM   1352 C  CB  . SER A 1 215 ? 21.561  10.918  40.280  1.00 31.19 ? 204  SER A CB  1 
ATOM   1353 O  OG  . SER A 1 215 ? 20.830  12.084  39.918  1.00 31.76 ? 204  SER A OG  1 
ATOM   1354 N  N   . LYS A 1 216 ? 19.008  10.043  39.220  1.00 27.73 ? 205  LYS A N   1 
ATOM   1355 C  CA  . LYS A 1 216 ? 18.004  9.499   38.291  1.00 26.50 ? 205  LYS A CA  1 
ATOM   1356 C  C   . LYS A 1 216 ? 17.869  10.343  37.028  1.00 24.29 ? 205  LYS A C   1 
ATOM   1357 O  O   . LYS A 1 216 ? 18.175  11.543  37.034  1.00 24.30 ? 205  LYS A O   1 
ATOM   1358 C  CB  . LYS A 1 216 ? 16.637  9.375   38.986  1.00 26.09 ? 205  LYS A CB  1 
ATOM   1359 C  CG  . LYS A 1 216 ? 15.953  10.714  39.209  1.00 27.72 ? 205  LYS A CG  1 
ATOM   1360 C  CD  . LYS A 1 216 ? 14.651  10.618  39.998  1.00 28.03 ? 205  LYS A CD  1 
ATOM   1361 C  CE  . LYS A 1 216 ? 14.209  12.008  40.416  1.00 27.76 ? 205  LYS A CE  1 
ATOM   1362 N  NZ  . LYS A 1 216 ? 12.746  12.082  40.698  1.00 28.37 ? 205  LYS A NZ  1 
ATOM   1363 N  N   . THR A 1 217 ? 17.404  9.692   35.963  1.00 22.43 ? 206  THR A N   1 
ATOM   1364 C  CA  . THR A 1 217 ? 17.102  10.319  34.690  1.00 21.49 ? 206  THR A CA  1 
ATOM   1365 C  C   . THR A 1 217 ? 15.726  9.832   34.284  1.00 21.38 ? 206  THR A C   1 
ATOM   1366 O  O   . THR A 1 217 ? 15.420  8.651   34.427  1.00 21.92 ? 206  THR A O   1 
ATOM   1367 C  CB  . THR A 1 217 ? 18.127  9.937   33.604  1.00 20.65 ? 206  THR A CB  1 
ATOM   1368 O  OG1 . THR A 1 217 ? 19.390  10.521  33.922  1.00 20.29 ? 206  THR A OG1 1 
ATOM   1369 C  CG2 . THR A 1 217 ? 17.685  10.432  32.216  1.00 20.09 ? 206  THR A CG2 1 
ATOM   1370 N  N   . VAL A 1 218 ? 14.895  10.744  33.788  1.00 20.42 ? 207  VAL A N   1 
ATOM   1371 C  CA  . VAL A 1 218 ? 13.521  10.404  33.473  1.00 19.69 ? 207  VAL A CA  1 
ATOM   1372 C  C   . VAL A 1 218 ? 13.302  10.500  31.971  1.00 19.94 ? 207  VAL A C   1 
ATOM   1373 O  O   . VAL A 1 218 ? 13.621  11.517  31.335  1.00 19.25 ? 207  VAL A O   1 
ATOM   1374 C  CB  . VAL A 1 218 ? 12.525  11.320  34.205  1.00 19.87 ? 207  VAL A CB  1 
ATOM   1375 C  CG1 . VAL A 1 218 ? 11.095  10.943  33.821  1.00 19.23 ? 207  VAL A CG1 1 
ATOM   1376 C  CG2 . VAL A 1 218 ? 12.718  11.234  35.726  1.00 19.15 ? 207  VAL A CG2 1 
ATOM   1377 N  N   . PHE A 1 219 ? 12.775  9.416   31.423  1.00 19.53 ? 208  PHE A N   1 
ATOM   1378 C  CA  . PHE A 1 219 ? 12.505  9.276   30.010  1.00 20.85 ? 208  PHE A CA  1 
ATOM   1379 C  C   . PHE A 1 219 ? 11.007  9.274   29.736  1.00 20.54 ? 208  PHE A C   1 
ATOM   1380 O  O   . PHE A 1 219 ? 10.230  8.767   30.548  1.00 21.70 ? 208  PHE A O   1 
ATOM   1381 C  CB  . PHE A 1 219 ? 13.060  7.935   29.541  1.00 20.76 ? 208  PHE A CB  1 
ATOM   1382 C  CG  . PHE A 1 219 ? 14.534  7.814   29.695  1.00 22.10 ? 208  PHE A CG  1 
ATOM   1383 C  CD1 . PHE A 1 219 ? 15.083  7.439   30.907  1.00 21.44 ? 208  PHE A CD1 1 
ATOM   1384 C  CD2 . PHE A 1 219 ? 15.374  8.073   28.620  1.00 21.98 ? 208  PHE A CD2 1 
ATOM   1385 C  CE1 . PHE A 1 219 ? 16.443  7.323   31.050  1.00 22.89 ? 208  PHE A CE1 1 
ATOM   1386 C  CE2 . PHE A 1 219 ? 16.739  7.957   28.759  1.00 23.39 ? 208  PHE A CE2 1 
ATOM   1387 C  CZ  . PHE A 1 219 ? 17.278  7.586   29.977  1.00 22.33 ? 208  PHE A CZ  1 
ATOM   1388 N  N   . GLU A 1 220 ? 10.613  9.802   28.584  1.00 19.32 ? 209  GLU A N   1 
ATOM   1389 C  CA  . GLU A 1 220 ? 9.219   9.778   28.201  1.00 20.82 ? 209  GLU A CA  1 
ATOM   1390 C  C   . GLU A 1 220 ? 9.092   9.407   26.738  1.00 20.07 ? 209  GLU A C   1 
ATOM   1391 O  O   . GLU A 1 220 ? 9.827   9.922   25.907  1.00 21.32 ? 209  GLU A O   1 
ATOM   1392 C  CB  . GLU A 1 220 ? 8.570   11.144  28.441  1.00 22.04 ? 209  GLU A CB  1 
ATOM   1393 C  CG  . GLU A 1 220 ? 7.093   11.172  28.096  1.00 24.55 ? 209  GLU A CG  1 
ATOM   1394 C  CD  . GLU A 1 220 ? 6.509   12.567  28.138  1.00 28.41 ? 209  GLU A CD  1 
ATOM   1395 O  OE1 . GLU A 1 220 ? 6.961   13.466  27.381  1.00 31.45 ? 209  GLU A OE1 1 
ATOM   1396 O  OE2 . GLU A 1 220 ? 5.577   12.764  28.932  1.00 31.88 ? 209  GLU A OE2 1 
ATOM   1397 N  N   . TYR A 1 221 ? 8.187   8.494   26.431  1.00 20.06 ? 210  TYR A N   1 
ATOM   1398 C  CA  . TYR A 1 221 ? 7.741   8.323   25.045  1.00 20.67 ? 210  TYR A CA  1 
ATOM   1399 C  C   . TYR A 1 221 ? 6.288   8.734   24.882  1.00 20.95 ? 210  TYR A C   1 
ATOM   1400 O  O   . TYR A 1 221 ? 5.417   8.318   25.653  1.00 20.63 ? 210  TYR A O   1 
ATOM   1401 C  CB  . TYR A 1 221 ? 7.969   6.902   24.505  1.00 21.14 ? 210  TYR A CB  1 
ATOM   1402 C  CG  . TYR A 1 221 ? 7.690   6.798   23.014  1.00 22.82 ? 210  TYR A CG  1 
ATOM   1403 C  CD1 . TYR A 1 221 ? 8.550   7.386   22.071  1.00 22.22 ? 210  TYR A CD1 1 
ATOM   1404 C  CD2 . TYR A 1 221 ? 6.551   6.148   22.546  1.00 22.47 ? 210  TYR A CD2 1 
ATOM   1405 C  CE1 . TYR A 1 221 ? 8.292   7.299   20.710  1.00 21.92 ? 210  TYR A CE1 1 
ATOM   1406 C  CE2 . TYR A 1 221 ? 6.288   6.059   21.198  1.00 22.67 ? 210  TYR A CE2 1 
ATOM   1407 C  CZ  . TYR A 1 221 ? 7.155   6.637   20.285  1.00 23.05 ? 210  TYR A CZ  1 
ATOM   1408 O  OH  . TYR A 1 221 ? 6.858   6.547   18.947  1.00 23.44 ? 210  TYR A OH  1 
ATOM   1409 N  N   . ARG A 1 222 ? 6.042   9.540   23.858  1.00 21.37 ? 211  ARG A N   1 
ATOM   1410 C  CA  . ARG A 1 222 ? 4.737   10.105  23.600  1.00 23.98 ? 211  ARG A CA  1 
ATOM   1411 C  C   . ARG A 1 222 ? 4.385   9.867   22.128  1.00 24.48 ? 211  ARG A C   1 
ATOM   1412 O  O   . ARG A 1 222 ? 5.215   10.054  21.244  1.00 24.73 ? 211  ARG A O   1 
ATOM   1413 C  CB  . ARG A 1 222 ? 4.788   11.598  23.958  1.00 25.88 ? 211  ARG A CB  1 
ATOM   1414 C  CG  . ARG A 1 222 ? 3.463   12.312  24.008  1.00 29.67 ? 211  ARG A CG  1 
ATOM   1415 C  CD  . ARG A 1 222 ? 3.646   13.739  24.521  1.00 31.11 ? 211  ARG A CD  1 
ATOM   1416 N  NE  . ARG A 1 222 ? 3.848   13.750  25.963  1.00 33.02 ? 211  ARG A NE  1 
ATOM   1417 C  CZ  . ARG A 1 222 ? 2.856   13.733  26.852  1.00 35.99 ? 211  ARG A CZ  1 
ATOM   1418 N  NH1 . ARG A 1 222 ? 1.588   13.716  26.447  1.00 38.83 ? 211  ARG A NH1 1 
ATOM   1419 N  NH2 . ARG A 1 222 ? 3.123   13.739  28.147  1.00 33.47 ? 211  ARG A NH2 1 
ATOM   1420 N  N   . THR A 1 223 ? 3.174   9.406   21.849  1.00 24.60 ? 212  THR A N   1 
ATOM   1421 C  CA  . THR A 1 223 ? 2.845   9.031   20.467  1.00 24.91 ? 212  THR A CA  1 
ATOM   1422 C  C   . THR A 1 223 ? 1.353   9.133   20.148  1.00 25.66 ? 212  THR A C   1 
ATOM   1423 O  O   . THR A 1 223 ? 0.499   8.917   21.022  1.00 25.35 ? 212  THR A O   1 
ATOM   1424 C  CB  . THR A 1 223 ? 3.300   7.585   20.146  1.00 25.01 ? 212  THR A CB  1 
ATOM   1425 O  OG1 . THR A 1 223 ? 3.046   7.295   18.769  1.00 24.29 ? 212  THR A OG1 1 
ATOM   1426 C  CG2 . THR A 1 223 ? 2.534   6.542   20.995  1.00 24.15 ? 212  THR A CG2 1 
ATOM   1427 N  N   . ARG A 1 224 ? 1.047   9.415   18.888  1.00 26.61 ? 213  ARG A N   1 
ATOM   1428 C  CA  . ARG A 1 224 ? -0.322  9.317   18.388  1.00 28.29 ? 213  ARG A CA  1 
ATOM   1429 C  C   . ARG A 1 224 ? -0.631  7.909   17.860  1.00 28.03 ? 213  ARG A C   1 
ATOM   1430 O  O   . ARG A 1 224 ? -1.748  7.634   17.458  1.00 30.58 ? 213  ARG A O   1 
ATOM   1431 C  CB  . ARG A 1 224 ? -0.572  10.397  17.326  1.00 33.29 ? 213  ARG A CB  1 
ATOM   1432 C  CG  . ARG A 1 224 ? -0.558  11.806  17.930  1.00 39.79 ? 213  ARG A CG  1 
ATOM   1433 C  CD  . ARG A 1 224 ? -0.799  12.933  16.930  1.00 44.72 ? 213  ARG A CD  1 
ATOM   1434 N  NE  . ARG A 1 224 ? -1.982  12.723  16.090  1.00 50.21 ? 213  ARG A NE  1 
ATOM   1435 C  CZ  . ARG A 1 224 ? -3.244  12.919  16.476  1.00 55.47 ? 213  ARG A CZ  1 
ATOM   1436 N  NH1 . ARG A 1 224 ? -3.523  13.335  17.710  1.00 54.38 ? 213  ARG A NH1 1 
ATOM   1437 N  NH2 . ARG A 1 224 ? -4.237  12.693  15.621  1.00 56.14 ? 213  ARG A NH2 1 
ATOM   1438 N  N   . LYS A 1 225 ? 0.360   7.021   17.880  1.00 26.94 ? 214  LYS A N   1 
ATOM   1439 C  CA  . LYS A 1 225 ? 0.205   5.640   17.416  1.00 27.45 ? 214  LYS A CA  1 
ATOM   1440 C  C   . LYS A 1 225 ? 0.357   4.717   18.599  1.00 24.60 ? 214  LYS A C   1 
ATOM   1441 O  O   . LYS A 1 225 ? 1.417   4.122   18.807  1.00 22.80 ? 214  LYS A O   1 
ATOM   1442 C  CB  . LYS A 1 225 ? 1.248   5.307   16.335  1.00 30.90 ? 214  LYS A CB  1 
ATOM   1443 C  CG  . LYS A 1 225 ? 0.898   5.882   14.966  1.00 36.72 ? 214  LYS A CG  1 
ATOM   1444 C  CD  . LYS A 1 225 ? -0.123  4.993   14.246  1.00 42.16 ? 214  LYS A CD  1 
ATOM   1445 C  CE  . LYS A 1 225 ? -1.355  5.768   13.777  1.00 40.96 ? 214  LYS A CE  1 
ATOM   1446 N  NZ  . LYS A 1 225 ? -0.995  6.823   12.790  1.00 43.70 ? 214  LYS A NZ  1 
ATOM   1447 N  N   . ALA A 1 226 ? -0.722  4.613   19.367  1.00 21.93 ? 215  ALA A N   1 
ATOM   1448 C  CA  . ALA A 1 226 ? -0.696  4.036   20.703  1.00 21.78 ? 215  ALA A CA  1 
ATOM   1449 C  C   . ALA A 1 226 ? -0.362  2.543   20.762  1.00 22.05 ? 215  ALA A C   1 
ATOM   1450 O  O   . ALA A 1 226 ? -0.020  2.028   21.842  1.00 21.28 ? 215  ALA A O   1 
ATOM   1451 C  CB  . ALA A 1 226 ? -2.002  4.349   21.438  1.00 22.08 ? 215  ALA A CB  1 
ATOM   1452 N  N   . VAL A 1 227 ? -0.416  1.857   19.615  1.00 21.27 ? 216  VAL A N   1 
ATOM   1453 C  CA  . VAL A 1 227 ? 0.036   0.455   19.540  1.00 22.24 ? 216  VAL A CA  1 
ATOM   1454 C  C   . VAL A 1 227 ? 1.520   0.301   19.917  1.00 22.27 ? 216  VAL A C   1 
ATOM   1455 O  O   . VAL A 1 227 ? 1.958   -0.776  20.332  1.00 21.68 ? 216  VAL A O   1 
ATOM   1456 C  CB  . VAL A 1 227 ? -0.285  -0.242  18.169  1.00 22.83 ? 216  VAL A CB  1 
ATOM   1457 C  CG1 . VAL A 1 227 ? -1.791  -0.367  17.982  1.00 22.34 ? 216  VAL A CG1 1 
ATOM   1458 C  CG2 . VAL A 1 227 ? 0.318   0.515   16.993  1.00 22.81 ? 216  VAL A CG2 1 
ATOM   1459 N  N   . ARG A 1 228 ? 2.282   1.382   19.803  1.00 22.57 ? 217  ARG A N   1 
ATOM   1460 C  CA  . ARG A 1 228 ? 3.701   1.340   20.155  1.00 23.53 ? 217  ARG A CA  1 
ATOM   1461 C  C   . ARG A 1 228 ? 3.948   1.183   21.652  1.00 22.51 ? 217  ARG A C   1 
ATOM   1462 O  O   . ARG A 1 228 ? 5.004   0.746   22.072  1.00 24.04 ? 217  ARG A O   1 
ATOM   1463 C  CB  . ARG A 1 228 ? 4.403   2.591   19.633  1.00 24.57 ? 217  ARG A CB  1 
ATOM   1464 C  CG  . ARG A 1 228 ? 4.556   2.603   18.126  1.00 25.21 ? 217  ARG A CG  1 
ATOM   1465 C  CD  . ARG A 1 228 ? 5.026   3.976   17.644  1.00 27.57 ? 217  ARG A CD  1 
ATOM   1466 N  NE  . ARG A 1 228 ? 4.787   4.111   16.207  1.00 28.43 ? 217  ARG A NE  1 
ATOM   1467 C  CZ  . ARG A 1 228 ? 4.954   5.214   15.487  1.00 28.85 ? 217  ARG A CZ  1 
ATOM   1468 N  NH1 . ARG A 1 228 ? 5.359   6.352   16.033  1.00 30.76 ? 217  ARG A NH1 1 
ATOM   1469 N  NH2 . ARG A 1 228 ? 4.696   5.172   14.201  1.00 29.06 ? 217  ARG A NH2 1 
ATOM   1470 N  N   . LEU A 1 229 ? 2.969   1.529   22.465  1.00 22.65 ? 218  LEU A N   1 
ATOM   1471 C  CA  . LEU A 1 229 ? 3.119   1.399   23.920  1.00 21.57 ? 218  LEU A CA  1 
ATOM   1472 C  C   . LEU A 1 229 ? 2.244   0.246   24.399  1.00 20.91 ? 218  LEU A C   1 
ATOM   1473 O  O   . LEU A 1 229 ? 1.349   -0.162  23.674  1.00 21.07 ? 218  LEU A O   1 
ATOM   1474 C  CB  . LEU A 1 229 ? 2.717   2.697   24.627  1.00 19.42 ? 218  LEU A CB  1 
ATOM   1475 C  CG  . LEU A 1 229 ? 3.679   3.878   24.478  1.00 20.69 ? 218  LEU A CG  1 
ATOM   1476 C  CD1 . LEU A 1 229 ? 3.057   5.143   25.079  1.00 19.08 ? 218  LEU A CD1 1 
ATOM   1477 C  CD2 . LEU A 1 229 ? 5.038   3.589   25.115  1.00 20.83 ? 218  LEU A CD2 1 
ATOM   1478 N  N   . PRO A 1 230 ? 2.459   -0.243  25.639  1.00 20.58 ? 219  PRO A N   1 
ATOM   1479 C  CA  . PRO A 1 230 ? 3.421   0.204   26.656  1.00 20.42 ? 219  PRO A CA  1 
ATOM   1480 C  C   . PRO A 1 230 ? 4.851   -0.256  26.410  1.00 21.42 ? 219  PRO A C   1 
ATOM   1481 O  O   . PRO A 1 230 ? 5.124   -1.063  25.510  1.00 21.82 ? 219  PRO A O   1 
ATOM   1482 C  CB  . PRO A 1 230 ? 2.903   -0.458  27.940  1.00 20.48 ? 219  PRO A CB  1 
ATOM   1483 C  CG  . PRO A 1 230 ? 2.242   -1.716  27.458  1.00 20.66 ? 219  PRO A CG  1 
ATOM   1484 C  CD  . PRO A 1 230 ? 1.592   -1.329  26.150  1.00 21.21 ? 219  PRO A CD  1 
ATOM   1485 N  N   . ILE A 1 231 ? 5.739   0.271   27.239  1.00 21.41 ? 220  ILE A N   1 
ATOM   1486 C  CA  . ILE A 1 231 ? 7.117   -0.120  27.320  1.00 22.67 ? 220  ILE A CA  1 
ATOM   1487 C  C   . ILE A 1 231 ? 7.214   -1.460  28.053  1.00 23.80 ? 220  ILE A C   1 
ATOM   1488 O  O   . ILE A 1 231 ? 6.625   -1.627  29.130  1.00 23.28 ? 220  ILE A O   1 
ATOM   1489 C  CB  . ILE A 1 231 ? 7.915   0.959   28.083  1.00 23.23 ? 220  ILE A CB  1 
ATOM   1490 C  CG1 . ILE A 1 231 ? 8.042   2.216   27.217  1.00 21.85 ? 220  ILE A CG1 1 
ATOM   1491 C  CG2 . ILE A 1 231 ? 9.288   0.438   28.502  1.00 22.95 ? 220  ILE A CG2 1 
ATOM   1492 C  CD1 . ILE A 1 231 ? 8.531   3.433   27.970  1.00 23.69 ? 220  ILE A CD1 1 
ATOM   1493 N  N   . VAL A 1 232 ? 7.948   -2.410  27.474  1.00 25.16 ? 221  VAL A N   1 
ATOM   1494 C  CA  . VAL A 1 232 ? 8.033   -3.760  28.061  1.00 26.86 ? 221  VAL A CA  1 
ATOM   1495 C  C   . VAL A 1 232 ? 9.431   -4.159  28.537  1.00 26.95 ? 221  VAL A C   1 
ATOM   1496 O  O   . VAL A 1 232 ? 9.572   -5.119  29.282  1.00 28.75 ? 221  VAL A O   1 
ATOM   1497 C  CB  . VAL A 1 232 ? 7.446   -4.882  27.144  1.00 27.43 ? 221  VAL A CB  1 
ATOM   1498 C  CG1 . VAL A 1 232 ? 5.957   -4.661  26.850  1.00 25.34 ? 221  VAL A CG1 1 
ATOM   1499 C  CG2 . VAL A 1 232 ? 8.243   -5.023  25.855  1.00 25.50 ? 221  VAL A CG2 1 
ATOM   1500 N  N   . ASP A 1 233 ? 10.457  -3.429  28.119  1.00 28.06 ? 222  ASP A N   1 
ATOM   1501 C  CA  . ASP A 1 233 ? 11.824  -3.721  28.582  1.00 29.19 ? 222  ASP A CA  1 
ATOM   1502 C  C   . ASP A 1 233 ? 12.690  -2.474  28.477  1.00 27.61 ? 222  ASP A C   1 
ATOM   1503 O  O   . ASP A 1 233 ? 12.328  -1.513  27.799  1.00 28.16 ? 222  ASP A O   1 
ATOM   1504 C  CB  . ASP A 1 233 ? 12.450  -4.881  27.773  1.00 28.59 ? 222  ASP A CB  1 
ATOM   1505 C  CG  . ASP A 1 233 ? 13.473  -5.710  28.587  1.00 31.79 ? 222  ASP A CG  1 
ATOM   1506 O  OD1 . ASP A 1 233 ? 14.038  -5.244  29.617  1.00 31.15 ? 222  ASP A OD1 1 
ATOM   1507 O  OD2 . ASP A 1 233 ? 13.718  -6.867  28.190  1.00 33.34 ? 222  ASP A OD2 1 
ATOM   1508 N  N   . ILE A 1 234 ? 13.828  -2.512  29.152  1.00 26.47 ? 223  ILE A N   1 
ATOM   1509 C  CA  . ILE A 1 234 ? 14.811  -1.445  29.138  1.00 27.03 ? 223  ILE A CA  1 
ATOM   1510 C  C   . ILE A 1 234 ? 16.207  -2.047  28.919  1.00 29.80 ? 223  ILE A C   1 
ATOM   1511 O  O   . ILE A 1 234 ? 16.524  -3.095  29.506  1.00 28.07 ? 223  ILE A O   1 
ATOM   1512 C  CB  . ILE A 1 234 ? 14.760  -0.631  30.455  1.00 26.71 ? 223  ILE A CB  1 
ATOM   1513 C  CG1 . ILE A 1 234 ? 15.690  0.581   30.386  1.00 25.40 ? 223  ILE A CG1 1 
ATOM   1514 C  CG2 . ILE A 1 234 ? 15.069  -1.499  31.682  1.00 26.69 ? 223  ILE A CG2 1 
ATOM   1515 C  CD1 . ILE A 1 234 ? 15.431  1.596   31.468  1.00 23.36 ? 223  ILE A CD1 1 
ATOM   1516 N  N   . ALA A 1 235 ? 17.019  -1.403  28.068  1.00 28.58 ? 224  ALA A N   1 
ATOM   1517 C  CA  . ALA A 1 235 ? 18.407  -1.823  27.852  1.00 29.19 ? 224  ALA A CA  1 
ATOM   1518 C  C   . ALA A 1 235 ? 19.425  -0.737  28.167  1.00 28.66 ? 224  ALA A C   1 
ATOM   1519 O  O   . ALA A 1 235 ? 19.756  0.071   27.301  1.00 29.40 ? 224  ALA A O   1 
ATOM   1520 C  CB  . ALA A 1 235 ? 18.621  -2.338  26.425  1.00 31.20 ? 224  ALA A CB  1 
ATOM   1521 N  N   . PRO A 1 236 ? 19.948  -0.731  29.401  1.00 28.90 ? 225  PRO A N   1 
ATOM   1522 C  CA  . PRO A 1 236 ? 21.035  0.165   29.709  1.00 30.67 ? 225  PRO A CA  1 
ATOM   1523 C  C   . PRO A 1 236 ? 22.253  -0.182  28.864  1.00 32.95 ? 225  PRO A C   1 
ATOM   1524 O  O   . PRO A 1 236 ? 22.307  -1.257  28.267  1.00 35.21 ? 225  PRO A O   1 
ATOM   1525 C  CB  . PRO A 1 236 ? 21.322  -0.110  31.190  1.00 30.02 ? 225  PRO A CB  1 
ATOM   1526 C  CG  . PRO A 1 236 ? 20.182  -0.933  31.696  1.00 28.66 ? 225  PRO A CG  1 
ATOM   1527 C  CD  . PRO A 1 236 ? 19.665  -1.660  30.507  1.00 29.56 ? 225  PRO A CD  1 
ATOM   1528 N  N   . TYR A 1 237 ? 23.211  0.732   28.821  1.00 34.32 ? 226  TYR A N   1 
ATOM   1529 C  CA  . TYR A 1 237 ? 24.451  0.547   28.094  1.00 36.51 ? 226  TYR A CA  1 
ATOM   1530 C  C   . TYR A 1 237 ? 25.622  0.691   29.067  1.00 36.86 ? 226  TYR A C   1 
ATOM   1531 O  O   . TYR A 1 237 ? 26.515  -0.156  29.128  1.00 36.03 ? 226  TYR A O   1 
ATOM   1532 C  CB  . TYR A 1 237 ? 24.544  1.589   26.980  1.00 37.86 ? 226  TYR A CB  1 
ATOM   1533 C  CG  . TYR A 1 237 ? 25.799  1.525   26.153  1.00 38.08 ? 226  TYR A CG  1 
ATOM   1534 C  CD1 . TYR A 1 237 ? 26.953  2.186   26.554  1.00 39.52 ? 226  TYR A CD1 1 
ATOM   1535 C  CD2 . TYR A 1 237 ? 25.828  0.814   24.960  1.00 41.13 ? 226  TYR A CD2 1 
ATOM   1536 C  CE1 . TYR A 1 237 ? 28.110  2.132   25.795  1.00 42.25 ? 226  TYR A CE1 1 
ATOM   1537 C  CE2 . TYR A 1 237 ? 26.982  0.749   24.192  1.00 44.17 ? 226  TYR A CE2 1 
ATOM   1538 C  CZ  . TYR A 1 237 ? 28.116  1.410   24.617  1.00 43.55 ? 226  TYR A CZ  1 
ATOM   1539 O  OH  . TYR A 1 237 ? 29.252  1.351   23.854  1.00 48.97 ? 226  TYR A OH  1 
ATOM   1540 N  N   . ASP A 1 238 ? 25.611  1.756   29.853  1.00 36.59 ? 227  ASP A N   1 
ATOM   1541 C  CA  . ASP A 1 238 ? 26.723  1.995   30.753  1.00 36.15 ? 227  ASP A CA  1 
ATOM   1542 C  C   . ASP A 1 238 ? 26.554  1.221   32.049  1.00 38.17 ? 227  ASP A C   1 
ATOM   1543 O  O   . ASP A 1 238 ? 26.266  1.788   33.102  1.00 37.08 ? 227  ASP A O   1 
ATOM   1544 C  CB  . ASP A 1 238 ? 26.911  3.482   31.006  1.00 35.10 ? 227  ASP A CB  1 
ATOM   1545 C  CG  . ASP A 1 238 ? 28.193  3.784   31.743  1.00 35.66 ? 227  ASP A CG  1 
ATOM   1546 O  OD1 . ASP A 1 238 ? 29.226  3.138   31.455  1.00 36.91 ? 227  ASP A OD1 1 
ATOM   1547 O  OD2 . ASP A 1 238 ? 28.165  4.678   32.608  1.00 35.66 ? 227  ASP A OD2 1 
ATOM   1548 N  N   . ILE A 1 239 ? 26.739  -0.091  31.941  1.00 39.74 ? 228  ILE A N   1 
ATOM   1549 C  CA  . ILE A 1 239 ? 26.695  -1.016  33.079  1.00 41.47 ? 228  ILE A CA  1 
ATOM   1550 C  C   . ILE A 1 239 ? 27.713  -2.142  32.858  1.00 42.92 ? 228  ILE A C   1 
ATOM   1551 O  O   . ILE A 1 239 ? 28.293  -2.245  31.773  1.00 39.78 ? 228  ILE A O   1 
ATOM   1552 C  CB  . ILE A 1 239 ? 25.295  -1.643  33.252  1.00 39.41 ? 228  ILE A CB  1 
ATOM   1553 C  CG1 . ILE A 1 239 ? 24.697  -1.990  31.883  1.00 39.35 ? 228  ILE A CG1 1 
ATOM   1554 C  CG2 . ILE A 1 239 ? 24.397  -0.705  34.035  1.00 40.34 ? 228  ILE A CG2 1 
ATOM   1555 C  CD1 . ILE A 1 239 ? 23.792  -3.208  31.870  1.00 39.95 ? 228  ILE A CD1 1 
ATOM   1556 N  N   . GLY A 1 240 ? 27.840  -3.009  33.855  1.00 45.30 ? 229  GLY A N   1 
ATOM   1557 C  CA  . GLY A 1 240 ? 28.777  -4.118  33.862  1.00 51.38 ? 229  GLY A CA  1 
ATOM   1558 C  C   . GLY A 1 240 ? 30.038  -3.987  34.703  1.00 53.65 ? 229  GLY A C   1 
ATOM   1559 O  O   . GLY A 1 240 ? 30.756  -4.948  34.897  1.00 56.53 ? 229  GLY A O   1 
ATOM   1560 N  N   . GLY A 1 241 ? 30.298  -2.794  35.194  1.00 54.07 ? 230  GLY A N   1 
ATOM   1561 C  CA  . GLY A 1 241 ? 31.357  -2.536  36.135  1.00 52.96 ? 230  GLY A CA  1 
ATOM   1562 C  C   . GLY A 1 241 ? 30.909  -2.820  37.533  1.00 55.39 ? 230  GLY A C   1 
ATOM   1563 O  O   . GLY A 1 241 ? 29.729  -2.878  37.781  1.00 55.30 ? 230  GLY A O   1 
ATOM   1564 N  N   . PRO A 1 242 ? 31.867  -2.986  38.432  1.00 54.10 ? 231  PRO A N   1 
ATOM   1565 C  CA  . PRO A 1 242 ? 31.657  -3.367  39.828  1.00 53.25 ? 231  PRO A CA  1 
ATOM   1566 C  C   . PRO A 1 242 ? 30.881  -2.363  40.620  1.00 53.43 ? 231  PRO A C   1 
ATOM   1567 O  O   . PRO A 1 242 ? 30.097  -2.706  41.480  1.00 53.04 ? 231  PRO A O   1 
ATOM   1568 C  CB  . PRO A 1 242 ? 33.077  -3.391  40.383  1.00 53.76 ? 231  PRO A CB  1 
ATOM   1569 C  CG  . PRO A 1 242 ? 33.923  -3.668  39.218  1.00 54.16 ? 231  PRO A CG  1 
ATOM   1570 C  CD  . PRO A 1 242 ? 33.284  -2.973  38.070  1.00 54.03 ? 231  PRO A CD  1 
ATOM   1571 N  N   . ASP A 1 243 ? 31.173  -1.108  40.343  1.00 54.06 ? 232  ASP A N   1 
ATOM   1572 C  CA  . ASP A 1 243 ? 30.608  0.032   41.024  1.00 51.89 ? 232  ASP A CA  1 
ATOM   1573 C  C   . ASP A 1 243 ? 29.299  0.510   40.393  1.00 47.54 ? 232  ASP A C   1 
ATOM   1574 O  O   . ASP A 1 243 ? 28.653  1.396   40.901  1.00 43.86 ? 232  ASP A O   1 
ATOM   1575 C  CB  . ASP A 1 243 ? 31.638  1.154   40.962  1.00 56.54 ? 232  ASP A CB  1 
ATOM   1576 C  CG  . ASP A 1 243 ? 32.206  1.355   39.556  1.00 60.63 ? 232  ASP A CG  1 
ATOM   1577 O  OD1 . ASP A 1 243 ? 32.357  0.373   38.811  1.00 58.18 ? 232  ASP A OD1 1 
ATOM   1578 O  OD2 . ASP A 1 243 ? 32.495  2.506   39.184  1.00 64.78 ? 232  ASP A OD2 1 
ATOM   1579 N  N   . GLN A 1 244 ? 28.940  -0.084  39.273  1.00 42.65 ? 233  GLN A N   1 
ATOM   1580 C  CA  . GLN A 1 244 ? 27.832  0.388   38.435  1.00 42.15 ? 233  GLN A CA  1 
ATOM   1581 C  C   . GLN A 1 244 ? 26.522  -0.309  38.762  1.00 43.39 ? 233  GLN A C   1 
ATOM   1582 O  O   . GLN A 1 244 ? 26.345  -1.492  38.425  1.00 44.00 ? 233  GLN A O   1 
ATOM   1583 C  CB  . GLN A 1 244 ? 28.157  0.146   36.960  1.00 40.27 ? 233  GLN A CB  1 
ATOM   1584 C  CG  . GLN A 1 244 ? 29.440  0.803   36.482  1.00 39.45 ? 233  GLN A CG  1 
ATOM   1585 C  CD  . GLN A 1 244 ? 29.556  0.804   34.970  1.00 40.46 ? 233  GLN A CD  1 
ATOM   1586 O  OE1 . GLN A 1 244 ? 29.823  -0.229  34.358  1.00 43.88 ? 233  GLN A OE1 1 
ATOM   1587 N  NE2 . GLN A 1 244 ? 29.346  1.968   34.355  1.00 38.46 ? 233  GLN A NE2 1 
ATOM   1588 N  N   . GLU A 1 245 ? 25.610  0.435   39.396  1.00 42.42 ? 234  GLU A N   1 
ATOM   1589 C  CA  . GLU A 1 245 ? 24.289  -0.065  39.825  1.00 40.82 ? 234  GLU A CA  1 
ATOM   1590 C  C   . GLU A 1 245 ? 23.104  0.729   39.219  1.00 40.19 ? 234  GLU A C   1 
ATOM   1591 O  O   . GLU A 1 245 ? 23.226  1.932   38.926  1.00 36.99 ? 234  GLU A O   1 
ATOM   1592 C  CB  . GLU A 1 245 ? 24.175  -0.021  41.360  1.00 42.42 ? 234  GLU A CB  1 
ATOM   1593 C  CG  . GLU A 1 245 ? 25.192  -0.858  42.141  1.00 45.40 ? 234  GLU A CG  1 
ATOM   1594 C  CD  . GLU A 1 245 ? 24.858  -0.961  43.627  1.00 46.15 ? 234  GLU A CD  1 
ATOM   1595 O  OE1 . GLU A 1 245 ? 23.849  -1.609  43.967  1.00 49.44 ? 234  GLU A OE1 1 
ATOM   1596 O  OE2 . GLU A 1 245 ? 25.601  -0.402  44.465  1.00 47.17 ? 234  GLU A OE2 1 
ATOM   1597 N  N   . PHE A 1 246 ? 21.957  0.067   39.049  1.00 37.18 ? 235  PHE A N   1 
ATOM   1598 C  CA  . PHE A 1 246 ? 20.751  0.760   38.607  1.00 37.03 ? 235  PHE A CA  1 
ATOM   1599 C  C   . PHE A 1 246 ? 19.451  0.198   39.160  1.00 36.98 ? 235  PHE A C   1 
ATOM   1600 O  O   . PHE A 1 246 ? 19.383  -0.955  39.596  1.00 36.59 ? 235  PHE A O   1 
ATOM   1601 C  CB  . PHE A 1 246 ? 20.679  0.884   37.076  1.00 37.25 ? 235  PHE A CB  1 
ATOM   1602 C  CG  . PHE A 1 246 ? 20.283  -0.386  36.372  1.00 37.91 ? 235  PHE A CG  1 
ATOM   1603 C  CD1 . PHE A 1 246 ? 18.938  -0.700  36.160  1.00 36.27 ? 235  PHE A CD1 1 
ATOM   1604 C  CD2 . PHE A 1 246 ? 21.249  -1.264  35.903  1.00 37.77 ? 235  PHE A CD2 1 
ATOM   1605 C  CE1 . PHE A 1 246 ? 18.575  -1.872  35.509  1.00 37.42 ? 235  PHE A CE1 1 
ATOM   1606 C  CE2 . PHE A 1 246 ? 20.888  -2.436  35.245  1.00 36.75 ? 235  PHE A CE2 1 
ATOM   1607 C  CZ  . PHE A 1 246 ? 19.554  -2.747  35.056  1.00 36.03 ? 235  PHE A CZ  1 
ATOM   1608 N  N   . GLY A 1 247 ? 18.436  1.060   39.152  1.00 36.40 ? 236  GLY A N   1 
ATOM   1609 C  CA  . GLY A 1 247 ? 17.059  0.720   39.489  1.00 34.74 ? 236  GLY A CA  1 
ATOM   1610 C  C   . GLY A 1 247 ? 16.152  1.365   38.453  1.00 31.48 ? 236  GLY A C   1 
ATOM   1611 O  O   . GLY A 1 247 ? 16.600  2.219   37.698  1.00 29.57 ? 236  GLY A O   1 
ATOM   1612 N  N   . VAL A 1 248 ? 14.885  0.946   38.417  1.00 32.20 ? 237  VAL A N   1 
ATOM   1613 C  CA  . VAL A 1 248 ? 13.892  1.440   37.448  1.00 30.34 ? 237  VAL A CA  1 
ATOM   1614 C  C   . VAL A 1 248 ? 12.530  1.627   38.112  1.00 30.93 ? 237  VAL A C   1 
ATOM   1615 O  O   . VAL A 1 248 ? 12.044  0.740   38.819  1.00 29.92 ? 237  VAL A O   1 
ATOM   1616 C  CB  . VAL A 1 248 ? 13.732  0.487   36.240  1.00 30.44 ? 237  VAL A CB  1 
ATOM   1617 C  CG1 . VAL A 1 248 ? 12.848  1.109   35.159  1.00 30.10 ? 237  VAL A CG1 1 
ATOM   1618 C  CG2 . VAL A 1 248 ? 15.087  0.109   35.650  1.00 29.80 ? 237  VAL A CG2 1 
ATOM   1619 N  N   . ASP A 1 249 ? 11.938  2.803   37.911  1.00 29.64 ? 238  ASP A N   1 
ATOM   1620 C  CA  . ASP A 1 249 ? 10.535  3.042   38.230  1.00 28.83 ? 238  ASP A CA  1 
ATOM   1621 C  C   . ASP A 1 249 ? 9.786   3.107   36.918  1.00 27.09 ? 238  ASP A C   1 
ATOM   1622 O  O   . ASP A 1 249 ? 10.050  3.987   36.099  1.00 26.54 ? 238  ASP A O   1 
ATOM   1623 C  CB  . ASP A 1 249 ? 10.340  4.364   38.985  1.00 31.82 ? 238  ASP A CB  1 
ATOM   1624 C  CG  . ASP A 1 249 ? 10.673  4.256   40.453  1.00 35.53 ? 238  ASP A CG  1 
ATOM   1625 O  OD1 . ASP A 1 249 ? 10.307  3.233   41.076  1.00 42.70 ? 238  ASP A OD1 1 
ATOM   1626 O  OD2 . ASP A 1 249 ? 11.269  5.209   40.997  1.00 38.23 ? 238  ASP A OD2 1 
ATOM   1627 N  N   . VAL A 1 250 ? 8.876   2.160   36.714  1.00 24.83 ? 239  VAL A N   1 
ATOM   1628 C  CA  . VAL A 1 250 ? 8.100   2.081   35.495  1.00 23.13 ? 239  VAL A CA  1 
ATOM   1629 C  C   . VAL A 1 250 ? 6.819   2.845   35.692  1.00 21.75 ? 239  VAL A C   1 
ATOM   1630 O  O   . VAL A 1 250 ? 5.947   2.431   36.459  1.00 20.13 ? 239  VAL A O   1 
ATOM   1631 C  CB  . VAL A 1 250 ? 7.753   0.630   35.115  1.00 24.31 ? 239  VAL A CB  1 
ATOM   1632 C  CG1 . VAL A 1 250 ? 6.970   0.596   33.802  1.00 24.31 ? 239  VAL A CG1 1 
ATOM   1633 C  CG2 . VAL A 1 250 ? 9.027   -0.195  34.992  1.00 26.01 ? 239  VAL A CG2 1 
ATOM   1634 N  N   . GLY A 1 251 ? 6.700   3.959   34.980  1.00 20.78 ? 240  GLY A N   1 
ATOM   1635 C  CA  . GLY A 1 251 ? 5.499   4.765   35.063  1.00 19.45 ? 240  GLY A CA  1 
ATOM   1636 C  C   . GLY A 1 251 ? 4.357   4.041   34.376  1.00 19.03 ? 240  GLY A C   1 
ATOM   1637 O  O   . GLY A 1 251 ? 4.585   3.088   33.607  1.00 17.85 ? 240  GLY A O   1 
ATOM   1638 N  N   . PRO A 1 252 ? 3.117   4.451   34.696  1.00 18.65 ? 241  PRO A N   1 
ATOM   1639 C  CA  . PRO A 1 252 ? 1.938   3.871   34.073  1.00 18.41 ? 241  PRO A CA  1 
ATOM   1640 C  C   . PRO A 1 252 ? 1.832   4.254   32.619  1.00 17.54 ? 241  PRO A C   1 
ATOM   1641 O  O   . PRO A 1 252 ? 2.287   5.313   32.225  1.00 18.43 ? 241  PRO A O   1 
ATOM   1642 C  CB  . PRO A 1 252 ? 0.765   4.499   34.856  1.00 18.17 ? 241  PRO A CB  1 
ATOM   1643 C  CG  . PRO A 1 252 ? 1.320   5.719   35.504  1.00 17.67 ? 241  PRO A CG  1 
ATOM   1644 C  CD  . PRO A 1 252 ? 2.760   5.372   35.799  1.00 18.56 ? 241  PRO A CD  1 
ATOM   1645 N  N   . VAL A 1 253 ? 1.234   3.390   31.819  1.00 17.29 ? 242  VAL A N   1 
ATOM   1646 C  CA  . VAL A 1 253 ? 0.983   3.752   30.448  1.00 17.11 ? 242  VAL A CA  1 
ATOM   1647 C  C   . VAL A 1 253 ? -0.330  4.530   30.459  1.00 17.28 ? 242  VAL A C   1 
ATOM   1648 O  O   . VAL A 1 253 ? -1.334  4.087   31.041  1.00 17.63 ? 242  VAL A O   1 
ATOM   1649 C  CB  . VAL A 1 253 ? 1.017   2.515   29.517  1.00 17.35 ? 242  VAL A CB  1 
ATOM   1650 C  CG1 . VAL A 1 253 ? 0.140   1.370   30.058  1.00 16.96 ? 242  VAL A CG1 1 
ATOM   1651 C  CG2 . VAL A 1 253 ? 0.633   2.904   28.093  1.00 16.86 ? 242  VAL A CG2 1 
ATOM   1652 N  N   . CYS A 1 254 ? -0.315  5.710   29.858  1.00 16.79 ? 243  CYS A N   1 
ATOM   1653 C  CA  . CYS A 1 254 ? -1.469  6.570   29.929  1.00 17.34 ? 243  CYS A CA  1 
ATOM   1654 C  C   . CYS A 1 254 ? -2.061  6.733   28.553  1.00 18.13 ? 243  CYS A C   1 
ATOM   1655 O  O   . CYS A 1 254 ? -1.373  7.176   27.629  1.00 18.63 ? 243  CYS A O   1 
ATOM   1656 C  CB  . CYS A 1 254 ? -1.093  7.938   30.545  1.00 17.27 ? 243  CYS A CB  1 
ATOM   1657 S  SG  . CYS A 1 254 ? -0.721  7.866   32.312  1.00 15.27 ? 243  CYS A SG  1 
ATOM   1658 N  N   . PHE A 1 255 ? -3.327  6.349   28.411  1.00 17.97 ? 244  PHE A N   1 
ATOM   1659 C  CA  . PHE A 1 255 ? -4.032  6.447   27.124  1.00 19.12 ? 244  PHE A CA  1 
ATOM   1660 C  C   . PHE A 1 255 ? -5.056  7.570   27.152  1.00 20.89 ? 244  PHE A C   1 
ATOM   1661 O  O   . PHE A 1 255 ? -5.741  7.760   28.165  1.00 22.36 ? 244  PHE A O   1 
ATOM   1662 C  CB  . PHE A 1 255 ? -4.772  5.155   26.832  1.00 17.53 ? 244  PHE A CB  1 
ATOM   1663 C  CG  . PHE A 1 255 ? -3.878  3.968   26.688  1.00 17.77 ? 244  PHE A CG  1 
ATOM   1664 C  CD1 . PHE A 1 255 ? -3.286  3.671   25.453  1.00 17.45 ? 244  PHE A CD1 1 
ATOM   1665 C  CD2 . PHE A 1 255 ? -3.641  3.126   27.767  1.00 17.13 ? 244  PHE A CD2 1 
ATOM   1666 C  CE1 . PHE A 1 255 ? -2.451  2.565   25.311  1.00 17.98 ? 244  PHE A CE1 1 
ATOM   1667 C  CE2 . PHE A 1 255 ? -2.826  2.015   27.624  1.00 17.41 ? 244  PHE A CE2 1 
ATOM   1668 C  CZ  . PHE A 1 255 ? -2.222  1.733   26.399  1.00 17.55 ? 244  PHE A CZ  1 
ATOM   1669 N  N   . LEU A 1 256 ? -5.168  8.294   26.060  1.00 22.48 ? 245  LEU A N   1 
ATOM   1670 C  CA  . LEU A 1 256 ? -6.227  9.243   25.882  1.00 25.37 ? 245  LEU A CA  1 
ATOM   1671 C  C   . LEU A 1 256 ? -7.232  8.781   24.826  1.00 29.94 ? 245  LEU A C   1 
ATOM   1672 O  O   . LEU A 1 256 ? -8.284  8.272   25.172  1.00 31.71 ? 245  LEU A O   1 
ATOM   1673 C  CB  . LEU A 1 256 ? -5.678  10.601  25.513  1.00 26.88 ? 245  LEU A CB  1 
ATOM   1674 C  CG  . LEU A 1 256 ? -6.705  11.720  25.436  1.00 27.98 ? 245  LEU A CG  1 
ATOM   1675 C  CD1 . LEU A 1 256 ? -7.613  11.755  26.648  1.00 27.61 ? 245  LEU A CD1 1 
ATOM   1676 C  CD2 . LEU A 1 256 ? -6.016  13.043  25.264  1.00 27.49 ? 245  LEU A CD2 1 
ATOM   1677 O  OXT . LEU A 1 256 ? -7.197  8.963   23.670  1.00 30.35 ? 245  LEU A OXT 1 
ATOM   1678 N  N   . ILE B 1 39  ? -28.311 -9.047  33.849  1.00 44.92 ? 28   ILE B N   1 
ATOM   1679 C  CA  . ILE B 1 39  ? -27.826 -10.289 33.259  1.00 45.60 ? 28   ILE B CA  1 
ATOM   1680 C  C   . ILE B 1 39  ? -26.934 -10.014 32.053  1.00 44.57 ? 28   ILE B C   1 
ATOM   1681 O  O   . ILE B 1 39  ? -26.973 -8.929  31.474  1.00 42.83 ? 28   ILE B O   1 
ATOM   1682 C  CB  . ILE B 1 39  ? -28.989 -11.201 32.828  1.00 45.34 ? 28   ILE B CB  1 
ATOM   1683 N  N   . SER B 1 40  ? -26.134 -11.002 31.705  1.00 45.63 ? 29   SER B N   1 
ATOM   1684 C  CA  . SER B 1 40  ? -25.112 -10.903 30.699  1.00 45.49 ? 29   SER B CA  1 
ATOM   1685 C  C   . SER B 1 40  ? -25.480 -11.903 29.617  1.00 40.71 ? 29   SER B C   1 
ATOM   1686 O  O   . SER B 1 40  ? -25.912 -12.989 29.917  1.00 43.66 ? 29   SER B O   1 
ATOM   1687 C  CB  . SER B 1 40  ? -23.761 -11.242 31.321  1.00 48.16 ? 29   SER B CB  1 
ATOM   1688 O  OG  . SER B 1 40  ? -22.690 -10.572 30.695  1.00 48.72 ? 29   SER B OG  1 
ATOM   1689 N  N   . PRO B 1 41  ? -25.316 -11.535 28.361  1.00 36.23 ? 30   PRO B N   1 
ATOM   1690 C  CA  . PRO B 1 41  ? -25.917 -12.289 27.267  1.00 33.25 ? 30   PRO B CA  1 
ATOM   1691 C  C   . PRO B 1 41  ? -25.452 -13.719 27.256  1.00 31.10 ? 30   PRO B C   1 
ATOM   1692 O  O   . PRO B 1 41  ? -24.316 -13.962 27.555  1.00 32.33 ? 30   PRO B O   1 
ATOM   1693 C  CB  . PRO B 1 41  ? -25.411 -11.572 26.015  1.00 33.25 ? 30   PRO B CB  1 
ATOM   1694 C  CG  . PRO B 1 41  ? -24.416 -10.573 26.460  1.00 33.49 ? 30   PRO B CG  1 
ATOM   1695 C  CD  . PRO B 1 41  ? -24.633 -10.321 27.900  1.00 34.81 ? 30   PRO B CD  1 
ATOM   1696 N  N   . ASP B 1 42  ? -26.319 -14.654 26.926  1.00 27.41 ? 31   ASP B N   1 
ATOM   1697 C  CA  . ASP B 1 42  ? -25.942 -16.059 27.072  1.00 28.37 ? 31   ASP B CA  1 
ATOM   1698 C  C   . ASP B 1 42  ? -25.523 -16.798 25.788  1.00 26.46 ? 31   ASP B C   1 
ATOM   1699 O  O   . ASP B 1 42  ? -25.382 -18.014 25.801  1.00 25.34 ? 31   ASP B O   1 
ATOM   1700 C  CB  . ASP B 1 42  ? -27.045 -16.839 27.789  1.00 31.39 ? 31   ASP B CB  1 
ATOM   1701 C  CG  . ASP B 1 42  ? -28.354 -16.827 27.037  1.00 33.78 ? 31   ASP B CG  1 
ATOM   1702 O  OD1 . ASP B 1 42  ? -28.441 -16.269 25.917  1.00 33.50 ? 31   ASP B OD1 1 
ATOM   1703 O  OD2 . ASP B 1 42  ? -29.321 -17.381 27.590  1.00 40.93 ? 31   ASP B OD2 1 
ATOM   1704 N  N   . GLY B 1 43  ? -25.314 -16.069 24.697  1.00 23.78 ? 32   GLY B N   1 
ATOM   1705 C  CA  . GLY B 1 43  ? -24.830 -16.679 23.471  1.00 22.72 ? 32   GLY B CA  1 
ATOM   1706 C  C   . GLY B 1 43  ? -25.897 -17.319 22.605  1.00 22.46 ? 32   GLY B C   1 
ATOM   1707 O  O   . GLY B 1 43  ? -25.578 -18.093 21.718  1.00 20.61 ? 32   GLY B O   1 
ATOM   1708 N  N   . SER B 1 44  ? -27.169 -17.029 22.877  1.00 23.21 ? 33   SER B N   1 
ATOM   1709 C  CA  . SER B 1 44  ? -28.264 -17.490 22.006  1.00 23.47 ? 33   SER B CA  1 
ATOM   1710 C  C   . SER B 1 44  ? -28.404 -16.482 20.869  1.00 23.97 ? 33   SER B C   1 
ATOM   1711 O  O   . SER B 1 44  ? -27.864 -15.374 20.957  1.00 23.31 ? 33   SER B O   1 
ATOM   1712 C  CB  . SER B 1 44  ? -29.556 -17.506 22.806  1.00 23.27 ? 33   SER B CB  1 
ATOM   1713 O  OG  . SER B 1 44  ? -29.852 -16.174 23.194  1.00 23.64 ? 33   SER B OG  1 
ATOM   1714 N  N   . ARG B 1 45  ? -29.132 -16.836 19.812  1.00 24.22 ? 34   ARG B N   1 
ATOM   1715 C  CA  . ARG B 1 45  ? -29.372 -15.891 18.724  1.00 24.50 ? 34   ARG B CA  1 
ATOM   1716 C  C   . ARG B 1 45  ? -30.048 -14.604 19.199  1.00 24.54 ? 34   ARG B C   1 
ATOM   1717 O  O   . ARG B 1 45  ? -29.700 -13.531 18.757  1.00 24.56 ? 34   ARG B O   1 
ATOM   1718 C  CB  . ARG B 1 45  ? -30.176 -16.529 17.588  1.00 25.74 ? 34   ARG B CB  1 
ATOM   1719 C  CG  . ARG B 1 45  ? -30.222 -15.656 16.338  1.00 26.65 ? 34   ARG B CG  1 
ATOM   1720 C  CD  . ARG B 1 45  ? -30.664 -16.422 15.098  1.00 27.17 ? 34   ARG B CD  1 
ATOM   1721 N  NE  . ARG B 1 45  ? -30.501 -15.590 13.910  1.00 28.74 ? 34   ARG B NE  1 
ATOM   1722 C  CZ  . ARG B 1 45  ? -30.724 -15.989 12.658  1.00 30.50 ? 34   ARG B CZ  1 
ATOM   1723 N  NH1 . ARG B 1 45  ? -31.109 -17.237 12.394  1.00 31.06 ? 34   ARG B NH1 1 
ATOM   1724 N  NH2 . ARG B 1 45  ? -30.542 -15.128 11.669  1.00 31.20 ? 34   ARG B NH2 1 
ATOM   1725 N  N   . LYS B 1 46  ? -30.998 -14.709 20.118  1.00 26.26 ? 35   LYS B N   1 
ATOM   1726 C  CA  . LYS B 1 46  ? -31.631 -13.520 20.679  1.00 27.87 ? 35   LYS B CA  1 
ATOM   1727 C  C   . LYS B 1 46  ? -30.693 -12.637 21.530  1.00 26.22 ? 35   LYS B C   1 
ATOM   1728 O  O   . LYS B 1 46  ? -30.849 -11.415 21.567  1.00 25.52 ? 35   LYS B O   1 
ATOM   1729 C  CB  . LYS B 1 46  ? -32.884 -13.888 21.490  1.00 32.50 ? 35   LYS B CB  1 
ATOM   1730 C  CG  . LYS B 1 46  ? -33.665 -12.647 21.915  1.00 36.42 ? 35   LYS B CG  1 
ATOM   1731 C  CD  . LYS B 1 46  ? -35.047 -12.929 22.473  1.00 42.56 ? 35   LYS B CD  1 
ATOM   1732 C  CE  . LYS B 1 46  ? -35.818 -11.613 22.523  1.00 45.91 ? 35   LYS B CE  1 
ATOM   1733 N  NZ  . LYS B 1 46  ? -37.133 -11.728 23.216  1.00 51.11 ? 35   LYS B NZ  1 
ATOM   1734 N  N   . ASN B 1 47  ? -29.733 -13.270 22.207  1.00 24.68 ? 36   ASN B N   1 
ATOM   1735 C  CA  . ASN B 1 47  ? -28.824 -12.591 23.122  1.00 23.87 ? 36   ASN B CA  1 
ATOM   1736 C  C   . ASN B 1 47  ? -27.357 -13.007 22.873  1.00 21.74 ? 36   ASN B C   1 
ATOM   1737 O  O   . ASN B 1 47  ? -26.756 -13.707 23.700  1.00 19.81 ? 36   ASN B O   1 
ATOM   1738 C  CB  . ASN B 1 47  ? -29.216 -12.906 24.578  1.00 26.50 ? 36   ASN B CB  1 
ATOM   1739 C  CG  . ASN B 1 47  ? -30.611 -12.421 24.935  1.00 27.98 ? 36   ASN B CG  1 
ATOM   1740 O  OD1 . ASN B 1 47  ? -30.915 -11.244 24.820  1.00 30.58 ? 36   ASN B OD1 1 
ATOM   1741 N  ND2 . ASN B 1 47  ? -31.457 -13.332 25.390  1.00 30.11 ? 36   ASN B ND2 1 
ATOM   1742 N  N   . PRO B 1 48  ? -26.778 -12.601 21.725  1.00 20.33 ? 37   PRO B N   1 
ATOM   1743 C  CA  . PRO B 1 48  ? -25.417 -13.053 21.452  1.00 19.76 ? 37   PRO B CA  1 
ATOM   1744 C  C   . PRO B 1 48  ? -24.404 -12.429 22.410  1.00 19.69 ? 37   PRO B C   1 
ATOM   1745 O  O   . PRO B 1 48  ? -24.568 -11.284 22.807  1.00 19.70 ? 37   PRO B O   1 
ATOM   1746 C  CB  . PRO B 1 48  ? -25.166 -12.577 20.009  1.00 19.96 ? 37   PRO B CB  1 
ATOM   1747 C  CG  . PRO B 1 48  ? -26.095 -11.422 19.821  1.00 20.73 ? 37   PRO B CG  1 
ATOM   1748 C  CD  . PRO B 1 48  ? -27.316 -11.766 20.635  1.00 21.01 ? 37   PRO B CD  1 
ATOM   1749 N  N   . ALA B 1 49  ? -23.365 -13.176 22.774  1.00 19.23 ? 38   ALA B N   1 
ATOM   1750 C  CA  . ALA B 1 49  ? -22.243 -12.607 23.527  1.00 19.17 ? 38   ALA B CA  1 
ATOM   1751 C  C   . ALA B 1 49  ? -21.273 -11.879 22.584  1.00 19.41 ? 38   ALA B C   1 
ATOM   1752 O  O   . ALA B 1 49  ? -21.384 -12.009 21.376  1.00 19.54 ? 38   ALA B O   1 
ATOM   1753 C  CB  . ALA B 1 49  ? -21.537 -13.689 24.321  1.00 18.58 ? 38   ALA B CB  1 
ATOM   1754 N  N   . ARG B 1 50  ? -20.350 -11.090 23.131  1.00 19.18 ? 39   ARG B N   1 
ATOM   1755 C  CA  . ARG B 1 50  ? -19.389 -10.365 22.321  1.00 18.98 ? 39   ARG B CA  1 
ATOM   1756 C  C   . ARG B 1 50  ? -18.476 -11.349 21.564  1.00 19.54 ? 39   ARG B C   1 
ATOM   1757 O  O   . ARG B 1 50  ? -18.222 -11.186 20.367  1.00 17.99 ? 39   ARG B O   1 
ATOM   1758 C  CB  . ARG B 1 50  ? -18.553 -9.438  23.213  1.00 19.55 ? 39   ARG B CB  1 
ATOM   1759 C  CG  . ARG B 1 50  ? -17.522 -8.591  22.461  1.00 19.34 ? 39   ARG B CG  1 
ATOM   1760 C  CD  . ARG B 1 50  ? -16.788 -7.643  23.405  1.00 20.72 ? 39   ARG B CD  1 
ATOM   1761 N  NE  . ARG B 1 50  ? -15.799 -8.342  24.234  1.00 19.70 ? 39   ARG B NE  1 
ATOM   1762 C  CZ  . ARG B 1 50  ? -14.563 -8.661  23.843  1.00 20.74 ? 39   ARG B CZ  1 
ATOM   1763 N  NH1 . ARG B 1 50  ? -14.104 -8.342  22.623  1.00 20.02 ? 39   ARG B NH1 1 
ATOM   1764 N  NH2 . ARG B 1 50  ? -13.762 -9.299  24.680  1.00 20.22 ? 39   ARG B NH2 1 
ATOM   1765 N  N   . ASN B 1 51  ? -17.945 -12.327 22.304  1.00 18.63 ? 40   ASN B N   1 
ATOM   1766 C  CA  . ASN B 1 51  ? -17.222 -13.472 21.758  1.00 18.73 ? 40   ASN B CA  1 
ATOM   1767 C  C   . ASN B 1 51  ? -17.294 -14.634 22.738  1.00 19.17 ? 40   ASN B C   1 
ATOM   1768 O  O   . ASN B 1 51  ? -17.979 -14.520 23.772  1.00 18.72 ? 40   ASN B O   1 
ATOM   1769 C  CB  . ASN B 1 51  ? -15.777 -13.129 21.400  1.00 19.57 ? 40   ASN B CB  1 
ATOM   1770 C  CG  . ASN B 1 51  ? -14.981 -12.586 22.568  1.00 19.56 ? 40   ASN B CG  1 
ATOM   1771 O  OD1 . ASN B 1 51  ? -15.277 -12.849 23.722  1.00 20.12 ? 40   ASN B OD1 1 
ATOM   1772 N  ND2 . ASN B 1 51  ? -13.945 -11.828 22.254  1.00 20.45 ? 40   ASN B ND2 1 
ATOM   1773 N  N   . CYS B 1 52  ? -16.599 -15.733 22.431  1.00 18.44 ? 41   CYS B N   1 
ATOM   1774 C  CA  . CYS B 1 52  ? -16.613 -16.917 23.294  1.00 18.05 ? 41   CYS B CA  1 
ATOM   1775 C  C   . CYS B 1 52  ? -15.820 -16.736 24.599  1.00 18.81 ? 41   CYS B C   1 
ATOM   1776 O  O   . CYS B 1 52  ? -16.157 -17.351 25.610  1.00 19.28 ? 41   CYS B O   1 
ATOM   1777 C  CB  . CYS B 1 52  ? -16.090 -18.156 22.535  1.00 17.39 ? 41   CYS B CB  1 
ATOM   1778 S  SG  . CYS B 1 52  ? -17.108 -18.561 21.097  1.00 17.19 ? 41   CYS B SG  1 
ATOM   1779 N  N   . ARG B 1 53  ? -14.765 -15.921 24.582  1.00 19.02 ? 42   ARG B N   1 
ATOM   1780 C  CA  . ARG B 1 53  ? -14.039 -15.618 25.815  1.00 19.14 ? 42   ARG B CA  1 
ATOM   1781 C  C   . ARG B 1 53  ? -14.921 -14.919 26.832  1.00 20.33 ? 42   ARG B C   1 
ATOM   1782 O  O   . ARG B 1 53  ? -14.889 -15.251 28.015  1.00 21.04 ? 42   ARG B O   1 
ATOM   1783 C  CB  . ARG B 1 53  ? -12.791 -14.777 25.558  1.00 19.76 ? 42   ARG B CB  1 
ATOM   1784 C  CG  . ARG B 1 53  ? -11.862 -14.695 26.774  1.00 21.56 ? 42   ARG B CG  1 
ATOM   1785 C  CD  . ARG B 1 53  ? -11.284 -16.086 27.077  1.00 23.01 ? 42   ARG B CD  1 
ATOM   1786 N  NE  . ARG B 1 53  ? -10.428 -16.172 28.261  1.00 25.24 ? 42   ARG B NE  1 
ATOM   1787 C  CZ  . ARG B 1 53  ? -10.883 -16.257 29.513  1.00 27.08 ? 42   ARG B CZ  1 
ATOM   1788 N  NH1 . ARG B 1 53  ? -12.196 -16.228 29.755  1.00 26.67 ? 42   ARG B NH1 1 
ATOM   1789 N  NH2 . ARG B 1 53  ? -10.027 -16.360 30.530  1.00 25.92 ? 42   ARG B NH2 1 
ATOM   1790 N  N   . ASP B 1 54  ? -15.692 -13.933 26.376  1.00 22.43 ? 43   ASP B N   1 
ATOM   1791 C  CA  . ASP B 1 54  ? -16.636 -13.235 27.250  1.00 24.80 ? 43   ASP B CA  1 
ATOM   1792 C  C   . ASP B 1 54  ? -17.670 -14.188 27.786  1.00 26.78 ? 43   ASP B C   1 
ATOM   1793 O  O   . ASP B 1 54  ? -18.029 -14.123 28.959  1.00 29.57 ? 43   ASP B O   1 
ATOM   1794 C  CB  . ASP B 1 54  ? -17.351 -12.113 26.505  1.00 24.91 ? 43   ASP B CB  1 
ATOM   1795 C  CG  . ASP B 1 54  ? -16.556 -10.843 26.491  1.00 24.83 ? 43   ASP B CG  1 
ATOM   1796 O  OD1 . ASP B 1 54  ? -15.302 -10.930 26.538  1.00 25.16 ? 43   ASP B OD1 1 
ATOM   1797 O  OD2 . ASP B 1 54  ? -17.184 -9.767  26.426  1.00 24.83 ? 43   ASP B OD2 1 
ATOM   1798 N  N   . LEU B 1 55  ? -18.138 -15.077 26.917  1.00 26.39 ? 44   LEU B N   1 
ATOM   1799 C  CA  . LEU B 1 55  ? -19.164 -16.025 27.287  1.00 27.52 ? 44   LEU B CA  1 
ATOM   1800 C  C   . LEU B 1 55  ? -18.610 -17.006 28.311  1.00 27.51 ? 44   LEU B C   1 
ATOM   1801 O  O   . LEU B 1 55  ? -19.287 -17.347 29.270  1.00 26.74 ? 44   LEU B O   1 
ATOM   1802 C  CB  . LEU B 1 55  ? -19.700 -16.743 26.045  1.00 25.97 ? 44   LEU B CB  1 
ATOM   1803 C  CG  . LEU B 1 55  ? -20.937 -17.612 26.215  1.00 26.02 ? 44   LEU B CG  1 
ATOM   1804 C  CD1 . LEU B 1 55  ? -22.132 -16.788 26.692  1.00 24.65 ? 44   LEU B CD1 1 
ATOM   1805 C  CD2 . LEU B 1 55  ? -21.238 -18.330 24.897  1.00 24.88 ? 44   LEU B CD2 1 
ATOM   1806 N  N   . LYS B 1 56  ? -17.367 -17.437 28.123  1.00 29.09 ? 45   LYS B N   1 
ATOM   1807 C  CA  . LYS B 1 56  ? -16.705 -18.276 29.127  1.00 29.86 ? 45   LYS B CA  1 
ATOM   1808 C  C   . LYS B 1 56  ? -16.585 -17.567 30.488  1.00 31.38 ? 45   LYS B C   1 
ATOM   1809 O  O   . LYS B 1 56  ? -16.835 -18.192 31.510  1.00 33.17 ? 45   LYS B O   1 
ATOM   1810 C  CB  . LYS B 1 56  ? -15.338 -18.754 28.643  1.00 28.90 ? 45   LYS B CB  1 
ATOM   1811 C  CG  . LYS B 1 56  ? -14.544 -19.597 29.643  1.00 28.65 ? 45   LYS B CG  1 
ATOM   1812 C  CD  . LYS B 1 56  ? -13.195 -19.938 29.030  1.00 29.50 ? 45   LYS B CD  1 
ATOM   1813 C  CE  . LYS B 1 56  ? -12.163 -20.456 30.027  1.00 31.59 ? 45   LYS B CE  1 
ATOM   1814 N  NZ  . LYS B 1 56  ? -12.453 -21.876 30.356  1.00 34.36 ? 45   LYS B NZ  1 
ATOM   1815 N  N   . PHE B 1 57  ? -16.234 -16.274 30.483  1.00 30.60 ? 46   PHE B N   1 
ATOM   1816 C  CA  . PHE B 1 57  ? -15.964 -15.506 31.716  1.00 31.82 ? 46   PHE B CA  1 
ATOM   1817 C  C   . PHE B 1 57  ? -17.238 -15.343 32.511  1.00 32.98 ? 46   PHE B C   1 
ATOM   1818 O  O   . PHE B 1 57  ? -17.263 -15.582 33.715  1.00 34.18 ? 46   PHE B O   1 
ATOM   1819 C  CB  . PHE B 1 57  ? -15.395 -14.106 31.409  1.00 31.41 ? 46   PHE B CB  1 
ATOM   1820 C  CG  . PHE B 1 57  ? -14.363 -13.634 32.390  1.00 31.64 ? 46   PHE B CG  1 
ATOM   1821 C  CD1 . PHE B 1 57  ? -14.731 -13.142 33.633  1.00 33.39 ? 46   PHE B CD1 1 
ATOM   1822 C  CD2 . PHE B 1 57  ? -13.014 -13.649 32.057  1.00 33.40 ? 46   PHE B CD2 1 
ATOM   1823 C  CE1 . PHE B 1 57  ? -13.774 -12.700 34.543  1.00 34.70 ? 46   PHE B CE1 1 
ATOM   1824 C  CE2 . PHE B 1 57  ? -12.044 -13.213 32.961  1.00 33.30 ? 46   PHE B CE2 1 
ATOM   1825 C  CZ  . PHE B 1 57  ? -12.428 -12.735 34.207  1.00 35.38 ? 46   PHE B CZ  1 
ATOM   1826 N  N   . CYS B 1 58  ? -18.285 -14.930 31.811  1.00 33.66 ? 47   CYS B N   1 
ATOM   1827 C  CA  . CYS B 1 58  ? -19.580 -14.599 32.383  1.00 34.54 ? 47   CYS B CA  1 
ATOM   1828 C  C   . CYS B 1 58  ? -20.518 -15.822 32.572  1.00 34.51 ? 47   CYS B C   1 
ATOM   1829 O  O   . CYS B 1 58  ? -21.500 -15.755 33.311  1.00 36.26 ? 47   CYS B O   1 
ATOM   1830 C  CB  . CYS B 1 58  ? -20.244 -13.519 31.490  1.00 35.10 ? 47   CYS B CB  1 
ATOM   1831 S  SG  . CYS B 1 58  ? -20.202 -11.802 32.125  1.00 39.98 ? 47   CYS B SG  1 
ATOM   1832 N  N   . HIS B 1 59  ? -20.233 -16.931 31.895  1.00 32.33 ? 48   HIS B N   1 
ATOM   1833 C  CA  . HIS B 1 59  ? -21.100 -18.113 31.958  1.00 30.32 ? 48   HIS B CA  1 
ATOM   1834 C  C   . HIS B 1 59  ? -20.258 -19.357 31.968  1.00 30.99 ? 48   HIS B C   1 
ATOM   1835 O  O   . HIS B 1 59  ? -20.237 -20.120 30.991  1.00 29.44 ? 48   HIS B O   1 
ATOM   1836 C  CB  . HIS B 1 59  ? -22.067 -18.131 30.785  1.00 29.97 ? 48   HIS B CB  1 
ATOM   1837 C  CG  . HIS B 1 59  ? -23.179 -17.119 30.888  1.00 31.93 ? 48   HIS B CG  1 
ATOM   1838 N  ND1 . HIS B 1 59  ? -24.272 -17.307 31.661  1.00 31.93 ? 48   HIS B ND1 1 
ATOM   1839 C  CD2 . HIS B 1 59  ? -23.323 -15.862 30.303  1.00 32.87 ? 48   HIS B CD2 1 
ATOM   1840 C  CE1 . HIS B 1 59  ? -25.084 -16.237 31.558  1.00 32.48 ? 48   HIS B CE1 1 
ATOM   1841 N  NE2 . HIS B 1 59  ? -24.507 -15.356 30.721  1.00 33.26 ? 48   HIS B NE2 1 
ATOM   1842 N  N   . PRO B 1 60  ? -19.531 -19.586 33.073  1.00 31.23 ? 49   PRO B N   1 
ATOM   1843 C  CA  . PRO B 1 60  ? -18.565 -20.679 33.064  1.00 30.32 ? 49   PRO B CA  1 
ATOM   1844 C  C   . PRO B 1 60  ? -19.199 -22.070 33.093  1.00 30.71 ? 49   PRO B C   1 
ATOM   1845 O  O   . PRO B 1 60  ? -18.481 -23.058 32.941  1.00 32.45 ? 49   PRO B O   1 
ATOM   1846 C  CB  . PRO B 1 60  ? -17.729 -20.429 34.326  1.00 31.73 ? 49   PRO B CB  1 
ATOM   1847 C  CG  . PRO B 1 60  ? -18.619 -19.646 35.230  1.00 30.19 ? 49   PRO B CG  1 
ATOM   1848 C  CD  . PRO B 1 60  ? -19.562 -18.864 34.362  1.00 30.86 ? 49   PRO B CD  1 
ATOM   1849 N  N   . GLU B 1 61  ? -20.513 -22.120 33.246  1.00 30.50 ? 50   GLU B N   1 
ATOM   1850 C  CA  . GLU B 1 61  ? -21.320 -23.328 33.215  1.00 31.47 ? 50   GLU B CA  1 
ATOM   1851 C  C   . GLU B 1 61  ? -21.485 -23.927 31.815  1.00 30.93 ? 50   GLU B C   1 
ATOM   1852 O  O   . GLU B 1 61  ? -21.685 -25.100 31.670  1.00 30.45 ? 50   GLU B O   1 
ATOM   1853 C  CB  . GLU B 1 61  ? -22.697 -23.108 33.904  1.00 33.19 ? 50   GLU B CB  1 
ATOM   1854 C  CG  . GLU B 1 61  ? -23.817 -22.330 33.175  1.00 34.21 ? 50   GLU B CG  1 
ATOM   1855 C  CD  . GLU B 1 61  ? -23.619 -20.839 33.185  1.00 36.47 ? 50   GLU B CD  1 
ATOM   1856 O  OE1 . GLU B 1 61  ? -22.566 -20.487 33.681  1.00 38.82 ? 50   GLU B OE1 1 
ATOM   1857 O  OE2 . GLU B 1 61  ? -24.465 -20.014 32.751  1.00 36.70 ? 50   GLU B OE2 1 
ATOM   1858 N  N   . LEU B 1 62  ? -21.363 -23.104 30.799  1.00 28.23 ? 51   LEU B N   1 
ATOM   1859 C  CA  . LEU B 1 62  ? -21.675 -23.520 29.430  1.00 27.28 ? 51   LEU B CA  1 
ATOM   1860 C  C   . LEU B 1 62  ? -20.629 -24.434 28.808  1.00 26.26 ? 51   LEU B C   1 
ATOM   1861 O  O   . LEU B 1 62  ? -19.442 -24.221 28.952  1.00 26.17 ? 51   LEU B O   1 
ATOM   1862 C  CB  . LEU B 1 62  ? -21.928 -22.323 28.524  1.00 25.52 ? 51   LEU B CB  1 
ATOM   1863 C  CG  . LEU B 1 62  ? -23.090 -21.433 28.940  1.00 25.20 ? 51   LEU B CG  1 
ATOM   1864 C  CD1 . LEU B 1 62  ? -23.084 -20.187 28.074  1.00 24.25 ? 51   LEU B CD1 1 
ATOM   1865 C  CD2 . LEU B 1 62  ? -24.430 -22.153 28.842  1.00 26.17 ? 51   LEU B CD2 1 
ATOM   1866 N  N   . LYS B 1 63  ? -21.086 -25.446 28.088  1.00 24.95 ? 52   LYS B N   1 
ATOM   1867 C  CA  . LYS B 1 63  ? -20.177 -26.401 27.489  1.00 24.36 ? 52   LYS B CA  1 
ATOM   1868 C  C   . LYS B 1 63  ? -19.828 -26.004 26.051  1.00 22.79 ? 52   LYS B C   1 
ATOM   1869 O  O   . LYS B 1 63  ? -20.537 -25.223 25.413  1.00 21.92 ? 52   LYS B O   1 
ATOM   1870 C  CB  . LYS B 1 63  ? -20.819 -27.784 27.527  1.00 27.71 ? 52   LYS B CB  1 
ATOM   1871 C  CG  . LYS B 1 63  ? -21.094 -28.300 28.941  1.00 28.14 ? 52   LYS B CG  1 
ATOM   1872 C  CD  . LYS B 1 63  ? -21.803 -29.638 28.875  1.00 29.87 ? 52   LYS B CD  1 
ATOM   1873 C  CE  . LYS B 1 63  ? -22.332 -30.028 30.245  1.00 32.55 ? 52   LYS B CE  1 
ATOM   1874 N  NZ  . LYS B 1 63  ? -21.202 -30.513 31.088  1.00 37.86 ? 52   LYS B NZ  1 
ATOM   1875 N  N   . SER B 1 64  ? -18.728 -26.539 25.553  1.00 21.77 ? 53   SER B N   1 
ATOM   1876 C  CA  . SER B 1 64  ? -18.302 -26.281 24.196  1.00 21.49 ? 53   SER B CA  1 
ATOM   1877 C  C   . SER B 1 64  ? -19.397 -26.615 23.212  1.00 22.00 ? 53   SER B C   1 
ATOM   1878 O  O   . SER B 1 64  ? -20.043 -27.675 23.291  1.00 22.15 ? 53   SER B O   1 
ATOM   1879 C  CB  . SER B 1 64  ? -17.053 -27.078 23.877  1.00 21.19 ? 53   SER B CB  1 
ATOM   1880 O  OG  . SER B 1 64  ? -16.028 -26.686 24.762  1.00 21.50 ? 53   SER B OG  1 
ATOM   1881 N  N   . GLY B 1 65  ? -19.606 -25.710 22.270  1.00 20.45 ? 54   GLY B N   1 
ATOM   1882 C  CA  . GLY B 1 65  ? -20.620 -25.932 21.277  1.00 19.78 ? 54   GLY B CA  1 
ATOM   1883 C  C   . GLY B 1 65  ? -20.905 -24.683 20.494  1.00 20.06 ? 54   GLY B C   1 
ATOM   1884 O  O   . GLY B 1 65  ? -20.106 -23.743 20.476  1.00 18.69 ? 54   GLY B O   1 
ATOM   1885 N  N   . GLU B 1 66  ? -22.073 -24.687 19.866  1.00 20.44 ? 55   GLU B N   1 
ATOM   1886 C  CA  . GLU B 1 66  ? -22.488 -23.650 18.956  1.00 21.22 ? 55   GLU B CA  1 
ATOM   1887 C  C   . GLU B 1 66  ? -23.156 -22.502 19.709  1.00 20.37 ? 55   GLU B C   1 
ATOM   1888 O  O   . GLU B 1 66  ? -24.086 -22.735 20.483  1.00 20.26 ? 55   GLU B O   1 
ATOM   1889 C  CB  . GLU B 1 66  ? -23.475 -24.256 17.957  1.00 24.41 ? 55   GLU B CB  1 
ATOM   1890 C  CG  . GLU B 1 66  ? -24.194 -23.231 17.101  1.00 26.20 ? 55   GLU B CG  1 
ATOM   1891 C  CD  . GLU B 1 66  ? -25.004 -23.911 16.025  1.00 29.94 ? 55   GLU B CD  1 
ATOM   1892 O  OE1 . GLU B 1 66  ? -26.182 -24.240 16.288  1.00 32.54 ? 55   GLU B OE1 1 
ATOM   1893 O  OE2 . GLU B 1 66  ? -24.442 -24.141 14.932  1.00 32.86 ? 55   GLU B OE2 1 
ATOM   1894 N  N   . TYR B 1 67  ? -22.684 -21.277 19.476  1.00 19.18 ? 56   TYR B N   1 
ATOM   1895 C  CA  . TYR B 1 67  ? -23.287 -20.093 20.069  1.00 18.78 ? 56   TYR B CA  1 
ATOM   1896 C  C   . TYR B 1 67  ? -23.253 -18.988 19.032  1.00 19.92 ? 56   TYR B C   1 
ATOM   1897 O  O   . TYR B 1 67  ? -22.596 -19.125 17.978  1.00 18.82 ? 56   TYR B O   1 
ATOM   1898 C  CB  . TYR B 1 67  ? -22.523 -19.637 21.332  1.00 18.39 ? 56   TYR B CB  1 
ATOM   1899 C  CG  . TYR B 1 67  ? -22.553 -20.677 22.443  1.00 19.20 ? 56   TYR B CG  1 
ATOM   1900 C  CD1 . TYR B 1 67  ? -21.591 -21.687 22.506  1.00 18.74 ? 56   TYR B CD1 1 
ATOM   1901 C  CD2 . TYR B 1 67  ? -23.576 -20.681 23.400  1.00 18.72 ? 56   TYR B CD2 1 
ATOM   1902 C  CE1 . TYR B 1 67  ? -21.636 -22.659 23.505  1.00 19.39 ? 56   TYR B CE1 1 
ATOM   1903 C  CE2 . TYR B 1 67  ? -23.624 -21.642 24.403  1.00 19.05 ? 56   TYR B CE2 1 
ATOM   1904 C  CZ  . TYR B 1 67  ? -22.646 -22.635 24.453  1.00 19.33 ? 56   TYR B CZ  1 
ATOM   1905 O  OH  . TYR B 1 67  ? -22.682 -23.606 25.456  1.00 19.20 ? 56   TYR B OH  1 
ATOM   1906 N  N   . TRP B 1 68  ? -23.955 -17.898 19.345  1.00 18.71 ? 57   TRP B N   1 
ATOM   1907 C  CA  . TRP B 1 68  ? -23.981 -16.706 18.523  1.00 18.95 ? 57   TRP B CA  1 
ATOM   1908 C  C   . TRP B 1 68  ? -23.200 -15.623 19.192  1.00 18.79 ? 57   TRP B C   1 
ATOM   1909 O  O   . TRP B 1 68  ? -23.360 -15.382 20.407  1.00 18.90 ? 57   TRP B O   1 
ATOM   1910 C  CB  . TRP B 1 68  ? -25.410 -16.258 18.351  1.00 20.24 ? 57   TRP B CB  1 
ATOM   1911 C  CG  . TRP B 1 68  ? -26.189 -17.195 17.461  1.00 21.27 ? 57   TRP B CG  1 
ATOM   1912 C  CD1 . TRP B 1 68  ? -26.772 -18.410 17.818  1.00 21.05 ? 57   TRP B CD1 1 
ATOM   1913 C  CD2 . TRP B 1 68  ? -26.488 -17.029 16.021  1.00 20.59 ? 57   TRP B CD2 1 
ATOM   1914 N  NE1 . TRP B 1 68  ? -27.401 -18.970 16.741  1.00 22.71 ? 57   TRP B NE1 1 
ATOM   1915 C  CE2 . TRP B 1 68  ? -27.289 -18.188 15.639  1.00 21.48 ? 57   TRP B CE2 1 
ATOM   1916 C  CE3 . TRP B 1 68  ? -26.227 -16.046 15.074  1.00 20.23 ? 57   TRP B CE3 1 
ATOM   1917 C  CZ2 . TRP B 1 68  ? -27.766 -18.363 14.338  1.00 20.90 ? 57   TRP B CZ2 1 
ATOM   1918 C  CZ3 . TRP B 1 68  ? -26.717 -16.220 13.778  1.00 20.22 ? 57   TRP B CZ3 1 
ATOM   1919 C  CH2 . TRP B 1 68  ? -27.452 -17.359 13.412  1.00 20.38 ? 57   TRP B CH2 1 
ATOM   1920 N  N   . VAL B 1 69  ? -22.312 -14.983 18.436  1.00 17.51 ? 58   VAL B N   1 
ATOM   1921 C  CA  . VAL B 1 69  ? -21.485 -13.909 18.998  1.00 17.67 ? 58   VAL B CA  1 
ATOM   1922 C  C   . VAL B 1 69  ? -21.559 -12.663 18.114  1.00 18.53 ? 58   VAL B C   1 
ATOM   1923 O  O   . VAL B 1 69  ? -21.845 -12.771 16.926  1.00 17.88 ? 58   VAL B O   1 
ATOM   1924 C  CB  . VAL B 1 69  ? -20.013 -14.334 19.245  1.00 18.00 ? 58   VAL B CB  1 
ATOM   1925 C  CG1 . VAL B 1 69  ? -19.939 -15.494 20.254  1.00 17.12 ? 58   VAL B CG1 1 
ATOM   1926 C  CG2 . VAL B 1 69  ? -19.301 -14.698 17.943  1.00 16.27 ? 58   VAL B CG2 1 
ATOM   1927 N  N   . ASP B 1 70  ? -21.311 -11.488 18.700  1.00 18.39 ? 59   ASP B N   1 
ATOM   1928 C  CA  . ASP B 1 70  ? -21.504 -10.239 18.000  1.00 17.79 ? 59   ASP B CA  1 
ATOM   1929 C  C   . ASP B 1 70  ? -20.344 -9.332  18.311  1.00 17.08 ? 59   ASP B C   1 
ATOM   1930 O  O   . ASP B 1 70  ? -20.470 -8.387  19.098  1.00 16.97 ? 59   ASP B O   1 
ATOM   1931 C  CB  . ASP B 1 70  ? -22.826 -9.587  18.418  1.00 18.90 ? 59   ASP B CB  1 
ATOM   1932 C  CG  . ASP B 1 70  ? -23.194 -8.386  17.537  1.00 20.00 ? 59   ASP B CG  1 
ATOM   1933 O  OD1 . ASP B 1 70  ? -22.777 -8.344  16.354  1.00 20.08 ? 59   ASP B OD1 1 
ATOM   1934 O  OD2 . ASP B 1 70  ? -23.920 -7.492  18.011  1.00 19.75 ? 59   ASP B OD2 1 
ATOM   1935 N  N   . PRO B 1 71  ? -19.193 -9.623  17.705  1.00 17.72 ? 60   PRO B N   1 
ATOM   1936 C  CA  . PRO B 1 71  ? -17.965 -8.870  17.997  1.00 17.52 ? 60   PRO B CA  1 
ATOM   1937 C  C   . PRO B 1 71  ? -18.130 -7.371  17.835  1.00 17.74 ? 60   PRO B C   1 
ATOM   1938 O  O   . PRO B 1 71  ? -17.501 -6.627  18.568  1.00 16.28 ? 60   PRO B O   1 
ATOM   1939 C  CB  . PRO B 1 71  ? -16.967 -9.398  16.969  1.00 17.16 ? 60   PRO B CB  1 
ATOM   1940 C  CG  . PRO B 1 71  ? -17.460 -10.774 16.656  1.00 17.32 ? 60   PRO B CG  1 
ATOM   1941 C  CD  . PRO B 1 71  ? -18.951 -10.739 16.762  1.00 17.36 ? 60   PRO B CD  1 
ATOM   1942 N  N   . ASN B 1 72  ? -18.965 -6.933  16.891  1.00 18.32 ? 61   ASN B N   1 
ATOM   1943 C  CA  . ASN B 1 72  ? -19.133 -5.493  16.687  1.00 18.96 ? 61   ASN B CA  1 
ATOM   1944 C  C   . ASN B 1 72  ? -20.194 -4.840  17.577  1.00 19.44 ? 61   ASN B C   1 
ATOM   1945 O  O   . ASN B 1 72  ? -20.406 -3.636  17.486  1.00 19.09 ? 61   ASN B O   1 
ATOM   1946 C  CB  . ASN B 1 72  ? -19.320 -5.137  15.205  1.00 18.45 ? 61   ASN B CB  1 
ATOM   1947 C  CG  . ASN B 1 72  ? -20.659 -5.577  14.631  1.00 18.76 ? 61   ASN B CG  1 
ATOM   1948 O  OD1 . ASN B 1 72  ? -21.564 -6.053  15.335  1.00 18.24 ? 61   ASN B OD1 1 
ATOM   1949 N  ND2 . ASN B 1 72  ? -20.799 -5.383  13.321  1.00 17.55 ? 61   ASN B ND2 1 
ATOM   1950 N  N   . GLN B 1 73  ? -20.835 -5.638  18.437  1.00 19.01 ? 62   GLN B N   1 
ATOM   1951 C  CA  . GLN B 1 73  ? -21.853 -5.153  19.383  1.00 20.08 ? 62   GLN B CA  1 
ATOM   1952 C  C   . GLN B 1 73  ? -22.933 -4.341  18.672  1.00 20.47 ? 62   GLN B C   1 
ATOM   1953 O  O   . GLN B 1 73  ? -23.367 -4.734  17.589  1.00 20.94 ? 62   GLN B O   1 
ATOM   1954 C  CB  . GLN B 1 73  ? -21.221 -4.378  20.555  1.00 20.58 ? 62   GLN B CB  1 
ATOM   1955 C  CG  . GLN B 1 73  ? -20.312 -5.232  21.438  1.00 22.22 ? 62   GLN B CG  1 
ATOM   1956 C  CD  . GLN B 1 73  ? -21.082 -6.299  22.191  1.00 23.62 ? 62   GLN B CD  1 
ATOM   1957 O  OE1 . GLN B 1 73  ? -21.304 -7.425  21.692  1.00 25.30 ? 62   GLN B OE1 1 
ATOM   1958 N  NE2 . GLN B 1 73  ? -21.521 -5.953  23.385  1.00 22.90 ? 62   GLN B NE2 1 
ATOM   1959 N  N   . GLY B 1 74  ? -23.381 -3.236  19.268  1.00 21.42 ? 63   GLY B N   1 
ATOM   1960 C  CA  . GLY B 1 74  ? -24.481 -2.438  18.681  1.00 22.48 ? 63   GLY B CA  1 
ATOM   1961 C  C   . GLY B 1 74  ? -25.692 -3.335  18.465  1.00 22.60 ? 63   GLY B C   1 
ATOM   1962 O  O   . GLY B 1 74  ? -26.014 -4.134  19.330  1.00 23.09 ? 63   GLY B O   1 
ATOM   1963 N  N   . CYS B 1 75  ? -26.320 -3.247  17.297  1.00 24.15 ? 64   CYS B N   1 
ATOM   1964 C  CA  . CYS B 1 75  ? -27.422 -4.152  16.910  1.00 25.37 ? 64   CYS B CA  1 
ATOM   1965 C  C   . CYS B 1 75  ? -27.057 -5.651  16.999  1.00 24.10 ? 64   CYS B C   1 
ATOM   1966 O  O   . CYS B 1 75  ? -25.996 -6.069  16.548  1.00 23.86 ? 64   CYS B O   1 
ATOM   1967 C  CB  . CYS B 1 75  ? -27.863 -3.828  15.483  1.00 27.27 ? 64   CYS B CB  1 
ATOM   1968 S  SG  . CYS B 1 75  ? -29.474 -4.463  14.994  1.00 27.27 ? 64   CYS B SG  1 
ATOM   1969 N  N   . LYS B 1 76  ? -27.956 -6.451  17.557  1.00 25.02 ? 65   LYS B N   1 
ATOM   1970 C  CA  . LYS B 1 76  ? -27.741 -7.895  17.711  1.00 26.43 ? 65   LYS B CA  1 
ATOM   1971 C  C   . LYS B 1 76  ? -27.935 -8.675  16.396  1.00 24.52 ? 65   LYS B C   1 
ATOM   1972 O  O   . LYS B 1 76  ? -27.521 -9.828  16.265  1.00 21.79 ? 65   LYS B O   1 
ATOM   1973 C  CB  . LYS B 1 76  ? -28.717 -8.455  18.744  1.00 29.50 ? 65   LYS B CB  1 
ATOM   1974 C  CG  . LYS B 1 76  ? -28.608 -7.876  20.154  1.00 33.86 ? 65   LYS B CG  1 
ATOM   1975 C  CD  . LYS B 1 76  ? -29.859 -8.277  20.943  1.00 37.20 ? 65   LYS B CD  1 
ATOM   1976 C  CE  . LYS B 1 76  ? -29.744 -8.057  22.445  1.00 39.34 ? 65   LYS B CE  1 
ATOM   1977 N  NZ  . LYS B 1 76  ? -29.692 -6.608  22.782  1.00 41.61 ? 65   LYS B NZ  1 
ATOM   1978 N  N   . LEU B 1 77  ? -28.561 -8.034  15.420  1.00 24.09 ? 66   LEU B N   1 
ATOM   1979 C  CA  . LEU B 1 77  ? -29.123 -8.767  14.286  1.00 23.83 ? 66   LEU B CA  1 
ATOM   1980 C  C   . LEU B 1 77  ? -28.092 -9.283  13.297  1.00 23.25 ? 66   LEU B C   1 
ATOM   1981 O  O   . LEU B 1 77  ? -28.379 -10.208 12.542  1.00 22.29 ? 66   LEU B O   1 
ATOM   1982 C  CB  . LEU B 1 77  ? -30.198 -7.931  13.595  1.00 25.30 ? 66   LEU B CB  1 
ATOM   1983 C  CG  . LEU B 1 77  ? -31.440 -7.770  14.488  1.00 26.75 ? 66   LEU B CG  1 
ATOM   1984 C  CD1 . LEU B 1 77  ? -32.450 -6.804  13.880  1.00 27.42 ? 66   LEU B CD1 1 
ATOM   1985 C  CD2 . LEU B 1 77  ? -32.073 -9.143  14.712  1.00 27.62 ? 66   LEU B CD2 1 
ATOM   1986 N  N   . ASP B 1 78  ? -26.887 -8.704  13.331  1.00 21.72 ? 67   ASP B N   1 
ATOM   1987 C  CA  . ASP B 1 78  ? -25.802 -9.149  12.462  1.00 20.78 ? 67   ASP B CA  1 
ATOM   1988 C  C   . ASP B 1 78  ? -24.810 -10.110 13.160  1.00 19.30 ? 67   ASP B C   1 
ATOM   1989 O  O   . ASP B 1 78  ? -23.664 -10.271 12.712  1.00 18.79 ? 67   ASP B O   1 
ATOM   1990 C  CB  . ASP B 1 78  ? -25.085 -7.944  11.809  1.00 20.62 ? 67   ASP B CB  1 
ATOM   1991 C  CG  . ASP B 1 78  ? -24.399 -7.017  12.821  1.00 21.94 ? 67   ASP B CG  1 
ATOM   1992 O  OD1 . ASP B 1 78  ? -24.524 -7.229  14.064  1.00 21.32 ? 67   ASP B OD1 1 
ATOM   1993 O  OD2 . ASP B 1 78  ? -23.701 -6.061  12.359  1.00 21.99 ? 67   ASP B OD2 1 
ATOM   1994 N  N   . ALA B 1 79  ? -25.264 -10.757 14.232  1.00 18.21 ? 68   ALA B N   1 
ATOM   1995 C  CA  . ALA B 1 79  ? -24.447 -11.747 14.951  1.00 17.91 ? 68   ALA B CA  1 
ATOM   1996 C  C   . ALA B 1 79  ? -24.054 -12.906 14.056  1.00 17.67 ? 68   ALA B C   1 
ATOM   1997 O  O   . ALA B 1 79  ? -24.742 -13.200 13.075  1.00 18.53 ? 68   ALA B O   1 
ATOM   1998 C  CB  . ALA B 1 79  ? -25.190 -12.274 16.163  1.00 17.62 ? 68   ALA B CB  1 
ATOM   1999 N  N   . ILE B 1 80  ? -22.948 -13.556 14.409  1.00 17.97 ? 69   ILE B N   1 
ATOM   2000 C  CA  . ILE B 1 80  ? -22.409 -14.691 13.669  1.00 18.77 ? 69   ILE B CA  1 
ATOM   2001 C  C   . ILE B 1 80  ? -22.460 -15.948 14.507  1.00 19.24 ? 69   ILE B C   1 
ATOM   2002 O  O   . ILE B 1 80  ? -22.409 -15.905 15.743  1.00 18.80 ? 69   ILE B O   1 
ATOM   2003 C  CB  . ILE B 1 80  ? -20.969 -14.461 13.137  1.00 19.42 ? 69   ILE B CB  1 
ATOM   2004 C  CG1 . ILE B 1 80  ? -19.996 -14.122 14.267  1.00 20.65 ? 69   ILE B CG1 1 
ATOM   2005 C  CG2 . ILE B 1 80  ? -20.947 -13.367 12.067  1.00 19.99 ? 69   ILE B CG2 1 
ATOM   2006 C  CD1 . ILE B 1 80  ? -18.547 -14.089 13.817  1.00 20.68 ? 69   ILE B CD1 1 
ATOM   2007 N  N   . LYS B 1 81  ? -22.580 -17.073 13.827  1.00 19.01 ? 70   LYS B N   1 
ATOM   2008 C  CA  . LYS B 1 81  ? -22.714 -18.328 14.512  1.00 20.58 ? 70   LYS B CA  1 
ATOM   2009 C  C   . LYS B 1 81  ? -21.357 -19.017 14.538  1.00 18.93 ? 70   LYS B C   1 
ATOM   2010 O  O   . LYS B 1 81  ? -20.679 -19.118 13.504  1.00 18.38 ? 70   LYS B O   1 
ATOM   2011 C  CB  . LYS B 1 81  ? -23.775 -19.179 13.810  1.00 22.89 ? 70   LYS B CB  1 
ATOM   2012 C  CG  . LYS B 1 81  ? -24.129 -20.437 14.567  1.00 26.93 ? 70   LYS B CG  1 
ATOM   2013 C  CD  . LYS B 1 81  ? -25.247 -21.190 13.863  1.00 31.29 ? 70   LYS B CD  1 
ATOM   2014 C  CE  . LYS B 1 81  ? -24.746 -21.867 12.599  1.00 35.17 ? 70   LYS B CE  1 
ATOM   2015 N  NZ  . LYS B 1 81  ? -25.915 -22.244 11.750  1.00 39.57 ? 70   LYS B NZ  1 
ATOM   2016 N  N   . VAL B 1 82  ? -20.944 -19.461 15.725  1.00 17.29 ? 71   VAL B N   1 
ATOM   2017 C  CA  . VAL B 1 82  ? -19.593 -19.968 15.897  1.00 16.64 ? 71   VAL B CA  1 
ATOM   2018 C  C   . VAL B 1 82  ? -19.573 -21.219 16.764  1.00 16.94 ? 71   VAL B C   1 
ATOM   2019 O  O   . VAL B 1 82  ? -20.578 -21.544 17.406  1.00 16.74 ? 71   VAL B O   1 
ATOM   2020 C  CB  . VAL B 1 82  ? -18.652 -18.893 16.514  1.00 16.65 ? 71   VAL B CB  1 
ATOM   2021 C  CG1 . VAL B 1 82  ? -18.616 -17.637 15.669  1.00 16.30 ? 71   VAL B CG1 1 
ATOM   2022 C  CG2 . VAL B 1 82  ? -19.058 -18.559 17.947  1.00 16.31 ? 71   VAL B CG2 1 
ATOM   2023 N  N   . PHE B 1 83  ? -18.427 -21.907 16.790  1.00 16.56 ? 72   PHE B N   1 
ATOM   2024 C  CA  . PHE B 1 83  ? -18.150 -22.899 17.827  1.00 17.81 ? 72   PHE B CA  1 
ATOM   2025 C  C   . PHE B 1 83  ? -17.352 -22.213 18.953  1.00 17.30 ? 72   PHE B C   1 
ATOM   2026 O  O   . PHE B 1 83  ? -16.313 -21.598 18.672  1.00 16.66 ? 72   PHE B O   1 
ATOM   2027 C  CB  . PHE B 1 83  ? -17.360 -24.103 17.258  1.00 17.44 ? 72   PHE B CB  1 
ATOM   2028 C  CG  . PHE B 1 83  ? -16.980 -25.145 18.308  1.00 17.93 ? 72   PHE B CG  1 
ATOM   2029 C  CD1 . PHE B 1 83  ? -17.895 -26.114 18.718  1.00 17.70 ? 72   PHE B CD1 1 
ATOM   2030 C  CD2 . PHE B 1 83  ? -15.701 -25.160 18.876  1.00 17.65 ? 72   PHE B CD2 1 
ATOM   2031 C  CE1 . PHE B 1 83  ? -17.541 -27.079 19.666  1.00 18.26 ? 72   PHE B CE1 1 
ATOM   2032 C  CE2 . PHE B 1 83  ? -15.343 -26.119 19.824  1.00 18.10 ? 72   PHE B CE2 1 
ATOM   2033 C  CZ  . PHE B 1 83  ? -16.257 -27.088 20.218  1.00 17.58 ? 72   PHE B CZ  1 
ATOM   2034 N  N   . CYS B 1 84  ? -17.834 -22.305 20.200  1.00 16.77 ? 73   CYS B N   1 
ATOM   2035 C  CA  . CYS B 1 84  ? -17.052 -21.853 21.366  1.00 17.42 ? 73   CYS B CA  1 
ATOM   2036 C  C   . CYS B 1 84  ? -16.391 -23.061 22.003  1.00 18.33 ? 73   CYS B C   1 
ATOM   2037 O  O   . CYS B 1 84  ? -17.079 -23.995 22.451  1.00 18.76 ? 73   CYS B O   1 
ATOM   2038 C  CB  . CYS B 1 84  ? -17.908 -21.135 22.421  1.00 16.41 ? 73   CYS B CB  1 
ATOM   2039 S  SG  . CYS B 1 84  ? -18.664 -19.567 21.911  1.00 15.41 ? 73   CYS B SG  1 
ATOM   2040 N  N   . ASN B 1 85  ? -15.060 -23.069 22.007  1.00 19.66 ? 74   ASN B N   1 
ATOM   2041 C  CA  . ASN B 1 85  ? -14.318 -23.991 22.876  1.00 20.71 ? 74   ASN B CA  1 
ATOM   2042 C  C   . ASN B 1 85  ? -14.325 -23.391 24.282  1.00 20.98 ? 74   ASN B C   1 
ATOM   2043 O  O   . ASN B 1 85  ? -13.588 -22.444 24.559  1.00 21.77 ? 74   ASN B O   1 
ATOM   2044 C  CB  . ASN B 1 85  ? -12.880 -24.192 22.366  1.00 20.51 ? 74   ASN B CB  1 
ATOM   2045 C  CG  . ASN B 1 85  ? -12.148 -25.332 23.089  1.00 20.53 ? 74   ASN B CG  1 
ATOM   2046 O  OD1 . ASN B 1 85  ? -12.308 -25.510 24.285  1.00 20.94 ? 74   ASN B OD1 1 
ATOM   2047 N  ND2 . ASN B 1 85  ? -11.336 -26.092 22.360  1.00 19.46 ? 74   ASN B ND2 1 
HETATM 2048 N  N   . MSE B 1 86  ? -15.166 -23.925 25.162  1.00 20.96 ? 75   MSE B N   1 
HETATM 2049 C  CA  . MSE B 1 86  ? -15.285 -23.381 26.519  1.00 22.51 ? 75   MSE B CA  1 
HETATM 2050 C  C   . MSE B 1 86  ? -14.142 -23.752 27.444  1.00 23.28 ? 75   MSE B C   1 
HETATM 2051 O  O   . MSE B 1 86  ? -14.015 -23.178 28.523  1.00 22.92 ? 75   MSE B O   1 
HETATM 2052 C  CB  . MSE B 1 86  ? -16.629 -23.736 27.148  1.00 25.06 ? 75   MSE B CB  1 
HETATM 2053 C  CG  . MSE B 1 86  ? -17.756 -23.134 26.331  1.00 28.53 ? 75   MSE B CG  1 
HETATM 2054 SE SE  . MSE B 1 86  ? -17.555 -21.171 26.272  1.00 37.37 ? 75   MSE B SE  1 
HETATM 2055 C  CE  . MSE B 1 86  ? -19.459 -20.889 25.911  1.00 34.28 ? 75   MSE B CE  1 
ATOM   2056 N  N   . GLU B 1 87  ? -13.277 -24.677 27.033  1.00 22.62 ? 76   GLU B N   1 
ATOM   2057 C  CA  . GLU B 1 87  ? -12.099 -24.972 27.834  1.00 23.87 ? 76   GLU B CA  1 
ATOM   2058 C  C   . GLU B 1 87  ? -11.049 -23.855 27.631  1.00 24.88 ? 76   GLU B C   1 
ATOM   2059 O  O   . GLU B 1 87  ? -10.508 -23.299 28.597  1.00 24.85 ? 76   GLU B O   1 
ATOM   2060 C  CB  . GLU B 1 87  ? -11.560 -26.374 27.495  1.00 23.56 ? 76   GLU B CB  1 
ATOM   2061 C  CG  . GLU B 1 87  ? -10.598 -26.923 28.538  1.00 27.70 ? 76   GLU B CG  1 
ATOM   2062 N  N   . THR B 1 88  ? -10.813 -23.483 26.373  1.00 24.61 ? 77   THR B N   1 
ATOM   2063 C  CA  . THR B 1 88  ? -9.812  -22.459 26.038  1.00 25.17 ? 77   THR B CA  1 
ATOM   2064 C  C   . THR B 1 88  ? -10.378 -21.039 25.944  1.00 26.00 ? 77   THR B C   1 
ATOM   2065 O  O   . THR B 1 88  ? -9.637  -20.084 26.091  1.00 27.65 ? 77   THR B O   1 
ATOM   2066 C  CB  . THR B 1 88  ? -9.118  -22.763 24.698  1.00 25.67 ? 77   THR B CB  1 
ATOM   2067 O  OG1 . THR B 1 88  ? -10.103 -22.792 23.659  1.00 26.33 ? 77   THR B OG1 1 
ATOM   2068 C  CG2 . THR B 1 88  ? -8.412  -24.110 24.734  1.00 24.97 ? 77   THR B CG2 1 
ATOM   2069 N  N   . GLY B 1 89  ? -11.682 -20.907 25.694  1.00 25.72 ? 78   GLY B N   1 
ATOM   2070 C  CA  . GLY B 1 89  ? -12.309 -19.611 25.484  1.00 22.62 ? 78   GLY B CA  1 
ATOM   2071 C  C   . GLY B 1 89  ? -12.256 -19.127 24.048  1.00 20.67 ? 78   GLY B C   1 
ATOM   2072 O  O   . GLY B 1 89  ? -12.569 -17.978 23.771  1.00 19.66 ? 78   GLY B O   1 
ATOM   2073 N  N   . GLU B 1 90  ? -11.837 -20.001 23.144  1.00 20.03 ? 79   GLU B N   1 
ATOM   2074 C  CA  . GLU B 1 90  ? -11.634 -19.659 21.750  1.00 20.00 ? 79   GLU B CA  1 
ATOM   2075 C  C   . GLU B 1 90  ? -12.943 -19.550 20.975  1.00 18.93 ? 79   GLU B C   1 
ATOM   2076 O  O   . GLU B 1 90  ? -13.850 -20.347 21.174  1.00 18.20 ? 79   GLU B O   1 
ATOM   2077 C  CB  . GLU B 1 90  ? -10.786 -20.723 21.065  1.00 21.45 ? 79   GLU B CB  1 
ATOM   2078 C  CG  . GLU B 1 90  ? -9.289  -20.695 21.331  1.00 22.74 ? 79   GLU B CG  1 
ATOM   2079 C  CD  . GLU B 1 90  ? -8.649  -21.970 20.824  1.00 24.60 ? 79   GLU B CD  1 
ATOM   2080 O  OE1 . GLU B 1 90  ? -9.011  -23.058 21.338  1.00 25.84 ? 79   GLU B OE1 1 
ATOM   2081 O  OE2 . GLU B 1 90  ? -7.835  -21.903 19.875  1.00 24.69 ? 79   GLU B OE2 1 
ATOM   2082 N  N   . THR B 1 91  ? -12.997 -18.584 20.065  1.00 17.39 ? 80   THR B N   1 
ATOM   2083 C  CA  . THR B 1 91  ? -14.133 -18.378 19.181  1.00 16.91 ? 80   THR B CA  1 
ATOM   2084 C  C   . THR B 1 91  ? -13.711 -18.899 17.815  1.00 16.85 ? 80   THR B C   1 
ATOM   2085 O  O   . THR B 1 91  ? -12.781 -18.371 17.226  1.00 16.74 ? 80   THR B O   1 
ATOM   2086 C  CB  . THR B 1 91  ? -14.415 -16.862 19.037  1.00 16.59 ? 80   THR B CB  1 
ATOM   2087 O  OG1 . THR B 1 91  ? -14.660 -16.289 20.322  1.00 16.53 ? 80   THR B OG1 1 
ATOM   2088 C  CG2 . THR B 1 91  ? -15.636 -16.587 18.146  1.00 17.06 ? 80   THR B CG2 1 
ATOM   2089 N  N   . CYS B 1 92  ? -14.382 -19.924 17.311  1.00 16.66 ? 81   CYS B N   1 
ATOM   2090 C  CA  . CYS B 1 92  ? -13.954 -20.571 16.073  1.00 17.15 ? 81   CYS B CA  1 
ATOM   2091 C  C   . CYS B 1 92  ? -14.982 -20.423 14.953  1.00 17.47 ? 81   CYS B C   1 
ATOM   2092 O  O   . CYS B 1 92  ? -16.116 -20.875 15.082  1.00 18.50 ? 81   CYS B O   1 
ATOM   2093 C  CB  . CYS B 1 92  ? -13.673 -22.067 16.326  1.00 17.17 ? 81   CYS B CB  1 
ATOM   2094 S  SG  . CYS B 1 92  ? -12.350 -22.366 17.506  1.00 17.11 ? 81   CYS B SG  1 
ATOM   2095 N  N   . ILE B 1 93  ? -14.577 -19.824 13.839  1.00 18.00 ? 82   ILE B N   1 
ATOM   2096 C  CA  . ILE B 1 93  ? -15.500 -19.564 12.736  1.00 19.01 ? 82   ILE B CA  1 
ATOM   2097 C  C   . ILE B 1 93  ? -15.229 -20.517 11.559  1.00 19.07 ? 82   ILE B C   1 
ATOM   2098 O  O   . ILE B 1 93  ? -14.129 -20.551 11.022  1.00 18.29 ? 82   ILE B O   1 
ATOM   2099 C  CB  . ILE B 1 93  ? -15.428 -18.081 12.291  1.00 19.27 ? 82   ILE B CB  1 
ATOM   2100 C  CG1 . ILE B 1 93  ? -15.571 -17.182 13.524  1.00 19.89 ? 82   ILE B CG1 1 
ATOM   2101 C  CG2 . ILE B 1 93  ? -16.530 -17.791 11.268  1.00 19.73 ? 82   ILE B CG2 1 
ATOM   2102 C  CD1 . ILE B 1 93  ? -15.565 -15.703 13.227  1.00 21.14 ? 82   ILE B CD1 1 
ATOM   2103 N  N   . SER B 1 94  ? -16.230 -21.294 11.171  1.00 19.71 ? 83   SER B N   1 
ATOM   2104 C  CA  . SER B 1 94  ? -16.052 -22.237 10.073  1.00 20.70 ? 83   SER B CA  1 
ATOM   2105 C  C   . SER B 1 94  ? -15.948 -21.525 8.736   1.00 21.91 ? 83   SER B C   1 
ATOM   2106 O  O   . SER B 1 94  ? -16.537 -20.450 8.553   1.00 22.83 ? 83   SER B O   1 
ATOM   2107 C  CB  . SER B 1 94  ? -17.206 -23.227 10.044  1.00 20.76 ? 83   SER B CB  1 
ATOM   2108 O  OG  . SER B 1 94  ? -17.186 -23.997 11.235  1.00 21.60 ? 83   SER B OG  1 
ATOM   2109 N  N   . ALA B 1 95  ? -15.190 -22.108 7.828   1.00 22.04 ? 84   ALA B N   1 
ATOM   2110 C  CA  . ALA B 1 95  ? -15.113 -21.706 6.449   1.00 22.70 ? 84   ALA B CA  1 
ATOM   2111 C  C   . ALA B 1 95  ? -16.358 -22.106 5.688   1.00 24.32 ? 84   ALA B C   1 
ATOM   2112 O  O   . ALA B 1 95  ? -16.919 -23.110 5.946   1.00 24.58 ? 84   ALA B O   1 
ATOM   2113 C  CB  . ALA B 1 95  ? -13.913 -22.331 5.808   1.00 20.77 ? 84   ALA B CB  1 
ATOM   2114 N  N   . ASN B 1 96  ? -16.774 -21.283 4.757   1.00 27.78 ? 85   ASN B N   1 
ATOM   2115 C  CA  . ASN B 1 96  ? -17.824 -21.622 3.836   1.00 32.63 ? 85   ASN B CA  1 
ATOM   2116 C  C   . ASN B 1 96  ? -17.413 -21.306 2.438   1.00 34.34 ? 85   ASN B C   1 
ATOM   2117 O  O   . ASN B 1 96  ? -17.262 -20.165 2.112   1.00 38.60 ? 85   ASN B O   1 
ATOM   2118 C  CB  . ASN B 1 96  ? -19.040 -20.781 4.127   1.00 38.13 ? 85   ASN B CB  1 
ATOM   2119 C  CG  . ASN B 1 96  ? -20.202 -21.598 4.592   1.00 41.81 ? 85   ASN B CG  1 
ATOM   2120 O  OD1 . ASN B 1 96  ? -20.852 -22.277 3.810   1.00 42.83 ? 85   ASN B OD1 1 
ATOM   2121 N  ND2 . ASN B 1 96  ? -20.461 -21.547 5.876   1.00 44.62 ? 85   ASN B ND2 1 
ATOM   2122 N  N   . PRO B 1 97  ? -17.291 -22.296 1.582   1.00 33.90 ? 86   PRO B N   1 
ATOM   2123 C  CA  . PRO B 1 97  ? -17.431 -23.693 1.932   1.00 32.74 ? 86   PRO B CA  1 
ATOM   2124 C  C   . PRO B 1 97  ? -16.253 -24.238 2.717   1.00 31.18 ? 86   PRO B C   1 
ATOM   2125 O  O   . PRO B 1 97  ? -15.230 -23.639 2.809   1.00 31.10 ? 86   PRO B O   1 
ATOM   2126 C  CB  . PRO B 1 97  ? -17.497 -24.356 0.570   1.00 33.62 ? 86   PRO B CB  1 
ATOM   2127 C  CG  . PRO B 1 97  ? -16.605 -23.529 -0.263  1.00 34.99 ? 86   PRO B CG  1 
ATOM   2128 C  CD  . PRO B 1 97  ? -16.692 -22.133 0.258   1.00 35.58 ? 86   PRO B CD  1 
ATOM   2129 N  N   . LEU B 1 98  ? -16.463 -25.387 3.312   1.00 32.73 ? 87   LEU B N   1 
ATOM   2130 C  CA  . LEU B 1 98  ? -15.464 -26.046 4.146   1.00 34.56 ? 87   LEU B CA  1 
ATOM   2131 C  C   . LEU B 1 98  ? -14.338 -26.638 3.306   1.00 35.33 ? 87   LEU B C   1 
ATOM   2132 O  O   . LEU B 1 98  ? -13.187 -26.691 3.734   1.00 35.03 ? 87   LEU B O   1 
ATOM   2133 C  CB  . LEU B 1 98  ? -16.129 -27.164 4.957   1.00 34.63 ? 87   LEU B CB  1 
ATOM   2134 C  CG  . LEU B 1 98  ? -17.167 -26.738 6.015   1.00 39.54 ? 87   LEU B CG  1 
ATOM   2135 C  CD1 . LEU B 1 98  ? -18.142 -27.854 6.401   1.00 37.44 ? 87   LEU B CD1 1 
ATOM   2136 C  CD2 . LEU B 1 98  ? -16.464 -26.190 7.251   1.00 38.19 ? 87   LEU B CD2 1 
ATOM   2137 N  N   . ASN B 1 99  ? -14.673 -27.096 2.110   1.00 34.63 ? 88   ASN B N   1 
ATOM   2138 C  CA  . ASN B 1 99  ? -13.712 -27.863 1.354   1.00 37.37 ? 88   ASN B CA  1 
ATOM   2139 C  C   . ASN B 1 99  ? -13.539 -27.456 -0.104  1.00 34.32 ? 88   ASN B C   1 
ATOM   2140 O  O   . ASN B 1 99  ? -14.400 -26.820 -0.704  1.00 32.92 ? 88   ASN B O   1 
ATOM   2141 C  CB  . ASN B 1 99  ? -14.012 -29.360 1.468   1.00 41.76 ? 88   ASN B CB  1 
ATOM   2142 C  CG  . ASN B 1 99  ? -15.215 -29.764 0.667   1.00 45.96 ? 88   ASN B CG  1 
ATOM   2143 O  OD1 . ASN B 1 99  ? -16.320 -29.282 0.917   1.00 52.59 ? 88   ASN B OD1 1 
ATOM   2144 N  ND2 . ASN B 1 99  ? -15.014 -30.651 -0.307  1.00 46.30 ? 88   ASN B ND2 1 
ATOM   2145 N  N   . VAL B 1 100 ? -12.379 -27.816 -0.630  1.00 32.56 ? 89   VAL B N   1 
ATOM   2146 C  CA  . VAL B 1 100 ? -12.071 -27.747 -2.038  1.00 31.50 ? 89   VAL B CA  1 
ATOM   2147 C  C   . VAL B 1 100 ? -12.067 -29.213 -2.448  1.00 30.26 ? 89   VAL B C   1 
ATOM   2148 O  O   . VAL B 1 100 ? -11.293 -29.983 -1.907  1.00 27.41 ? 89   VAL B O   1 
ATOM   2149 C  CB  . VAL B 1 100 ? -10.689 -27.095 -2.269  1.00 30.63 ? 89   VAL B CB  1 
ATOM   2150 C  CG1 . VAL B 1 100 ? -10.225 -27.273 -3.705  1.00 29.88 ? 89   VAL B CG1 1 
ATOM   2151 C  CG2 . VAL B 1 100 ? -10.744 -25.623 -1.921  1.00 30.12 ? 89   VAL B CG2 1 
ATOM   2152 N  N   . PRO B 1 101 ? -12.979 -29.612 -3.364  1.00 32.00 ? 90   PRO B N   1 
ATOM   2153 C  CA  . PRO B 1 101 ? -13.069 -31.033 -3.770  1.00 31.73 ? 90   PRO B CA  1 
ATOM   2154 C  C   . PRO B 1 101 ? -11.766 -31.539 -4.390  1.00 31.02 ? 90   PRO B C   1 
ATOM   2155 O  O   . PRO B 1 101 ? -10.974 -30.762 -4.924  1.00 31.14 ? 90   PRO B O   1 
ATOM   2156 C  CB  . PRO B 1 101 ? -14.206 -31.043 -4.816  1.00 31.20 ? 90   PRO B CB  1 
ATOM   2157 C  CG  . PRO B 1 101 ? -14.977 -29.785 -4.580  1.00 31.33 ? 90   PRO B CG  1 
ATOM   2158 C  CD  . PRO B 1 101 ? -13.995 -28.775 -4.036  1.00 30.75 ? 90   PRO B CD  1 
ATOM   2159 N  N   . ARG B 1 102 ? -11.548 -32.840 -4.294  1.00 33.16 ? 91   ARG B N   1 
ATOM   2160 C  CA  . ARG B 1 102 ? -10.379 -33.482 -4.861  1.00 34.01 ? 91   ARG B CA  1 
ATOM   2161 C  C   . ARG B 1 102 ? -10.474 -33.460 -6.371  1.00 35.34 ? 91   ARG B C   1 
ATOM   2162 O  O   . ARG B 1 102 ? -11.445 -33.956 -6.920  1.00 35.40 ? 91   ARG B O   1 
ATOM   2163 C  CB  . ARG B 1 102 ? -10.357 -34.925 -4.383  1.00 37.36 ? 91   ARG B CB  1 
ATOM   2164 C  CG  . ARG B 1 102 ? -9.931  -35.104 -2.931  1.00 40.53 ? 91   ARG B CG  1 
ATOM   2165 C  CD  . ARG B 1 102 ? -10.762 -36.195 -2.291  1.00 42.87 ? 91   ARG B CD  1 
ATOM   2166 N  NE  . ARG B 1 102 ? -10.028 -36.975 -1.306  1.00 46.71 ? 91   ARG B NE  1 
ATOM   2167 C  CZ  . ARG B 1 102 ? -9.686  -38.250 -1.478  1.00 50.26 ? 91   ARG B CZ  1 
ATOM   2168 N  NH1 . ARG B 1 102 ? -10.005 -38.894 -2.604  1.00 52.66 ? 91   ARG B NH1 1 
ATOM   2169 N  NH2 . ARG B 1 102 ? -9.029  -38.889 -0.522  1.00 49.82 ? 91   ARG B NH2 1 
ATOM   2170 N  N   . LYS B 1 103 ? -9.482  -32.883 -7.047  1.00 37.92 ? 92   LYS B N   1 
ATOM   2171 C  CA  . LYS B 1 103 ? -9.523  -32.769 -8.511  1.00 38.90 ? 92   LYS B CA  1 
ATOM   2172 C  C   . LYS B 1 103 ? -8.151  -32.575 -9.117  1.00 39.65 ? 92   LYS B C   1 
ATOM   2173 O  O   . LYS B 1 103 ? -7.192  -32.195 -8.427  1.00 36.92 ? 92   LYS B O   1 
ATOM   2174 C  CB  . LYS B 1 103 ? -10.394 -31.579 -8.943  1.00 42.99 ? 92   LYS B CB  1 
ATOM   2175 C  CG  . LYS B 1 103 ? -11.852 -31.893 -9.262  1.00 46.65 ? 92   LYS B CG  1 
ATOM   2176 C  CD  . LYS B 1 103 ? -12.584 -30.661 -9.785  1.00 49.05 ? 92   LYS B CD  1 
ATOM   2177 C  CE  . LYS B 1 103 ? -14.095 -30.812 -9.649  1.00 54.36 ? 92   LYS B CE  1 
ATOM   2178 N  NZ  . LYS B 1 103 ? -14.821 -29.513 -9.787  1.00 56.75 ? 92   LYS B NZ  1 
ATOM   2179 N  N   . HIS B 1 104 ? -8.064  -32.832 -10.420 1.00 38.09 ? 93   HIS B N   1 
ATOM   2180 C  CA  . HIS B 1 104 ? -6.935  -32.378 -11.215 1.00 40.07 ? 93   HIS B CA  1 
ATOM   2181 C  C   . HIS B 1 104 ? -7.160  -30.913 -11.531 1.00 41.13 ? 93   HIS B C   1 
ATOM   2182 O  O   . HIS B 1 104 ? -7.771  -30.569 -12.539 1.00 44.77 ? 93   HIS B O   1 
ATOM   2183 C  CB  . HIS B 1 104 ? -6.784  -33.250 -12.471 1.00 42.51 ? 93   HIS B CB  1 
ATOM   2184 C  CG  . HIS B 1 104 ? -5.693  -32.792 -13.411 1.00 44.67 ? 93   HIS B CG  1 
ATOM   2185 N  ND1 . HIS B 1 104 ? -4.393  -33.064 -13.198 1.00 47.03 ? 93   HIS B ND1 1 
ATOM   2186 C  CD2 . HIS B 1 104 ? -5.754  -32.053 -14.597 1.00 47.01 ? 93   HIS B CD2 1 
ATOM   2187 C  CE1 . HIS B 1 104 ? -3.653  -32.522 -14.186 1.00 47.37 ? 93   HIS B CE1 1 
ATOM   2188 N  NE2 . HIS B 1 104 ? -4.489  -31.909 -15.045 1.00 48.67 ? 93   HIS B NE2 1 
ATOM   2189 N  N   . TRP B 1 105 ? -6.692  -30.035 -10.650 1.00 37.76 ? 94   TRP B N   1 
ATOM   2190 C  CA  . TRP B 1 105 ? -6.994  -28.602 -10.746 1.00 35.81 ? 94   TRP B CA  1 
ATOM   2191 C  C   . TRP B 1 105 ? -6.070  -27.836 -11.675 1.00 36.12 ? 94   TRP B C   1 
ATOM   2192 O  O   . TRP B 1 105 ? -6.438  -26.794 -12.217 1.00 34.06 ? 94   TRP B O   1 
ATOM   2193 C  CB  . TRP B 1 105 ? -6.938  -27.956 -9.353  1.00 33.00 ? 94   TRP B CB  1 
ATOM   2194 C  CG  . TRP B 1 105 ? -8.065  -28.330 -8.409  1.00 33.63 ? 94   TRP B CG  1 
ATOM   2195 C  CD1 . TRP B 1 105 ? -8.037  -29.270 -7.378  1.00 32.78 ? 94   TRP B CD1 1 
ATOM   2196 C  CD2 . TRP B 1 105 ? -9.430  -27.769 -8.379  1.00 33.59 ? 94   TRP B CD2 1 
ATOM   2197 N  NE1 . TRP B 1 105 ? -9.250  -29.335 -6.742  1.00 32.91 ? 94   TRP B NE1 1 
ATOM   2198 C  CE2 . TRP B 1 105 ? -10.132 -28.460 -7.289  1.00 33.21 ? 94   TRP B CE2 1 
ATOM   2199 C  CE3 . TRP B 1 105 ? -10.112 -26.790 -9.118  1.00 33.14 ? 94   TRP B CE3 1 
ATOM   2200 C  CZ2 . TRP B 1 105 ? -11.464 -28.187 -6.975  1.00 33.17 ? 94   TRP B CZ2 1 
ATOM   2201 C  CZ3 . TRP B 1 105 ? -11.455 -26.522 -8.793  1.00 34.15 ? 94   TRP B CZ3 1 
ATOM   2202 C  CH2 . TRP B 1 105 ? -12.114 -27.207 -7.747  1.00 33.98 ? 94   TRP B CH2 1 
ATOM   2203 N  N   . TRP B 1 106 ? -4.839  -28.303 -11.834 1.00 34.40 ? 95   TRP B N   1 
ATOM   2204 C  CA  . TRP B 1 106 ? -3.864  -27.524 -12.583 1.00 33.97 ? 95   TRP B CA  1 
ATOM   2205 C  C   . TRP B 1 106 ? -3.142  -28.378 -13.562 1.00 35.21 ? 95   TRP B C   1 
ATOM   2206 O  O   . TRP B 1 106 ? -2.603  -29.439 -13.210 1.00 33.17 ? 95   TRP B O   1 
ATOM   2207 C  CB  . TRP B 1 106 ? -2.877  -26.876 -11.628 1.00 33.47 ? 95   TRP B CB  1 
ATOM   2208 C  CG  . TRP B 1 106 ? -1.848  -25.990 -12.286 1.00 33.16 ? 95   TRP B CG  1 
ATOM   2209 C  CD1 . TRP B 1 106 ? -0.491  -26.254 -12.475 1.00 32.57 ? 95   TRP B CD1 1 
ATOM   2210 C  CD2 . TRP B 1 106 ? -2.059  -24.644 -12.846 1.00 33.09 ? 95   TRP B CD2 1 
ATOM   2211 N  NE1 . TRP B 1 106 ? 0.133   -25.198 -13.090 1.00 33.14 ? 95   TRP B NE1 1 
ATOM   2212 C  CE2 . TRP B 1 106 ? -0.750  -24.198 -13.343 1.00 33.63 ? 95   TRP B CE2 1 
ATOM   2213 C  CE3 . TRP B 1 106 ? -3.159  -23.801 -12.981 1.00 33.59 ? 95   TRP B CE3 1 
ATOM   2214 C  CZ2 . TRP B 1 106 ? -0.576  -22.956 -13.940 1.00 33.03 ? 95   TRP B CZ2 1 
ATOM   2215 C  CZ3 . TRP B 1 106 ? -2.970  -22.547 -13.579 1.00 33.16 ? 95   TRP B CZ3 1 
ATOM   2216 C  CH2 . TRP B 1 106 ? -1.713  -22.139 -14.053 1.00 33.79 ? 95   TRP B CH2 1 
ATOM   2217 N  N   . THR B 1 107 ? -3.136  -27.920 -14.807 1.00 36.81 ? 96   THR B N   1 
ATOM   2218 C  CA  . THR B 1 107 ? -2.385  -28.566 -15.864 1.00 37.58 ? 96   THR B CA  1 
ATOM   2219 C  C   . THR B 1 107 ? -1.320  -27.626 -16.366 1.00 40.45 ? 96   THR B C   1 
ATOM   2220 O  O   . THR B 1 107 ? -1.608  -26.502 -16.793 1.00 40.56 ? 96   THR B O   1 
ATOM   2221 C  CB  . THR B 1 107 ? -3.297  -28.948 -17.037 1.00 39.69 ? 96   THR B CB  1 
ATOM   2222 O  OG1 . THR B 1 107 ? -4.233  -29.932 -16.591 1.00 40.76 ? 96   THR B OG1 1 
ATOM   2223 C  CG2 . THR B 1 107 ? -2.471  -29.526 -18.211 1.00 39.25 ? 96   THR B CG2 1 
ATOM   2224 N  N   . ASP B 1 108 ? -0.082  -28.091 -16.298 1.00 42.16 ? 97   ASP B N   1 
ATOM   2225 C  CA  . ASP B 1 108 ? 1.033   -27.432 -16.949 1.00 42.41 ? 97   ASP B CA  1 
ATOM   2226 C  C   . ASP B 1 108 ? 1.915   -28.532 -17.533 1.00 44.51 ? 97   ASP B C   1 
ATOM   2227 O  O   . ASP B 1 108 ? 2.779   -29.087 -16.845 1.00 41.59 ? 97   ASP B O   1 
ATOM   2228 C  CB  . ASP B 1 108 ? 1.803   -26.567 -15.957 1.00 44.09 ? 97   ASP B CB  1 
ATOM   2229 C  CG  . ASP B 1 108 ? 2.975   -25.832 -16.603 1.00 48.49 ? 97   ASP B CG  1 
ATOM   2230 O  OD1 . ASP B 1 108 ? 3.285   -26.090 -17.788 1.00 47.94 ? 97   ASP B OD1 1 
ATOM   2231 O  OD2 . ASP B 1 108 ? 3.595   -24.993 -15.914 1.00 51.11 ? 97   ASP B OD2 1 
ATOM   2232 N  N   . SER B 1 109 ? 1.685   -28.843 -18.809 1.00 46.97 ? 98   SER B N   1 
ATOM   2233 C  CA  . SER B 1 109 ? 2.380   -29.947 -19.488 1.00 46.32 ? 98   SER B CA  1 
ATOM   2234 C  C   . SER B 1 109 ? 3.798   -29.582 -19.961 1.00 44.75 ? 98   SER B C   1 
ATOM   2235 O  O   . SER B 1 109 ? 4.506   -30.421 -20.520 1.00 46.20 ? 98   SER B O   1 
ATOM   2236 C  CB  . SER B 1 109 ? 1.528   -30.520 -20.637 1.00 47.33 ? 98   SER B CB  1 
ATOM   2237 O  OG  . SER B 1 109 ? 1.680   -29.762 -21.825 1.00 49.63 ? 98   SER B OG  1 
ATOM   2238 N  N   . SER B 1 110 ? 4.213   -28.339 -19.725 1.00 43.95 ? 99   SER B N   1 
ATOM   2239 C  CA  . SER B 1 110 ? 5.620   -27.958 -19.888 1.00 44.30 ? 99   SER B CA  1 
ATOM   2240 C  C   . SER B 1 110 ? 6.484   -28.589 -18.774 1.00 42.23 ? 99   SER B C   1 
ATOM   2241 O  O   . SER B 1 110 ? 7.710   -28.447 -18.772 1.00 41.51 ? 99   SER B O   1 
ATOM   2242 C  CB  . SER B 1 110 ? 5.776   -26.431 -19.879 1.00 43.41 ? 99   SER B CB  1 
ATOM   2243 O  OG  . SER B 1 110 ? 5.768   -25.924 -18.554 1.00 43.43 ? 99   SER B OG  1 
ATOM   2244 N  N   . ALA B 1 111 ? 5.823   -29.266 -17.834 1.00 40.91 ? 100  ALA B N   1 
ATOM   2245 C  CA  . ALA B 1 111 ? 6.463   -29.954 -16.699 1.00 42.13 ? 100  ALA B CA  1 
ATOM   2246 C  C   . ALA B 1 111 ? 7.233   -29.014 -15.756 1.00 41.69 ? 100  ALA B C   1 
ATOM   2247 O  O   . ALA B 1 111 ? 7.960   -29.467 -14.859 1.00 41.53 ? 100  ALA B O   1 
ATOM   2248 C  CB  . ALA B 1 111 ? 7.347   -31.111 -17.187 1.00 41.09 ? 100  ALA B CB  1 
ATOM   2249 N  N   . GLU B 1 112 ? 7.070   -27.709 -15.971 1.00 40.77 ? 101  GLU B N   1 
ATOM   2250 C  CA  . GLU B 1 112 ? 7.566   -26.698 -15.044 1.00 42.88 ? 101  GLU B CA  1 
ATOM   2251 C  C   . GLU B 1 112 ? 6.865   -26.837 -13.676 1.00 41.17 ? 101  GLU B C   1 
ATOM   2252 O  O   . GLU B 1 112 ? 5.665   -27.082 -13.605 1.00 38.38 ? 101  GLU B O   1 
ATOM   2253 C  CB  . GLU B 1 112 ? 7.338   -25.300 -15.627 1.00 47.10 ? 101  GLU B CB  1 
ATOM   2254 C  CG  . GLU B 1 112 ? 8.294   -24.233 -15.112 1.00 51.66 ? 101  GLU B CG  1 
ATOM   2255 C  CD  . GLU B 1 112 ? 9.752   -24.516 -15.460 1.00 54.66 ? 101  GLU B CD  1 
ATOM   2256 O  OE1 . GLU B 1 112 ? 10.076  -24.605 -16.673 1.00 54.14 ? 101  GLU B OE1 1 
ATOM   2257 O  OE2 . GLU B 1 112 ? 10.574  -24.645 -14.518 1.00 52.39 ? 101  GLU B OE2 1 
ATOM   2258 N  N   . LYS B 1 113 ? 7.625   -26.716 -12.595 1.00 40.00 ? 102  LYS B N   1 
ATOM   2259 C  CA  . LYS B 1 113 ? 7.031   -26.687 -11.257 1.00 37.99 ? 102  LYS B CA  1 
ATOM   2260 C  C   . LYS B 1 113 ? 7.186   -25.278 -10.664 1.00 37.62 ? 102  LYS B C   1 
ATOM   2261 O  O   . LYS B 1 113 ? 8.240   -24.645 -10.802 1.00 38.40 ? 102  LYS B O   1 
ATOM   2262 C  CB  . LYS B 1 113 ? 7.620   -27.778 -10.347 1.00 34.89 ? 102  LYS B CB  1 
ATOM   2263 C  CG  . LYS B 1 113 ? 7.482   -29.225 -10.855 1.00 33.28 ? 102  LYS B CG  1 
ATOM   2264 C  CD  . LYS B 1 113 ? 6.041   -29.608 -11.182 1.00 34.41 ? 102  LYS B CD  1 
ATOM   2265 C  CE  . LYS B 1 113 ? 5.931   -31.021 -11.759 1.00 34.15 ? 102  LYS B CE  1 
ATOM   2266 N  NZ  . LYS B 1 113 ? 4.621   -31.212 -12.457 1.00 34.00 ? 102  LYS B NZ  1 
ATOM   2267 N  N   . LYS B 1 114 ? 6.127   -24.800 -10.013 1.00 35.89 ? 103  LYS B N   1 
ATOM   2268 C  CA  . LYS B 1 114 ? 5.982   -23.385 -9.601  1.00 36.20 ? 103  LYS B CA  1 
ATOM   2269 C  C   . LYS B 1 114 ? 4.801   -23.278 -8.613  1.00 31.89 ? 103  LYS B C   1 
ATOM   2270 O  O   . LYS B 1 114 ? 3.855   -24.073 -8.687  1.00 28.58 ? 103  LYS B O   1 
ATOM   2271 C  CB  . LYS B 1 114 ? 5.743   -22.519 -10.864 1.00 38.17 ? 103  LYS B CB  1 
ATOM   2272 C  CG  . LYS B 1 114 ? 5.138   -21.133 -10.668 1.00 42.28 ? 103  LYS B CG  1 
ATOM   2273 C  CD  . LYS B 1 114 ? 4.234   -20.756 -11.852 1.00 44.85 ? 103  LYS B CD  1 
ATOM   2274 C  CE  . LYS B 1 114 ? 3.534   -19.397 -11.681 1.00 46.78 ? 103  LYS B CE  1 
ATOM   2275 N  NZ  . LYS B 1 114 ? 2.203   -19.416 -10.981 1.00 47.80 ? 103  LYS B NZ  1 
ATOM   2276 N  N   . HIS B 1 115 ? 4.854   -22.327 -7.680  1.00 30.47 ? 104  HIS B N   1 
ATOM   2277 C  CA  . HIS B 1 115 ? 3.680   -22.074 -6.845  1.00 31.25 ? 104  HIS B CA  1 
ATOM   2278 C  C   . HIS B 1 115 ? 2.591   -21.475 -7.667  1.00 30.61 ? 104  HIS B C   1 
ATOM   2279 O  O   . HIS B 1 115 ? 2.807   -20.489 -8.377  1.00 30.76 ? 104  HIS B O   1 
ATOM   2280 C  CB  . HIS B 1 115 ? 4.006   -21.173 -5.667  1.00 30.69 ? 104  HIS B CB  1 
ATOM   2281 C  CG  . HIS B 1 115 ? 4.938   -21.805 -4.682  1.00 31.41 ? 104  HIS B CG  1 
ATOM   2282 N  ND1 . HIS B 1 115 ? 4.584   -22.872 -3.935  1.00 32.17 ? 104  HIS B ND1 1 
ATOM   2283 C  CD2 . HIS B 1 115 ? 6.259   -21.515 -4.360  1.00 29.02 ? 104  HIS B CD2 1 
ATOM   2284 C  CE1 . HIS B 1 115 ? 5.623   -23.225 -3.152  1.00 30.53 ? 104  HIS B CE1 1 
ATOM   2285 N  NE2 . HIS B 1 115 ? 6.645   -22.397 -3.419  1.00 30.71 ? 104  HIS B NE2 1 
ATOM   2286 N  N   . VAL B 1 116 ? 1.416   -22.085 -7.599  1.00 30.27 ? 105  VAL B N   1 
ATOM   2287 C  CA  . VAL B 1 116 ? 0.246   -21.562 -8.283  1.00 30.42 ? 105  VAL B CA  1 
ATOM   2288 C  C   . VAL B 1 116 ? -0.886  -21.414 -7.260  1.00 30.76 ? 105  VAL B C   1 
ATOM   2289 O  O   . VAL B 1 116 ? -1.330  -22.414 -6.677  1.00 28.63 ? 105  VAL B O   1 
ATOM   2290 C  CB  . VAL B 1 116 ? -0.202  -22.508 -9.419  1.00 32.71 ? 105  VAL B CB  1 
ATOM   2291 C  CG1 . VAL B 1 116 ? -1.476  -22.005 -10.078 1.00 31.46 ? 105  VAL B CG1 1 
ATOM   2292 C  CG2 . VAL B 1 116 ? 0.899   -22.681 -10.461 1.00 34.21 ? 105  VAL B CG2 1 
ATOM   2293 N  N   . TRP B 1 117 ? -1.329  -20.172 -7.032  1.00 29.38 ? 106  TRP B N   1 
ATOM   2294 C  CA  . TRP B 1 117 ? -2.469  -19.909 -6.147  1.00 27.50 ? 106  TRP B CA  1 
ATOM   2295 C  C   . TRP B 1 117 ? -3.718  -20.518 -6.696  1.00 28.19 ? 106  TRP B C   1 
ATOM   2296 O  O   . TRP B 1 117 ? -4.072  -20.252 -7.845  1.00 28.55 ? 106  TRP B O   1 
ATOM   2297 C  CB  . TRP B 1 117 ? -2.671  -18.413 -5.921  1.00 26.78 ? 106  TRP B CB  1 
ATOM   2298 C  CG  . TRP B 1 117 ? -1.550  -17.839 -5.116  1.00 27.19 ? 106  TRP B CG  1 
ATOM   2299 C  CD1 . TRP B 1 117 ? -0.506  -17.042 -5.568  1.00 27.66 ? 106  TRP B CD1 1 
ATOM   2300 C  CD2 . TRP B 1 117 ? -1.262  -18.084 -3.693  1.00 26.74 ? 106  TRP B CD2 1 
ATOM   2301 N  NE1 . TRP B 1 117 ? 0.380   -16.777 -4.554  1.00 28.64 ? 106  TRP B NE1 1 
ATOM   2302 C  CE2 . TRP B 1 117 ? -0.024  -17.359 -3.396  1.00 27.70 ? 106  TRP B CE2 1 
ATOM   2303 C  CE3 . TRP B 1 117 ? -1.897  -18.784 -2.671  1.00 26.41 ? 106  TRP B CE3 1 
ATOM   2304 C  CZ2 . TRP B 1 117 ? 0.536   -17.342 -2.118  1.00 27.48 ? 106  TRP B CZ2 1 
ATOM   2305 C  CZ3 . TRP B 1 117 ? -1.309  -18.772 -1.384  1.00 25.51 ? 106  TRP B CZ3 1 
ATOM   2306 C  CH2 . TRP B 1 117 ? -0.128  -18.074 -1.121  1.00 25.16 ? 106  TRP B CH2 1 
ATOM   2307 N  N   . PHE B 1 118 ? -4.381  -21.349 -5.883  1.00 25.84 ? 107  PHE B N   1 
ATOM   2308 C  CA  . PHE B 1 118 ? -5.687  -21.907 -6.206  1.00 27.32 ? 107  PHE B CA  1 
ATOM   2309 C  C   . PHE B 1 118 ? -6.761  -20.835 -6.494  1.00 29.75 ? 107  PHE B C   1 
ATOM   2310 O  O   . PHE B 1 118 ? -7.363  -20.834 -7.562  1.00 30.38 ? 107  PHE B O   1 
ATOM   2311 C  CB  . PHE B 1 118 ? -6.133  -22.846 -5.086  1.00 25.56 ? 107  PHE B CB  1 
ATOM   2312 C  CG  . PHE B 1 118 ? -7.565  -23.292 -5.176  1.00 24.98 ? 107  PHE B CG  1 
ATOM   2313 C  CD1 . PHE B 1 118 ? -7.949  -24.306 -6.056  1.00 24.11 ? 107  PHE B CD1 1 
ATOM   2314 C  CD2 . PHE B 1 118 ? -8.529  -22.742 -4.339  1.00 23.55 ? 107  PHE B CD2 1 
ATOM   2315 C  CE1 . PHE B 1 118 ? -9.273  -24.727 -6.119  1.00 24.12 ? 107  PHE B CE1 1 
ATOM   2316 C  CE2 . PHE B 1 118 ? -9.850  -23.150 -4.407  1.00 21.80 ? 107  PHE B CE2 1 
ATOM   2317 C  CZ  . PHE B 1 118 ? -10.227 -24.143 -5.291  1.00 23.52 ? 107  PHE B CZ  1 
ATOM   2318 N  N   . GLY B 1 119 ? -7.005  -19.944 -5.535  1.00 31.27 ? 108  GLY B N   1 
ATOM   2319 C  CA  . GLY B 1 119 ? -7.995  -18.877 -5.686  1.00 31.10 ? 108  GLY B CA  1 
ATOM   2320 C  C   . GLY B 1 119 ? -7.685  -17.841 -6.761  1.00 32.05 ? 108  GLY B C   1 
ATOM   2321 O  O   . GLY B 1 119 ? -8.562  -17.472 -7.514  1.00 31.23 ? 108  GLY B O   1 
ATOM   2322 N  N   . GLU B 1 120 ? -6.445  -17.350 -6.812  1.00 34.65 ? 109  GLU B N   1 
ATOM   2323 C  CA  . GLU B 1 120 ? -6.020  -16.390 -7.835  1.00 36.79 ? 109  GLU B CA  1 
ATOM   2324 C  C   . GLU B 1 120 ? -5.923  -16.939 -9.257  1.00 36.37 ? 109  GLU B C   1 
ATOM   2325 O  O   . GLU B 1 120 ? -6.250  -16.229 -10.199 1.00 35.98 ? 109  GLU B O   1 
ATOM   2326 C  CB  . GLU B 1 120 ? -4.667  -15.779 -7.486  1.00 40.53 ? 109  GLU B CB  1 
ATOM   2327 C  CG  . GLU B 1 120 ? -4.731  -14.442 -6.782  1.00 43.27 ? 109  GLU B CG  1 
ATOM   2328 C  CD  . GLU B 1 120 ? -3.350  -13.922 -6.439  1.00 46.01 ? 109  GLU B CD  1 
ATOM   2329 O  OE1 . GLU B 1 120 ? -2.434  -14.052 -7.289  1.00 48.11 ? 109  GLU B OE1 1 
ATOM   2330 O  OE2 . GLU B 1 120 ? -3.172  -13.404 -5.315  1.00 45.39 ? 109  GLU B OE2 1 
ATOM   2331 N  N   . SER B 1 121 ? -5.470  -18.180 -9.430  1.00 34.85 ? 110  SER B N   1 
ATOM   2332 C  CA  . SER B 1 121 ? -5.095  -18.630 -10.786 1.00 33.52 ? 110  SER B CA  1 
ATOM   2333 C  C   . SER B 1 121 ? -5.767  -19.863 -11.359 1.00 32.60 ? 110  SER B C   1 
ATOM   2334 O  O   . SER B 1 121 ? -5.649  -20.103 -12.549 1.00 33.55 ? 110  SER B O   1 
ATOM   2335 C  CB  . SER B 1 121 ? -3.584  -18.814 -10.888 1.00 33.02 ? 110  SER B CB  1 
ATOM   2336 O  OG  . SER B 1 121 ? -2.917  -17.845 -10.100 1.00 34.62 ? 110  SER B OG  1 
HETATM 2337 N  N   . MSE B 1 122 ? -6.444  -20.663 -10.547 1.00 31.53 ? 111  MSE B N   1 
HETATM 2338 C  CA  . MSE B 1 122 ? -6.948  -21.950 -11.055 1.00 33.85 ? 111  MSE B CA  1 
HETATM 2339 C  C   . MSE B 1 122 ? -8.385  -21.851 -11.500 1.00 35.10 ? 111  MSE B C   1 
HETATM 2340 O  O   . MSE B 1 122 ? -9.170  -21.086 -10.933 1.00 36.22 ? 111  MSE B O   1 
HETATM 2341 C  CB  . MSE B 1 122 ? -6.738  -23.037 -10.001 1.00 35.06 ? 111  MSE B CB  1 
HETATM 2342 C  CG  . MSE B 1 122 ? -5.240  -23.160 -9.654  1.00 36.95 ? 111  MSE B CG  1 
HETATM 2343 SE SE  . MSE B 1 122 ? -4.829  -24.799 -8.624  1.00 36.73 ? 111  MSE B SE  1 
HETATM 2344 C  CE  . MSE B 1 122 ? -6.679  -25.439 -8.549  1.00 40.18 ? 111  MSE B CE  1 
ATOM   2345 N  N   . ASP B 1 123 ? -8.735  -22.604 -12.540 1.00 35.96 ? 112  ASP B N   1 
ATOM   2346 C  CA  . ASP B 1 123 ? -10.102 -22.638 -13.052 1.00 37.39 ? 112  ASP B CA  1 
ATOM   2347 C  C   . ASP B 1 123 ? -11.021 -23.327 -12.054 1.00 34.52 ? 112  ASP B C   1 
ATOM   2348 O  O   . ASP B 1 123 ? -10.792 -24.468 -11.705 1.00 36.07 ? 112  ASP B O   1 
ATOM   2349 C  CB  . ASP B 1 123 ? -10.158 -23.391 -14.389 1.00 43.10 ? 112  ASP B CB  1 
ATOM   2350 C  CG  . ASP B 1 123 ? -9.334  -22.725 -15.476 1.00 47.56 ? 112  ASP B CG  1 
ATOM   2351 O  OD1 . ASP B 1 123 ? -9.295  -21.476 -15.515 1.00 54.94 ? 112  ASP B OD1 1 
ATOM   2352 O  OD2 . ASP B 1 123 ? -8.734  -23.449 -16.299 1.00 48.85 ? 112  ASP B OD2 1 
ATOM   2353 N  N   . GLY B 1 124 ? -12.078 -22.646 -11.629 1.00 33.31 ? 113  GLY B N   1 
ATOM   2354 C  CA  . GLY B 1 124 ? -12.946 -23.155 -10.551 1.00 33.37 ? 113  GLY B CA  1 
ATOM   2355 C  C   . GLY B 1 124 ? -12.451 -22.671 -9.192  1.00 32.22 ? 113  GLY B C   1 
ATOM   2356 O  O   . GLY B 1 124 ? -13.059 -22.948 -8.160  1.00 30.37 ? 113  GLY B O   1 
ATOM   2357 N  N   . GLY B 1 125 ? -11.343 -21.926 -9.207  1.00 33.80 ? 114  GLY B N   1 
ATOM   2358 C  CA  . GLY B 1 125 ? -10.719 -21.409 -7.987  1.00 34.79 ? 114  GLY B CA  1 
ATOM   2359 C  C   . GLY B 1 125 ? -11.528 -20.359 -7.241  1.00 35.48 ? 114  GLY B C   1 
ATOM   2360 O  O   . GLY B 1 125 ? -12.266 -19.579 -7.844  1.00 36.94 ? 114  GLY B O   1 
ATOM   2361 N  N   . PHE B 1 126 ? -11.390 -20.349 -5.917  1.00 34.95 ? 115  PHE B N   1 
ATOM   2362 C  CA  . PHE B 1 126 ? -11.992 -19.321 -5.066  1.00 32.36 ? 115  PHE B CA  1 
ATOM   2363 C  C   . PHE B 1 126 ? -11.122 -19.097 -3.840  1.00 33.37 ? 115  PHE B C   1 
ATOM   2364 O  O   . PHE B 1 126 ? -10.420 -20.016 -3.392  1.00 32.11 ? 115  PHE B O   1 
ATOM   2365 C  CB  . PHE B 1 126 ? -13.417 -19.703 -4.640  1.00 31.03 ? 115  PHE B CB  1 
ATOM   2366 C  CG  . PHE B 1 126 ? -13.535 -21.070 -4.008  1.00 33.81 ? 115  PHE B CG  1 
ATOM   2367 C  CD1 . PHE B 1 126 ? -13.358 -21.244 -2.635  1.00 33.54 ? 115  PHE B CD1 1 
ATOM   2368 C  CD2 . PHE B 1 126 ? -13.871 -22.181 -4.777  1.00 32.69 ? 115  PHE B CD2 1 
ATOM   2369 C  CE1 . PHE B 1 126 ? -13.482 -22.509 -2.050  1.00 34.51 ? 115  PHE B CE1 1 
ATOM   2370 C  CE2 . PHE B 1 126 ? -14.003 -23.440 -4.196  1.00 34.28 ? 115  PHE B CE2 1 
ATOM   2371 C  CZ  . PHE B 1 126 ? -13.806 -23.610 -2.829  1.00 33.89 ? 115  PHE B CZ  1 
ATOM   2372 N  N   . GLN B 1 127 ? -11.163 -17.880 -3.303  1.00 32.82 ? 116  GLN B N   1 
ATOM   2373 C  CA  . GLN B 1 127 ? -10.477 -17.571 -2.055  1.00 32.39 ? 116  GLN B CA  1 
ATOM   2374 C  C   . GLN B 1 127 ? -11.410 -17.936 -0.917  1.00 31.95 ? 116  GLN B C   1 
ATOM   2375 O  O   . GLN B 1 127 ? -12.611 -18.099 -1.140  1.00 32.29 ? 116  GLN B O   1 
ATOM   2376 C  CB  . GLN B 1 127 ? -10.019 -16.119 -2.023  1.00 32.05 ? 116  GLN B CB  1 
ATOM   2377 C  CG  . GLN B 1 127 ? -8.852  -15.932 -2.977  1.00 36.03 ? 116  GLN B CG  1 
ATOM   2378 C  CD  . GLN B 1 127 ? -8.045  -14.687 -2.719  1.00 37.49 ? 116  GLN B CD  1 
ATOM   2379 O  OE1 . GLN B 1 127 ? -8.590  -13.636 -2.364  1.00 40.75 ? 116  GLN B OE1 1 
ATOM   2380 N  NE2 . GLN B 1 127 ? -6.737  -14.790 -2.912  1.00 37.56 ? 116  GLN B NE2 1 
ATOM   2381 N  N   . PHE B 1 128 ? -10.860 -18.161 0.274   1.00 29.64 ? 117  PHE B N   1 
ATOM   2382 C  CA  . PHE B 1 128 ? -11.667 -18.757 1.335   1.00 28.32 ? 117  PHE B CA  1 
ATOM   2383 C  C   . PHE B 1 128 ? -12.452 -17.712 2.084   1.00 27.26 ? 117  PHE B C   1 
ATOM   2384 O  O   . PHE B 1 128 ? -11.969 -16.609 2.338   1.00 26.68 ? 117  PHE B O   1 
ATOM   2385 C  CB  . PHE B 1 128 ? -10.835 -19.594 2.317   1.00 28.45 ? 117  PHE B CB  1 
ATOM   2386 C  CG  . PHE B 1 128 ? -9.994  -20.635 1.662   1.00 28.80 ? 117  PHE B CG  1 
ATOM   2387 C  CD1 . PHE B 1 128 ? -10.511 -21.428 0.638   1.00 28.87 ? 117  PHE B CD1 1 
ATOM   2388 C  CD2 . PHE B 1 128 ? -8.677  -20.819 2.057   1.00 27.25 ? 117  PHE B CD2 1 
ATOM   2389 C  CE1 . PHE B 1 128 ? -9.722  -22.380 0.022   1.00 28.19 ? 117  PHE B CE1 1 
ATOM   2390 C  CE2 . PHE B 1 128 ? -7.891  -21.767 1.442   1.00 26.96 ? 117  PHE B CE2 1 
ATOM   2391 C  CZ  . PHE B 1 128 ? -8.412  -22.550 0.430   1.00 26.99 ? 117  PHE B CZ  1 
ATOM   2392 N  N   . SER B 1 129 ? -13.650 -18.110 2.471   1.00 27.01 ? 118  SER B N   1 
ATOM   2393 C  CA  . SER B 1 129 ? -14.625 -17.228 3.069   1.00 28.24 ? 118  SER B CA  1 
ATOM   2394 C  C   . SER B 1 129 ? -15.150 -17.813 4.404   1.00 26.46 ? 118  SER B C   1 
ATOM   2395 O  O   . SER B 1 129 ? -15.210 -19.041 4.584   1.00 26.14 ? 118  SER B O   1 
ATOM   2396 C  CB  . SER B 1 129 ? -15.744 -17.015 2.036   1.00 28.98 ? 118  SER B CB  1 
ATOM   2397 O  OG  . SER B 1 129 ? -16.946 -16.637 2.648   1.00 35.27 ? 118  SER B OG  1 
ATOM   2398 N  N   . TYR B 1 130 ? -15.544 -16.932 5.326   1.00 24.97 ? 119  TYR B N   1 
ATOM   2399 C  CA  . TYR B 1 130 ? -15.903 -17.326 6.690   1.00 23.17 ? 119  TYR B CA  1 
ATOM   2400 C  C   . TYR B 1 130 ? -17.141 -16.603 7.240   1.00 23.95 ? 119  TYR B C   1 
ATOM   2401 O  O   . TYR B 1 130 ? -17.305 -15.383 7.053   1.00 23.99 ? 119  TYR B O   1 
ATOM   2402 C  CB  . TYR B 1 130 ? -14.707 -17.070 7.629   1.00 22.42 ? 119  TYR B CB  1 
ATOM   2403 C  CG  . TYR B 1 130 ? -13.425 -17.769 7.207   1.00 21.77 ? 119  TYR B CG  1 
ATOM   2404 C  CD1 . TYR B 1 130 ? -12.592 -17.222 6.212   1.00 21.77 ? 119  TYR B CD1 1 
ATOM   2405 C  CD2 . TYR B 1 130 ? -13.062 -18.983 7.775   1.00 20.57 ? 119  TYR B CD2 1 
ATOM   2406 C  CE1 . TYR B 1 130 ? -11.451 -17.879 5.793   1.00 19.93 ? 119  TYR B CE1 1 
ATOM   2407 C  CE2 . TYR B 1 130 ? -11.925 -19.639 7.378   1.00 20.16 ? 119  TYR B CE2 1 
ATOM   2408 C  CZ  . TYR B 1 130 ? -11.114 -19.089 6.398   1.00 20.54 ? 119  TYR B CZ  1 
ATOM   2409 O  OH  . TYR B 1 130 ? -9.958  -19.759 6.037   1.00 19.00 ? 119  TYR B OH  1 
ATOM   2410 N  N   . GLY B 1 131 ? -17.988 -17.350 7.957   1.00 23.80 ? 120  GLY B N   1 
ATOM   2411 C  CA  . GLY B 1 131 ? -19.157 -16.774 8.635   1.00 23.70 ? 120  GLY B CA  1 
ATOM   2412 C  C   . GLY B 1 131 ? -20.466 -17.027 7.887   1.00 24.72 ? 120  GLY B C   1 
ATOM   2413 O  O   . GLY B 1 131 ? -20.441 -17.484 6.742   1.00 24.78 ? 120  GLY B O   1 
ATOM   2414 N  N   . ASN B 1 132 ? -21.592 -16.724 8.542   1.00 23.59 ? 121  ASN B N   1 
ATOM   2415 C  CA  . ASN B 1 132 ? -22.946 -16.985 8.036   1.00 24.65 ? 121  ASN B CA  1 
ATOM   2416 C  C   . ASN B 1 132 ? -23.152 -16.583 6.559   1.00 24.79 ? 121  ASN B C   1 
ATOM   2417 O  O   . ASN B 1 132 ? -23.092 -15.405 6.210   1.00 23.93 ? 121  ASN B O   1 
ATOM   2418 C  CB  . ASN B 1 132 ? -23.990 -16.247 8.893   1.00 25.86 ? 121  ASN B CB  1 
ATOM   2419 C  CG  . ASN B 1 132 ? -23.968 -16.654 10.368  1.00 27.04 ? 121  ASN B CG  1 
ATOM   2420 O  OD1 . ASN B 1 132 ? -22.906 -16.807 11.000  1.00 25.24 ? 121  ASN B OD1 1 
ATOM   2421 N  ND2 . ASN B 1 132 ? -25.162 -16.813 10.930  1.00 27.54 ? 121  ASN B ND2 1 
ATOM   2422 N  N   . PRO B 1 133 ? -23.424 -17.561 5.690   1.00 25.45 ? 122  PRO B N   1 
ATOM   2423 C  CA  . PRO B 1 133 ? -23.601 -17.218 4.274   1.00 25.03 ? 122  PRO B CA  1 
ATOM   2424 C  C   . PRO B 1 133 ? -24.772 -16.272 4.033   1.00 23.96 ? 122  PRO B C   1 
ATOM   2425 O  O   . PRO B 1 133 ? -24.781 -15.576 3.036   1.00 24.42 ? 122  PRO B O   1 
ATOM   2426 C  CB  . PRO B 1 133 ? -23.860 -18.567 3.597   1.00 25.49 ? 122  PRO B CB  1 
ATOM   2427 C  CG  . PRO B 1 133 ? -23.462 -19.622 4.598   1.00 27.06 ? 122  PRO B CG  1 
ATOM   2428 C  CD  . PRO B 1 133 ? -23.616 -18.997 5.960   1.00 26.44 ? 122  PRO B CD  1 
ATOM   2429 N  N   . GLU B 1 134 ? -25.748 -16.229 4.929   1.00 23.61 ? 123  GLU B N   1 
ATOM   2430 C  CA  . GLU B 1 134 ? -26.876 -15.309 4.729   1.00 24.21 ? 123  GLU B CA  1 
ATOM   2431 C  C   . GLU B 1 134 ? -26.587 -13.840 5.049   1.00 23.30 ? 123  GLU B C   1 
ATOM   2432 O  O   . GLU B 1 134 ? -27.400 -12.963 4.724   1.00 23.58 ? 123  GLU B O   1 
ATOM   2433 C  CB  . GLU B 1 134 ? -28.140 -15.794 5.448   1.00 25.13 ? 123  GLU B CB  1 
ATOM   2434 C  CG  . GLU B 1 134 ? -28.183 -15.553 6.948   1.00 29.14 ? 123  GLU B CG  1 
ATOM   2435 C  CD  . GLU B 1 134 ? -27.365 -16.558 7.784   1.00 29.85 ? 123  GLU B CD  1 
ATOM   2436 O  OE1 . GLU B 1 134 ? -26.669 -17.448 7.224   1.00 28.06 ? 123  GLU B OE1 1 
ATOM   2437 O  OE2 . GLU B 1 134 ? -27.429 -16.443 9.035   1.00 30.82 ? 123  GLU B OE2 1 
ATOM   2438 N  N   . LEU B 1 135 ? -25.444 -13.555 5.673   1.00 21.68 ? 124  LEU B N   1 
ATOM   2439 C  CA  . LEU B 1 135 ? -25.102 -12.158 5.984   1.00 21.96 ? 124  LEU B CA  1 
ATOM   2440 C  C   . LEU B 1 135 ? -24.348 -11.467 4.838   1.00 21.63 ? 124  LEU B C   1 
ATOM   2441 O  O   . LEU B 1 135 ? -23.616 -12.119 4.081   1.00 24.19 ? 124  LEU B O   1 
ATOM   2442 C  CB  . LEU B 1 135 ? -24.285 -12.046 7.279   1.00 20.22 ? 124  LEU B CB  1 
ATOM   2443 C  CG  . LEU B 1 135 ? -25.008 -12.260 8.610   1.00 21.48 ? 124  LEU B CG  1 
ATOM   2444 C  CD1 . LEU B 1 135 ? -23.975 -12.310 9.740   1.00 19.98 ? 124  LEU B CD1 1 
ATOM   2445 C  CD2 . LEU B 1 135 ? -26.045 -11.165 8.868   1.00 21.37 ? 124  LEU B CD2 1 
ATOM   2446 N  N   . PRO B 1 136 ? -24.496 -10.147 4.718   1.00 21.44 ? 125  PRO B N   1 
ATOM   2447 C  CA  . PRO B 1 136 ? -23.664 -9.458  3.713   1.00 23.14 ? 125  PRO B CA  1 
ATOM   2448 C  C   . PRO B 1 136 ? -22.167 -9.650  3.951   1.00 24.90 ? 125  PRO B C   1 
ATOM   2449 O  O   . PRO B 1 136 ? -21.682 -9.618  5.095   1.00 23.59 ? 125  PRO B O   1 
ATOM   2450 C  CB  . PRO B 1 136 ? -24.028 -7.982  3.889   1.00 22.48 ? 125  PRO B CB  1 
ATOM   2451 C  CG  . PRO B 1 136 ? -25.323 -7.962  4.644   1.00 21.59 ? 125  PRO B CG  1 
ATOM   2452 C  CD  . PRO B 1 136 ? -25.372 -9.224  5.465   1.00 21.10 ? 125  PRO B CD  1 
ATOM   2453 N  N   . GLU B 1 137 ? -21.446 -9.835  2.857   1.00 26.15 ? 126  GLU B N   1 
ATOM   2454 C  CA  . GLU B 1 137 ? -20.006 -9.998  2.879   1.00 28.25 ? 126  GLU B CA  1 
ATOM   2455 C  C   . GLU B 1 137 ? -19.298 -8.881  3.667   1.00 27.31 ? 126  GLU B C   1 
ATOM   2456 O  O   . GLU B 1 137 ? -18.373 -9.165  4.434   1.00 24.83 ? 126  GLU B O   1 
ATOM   2457 C  CB  . GLU B 1 137 ? -19.474 -10.093 1.439   1.00 32.37 ? 126  GLU B CB  1 
ATOM   2458 C  CG  . GLU B 1 137 ? -17.979 -9.902  1.280   1.00 39.30 ? 126  GLU B CG  1 
ATOM   2459 C  CD  . GLU B 1 137 ? -17.523 -9.924  -0.176  1.00 47.60 ? 126  GLU B CD  1 
ATOM   2460 O  OE1 . GLU B 1 137 ? -18.376 -9.927  -1.095  1.00 50.29 ? 126  GLU B OE1 1 
ATOM   2461 O  OE2 . GLU B 1 137 ? -16.293 -9.930  -0.406  1.00 51.86 ? 126  GLU B OE2 1 
ATOM   2462 N  N   . ASP B 1 138 ? -19.742 -7.648  3.491   1.00 26.66 ? 127  ASP B N   1 
ATOM   2463 C  CA  . ASP B 1 138 ? -19.201 -6.497  4.199   1.00 28.33 ? 127  ASP B CA  1 
ATOM   2464 C  C   . ASP B 1 138 ? -19.392 -6.609  5.699   1.00 25.40 ? 127  ASP B C   1 
ATOM   2465 O  O   . ASP B 1 138 ? -18.561 -6.193  6.439   1.00 24.84 ? 127  ASP B O   1 
ATOM   2466 C  CB  . ASP B 1 138 ? -19.716 -5.158  3.640   1.00 32.48 ? 127  ASP B CB  1 
ATOM   2467 C  CG  . ASP B 1 138 ? -21.197 -4.884  3.959   1.00 39.31 ? 127  ASP B CG  1 
ATOM   2468 O  OD1 . ASP B 1 138 ? -22.067 -5.267  3.171   1.00 44.06 ? 127  ASP B OD1 1 
ATOM   2469 O  OD2 . ASP B 1 138 ? -21.498 -4.241  4.973   1.00 44.51 ? 127  ASP B OD2 1 
ATOM   2470 N  N   . VAL B 1 139 ? -20.509 -7.169  6.120   1.00 22.96 ? 128  VAL B N   1 
ATOM   2471 C  CA  . VAL B 1 139 ? -20.822 -7.343  7.535   1.00 21.81 ? 128  VAL B CA  1 
ATOM   2472 C  C   . VAL B 1 139 ? -19.905 -8.416  8.132   1.00 21.08 ? 128  VAL B C   1 
ATOM   2473 O  O   . VAL B 1 139 ? -19.366 -8.243  9.230   1.00 21.52 ? 128  VAL B O   1 
ATOM   2474 C  CB  . VAL B 1 139 ? -22.315 -7.691  7.739   1.00 22.25 ? 128  VAL B CB  1 
ATOM   2475 C  CG1 . VAL B 1 139 ? -22.598 -8.191  9.145   1.00 21.05 ? 128  VAL B CG1 1 
ATOM   2476 C  CG2 . VAL B 1 139 ? -23.190 -6.490  7.403   1.00 22.39 ? 128  VAL B CG2 1 
ATOM   2477 N  N   . LEU B 1 140 ? -19.700 -9.502  7.393   1.00 20.37 ? 129  LEU B N   1 
ATOM   2478 C  CA  . LEU B 1 140 ? -18.831 -10.591 7.836   1.00 20.39 ? 129  LEU B CA  1 
ATOM   2479 C  C   . LEU B 1 140 ? -17.402 -10.090 7.949   1.00 21.14 ? 129  LEU B C   1 
ATOM   2480 O  O   . LEU B 1 140 ? -16.690 -10.429 8.900   1.00 18.71 ? 129  LEU B O   1 
ATOM   2481 C  CB  . LEU B 1 140 ? -18.917 -11.797 6.885   1.00 19.85 ? 129  LEU B CB  1 
ATOM   2482 C  CG  . LEU B 1 140 ? -20.250 -12.571 6.865   1.00 20.35 ? 129  LEU B CG  1 
ATOM   2483 C  CD1 . LEU B 1 140 ? -20.292 -13.606 5.748   1.00 19.36 ? 129  LEU B CD1 1 
ATOM   2484 C  CD2 . LEU B 1 140 ? -20.516 -13.240 8.201   1.00 20.36 ? 129  LEU B CD2 1 
ATOM   2485 N  N   A ASP B 1 141 ? -17.003 -9.256  6.990   0.50 22.05 ? 130  ASP B N   1 
ATOM   2486 N  N   B ASP B 1 141 ? -17.006 -9.223  7.020   0.50 22.05 ? 130  ASP B N   1 
ATOM   2487 C  CA  A ASP B 1 141 ? -15.654 -8.708  6.980   0.50 25.08 ? 130  ASP B CA  1 
ATOM   2488 C  CA  B ASP B 1 141 ? -15.671 -8.653  6.969   0.50 25.08 ? 130  ASP B CA  1 
ATOM   2489 C  C   A ASP B 1 141 ? -15.398 -7.874  8.246   0.50 23.75 ? 130  ASP B C   1 
ATOM   2490 C  C   B ASP B 1 141 ? -15.396 -7.830  8.216   0.50 23.75 ? 130  ASP B C   1 
ATOM   2491 O  O   A ASP B 1 141 ? -14.356 -8.009  8.871   0.50 22.82 ? 130  ASP B O   1 
ATOM   2492 O  O   B ASP B 1 141 ? -14.422 -8.027  8.855   0.50 22.82 ? 130  ASP B O   1 
ATOM   2493 C  CB  A ASP B 1 141 ? -15.408 -7.899  5.703   0.50 30.33 ? 130  ASP B CB  1 
ATOM   2494 C  CB  B ASP B 1 141 ? -15.511 -7.705  5.781   0.50 30.33 ? 130  ASP B CB  1 
ATOM   2495 C  CG  A ASP B 1 141 ? -13.991 -7.319  5.639   0.50 38.08 ? 130  ASP B CG  1 
ATOM   2496 C  CG  B ASP B 1 141 ? -15.259 -8.403  4.460   0.50 38.08 ? 130  ASP B CG  1 
ATOM   2497 O  OD1 A ASP B 1 141 ? -13.036 -8.075  5.320   0.50 43.98 ? 130  ASP B OD1 1 
ATOM   2498 O  OD1 B ASP B 1 141 ? -14.938 -9.603  4.415   0.50 43.98 ? 130  ASP B OD1 1 
ATOM   2499 O  OD2 A ASP B 1 141 ? -13.827 -6.099  5.904   0.50 40.43 ? 130  ASP B OD2 1 
ATOM   2500 O  OD2 B ASP B 1 141 ? -15.354 -7.716  3.420   0.50 40.43 ? 130  ASP B OD2 1 
ATOM   2501 N  N   . VAL B 1 142 ? -16.367 -7.044  8.636   1.00 22.84 ? 131  VAL B N   1 
ATOM   2502 C  CA  . VAL B 1 142 ? -16.271 -6.236  9.857   1.00 21.38 ? 131  VAL B CA  1 
ATOM   2503 C  C   . VAL B 1 142 ? -16.290 -7.114  11.115  1.00 21.18 ? 131  VAL B C   1 
ATOM   2504 O  O   . VAL B 1 142 ? -15.507 -6.888  12.039  1.00 22.17 ? 131  VAL B O   1 
ATOM   2505 C  CB  . VAL B 1 142 ? -17.390 -5.177  9.905   1.00 21.79 ? 131  VAL B CB  1 
ATOM   2506 C  CG1 . VAL B 1 142 ? -17.524 -4.553  11.294  1.00 20.28 ? 131  VAL B CG1 1 
ATOM   2507 C  CG2 . VAL B 1 142 ? -17.140 -4.106  8.842   1.00 22.58 ? 131  VAL B CG2 1 
ATOM   2508 N  N   . GLN B 1 143 ? -17.149 -8.128  11.147  1.00 19.68 ? 132  GLN B N   1 
ATOM   2509 C  CA  . GLN B 1 143 ? -17.180 -9.031  12.298  1.00 20.05 ? 132  GLN B CA  1 
ATOM   2510 C  C   . GLN B 1 143 ? -15.842 -9.752  12.473  1.00 20.92 ? 132  GLN B C   1 
ATOM   2511 O  O   . GLN B 1 143 ? -15.298 -9.795  13.579  1.00 21.04 ? 132  GLN B O   1 
ATOM   2512 C  CB  . GLN B 1 143 ? -18.350 -10.016 12.223  1.00 20.19 ? 132  GLN B CB  1 
ATOM   2513 C  CG  . GLN B 1 143 ? -19.733 -9.378  12.331  1.00 20.31 ? 132  GLN B CG  1 
ATOM   2514 C  CD  . GLN B 1 143 ? -20.089 -8.891  13.725  1.00 20.80 ? 132  GLN B CD  1 
ATOM   2515 O  OE1 . GLN B 1 143 ? -19.246 -8.354  14.454  1.00 21.23 ? 132  GLN B OE1 1 
ATOM   2516 N  NE2 . GLN B 1 143 ? -21.354 -9.070  14.106  1.00 20.06 ? 132  GLN B NE2 1 
ATOM   2517 N  N   . LEU B 1 144 ? -15.288 -10.277 11.381  1.00 20.99 ? 133  LEU B N   1 
ATOM   2518 C  CA  . LEU B 1 144 ? -13.947 -10.853 11.429  1.00 21.40 ? 133  LEU B CA  1 
ATOM   2519 C  C   . LEU B 1 144 ? -12.866 -9.860  11.806  1.00 20.29 ? 133  LEU B C   1 
ATOM   2520 O  O   . LEU B 1 144 ? -11.934 -10.223 12.504  1.00 20.38 ? 133  LEU B O   1 
ATOM   2521 C  CB  . LEU B 1 144 ? -13.584 -11.546 10.108  1.00 22.73 ? 133  LEU B CB  1 
ATOM   2522 C  CG  . LEU B 1 144 ? -13.928 -13.030 10.061  1.00 25.58 ? 133  LEU B CG  1 
ATOM   2523 C  CD1 . LEU B 1 144 ? -15.405 -13.286 10.352  1.00 25.48 ? 133  LEU B CD1 1 
ATOM   2524 C  CD2 . LEU B 1 144 ? -13.616 -13.524 8.663   1.00 30.24 ? 133  LEU B CD2 1 
ATOM   2525 N  N   . ALA B 1 145 ? -13.012 -8.612  11.363  1.00 19.27 ? 134  ALA B N   1 
ATOM   2526 C  CA  . ALA B 1 145 ? -12.034 -7.555  11.608  1.00 18.68 ? 134  ALA B CA  1 
ATOM   2527 C  C   . ALA B 1 145 ? -11.929 -7.238  13.098  1.00 18.75 ? 134  ALA B C   1 
ATOM   2528 O  O   . ALA B 1 145 ? -10.833 -7.047  13.624  1.00 19.15 ? 134  ALA B O   1 
ATOM   2529 C  CB  . ALA B 1 145 ? -12.374 -6.287  10.803  1.00 17.90 ? 134  ALA B CB  1 
ATOM   2530 N  N   . PHE B 1 146 ? -13.068 -7.194  13.785  1.00 19.61 ? 135  PHE B N   1 
ATOM   2531 C  CA  . PHE B 1 146 ? -13.074 -7.007  15.237  1.00 18.61 ? 135  PHE B CA  1 
ATOM   2532 C  C   . PHE B 1 146 ? -12.278 -8.106  15.915  1.00 19.35 ? 135  PHE B C   1 
ATOM   2533 O  O   . PHE B 1 146 ? -11.471 -7.822  16.806  1.00 21.09 ? 135  PHE B O   1 
ATOM   2534 C  CB  . PHE B 1 146 ? -14.490 -6.951  15.795  1.00 17.77 ? 135  PHE B CB  1 
ATOM   2535 C  CG  . PHE B 1 146 ? -15.024 -5.554  15.943  1.00 18.21 ? 135  PHE B CG  1 
ATOM   2536 C  CD1 . PHE B 1 146 ? -15.596 -4.891  14.850  1.00 18.62 ? 135  PHE B CD1 1 
ATOM   2537 C  CD2 . PHE B 1 146 ? -14.940 -4.888  17.162  1.00 18.08 ? 135  PHE B CD2 1 
ATOM   2538 C  CE1 . PHE B 1 146 ? -16.083 -3.602  14.974  1.00 18.78 ? 135  PHE B CE1 1 
ATOM   2539 C  CE2 . PHE B 1 146 ? -15.435 -3.603  17.300  1.00 19.09 ? 135  PHE B CE2 1 
ATOM   2540 C  CZ  . PHE B 1 146 ? -16.011 -2.955  16.201  1.00 19.54 ? 135  PHE B CZ  1 
ATOM   2541 N  N   . LEU B 1 147 ? -12.476 -9.353  15.492  1.00 19.14 ? 136  LEU B N   1 
ATOM   2542 C  CA  . LEU B 1 147 ? -11.735 -10.469 16.089  1.00 19.18 ? 136  LEU B CA  1 
ATOM   2543 C  C   . LEU B 1 147 ? -10.254 -10.469 15.701  1.00 18.88 ? 136  LEU B C   1 
ATOM   2544 O  O   . LEU B 1 147 ? -9.383  -10.753 16.534  1.00 19.81 ? 136  LEU B O   1 
ATOM   2545 C  CB  . LEU B 1 147 ? -12.392 -11.819 15.750  1.00 19.74 ? 136  LEU B CB  1 
ATOM   2546 C  CG  . LEU B 1 147 ? -13.777 -12.073 16.338  1.00 18.48 ? 136  LEU B CG  1 
ATOM   2547 C  CD1 . LEU B 1 147 ? -14.421 -13.210 15.584  1.00 19.88 ? 136  LEU B CD1 1 
ATOM   2548 C  CD2 . LEU B 1 147 ? -13.657 -12.421 17.812  1.00 18.40 ? 136  LEU B CD2 1 
ATOM   2549 N  N   . ARG B 1 148 ? -9.963  -10.128 14.449  1.00 18.49 ? 137  ARG B N   1 
ATOM   2550 C  CA  . ARG B 1 148 ? -8.580  -10.164 13.948  1.00 18.30 ? 137  ARG B CA  1 
ATOM   2551 C  C   . ARG B 1 148 ? -7.734  -9.081  14.608  1.00 18.94 ? 137  ARG B C   1 
ATOM   2552 O  O   . ARG B 1 148 ? -6.569  -9.304  14.981  1.00 18.51 ? 137  ARG B O   1 
ATOM   2553 C  CB  . ARG B 1 148 ? -8.558  -10.013 12.425  1.00 17.97 ? 137  ARG B CB  1 
ATOM   2554 C  CG  . ARG B 1 148 ? -9.192  -11.181 11.671  1.00 17.81 ? 137  ARG B CG  1 
ATOM   2555 C  CD  . ARG B 1 148 ? -9.450  -10.851 10.205  1.00 18.92 ? 137  ARG B CD  1 
ATOM   2556 N  NE  . ARG B 1 148 ? -8.208  -10.395 9.596   1.00 18.81 ? 137  ARG B NE  1 
ATOM   2557 C  CZ  . ARG B 1 148 ? -8.024  -9.206  9.039   1.00 19.81 ? 137  ARG B CZ  1 
ATOM   2558 N  NH1 . ARG B 1 148 ? -9.025  -8.341  8.923   1.00 20.13 ? 137  ARG B NH1 1 
ATOM   2559 N  NH2 . ARG B 1 148 ? -6.828  -8.889  8.577   1.00 20.31 ? 137  ARG B NH2 1 
ATOM   2560 N  N   . LEU B 1 149 ? -8.333  -7.904  14.775  1.00 19.23 ? 138  LEU B N   1 
ATOM   2561 C  CA  . LEU B 1 149 ? -7.601  -6.778  15.324  1.00 19.76 ? 138  LEU B CA  1 
ATOM   2562 C  C   . LEU B 1 149 ? -7.481  -6.797  16.843  1.00 18.91 ? 138  LEU B C   1 
ATOM   2563 O  O   . LEU B 1 149 ? -6.508  -6.297  17.365  1.00 18.29 ? 138  LEU B O   1 
ATOM   2564 C  CB  . LEU B 1 149 ? -8.184  -5.432  14.859  1.00 20.33 ? 138  LEU B CB  1 
ATOM   2565 C  CG  . LEU B 1 149 ? -7.635  -4.769  13.587  1.00 23.50 ? 138  LEU B CG  1 
ATOM   2566 C  CD1 . LEU B 1 149 ? -6.100  -4.770  13.571  1.00 23.37 ? 138  LEU B CD1 1 
ATOM   2567 C  CD2 . LEU B 1 149 ? -8.197  -5.411  12.316  1.00 23.72 ? 138  LEU B CD2 1 
ATOM   2568 N  N   . LEU B 1 150 ? -8.472  -7.350  17.540  1.00 18.71 ? 139  LEU B N   1 
ATOM   2569 C  CA  . LEU B 1 150 ? -8.588  -7.160  18.988  1.00 19.12 ? 139  LEU B CA  1 
ATOM   2570 C  C   . LEU B 1 150 ? -8.550  -8.462  19.828  1.00 20.03 ? 139  LEU B C   1 
ATOM   2571 O  O   . LEU B 1 150 ? -8.928  -8.454  20.992  1.00 20.67 ? 139  LEU B O   1 
ATOM   2572 C  CB  . LEU B 1 150 ? -9.850  -6.325  19.277  1.00 19.59 ? 139  LEU B CB  1 
ATOM   2573 C  CG  . LEU B 1 150 ? -9.772  -4.903  18.666  1.00 19.52 ? 139  LEU B CG  1 
ATOM   2574 C  CD1 . LEU B 1 150 ? -11.146 -4.275  18.549  1.00 20.53 ? 139  LEU B CD1 1 
ATOM   2575 C  CD2 . LEU B 1 150 ? -8.838  -3.985  19.459  1.00 18.78 ? 139  LEU B CD2 1 
ATOM   2576 N  N   . SER B 1 151 ? -8.106  -9.571  19.228  1.00 20.04 ? 140  SER B N   1 
ATOM   2577 C  CA  . SER B 1 151 ? -7.859  -10.845 19.949  1.00 21.04 ? 140  SER B CA  1 
ATOM   2578 C  C   . SER B 1 151 ? -6.418  -10.899 20.415  1.00 20.81 ? 140  SER B C   1 
ATOM   2579 O  O   . SER B 1 151 ? -5.561  -10.226 19.842  1.00 21.93 ? 140  SER B O   1 
ATOM   2580 C  CB  . SER B 1 151 ? -8.093  -12.050 19.027  1.00 21.14 ? 140  SER B CB  1 
ATOM   2581 O  OG  . SER B 1 151 ? -9.475  -12.235 18.767  1.00 22.35 ? 140  SER B OG  1 
ATOM   2582 N  N   . SER B 1 152 ? -6.138  -11.713 21.426  1.00 21.71 ? 141  SER B N   1 
ATOM   2583 C  CA  . SER B 1 152 ? -4.762  -11.888 21.895  1.00 23.04 ? 141  SER B CA  1 
ATOM   2584 C  C   . SER B 1 152 ? -3.967  -12.812 20.971  1.00 23.23 ? 141  SER B C   1 
ATOM   2585 O  O   . SER B 1 152 ? -2.764  -12.667 20.817  1.00 23.85 ? 141  SER B O   1 
ATOM   2586 C  CB  . SER B 1 152 ? -4.733  -12.433 23.320  1.00 23.96 ? 141  SER B CB  1 
ATOM   2587 O  OG  . SER B 1 152 ? -5.165  -13.779 23.363  1.00 26.76 ? 141  SER B OG  1 
ATOM   2588 N  N   . ARG B 1 153 ? -4.646  -13.781 20.374  1.00 22.77 ? 142  ARG B N   1 
ATOM   2589 C  CA  . ARG B 1 153 ? -3.982  -14.695 19.462  1.00 24.45 ? 142  ARG B CA  1 
ATOM   2590 C  C   . ARG B 1 153 ? -5.019  -15.390 18.597  1.00 22.89 ? 142  ARG B C   1 
ATOM   2591 O  O   . ARG B 1 153 ? -6.227  -15.273 18.863  1.00 21.02 ? 142  ARG B O   1 
ATOM   2592 C  CB  . ARG B 1 153 ? -3.147  -15.727 20.226  1.00 27.64 ? 142  ARG B CB  1 
ATOM   2593 C  CG  . ARG B 1 153 ? -3.955  -16.724 21.032  1.00 33.81 ? 142  ARG B CG  1 
ATOM   2594 C  CD  . ARG B 1 153 ? -3.078  -17.482 22.013  1.00 41.05 ? 142  ARG B CD  1 
ATOM   2595 N  NE  . ARG B 1 153 ? -2.785  -16.660 23.189  1.00 50.79 ? 142  ARG B NE  1 
ATOM   2596 C  CZ  . ARG B 1 153 ? -1.568  -16.322 23.607  1.00 53.07 ? 142  ARG B CZ  1 
ATOM   2597 N  NH1 . ARG B 1 153 ? -0.475  -16.737 22.963  1.00 53.96 ? 142  ARG B NH1 1 
ATOM   2598 N  NH2 . ARG B 1 153 ? -1.452  -15.571 24.691  1.00 53.94 ? 142  ARG B NH2 1 
ATOM   2599 N  N   . ALA B 1 154 ? -4.535  -16.108 17.582  1.00 19.52 ? 143  ALA B N   1 
ATOM   2600 C  CA  . ALA B 1 154 ? -5.381  -16.874 16.687  1.00 19.65 ? 143  ALA B CA  1 
ATOM   2601 C  C   . ALA B 1 154 ? -4.604  -18.027 16.101  1.00 19.71 ? 143  ALA B C   1 
ATOM   2602 O  O   . ALA B 1 154 ? -3.368  -17.996 16.066  1.00 19.77 ? 143  ALA B O   1 
ATOM   2603 C  CB  . ALA B 1 154 ? -5.938  -15.998 15.568  1.00 17.90 ? 143  ALA B CB  1 
ATOM   2604 N  N   . SER B 1 155 ? -5.338  -19.028 15.617  1.00 19.26 ? 144  SER B N   1 
ATOM   2605 C  CA  . SER B 1 155 ? -4.745  -20.193 14.962  1.00 19.31 ? 144  SER B CA  1 
ATOM   2606 C  C   . SER B 1 155 ? -5.741  -20.797 13.966  1.00 18.30 ? 144  SER B C   1 
ATOM   2607 O  O   . SER B 1 155 ? -6.943  -20.585 14.069  1.00 18.20 ? 144  SER B O   1 
ATOM   2608 C  CB  . SER B 1 155 ? -4.386  -21.246 15.993  1.00 18.80 ? 144  SER B CB  1 
ATOM   2609 O  OG  . SER B 1 155 ? -5.592  -21.805 16.471  1.00 20.65 ? 144  SER B OG  1 
ATOM   2610 N  N   . GLN B 1 156 ? -5.240  -21.554 12.999  1.00 17.97 ? 145  GLN B N   1 
ATOM   2611 C  CA  . GLN B 1 156 ? -6.111  -22.195 12.030  1.00 18.32 ? 145  GLN B CA  1 
ATOM   2612 C  C   . GLN B 1 156 ? -5.328  -23.334 11.431  1.00 18.44 ? 145  GLN B C   1 
ATOM   2613 O  O   . GLN B 1 156 ? -4.133  -23.177 11.155  1.00 19.17 ? 145  GLN B O   1 
ATOM   2614 C  CB  . GLN B 1 156 ? -6.566  -21.197 10.924  1.00 17.26 ? 145  GLN B CB  1 
ATOM   2615 C  CG  . GLN B 1 156 ? -7.567  -21.764 9.909   1.00 17.21 ? 145  GLN B CG  1 
ATOM   2616 C  CD  . GLN B 1 156 ? -7.964  -20.761 8.820   1.00 17.77 ? 145  GLN B CD  1 
ATOM   2617 O  OE1 . GLN B 1 156 ? -7.350  -19.703 8.665   1.00 17.53 ? 145  GLN B OE1 1 
ATOM   2618 N  NE2 . GLN B 1 156 ? -9.000  -21.091 8.065   1.00 17.34 ? 145  GLN B NE2 1 
ATOM   2619 N  N   . GLN B 1 157 ? -6.007  -24.459 11.236  1.00 17.83 ? 146  GLN B N   1 
ATOM   2620 C  CA  . GLN B 1 157 ? -5.472  -25.605 10.513  1.00 19.73 ? 146  GLN B CA  1 
ATOM   2621 C  C   . GLN B 1 157 ? -6.079  -25.722 9.113   1.00 20.38 ? 146  GLN B C   1 
ATOM   2622 O  O   . GLN B 1 157 ? -7.252  -25.381 8.870   1.00 20.50 ? 146  GLN B O   1 
ATOM   2623 C  CB  . GLN B 1 157 ? -5.739  -26.921 11.280  1.00 19.77 ? 146  GLN B CB  1 
ATOM   2624 C  CG  . GLN B 1 157 ? -5.067  -27.011 12.643  1.00 21.11 ? 146  GLN B CG  1 
ATOM   2625 C  CD  . GLN B 1 157 ? -5.433  -28.277 13.411  1.00 22.01 ? 146  GLN B CD  1 
ATOM   2626 O  OE1 . GLN B 1 157 ? -5.872  -29.272 12.836  1.00 22.66 ? 146  GLN B OE1 1 
ATOM   2627 N  NE2 . GLN B 1 157 ? -5.249  -28.236 14.719  1.00 22.19 ? 146  GLN B NE2 1 
ATOM   2628 N  N   . ILE B 1 158 ? -5.287  -26.254 8.195   1.00 21.08 ? 147  ILE B N   1 
ATOM   2629 C  CA  . ILE B 1 158 ? -5.761  -26.533 6.860   1.00 22.04 ? 147  ILE B CA  1 
ATOM   2630 C  C   . ILE B 1 158 ? -5.174  -27.888 6.469   1.00 22.06 ? 147  ILE B C   1 
ATOM   2631 O  O   . ILE B 1 158 ? -4.038  -28.186 6.818   1.00 22.16 ? 147  ILE B O   1 
ATOM   2632 C  CB  . ILE B 1 158 ? -5.417  -25.349 5.918   1.00 22.90 ? 147  ILE B CB  1 
ATOM   2633 C  CG1 . ILE B 1 158 ? -5.968  -25.563 4.514   1.00 24.19 ? 147  ILE B CG1 1 
ATOM   2634 C  CG2 . ILE B 1 158 ? -3.919  -25.070 5.894   1.00 23.32 ? 147  ILE B CG2 1 
ATOM   2635 C  CD1 . ILE B 1 158 ? -6.245  -24.253 3.782   1.00 25.68 ? 147  ILE B CD1 1 
ATOM   2636 N  N   . THR B 1 159 ? -5.985  -28.735 5.834   1.00 23.07 ? 148  THR B N   1 
ATOM   2637 C  CA  . THR B 1 159 ? -5.577  -30.074 5.403   1.00 23.59 ? 148  THR B CA  1 
ATOM   2638 C  C   . THR B 1 159 ? -5.509  -30.154 3.893   1.00 24.14 ? 148  THR B C   1 
ATOM   2639 O  O   . THR B 1 159 ? -6.491  -29.866 3.214   1.00 23.38 ? 148  THR B O   1 
ATOM   2640 C  CB  . THR B 1 159 ? -6.587  -31.135 5.850   1.00 23.93 ? 148  THR B CB  1 
ATOM   2641 O  OG1 . THR B 1 159 ? -6.809  -30.995 7.241   1.00 25.06 ? 148  THR B OG1 1 
ATOM   2642 C  CG2 . THR B 1 159 ? -6.064  -32.571 5.595   1.00 24.48 ? 148  THR B CG2 1 
ATOM   2643 N  N   . TYR B 1 160 ? -4.342  -30.537 3.377   1.00 24.47 ? 149  TYR B N   1 
ATOM   2644 C  CA  . TYR B 1 160 ? -4.135  -30.750 1.941   1.00 23.90 ? 149  TYR B CA  1 
ATOM   2645 C  C   . TYR B 1 160 ? -4.273  -32.252 1.662   1.00 25.28 ? 149  TYR B C   1 
ATOM   2646 O  O   . TYR B 1 160 ? -3.535  -33.059 2.231   1.00 25.13 ? 149  TYR B O   1 
ATOM   2647 C  CB  . TYR B 1 160 ? -2.733  -30.249 1.579   1.00 23.70 ? 149  TYR B CB  1 
ATOM   2648 C  CG  . TYR B 1 160 ? -2.319  -30.269 0.107   1.00 23.95 ? 149  TYR B CG  1 
ATOM   2649 C  CD1 . TYR B 1 160 ? -2.727  -29.259 -0.763  1.00 23.93 ? 149  TYR B CD1 1 
ATOM   2650 C  CD2 . TYR B 1 160 ? -1.475  -31.272 -0.395  1.00 23.17 ? 149  TYR B CD2 1 
ATOM   2651 C  CE1 . TYR B 1 160 ? -2.324  -29.249 -2.091  1.00 23.99 ? 149  TYR B CE1 1 
ATOM   2652 C  CE2 . TYR B 1 160 ? -1.052  -31.275 -1.720  1.00 23.32 ? 149  TYR B CE2 1 
ATOM   2653 C  CZ  . TYR B 1 160 ? -1.489  -30.260 -2.576  1.00 24.95 ? 149  TYR B CZ  1 
ATOM   2654 O  OH  . TYR B 1 160 ? -1.103  -30.228 -3.905  1.00 23.53 ? 149  TYR B OH  1 
ATOM   2655 N  N   . HIS B 1 161 ? -5.239  -32.622 0.820   1.00 25.86 ? 150  HIS B N   1 
ATOM   2656 C  CA  . HIS B 1 161 ? -5.374  -33.997 0.329   1.00 26.21 ? 150  HIS B CA  1 
ATOM   2657 C  C   . HIS B 1 161 ? -4.577  -34.133 -0.941  1.00 26.59 ? 150  HIS B C   1 
ATOM   2658 O  O   . HIS B 1 161 ? -4.714  -33.322 -1.852  1.00 25.68 ? 150  HIS B O   1 
ATOM   2659 C  CB  . HIS B 1 161 ? -6.830  -34.360 0.101   1.00 26.21 ? 150  HIS B CB  1 
ATOM   2660 C  CG  . HIS B 1 161 ? -7.659  -34.317 1.350   1.00 27.35 ? 150  HIS B CG  1 
ATOM   2661 N  ND1 . HIS B 1 161 ? -7.823  -35.387 2.145   1.00 29.22 ? 150  HIS B ND1 1 
ATOM   2662 C  CD2 . HIS B 1 161 ? -8.345  -33.263 1.963   1.00 28.79 ? 150  HIS B CD2 1 
ATOM   2663 C  CE1 . HIS B 1 161 ? -8.599  -35.059 3.200   1.00 28.41 ? 150  HIS B CE1 1 
ATOM   2664 N  NE2 . HIS B 1 161 ? -8.915  -33.754 3.087   1.00 30.92 ? 150  HIS B NE2 1 
ATOM   2665 N  N   . CYS B 1 162 ? -3.725  -35.152 -0.997  1.00 25.14 ? 151  CYS B N   1 
ATOM   2666 C  CA  . CYS B 1 162 ? -2.719  -35.255 -2.039  1.00 25.49 ? 151  CYS B CA  1 
ATOM   2667 C  C   . CYS B 1 162 ? -2.788  -36.610 -2.734  1.00 27.46 ? 151  CYS B C   1 
ATOM   2668 O  O   . CYS B 1 162 ? -2.893  -37.642 -2.073  1.00 26.89 ? 151  CYS B O   1 
ATOM   2669 C  CB  . CYS B 1 162 ? -1.322  -35.093 -1.426  1.00 23.98 ? 151  CYS B CB  1 
ATOM   2670 S  SG  . CYS B 1 162 ? -1.073  -36.240 -0.046  1.00 23.87 ? 151  CYS B SG  1 
ATOM   2671 N  N   . LYS B 1 163 ? -2.727  -36.585 -4.064  1.00 29.95 ? 152  LYS B N   1 
ATOM   2672 C  CA  . LYS B 1 163 ? -2.378  -37.767 -4.872  1.00 32.62 ? 152  LYS B CA  1 
ATOM   2673 C  C   . LYS B 1 163 ? -1.222  -37.374 -5.793  1.00 32.41 ? 152  LYS B C   1 
ATOM   2674 O  O   . LYS B 1 163 ? -1.361  -36.500 -6.656  1.00 30.94 ? 152  LYS B O   1 
ATOM   2675 C  CB  . LYS B 1 163 ? -3.589  -38.228 -5.683  1.00 36.80 ? 152  LYS B CB  1 
ATOM   2676 C  CG  . LYS B 1 163 ? -3.377  -39.398 -6.645  1.00 39.10 ? 152  LYS B CG  1 
ATOM   2677 C  CD  . LYS B 1 163 ? -4.670  -39.645 -7.435  1.00 40.95 ? 152  LYS B CD  1 
ATOM   2678 C  CE  . LYS B 1 163 ? -4.565  -40.862 -8.337  1.00 44.58 ? 152  LYS B CE  1 
ATOM   2679 N  NZ  . LYS B 1 163 ? -5.910  -41.309 -8.792  1.00 45.58 ? 152  LYS B NZ  1 
ATOM   2680 N  N   . ASN B 1 164 ? -0.074  -38.003 -5.589  1.00 32.67 ? 153  ASN B N   1 
ATOM   2681 C  CA  . ASN B 1 164 ? 1.146   -37.676 -6.325  1.00 34.41 ? 153  ASN B CA  1 
ATOM   2682 C  C   . ASN B 1 164 ? 1.498   -36.202 -6.260  1.00 35.81 ? 153  ASN B C   1 
ATOM   2683 O  O   . ASN B 1 164 ? 1.771   -35.572 -7.291  1.00 38.09 ? 153  ASN B O   1 
ATOM   2684 C  CB  . ASN B 1 164 ? 1.062   -38.137 -7.781  1.00 34.32 ? 153  ASN B CB  1 
ATOM   2685 C  CG  . ASN B 1 164 ? 0.619   -39.578 -7.902  1.00 34.57 ? 153  ASN B CG  1 
ATOM   2686 O  OD1 . ASN B 1 164 ? -0.328  -39.881 -8.621  1.00 37.99 ? 153  ASN B OD1 1 
ATOM   2687 N  ND2 . ASN B 1 164 ? 1.283   -40.469 -7.187  1.00 32.15 ? 153  ASN B ND2 1 
ATOM   2688 N  N   . SER B 1 165 ? 1.497   -35.665 -5.040  1.00 33.69 ? 154  SER B N   1 
ATOM   2689 C  CA  . SER B 1 165 ? 1.804   -34.264 -4.805  1.00 31.47 ? 154  SER B CA  1 
ATOM   2690 C  C   . SER B 1 165 ? 2.427   -34.075 -3.425  1.00 30.13 ? 154  SER B C   1 
ATOM   2691 O  O   . SER B 1 165 ? 1.770   -34.262 -2.413  1.00 29.66 ? 154  SER B O   1 
ATOM   2692 C  CB  . SER B 1 165 ? 0.533   -33.406 -4.950  1.00 30.82 ? 154  SER B CB  1 
ATOM   2693 O  OG  . SER B 1 165 ? 0.840   -32.015 -4.848  1.00 29.21 ? 154  SER B OG  1 
ATOM   2694 N  N   . ILE B 1 166 ? 3.707   -33.723 -3.401  1.00 29.89 ? 155  ILE B N   1 
ATOM   2695 C  CA  . ILE B 1 166 ? 4.389   -33.314 -2.182  1.00 28.76 ? 155  ILE B CA  1 
ATOM   2696 C  C   . ILE B 1 166 ? 3.671   -32.072 -1.645  1.00 28.71 ? 155  ILE B C   1 
ATOM   2697 O  O   . ILE B 1 166 ? 3.313   -31.167 -2.424  1.00 26.92 ? 155  ILE B O   1 
ATOM   2698 C  CB  . ILE B 1 166 ? 5.859   -32.970 -2.466  1.00 29.95 ? 155  ILE B CB  1 
ATOM   2699 C  CG1 . ILE B 1 166 ? 6.564   -34.102 -3.252  1.00 33.95 ? 155  ILE B CG1 1 
ATOM   2700 C  CG2 . ILE B 1 166 ? 6.612   -32.643 -1.189  1.00 31.11 ? 155  ILE B CG2 1 
ATOM   2701 C  CD1 . ILE B 1 166 ? 6.543   -35.476 -2.594  1.00 32.84 ? 155  ILE B CD1 1 
ATOM   2702 N  N   . ALA B 1 167 ? 3.430   -32.062 -0.334  1.00 24.19 ? 156  ALA B N   1 
ATOM   2703 C  CA  . ALA B 1 167 ? 2.735   -30.972 0.335   1.00 25.59 ? 156  ALA B CA  1 
ATOM   2704 C  C   . ALA B 1 167 ? 3.732   -30.220 1.168   1.00 24.58 ? 156  ALA B C   1 
ATOM   2705 O  O   . ALA B 1 167 ? 3.657   -28.995 1.318   1.00 25.07 ? 156  ALA B O   1 
ATOM   2706 C  CB  . ALA B 1 167 ? 1.625   -31.509 1.221   1.00 24.06 ? 156  ALA B CB  1 
ATOM   2707 N  N   . TYR B 1 168 ? 4.695   -30.957 1.700   1.00 23.64 ? 157  TYR B N   1 
ATOM   2708 C  CA  . TYR B 1 168 ? 5.662   -30.352 2.581   1.00 23.17 ? 157  TYR B CA  1 
ATOM   2709 C  C   . TYR B 1 168 ? 7.057   -30.941 2.365   1.00 24.84 ? 157  TYR B C   1 
ATOM   2710 O  O   . TYR B 1 168 ? 7.924   -30.303 1.754   1.00 24.25 ? 157  TYR B O   1 
ATOM   2711 C  CB  . TYR B 1 168 ? 5.182   -30.466 4.024   1.00 21.01 ? 157  TYR B CB  1 
ATOM   2712 C  CG  . TYR B 1 168 ? 6.132   -29.911 5.045   1.00 21.73 ? 157  TYR B CG  1 
ATOM   2713 C  CD1 . TYR B 1 168 ? 6.448   -28.546 5.076   1.00 20.28 ? 157  TYR B CD1 1 
ATOM   2714 C  CD2 . TYR B 1 168 ? 6.706   -30.753 6.003   1.00 20.76 ? 157  TYR B CD2 1 
ATOM   2715 C  CE1 . TYR B 1 168 ? 7.329   -28.046 6.024   1.00 20.54 ? 157  TYR B CE1 1 
ATOM   2716 C  CE2 . TYR B 1 168 ? 7.562   -30.258 6.959   1.00 20.44 ? 157  TYR B CE2 1 
ATOM   2717 C  CZ  . TYR B 1 168 ? 7.867   -28.916 6.967   1.00 21.10 ? 157  TYR B CZ  1 
ATOM   2718 O  OH  . TYR B 1 168 ? 8.740   -28.470 7.914   1.00 22.33 ? 157  TYR B OH  1 
HETATM 2719 N  N   . MSE B 1 169 ? 7.259   -32.160 2.845   1.00 25.66 ? 158  MSE B N   1 
HETATM 2720 C  CA  . MSE B 1 169 ? 8.565   -32.780 2.783   1.00 27.03 ? 158  MSE B CA  1 
HETATM 2721 C  C   . MSE B 1 169 ? 8.544   -33.706 1.592   1.00 26.33 ? 158  MSE B C   1 
HETATM 2722 O  O   . MSE B 1 169 ? 7.558   -34.383 1.320   1.00 22.68 ? 158  MSE B O   1 
HETATM 2723 C  CB  . MSE B 1 169 ? 8.766   -33.463 4.135   1.00 30.85 ? 158  MSE B CB  1 
HETATM 2724 C  CG  . MSE B 1 169 ? 9.727   -34.637 4.146   1.00 38.64 ? 158  MSE B CG  1 
HETATM 2725 SE SE  . MSE B 1 169 ? 11.487  -33.955 4.676   1.00 54.87 ? 158  MSE B SE  1 
HETATM 2726 C  CE  . MSE B 1 169 ? 11.201  -33.367 6.535   1.00 49.26 ? 158  MSE B CE  1 
ATOM   2727 N  N   . ASP B 1 170 ? 9.647   -33.782 0.888   1.00 26.49 ? 159  ASP B N   1 
ATOM   2728 C  CA  . ASP B 1 170 ? 9.793   -34.760 -0.152  1.00 28.55 ? 159  ASP B CA  1 
ATOM   2729 C  C   . ASP B 1 170 ? 10.692  -35.897 0.351   1.00 27.61 ? 159  ASP B C   1 
ATOM   2730 O  O   . ASP B 1 170 ? 11.782  -35.646 0.801   1.00 26.75 ? 159  ASP B O   1 
ATOM   2731 C  CB  . ASP B 1 170 ? 10.378  -34.080 -1.378  1.00 30.23 ? 159  ASP B CB  1 
ATOM   2732 C  CG  . ASP B 1 170 ? 10.915  -35.040 -2.360  1.00 31.58 ? 159  ASP B CG  1 
ATOM   2733 O  OD1 . ASP B 1 170 ? 10.158  -35.599 -3.127  1.00 33.66 ? 159  ASP B OD1 1 
ATOM   2734 O  OD2 . ASP B 1 170 ? 12.104  -35.267 -2.344  1.00 37.30 ? 159  ASP B OD2 1 
ATOM   2735 N  N   . GLN B 1 171 ? 10.186  -37.099 0.336   1.00 28.35 ? 160  GLN B N   1 
ATOM   2736 C  CA  . GLN B 1 171 ? 10.951  -38.182 0.879   1.00 32.30 ? 160  GLN B CA  1 
ATOM   2737 C  C   . GLN B 1 171 ? 12.270  -38.435 0.137   1.00 31.65 ? 160  GLN B C   1 
ATOM   2738 O  O   . GLN B 1 171 ? 13.265  -38.684 0.757   1.00 31.08 ? 160  GLN B O   1 
ATOM   2739 C  CB  . GLN B 1 171 ? 10.112  -39.437 0.970   1.00 20.00 ? 160  GLN B CB  1 
ATOM   2740 C  CG  . GLN B 1 171 ? 10.861  -40.612 1.542   1.00 20.00 ? 160  GLN B CG  1 
ATOM   2741 C  CD  . GLN B 1 171 ? 10.913  -41.753 0.570   1.00 20.00 ? 160  GLN B CD  1 
ATOM   2742 O  OE1 . GLN B 1 171 ? 10.107  -42.659 0.652   1.00 20.00 ? 160  GLN B OE1 1 
ATOM   2743 N  NE2 . GLN B 1 171 ? 11.839  -41.702 -0.372  1.00 20.00 ? 160  GLN B NE2 1 
ATOM   2744 N  N   . ALA B 1 172 ? 12.258  -38.349 -1.181  1.00 30.96 ? 161  ALA B N   1 
ATOM   2745 C  CA  . ALA B 1 172 ? 13.462  -38.586 -1.966  1.00 30.28 ? 161  ALA B CA  1 
ATOM   2746 C  C   . ALA B 1 172 ? 14.612  -37.663 -1.569  1.00 30.69 ? 161  ALA B C   1 
ATOM   2747 O  O   . ALA B 1 172 ? 15.766  -38.088 -1.519  1.00 29.91 ? 161  ALA B O   1 
ATOM   2748 C  CB  . ALA B 1 172 ? 13.160  -38.447 -3.451  1.00 27.61 ? 161  ALA B CB  1 
ATOM   2749 N  N   . SER B 1 173 ? 14.296  -36.401 -1.297  1.00 29.14 ? 162  SER B N   1 
ATOM   2750 C  CA  . SER B 1 173 ? 15.325  -35.410 -1.035  1.00 27.77 ? 162  SER B CA  1 
ATOM   2751 C  C   . SER B 1 173 ? 15.556  -35.159 0.436   1.00 27.72 ? 162  SER B C   1 
ATOM   2752 O  O   . SER B 1 173 ? 16.598  -34.629 0.819   1.00 26.61 ? 162  SER B O   1 
ATOM   2753 C  CB  . SER B 1 173 ? 14.984  -34.083 -1.719  1.00 28.79 ? 162  SER B CB  1 
ATOM   2754 O  OG  . SER B 1 173 ? 13.966  -33.392 -1.017  1.00 29.82 ? 162  SER B OG  1 
ATOM   2755 N  N   . GLY B 1 174 ? 14.571  -35.503 1.261   1.00 28.57 ? 163  GLY B N   1 
ATOM   2756 C  CA  . GLY B 1 174 ? 14.606  -35.110 2.675   1.00 27.67 ? 163  GLY B CA  1 
ATOM   2757 C  C   . GLY B 1 174 ? 14.437  -33.613 2.922   1.00 28.54 ? 163  GLY B C   1 
ATOM   2758 O  O   . GLY B 1 174 ? 14.659  -33.138 4.037   1.00 28.63 ? 163  GLY B O   1 
ATOM   2759 N  N   . ASN B 1 175 ? 14.043  -32.845 1.908   1.00 26.81 ? 164  ASN B N   1 
ATOM   2760 C  CA  . ASN B 1 175 ? 13.885  -31.410 2.143   1.00 26.29 ? 164  ASN B CA  1 
ATOM   2761 C  C   . ASN B 1 175 ? 12.493  -30.896 1.802   1.00 24.73 ? 164  ASN B C   1 
ATOM   2762 O  O   . ASN B 1 175 ? 11.649  -31.647 1.301   1.00 22.62 ? 164  ASN B O   1 
ATOM   2763 C  CB  . ASN B 1 175 ? 15.016  -30.575 1.485   1.00 28.21 ? 164  ASN B CB  1 
ATOM   2764 C  CG  . ASN B 1 175 ? 14.854  -30.432 -0.028  1.00 29.49 ? 164  ASN B CG  1 
ATOM   2765 O  OD1 . ASN B 1 175 ? 13.754  -30.239 -0.546  1.00 28.39 ? 164  ASN B OD1 1 
ATOM   2766 N  ND2 . ASN B 1 175 ? 15.970  -30.528 -0.742  1.00 30.44 ? 164  ASN B ND2 1 
ATOM   2767 N  N   . VAL B 1 176 ? 12.265  -29.614 2.102   1.00 24.40 ? 165  VAL B N   1 
ATOM   2768 C  CA  . VAL B 1 176 ? 10.942  -28.997 2.004   1.00 23.66 ? 165  VAL B CA  1 
ATOM   2769 C  C   . VAL B 1 176 ? 10.885  -27.901 0.922   1.00 24.36 ? 165  VAL B C   1 
ATOM   2770 O  O   . VAL B 1 176 ? 10.060  -26.979 0.996   1.00 22.57 ? 165  VAL B O   1 
ATOM   2771 C  CB  . VAL B 1 176 ? 10.458  -28.447 3.376   1.00 22.32 ? 165  VAL B CB  1 
ATOM   2772 C  CG1 . VAL B 1 176 ? 10.297  -29.584 4.374   1.00 22.20 ? 165  VAL B CG1 1 
ATOM   2773 C  CG2 . VAL B 1 176 ? 11.400  -27.376 3.919   1.00 20.55 ? 165  VAL B CG2 1 
ATOM   2774 N  N   . LYS B 1 177 ? 11.736  -28.024 -0.099  1.00 23.78 ? 166  LYS B N   1 
ATOM   2775 C  CA  . LYS B 1 177 ? 11.812  -26.988 -1.137  1.00 24.25 ? 166  LYS B CA  1 
ATOM   2776 C  C   . LYS B 1 177 ? 10.579  -27.007 -2.013  1.00 23.51 ? 166  LYS B C   1 
ATOM   2777 O  O   . LYS B 1 177 ? 10.266  -26.013 -2.641  1.00 24.31 ? 166  LYS B O   1 
ATOM   2778 C  CB  . LYS B 1 177 ? 13.088  -27.107 -2.008  1.00 25.54 ? 166  LYS B CB  1 
ATOM   2779 C  CG  . LYS B 1 177 ? 14.402  -26.925 -1.266  1.00 25.86 ? 166  LYS B CG  1 
ATOM   2780 C  CD  . LYS B 1 177 ? 14.516  -25.552 -0.635  1.00 28.38 ? 166  LYS B CD  1 
ATOM   2781 C  CE  . LYS B 1 177 ? 15.904  -25.380 -0.024  1.00 32.68 ? 166  LYS B CE  1 
ATOM   2782 N  NZ  . LYS B 1 177 ? 15.928  -24.302 1.001   1.00 35.36 ? 166  LYS B NZ  1 
ATOM   2783 N  N   . LYS B 1 178 ? 9.874   -28.129 -2.041  1.00 23.35 ? 167  LYS B N   1 
ATOM   2784 C  CA  . LYS B 1 178 ? 8.628   -28.229 -2.798  1.00 23.90 ? 167  LYS B CA  1 
ATOM   2785 C  C   . LYS B 1 178 ? 7.357   -27.979 -1.967  1.00 24.20 ? 167  LYS B C   1 
ATOM   2786 O  O   . LYS B 1 178 ? 6.251   -28.254 -2.437  1.00 25.14 ? 167  LYS B O   1 
ATOM   2787 C  CB  . LYS B 1 178 ? 8.531   -29.597 -3.441  1.00 25.22 ? 167  LYS B CB  1 
ATOM   2788 C  CG  . LYS B 1 178 ? 9.664   -29.929 -4.408  1.00 27.79 ? 167  LYS B CG  1 
ATOM   2789 C  CD  . LYS B 1 178 ? 9.629   -31.425 -4.712  1.00 31.17 ? 167  LYS B CD  1 
ATOM   2790 C  CE  . LYS B 1 178 ? 10.338  -31.783 -6.007  1.00 32.86 ? 167  LYS B CE  1 
ATOM   2791 N  NZ  . LYS B 1 178 ? 10.092  -33.229 -6.260  1.00 36.98 ? 167  LYS B NZ  1 
ATOM   2792 N  N   . ALA B 1 179 ? 7.499   -27.463 -0.746  1.00 23.62 ? 168  ALA B N   1 
ATOM   2793 C  CA  . ALA B 1 179 ? 6.327   -27.266 0.139   1.00 22.83 ? 168  ALA B CA  1 
ATOM   2794 C  C   . ALA B 1 179 ? 5.402   -26.183 -0.389  1.00 22.66 ? 168  ALA B C   1 
ATOM   2795 O  O   . ALA B 1 179 ? 5.868   -25.192 -0.941  1.00 23.93 ? 168  ALA B O   1 
ATOM   2796 C  CB  . ALA B 1 179 ? 6.778   -26.918 1.543   1.00 21.73 ? 168  ALA B CB  1 
ATOM   2797 N  N   . LEU B 1 180 ? 4.100   -26.377 -0.206  1.00 22.15 ? 169  LEU B N   1 
ATOM   2798 C  CA  . LEU B 1 180 ? 3.099   -25.385 -0.542  1.00 21.50 ? 169  LEU B CA  1 
ATOM   2799 C  C   . LEU B 1 180 ? 3.178   -24.131 0.341   1.00 22.83 ? 169  LEU B C   1 
ATOM   2800 O  O   . LEU B 1 180 ? 3.885   -24.109 1.362   1.00 22.38 ? 169  LEU B O   1 
ATOM   2801 C  CB  . LEU B 1 180 ? 1.708   -26.009 -0.479  1.00 20.99 ? 169  LEU B CB  1 
ATOM   2802 C  CG  . LEU B 1 180 ? 1.163   -26.558 0.862   1.00 20.40 ? 169  LEU B CG  1 
ATOM   2803 C  CD1 . LEU B 1 180 ? 0.550   -25.452 1.715   1.00 20.08 ? 169  LEU B CD1 1 
ATOM   2804 C  CD2 . LEU B 1 180 ? 0.124   -27.641 0.602   1.00 18.28 ? 169  LEU B CD2 1 
ATOM   2805 N  N   . LYS B 1 181 ? 2.458   -23.091 -0.084  1.00 24.09 ? 170  LYS B N   1 
ATOM   2806 C  CA  . LYS B 1 181 ? 2.318   -21.817 0.653   1.00 24.71 ? 170  LYS B CA  1 
ATOM   2807 C  C   . LYS B 1 181 ? 0.852   -21.552 0.971   1.00 23.61 ? 170  LYS B C   1 
ATOM   2808 O  O   . LYS B 1 181 ? -0.059  -22.037 0.283   1.00 23.76 ? 170  LYS B O   1 
ATOM   2809 C  CB  . LYS B 1 181 ? 2.785   -20.620 -0.189  1.00 26.14 ? 170  LYS B CB  1 
ATOM   2810 C  CG  . LYS B 1 181 ? 4.253   -20.599 -0.550  1.00 31.05 ? 170  LYS B CG  1 
ATOM   2811 C  CD  . LYS B 1 181 ? 4.692   -19.233 -1.085  1.00 32.42 ? 170  LYS B CD  1 
ATOM   2812 C  CE  . LYS B 1 181 ? 4.135   -18.878 -2.465  1.00 32.13 ? 170  LYS B CE  1 
ATOM   2813 N  NZ  . LYS B 1 181 ? 4.811   -17.629 -2.941  1.00 30.94 ? 170  LYS B NZ  1 
ATOM   2814 N  N   . LEU B 1 182 ? 0.633   -20.733 1.988   1.00 22.75 ? 171  LEU B N   1 
ATOM   2815 C  CA  . LEU B 1 182 ? -0.713  -20.307 2.355   1.00 22.79 ? 171  LEU B CA  1 
ATOM   2816 C  C   . LEU B 1 182 ? -0.717  -18.783 2.333   1.00 22.38 ? 171  LEU B C   1 
ATOM   2817 O  O   . LEU B 1 182 ? 0.283   -18.169 2.657   1.00 24.24 ? 171  LEU B O   1 
ATOM   2818 C  CB  . LEU B 1 182 ? -1.059  -20.828 3.761   1.00 20.55 ? 171  LEU B CB  1 
ATOM   2819 C  CG  . LEU B 1 182 ? -0.926  -22.333 4.021   1.00 20.00 ? 171  LEU B CG  1 
ATOM   2820 C  CD1 . LEU B 1 182 ? -0.944  -22.624 5.520   1.00 19.39 ? 171  LEU B CD1 1 
ATOM   2821 C  CD2 . LEU B 1 182 ? -2.040  -23.089 3.316   1.00 19.41 ? 171  LEU B CD2 1 
HETATM 2822 N  N   A MSE B 1 183 ? -1.839  -18.183 1.955   0.50 23.16 ? 172  MSE B N   1 
HETATM 2823 N  N   B MSE B 1 183 ? -1.834  -18.179 1.945   0.50 23.41 ? 172  MSE B N   1 
HETATM 2824 C  CA  A MSE B 1 183 ? -1.971  -16.730 1.958   0.50 24.07 ? 172  MSE B CA  1 
HETATM 2825 C  CA  B MSE B 1 183 ? -1.952  -16.725 1.966   0.50 24.51 ? 172  MSE B CA  1 
HETATM 2826 C  C   A MSE B 1 183 ? -2.774  -16.304 3.155   0.50 23.72 ? 172  MSE B C   1 
HETATM 2827 C  C   B MSE B 1 183 ? -2.767  -16.308 3.156   0.50 24.00 ? 172  MSE B C   1 
HETATM 2828 O  O   A MSE B 1 183 ? -3.897  -16.758 3.350   0.50 23.31 ? 172  MSE B O   1 
HETATM 2829 O  O   B MSE B 1 183 ? -3.888  -16.769 3.345   0.50 23.55 ? 172  MSE B O   1 
HETATM 2830 C  CB  A MSE B 1 183 ? -2.710  -16.288 0.705   0.50 25.84 ? 172  MSE B CB  1 
HETATM 2831 C  CB  B MSE B 1 183 ? -2.651  -16.217 0.716   0.50 26.88 ? 172  MSE B CB  1 
HETATM 2832 C  CG  A MSE B 1 183 ? -2.719  -14.767 0.569   0.50 27.75 ? 172  MSE B CG  1 
HETATM 2833 C  CG  B MSE B 1 183 ? -2.794  -14.697 0.766   0.50 29.34 ? 172  MSE B CG  1 
HETATM 2834 SE SE  A MSE B 1 183 ? -3.691  -14.254 -1.073  0.50 33.70 ? 172  MSE B SE  1 
HETATM 2835 SE SE  B MSE B 1 183 ? -1.055  -13.849 0.390   0.50 37.23 ? 172  MSE B SE  1 
HETATM 2836 C  CE  A MSE B 1 183 ? -2.396  -14.868 -2.424  0.50 30.81 ? 172  MSE B CE  1 
HETATM 2837 C  CE  B MSE B 1 183 ? -1.639  -11.984 0.110   0.50 34.29 ? 172  MSE B CE  1 
ATOM   2838 N  N   . GLY B 1 184 ? -2.206  -15.426 3.972   1.00 24.07 ? 173  GLY B N   1 
ATOM   2839 C  CA  . GLY B 1 184 ? -2.933  -14.867 5.100   1.00 24.84 ? 173  GLY B CA  1 
ATOM   2840 C  C   . GLY B 1 184 ? -3.780  -13.670 4.717   1.00 26.04 ? 173  GLY B C   1 
ATOM   2841 O  O   . GLY B 1 184 ? -3.983  -13.387 3.550   1.00 26.62 ? 173  GLY B O   1 
ATOM   2842 N  N   . SER B 1 185 ? -4.256  -12.956 5.722   1.00 26.75 ? 174  SER B N   1 
ATOM   2843 C  CA  . SER B 1 185 ? -5.241  -11.918 5.541   1.00 27.03 ? 174  SER B CA  1 
ATOM   2844 C  C   . SER B 1 185 ? -4.653  -10.529 5.638   1.00 29.58 ? 174  SER B C   1 
ATOM   2845 O  O   . SER B 1 185 ? -5.379  -9.549  5.503   1.00 30.56 ? 174  SER B O   1 
ATOM   2846 C  CB  . SER B 1 185 ? -6.330  -12.054 6.618   1.00 25.02 ? 174  SER B CB  1 
ATOM   2847 O  OG  . SER B 1 185 ? -7.282  -13.028 6.260   1.00 23.72 ? 174  SER B OG  1 
ATOM   2848 N  N   . ASN B 1 186 ? -3.363  -10.431 5.917   1.00 32.09 ? 175  ASN B N   1 
ATOM   2849 C  CA  . ASN B 1 186 ? -2.711  -9.128  6.025   1.00 37.02 ? 175  ASN B CA  1 
ATOM   2850 C  C   . ASN B 1 186 ? -1.665  -9.019  4.930   1.00 39.52 ? 175  ASN B C   1 
ATOM   2851 O  O   . ASN B 1 186 ? -0.546  -8.546  5.164   1.00 39.27 ? 175  ASN B O   1 
ATOM   2852 C  CB  . ASN B 1 186 ? -2.071  -8.931  7.416   1.00 37.92 ? 175  ASN B CB  1 
ATOM   2853 C  CG  . ASN B 1 186 ? -1.910  -7.455  7.797   1.00 39.72 ? 175  ASN B CG  1 
ATOM   2854 O  OD1 . ASN B 1 186 ? -2.773  -6.620  7.492   1.00 37.64 ? 175  ASN B OD1 1 
ATOM   2855 N  ND2 . ASN B 1 186 ? -0.808  -7.133  8.487   1.00 36.83 ? 175  ASN B ND2 1 
ATOM   2856 N  N   . GLU B 1 187 ? -2.035  -9.487  3.737   1.00 41.13 ? 176  GLU B N   1 
ATOM   2857 C  CA  . GLU B 1 187 ? -1.152  -9.444  2.568   1.00 46.44 ? 176  GLU B CA  1 
ATOM   2858 C  C   . GLU B 1 187 ? 0.144   -10.281 2.747   1.00 49.31 ? 176  GLU B C   1 
ATOM   2859 O  O   . GLU B 1 187 ? 1.150   -10.046 2.057   1.00 50.95 ? 176  GLU B O   1 
ATOM   2860 C  CB  . GLU B 1 187 ? -0.826  -7.983  2.203   1.00 50.04 ? 176  GLU B CB  1 
ATOM   2861 C  CG  . GLU B 1 187 ? -2.043  -7.058  2.210   1.00 55.29 ? 176  GLU B CG  1 
ATOM   2862 C  CD  . GLU B 1 187 ? -1.777  -5.706  1.563   1.00 58.61 ? 176  GLU B CD  1 
ATOM   2863 O  OE1 . GLU B 1 187 ? -0.912  -4.944  2.062   1.00 58.56 ? 176  GLU B OE1 1 
ATOM   2864 O  OE2 . GLU B 1 187 ? -2.448  -5.405  0.555   1.00 57.53 ? 176  GLU B OE2 1 
ATOM   2865 N  N   . GLY B 1 188 ? 0.108   -11.254 3.664   1.00 43.44 ? 177  GLY B N   1 
ATOM   2866 C  CA  . GLY B 1 188 ? 1.274   -12.075 3.988   1.00 38.78 ? 177  GLY B CA  1 
ATOM   2867 C  C   . GLY B 1 188 ? 1.106   -13.535 3.590   1.00 36.85 ? 177  GLY B C   1 
ATOM   2868 O  O   . GLY B 1 188 ? -0.010  -14.027 3.427   1.00 39.90 ? 177  GLY B O   1 
ATOM   2869 N  N   . GLU B 1 189 ? 2.227   -14.224 3.421   1.00 32.29 ? 178  GLU B N   1 
ATOM   2870 C  CA  . GLU B 1 189 ? 2.232   -15.639 3.083   1.00 30.90 ? 178  GLU B CA  1 
ATOM   2871 C  C   . GLU B 1 189 ? 2.868   -16.438 4.211   1.00 27.50 ? 178  GLU B C   1 
ATOM   2872 O  O   . GLU B 1 189 ? 3.825   -15.992 4.825   1.00 26.71 ? 178  GLU B O   1 
ATOM   2873 C  CB  . GLU B 1 189 ? 3.033   -15.886 1.798   1.00 32.09 ? 178  GLU B CB  1 
ATOM   2874 C  CG  . GLU B 1 189 ? 2.578   -15.058 0.607   1.00 34.22 ? 178  GLU B CG  1 
ATOM   2875 C  CD  . GLU B 1 189 ? 3.435   -15.264 -0.621  1.00 34.06 ? 178  GLU B CD  1 
ATOM   2876 O  OE1 . GLU B 1 189 ? 4.440   -16.006 -0.561  1.00 34.92 ? 178  GLU B OE1 1 
ATOM   2877 O  OE2 . GLU B 1 189 ? 3.101   -14.671 -1.657  1.00 35.87 ? 178  GLU B OE2 1 
ATOM   2878 N  N   . PHE B 1 190 ? 2.338   -17.629 4.454   1.00 25.35 ? 179  PHE B N   1 
ATOM   2879 C  CA  . PHE B 1 190 ? 2.913   -18.558 5.421   1.00 23.77 ? 179  PHE B CA  1 
ATOM   2880 C  C   . PHE B 1 190 ? 3.620   -19.664 4.657   1.00 23.58 ? 179  PHE B C   1 
ATOM   2881 O  O   . PHE B 1 190 ? 3.048   -20.252 3.730   1.00 22.92 ? 179  PHE B O   1 
ATOM   2882 C  CB  . PHE B 1 190 ? 1.813   -19.118 6.322   1.00 21.25 ? 179  PHE B CB  1 
ATOM   2883 C  CG  . PHE B 1 190 ? 0.873   -18.072 6.841   1.00 20.42 ? 179  PHE B CG  1 
ATOM   2884 C  CD1 . PHE B 1 190 ? 1.359   -16.845 7.307   1.00 20.77 ? 179  PHE B CD1 1 
ATOM   2885 C  CD2 . PHE B 1 190 ? -0.505  -18.299 6.864   1.00 19.27 ? 179  PHE B CD2 1 
ATOM   2886 C  CE1 . PHE B 1 190 ? 0.484   -15.874 7.780   1.00 20.30 ? 179  PHE B CE1 1 
ATOM   2887 C  CE2 . PHE B 1 190 ? -1.381  -17.336 7.348   1.00 20.06 ? 179  PHE B CE2 1 
ATOM   2888 C  CZ  . PHE B 1 190 ? -0.886  -16.123 7.801   1.00 20.27 ? 179  PHE B CZ  1 
ATOM   2889 N  N   . LYS B 1 191 ? 4.867   -19.924 5.027   1.00 24.24 ? 180  LYS B N   1 
ATOM   2890 C  CA  . LYS B 1 191 ? 5.748   -20.787 4.227   1.00 25.07 ? 180  LYS B CA  1 
ATOM   2891 C  C   . LYS B 1 191 ? 6.413   -21.858 5.078   1.00 25.09 ? 180  LYS B C   1 
ATOM   2892 O  O   . LYS B 1 191 ? 6.412   -21.765 6.314   1.00 22.67 ? 180  LYS B O   1 
ATOM   2893 C  CB  . LYS B 1 191 ? 6.867   -19.952 3.598   1.00 25.45 ? 180  LYS B CB  1 
ATOM   2894 C  CG  . LYS B 1 191 ? 6.441   -18.912 2.567   1.00 29.34 ? 180  LYS B CG  1 
ATOM   2895 C  CD  . LYS B 1 191 ? 7.674   -18.452 1.802   1.00 31.29 ? 180  LYS B CD  1 
ATOM   2896 C  CE  . LYS B 1 191 ? 7.352   -17.406 0.759   1.00 36.91 ? 180  LYS B CE  1 
ATOM   2897 N  NZ  . LYS B 1 191 ? 7.356   -16.042 1.359   1.00 40.93 ? 180  LYS B NZ  1 
ATOM   2898 N  N   . ALA B 1 192 ? 7.051   -22.829 4.417   1.00 24.55 ? 181  ALA B N   1 
ATOM   2899 C  CA  . ALA B 1 192 ? 7.829   -23.826 5.147   1.00 25.86 ? 181  ALA B CA  1 
ATOM   2900 C  C   . ALA B 1 192 ? 9.046   -23.208 5.801   1.00 25.86 ? 181  ALA B C   1 
ATOM   2901 O  O   . ALA B 1 192 ? 9.436   -23.611 6.878   1.00 25.50 ? 181  ALA B O   1 
ATOM   2902 C  CB  . ALA B 1 192 ? 8.249   -24.972 4.245   1.00 25.75 ? 181  ALA B CB  1 
ATOM   2903 N  N   . GLU B 1 193 ? 9.656   -22.233 5.139   1.00 27.57 ? 182  GLU B N   1 
ATOM   2904 C  CA  . GLU B 1 193 ? 10.913  -21.652 5.615   1.00 29.74 ? 182  GLU B CA  1 
ATOM   2905 C  C   . GLU B 1 193 ? 10.886  -20.141 5.446   1.00 30.72 ? 182  GLU B C   1 
ATOM   2906 O  O   . GLU B 1 193 ? 9.907   -19.582 4.958   1.00 30.56 ? 182  GLU B O   1 
ATOM   2907 C  CB  . GLU B 1 193 ? 12.097  -22.237 4.837   1.00 31.50 ? 182  GLU B CB  1 
ATOM   2908 C  CG  . GLU B 1 193 ? 12.046  -23.750 4.637   1.00 31.15 ? 182  GLU B CG  1 
ATOM   2909 C  CD  . GLU B 1 193 ? 13.296  -24.281 3.948   1.00 32.65 ? 182  GLU B CD  1 
ATOM   2910 O  OE1 . GLU B 1 193 ? 14.312  -24.441 4.646   1.00 35.10 ? 182  GLU B OE1 1 
ATOM   2911 O  OE2 . GLU B 1 193 ? 13.276  -24.534 2.719   1.00 31.69 ? 182  GLU B OE2 1 
ATOM   2912 N  N   . GLY B 1 194 ? 11.972  -19.488 5.838   1.00 32.71 ? 183  GLY B N   1 
ATOM   2913 C  CA  . GLY B 1 194 ? 12.074  -18.029 5.776   1.00 30.95 ? 183  GLY B CA  1 
ATOM   2914 C  C   . GLY B 1 194 ? 11.794  -17.358 7.109   1.00 31.01 ? 183  GLY B C   1 
ATOM   2915 O  O   . GLY B 1 194 ? 12.001  -17.940 8.173   1.00 30.30 ? 183  GLY B O   1 
ATOM   2916 N  N   . ASN B 1 195 ? 11.343  -16.112 7.037   1.00 33.16 ? 184  ASN B N   1 
ATOM   2917 C  CA  . ASN B 1 195 ? 10.974  -15.313 8.193   1.00 31.41 ? 184  ASN B CA  1 
ATOM   2918 C  C   . ASN B 1 195 ? 10.202  -16.208 9.164   1.00 32.72 ? 184  ASN B C   1 
ATOM   2919 O  O   . ASN B 1 195 ? 9.105   -16.698 8.832   1.00 28.90 ? 184  ASN B O   1 
ATOM   2920 C  CB  . ASN B 1 195 ? 10.090  -14.161 7.697   1.00 33.23 ? 184  ASN B CB  1 
ATOM   2921 C  CG  . ASN B 1 195 ? 9.820   -13.118 8.755   1.00 34.50 ? 184  ASN B CG  1 
ATOM   2922 O  OD1 . ASN B 1 195 ? 9.656   -13.425 9.936   1.00 38.66 ? 184  ASN B OD1 1 
ATOM   2923 N  ND2 . ASN B 1 195 ? 9.758   -11.870 8.330   1.00 33.70 ? 184  ASN B ND2 1 
ATOM   2924 N  N   . SER B 1 196 ? 10.786  -16.431 10.344  1.00 32.19 ? 185  SER B N   1 
ATOM   2925 C  CA  . SER B 1 196 ? 10.211  -17.328 11.338  1.00 33.12 ? 185  SER B CA  1 
ATOM   2926 C  C   . SER B 1 196 ? 8.882   -16.827 11.919  1.00 33.11 ? 185  SER B C   1 
ATOM   2927 O  O   . SER B 1 196 ? 8.167   -17.584 12.547  1.00 32.36 ? 185  SER B O   1 
ATOM   2928 C  CB  . SER B 1 196 ? 11.195  -17.553 12.474  1.00 34.97 ? 185  SER B CB  1 
ATOM   2929 O  OG  . SER B 1 196 ? 11.415  -16.318 13.128  1.00 39.48 ? 185  SER B OG  1 
ATOM   2930 N  N   . LYS B 1 197 ? 8.555   -15.556 11.720  1.00 33.48 ? 186  LYS B N   1 
ATOM   2931 C  CA  . LYS B 1 197 ? 7.254   -15.052 12.175  1.00 33.75 ? 186  LYS B CA  1 
ATOM   2932 C  C   . LYS B 1 197 ? 6.129   -15.549 11.260  1.00 29.80 ? 186  LYS B C   1 
ATOM   2933 O  O   . LYS B 1 197 ? 4.960   -15.490 11.619  1.00 26.51 ? 186  LYS B O   1 
ATOM   2934 C  CB  . LYS B 1 197 ? 7.260   -13.523 12.259  1.00 35.91 ? 186  LYS B CB  1 
ATOM   2935 C  CG  . LYS B 1 197 ? 8.287   -12.951 13.237  1.00 40.18 ? 186  LYS B CG  1 
ATOM   2936 C  CD  . LYS B 1 197 ? 8.037   -11.472 13.561  1.00 43.38 ? 186  LYS B CD  1 
ATOM   2937 C  CE  . LYS B 1 197 ? 8.399   -10.525 12.418  1.00 45.77 ? 186  LYS B CE  1 
ATOM   2938 N  NZ  . LYS B 1 197 ? 9.823   -10.081 12.473  1.00 48.12 ? 186  LYS B NZ  1 
ATOM   2939 N  N   . PHE B 1 198 ? 6.508   -16.056 10.090  1.00 27.71 ? 187  PHE B N   1 
ATOM   2940 C  CA  . PHE B 1 198 ? 5.558   -16.383 9.034   1.00 27.47 ? 187  PHE B CA  1 
ATOM   2941 C  C   . PHE B 1 198 ? 5.586   -17.850 8.596   1.00 25.53 ? 187  PHE B C   1 
ATOM   2942 O  O   . PHE B 1 198 ? 4.945   -18.224 7.607   1.00 26.31 ? 187  PHE B O   1 
ATOM   2943 C  CB  . PHE B 1 198 ? 5.741   -15.434 7.835   1.00 28.41 ? 187  PHE B CB  1 
ATOM   2944 C  CG  . PHE B 1 198 ? 5.215   -14.040 8.086   1.00 30.40 ? 187  PHE B CG  1 
ATOM   2945 C  CD1 . PHE B 1 198 ? 6.025   -13.061 8.666   1.00 31.03 ? 187  PHE B CD1 1 
ATOM   2946 C  CD2 . PHE B 1 198 ? 3.904   -13.711 7.761   1.00 31.25 ? 187  PHE B CD2 1 
ATOM   2947 C  CE1 . PHE B 1 198 ? 5.544   -11.778 8.905   1.00 32.45 ? 187  PHE B CE1 1 
ATOM   2948 C  CE2 . PHE B 1 198 ? 3.408   -12.425 8.001   1.00 32.58 ? 187  PHE B CE2 1 
ATOM   2949 C  CZ  . PHE B 1 198 ? 4.230   -11.460 8.571   1.00 31.58 ? 187  PHE B CZ  1 
ATOM   2950 N  N   . THR B 1 199 ? 6.311   -18.686 9.329   1.00 24.12 ? 188  THR B N   1 
ATOM   2951 C  CA  . THR B 1 199 ? 6.321   -20.119 9.007   1.00 23.74 ? 188  THR B CA  1 
ATOM   2952 C  C   . THR B 1 199 ? 5.104   -20.808 9.620   1.00 23.26 ? 188  THR B C   1 
ATOM   2953 O  O   . THR B 1 199 ? 4.713   -20.519 10.759  1.00 23.49 ? 188  THR B O   1 
ATOM   2954 C  CB  . THR B 1 199 ? 7.622   -20.818 9.456   1.00 24.00 ? 188  THR B CB  1 
ATOM   2955 O  OG1 . THR B 1 199 ? 7.881   -20.477 10.804  1.00 24.90 ? 188  THR B OG1 1 
ATOM   2956 C  CG2 . THR B 1 199 ? 8.832   -20.334 8.641   1.00 24.60 ? 188  THR B CG2 1 
ATOM   2957 N  N   . TYR B 1 200 ? 4.486   -21.704 8.857   1.00 22.12 ? 189  TYR B N   1 
ATOM   2958 C  CA  . TYR B 1 200 ? 3.480   -22.582 9.427   1.00 20.62 ? 189  TYR B CA  1 
ATOM   2959 C  C   . TYR B 1 200 ? 4.195   -23.747 10.102  1.00 20.20 ? 189  TYR B C   1 
ATOM   2960 O  O   . TYR B 1 200 ? 5.420   -23.854 10.017  1.00 18.64 ? 189  TYR B O   1 
ATOM   2961 C  CB  . TYR B 1 200 ? 2.489   -23.068 8.353   1.00 19.84 ? 189  TYR B CB  1 
ATOM   2962 C  CG  . TYR B 1 200 ? 3.120   -23.681 7.116   1.00 20.88 ? 189  TYR B CG  1 
ATOM   2963 C  CD1 . TYR B 1 200 ? 3.926   -24.828 7.198   1.00 20.54 ? 189  TYR B CD1 1 
ATOM   2964 C  CD2 . TYR B 1 200 ? 2.872   -23.148 5.842   1.00 20.82 ? 189  TYR B CD2 1 
ATOM   2965 C  CE1 . TYR B 1 200 ? 4.497   -25.392 6.057   1.00 20.57 ? 189  TYR B CE1 1 
ATOM   2966 C  CE2 . TYR B 1 200 ? 3.431   -23.717 4.695   1.00 20.58 ? 189  TYR B CE2 1 
ATOM   2967 C  CZ  . TYR B 1 200 ? 4.242   -24.829 4.801   1.00 20.73 ? 189  TYR B CZ  1 
ATOM   2968 O  OH  . TYR B 1 200 ? 4.811   -25.382 3.646   1.00 21.64 ? 189  TYR B OH  1 
ATOM   2969 N  N   . THR B 1 201 ? 3.435   -24.616 10.766  1.00 19.93 ? 190  THR B N   1 
ATOM   2970 C  CA  . THR B 1 201 ? 3.981   -25.879 11.268  1.00 21.15 ? 190  THR B CA  1 
ATOM   2971 C  C   . THR B 1 201 ? 3.121   -27.000 10.711  1.00 21.49 ? 190  THR B C   1 
ATOM   2972 O  O   . THR B 1 201 ? 1.945   -26.797 10.378  1.00 22.00 ? 190  THR B O   1 
ATOM   2973 C  CB  . THR B 1 201 ? 4.034   -25.982 12.823  1.00 21.52 ? 190  THR B CB  1 
ATOM   2974 O  OG1 . THR B 1 201 ? 2.716   -26.141 13.344  1.00 22.39 ? 190  THR B OG1 1 
ATOM   2975 C  CG2 . THR B 1 201 ? 4.690   -24.753 13.457  1.00 21.18 ? 190  THR B CG2 1 
ATOM   2976 N  N   . VAL B 1 202 ? 3.703   -28.184 10.623  1.00 20.10 ? 191  VAL B N   1 
ATOM   2977 C  CA  . VAL B 1 202 ? 3.020   -29.314 10.041  1.00 19.50 ? 191  VAL B CA  1 
ATOM   2978 C  C   . VAL B 1 202 ? 2.728   -30.284 11.167  1.00 18.87 ? 191  VAL B C   1 
ATOM   2979 O  O   . VAL B 1 202 ? 3.626   -30.643 11.951  1.00 18.28 ? 191  VAL B O   1 
ATOM   2980 C  CB  . VAL B 1 202 ? 3.874   -29.956 8.929   1.00 20.21 ? 191  VAL B CB  1 
ATOM   2981 C  CG1 . VAL B 1 202 ? 3.239   -31.227 8.417   1.00 19.53 ? 191  VAL B CG1 1 
ATOM   2982 C  CG2 . VAL B 1 202 ? 4.092   -28.959 7.784   1.00 20.73 ? 191  VAL B CG2 1 
ATOM   2983 N  N   . LEU B 1 203 ? 1.473   -30.703 11.243  1.00 18.58 ? 192  LEU B N   1 
ATOM   2984 C  CA  . LEU B 1 203 ? 0.997   -31.538 12.349  1.00 19.62 ? 192  LEU B CA  1 
ATOM   2985 C  C   . LEU B 1 203 ? 1.033   -33.015 12.025  1.00 19.87 ? 192  LEU B C   1 
ATOM   2986 O  O   . LEU B 1 203 ? 1.132   -33.859 12.928  1.00 18.44 ? 192  LEU B O   1 
ATOM   2987 C  CB  . LEU B 1 203 ? -0.409  -31.125 12.782  1.00 19.40 ? 192  LEU B CB  1 
ATOM   2988 C  CG  . LEU B 1 203 ? -0.578  -29.678 13.267  1.00 20.26 ? 192  LEU B CG  1 
ATOM   2989 C  CD1 . LEU B 1 203 ? -2.017  -29.542 13.774  1.00 19.60 ? 192  LEU B CD1 1 
ATOM   2990 C  CD2 . LEU B 1 203 ? 0.438   -29.333 14.362  1.00 19.43 ? 192  LEU B CD2 1 
ATOM   2991 N  N   . GLU B 1 204 ? 0.899   -33.311 10.735  1.00 21.29 ? 193  GLU B N   1 
ATOM   2992 C  CA  . GLU B 1 204 ? 1.152   -34.626 10.166  1.00 22.19 ? 193  GLU B CA  1 
ATOM   2993 C  C   . GLU B 1 204 ? 1.452   -34.458 8.664   1.00 22.85 ? 193  GLU B C   1 
ATOM   2994 O  O   . GLU B 1 204 ? 1.050   -33.469 8.046   1.00 21.18 ? 193  GLU B O   1 
ATOM   2995 C  CB  . GLU B 1 204 ? -0.033  -35.571 10.394  1.00 23.69 ? 193  GLU B CB  1 
ATOM   2996 C  CG  . GLU B 1 204 ? -1.155  -35.448 9.395   1.00 25.92 ? 193  GLU B CG  1 
ATOM   2997 C  CD  . GLU B 1 204 ? -2.414  -36.167 9.839   1.00 28.17 ? 193  GLU B CD  1 
ATOM   2998 O  OE1 . GLU B 1 204 ? -3.024  -35.720 10.831  1.00 28.92 ? 193  GLU B OE1 1 
ATOM   2999 O  OE2 . GLU B 1 204 ? -2.822  -37.156 9.178   1.00 29.37 ? 193  GLU B OE2 1 
ATOM   3000 N  N   . ASP B 1 205 ? 2.137   -35.433 8.077   1.00 23.62 ? 194  ASP B N   1 
ATOM   3001 C  CA  . ASP B 1 205 ? 2.584   -35.323 6.684   1.00 23.36 ? 194  ASP B CA  1 
ATOM   3002 C  C   . ASP B 1 205 ? 2.594   -36.679 6.007   1.00 23.79 ? 194  ASP B C   1 
ATOM   3003 O  O   . ASP B 1 205 ? 3.554   -37.416 6.143   1.00 24.50 ? 194  ASP B O   1 
ATOM   3004 C  CB  . ASP B 1 205 ? 3.981   -34.686 6.622   1.00 23.25 ? 194  ASP B CB  1 
ATOM   3005 C  CG  . ASP B 1 205 ? 4.390   -34.287 5.199   1.00 22.87 ? 194  ASP B CG  1 
ATOM   3006 O  OD1 . ASP B 1 205 ? 3.596   -34.467 4.257   1.00 21.87 ? 194  ASP B OD1 1 
ATOM   3007 O  OD2 . ASP B 1 205 ? 5.505   -33.774 5.038   1.00 22.31 ? 194  ASP B OD2 1 
ATOM   3008 N  N   . GLY B 1 206 ? 1.517   -37.009 5.296   1.00 23.12 ? 195  GLY B N   1 
ATOM   3009 C  CA  . GLY B 1 206 ? 1.418   -38.280 4.585   1.00 23.24 ? 195  GLY B CA  1 
ATOM   3010 C  C   . GLY B 1 206 ? 1.612   -38.160 3.078   1.00 24.79 ? 195  GLY B C   1 
ATOM   3011 O  O   . GLY B 1 206 ? 1.372   -39.106 2.348   1.00 26.64 ? 195  GLY B O   1 
ATOM   3012 N  N   . CYS B 1 207 ? 2.054   -36.993 2.614   1.00 24.28 ? 196  CYS B N   1 
ATOM   3013 C  CA  . CYS B 1 207 ? 2.117   -36.687 1.191   1.00 23.29 ? 196  CYS B CA  1 
ATOM   3014 C  C   . CYS B 1 207 ? 3.542   -36.743 0.608   1.00 24.68 ? 196  CYS B C   1 
ATOM   3015 O  O   . CYS B 1 207 ? 3.749   -36.301 -0.531  1.00 24.79 ? 196  CYS B O   1 
ATOM   3016 C  CB  . CYS B 1 207 ? 1.549   -35.280 0.968   1.00 22.67 ? 196  CYS B CB  1 
ATOM   3017 S  SG  . CYS B 1 207 ? -0.195  -35.103 1.398   1.00 21.13 ? 196  CYS B SG  1 
ATOM   3018 N  N   . THR B 1 208 ? 4.506   -37.285 1.365   1.00 23.03 ? 197  THR B N   1 
ATOM   3019 C  CA  . THR B 1 208 ? 5.939   -37.190 1.021   1.00 23.48 ? 197  THR B CA  1 
ATOM   3020 C  C   . THR B 1 208 ? 6.435   -37.952 -0.227  1.00 25.56 ? 197  THR B C   1 
ATOM   3021 O  O   . THR B 1 208 ? 7.583   -37.724 -0.654  1.00 25.03 ? 197  THR B O   1 
ATOM   3022 C  CB  . THR B 1 208 ? 6.855   -37.631 2.187   1.00 22.39 ? 197  THR B CB  1 
ATOM   3023 O  OG1 . THR B 1 208 ? 6.695   -39.038 2.425   1.00 21.32 ? 197  THR B OG1 1 
ATOM   3024 C  CG2 . THR B 1 208 ? 6.544   -36.840 3.461   1.00 22.64 ? 197  THR B CG2 1 
ATOM   3025 N  N   . LYS B 1 209 ? 5.614   -38.853 -0.776  1.00 26.68 ? 198  LYS B N   1 
ATOM   3026 C  CA  . LYS B 1 209 ? 5.958   -39.632 -1.985  1.00 30.56 ? 198  LYS B CA  1 
ATOM   3027 C  C   . LYS B 1 209 ? 4.768   -39.720 -2.923  1.00 31.50 ? 198  LYS B C   1 
ATOM   3028 O  O   . LYS B 1 209 ? 3.624   -39.693 -2.467  1.00 32.91 ? 198  LYS B O   1 
ATOM   3029 C  CB  . LYS B 1 209 ? 6.317   -41.098 -1.655  1.00 33.90 ? 198  LYS B CB  1 
ATOM   3030 C  CG  . LYS B 1 209 ? 6.846   -41.412 -0.267  1.00 36.05 ? 198  LYS B CG  1 
ATOM   3031 C  CD  . LYS B 1 209 ? 7.007   -42.926 -0.079  1.00 38.43 ? 198  LYS B CD  1 
ATOM   3032 C  CE  . LYS B 1 209 ? 6.906   -43.287 1.402   1.00 42.82 ? 198  LYS B CE  1 
ATOM   3033 N  NZ  . LYS B 1 209 ? 6.815   -44.746 1.698   1.00 41.34 ? 198  LYS B NZ  1 
ATOM   3034 N  N   . HIS B 1 210 ? 5.028   -39.883 -4.221  1.00 33.04 ? 199  HIS B N   1 
ATOM   3035 C  CA  . HIS B 1 210 ? 3.968   -40.168 -5.198  1.00 33.08 ? 199  HIS B CA  1 
ATOM   3036 C  C   . HIS B 1 210 ? 3.683   -41.646 -5.199  1.00 35.68 ? 199  HIS B C   1 
ATOM   3037 O  O   . HIS B 1 210 ? 4.450   -42.439 -5.766  1.00 36.09 ? 199  HIS B O   1 
ATOM   3038 C  CB  . HIS B 1 210 ? 4.389   -39.747 -6.604  1.00 33.37 ? 199  HIS B CB  1 
ATOM   3039 C  CG  . HIS B 1 210 ? 4.653   -38.261 -6.769  1.00 33.74 ? 199  HIS B CG  1 
ATOM   3040 N  ND1 . HIS B 1 210 ? 4.787   -37.686 -7.977  1.00 33.38 ? 199  HIS B ND1 1 
ATOM   3041 C  CD2 . HIS B 1 210 ? 4.818   -37.246 -5.836  1.00 32.64 ? 199  HIS B CD2 1 
ATOM   3042 C  CE1 . HIS B 1 210 ? 5.043   -36.375 -7.828  1.00 32.24 ? 199  HIS B CE1 1 
ATOM   3043 N  NE2 . HIS B 1 210 ? 5.055   -36.104 -6.521  1.00 33.68 ? 199  HIS B NE2 1 
ATOM   3044 N  N   . THR B 1 211 ? 2.576   -42.044 -4.584  1.00 35.86 ? 200  THR B N   1 
ATOM   3045 C  CA  . THR B 1 211 ? 2.257   -43.458 -4.441  1.00 34.82 ? 200  THR B CA  1 
ATOM   3046 C  C   . THR B 1 211 ? 1.140   -43.887 -5.374  1.00 36.25 ? 200  THR B C   1 
ATOM   3047 O  O   . THR B 1 211 ? 0.854   -45.076 -5.491  1.00 37.56 ? 200  THR B O   1 
ATOM   3048 C  CB  . THR B 1 211 ? 1.792   -43.776 -3.018  1.00 34.32 ? 200  THR B CB  1 
ATOM   3049 O  OG1 . THR B 1 211 ? 0.527   -43.146 -2.805  1.00 35.68 ? 200  THR B OG1 1 
ATOM   3050 C  CG2 . THR B 1 211 ? 2.793   -43.268 -1.989  1.00 35.72 ? 200  THR B CG2 1 
ATOM   3051 N  N   . GLY B 1 212 ? 0.486   -42.930 -6.020  1.00 36.04 ? 201  GLY B N   1 
ATOM   3052 C  CA  . GLY B 1 212 ? -0.743  -43.218 -6.763  1.00 37.09 ? 201  GLY B CA  1 
ATOM   3053 C  C   . GLY B 1 212 ? -1.943  -43.388 -5.841  1.00 41.16 ? 201  GLY B C   1 
ATOM   3054 O  O   . GLY B 1 212 ? -3.036  -43.709 -6.298  1.00 46.03 ? 201  GLY B O   1 
ATOM   3055 N  N   . GLU B 1 213 ? -1.746  -43.173 -4.540  1.00 40.39 ? 202  GLU B N   1 
ATOM   3056 C  CA  . GLU B 1 213 ? -2.832  -43.249 -3.552  1.00 40.92 ? 202  GLU B CA  1 
ATOM   3057 C  C   . GLU B 1 213 ? -3.119  -41.885 -2.900  1.00 36.74 ? 202  GLU B C   1 
ATOM   3058 O  O   . GLU B 1 213 ? -2.328  -40.961 -3.019  1.00 32.39 ? 202  GLU B O   1 
ATOM   3059 C  CB  . GLU B 1 213 ? -2.509  -44.290 -2.470  1.00 43.79 ? 202  GLU B CB  1 
ATOM   3060 C  CG  . GLU B 1 213 ? -2.540  -45.735 -2.942  1.00 49.32 ? 202  GLU B CG  1 
ATOM   3061 C  CD  . GLU B 1 213 ? -3.934  -46.193 -3.342  1.00 55.28 ? 202  GLU B CD  1 
ATOM   3062 O  OE1 . GLU B 1 213 ? -4.479  -45.670 -4.344  1.00 59.97 ? 202  GLU B OE1 1 
ATOM   3063 O  OE2 . GLU B 1 213 ? -4.492  -47.077 -2.651  1.00 57.71 ? 202  GLU B OE2 1 
ATOM   3064 N  N   . TRP B 1 214 ? -4.252  -41.779 -2.209  1.00 35.49 ? 203  TRP B N   1 
ATOM   3065 C  CA  . TRP B 1 214 ? -4.647  -40.543 -1.543  1.00 32.09 ? 203  TRP B CA  1 
ATOM   3066 C  C   . TRP B 1 214 ? -4.158  -40.478 -0.124  1.00 31.24 ? 203  TRP B C   1 
ATOM   3067 O  O   . TRP B 1 214 ? -4.237  -41.454 0.626   1.00 30.71 ? 203  TRP B O   1 
ATOM   3068 C  CB  . TRP B 1 214 ? -6.159  -40.366 -1.593  1.00 31.85 ? 203  TRP B CB  1 
ATOM   3069 C  CG  . TRP B 1 214 ? -6.640  -39.789 -2.907  1.00 32.16 ? 203  TRP B CG  1 
ATOM   3070 C  CD1 . TRP B 1 214 ? -7.166  -40.480 -3.996  1.00 31.80 ? 203  TRP B CD1 1 
ATOM   3071 C  CD2 . TRP B 1 214 ? -6.635  -38.378 -3.325  1.00 31.96 ? 203  TRP B CD2 1 
ATOM   3072 N  NE1 . TRP B 1 214 ? -7.478  -39.623 -5.016  1.00 31.66 ? 203  TRP B NE1 1 
ATOM   3073 C  CE2 . TRP B 1 214 ? -7.188  -38.353 -4.688  1.00 32.26 ? 203  TRP B CE2 1 
ATOM   3074 C  CE3 . TRP B 1 214 ? -6.265  -37.178 -2.725  1.00 30.59 ? 203  TRP B CE3 1 
ATOM   3075 C  CZ2 . TRP B 1 214 ? -7.357  -37.170 -5.393  1.00 31.33 ? 203  TRP B CZ2 1 
ATOM   3076 C  CZ3 . TRP B 1 214 ? -6.410  -35.998 -3.456  1.00 31.09 ? 203  TRP B CZ3 1 
ATOM   3077 C  CH2 . TRP B 1 214 ? -6.948  -35.991 -4.755  1.00 32.18 ? 203  TRP B CH2 1 
ATOM   3078 N  N   . SER B 1 215 ? -3.645  -39.317 0.259   1.00 29.98 ? 204  SER B N   1 
ATOM   3079 C  CA  . SER B 1 215 ? -3.237  -39.087 1.637   1.00 29.00 ? 204  SER B CA  1 
ATOM   3080 C  C   . SER B 1 215 ? -3.416  -37.607 1.997   1.00 28.78 ? 204  SER B C   1 
ATOM   3081 O  O   . SER B 1 215 ? -4.069  -36.851 1.264   1.00 28.32 ? 204  SER B O   1 
ATOM   3082 C  CB  . SER B 1 215 ? -1.793  -39.551 1.840   1.00 28.54 ? 204  SER B CB  1 
ATOM   3083 O  OG  . SER B 1 215 ? -1.526  -39.790 3.214   1.00 32.11 ? 204  SER B OG  1 
ATOM   3084 N  N   . LYS B 1 216 ? -2.835  -37.184 3.119   1.00 28.15 ? 205  LYS B N   1 
ATOM   3085 C  CA  . LYS B 1 216 ? -2.995  -35.803 3.563   1.00 24.71 ? 205  LYS B CA  1 
ATOM   3086 C  C   . LYS B 1 216 ? -1.859  -35.278 4.440   1.00 23.03 ? 205  LYS B C   1 
ATOM   3087 O  O   . LYS B 1 216 ? -1.105  -36.022 5.067   1.00 22.47 ? 205  LYS B O   1 
ATOM   3088 C  CB  . LYS B 1 216 ? -4.348  -35.629 4.267   1.00 25.12 ? 205  LYS B CB  1 
ATOM   3089 C  CG  . LYS B 1 216 ? -4.376  -36.239 5.648   1.00 24.49 ? 205  LYS B CG  1 
ATOM   3090 C  CD  . LYS B 1 216 ? -5.782  -36.406 6.173   1.00 26.92 ? 205  LYS B CD  1 
ATOM   3091 C  CE  . LYS B 1 216 ? -5.737  -37.327 7.377   1.00 28.06 ? 205  LYS B CE  1 
ATOM   3092 N  NZ  . LYS B 1 216 ? -6.580  -36.772 8.455   1.00 29.96 ? 205  LYS B NZ  1 
ATOM   3093 N  N   . THR B 1 217 ? -1.755  -33.963 4.461   1.00 21.50 ? 206  THR B N   1 
ATOM   3094 C  CA  . THR B 1 217 ? -0.805  -33.262 5.292   1.00 20.98 ? 206  THR B CA  1 
ATOM   3095 C  C   . THR B 1 217 ? -1.618  -32.158 5.951   1.00 20.99 ? 206  THR B C   1 
ATOM   3096 O  O   . THR B 1 217 ? -2.462  -31.527 5.300   1.00 20.18 ? 206  THR B O   1 
ATOM   3097 C  CB  . THR B 1 217 ? 0.327   -32.691 4.417   1.00 20.92 ? 206  THR B CB  1 
ATOM   3098 O  OG1 . THR B 1 217 ? 1.014   -33.793 3.793   1.00 19.95 ? 206  THR B OG1 1 
ATOM   3099 C  CG2 . THR B 1 217 ? 1.305   -31.869 5.232   1.00 19.33 ? 206  THR B CG2 1 
ATOM   3100 N  N   . VAL B 1 218 ? -1.389  -31.954 7.245   1.00 19.70 ? 207  VAL B N   1 
ATOM   3101 C  CA  . VAL B 1 218 ? -2.141  -30.965 7.992   1.00 18.50 ? 207  VAL B CA  1 
ATOM   3102 C  C   . VAL B 1 218 ? -1.191  -29.840 8.392   1.00 18.92 ? 207  VAL B C   1 
ATOM   3103 O  O   . VAL B 1 218 ? -0.131  -30.085 9.018   1.00 18.13 ? 207  VAL B O   1 
ATOM   3104 C  CB  . VAL B 1 218 ? -2.816  -31.586 9.233   1.00 18.35 ? 207  VAL B CB  1 
ATOM   3105 C  CG1 . VAL B 1 218 ? -3.490  -30.506 10.056  1.00 18.19 ? 207  VAL B CG1 1 
ATOM   3106 C  CG2 . VAL B 1 218 ? -3.810  -32.690 8.835   1.00 17.41 ? 207  VAL B CG2 1 
ATOM   3107 N  N   . PHE B 1 219 ? -1.573  -28.617 8.021   1.00 17.40 ? 208  PHE B N   1 
ATOM   3108 C  CA  . PHE B 1 219 ? -0.778  -27.450 8.316   1.00 18.29 ? 208  PHE B CA  1 
ATOM   3109 C  C   . PHE B 1 219 ? -1.478  -26.613 9.376   1.00 18.80 ? 208  PHE B C   1 
ATOM   3110 O  O   . PHE B 1 219 ? -2.693  -26.603 9.436   1.00 20.46 ? 208  PHE B O   1 
ATOM   3111 C  CB  . PHE B 1 219 ? -0.608  -26.608 7.057   1.00 18.04 ? 208  PHE B CB  1 
ATOM   3112 C  CG  . PHE B 1 219 ? 0.086   -27.321 5.921   1.00 18.60 ? 208  PHE B CG  1 
ATOM   3113 C  CD1 . PHE B 1 219 ? -0.624  -28.164 5.068   1.00 17.84 ? 208  PHE B CD1 1 
ATOM   3114 C  CD2 . PHE B 1 219 ? 1.441   -27.104 5.678   1.00 18.80 ? 208  PHE B CD2 1 
ATOM   3115 C  CE1 . PHE B 1 219 ? 0.014   -28.775 3.998   1.00 19.00 ? 208  PHE B CE1 1 
ATOM   3116 C  CE2 . PHE B 1 219 ? 2.083   -27.718 4.602   1.00 19.59 ? 208  PHE B CE2 1 
ATOM   3117 C  CZ  . PHE B 1 219 ? 1.367   -28.558 3.770   1.00 18.80 ? 208  PHE B CZ  1 
ATOM   3118 N  N   . GLU B 1 220 ? -0.708  -25.880 10.170  1.00 19.30 ? 209  GLU B N   1 
ATOM   3119 C  CA  . GLU B 1 220 ? -1.252  -24.954 11.159  1.00 20.57 ? 209  GLU B CA  1 
ATOM   3120 C  C   . GLU B 1 220 ? -0.457  -23.664 11.161  1.00 20.24 ? 209  GLU B C   1 
ATOM   3121 O  O   . GLU B 1 220 ? 0.761   -23.689 11.068  1.00 19.41 ? 209  GLU B O   1 
ATOM   3122 C  CB  . GLU B 1 220 ? -1.176  -25.558 12.559  1.00 21.61 ? 209  GLU B CB  1 
ATOM   3123 C  CG  . GLU B 1 220 ? -1.706  -24.660 13.659  1.00 25.14 ? 209  GLU B CG  1 
ATOM   3124 C  CD  . GLU B 1 220 ? -1.680  -25.343 15.006  1.00 27.95 ? 209  GLU B CD  1 
ATOM   3125 O  OE1 . GLU B 1 220 ? -0.592  -25.543 15.558  1.00 30.66 ? 209  GLU B OE1 1 
ATOM   3126 O  OE2 . GLU B 1 220 ? -2.758  -25.688 15.513  1.00 32.31 ? 209  GLU B OE2 1 
ATOM   3127 N  N   . TYR B 1 221 ? -1.150  -22.534 11.249  1.00 20.23 ? 210  TYR B N   1 
ATOM   3128 C  CA  . TYR B 1 221 ? -0.470  -21.291 11.561  1.00 21.14 ? 210  TYR B CA  1 
ATOM   3129 C  C   . TYR B 1 221 ? -1.039  -20.746 12.843  1.00 21.14 ? 210  TYR B C   1 
ATOM   3130 O  O   . TYR B 1 221 ? -2.248  -20.719 13.020  1.00 22.04 ? 210  TYR B O   1 
ATOM   3131 C  CB  . TYR B 1 221 ? -0.591  -20.265 10.444  1.00 20.99 ? 210  TYR B CB  1 
ATOM   3132 C  CG  . TYR B 1 221 ? 0.199   -19.006 10.740  1.00 21.52 ? 210  TYR B CG  1 
ATOM   3133 C  CD1 . TYR B 1 221 ? 1.596   -19.024 10.741  1.00 21.76 ? 210  TYR B CD1 1 
ATOM   3134 C  CD2 . TYR B 1 221 ? -0.442  -17.812 11.034  1.00 21.36 ? 210  TYR B CD2 1 
ATOM   3135 C  CE1 . TYR B 1 221 ? 2.333   -17.880 11.007  1.00 22.21 ? 210  TYR B CE1 1 
ATOM   3136 C  CE2 . TYR B 1 221 ? 0.287   -16.667 11.305  1.00 22.51 ? 210  TYR B CE2 1 
ATOM   3137 C  CZ  . TYR B 1 221 ? 1.672   -16.714 11.279  1.00 21.77 ? 210  TYR B CZ  1 
ATOM   3138 O  OH  . TYR B 1 221 ? 2.394   -15.596 11.530  1.00 23.56 ? 210  TYR B OH  1 
ATOM   3139 N  N   . ARG B 1 222 ? -0.162  -20.329 13.742  1.00 22.38 ? 211  ARG B N   1 
ATOM   3140 C  CA  . ARG B 1 222 ? -0.569  -19.921 15.079  1.00 24.14 ? 211  ARG B CA  1 
ATOM   3141 C  C   . ARG B 1 222 ? 0.176   -18.622 15.325  1.00 23.57 ? 211  ARG B C   1 
ATOM   3142 O  O   . ARG B 1 222 ? 1.360   -18.547 15.055  1.00 22.67 ? 211  ARG B O   1 
ATOM   3143 C  CB  . ARG B 1 222 ? -0.197  -21.039 16.075  1.00 27.00 ? 211  ARG B CB  1 
ATOM   3144 C  CG  . ARG B 1 222 ? -0.353  -20.732 17.556  1.00 31.38 ? 211  ARG B CG  1 
ATOM   3145 C  CD  . ARG B 1 222 ? -0.129  -21.995 18.393  1.00 32.65 ? 211  ARG B CD  1 
ATOM   3146 N  NE  . ARG B 1 222 ? -1.051  -23.059 18.013  1.00 33.13 ? 211  ARG B NE  1 
ATOM   3147 C  CZ  . ARG B 1 222 ? -2.261  -23.246 18.548  1.00 33.54 ? 211  ARG B CZ  1 
ATOM   3148 N  NH1 . ARG B 1 222 ? -2.714  -22.445 19.512  1.00 31.58 ? 211  ARG B NH1 1 
ATOM   3149 N  NH2 . ARG B 1 222 ? -3.026  -24.239 18.113  1.00 30.46 ? 211  ARG B NH2 1 
ATOM   3150 N  N   . THR B 1 223 ? -0.507  -17.585 15.785  1.00 23.50 ? 212  THR B N   1 
ATOM   3151 C  CA  . THR B 1 223 ? 0.144   -16.281 15.894  1.00 23.61 ? 212  THR B CA  1 
ATOM   3152 C  C   . THR B 1 223 ? -0.454  -15.397 16.961  1.00 25.40 ? 212  THR B C   1 
ATOM   3153 O  O   . THR B 1 223 ? -1.612  -15.561 17.350  1.00 26.63 ? 212  THR B O   1 
ATOM   3154 C  CB  . THR B 1 223 ? 0.119   -15.514 14.553  1.00 23.13 ? 212  THR B CB  1 
ATOM   3155 O  OG1 . THR B 1 223 ? 0.732   -14.231 14.720  1.00 23.22 ? 212  THR B OG1 1 
ATOM   3156 C  CG2 . THR B 1 223 ? -1.316  -15.318 14.043  1.00 22.88 ? 212  THR B CG2 1 
ATOM   3157 N  N   . ARG B 1 224 ? 0.343   -14.438 17.416  1.00 27.30 ? 213  ARG B N   1 
ATOM   3158 C  CA  . ARG B 1 224 ? -0.142  -13.407 18.322  1.00 28.71 ? 213  ARG B CA  1 
ATOM   3159 C  C   . ARG B 1 224 ? -0.581  -12.172 17.561  1.00 26.93 ? 213  ARG B C   1 
ATOM   3160 O  O   . ARG B 1 224 ? -1.123  -11.232 18.145  1.00 27.62 ? 213  ARG B O   1 
ATOM   3161 C  CB  . ARG B 1 224 ? 0.916   -13.097 19.391  1.00 33.24 ? 213  ARG B CB  1 
ATOM   3162 C  CG  . ARG B 1 224 ? 1.026   -14.255 20.381  1.00 40.26 ? 213  ARG B CG  1 
ATOM   3163 C  CD  . ARG B 1 224 ? 2.190   -14.120 21.330  1.00 48.59 ? 213  ARG B CD  1 
ATOM   3164 N  NE  . ARG B 1 224 ? 1.757   -14.372 22.703  1.00 59.16 ? 213  ARG B NE  1 
ATOM   3165 C  CZ  . ARG B 1 224 ? 1.522   -13.416 23.600  1.00 62.93 ? 213  ARG B CZ  1 
ATOM   3166 N  NH1 . ARG B 1 224 ? 1.689   -12.132 23.281  1.00 64.07 ? 213  ARG B NH1 1 
ATOM   3167 N  NH2 . ARG B 1 224 ? 1.129   -13.743 24.822  1.00 63.14 ? 213  ARG B NH2 1 
ATOM   3168 N  N   . LYS B 1 225 ? -0.365  -12.183 16.253  1.00 25.18 ? 214  LYS B N   1 
ATOM   3169 C  CA  . LYS B 1 225 ? -0.838  -11.113 15.397  1.00 26.56 ? 214  LYS B CA  1 
ATOM   3170 C  C   . LYS B 1 225 ? -1.997  -11.620 14.538  1.00 23.60 ? 214  LYS B C   1 
ATOM   3171 O  O   . LYS B 1 225 ? -1.827  -11.908 13.349  1.00 22.19 ? 214  LYS B O   1 
ATOM   3172 C  CB  . LYS B 1 225 ? 0.304   -10.578 14.526  1.00 29.35 ? 214  LYS B CB  1 
ATOM   3173 C  CG  . LYS B 1 225 ? 1.441   -9.931  15.313  1.00 35.70 ? 214  LYS B CG  1 
ATOM   3174 C  CD  . LYS B 1 225 ? 1.133   -8.492  15.731  1.00 41.16 ? 214  LYS B CD  1 
ATOM   3175 C  CE  . LYS B 1 225 ? 0.858   -7.586  14.528  1.00 45.96 ? 214  LYS B CE  1 
ATOM   3176 N  NZ  . LYS B 1 225 ? 1.125   -6.147  14.831  1.00 47.39 ? 214  LYS B NZ  1 
ATOM   3177 N  N   . ALA B 1 226 ? -3.179  -11.685 15.149  1.00 21.48 ? 215  ALA B N   1 
ATOM   3178 C  CA  . ALA B 1 226 ? -4.359  -12.361 14.567  1.00 20.83 ? 215  ALA B CA  1 
ATOM   3179 C  C   . ALA B 1 226 ? -4.848  -11.677 13.315  1.00 19.88 ? 215  ALA B C   1 
ATOM   3180 O  O   . ALA B 1 226 ? -5.680  -12.207 12.586  1.00 19.76 ? 215  ALA B O   1 
ATOM   3181 C  CB  . ALA B 1 226 ? -5.489  -12.465 15.601  1.00 19.94 ? 215  ALA B CB  1 
ATOM   3182 N  N   . VAL B 1 227 ? -4.336  -10.486 13.064  1.00 20.23 ? 216  VAL B N   1 
ATOM   3183 C  CA  . VAL B 1 227 ? -4.619  -9.780  11.804  1.00 20.33 ? 216  VAL B CA  1 
ATOM   3184 C  C   . VAL B 1 227 ? -4.166  -10.603 10.571  1.00 20.23 ? 216  VAL B C   1 
ATOM   3185 O  O   . VAL B 1 227 ? -4.730  -10.477 9.475   1.00 20.49 ? 216  VAL B O   1 
ATOM   3186 C  CB  . VAL B 1 227 ? -4.040  -8.326  11.863  1.00 20.95 ? 216  VAL B CB  1 
ATOM   3187 C  CG1 . VAL B 1 227 ? -2.520  -8.315  11.896  1.00 20.98 ? 216  VAL B CG1 1 
ATOM   3188 C  CG2 . VAL B 1 227 ? -4.579  -7.428  10.765  1.00 21.01 ? 216  VAL B CG2 1 
ATOM   3189 N  N   . ARG B 1 228 ? -3.183  -11.478 10.760  1.00 19.52 ? 217  ARG B N   1 
ATOM   3190 C  CA  . ARG B 1 228 ? -2.659  -12.291 9.657   1.00 20.04 ? 217  ARG B CA  1 
ATOM   3191 C  C   . ARG B 1 228 ? -3.602  -13.430 9.284   1.00 19.49 ? 217  ARG B C   1 
ATOM   3192 O  O   . ARG B 1 228 ? -3.469  -14.037 8.245   1.00 17.35 ? 217  ARG B O   1 
ATOM   3193 C  CB  . ARG B 1 228 ? -1.294  -12.870 10.039  1.00 21.55 ? 217  ARG B CB  1 
ATOM   3194 C  CG  . ARG B 1 228 ? -0.323  -11.803 10.528  1.00 22.86 ? 217  ARG B CG  1 
ATOM   3195 C  CD  . ARG B 1 228 ? 1.007   -12.403 10.909  1.00 23.96 ? 217  ARG B CD  1 
ATOM   3196 N  NE  . ARG B 1 228 ? 1.959   -11.354 11.227  1.00 24.12 ? 217  ARG B NE  1 
ATOM   3197 C  CZ  . ARG B 1 228 ? 2.979   -11.516 12.056  1.00 26.20 ? 217  ARG B CZ  1 
ATOM   3198 N  NH1 . ARG B 1 228 ? 3.165   -12.691 12.664  1.00 26.37 ? 217  ARG B NH1 1 
ATOM   3199 N  NH2 . ARG B 1 228 ? 3.794   -10.501 12.296  1.00 27.33 ? 217  ARG B NH2 1 
ATOM   3200 N  N   . LEU B 1 229 ? -4.566  -13.712 10.147  1.00 20.28 ? 218  LEU B N   1 
ATOM   3201 C  CA  . LEU B 1 229 ? -5.527  -14.759 9.876   1.00 19.69 ? 218  LEU B CA  1 
ATOM   3202 C  C   . LEU B 1 229 ? -6.898  -14.135 9.544   1.00 19.49 ? 218  LEU B C   1 
ATOM   3203 O  O   . LEU B 1 229 ? -7.124  -12.959 9.865   1.00 19.97 ? 218  LEU B O   1 
ATOM   3204 C  CB  . LEU B 1 229 ? -5.603  -15.712 11.067  1.00 19.12 ? 218  LEU B CB  1 
ATOM   3205 C  CG  . LEU B 1 229 ? -4.408  -16.668 11.192  1.00 19.30 ? 218  LEU B CG  1 
ATOM   3206 C  CD1 . LEU B 1 229 ? -4.558  -17.495 12.471  1.00 18.09 ? 218  LEU B CD1 1 
ATOM   3207 C  CD2 . LEU B 1 229 ? -4.314  -17.564 9.970   1.00 18.78 ? 218  LEU B CD2 1 
ATOM   3208 N  N   . PRO B 1 230 ? -7.806  -14.905 8.904   1.00 18.14 ? 219  PRO B N   1 
ATOM   3209 C  CA  . PRO B 1 230 ? -7.737  -16.297 8.429   1.00 18.14 ? 219  PRO B CA  1 
ATOM   3210 C  C   . PRO B 1 230 ? -6.933  -16.526 7.137   1.00 18.66 ? 219  PRO B C   1 
ATOM   3211 O  O   . PRO B 1 230 ? -6.469  -15.580 6.506   1.00 18.08 ? 219  PRO B O   1 
ATOM   3212 C  CB  . PRO B 1 230 ? -9.195  -16.627 8.153   1.00 17.64 ? 219  PRO B CB  1 
ATOM   3213 C  CG  . PRO B 1 230 ? -9.776  -15.322 7.734   1.00 17.72 ? 219  PRO B CG  1 
ATOM   3214 C  CD  . PRO B 1 230 ? -9.130  -14.319 8.640   1.00 18.27 ? 219  PRO B CD  1 
ATOM   3215 N  N   . ILE B 1 231 ? -6.802  -17.797 6.760   1.00 19.29 ? 220  ILE B N   1 
ATOM   3216 C  CA  . ILE B 1 231 ? -6.206  -18.195 5.504   1.00 19.43 ? 220  ILE B CA  1 
ATOM   3217 C  C   . ILE B 1 231 ? -7.219  -18.008 4.384   1.00 19.23 ? 220  ILE B C   1 
ATOM   3218 O  O   . ILE B 1 231 ? -8.365  -18.413 4.497   1.00 17.86 ? 220  ILE B O   1 
ATOM   3219 C  CB  . ILE B 1 231 ? -5.684  -19.654 5.587   1.00 20.30 ? 220  ILE B CB  1 
ATOM   3220 C  CG1 . ILE B 1 231 ? -4.578  -19.745 6.654   1.00 19.42 ? 220  ILE B CG1 1 
ATOM   3221 C  CG2 . ILE B 1 231 ? -5.146  -20.155 4.233   1.00 18.66 ? 220  ILE B CG2 1 
ATOM   3222 C  CD1 . ILE B 1 231 ? -4.463  -21.134 7.251   1.00 20.31 ? 220  ILE B CD1 1 
ATOM   3223 N  N   . VAL B 1 232 ? -6.782  -17.375 3.301   1.00 19.87 ? 221  VAL B N   1 
ATOM   3224 C  CA  . VAL B 1 232 ? -7.692  -17.044 2.213   1.00 22.01 ? 221  VAL B CA  1 
ATOM   3225 C  C   . VAL B 1 232 ? -7.319  -17.805 0.939   1.00 23.18 ? 221  VAL B C   1 
ATOM   3226 O  O   . VAL B 1 232 ? -8.121  -17.931 0.045   1.00 25.43 ? 221  VAL B O   1 
ATOM   3227 C  CB  . VAL B 1 232 ? -7.765  -15.511 1.958   1.00 22.24 ? 221  VAL B CB  1 
ATOM   3228 C  CG1 . VAL B 1 232 ? -8.262  -14.768 3.199   1.00 21.82 ? 221  VAL B CG1 1 
ATOM   3229 C  CG2 . VAL B 1 232 ? -6.408  -14.961 1.550   1.00 22.32 ? 221  VAL B CG2 1 
ATOM   3230 N  N   . ASP B 1 233 ? -6.105  -18.341 0.878   1.00 23.60 ? 222  ASP B N   1 
ATOM   3231 C  CA  . ASP B 1 233 ? -5.658  -19.061 -0.318  1.00 23.78 ? 222  ASP B CA  1 
ATOM   3232 C  C   . ASP B 1 233 ? -4.510  -20.019 -0.005  1.00 22.61 ? 222  ASP B C   1 
ATOM   3233 O  O   . ASP B 1 233 ? -3.851  -19.915 1.049   1.00 21.43 ? 222  ASP B O   1 
ATOM   3234 C  CB  . ASP B 1 233 ? -5.229  -18.065 -1.415  1.00 24.16 ? 222  ASP B CB  1 
ATOM   3235 C  CG  . ASP B 1 233 ? -5.565  -18.542 -2.846  1.00 25.70 ? 222  ASP B CG  1 
ATOM   3236 O  OD1 . ASP B 1 233 ? -5.825  -19.745 -3.087  1.00 25.95 ? 222  ASP B OD1 1 
ATOM   3237 O  OD2 . ASP B 1 233 ? -5.531  -17.688 -3.763  1.00 28.06 ? 222  ASP B OD2 1 
ATOM   3238 N  N   . ILE B 1 234 ? -4.266  -20.923 -0.958  1.00 22.82 ? 223  ILE B N   1 
ATOM   3239 C  CA  . ILE B 1 234 ? -3.255  -21.959 -0.876  1.00 21.98 ? 223  ILE B CA  1 
ATOM   3240 C  C   . ILE B 1 234 ? -2.573  -22.069 -2.241  1.00 23.13 ? 223  ILE B C   1 
ATOM   3241 O  O   . ILE B 1 234 ? -3.234  -22.054 -3.270  1.00 25.08 ? 223  ILE B O   1 
ATOM   3242 C  CB  . ILE B 1 234 ? -3.877  -23.318 -0.430  1.00 21.05 ? 223  ILE B CB  1 
ATOM   3243 C  CG1 . ILE B 1 234 ? -2.813  -24.411 -0.270  1.00 21.71 ? 223  ILE B CG1 1 
ATOM   3244 C  CG2 . ILE B 1 234 ? -4.970  -23.787 -1.380  1.00 21.73 ? 223  ILE B CG2 1 
ATOM   3245 C  CD1 . ILE B 1 234 ? -3.257  -25.594 0.585   1.00 20.10 ? 223  ILE B CD1 1 
ATOM   3246 N  N   . ALA B 1 235 ? -1.251  -22.170 -2.239  1.00 21.94 ? 224  ALA B N   1 
ATOM   3247 C  CA  . ALA B 1 235 ? -0.493  -22.368 -3.458  1.00 22.30 ? 224  ALA B CA  1 
ATOM   3248 C  C   . ALA B 1 235 ? 0.354   -23.626 -3.361  1.00 20.97 ? 224  ALA B C   1 
ATOM   3249 O  O   . ALA B 1 235 ? 1.471   -23.576 -2.857  1.00 21.59 ? 224  ALA B O   1 
ATOM   3250 C  CB  . ALA B 1 235 ? 0.402   -21.166 -3.749  1.00 20.86 ? 224  ALA B CB  1 
ATOM   3251 N  N   . PRO B 1 236 ? -0.172  -24.743 -3.853  1.00 21.29 ? 225  PRO B N   1 
ATOM   3252 C  CA  . PRO B 1 236 ? 0.646   -25.939 -4.028  1.00 22.77 ? 225  PRO B CA  1 
ATOM   3253 C  C   . PRO B 1 236 ? 1.811   -25.679 -5.000  1.00 25.03 ? 225  PRO B C   1 
ATOM   3254 O  O   . PRO B 1 236 ? 1.719   -24.791 -5.848  1.00 24.95 ? 225  PRO B O   1 
ATOM   3255 C  CB  . PRO B 1 236 ? -0.338  -26.964 -4.616  1.00 22.46 ? 225  PRO B CB  1 
ATOM   3256 C  CG  . PRO B 1 236 ? -1.716  -26.404 -4.375  1.00 21.39 ? 225  PRO B CG  1 
ATOM   3257 C  CD  . PRO B 1 236 ? -1.548  -24.913 -4.365  1.00 21.57 ? 225  PRO B CD  1 
ATOM   3258 N  N   . TYR B 1 237 ? 2.903   -26.420 -4.842  1.00 25.94 ? 226  TYR B N   1 
ATOM   3259 C  CA  . TYR B 1 237 ? 4.055   -26.348 -5.742  1.00 28.32 ? 226  TYR B CA  1 
ATOM   3260 C  C   . TYR B 1 237 ? 4.140   -27.582 -6.600  1.00 27.98 ? 226  TYR B C   1 
ATOM   3261 O  O   . TYR B 1 237 ? 4.246   -27.489 -7.823  1.00 29.03 ? 226  TYR B O   1 
ATOM   3262 C  CB  . TYR B 1 237 ? 5.350   -26.227 -4.940  1.00 31.21 ? 226  TYR B CB  1 
ATOM   3263 C  CG  . TYR B 1 237 ? 6.634   -26.192 -5.756  1.00 33.06 ? 226  TYR B CG  1 
ATOM   3264 C  CD1 . TYR B 1 237 ? 7.258   -27.379 -6.167  1.00 32.67 ? 226  TYR B CD1 1 
ATOM   3265 C  CD2 . TYR B 1 237 ? 7.246   -24.977 -6.084  1.00 33.08 ? 226  TYR B CD2 1 
ATOM   3266 C  CE1 . TYR B 1 237 ? 8.437   -27.356 -6.894  1.00 33.15 ? 226  TYR B CE1 1 
ATOM   3267 C  CE2 . TYR B 1 237 ? 8.436   -24.946 -6.811  1.00 33.64 ? 226  TYR B CE2 1 
ATOM   3268 C  CZ  . TYR B 1 237 ? 9.024   -26.141 -7.212  1.00 34.20 ? 226  TYR B CZ  1 
ATOM   3269 O  OH  . TYR B 1 237 ? 10.198  -26.138 -7.932  1.00 33.80 ? 226  TYR B OH  1 
ATOM   3270 N  N   . ASP B 1 238 ? 4.121   -28.747 -5.962  1.00 27.94 ? 227  ASP B N   1 
ATOM   3271 C  CA  . ASP B 1 238 ? 4.242   -30.008 -6.698  1.00 28.07 ? 227  ASP B CA  1 
ATOM   3272 C  C   . ASP B 1 238 ? 2.927   -30.377 -7.397  1.00 27.05 ? 227  ASP B C   1 
ATOM   3273 O  O   . ASP B 1 238 ? 2.273   -31.350 -7.033  1.00 27.35 ? 227  ASP B O   1 
ATOM   3274 C  CB  . ASP B 1 238 ? 4.763   -31.143 -5.804  1.00 27.46 ? 227  ASP B CB  1 
ATOM   3275 C  CG  . ASP B 1 238 ? 5.059   -32.424 -6.592  1.00 28.20 ? 227  ASP B CG  1 
ATOM   3276 O  OD1 . ASP B 1 238 ? 5.393   -32.328 -7.791  1.00 27.49 ? 227  ASP B OD1 1 
ATOM   3277 O  OD2 . ASP B 1 238 ? 4.939   -33.526 -6.018  1.00 28.30 ? 227  ASP B OD2 1 
ATOM   3278 N  N   . ILE B 1 239 ? 2.550   -29.578 -8.399  1.00 26.38 ? 228  ILE B N   1 
ATOM   3279 C  CA  . ILE B 1 239 ? 1.342   -29.834 -9.197  1.00 28.56 ? 228  ILE B CA  1 
ATOM   3280 C  C   . ILE B 1 239 ? 1.592   -29.548 -10.686 1.00 29.52 ? 228  ILE B C   1 
ATOM   3281 O  O   . ILE B 1 239 ? 2.612   -28.937 -11.045 1.00 30.47 ? 228  ILE B O   1 
ATOM   3282 C  CB  . ILE B 1 239 ? 0.142   -28.978 -8.707  1.00 28.10 ? 228  ILE B CB  1 
ATOM   3283 C  CG1 . ILE B 1 239 ? 0.527   -27.492 -8.622  1.00 27.43 ? 228  ILE B CG1 1 
ATOM   3284 C  CG2 . ILE B 1 239 ? -0.362  -29.484 -7.364  1.00 28.15 ? 228  ILE B CG2 1 
ATOM   3285 C  CD1 . ILE B 1 239 ? -0.629  -26.564 -8.299  1.00 27.53 ? 228  ILE B CD1 1 
ATOM   3286 N  N   . GLY B 1 240 ? 0.661   -29.971 -11.538 1.00 30.35 ? 229  GLY B N   1 
ATOM   3287 C  CA  . GLY B 1 240 ? 0.723   -29.651 -12.966 1.00 36.22 ? 229  GLY B CA  1 
ATOM   3288 C  C   . GLY B 1 240 ? 0.796   -30.862 -13.888 1.00 39.84 ? 229  GLY B C   1 
ATOM   3289 O  O   . GLY B 1 240 ? 0.348   -30.793 -15.033 1.00 40.42 ? 229  GLY B O   1 
ATOM   3290 N  N   . GLY B 1 241 ? 1.358   -31.964 -13.381 1.00 40.43 ? 230  GLY B N   1 
ATOM   3291 C  CA  . GLY B 1 241 ? 1.471   -33.221 -14.121 1.00 38.96 ? 230  GLY B CA  1 
ATOM   3292 C  C   . GLY B 1 241 ? 0.129   -33.930 -14.249 1.00 41.35 ? 230  GLY B C   1 
ATOM   3293 O  O   . GLY B 1 241 ? -0.763  -33.716 -13.421 1.00 39.01 ? 230  GLY B O   1 
ATOM   3294 N  N   . PRO B 1 242 ? -0.020  -34.780 -15.296 1.00 43.30 ? 231  PRO B N   1 
ATOM   3295 C  CA  . PRO B 1 242 ? -1.282  -35.477 -15.641 1.00 42.37 ? 231  PRO B CA  1 
ATOM   3296 C  C   . PRO B 1 242 ? -1.901  -36.279 -14.492 1.00 42.03 ? 231  PRO B C   1 
ATOM   3297 O  O   . PRO B 1 242 ? -3.115  -36.437 -14.429 1.00 39.87 ? 231  PRO B O   1 
ATOM   3298 C  CB  . PRO B 1 242 ? -0.868  -36.431 -16.778 1.00 41.99 ? 231  PRO B CB  1 
ATOM   3299 C  CG  . PRO B 1 242 ? 0.635   -36.453 -16.770 1.00 41.94 ? 231  PRO B CG  1 
ATOM   3300 C  CD  . PRO B 1 242 ? 1.064   -35.117 -16.241 1.00 39.84 ? 231  PRO B CD  1 
ATOM   3301 N  N   . ASP B 1 243 ? -1.066  -36.780 -13.592 1.00 43.77 ? 232  ASP B N   1 
ATOM   3302 C  CA  . ASP B 1 243 ? -1.532  -37.605 -12.479 1.00 45.44 ? 232  ASP B CA  1 
ATOM   3303 C  C   . ASP B 1 243 ? -1.554  -36.879 -11.109 1.00 42.89 ? 232  ASP B C   1 
ATOM   3304 O  O   . ASP B 1 243 ? -1.804  -37.497 -10.066 1.00 39.99 ? 232  ASP B O   1 
ATOM   3305 C  CB  . ASP B 1 243 ? -0.678  -38.878 -12.404 1.00 49.87 ? 232  ASP B CB  1 
ATOM   3306 C  CG  . ASP B 1 243 ? 0.826   -38.586 -12.374 1.00 56.73 ? 232  ASP B CG  1 
ATOM   3307 O  OD1 . ASP B 1 243 ? 1.262   -37.439 -12.676 1.00 58.02 ? 232  ASP B OD1 1 
ATOM   3308 O  OD2 . ASP B 1 243 ? 1.583   -39.529 -12.048 1.00 63.47 ? 232  ASP B OD2 1 
ATOM   3309 N  N   . GLN B 1 244 ? -1.299  -35.576 -11.109 1.00 38.33 ? 233  GLN B N   1 
ATOM   3310 C  CA  . GLN B 1 244 ? -1.212  -34.846 -9.857  1.00 34.48 ? 233  GLN B CA  1 
ATOM   3311 C  C   . GLN B 1 244 ? -2.530  -34.173 -9.476  1.00 34.19 ? 233  GLN B C   1 
ATOM   3312 O  O   . GLN B 1 244 ? -3.085  -33.361 -10.238 1.00 33.01 ? 233  GLN B O   1 
ATOM   3313 C  CB  . GLN B 1 244 ? -0.058  -33.856 -9.900  1.00 34.33 ? 233  GLN B CB  1 
ATOM   3314 C  CG  . GLN B 1 244 ? 1.288   -34.487 -10.217 1.00 32.07 ? 233  GLN B CG  1 
ATOM   3315 C  CD  . GLN B 1 244 ? 2.407   -33.475 -10.114 1.00 33.07 ? 233  GLN B CD  1 
ATOM   3316 O  OE1 . GLN B 1 244 ? 2.506   -32.588 -10.947 1.00 36.22 ? 233  GLN B OE1 1 
ATOM   3317 N  NE2 . GLN B 1 244 ? 3.246   -33.589 -9.078  1.00 30.34 ? 233  GLN B NE2 1 
ATOM   3318 N  N   . GLU B 1 245 ? -3.018  -34.532 -8.285  1.00 33.55 ? 234  GLU B N   1 
ATOM   3319 C  CA  . GLU B 1 245 ? -4.317  -34.087 -7.774  1.00 32.99 ? 234  GLU B CA  1 
ATOM   3320 C  C   . GLU B 1 245 ? -4.309  -33.650 -6.309  1.00 31.33 ? 234  GLU B C   1 
ATOM   3321 O  O   . GLU B 1 245 ? -3.518  -34.156 -5.495  1.00 30.01 ? 234  GLU B O   1 
ATOM   3322 C  CB  . GLU B 1 245 ? -5.337  -35.201 -7.929  1.00 33.75 ? 234  GLU B CB  1 
ATOM   3323 C  CG  . GLU B 1 245 ? -5.783  -35.454 -9.352  1.00 37.30 ? 234  GLU B CG  1 
ATOM   3324 C  CD  . GLU B 1 245 ? -6.883  -36.504 -9.394  1.00 40.91 ? 234  GLU B CD  1 
ATOM   3325 O  OE1 . GLU B 1 245 ? -7.913  -36.337 -8.709  1.00 44.65 ? 234  GLU B OE1 1 
ATOM   3326 O  OE2 . GLU B 1 245 ? -6.714  -37.513 -10.095 1.00 43.11 ? 234  GLU B OE2 1 
ATOM   3327 N  N   . PHE B 1 246 ? -5.204  -32.718 -5.971  1.00 29.88 ? 235  PHE B N   1 
ATOM   3328 C  CA  . PHE B 1 246 ? -5.356  -32.281 -4.584  1.00 28.49 ? 235  PHE B CA  1 
ATOM   3329 C  C   . PHE B 1 246 ? -6.768  -31.888 -4.198  1.00 28.36 ? 235  PHE B C   1 
ATOM   3330 O  O   . PHE B 1 246 ? -7.596  -31.533 -5.052  1.00 28.54 ? 235  PHE B O   1 
ATOM   3331 C  CB  . PHE B 1 246 ? -4.367  -31.162 -4.233  1.00 27.87 ? 235  PHE B CB  1 
ATOM   3332 C  CG  . PHE B 1 246 ? -4.698  -29.823 -4.835  1.00 28.03 ? 235  PHE B CG  1 
ATOM   3333 C  CD1 . PHE B 1 246 ? -5.594  -28.960 -4.200  1.00 26.75 ? 235  PHE B CD1 1 
ATOM   3334 C  CD2 . PHE B 1 246 ? -4.085  -29.406 -6.021  1.00 26.93 ? 235  PHE B CD2 1 
ATOM   3335 C  CE1 . PHE B 1 246 ? -5.899  -27.732 -4.752  1.00 27.04 ? 235  PHE B CE1 1 
ATOM   3336 C  CE2 . PHE B 1 246 ? -4.378  -28.167 -6.569  1.00 26.41 ? 235  PHE B CE2 1 
ATOM   3337 C  CZ  . PHE B 1 246 ? -5.277  -27.331 -5.932  1.00 27.68 ? 235  PHE B CZ  1 
ATOM   3338 N  N   . GLY B 1 247 ? -7.022  -31.977 -2.896  1.00 28.24 ? 236  GLY B N   1 
ATOM   3339 C  CA  . GLY B 1 247 ? -8.245  -31.479 -2.254  1.00 27.63 ? 236  GLY B CA  1 
ATOM   3340 C  C   . GLY B 1 247 ? -7.833  -30.643 -1.046  1.00 27.05 ? 236  GLY B C   1 
ATOM   3341 O  O   . GLY B 1 247 ? -6.656  -30.639 -0.669  1.00 25.84 ? 236  GLY B O   1 
ATOM   3342 N  N   . VAL B 1 248 ? -8.782  -29.923 -0.444  1.00 25.24 ? 237  VAL B N   1 
ATOM   3343 C  CA  . VAL B 1 248 ? -8.482  -29.094 0.727   1.00 23.94 ? 237  VAL B CA  1 
ATOM   3344 C  C   . VAL B 1 248 ? -9.629  -29.151 1.728   1.00 24.44 ? 237  VAL B C   1 
ATOM   3345 O  O   . VAL B 1 248 ? -10.794 -29.076 1.342   1.00 24.79 ? 237  VAL B O   1 
ATOM   3346 C  CB  . VAL B 1 248 ? -8.206  -27.626 0.331   1.00 24.46 ? 237  VAL B CB  1 
ATOM   3347 C  CG1 . VAL B 1 248 ? -7.798  -26.784 1.550   1.00 23.44 ? 237  VAL B CG1 1 
ATOM   3348 C  CG2 . VAL B 1 248 ? -7.136  -27.537 -0.754  1.00 23.51 ? 237  VAL B CG2 1 
ATOM   3349 N  N   . ASP B 1 249 ? -9.309  -29.329 3.009   1.00 24.52 ? 238  ASP B N   1 
ATOM   3350 C  CA  . ASP B 1 249 ? -10.290 -29.115 4.096   1.00 24.07 ? 238  ASP B CA  1 
ATOM   3351 C  C   . ASP B 1 249 ? -9.798  -27.904 4.860   1.00 22.42 ? 238  ASP B C   1 
ATOM   3352 O  O   . ASP B 1 249 ? -8.731  -27.957 5.471   1.00 21.47 ? 238  ASP B O   1 
ATOM   3353 C  CB  . ASP B 1 249 ? -10.348 -30.293 5.073   1.00 26.86 ? 238  ASP B CB  1 
ATOM   3354 C  CG  . ASP B 1 249 ? -10.948 -31.551 4.471   1.00 31.96 ? 238  ASP B CG  1 
ATOM   3355 O  OD1 . ASP B 1 249 ? -11.744 -31.485 3.507   1.00 34.30 ? 238  ASP B OD1 1 
ATOM   3356 O  OD2 . ASP B 1 249 ? -10.621 -32.632 4.993   1.00 36.67 ? 238  ASP B OD2 1 
ATOM   3357 N  N   . VAL B 1 250 ? -10.557 -26.817 4.802   1.00 20.67 ? 239  VAL B N   1 
ATOM   3358 C  CA  . VAL B 1 250 ? -10.217 -25.578 5.484   1.00 19.15 ? 239  VAL B CA  1 
ATOM   3359 C  C   . VAL B 1 250 ? -10.797 -25.618 6.906   1.00 18.61 ? 239  VAL B C   1 
ATOM   3360 O  O   . VAL B 1 250 ? -12.013 -25.635 7.089   1.00 17.35 ? 239  VAL B O   1 
ATOM   3361 C  CB  . VAL B 1 250 ? -10.801 -24.359 4.738   1.00 20.18 ? 239  VAL B CB  1 
ATOM   3362 C  CG1 . VAL B 1 250 ? -10.283 -23.076 5.355   1.00 19.56 ? 239  VAL B CG1 1 
ATOM   3363 C  CG2 . VAL B 1 250 ? -10.459 -24.406 3.243   1.00 20.09 ? 239  VAL B CG2 1 
ATOM   3364 N  N   . GLY B 1 251 ? -9.928  -25.622 7.909   1.00 17.60 ? 240  GLY B N   1 
ATOM   3365 C  CA  . GLY B 1 251 ? -10.382 -25.611 9.288   1.00 17.57 ? 240  GLY B CA  1 
ATOM   3366 C  C   . GLY B 1 251 ? -10.856 -24.242 9.739   1.00 17.30 ? 240  GLY B C   1 
ATOM   3367 O  O   . GLY B 1 251 ? -10.564 -23.235 9.085   1.00 17.29 ? 240  GLY B O   1 
ATOM   3368 N  N   . PRO B 1 252 ? -11.614 -24.200 10.851  1.00 17.59 ? 241  PRO B N   1 
ATOM   3369 C  CA  . PRO B 1 252 ? -12.112 -22.929 11.375  1.00 17.48 ? 241  PRO B CA  1 
ATOM   3370 C  C   . PRO B 1 252 ? -10.966 -22.036 11.824  1.00 17.77 ? 241  PRO B C   1 
ATOM   3371 O  O   . PRO B 1 252 ? -9.946  -22.525 12.315  1.00 16.47 ? 241  PRO B O   1 
ATOM   3372 C  CB  . PRO B 1 252 ? -12.957 -23.327 12.604  1.00 18.16 ? 241  PRO B CB  1 
ATOM   3373 C  CG  . PRO B 1 252 ? -13.117 -24.818 12.564  1.00 18.64 ? 241  PRO B CG  1 
ATOM   3374 C  CD  . PRO B 1 252 ? -12.154 -25.386 11.557  1.00 17.37 ? 241  PRO B CD  1 
ATOM   3375 N  N   . VAL B 1 253 ? -11.114 -20.737 11.630  1.00 17.79 ? 242  VAL B N   1 
ATOM   3376 C  CA  . VAL B 1 253 ? -10.143 -19.810 12.184  1.00 17.97 ? 242  VAL B CA  1 
ATOM   3377 C  C   . VAL B 1 253 ? -10.568 -19.599 13.640  1.00 18.91 ? 242  VAL B C   1 
ATOM   3378 O  O   . VAL B 1 253 ? -11.746 -19.365 13.915  1.00 19.17 ? 242  VAL B O   1 
ATOM   3379 C  CB  . VAL B 1 253 ? -10.046 -18.507 11.362  1.00 17.77 ? 242  VAL B CB  1 
ATOM   3380 C  CG1 . VAL B 1 253 ? -11.431 -17.865 11.172  1.00 17.79 ? 242  VAL B CG1 1 
ATOM   3381 C  CG2 . VAL B 1 253 ? -9.043  -17.538 11.975  1.00 16.23 ? 242  VAL B CG2 1 
ATOM   3382 N  N   . CYS B 1 254 ? -9.627  -19.749 14.570  1.00 18.46 ? 243  CYS B N   1 
ATOM   3383 C  CA  . CYS B 1 254 ? -9.962  -19.740 15.988  1.00 19.36 ? 243  CYS B CA  1 
ATOM   3384 C  C   . CYS B 1 254 ? -9.260  -18.573 16.669  1.00 20.15 ? 243  CYS B C   1 
ATOM   3385 O  O   . CYS B 1 254 ? -8.019  -18.490 16.642  1.00 19.46 ? 243  CYS B O   1 
ATOM   3386 C  CB  . CYS B 1 254 ? -9.593  -21.072 16.678  1.00 18.60 ? 243  CYS B CB  1 
ATOM   3387 S  SG  . CYS B 1 254 ? -10.611 -22.518 16.236  1.00 18.00 ? 243  CYS B SG  1 
ATOM   3388 N  N   . PHE B 1 255 ? -10.062 -17.685 17.264  1.00 19.30 ? 244  PHE B N   1 
ATOM   3389 C  CA  . PHE B 1 255 ? -9.546  -16.501 17.957  1.00 20.35 ? 244  PHE B CA  1 
ATOM   3390 C  C   . PHE B 1 255 ? -9.663  -16.631 19.473  1.00 21.44 ? 244  PHE B C   1 
ATOM   3391 O  O   . PHE B 1 255 ? -10.677 -17.109 19.983  1.00 22.40 ? 244  PHE B O   1 
ATOM   3392 C  CB  . PHE B 1 255 ? -10.310 -15.232 17.525  1.00 17.95 ? 244  PHE B CB  1 
ATOM   3393 C  CG  . PHE B 1 255 ? -10.270 -14.953 16.041  1.00 17.96 ? 244  PHE B CG  1 
ATOM   3394 C  CD1 . PHE B 1 255 ? -9.250  -14.195 15.494  1.00 17.16 ? 244  PHE B CD1 1 
ATOM   3395 C  CD2 . PHE B 1 255 ? -11.285 -15.427 15.189  1.00 17.56 ? 244  PHE B CD2 1 
ATOM   3396 C  CE1 . PHE B 1 255 ? -9.221  -13.914 14.141  1.00 17.84 ? 244  PHE B CE1 1 
ATOM   3397 C  CE2 . PHE B 1 255 ? -11.269 -15.145 13.824  1.00 17.40 ? 244  PHE B CE2 1 
ATOM   3398 C  CZ  . PHE B 1 255 ? -10.238 -14.377 13.296  1.00 18.05 ? 244  PHE B CZ  1 
ATOM   3399 N  N   . LEU B 1 256 ? -8.655  -16.154 20.193  1.00 24.37 ? 245  LEU B N   1 
ATOM   3400 C  CA  . LEU B 1 256 ? -8.769  -16.003 21.640  1.00 28.28 ? 245  LEU B CA  1 
ATOM   3401 C  C   . LEU B 1 256 ? -9.044  -14.530 22.046  1.00 32.94 ? 245  LEU B C   1 
ATOM   3402 O  O   . LEU B 1 256 ? -10.207 -14.075 21.989  1.00 37.53 ? 245  LEU B O   1 
ATOM   3403 C  CB  . LEU B 1 256 ? -7.539  -16.571 22.345  1.00 29.96 ? 245  LEU B CB  1 
ATOM   3404 C  CG  . LEU B 1 256 ? -7.644  -16.830 23.850  1.00 31.63 ? 245  LEU B CG  1 
ATOM   3405 C  CD1 . LEU B 1 256 ? -8.610  -17.972 24.148  1.00 34.78 ? 245  LEU B CD1 1 
ATOM   3406 C  CD2 . LEU B 1 256 ? -6.271  -17.132 24.457  1.00 32.19 ? 245  LEU B CD2 1 
ATOM   3407 O  OXT . LEU B 1 256 ? -8.169  -13.740 22.441  1.00 30.71 ? 245  LEU B OXT 1 
ATOM   3408 N  N   . ILE C 1 39  ? -36.603 0.186   23.427  1.00 67.89 ? 28   ILE C N   1 
ATOM   3409 C  CA  . ILE C 1 39  ? -35.799 1.428   23.223  1.00 69.36 ? 28   ILE C CA  1 
ATOM   3410 C  C   . ILE C 1 39  ? -34.540 1.162   22.380  1.00 69.74 ? 28   ILE C C   1 
ATOM   3411 O  O   . ILE C 1 39  ? -33.469 1.716   22.655  1.00 72.72 ? 28   ILE C O   1 
ATOM   3412 C  CB  . ILE C 1 39  ? -35.433 2.096   24.571  1.00 65.69 ? 28   ILE C CB  1 
ATOM   3413 N  N   . SER C 1 40  ? -34.683 0.314   21.355  1.00 67.94 ? 29   SER C N   1 
ATOM   3414 C  CA  . SER C 1 40  ? -33.614 0.027   20.385  1.00 64.32 ? 29   SER C CA  1 
ATOM   3415 C  C   . SER C 1 40  ? -33.132 1.319   19.719  1.00 62.59 ? 29   SER C C   1 
ATOM   3416 O  O   . SER C 1 40  ? -33.959 2.085   19.214  1.00 62.51 ? 29   SER C O   1 
ATOM   3417 C  CB  . SER C 1 40  ? -34.112 -0.959  19.318  1.00 65.25 ? 29   SER C CB  1 
ATOM   3418 O  OG  . SER C 1 40  ? -33.130 -1.184  18.317  1.00 66.28 ? 29   SER C OG  1 
ATOM   3419 N  N   . PRO C 1 41  ? -31.798 1.564   19.717  1.00 57.82 ? 30   PRO C N   1 
ATOM   3420 C  CA  . PRO C 1 41  ? -31.213 2.821   19.219  1.00 52.98 ? 30   PRO C CA  1 
ATOM   3421 C  C   . PRO C 1 41  ? -31.768 3.224   17.856  1.00 48.57 ? 30   PRO C C   1 
ATOM   3422 O  O   . PRO C 1 41  ? -31.938 2.379   16.982  1.00 49.73 ? 30   PRO C O   1 
ATOM   3423 C  CB  . PRO C 1 41  ? -29.721 2.495   19.130  1.00 54.58 ? 30   PRO C CB  1 
ATOM   3424 C  CG  . PRO C 1 41  ? -29.511 1.479   20.203  1.00 51.45 ? 30   PRO C CG  1 
ATOM   3425 C  CD  . PRO C 1 41  ? -30.750 0.626   20.172  1.00 55.71 ? 30   PRO C CD  1 
ATOM   3426 N  N   . ASP C 1 42  ? -32.064 4.506   17.691  1.00 44.13 ? 31   ASP C N   1 
ATOM   3427 C  CA  . ASP C 1 42  ? -32.800 4.967   16.517  1.00 40.55 ? 31   ASP C CA  1 
ATOM   3428 C  C   . ASP C 1 42  ? -32.113 6.044   15.695  1.00 36.71 ? 31   ASP C C   1 
ATOM   3429 O  O   . ASP C 1 42  ? -32.633 6.452   14.666  1.00 36.61 ? 31   ASP C O   1 
ATOM   3430 C  CB  . ASP C 1 42  ? -34.230 5.390   16.895  1.00 41.43 ? 31   ASP C CB  1 
ATOM   3431 C  CG  . ASP C 1 42  ? -34.282 6.558   17.877  1.00 43.32 ? 31   ASP C CG  1 
ATOM   3432 O  OD1 . ASP C 1 42  ? -33.234 7.117   18.292  1.00 43.68 ? 31   ASP C OD1 1 
ATOM   3433 O  OD2 . ASP C 1 42  ? -35.419 6.921   18.240  1.00 46.07 ? 31   ASP C OD2 1 
ATOM   3434 N  N   . GLY C 1 43  ? -30.942 6.495   16.130  1.00 34.48 ? 32   GLY C N   1 
ATOM   3435 C  CA  . GLY C 1 43  ? -30.204 7.508   15.372  1.00 32.21 ? 32   GLY C CA  1 
ATOM   3436 C  C   . GLY C 1 43  ? -30.510 8.935   15.801  1.00 32.10 ? 32   GLY C C   1 
ATOM   3437 O  O   . GLY C 1 43  ? -29.969 9.883   15.225  1.00 27.08 ? 32   GLY C O   1 
ATOM   3438 N  N   . SER C 1 44  ? -31.368 9.089   16.817  1.00 32.19 ? 33   SER C N   1 
ATOM   3439 C  CA  . SER C 1 44  ? -31.552 10.397  17.449  1.00 35.33 ? 33   SER C CA  1 
ATOM   3440 C  C   . SER C 1 44  ? -30.348 10.705  18.344  1.00 37.29 ? 33   SER C C   1 
ATOM   3441 O  O   . SER C 1 44  ? -29.580 9.798   18.700  1.00 37.41 ? 33   SER C O   1 
ATOM   3442 C  CB  . SER C 1 44  ? -32.848 10.453  18.258  1.00 34.96 ? 33   SER C CB  1 
ATOM   3443 O  OG  . SER C 1 44  ? -32.863 9.472   19.284  1.00 37.49 ? 33   SER C OG  1 
ATOM   3444 N  N   . ARG C 1 45  ? -30.184 11.981  18.685  1.00 37.45 ? 34   ARG C N   1 
ATOM   3445 C  CA  . ARG C 1 45  ? -29.101 12.445  19.551  1.00 39.72 ? 34   ARG C CA  1 
ATOM   3446 C  C   . ARG C 1 45  ? -29.095 11.724  20.893  1.00 39.47 ? 34   ARG C C   1 
ATOM   3447 O  O   . ARG C 1 45  ? -28.038 11.435  21.441  1.00 41.01 ? 34   ARG C O   1 
ATOM   3448 C  CB  . ARG C 1 45  ? -29.193 13.959  19.778  1.00 40.39 ? 34   ARG C CB  1 
ATOM   3449 C  CG  . ARG C 1 45  ? -27.904 14.557  20.330  1.00 42.89 ? 34   ARG C CG  1 
ATOM   3450 C  CD  . ARG C 1 45  ? -27.995 16.066  20.527  1.00 42.36 ? 34   ARG C CD  1 
ATOM   3451 N  NE  . ARG C 1 45  ? -26.654 16.646  20.574  1.00 44.33 ? 34   ARG C NE  1 
ATOM   3452 C  CZ  . ARG C 1 45  ? -26.371 17.937  20.402  1.00 47.24 ? 34   ARG C CZ  1 
ATOM   3453 N  NH1 . ARG C 1 45  ? -27.335 18.826  20.172  1.00 46.56 ? 34   ARG C NH1 1 
ATOM   3454 N  NH2 . ARG C 1 45  ? -25.108 18.340  20.456  1.00 48.38 ? 34   ARG C NH2 1 
ATOM   3455 N  N   . LYS C 1 46  ? -30.286 11.441  21.403  1.00 40.44 ? 35   LYS C N   1 
ATOM   3456 C  CA  . LYS C 1 46  ? -30.443 10.763  22.675  1.00 40.62 ? 35   LYS C CA  1 
ATOM   3457 C  C   . LYS C 1 46  ? -30.286 9.252   22.547  1.00 37.93 ? 35   LYS C C   1 
ATOM   3458 O  O   . LYS C 1 46  ? -29.946 8.586   23.523  1.00 37.48 ? 35   LYS C O   1 
ATOM   3459 C  CB  . LYS C 1 46  ? -31.796 11.112  23.315  1.00 43.27 ? 35   LYS C CB  1 
ATOM   3460 C  CG  . LYS C 1 46  ? -32.029 12.612  23.467  1.00 48.49 ? 35   LYS C CG  1 
ATOM   3461 C  CD  . LYS C 1 46  ? -32.795 12.957  24.735  1.00 49.06 ? 35   LYS C CD  1 
ATOM   3462 C  CE  . LYS C 1 46  ? -32.480 14.385  25.156  1.00 49.78 ? 35   LYS C CE  1 
ATOM   3463 N  NZ  . LYS C 1 46  ? -32.117 14.429  26.602  1.00 51.56 ? 35   LYS C NZ  1 
ATOM   3464 N  N   . ASN C 1 47  ? -30.543 8.709   21.359  1.00 35.61 ? 36   ASN C N   1 
ATOM   3465 C  CA  . ASN C 1 47  ? -30.379 7.268   21.150  1.00 36.14 ? 36   ASN C CA  1 
ATOM   3466 C  C   . ASN C 1 47  ? -29.612 6.910   19.884  1.00 30.79 ? 36   ASN C C   1 
ATOM   3467 O  O   . ASN C 1 47  ? -30.184 6.341   18.957  1.00 28.00 ? 36   ASN C O   1 
ATOM   3468 C  CB  . ASN C 1 47  ? -31.718 6.534   21.230  1.00 39.74 ? 36   ASN C CB  1 
ATOM   3469 C  CG  . ASN C 1 47  ? -31.836 5.705   22.488  1.00 48.81 ? 36   ASN C CG  1 
ATOM   3470 O  OD1 . ASN C 1 47  ? -31.188 4.649   22.618  1.00 49.68 ? 36   ASN C OD1 1 
ATOM   3471 N  ND2 . ASN C 1 47  ? -32.648 6.182   23.442  1.00 48.17 ? 36   ASN C ND2 1 
ATOM   3472 N  N   . PRO C 1 48  ? -28.312 7.273   19.841  1.00 28.72 ? 37   PRO C N   1 
ATOM   3473 C  CA  . PRO C 1 48  ? -27.501 7.073   18.638  1.00 27.12 ? 37   PRO C CA  1 
ATOM   3474 C  C   . PRO C 1 48  ? -27.244 5.594   18.390  1.00 26.70 ? 37   PRO C C   1 
ATOM   3475 O  O   . PRO C 1 48  ? -27.196 4.818   19.340  1.00 27.30 ? 37   PRO C O   1 
ATOM   3476 C  CB  . PRO C 1 48  ? -26.195 7.794   18.968  1.00 27.32 ? 37   PRO C CB  1 
ATOM   3477 C  CG  . PRO C 1 48  ? -26.121 7.786   20.464  1.00 28.02 ? 37   PRO C CG  1 
ATOM   3478 C  CD  . PRO C 1 48  ? -27.549 7.949   20.908  1.00 27.93 ? 37   PRO C CD  1 
ATOM   3479 N  N   . ALA C 1 49  ? -27.147 5.213   17.121  1.00 25.83 ? 38   ALA C N   1 
ATOM   3480 C  CA  . ALA C 1 49  ? -26.751 3.861   16.741  1.00 27.94 ? 38   ALA C CA  1 
ATOM   3481 C  C   . ALA C 1 49  ? -25.227 3.861   16.680  1.00 26.60 ? 38   ALA C C   1 
ATOM   3482 O  O   . ALA C 1 49  ? -24.615 4.913   16.817  1.00 30.21 ? 38   ALA C O   1 
ATOM   3483 C  CB  . ALA C 1 49  ? -27.372 3.474   15.392  1.00 25.75 ? 38   ALA C CB  1 
ATOM   3484 N  N   . ARG C 1 50  ? -24.610 2.708   16.480  1.00 26.62 ? 39   ARG C N   1 
ATOM   3485 C  CA  . ARG C 1 50  ? -23.147 2.646   16.448  1.00 25.50 ? 39   ARG C CA  1 
ATOM   3486 C  C   . ARG C 1 50  ? -22.582 3.287   15.189  1.00 24.38 ? 39   ARG C C   1 
ATOM   3487 O  O   . ARG C 1 50  ? -21.581 4.011   15.244  1.00 23.23 ? 39   ARG C O   1 
ATOM   3488 C  CB  . ARG C 1 50  ? -22.640 1.211   16.597  1.00 26.15 ? 39   ARG C CB  1 
ATOM   3489 C  CG  . ARG C 1 50  ? -21.127 1.145   16.643  1.00 26.35 ? 39   ARG C CG  1 
ATOM   3490 C  CD  . ARG C 1 50  ? -20.593 -0.131  17.263  1.00 26.24 ? 39   ARG C CD  1 
ATOM   3491 N  NE  . ARG C 1 50  ? -19.331 0.185   17.945  1.00 27.34 ? 39   ARG C NE  1 
ATOM   3492 C  CZ  . ARG C 1 50  ? -18.623 -0.651  18.702  1.00 27.26 ? 39   ARG C CZ  1 
ATOM   3493 N  NH1 . ARG C 1 50  ? -19.010 -1.912  18.880  1.00 24.14 ? 39   ARG C NH1 1 
ATOM   3494 N  NH2 . ARG C 1 50  ? -17.516 -0.204  19.290  1.00 26.84 ? 39   ARG C NH2 1 
ATOM   3495 N  N   . ASN C 1 51  ? -23.233 3.007   14.063  1.00 22.80 ? 40   ASN C N   1 
ATOM   3496 C  CA  . ASN C 1 51  ? -22.922 3.611   12.788  1.00 22.34 ? 40   ASN C CA  1 
ATOM   3497 C  C   . ASN C 1 51  ? -24.095 3.397   11.859  1.00 22.49 ? 40   ASN C C   1 
ATOM   3498 O  O   . ASN C 1 51  ? -25.106 2.826   12.252  1.00 21.26 ? 40   ASN C O   1 
ATOM   3499 C  CB  . ASN C 1 51  ? -21.638 3.015   12.176  1.00 23.04 ? 40   ASN C CB  1 
ATOM   3500 C  CG  . ASN C 1 51  ? -21.804 1.573   11.746  1.00 24.41 ? 40   ASN C CG  1 
ATOM   3501 O  OD1 . ASN C 1 51  ? -22.840 0.942   11.976  1.00 26.83 ? 40   ASN C OD1 1 
ATOM   3502 N  ND2 . ASN C 1 51  ? -20.782 1.040   11.120  1.00 25.40 ? 40   ASN C ND2 1 
ATOM   3503 N  N   . CYS C 1 52  ? -23.958 3.834   10.610  1.00 23.97 ? 41   CYS C N   1 
ATOM   3504 C  CA  . CYS C 1 52  ? -25.091 3.783   9.704   1.00 24.67 ? 41   CYS C CA  1 
ATOM   3505 C  C   . CYS C 1 52  ? -25.527 2.355   9.350   1.00 24.67 ? 41   CYS C C   1 
ATOM   3506 O  O   . CYS C 1 52  ? -26.730 2.100   9.273   1.00 24.01 ? 41   CYS C O   1 
ATOM   3507 C  CB  . CYS C 1 52  ? -24.870 4.679   8.467   1.00 24.98 ? 41   CYS C CB  1 
ATOM   3508 S  SG  . CYS C 1 52  ? -24.741 6.451   8.897   1.00 26.17 ? 41   CYS C SG  1 
ATOM   3509 N  N   . ARG C 1 53  ? -24.590 1.427   9.141   1.00 24.52 ? 42   ARG C N   1 
ATOM   3510 C  CA  . ARG C 1 53  ? -25.024 0.076   8.816   1.00 26.76 ? 42   ARG C CA  1 
ATOM   3511 C  C   . ARG C 1 53  ? -25.747 -0.556  9.985   1.00 26.88 ? 42   ARG C C   1 
ATOM   3512 O  O   . ARG C 1 53  ? -26.735 -1.240  9.790   1.00 27.24 ? 42   ARG C O   1 
ATOM   3513 C  CB  . ARG C 1 53  ? -23.913 -0.849  8.323   1.00 29.87 ? 42   ARG C CB  1 
ATOM   3514 C  CG  . ARG C 1 53  ? -24.514 -2.010  7.528   1.00 32.14 ? 42   ARG C CG  1 
ATOM   3515 C  CD  . ARG C 1 53  ? -23.455 -2.908  6.952   1.00 33.17 ? 42   ARG C CD  1 
ATOM   3516 N  NE  . ARG C 1 53  ? -22.491 -3.270  7.991   1.00 33.83 ? 42   ARG C NE  1 
ATOM   3517 C  CZ  . ARG C 1 53  ? -21.184 -3.463  7.796   1.00 33.51 ? 42   ARG C CZ  1 
ATOM   3518 N  NH1 . ARG C 1 53  ? -20.648 -3.329  6.594   1.00 31.11 ? 42   ARG C NH1 1 
ATOM   3519 N  NH2 . ARG C 1 53  ? -20.409 -3.779  8.826   1.00 34.42 ? 42   ARG C NH2 1 
ATOM   3520 N  N   . ASP C 1 54  ? -25.259 -0.304  11.192  1.00 27.55 ? 43   ASP C N   1 
ATOM   3521 C  CA  . ASP C 1 54  ? -25.879 -0.795  12.423  1.00 29.82 ? 43   ASP C CA  1 
ATOM   3522 C  C   . ASP C 1 54  ? -27.334 -0.285  12.525  1.00 30.04 ? 43   ASP C C   1 
ATOM   3523 O  O   . ASP C 1 54  ? -28.259 -1.057  12.798  1.00 30.54 ? 43   ASP C O   1 
ATOM   3524 C  CB  . ASP C 1 54  ? -25.020 -0.322  13.605  1.00 30.89 ? 43   ASP C CB  1 
ATOM   3525 C  CG  . ASP C 1 54  ? -25.508 -0.820  14.951  1.00 34.68 ? 43   ASP C CG  1 
ATOM   3526 O  OD1 . ASP C 1 54  ? -25.574 -2.054  15.149  1.00 35.28 ? 43   ASP C OD1 1 
ATOM   3527 O  OD2 . ASP C 1 54  ? -25.774 0.040   15.841  1.00 35.29 ? 43   ASP C OD2 1 
ATOM   3528 N  N   . LEU C 1 55  ? -27.526 1.009   12.271  1.00 28.35 ? 44   LEU C N   1 
ATOM   3529 C  CA  . LEU C 1 55  ? -28.857 1.615   12.250  1.00 29.19 ? 44   LEU C CA  1 
ATOM   3530 C  C   . LEU C 1 55  ? -29.730 0.975   11.174  1.00 29.38 ? 44   LEU C C   1 
ATOM   3531 O  O   . LEU C 1 55  ? -30.871 0.592   11.439  1.00 30.63 ? 44   LEU C O   1 
ATOM   3532 C  CB  . LEU C 1 55  ? -28.760 3.125   11.982  1.00 27.98 ? 44   LEU C CB  1 
ATOM   3533 C  CG  . LEU C 1 55  ? -30.067 3.922   11.922  1.00 26.81 ? 44   LEU C CG  1 
ATOM   3534 C  CD1 . LEU C 1 55  ? -30.755 3.915   13.280  1.00 25.63 ? 44   LEU C CD1 1 
ATOM   3535 C  CD2 . LEU C 1 55  ? -29.764 5.344   11.477  1.00 27.97 ? 44   LEU C CD2 1 
ATOM   3536 N  N   . LYS C 1 56  ? -29.192 0.870   9.963   1.00 28.95 ? 45   LYS C N   1 
ATOM   3537 C  CA  . LYS C 1 56  ? -29.907 0.236   8.866   1.00 32.61 ? 45   LYS C CA  1 
ATOM   3538 C  C   . LYS C 1 56  ? -30.348 -1.189  9.249   1.00 35.95 ? 45   LYS C C   1 
ATOM   3539 O  O   . LYS C 1 56  ? -31.515 -1.541  9.108   1.00 37.02 ? 45   LYS C O   1 
ATOM   3540 C  CB  . LYS C 1 56  ? -29.051 0.220   7.607   1.00 33.43 ? 45   LYS C CB  1 
ATOM   3541 C  CG  . LYS C 1 56  ? -29.749 -0.441  6.434   1.00 34.57 ? 45   LYS C CG  1 
ATOM   3542 C  CD  . LYS C 1 56  ? -28.833 -0.581  5.228   1.00 33.84 ? 45   LYS C CD  1 
ATOM   3543 C  CE  . LYS C 1 56  ? -29.536 -1.446  4.195   1.00 34.63 ? 45   LYS C CE  1 
ATOM   3544 N  NZ  . LYS C 1 56  ? -28.997 -1.202  2.835   1.00 36.99 ? 45   LYS C NZ  1 
ATOM   3545 N  N   . PHE C 1 57  ? -29.418 -1.989  9.770   1.00 35.78 ? 46   PHE C N   1 
ATOM   3546 C  CA  . PHE C 1 57  ? -29.737 -3.308  10.309  1.00 34.24 ? 46   PHE C CA  1 
ATOM   3547 C  C   . PHE C 1 57  ? -30.846 -3.322  11.372  1.00 34.71 ? 46   PHE C C   1 
ATOM   3548 O  O   . PHE C 1 57  ? -31.698 -4.209  11.374  1.00 36.18 ? 46   PHE C O   1 
ATOM   3549 C  CB  . PHE C 1 57  ? -28.472 -3.971  10.871  1.00 35.94 ? 46   PHE C CB  1 
ATOM   3550 C  CG  . PHE C 1 57  ? -28.062 -5.208  10.132  1.00 35.00 ? 46   PHE C CG  1 
ATOM   3551 C  CD1 . PHE C 1 57  ? -28.713 -6.406  10.359  1.00 33.73 ? 46   PHE C CD1 1 
ATOM   3552 C  CD2 . PHE C 1 57  ? -27.040 -5.170  9.207   1.00 35.55 ? 46   PHE C CD2 1 
ATOM   3553 C  CE1 . PHE C 1 57  ? -28.349 -7.554  9.683   1.00 34.54 ? 46   PHE C CE1 1 
ATOM   3554 C  CE2 . PHE C 1 57  ? -26.673 -6.313  8.515   1.00 34.43 ? 46   PHE C CE2 1 
ATOM   3555 C  CZ  . PHE C 1 57  ? -27.327 -7.509  8.760   1.00 33.75 ? 46   PHE C CZ  1 
ATOM   3556 N  N   . CYS C 1 58  ? -30.849 -2.364  12.288  1.00 33.57 ? 47   CYS C N   1 
ATOM   3557 C  CA  . CYS C 1 58  ? -31.857 -2.413  13.357  1.00 33.92 ? 47   CYS C CA  1 
ATOM   3558 C  C   . CYS C 1 58  ? -33.178 -1.721  12.966  1.00 34.10 ? 47   CYS C C   1 
ATOM   3559 O  O   . CYS C 1 58  ? -34.227 -2.035  13.515  1.00 35.24 ? 47   CYS C O   1 
ATOM   3560 C  CB  . CYS C 1 58  ? -31.289 -1.896  14.688  1.00 33.38 ? 47   CYS C CB  1 
ATOM   3561 S  SG  . CYS C 1 58  ? -30.810 -3.170  15.903  1.00 35.23 ? 47   CYS C SG  1 
ATOM   3562 N  N   . HIS C 1 59  ? -33.115 -0.798  12.007  1.00 35.53 ? 48   HIS C N   1 
ATOM   3563 C  CA  . HIS C 1 59  ? -34.305 -0.107  11.474  1.00 35.15 ? 48   HIS C CA  1 
ATOM   3564 C  C   . HIS C 1 59  ? -34.223 0.038   9.980   1.00 33.33 ? 48   HIS C C   1 
ATOM   3565 O  O   . HIS C 1 59  ? -33.991 1.147   9.468   1.00 30.65 ? 48   HIS C O   1 
ATOM   3566 C  CB  . HIS C 1 59  ? -34.476 1.263   12.120  1.00 34.94 ? 48   HIS C CB  1 
ATOM   3567 C  CG  . HIS C 1 59  ? -34.843 1.202   13.567  1.00 36.01 ? 48   HIS C CG  1 
ATOM   3568 N  ND1 . HIS C 1 59  ? -33.956 1.436   14.541  1.00 37.75 ? 48   HIS C ND1 1 
ATOM   3569 C  CD2 . HIS C 1 59  ? -36.050 0.903   14.195  1.00 37.60 ? 48   HIS C CD2 1 
ATOM   3570 C  CE1 . HIS C 1 59  ? -34.556 1.301   15.744  1.00 37.72 ? 48   HIS C CE1 1 
ATOM   3571 N  NE2 . HIS C 1 59  ? -35.838 0.974   15.531  1.00 38.46 ? 48   HIS C NE2 1 
ATOM   3572 N  N   . PRO C 1 60  ? -34.434 -1.077  9.248   1.00 34.86 ? 49   PRO C N   1 
ATOM   3573 C  CA  . PRO C 1 60  ? -34.197 -1.069  7.792   1.00 33.48 ? 49   PRO C CA  1 
ATOM   3574 C  C   . PRO C 1 60  ? -35.235 -0.261  7.013   1.00 33.28 ? 49   PRO C C   1 
ATOM   3575 O  O   . PRO C 1 60  ? -35.027 0.007   5.840   1.00 33.87 ? 49   PRO C O   1 
ATOM   3576 C  CB  . PRO C 1 60  ? -34.218 -2.556  7.415   1.00 33.49 ? 49   PRO C CB  1 
ATOM   3577 C  CG  . PRO C 1 60  ? -35.051 -3.215  8.473   1.00 34.23 ? 49   PRO C CG  1 
ATOM   3578 C  CD  . PRO C 1 60  ? -35.060 -2.338  9.706   1.00 35.30 ? 49   PRO C CD  1 
ATOM   3579 N  N   . GLU C 1 61  ? -36.318 0.159   7.663   1.00 35.44 ? 50   GLU C N   1 
ATOM   3580 C  CA  . GLU C 1 61  ? -37.293 1.049   7.008   1.00 40.45 ? 50   GLU C CA  1 
ATOM   3581 C  C   . GLU C 1 61  ? -36.785 2.498   6.870   1.00 41.61 ? 50   GLU C C   1 
ATOM   3582 O  O   . GLU C 1 61  ? -37.244 3.224   5.988   1.00 43.30 ? 50   GLU C O   1 
ATOM   3583 C  CB  . GLU C 1 61  ? -38.657 1.009   7.717   1.00 41.87 ? 50   GLU C CB  1 
ATOM   3584 C  CG  . GLU C 1 61  ? -38.749 1.789   9.028   1.00 46.54 ? 50   GLU C CG  1 
ATOM   3585 C  CD  . GLU C 1 61  ? -37.881 1.216   10.151  1.00 50.90 ? 50   GLU C CD  1 
ATOM   3586 O  OE1 . GLU C 1 61  ? -37.271 0.130   9.968   1.00 48.13 ? 50   GLU C OE1 1 
ATOM   3587 O  OE2 . GLU C 1 61  ? -37.815 1.854   11.229  1.00 52.80 ? 50   GLU C OE2 1 
ATOM   3588 N  N   . LEU C 1 62  ? -35.830 2.900   7.719   1.00 39.31 ? 51   LEU C N   1 
ATOM   3589 C  CA  . LEU C 1 62  ? -35.304 4.279   7.722   1.00 37.64 ? 51   LEU C CA  1 
ATOM   3590 C  C   . LEU C 1 62  ? -34.645 4.673   6.414   1.00 37.91 ? 51   LEU C C   1 
ATOM   3591 O  O   . LEU C 1 62  ? -33.922 3.881   5.814   1.00 38.09 ? 51   LEU C O   1 
ATOM   3592 C  CB  . LEU C 1 62  ? -34.305 4.505   8.870   1.00 34.57 ? 51   LEU C CB  1 
ATOM   3593 C  CG  . LEU C 1 62  ? -34.889 4.649   10.277  1.00 35.59 ? 51   LEU C CG  1 
ATOM   3594 C  CD1 . LEU C 1 62  ? -33.786 4.777   11.323  1.00 36.07 ? 51   LEU C CD1 1 
ATOM   3595 C  CD2 . LEU C 1 62  ? -35.828 5.841   10.374  1.00 35.50 ? 51   LEU C CD2 1 
ATOM   3596 N  N   . LYS C 1 63  ? -34.884 5.912   5.992   1.00 38.49 ? 52   LYS C N   1 
ATOM   3597 C  CA  . LYS C 1 63  ? -34.285 6.442   4.768   1.00 37.44 ? 52   LYS C CA  1 
ATOM   3598 C  C   . LYS C 1 63  ? -33.052 7.265   5.056   1.00 35.71 ? 52   LYS C C   1 
ATOM   3599 O  O   . LYS C 1 63  ? -32.805 7.685   6.197   1.00 34.63 ? 52   LYS C O   1 
ATOM   3600 C  CB  . LYS C 1 63  ? -35.293 7.293   3.992   1.00 42.21 ? 52   LYS C CB  1 
ATOM   3601 C  CG  . LYS C 1 63  ? -36.315 6.466   3.232   1.00 47.02 ? 52   LYS C CG  1 
ATOM   3602 C  CD  . LYS C 1 63  ? -37.424 7.334   2.666   1.00 51.22 ? 52   LYS C CD  1 
ATOM   3603 C  CE  . LYS C 1 63  ? -38.456 6.479   1.948   1.00 55.73 ? 52   LYS C CE  1 
ATOM   3604 N  NZ  . LYS C 1 63  ? -39.107 5.520   2.884   1.00 58.48 ? 52   LYS C NZ  1 
ATOM   3605 N  N   . SER C 1 64  ? -32.276 7.477   4.003   1.00 34.88 ? 53   SER C N   1 
ATOM   3606 C  CA  . SER C 1 64  ? -31.072 8.283   4.048   1.00 36.05 ? 53   SER C CA  1 
ATOM   3607 C  C   . SER C 1 64  ? -31.360 9.659   4.607   1.00 37.34 ? 53   SER C C   1 
ATOM   3608 O  O   . SER C 1 64  ? -32.480 10.146  4.505   1.00 34.37 ? 53   SER C O   1 
ATOM   3609 C  CB  . SER C 1 64  ? -30.468 8.417   2.652   1.00 33.29 ? 53   SER C CB  1 
ATOM   3610 O  OG  . SER C 1 64  ? -30.243 7.138   2.100   1.00 33.75 ? 53   SER C OG  1 
ATOM   3611 N  N   . GLY C 1 65  ? -30.325 10.276  5.179   1.00 39.21 ? 54   GLY C N   1 
ATOM   3612 C  CA  . GLY C 1 65  ? -30.439 11.566  5.843   1.00 39.72 ? 54   GLY C CA  1 
ATOM   3613 C  C   . GLY C 1 65  ? -29.524 11.651  7.046   1.00 40.45 ? 54   GLY C C   1 
ATOM   3614 O  O   . GLY C 1 65  ? -28.621 10.820  7.217   1.00 43.25 ? 54   GLY C O   1 
ATOM   3615 N  N   . GLU C 1 66  ? -29.774 12.649  7.889   1.00 39.20 ? 55   GLU C N   1 
ATOM   3616 C  CA  . GLU C 1 66  ? -28.911 12.952  9.029   1.00 36.70 ? 55   GLU C CA  1 
ATOM   3617 C  C   . GLU C 1 66  ? -29.277 12.128  10.231  1.00 33.44 ? 55   GLU C C   1 
ATOM   3618 O  O   . GLU C 1 66  ? -30.450 12.051  10.624  1.00 31.28 ? 55   GLU C O   1 
ATOM   3619 C  CB  . GLU C 1 66  ? -28.995 14.431  9.410   1.00 40.85 ? 55   GLU C CB  1 
ATOM   3620 C  CG  . GLU C 1 66  ? -28.513 15.393  8.336   1.00 47.43 ? 55   GLU C CG  1 
ATOM   3621 C  CD  . GLU C 1 66  ? -27.004 15.531  8.301   1.00 50.84 ? 55   GLU C CD  1 
ATOM   3622 O  OE1 . GLU C 1 66  ? -26.321 14.540  7.966   1.00 49.08 ? 55   GLU C OE1 1 
ATOM   3623 O  OE2 . GLU C 1 66  ? -26.505 16.638  8.618   1.00 56.40 ? 55   GLU C OE2 1 
ATOM   3624 N  N   . TYR C 1 67  ? -28.267 11.507  10.826  1.00 30.60 ? 56   TYR C N   1 
ATOM   3625 C  CA  . TYR C 1 67  ? -28.497 10.707  12.023  1.00 29.66 ? 56   TYR C CA  1 
ATOM   3626 C  C   . TYR C 1 67  ? -27.364 10.894  13.011  1.00 26.96 ? 56   TYR C C   1 
ATOM   3627 O  O   . TYR C 1 67  ? -26.285 11.341  12.650  1.00 26.42 ? 56   TYR C O   1 
ATOM   3628 C  CB  . TYR C 1 67  ? -28.681 9.226   11.667  1.00 28.68 ? 56   TYR C CB  1 
ATOM   3629 C  CG  . TYR C 1 67  ? -29.939 8.922   10.879  1.00 29.05 ? 56   TYR C CG  1 
ATOM   3630 C  CD1 . TYR C 1 67  ? -31.148 8.632   11.529  1.00 29.74 ? 56   TYR C CD1 1 
ATOM   3631 C  CD2 . TYR C 1 67  ? -29.922 8.925   9.489   1.00 28.43 ? 56   TYR C CD2 1 
ATOM   3632 C  CE1 . TYR C 1 67  ? -32.301 8.355   10.807  1.00 29.59 ? 56   TYR C CE1 1 
ATOM   3633 C  CE2 . TYR C 1 67  ? -31.055 8.644   8.757   1.00 27.88 ? 56   TYR C CE2 1 
ATOM   3634 C  CZ  . TYR C 1 67  ? -32.237 8.361   9.410   1.00 30.48 ? 56   TYR C CZ  1 
ATOM   3635 O  OH  . TYR C 1 67  ? -33.357 8.074   8.658   1.00 31.91 ? 56   TYR C OH  1 
ATOM   3636 N  N   . TRP C 1 68  ? -27.633 10.598  14.271  1.00 27.35 ? 57   TRP C N   1 
ATOM   3637 C  CA  . TRP C 1 68  ? -26.580 10.584  15.273  1.00 28.01 ? 57   TRP C CA  1 
ATOM   3638 C  C   . TRP C 1 68  ? -26.060 9.171   15.415  1.00 27.25 ? 57   TRP C C   1 
ATOM   3639 O  O   . TRP C 1 68  ? -26.843 8.234   15.607  1.00 27.30 ? 57   TRP C O   1 
ATOM   3640 C  CB  . TRP C 1 68  ? -27.095 11.154  16.593  1.00 31.07 ? 57   TRP C CB  1 
ATOM   3641 C  CG  . TRP C 1 68  ? -27.346 12.648  16.512  1.00 32.81 ? 57   TRP C CG  1 
ATOM   3642 C  CD1 . TRP C 1 68  ? -28.466 13.295  15.984  1.00 33.02 ? 57   TRP C CD1 1 
ATOM   3643 C  CD2 . TRP C 1 68  ? -26.451 13.729  16.944  1.00 33.67 ? 57   TRP C CD2 1 
ATOM   3644 N  NE1 . TRP C 1 68  ? -28.326 14.662  16.067  1.00 35.43 ? 57   TRP C NE1 1 
ATOM   3645 C  CE2 . TRP C 1 68  ? -27.149 14.990  16.636  1.00 34.18 ? 57   TRP C CE2 1 
ATOM   3646 C  CE3 . TRP C 1 68  ? -25.185 13.782  17.541  1.00 34.23 ? 57   TRP C CE3 1 
ATOM   3647 C  CZ2 . TRP C 1 68  ? -26.589 16.232  16.922  1.00 33.98 ? 57   TRP C CZ2 1 
ATOM   3648 C  CZ3 . TRP C 1 68  ? -24.634 15.047  17.830  1.00 34.50 ? 57   TRP C CZ3 1 
ATOM   3649 C  CH2 . TRP C 1 68  ? -25.318 16.238  17.523  1.00 33.95 ? 57   TRP C CH2 1 
ATOM   3650 N  N   . VAL C 1 69  ? -24.744 9.006   15.265  1.00 25.07 ? 58   VAL C N   1 
ATOM   3651 C  CA  . VAL C 1 69  ? -24.082 7.710   15.502  1.00 24.64 ? 58   VAL C CA  1 
ATOM   3652 C  C   . VAL C 1 69  ? -22.980 7.852   16.540  1.00 24.64 ? 58   VAL C C   1 
ATOM   3653 O  O   . VAL C 1 69  ? -22.457 8.952   16.740  1.00 25.88 ? 58   VAL C O   1 
ATOM   3654 C  CB  . VAL C 1 69  ? -23.526 7.059   14.207  1.00 22.75 ? 58   VAL C CB  1 
ATOM   3655 C  CG1 . VAL C 1 69  ? -24.642 6.846   13.181  1.00 22.05 ? 58   VAL C CG1 1 
ATOM   3656 C  CG2 . VAL C 1 69  ? -22.415 7.894   13.609  1.00 21.83 ? 58   VAL C CG2 1 
ATOM   3657 N  N   . ASP C 1 70  ? -22.623 6.740   17.184  1.00 23.82 ? 59   ASP C N   1 
ATOM   3658 C  CA  . ASP C 1 70  ? -21.665 6.755   18.293  1.00 23.02 ? 59   ASP C CA  1 
ATOM   3659 C  C   . ASP C 1 70  ? -20.692 5.569   18.201  1.00 21.82 ? 59   ASP C C   1 
ATOM   3660 O  O   . ASP C 1 70  ? -20.829 4.583   18.935  1.00 21.54 ? 59   ASP C O   1 
ATOM   3661 C  CB  . ASP C 1 70  ? -22.423 6.723   19.633  1.00 22.68 ? 59   ASP C CB  1 
ATOM   3662 C  CG  . ASP C 1 70  ? -21.513 6.991   20.813  1.00 23.51 ? 59   ASP C CG  1 
ATOM   3663 O  OD1 . ASP C 1 70  ? -20.522 7.719   20.625  1.00 24.37 ? 59   ASP C OD1 1 
ATOM   3664 O  OD2 . ASP C 1 70  ? -21.775 6.483   21.927  1.00 24.95 ? 59   ASP C OD2 1 
ATOM   3665 N  N   . PRO C 1 71  ? -19.718 5.656   17.292  1.00 21.04 ? 60   PRO C N   1 
ATOM   3666 C  CA  . PRO C 1 71  ? -18.875 4.503   16.975  1.00 21.32 ? 60   PRO C CA  1 
ATOM   3667 C  C   . PRO C 1 71  ? -18.167 3.895   18.189  1.00 23.42 ? 60   PRO C C   1 
ATOM   3668 O  O   . PRO C 1 71  ? -18.054 2.669   18.285  1.00 22.88 ? 60   PRO C O   1 
ATOM   3669 C  CB  . PRO C 1 71  ? -17.846 5.067   15.984  1.00 21.18 ? 60   PRO C CB  1 
ATOM   3670 C  CG  . PRO C 1 71  ? -18.447 6.312   15.434  1.00 21.52 ? 60   PRO C CG  1 
ATOM   3671 C  CD  . PRO C 1 71  ? -19.478 6.807   16.400  1.00 20.67 ? 60   PRO C CD  1 
ATOM   3672 N  N   . ASN C 1 72  ? -17.633 4.726   19.059  1.00 24.03 ? 61   ASN C N   1 
ATOM   3673 C  CA  . ASN C 1 72  ? -16.982 4.271   20.256  1.00 23.90 ? 61   ASN C CA  1 
ATOM   3674 C  C   . ASN C 1 72  ? -17.901 3.749   21.347  1.00 24.29 ? 61   ASN C C   1 
ATOM   3675 O  O   . ASN C 1 72  ? -17.441 3.283   22.304  1.00 24.17 ? 61   ASN C O   1 
ATOM   3676 C  CB  . ASN C 1 72  ? -16.040 5.352   20.815  1.00 23.46 ? 61   ASN C CB  1 
ATOM   3677 C  CG  . ASN C 1 72  ? -16.760 6.549   21.453  1.00 23.29 ? 61   ASN C CG  1 
ATOM   3678 O  OD1 . ASN C 1 72  ? -17.933 6.565   21.659  1.00 22.52 ? 61   ASN C OD1 1 
ATOM   3679 N  ND2 . ASN C 1 72  ? -16.002 7.523   21.795  1.00 22.22 ? 61   ASN C ND2 1 
ATOM   3680 N  N   . GLN C 1 73  ? -19.207 3.914   21.194  1.00 25.09 ? 62   GLN C N   1 
ATOM   3681 C  CA  . GLN C 1 73  ? -20.183 3.435   22.180  1.00 25.40 ? 62   GLN C CA  1 
ATOM   3682 C  C   . GLN C 1 73  ? -19.958 3.981   23.606  1.00 25.77 ? 62   GLN C C   1 
ATOM   3683 O  O   . GLN C 1 73  ? -19.604 5.130   23.767  1.00 25.78 ? 62   GLN C O   1 
ATOM   3684 C  CB  . GLN C 1 73  ? -20.286 1.905   22.160  1.00 24.17 ? 62   GLN C CB  1 
ATOM   3685 C  CG  . GLN C 1 73  ? -20.746 1.330   20.832  1.00 24.20 ? 62   GLN C CG  1 
ATOM   3686 C  CD  . GLN C 1 73  ? -22.229 1.530   20.569  1.00 24.24 ? 62   GLN C CD  1 
ATOM   3687 O  OE1 . GLN C 1 73  ? -23.041 0.677   20.879  1.00 22.46 ? 62   GLN C OE1 1 
ATOM   3688 N  NE2 . GLN C 1 73  ? -22.577 2.661   19.987  1.00 23.89 ? 62   GLN C NE2 1 
ATOM   3689 N  N   . GLY C 1 74  ? -20.138 3.155   24.632  1.00 27.56 ? 63   GLY C N   1 
ATOM   3690 C  CA  . GLY C 1 74  ? -20.026 3.657   26.005  1.00 29.44 ? 63   GLY C CA  1 
ATOM   3691 C  C   . GLY C 1 74  ? -20.913 4.879   26.173  1.00 29.48 ? 63   GLY C C   1 
ATOM   3692 O  O   . GLY C 1 74  ? -22.086 4.845   25.792  1.00 29.56 ? 63   GLY C O   1 
ATOM   3693 N  N   . CYS C 1 75  ? -20.348 5.962   26.711  1.00 31.16 ? 64   CYS C N   1 
ATOM   3694 C  CA  . CYS C 1 75  ? -21.078 7.228   26.899  1.00 31.73 ? 64   CYS C CA  1 
ATOM   3695 C  C   . CYS C 1 75  ? -21.729 7.725   25.591  1.00 33.27 ? 64   CYS C C   1 
ATOM   3696 O  O   . CYS C 1 75  ? -21.050 7.880   24.560  1.00 33.55 ? 64   CYS C O   1 
ATOM   3697 C  CB  . CYS C 1 75  ? -20.151 8.299   27.486  1.00 33.62 ? 64   CYS C CB  1 
ATOM   3698 S  SG  . CYS C 1 75  ? -20.937 9.854   28.021  1.00 33.77 ? 64   CYS C SG  1 
ATOM   3699 N  N   . LYS C 1 76  ? -23.039 7.970   25.642  1.00 33.76 ? 65   LYS C N   1 
ATOM   3700 C  CA  . LYS C 1 76  ? -23.792 8.488   24.486  1.00 35.40 ? 65   LYS C CA  1 
ATOM   3701 C  C   . LYS C 1 76  ? -23.504 9.963   24.159  1.00 33.75 ? 65   LYS C C   1 
ATOM   3702 O  O   . LYS C 1 76  ? -23.820 10.424  23.057  1.00 33.92 ? 65   LYS C O   1 
ATOM   3703 C  CB  . LYS C 1 76  ? -25.308 8.314   24.686  1.00 38.86 ? 65   LYS C CB  1 
ATOM   3704 C  CG  . LYS C 1 76  ? -25.753 6.952   25.205  1.00 42.84 ? 65   LYS C CG  1 
ATOM   3705 C  CD  . LYS C 1 76  ? -27.272 6.872   25.263  1.00 46.67 ? 65   LYS C CD  1 
ATOM   3706 C  CE  . LYS C 1 76  ? -27.772 5.958   26.377  1.00 51.09 ? 65   LYS C CE  1 
ATOM   3707 N  NZ  . LYS C 1 76  ? -27.472 4.516   26.134  1.00 52.01 ? 65   LYS C NZ  1 
ATOM   3708 N  N   . LEU C 1 77  ? -22.904 10.695  25.096  1.00 31.02 ? 66   LEU C N   1 
ATOM   3709 C  CA  . LEU C 1 77  ? -22.769 12.157  24.966  1.00 31.32 ? 66   LEU C CA  1 
ATOM   3710 C  C   . LEU C 1 77  ? -21.754 12.650  23.918  1.00 30.51 ? 66   LEU C C   1 
ATOM   3711 O  O   . LEU C 1 77  ? -21.812 13.803  23.486  1.00 32.26 ? 66   LEU C O   1 
ATOM   3712 C  CB  . LEU C 1 77  ? -22.497 12.809  26.328  1.00 31.07 ? 66   LEU C CB  1 
ATOM   3713 C  CG  . LEU C 1 77  ? -23.465 12.526  27.485  1.00 33.16 ? 66   LEU C CG  1 
ATOM   3714 C  CD1 . LEU C 1 77  ? -22.960 13.214  28.746  1.00 34.30 ? 66   LEU C CD1 1 
ATOM   3715 C  CD2 . LEU C 1 77  ? -24.894 12.959  27.185  1.00 32.55 ? 66   LEU C CD2 1 
ATOM   3716 N  N   . ASP C 1 78  ? -20.837 11.795  23.486  1.00 28.26 ? 67   ASP C N   1 
ATOM   3717 C  CA  . ASP C 1 78  ? -19.907 12.231  22.437  1.00 27.19 ? 67   ASP C CA  1 
ATOM   3718 C  C   . ASP C 1 78  ? -20.320 11.751  21.045  1.00 26.47 ? 67   ASP C C   1 
ATOM   3719 O  O   . ASP C 1 78  ? -19.465 11.647  20.157  1.00 25.05 ? 67   ASP C O   1 
ATOM   3720 C  CB  . ASP C 1 78  ? -18.472 11.785  22.738  1.00 27.53 ? 67   ASP C CB  1 
ATOM   3721 C  CG  . ASP C 1 78  ? -18.339 10.260  22.875  1.00 28.68 ? 67   ASP C CG  1 
ATOM   3722 O  OD1 . ASP C 1 78  ? -19.351 9.521   22.722  1.00 28.00 ? 67   ASP C OD1 1 
ATOM   3723 O  OD2 . ASP C 1 78  ? -17.213 9.793   23.164  1.00 28.12 ? 67   ASP C OD2 1 
ATOM   3724 N  N   . ALA C 1 79  ? -21.617 11.478  20.844  1.00 25.64 ? 68   ALA C N   1 
ATOM   3725 C  CA  . ALA C 1 79  ? -22.095 11.021  19.524  1.00 25.34 ? 68   ALA C CA  1 
ATOM   3726 C  C   . ALA C 1 79  ? -21.825 12.074  18.472  1.00 26.00 ? 68   ALA C C   1 
ATOM   3727 O  O   . ALA C 1 79  ? -21.678 13.254  18.791  1.00 26.46 ? 68   ALA C O   1 
ATOM   3728 C  CB  . ALA C 1 79  ? -23.566 10.667  19.556  1.00 23.75 ? 68   ALA C CB  1 
ATOM   3729 N  N   . ILE C 1 80  ? -21.727 11.632  17.223  1.00 26.51 ? 69   ILE C N   1 
ATOM   3730 C  CA  . ILE C 1 80  ? -21.481 12.513  16.094  1.00 26.53 ? 69   ILE C CA  1 
ATOM   3731 C  C   . ILE C 1 80  ? -22.656 12.466  15.123  1.00 27.52 ? 69   ILE C C   1 
ATOM   3732 O  O   . ILE C 1 80  ? -23.306 11.428  14.947  1.00 27.54 ? 69   ILE C O   1 
ATOM   3733 C  CB  . ILE C 1 80  ? -20.173 12.163  15.339  1.00 27.21 ? 69   ILE C CB  1 
ATOM   3734 C  CG1 . ILE C 1 80  ? -20.143 10.686  14.895  1.00 25.25 ? 69   ILE C CG1 1 
ATOM   3735 C  CG2 . ILE C 1 80  ? -18.955 12.491  16.198  1.00 28.48 ? 69   ILE C CG2 1 
ATOM   3736 C  CD1 . ILE C 1 80  ? -19.002 10.381  13.950  1.00 23.98 ? 69   ILE C CD1 1 
ATOM   3737 N  N   . LYS C 1 81  ? -22.925 13.600  14.498  1.00 28.75 ? 70   LYS C N   1 
ATOM   3738 C  CA  . LYS C 1 81  ? -24.011 13.710  13.557  1.00 30.49 ? 70   LYS C CA  1 
ATOM   3739 C  C   . LYS C 1 81  ? -23.420 13.398  12.204  1.00 30.25 ? 70   LYS C C   1 
ATOM   3740 O  O   . LYS C 1 81  ? -22.385 13.943  11.834  1.00 29.89 ? 70   LYS C O   1 
ATOM   3741 C  CB  . LYS C 1 81  ? -24.593 15.118  13.589  1.00 33.19 ? 70   LYS C CB  1 
ATOM   3742 C  CG  . LYS C 1 81  ? -25.953 15.279  12.920  1.00 36.97 ? 70   LYS C CG  1 
ATOM   3743 C  CD  . LYS C 1 81  ? -26.532 16.636  13.312  1.00 40.32 ? 70   LYS C CD  1 
ATOM   3744 C  CE  . LYS C 1 81  ? -27.662 17.102  12.406  1.00 45.52 ? 70   LYS C CE  1 
ATOM   3745 N  NZ  . LYS C 1 81  ? -27.894 18.573  12.578  1.00 46.93 ? 70   LYS C NZ  1 
ATOM   3746 N  N   . VAL C 1 82  ? -24.057 12.482  11.483  1.00 29.18 ? 71   VAL C N   1 
ATOM   3747 C  CA  . VAL C 1 82  ? -23.553 12.071  10.190  1.00 30.14 ? 71   VAL C CA  1 
ATOM   3748 C  C   . VAL C 1 82  ? -24.687 11.977  9.187   1.00 29.73 ? 71   VAL C C   1 
ATOM   3749 O  O   . VAL C 1 82  ? -25.875 12.046  9.545   1.00 30.06 ? 71   VAL C O   1 
ATOM   3750 C  CB  . VAL C 1 82  ? -22.836 10.690  10.259  1.00 29.06 ? 71   VAL C CB  1 
ATOM   3751 C  CG1 . VAL C 1 82  ? -21.750 10.680  11.335  1.00 28.99 ? 71   VAL C CG1 1 
ATOM   3752 C  CG2 . VAL C 1 82  ? -23.844 9.581   10.496  1.00 27.62 ? 71   VAL C CG2 1 
ATOM   3753 N  N   . PHE C 1 83  ? -24.296 11.775  7.938   1.00 29.83 ? 72   PHE C N   1 
ATOM   3754 C  CA  . PHE C 1 83  ? -25.220 11.389  6.896   1.00 30.37 ? 72   PHE C CA  1 
ATOM   3755 C  C   . PHE C 1 83  ? -25.155 9.878   6.626   1.00 28.33 ? 72   PHE C C   1 
ATOM   3756 O  O   . PHE C 1 83  ? -24.102 9.334   6.312   1.00 27.59 ? 72   PHE C O   1 
ATOM   3757 C  CB  . PHE C 1 83  ? -24.936 12.175  5.616   1.00 30.94 ? 72   PHE C CB  1 
ATOM   3758 C  CG  . PHE C 1 83  ? -25.830 11.792  4.466   1.00 33.24 ? 72   PHE C CG  1 
ATOM   3759 C  CD1 . PHE C 1 83  ? -27.126 12.306  4.373   1.00 35.08 ? 72   PHE C CD1 1 
ATOM   3760 C  CD2 . PHE C 1 83  ? -25.379 10.909  3.480   1.00 33.28 ? 72   PHE C CD2 1 
ATOM   3761 C  CE1 . PHE C 1 83  ? -27.953 11.946  3.314   1.00 35.18 ? 72   PHE C CE1 1 
ATOM   3762 C  CE2 . PHE C 1 83  ? -26.201 10.546  2.429   1.00 35.20 ? 72   PHE C CE2 1 
ATOM   3763 C  CZ  . PHE C 1 83  ? -27.491 11.064  2.348   1.00 35.92 ? 72   PHE C CZ  1 
ATOM   3764 N  N   . CYS C 1 84  ? -26.297 9.218   6.756   1.00 29.06 ? 73   CYS C N   1 
ATOM   3765 C  CA  . CYS C 1 84  ? -26.407 7.791   6.501   1.00 28.83 ? 73   CYS C CA  1 
ATOM   3766 C  C   . CYS C 1 84  ? -27.032 7.623   5.134   1.00 30.21 ? 73   CYS C C   1 
ATOM   3767 O  O   . CYS C 1 84  ? -28.170 8.030   4.929   1.00 29.38 ? 73   CYS C O   1 
ATOM   3768 C  CB  . CYS C 1 84  ? -27.310 7.134   7.539   1.00 27.80 ? 73   CYS C CB  1 
ATOM   3769 S  SG  . CYS C 1 84  ? -26.652 7.048   9.211   1.00 25.08 ? 73   CYS C SG  1 
ATOM   3770 N  N   . ASN C 1 85  ? -26.269 7.073   4.197   1.00 31.76 ? 74   ASN C N   1 
ATOM   3771 C  CA  . ASN C 1 85  ? -26.821 6.582   2.940   1.00 34.62 ? 74   ASN C CA  1 
ATOM   3772 C  C   . ASN C 1 85  ? -27.439 5.202   3.184   1.00 34.55 ? 74   ASN C C   1 
ATOM   3773 O  O   . ASN C 1 85  ? -26.716 4.203   3.260   1.00 35.08 ? 74   ASN C O   1 
ATOM   3774 C  CB  . ASN C 1 85  ? -25.726 6.507   1.861   1.00 34.78 ? 74   ASN C CB  1 
ATOM   3775 C  CG  . ASN C 1 85  ? -26.208 5.838   0.562   1.00 38.37 ? 74   ASN C CG  1 
ATOM   3776 O  OD1 . ASN C 1 85  ? -27.260 5.191   0.516   1.00 39.65 ? 74   ASN C OD1 1 
ATOM   3777 N  ND2 . ASN C 1 85  ? -25.419 5.983   -0.495  1.00 38.92 ? 74   ASN C ND2 1 
HETATM 3778 N  N   . MSE C 1 86  ? -28.764 5.158   3.321   1.00 34.51 ? 75   MSE C N   1 
HETATM 3779 C  CA  . MSE C 1 86  ? -29.468 3.930   3.725   1.00 37.75 ? 75   MSE C CA  1 
HETATM 3780 C  C   . MSE C 1 86  ? -29.630 2.916   2.623   1.00 38.12 ? 75   MSE C C   1 
HETATM 3781 O  O   . MSE C 1 86  ? -30.105 1.811   2.866   1.00 41.74 ? 75   MSE C O   1 
HETATM 3782 C  CB  . MSE C 1 86  ? -30.804 4.219   4.415   1.00 38.42 ? 75   MSE C CB  1 
HETATM 3783 C  CG  . MSE C 1 86  ? -30.598 4.953   5.738   1.00 43.35 ? 75   MSE C CG  1 
HETATM 3784 SE SE  . MSE C 1 86  ? -29.534 3.934   7.074   1.00 50.39 ? 75   MSE C SE  1 
HETATM 3785 C  CE  . MSE C 1 86  ? -27.740 4.030   6.300   1.00 44.61 ? 75   MSE C CE  1 
ATOM   3786 N  N   . GLU C 1 87  ? -29.234 3.266   1.408   1.00 40.51 ? 76   GLU C N   1 
ATOM   3787 C  CA  . GLU C 1 87  ? -29.194 2.290   0.321   1.00 42.26 ? 76   GLU C CA  1 
ATOM   3788 C  C   . GLU C 1 87  ? -27.955 1.414   0.502   1.00 44.74 ? 76   GLU C C   1 
ATOM   3789 O  O   . GLU C 1 87  ? -28.069 0.186   0.560   1.00 44.38 ? 76   GLU C O   1 
ATOM   3790 C  CB  . GLU C 1 87  ? -29.191 2.976   -1.049  1.00 39.50 ? 76   GLU C CB  1 
ATOM   3791 N  N   . THR C 1 88  ? -26.789 2.053   0.645   1.00 44.00 ? 77   THR C N   1 
ATOM   3792 C  CA  . THR C 1 88  ? -25.510 1.339   0.740   1.00 43.80 ? 77   THR C CA  1 
ATOM   3793 C  C   . THR C 1 88  ? -25.055 1.025   2.163   1.00 40.76 ? 77   THR C C   1 
ATOM   3794 O  O   . THR C 1 88  ? -24.179 0.191   2.358   1.00 43.09 ? 77   THR C O   1 
ATOM   3795 C  CB  . THR C 1 88  ? -24.367 2.111   0.051   1.00 44.68 ? 77   THR C CB  1 
ATOM   3796 O  OG1 . THR C 1 88  ? -24.053 3.278   0.820   1.00 45.11 ? 77   THR C OG1 1 
ATOM   3797 C  CG2 . THR C 1 88  ? -24.775 2.521   -1.349  1.00 45.14 ? 77   THR C CG2 1 
ATOM   3798 N  N   . GLY C 1 89  ? -25.634 1.702   3.145   1.00 40.22 ? 78   GLY C N   1 
ATOM   3799 C  CA  . GLY C 1 89  ? -25.210 1.564   4.534   1.00 36.37 ? 78   GLY C CA  1 
ATOM   3800 C  C   . GLY C 1 89  ? -24.008 2.408   4.955   1.00 33.80 ? 78   GLY C C   1 
ATOM   3801 O  O   . GLY C 1 89  ? -23.543 2.300   6.094   1.00 30.52 ? 78   GLY C O   1 
ATOM   3802 N  N   . GLU C 1 90  ? -23.503 3.244   4.052   1.00 32.87 ? 79   GLU C N   1 
ATOM   3803 C  CA  . GLU C 1 90  ? -22.350 4.097   4.354   1.00 32.56 ? 79   GLU C CA  1 
ATOM   3804 C  C   . GLU C 1 90  ? -22.597 5.117   5.458   1.00 31.64 ? 79   GLU C C   1 
ATOM   3805 O  O   . GLU C 1 90  ? -23.669 5.719   5.532   1.00 32.37 ? 79   GLU C O   1 
ATOM   3806 C  CB  . GLU C 1 90  ? -21.910 4.858   3.123   1.00 33.62 ? 79   GLU C CB  1 
ATOM   3807 C  CG  . GLU C 1 90  ? -21.146 4.038   2.106   1.00 36.66 ? 79   GLU C CG  1 
ATOM   3808 C  CD  . GLU C 1 90  ? -21.041 4.764   0.787   1.00 36.89 ? 79   GLU C CD  1 
ATOM   3809 O  OE1 . GLU C 1 90  ? -22.107 5.081   0.212   1.00 39.49 ? 79   GLU C OE1 1 
ATOM   3810 O  OE2 . GLU C 1 90  ? -19.909 5.023   0.340   1.00 35.95 ? 79   GLU C OE2 1 
ATOM   3811 N  N   . THR C 1 91  ? -21.576 5.318   6.289   1.00 29.12 ? 80   THR C N   1 
ATOM   3812 C  CA  . THR C 1 91  ? -21.541 6.406   7.263   1.00 28.14 ? 80   THR C CA  1 
ATOM   3813 C  C   . THR C 1 91  ? -20.673 7.523   6.676   1.00 27.85 ? 80   THR C C   1 
ATOM   3814 O  O   . THR C 1 91  ? -19.531 7.292   6.305   1.00 27.21 ? 80   THR C O   1 
ATOM   3815 C  CB  . THR C 1 91  ? -20.986 5.933   8.625   1.00 26.22 ? 80   THR C CB  1 
ATOM   3816 O  OG1 . THR C 1 91  ? -21.828 4.893   9.140   1.00 26.07 ? 80   THR C OG1 1 
ATOM   3817 C  CG2 . THR C 1 91  ? -20.953 7.087   9.646   1.00 25.86 ? 80   THR C CG2 1 
ATOM   3818 N  N   . CYS C 1 92  ? -21.237 8.719   6.564   1.00 28.42 ? 81   CYS C N   1 
ATOM   3819 C  CA  . CYS C 1 92  ? -20.556 9.831   5.897   1.00 29.08 ? 81   CYS C CA  1 
ATOM   3820 C  C   . CYS C 1 92  ? -20.408 11.035  6.833   1.00 27.99 ? 81   CYS C C   1 
ATOM   3821 O  O   . CYS C 1 92  ? -21.395 11.567  7.337   1.00 27.83 ? 81   CYS C O   1 
ATOM   3822 C  CB  . CYS C 1 92  ? -21.291 10.198  4.588   1.00 29.94 ? 81   CYS C CB  1 
ATOM   3823 S  SG  . CYS C 1 92  ? -21.288 8.862   3.339   1.00 31.87 ? 81   CYS C SG  1 
ATOM   3824 N  N   . ILE C 1 93  ? -19.170 11.422  7.071   1.00 29.45 ? 82   ILE C N   1 
ATOM   3825 C  CA  . ILE C 1 93  ? -18.858 12.568  7.903   1.00 32.63 ? 82   ILE C CA  1 
ATOM   3826 C  C   . ILE C 1 93  ? -18.408 13.773  7.077   1.00 32.30 ? 82   ILE C C   1 
ATOM   3827 O  O   . ILE C 1 93  ? -17.452 13.715  6.345   1.00 29.98 ? 82   ILE C O   1 
ATOM   3828 C  CB  . ILE C 1 93  ? -17.761 12.232  8.921   1.00 32.24 ? 82   ILE C CB  1 
ATOM   3829 C  CG1 . ILE C 1 93  ? -18.107 10.969  9.674   1.00 33.65 ? 82   ILE C CG1 1 
ATOM   3830 C  CG2 . ILE C 1 93  ? -17.601 13.341  9.920   1.00 32.45 ? 82   ILE C CG2 1 
ATOM   3831 C  CD1 . ILE C 1 93  ? -16.906 10.262  10.209  1.00 34.01 ? 82   ILE C CD1 1 
ATOM   3832 N  N   . SER C 1 94  ? -19.142 14.859  7.228   1.00 35.15 ? 83   SER C N   1 
ATOM   3833 C  CA  . SER C 1 94  ? -18.884 16.115  6.546   1.00 36.44 ? 83   SER C CA  1 
ATOM   3834 C  C   . SER C 1 94  ? -17.659 16.815  7.088   1.00 37.98 ? 83   SER C C   1 
ATOM   3835 O  O   . SER C 1 94  ? -17.366 16.736  8.254   1.00 35.64 ? 83   SER C O   1 
ATOM   3836 C  CB  . SER C 1 94  ? -20.068 17.054  6.712   1.00 37.51 ? 83   SER C CB  1 
ATOM   3837 O  OG  . SER C 1 94  ? -21.189 16.659  5.973   1.00 39.28 ? 83   SER C OG  1 
ATOM   3838 N  N   . ALA C 1 95  ? -16.963 17.512  6.214   1.00 40.00 ? 84   ALA C N   1 
ATOM   3839 C  CA  . ALA C 1 95  ? -15.937 18.457  6.597   1.00 42.21 ? 84   ALA C CA  1 
ATOM   3840 C  C   . ALA C 1 95  ? -16.504 19.738  7.189   1.00 42.31 ? 84   ALA C C   1 
ATOM   3841 O  O   . ALA C 1 95  ? -17.605 20.138  6.892   1.00 41.44 ? 84   ALA C O   1 
ATOM   3842 C  CB  . ALA C 1 95  ? -15.047 18.773  5.422   1.00 41.35 ? 84   ALA C CB  1 
ATOM   3843 N  N   . ASN C 1 96  ? -15.732 20.256  8.129   1.00 46.95 ? 85   ASN C N   1 
ATOM   3844 C  CA  . ASN C 1 96  ? -15.954 21.543  8.723   1.00 49.58 ? 85   ASN C CA  1 
ATOM   3845 C  C   . ASN C 1 96  ? -14.658 22.293  8.751   1.00 51.16 ? 85   ASN C C   1 
ATOM   3846 O  O   . ASN C 1 96  ? -13.794 21.984  9.534   1.00 54.50 ? 85   ASN C O   1 
ATOM   3847 C  CB  . ASN C 1 96  ? -16.456 21.371  10.138  1.00 51.82 ? 85   ASN C CB  1 
ATOM   3848 C  CG  . ASN C 1 96  ? -17.942 21.594  10.251  1.00 57.02 ? 85   ASN C CG  1 
ATOM   3849 O  OD1 . ASN C 1 96  ? -18.390 22.664  10.649  1.00 59.69 ? 85   ASN C OD1 1 
ATOM   3850 N  ND2 . ASN C 1 96  ? -18.716 20.595  9.877   1.00 54.86 ? 85   ASN C ND2 1 
ATOM   3851 N  N   . PRO C 1 97  ? -14.534 23.322  7.936   1.00 50.45 ? 86   PRO C N   1 
ATOM   3852 C  CA  . PRO C 1 97  ? -15.553 23.742  6.974   1.00 48.60 ? 86   PRO C CA  1 
ATOM   3853 C  C   . PRO C 1 97  ? -15.767 22.857  5.737   1.00 48.45 ? 86   PRO C C   1 
ATOM   3854 O  O   . PRO C 1 97  ? -14.922 22.098  5.318   1.00 46.46 ? 86   PRO C O   1 
ATOM   3855 C  CB  . PRO C 1 97  ? -15.059 25.114  6.548   1.00 48.40 ? 86   PRO C CB  1 
ATOM   3856 C  CG  . PRO C 1 97  ? -13.605 25.129  6.868   1.00 48.55 ? 86   PRO C CG  1 
ATOM   3857 C  CD  . PRO C 1 97  ? -13.236 23.937  7.666   1.00 48.17 ? 86   PRO C CD  1 
ATOM   3858 N  N   . LEU C 1 98  ? -16.953 22.982  5.172   1.00 51.26 ? 87   LEU C N   1 
ATOM   3859 C  CA  . LEU C 1 98  ? -17.341 22.279  3.953   1.00 52.08 ? 87   LEU C CA  1 
ATOM   3860 C  C   . LEU C 1 98  ? -16.490 22.637  2.739   1.00 51.38 ? 87   LEU C C   1 
ATOM   3861 O  O   . LEU C 1 98  ? -16.148 21.764  1.930   1.00 47.89 ? 87   LEU C O   1 
ATOM   3862 C  CB  . LEU C 1 98  ? -18.816 22.569  3.630   1.00 53.01 ? 87   LEU C CB  1 
ATOM   3863 C  CG  . LEU C 1 98  ? -19.895 21.656  4.229   1.00 57.03 ? 87   LEU C CG  1 
ATOM   3864 C  CD1 . LEU C 1 98  ? -21.265 22.321  4.174   1.00 56.11 ? 87   LEU C CD1 1 
ATOM   3865 C  CD2 . LEU C 1 98  ? -19.920 20.298  3.530   1.00 56.85 ? 87   LEU C CD2 1 
ATOM   3866 N  N   . ASN C 1 99  ? -16.175 23.924  2.600   1.00 54.40 ? 88   ASN C N   1 
ATOM   3867 C  CA  . ASN C 1 99  ? -15.515 24.405  1.390   1.00 55.88 ? 88   ASN C CA  1 
ATOM   3868 C  C   . ASN C 1 99  ? -14.408 25.420  1.581   1.00 54.52 ? 88   ASN C C   1 
ATOM   3869 O  O   . ASN C 1 99  ? -14.381 26.170  2.560   1.00 57.73 ? 88   ASN C O   1 
ATOM   3870 C  CB  . ASN C 1 99  ? -16.534 24.892  0.340   1.00 59.03 ? 88   ASN C CB  1 
ATOM   3871 C  CG  . ASN C 1 99  ? -17.312 26.108  0.786   1.00 64.06 ? 88   ASN C CG  1 
ATOM   3872 O  OD1 . ASN C 1 99  ? -18.016 26.073  1.799   1.00 69.86 ? 88   ASN C OD1 1 
ATOM   3873 N  ND2 . ASN C 1 99  ? -17.210 27.191  0.015   1.00 63.48 ? 88   ASN C ND2 1 
ATOM   3874 N  N   . VAL C 1 100 ? -13.479 25.398  0.634   1.00 50.97 ? 89   VAL C N   1 
ATOM   3875 C  CA  . VAL C 1 100 ? -12.515 26.465  0.445   1.00 50.22 ? 89   VAL C CA  1 
ATOM   3876 C  C   . VAL C 1 100 ? -13.147 27.435  -0.572  1.00 51.17 ? 89   VAL C C   1 
ATOM   3877 O  O   . VAL C 1 100 ? -13.520 27.014  -1.676  1.00 49.28 ? 89   VAL C O   1 
ATOM   3878 C  CB  . VAL C 1 100 ? -11.178 25.892  -0.071  1.00 48.85 ? 89   VAL C CB  1 
ATOM   3879 C  CG1 . VAL C 1 100 ? -10.173 27.002  -0.368  1.00 48.85 ? 89   VAL C CG1 1 
ATOM   3880 C  CG2 . VAL C 1 100 ? -10.615 24.884  0.926   1.00 46.10 ? 89   VAL C CG2 1 
ATOM   3881 N  N   . PRO C 1 101 ? -13.305 28.727  -0.198  1.00 51.25 ? 90   PRO C N   1 
ATOM   3882 C  CA  . PRO C 1 101 ? -13.948 29.686  -1.122  1.00 52.66 ? 90   PRO C CA  1 
ATOM   3883 C  C   . PRO C 1 101 ? -13.091 29.993  -2.353  1.00 50.06 ? 90   PRO C C   1 
ATOM   3884 O  O   . PRO C 1 101 ? -11.867 29.842  -2.304  1.00 47.72 ? 90   PRO C O   1 
ATOM   3885 C  CB  . PRO C 1 101 ? -14.131 30.953  -0.269  1.00 52.16 ? 90   PRO C CB  1 
ATOM   3886 C  CG  . PRO C 1 101 ? -13.939 30.520  1.149   1.00 52.75 ? 90   PRO C CG  1 
ATOM   3887 C  CD  . PRO C 1 101 ? -13.011 29.338  1.111   1.00 52.69 ? 90   PRO C CD  1 
ATOM   3888 N  N   . ARG C 1 102 ? -13.739 30.411  -3.440  1.00 49.19 ? 91   ARG C N   1 
ATOM   3889 C  CA  . ARG C 1 102 ? -13.040 30.760  -4.682  1.00 53.84 ? 91   ARG C CA  1 
ATOM   3890 C  C   . ARG C 1 102 ? -12.205 32.032  -4.500  1.00 55.52 ? 91   ARG C C   1 
ATOM   3891 O  O   . ARG C 1 102 ? -12.750 33.134  -4.396  1.00 58.92 ? 91   ARG C O   1 
ATOM   3892 C  CB  . ARG C 1 102 ? -14.030 30.942  -5.841  1.00 52.70 ? 91   ARG C CB  1 
ATOM   3893 C  CG  . ARG C 1 102 ? -14.760 29.679  -6.277  1.00 53.67 ? 91   ARG C CG  1 
ATOM   3894 C  CD  . ARG C 1 102 ? -15.663 29.963  -7.467  1.00 54.15 ? 91   ARG C CD  1 
ATOM   3895 N  NE  . ARG C 1 102 ? -16.295 28.749  -7.984  1.00 56.94 ? 91   ARG C NE  1 
ATOM   3896 C  CZ  . ARG C 1 102 ? -17.015 28.680  -9.106  1.00 58.26 ? 91   ARG C CZ  1 
ATOM   3897 N  NH1 . ARG C 1 102 ? -17.202 29.754  -9.866  1.00 55.00 ? 91   ARG C NH1 1 
ATOM   3898 N  NH2 . ARG C 1 102 ? -17.550 27.525  -9.476  1.00 57.91 ? 91   ARG C NH2 1 
ATOM   3899 N  N   . LYS C 1 103 ? -10.886 31.874  -4.450  1.00 54.45 ? 92   LYS C N   1 
ATOM   3900 C  CA  . LYS C 1 103 ? -9.981  33.012  -4.264  1.00 57.08 ? 92   LYS C CA  1 
ATOM   3901 C  C   . LYS C 1 103 ? -8.686  32.861  -5.054  1.00 56.21 ? 92   LYS C C   1 
ATOM   3902 O  O   . LYS C 1 103 ? -8.283  31.749  -5.423  1.00 50.89 ? 92   LYS C O   1 
ATOM   3903 C  CB  . LYS C 1 103 ? -9.637  33.235  -2.778  1.00 56.51 ? 92   LYS C CB  1 
ATOM   3904 C  CG  . LYS C 1 103 ? -10.777 33.738  -1.898  1.00 60.60 ? 92   LYS C CG  1 
ATOM   3905 C  CD  . LYS C 1 103 ? -10.351 34.919  -1.031  1.00 62.46 ? 92   LYS C CD  1 
ATOM   3906 C  CE  . LYS C 1 103 ? -9.210  34.576  -0.074  1.00 64.01 ? 92   LYS C CE  1 
ATOM   3907 N  NZ  . LYS C 1 103 ? -8.464  35.801  0.342   1.00 62.96 ? 92   LYS C NZ  1 
ATOM   3908 N  N   . HIS C 1 104 ? -8.053  34.002  -5.317  1.00 58.17 ? 93   HIS C N   1 
ATOM   3909 C  CA  . HIS C 1 104 ? -6.664  34.050  -5.747  1.00 58.99 ? 93   HIS C CA  1 
ATOM   3910 C  C   . HIS C 1 104 ? -5.820  33.742  -4.502  1.00 59.85 ? 93   HIS C C   1 
ATOM   3911 O  O   . HIS C 1 104 ? -5.350  34.654  -3.804  1.00 59.02 ? 93   HIS C O   1 
ATOM   3912 C  CB  . HIS C 1 104 ? -6.301  35.409  -6.347  1.00 20.00 ? 93   HIS C CB  1 
ATOM   3913 C  CG  . HIS C 1 104 ? -4.893  35.492  -6.848  1.00 20.00 ? 93   HIS C CG  1 
ATOM   3914 N  ND1 . HIS C 1 104 ? -4.416  34.693  -7.866  1.00 20.00 ? 93   HIS C ND1 1 
ATOM   3915 C  CD2 . HIS C 1 104 ? -3.858  36.280  -6.473  1.00 20.00 ? 93   HIS C CD2 1 
ATOM   3916 C  CE1 . HIS C 1 104 ? -3.148  34.985  -8.094  1.00 20.00 ? 93   HIS C CE1 1 
ATOM   3917 N  NE2 . HIS C 1 104 ? -2.784  35.944  -7.264  1.00 20.00 ? 93   HIS C NE2 1 
ATOM   3918 N  N   . TRP C 1 105 ? -5.664  32.446  -4.218  1.00 56.21 ? 94   TRP C N   1 
ATOM   3919 C  CA  . TRP C 1 105 ? -5.081  31.972  -2.957  1.00 55.72 ? 94   TRP C CA  1 
ATOM   3920 C  C   . TRP C 1 105 ? -3.589  32.107  -2.888  1.00 58.30 ? 94   TRP C C   1 
ATOM   3921 O  O   . TRP C 1 105 ? -3.026  32.329  -1.813  1.00 58.92 ? 94   TRP C O   1 
ATOM   3922 C  CB  . TRP C 1 105 ? -5.456  30.512  -2.712  1.00 52.18 ? 94   TRP C CB  1 
ATOM   3923 C  CG  . TRP C 1 105 ? -6.870  30.332  -2.229  1.00 50.49 ? 94   TRP C CG  1 
ATOM   3924 C  CD1 . TRP C 1 105 ? -7.956  29.844  -2.947  1.00 48.13 ? 94   TRP C CD1 1 
ATOM   3925 C  CD2 . TRP C 1 105 ? -7.401  30.642  -0.892  1.00 49.91 ? 94   TRP C CD2 1 
ATOM   3926 N  NE1 . TRP C 1 105 ? -9.085  29.828  -2.177  1.00 48.65 ? 94   TRP C NE1 1 
ATOM   3927 C  CE2 . TRP C 1 105 ? -8.827  30.291  -0.929  1.00 50.19 ? 94   TRP C CE2 1 
ATOM   3928 C  CE3 . TRP C 1 105 ? -6.858  31.155  0.290   1.00 48.33 ? 94   TRP C CE3 1 
ATOM   3929 C  CZ2 . TRP C 1 105 ? -9.661  30.460  0.180   1.00 48.07 ? 94   TRP C CZ2 1 
ATOM   3930 C  CZ3 . TRP C 1 105 ? -7.705  31.317  1.399   1.00 49.88 ? 94   TRP C CZ3 1 
ATOM   3931 C  CH2 . TRP C 1 105 ? -9.074  30.975  1.342   1.00 47.99 ? 94   TRP C CH2 1 
ATOM   3932 N  N   . TRP C 1 106 ? -2.939  31.962  -4.038  1.00 56.31 ? 95   TRP C N   1 
ATOM   3933 C  CA  . TRP C 1 106 ? -1.495  31.851  -4.093  1.00 56.58 ? 95   TRP C CA  1 
ATOM   3934 C  C   . TRP C 1 106 ? -0.924  32.748  -5.152  1.00 59.04 ? 95   TRP C C   1 
ATOM   3935 O  O   . TRP C 1 106 ? -1.439  32.810  -6.282  1.00 54.81 ? 95   TRP C O   1 
ATOM   3936 C  CB  . TRP C 1 106 ? -1.124  30.408  -4.382  1.00 55.37 ? 95   TRP C CB  1 
ATOM   3937 C  CG  . TRP C 1 106 ? 0.348   30.111  -4.273  1.00 56.03 ? 95   TRP C CG  1 
ATOM   3938 C  CD1 . TRP C 1 106 ? 1.233   29.810  -5.306  1.00 55.74 ? 95   TRP C CD1 1 
ATOM   3939 C  CD2 . TRP C 1 106 ? 1.159   30.063  -3.045  1.00 56.03 ? 95   TRP C CD2 1 
ATOM   3940 N  NE1 . TRP C 1 106 ? 2.499   29.584  -4.820  1.00 58.99 ? 95   TRP C NE1 1 
ATOM   3941 C  CE2 . TRP C 1 106 ? 2.527   29.719  -3.473  1.00 57.66 ? 95   TRP C CE2 1 
ATOM   3942 C  CE3 . TRP C 1 106 ? 0.901   30.261  -1.688  1.00 54.51 ? 95   TRP C CE3 1 
ATOM   3943 C  CZ2 . TRP C 1 106 ? 3.574   29.586  -2.564  1.00 56.34 ? 95   TRP C CZ2 1 
ATOM   3944 C  CZ3 . TRP C 1 106 ? 1.962   30.118  -0.783  1.00 56.57 ? 95   TRP C CZ3 1 
ATOM   3945 C  CH2 . TRP C 1 106 ? 3.266   29.787  -1.212  1.00 56.84 ? 95   TRP C CH2 1 
ATOM   3946 N  N   . THR C 1 107 ? 0.156   33.455  -4.834  1.00 62.84 ? 96   THR C N   1 
ATOM   3947 C  CA  . THR C 1 107 ? 0.830   34.286  -5.839  1.00 67.83 ? 96   THR C CA  1 
ATOM   3948 C  C   . THR C 1 107 ? 2.292   33.895  -6.108  1.00 71.59 ? 96   THR C C   1 
ATOM   3949 O  O   . THR C 1 107 ? 3.160   34.012  -5.258  1.00 74.74 ? 96   THR C O   1 
ATOM   3950 C  CB  . THR C 1 107 ? 0.617   35.798  -5.595  1.00 67.89 ? 96   THR C CB  1 
ATOM   3951 O  OG1 . THR C 1 107 ? 1.530   36.567  -6.383  1.00 69.28 ? 96   THR C OG1 1 
ATOM   3952 C  CG2 . THR C 1 107 ? 0.764   36.152  -4.149  1.00 68.42 ? 96   THR C CG2 1 
ATOM   3953 N  N   . ASP C 1 108 ? 2.523   33.414  -7.321  1.00 74.07 ? 97   ASP C N   1 
ATOM   3954 C  CA  . ASP C 1 108 ? 3.752   32.760  -7.771  1.00 76.05 ? 97   ASP C CA  1 
ATOM   3955 C  C   . ASP C 1 108 ? 4.497   31.939  -6.740  1.00 76.43 ? 97   ASP C C   1 
ATOM   3956 O  O   . ASP C 1 108 ? 5.322   31.093  -7.100  1.00 74.93 ? 97   ASP C O   1 
ATOM   3957 C  CB  . ASP C 1 108 ? 4.703   33.731  -8.474  1.00 82.46 ? 97   ASP C CB  1 
ATOM   3958 C  CG  . ASP C 1 108 ? 4.187   34.154  -9.832  1.00 83.79 ? 97   ASP C CG  1 
ATOM   3959 O  OD1 . ASP C 1 108 ? 3.266   33.470  -10.306 1.00 83.11 ? 97   ASP C OD1 1 
ATOM   3960 O  OD2 . ASP C 1 108 ? 4.695   35.137  -10.428 1.00 84.59 ? 97   ASP C OD2 1 
ATOM   3961 N  N   . LYS C 1 114 ? 6.522   23.877  -8.268  1.00 60.57 ? 103  LYS C N   1 
ATOM   3962 C  CA  . LYS C 1 114 ? 6.249   23.391  -6.919  1.00 59.36 ? 103  LYS C CA  1 
ATOM   3963 C  C   . LYS C 1 114 ? 4.765   23.065  -6.706  1.00 60.56 ? 103  LYS C C   1 
ATOM   3964 O  O   . LYS C 1 114 ? 3.887   23.798  -7.171  1.00 58.11 ? 103  LYS C O   1 
ATOM   3965 C  CB  . LYS C 1 114 ? 6.709   24.418  -5.874  1.00 55.96 ? 103  LYS C CB  1 
ATOM   3966 N  N   . HIS C 1 115 ? 4.502   21.952  -6.019  1.00 58.31 ? 104  HIS C N   1 
ATOM   3967 C  CA  . HIS C 1 115 ? 3.196   21.706  -5.404  1.00 56.13 ? 104  HIS C CA  1 
ATOM   3968 C  C   . HIS C 1 115 ? 3.138   22.428  -4.095  1.00 52.65 ? 104  HIS C C   1 
ATOM   3969 O  O   . HIS C 1 115 ? 4.049   22.304  -3.272  1.00 54.78 ? 104  HIS C O   1 
ATOM   3970 C  CB  . HIS C 1 115 ? 2.973   20.222  -5.153  1.00 55.18 ? 104  HIS C CB  1 
ATOM   3971 C  CG  . HIS C 1 115 ? 2.736   19.423  -6.399  1.00 57.98 ? 104  HIS C CG  1 
ATOM   3972 N  ND1 . HIS C 1 115 ? 1.540   19.394  -7.025  1.00 57.28 ? 104  HIS C ND1 1 
ATOM   3973 C  CD2 . HIS C 1 115 ? 3.586   18.590  -7.126  1.00 58.40 ? 104  HIS C CD2 1 
ATOM   3974 C  CE1 . HIS C 1 115 ? 1.622   18.592  -8.102  1.00 58.32 ? 104  HIS C CE1 1 
ATOM   3975 N  NE2 . HIS C 1 115 ? 2.875   18.097  -8.162  1.00 58.90 ? 104  HIS C NE2 1 
ATOM   3976 N  N   . VAL C 1 116 ? 2.065   23.181  -3.880  1.00 53.23 ? 105  VAL C N   1 
ATOM   3977 C  CA  . VAL C 1 116 ? 1.901   23.957  -2.645  1.00 55.61 ? 105  VAL C CA  1 
ATOM   3978 C  C   . VAL C 1 116 ? 0.673   23.516  -1.830  1.00 56.15 ? 105  VAL C C   1 
ATOM   3979 O  O   . VAL C 1 116 ? -0.450  23.522  -2.337  1.00 53.85 ? 105  VAL C O   1 
ATOM   3980 C  CB  . VAL C 1 116 ? 1.819   25.472  -2.935  1.00 54.20 ? 105  VAL C CB  1 
ATOM   3981 C  CG1 . VAL C 1 116 ? 1.746   26.263  -1.638  1.00 53.62 ? 105  VAL C CG1 1 
ATOM   3982 C  CG2 . VAL C 1 116 ? 3.005   25.928  -3.782  1.00 56.61 ? 105  VAL C CG2 1 
ATOM   3983 N  N   . TRP C 1 117 ? 0.909   23.148  -0.566  1.00 56.15 ? 106  TRP C N   1 
ATOM   3984 C  CA  . TRP C 1 117 ? -0.143  22.685  0.359   1.00 49.76 ? 106  TRP C CA  1 
ATOM   3985 C  C   . TRP C 1 117 ? -1.005  23.796  0.863   1.00 50.05 ? 106  TRP C C   1 
ATOM   3986 O  O   . TRP C 1 117 ? -0.523  24.732  1.497   1.00 48.76 ? 106  TRP C O   1 
ATOM   3987 C  CB  . TRP C 1 117 ? 0.470   21.903  1.521   1.00 45.13 ? 106  TRP C CB  1 
ATOM   3988 C  CG  . TRP C 1 117 ? 1.027   20.598  1.037   1.00 42.96 ? 106  TRP C CG  1 
ATOM   3989 C  CD1 . TRP C 1 117 ? 2.369   20.244  0.878   1.00 40.86 ? 106  TRP C CD1 1 
ATOM   3990 C  CD2 . TRP C 1 117 ? 0.255   19.432  0.565   1.00 41.06 ? 106  TRP C CD2 1 
ATOM   3991 N  NE1 . TRP C 1 117 ? 2.476   18.973  0.363   1.00 41.94 ? 106  TRP C NE1 1 
ATOM   3992 C  CE2 . TRP C 1 117 ? 1.244   18.428  0.153   1.00 40.71 ? 106  TRP C CE2 1 
ATOM   3993 C  CE3 . TRP C 1 117 ? -1.110  19.134  0.451   1.00 41.06 ? 106  TRP C CE3 1 
ATOM   3994 C  CZ2 . TRP C 1 117 ? 0.864   17.186  -0.337  1.00 40.09 ? 106  TRP C CZ2 1 
ATOM   3995 C  CZ3 . TRP C 1 117 ? -1.483  17.881  -0.056  1.00 40.12 ? 106  TRP C CZ3 1 
ATOM   3996 C  CH2 . TRP C 1 117 ? -0.520  16.931  -0.438  1.00 42.37 ? 106  TRP C CH2 1 
ATOM   3997 N  N   . PHE C 1 118 ? -2.299  23.704  0.579   1.00 50.36 ? 107  PHE C N   1 
ATOM   3998 C  CA  . PHE C 1 118 ? -3.240  24.720  1.017   1.00 51.08 ? 107  PHE C CA  1 
ATOM   3999 C  C   . PHE C 1 118 ? -3.197  24.953  2.535   1.00 52.19 ? 107  PHE C C   1 
ATOM   4000 O  O   . PHE C 1 118 ? -3.125  26.104  2.991   1.00 50.56 ? 107  PHE C O   1 
ATOM   4001 C  CB  . PHE C 1 118 ? -4.654  24.365  0.568   1.00 50.31 ? 107  PHE C CB  1 
ATOM   4002 C  CG  . PHE C 1 118 ? -5.721  25.243  1.161   1.00 50.91 ? 107  PHE C CG  1 
ATOM   4003 C  CD1 . PHE C 1 118 ? -5.900  26.551  0.710   1.00 50.42 ? 107  PHE C CD1 1 
ATOM   4004 C  CD2 . PHE C 1 118 ? -6.558  24.759  2.165   1.00 49.17 ? 107  PHE C CD2 1 
ATOM   4005 C  CE1 . PHE C 1 118 ? -6.888  27.357  1.254   1.00 50.74 ? 107  PHE C CE1 1 
ATOM   4006 C  CE2 . PHE C 1 118 ? -7.546  25.562  2.711   1.00 48.97 ? 107  PHE C CE2 1 
ATOM   4007 C  CZ  . PHE C 1 118 ? -7.714  26.861  2.253   1.00 50.57 ? 107  PHE C CZ  1 
ATOM   4008 N  N   . GLY C 1 119 ? -3.231  23.864  3.301   1.00 50.11 ? 108  GLY C N   1 
ATOM   4009 C  CA  . GLY C 1 119 ? -3.318  23.943  4.760   1.00 55.08 ? 108  GLY C CA  1 
ATOM   4010 C  C   . GLY C 1 119 ? -2.025  24.404  5.399   1.00 58.14 ? 108  GLY C C   1 
ATOM   4011 O  O   . GLY C 1 119 ? -2.035  25.169  6.363   1.00 58.66 ? 108  GLY C O   1 
ATOM   4012 N  N   . GLU C 1 120 ? -0.914  23.949  4.833   1.00 61.33 ? 109  GLU C N   1 
ATOM   4013 C  CA  . GLU C 1 120 ? 0.408   24.200  5.391   1.00 66.45 ? 109  GLU C CA  1 
ATOM   4014 C  C   . GLU C 1 120 ? 0.990   25.578  5.055   1.00 67.33 ? 109  GLU C C   1 
ATOM   4015 O  O   . GLU C 1 120 ? 1.653   26.182  5.899   1.00 67.25 ? 109  GLU C O   1 
ATOM   4016 C  CB  . GLU C 1 120 ? 1.381   23.097  4.954   1.00 68.13 ? 109  GLU C CB  1 
ATOM   4017 C  CG  . GLU C 1 120 ? 0.893   21.690  5.264   1.00 68.54 ? 109  GLU C CG  1 
ATOM   4018 C  CD  . GLU C 1 120 ? 1.976   20.639  5.126   1.00 73.57 ? 109  GLU C CD  1 
ATOM   4019 O  OE1 . GLU C 1 120 ? 2.955   20.865  4.380   1.00 75.84 ? 109  GLU C OE1 1 
ATOM   4020 O  OE2 . GLU C 1 120 ? 1.847   19.578  5.773   1.00 73.08 ? 109  GLU C OE2 1 
ATOM   4021 N  N   . SER C 1 121 ? 0.726   26.080  3.844   1.00 66.48 ? 110  SER C N   1 
ATOM   4022 C  CA  . SER C 1 121 ? 1.509   27.200  3.293   1.00 61.88 ? 110  SER C CA  1 
ATOM   4023 C  C   . SER C 1 121 ? 0.749   28.460  2.863   1.00 63.21 ? 110  SER C C   1 
ATOM   4024 O  O   . SER C 1 121 ? 1.329   29.549  2.826   1.00 65.45 ? 110  SER C O   1 
ATOM   4025 C  CB  . SER C 1 121 ? 2.361   26.711  2.125   1.00 56.94 ? 110  SER C CB  1 
ATOM   4026 O  OG  . SER C 1 121 ? 3.169   25.623  2.522   1.00 53.78 ? 110  SER C OG  1 
HETATM 4027 N  N   . MSE C 1 122 ? -0.531  28.324  2.543   1.00 60.28 ? 111  MSE C N   1 
HETATM 4028 C  CA  . MSE C 1 122 ? -1.271  29.434  1.938   1.00 60.86 ? 111  MSE C CA  1 
HETATM 4029 C  C   . MSE C 1 122 ? -1.836  30.381  2.972   1.00 62.54 ? 111  MSE C C   1 
HETATM 4030 O  O   . MSE C 1 122 ? -2.287  29.951  4.043   1.00 60.76 ? 111  MSE C O   1 
HETATM 4031 C  CB  . MSE C 1 122 ? -2.350  28.902  0.988   1.00 60.53 ? 111  MSE C CB  1 
HETATM 4032 C  CG  . MSE C 1 122 ? -1.714  28.043  -0.113  1.00 61.36 ? 111  MSE C CG  1 
HETATM 4033 SE SE  . MSE C 1 122 ? -2.864  27.851  -1.714  1.00 60.35 ? 111  MSE C SE  1 
HETATM 4034 C  CE  . MSE C 1 122 ? -1.967  26.314  -2.558  1.00 55.73 ? 111  MSE C CE  1 
ATOM   4035 N  N   . ASP C 1 123 ? -1.813  31.678  2.645   1.00 59.93 ? 112  ASP C N   1 
ATOM   4036 C  CA  . ASP C 1 123 ? -2.337  32.737  3.515   1.00 59.31 ? 112  ASP C CA  1 
ATOM   4037 C  C   . ASP C 1 123 ? -3.842  32.570  3.739   1.00 60.04 ? 112  ASP C C   1 
ATOM   4038 O  O   . ASP C 1 123 ? -4.646  32.712  2.807   1.00 60.00 ? 112  ASP C O   1 
ATOM   4039 C  CB  . ASP C 1 123 ? -2.015  34.127  2.948   1.00 56.61 ? 112  ASP C CB  1 
ATOM   4040 N  N   . GLY C 1 124 ? -4.207  32.256  4.982   1.00 59.67 ? 113  GLY C N   1 
ATOM   4041 C  CA  . GLY C 1 124 ? -5.594  31.963  5.345   1.00 57.32 ? 113  GLY C CA  1 
ATOM   4042 C  C   . GLY C 1 124 ? -5.981  30.513  5.084   1.00 57.41 ? 113  GLY C C   1 
ATOM   4043 O  O   . GLY C 1 124 ? -7.164  30.170  5.118   1.00 59.56 ? 113  GLY C O   1 
ATOM   4044 N  N   . GLY C 1 125 ? -4.980  29.672  4.816   1.00 55.28 ? 114  GLY C N   1 
ATOM   4045 C  CA  . GLY C 1 125 ? -5.175  28.244  4.574   1.00 52.85 ? 114  GLY C CA  1 
ATOM   4046 C  C   . GLY C 1 125 ? -5.436  27.455  5.845   1.00 55.68 ? 114  GLY C C   1 
ATOM   4047 O  O   . GLY C 1 125 ? -5.092  27.901  6.947   1.00 56.31 ? 114  GLY C O   1 
ATOM   4048 N  N   . PHE C 1 126 ? -6.058  26.285  5.689   1.00 53.68 ? 115  PHE C N   1 
ATOM   4049 C  CA  . PHE C 1 126 ? -6.382  25.395  6.808   1.00 49.22 ? 115  PHE C CA  1 
ATOM   4050 C  C   . PHE C 1 126 ? -6.422  23.947  6.347   1.00 48.74 ? 115  PHE C C   1 
ATOM   4051 O  O   . PHE C 1 126 ? -6.720  23.663  5.185   1.00 46.47 ? 115  PHE C O   1 
ATOM   4052 C  CB  . PHE C 1 126 ? -7.720  25.779  7.473   1.00 47.54 ? 115  PHE C CB  1 
ATOM   4053 C  CG  . PHE C 1 126 ? -8.886  25.869  6.515   1.00 47.72 ? 115  PHE C CG  1 
ATOM   4054 C  CD1 . PHE C 1 126 ? -9.559  24.716  6.088   1.00 46.83 ? 115  PHE C CD1 1 
ATOM   4055 C  CD2 . PHE C 1 126 ? -9.330  27.112  6.052   1.00 46.66 ? 115  PHE C CD2 1 
ATOM   4056 C  CE1 . PHE C 1 126 ? -10.631 24.805  5.204   1.00 48.00 ? 115  PHE C CE1 1 
ATOM   4057 C  CE2 . PHE C 1 126 ? -10.408 27.208  5.175   1.00 47.62 ? 115  PHE C CE2 1 
ATOM   4058 C  CZ  . PHE C 1 126 ? -11.059 26.052  4.748   1.00 47.78 ? 115  PHE C CZ  1 
ATOM   4059 N  N   . GLN C 1 127 ? -6.106  23.030  7.254   1.00 48.26 ? 116  GLN C N   1 
ATOM   4060 C  CA  . GLN C 1 127 ? -6.285  21.610  6.972   1.00 48.60 ? 116  GLN C CA  1 
ATOM   4061 C  C   . GLN C 1 127 ? -7.742  21.257  7.234   1.00 46.97 ? 116  GLN C C   1 
ATOM   4062 O  O   . GLN C 1 127 ? -8.395  21.910  8.049   1.00 44.18 ? 116  GLN C O   1 
ATOM   4063 C  CB  . GLN C 1 127 ? -5.343  20.758  7.813   1.00 48.90 ? 116  GLN C CB  1 
ATOM   4064 C  CG  . GLN C 1 127 ? -3.885  21.119  7.610   1.00 52.45 ? 116  GLN C CG  1 
ATOM   4065 C  CD  . GLN C 1 127 ? -3.014  19.905  7.397   1.00 52.96 ? 116  GLN C CD  1 
ATOM   4066 O  OE1 . GLN C 1 127 ? -3.225  18.859  8.004   1.00 55.23 ? 116  GLN C OE1 1 
ATOM   4067 N  NE2 . GLN C 1 127 ? -2.023  20.040  6.526   1.00 56.03 ? 116  GLN C NE2 1 
ATOM   4068 N  N   . PHE C 1 128 ? -8.264  20.259  6.521   1.00 47.32 ? 117  PHE C N   1 
ATOM   4069 C  CA  . PHE C 1 128 ? -9.692  19.928  6.621   1.00 46.68 ? 117  PHE C CA  1 
ATOM   4070 C  C   . PHE C 1 128 ? -9.897  19.066  7.848   1.00 43.90 ? 117  PHE C C   1 
ATOM   4071 O  O   . PHE C 1 128 ? -9.057  18.232  8.179   1.00 43.57 ? 117  PHE C O   1 
ATOM   4072 C  CB  . PHE C 1 128 ? -10.211 19.192  5.373   1.00 48.28 ? 117  PHE C CB  1 
ATOM   4073 C  CG  . PHE C 1 128 ? -9.656  19.709  4.066   1.00 49.16 ? 117  PHE C CG  1 
ATOM   4074 C  CD1 . PHE C 1 128 ? -9.735  21.061  3.734   1.00 50.43 ? 117  PHE C CD1 1 
ATOM   4075 C  CD2 . PHE C 1 128 ? -9.073  18.830  3.156   1.00 48.66 ? 117  PHE C CD2 1 
ATOM   4076 C  CE1 . PHE C 1 128 ? -9.225  21.524  2.532   1.00 49.35 ? 117  PHE C CE1 1 
ATOM   4077 C  CE2 . PHE C 1 128 ? -8.568  19.284  1.954   1.00 48.28 ? 117  PHE C CE2 1 
ATOM   4078 C  CZ  . PHE C 1 128 ? -8.643  20.633  1.641   1.00 49.46 ? 117  PHE C CZ  1 
ATOM   4079 N  N   . SER C 1 129 ? -11.009 19.283  8.526   1.00 44.26 ? 118  SER C N   1 
ATOM   4080 C  CA  . SER C 1 129 ? -11.326 18.524  9.729   1.00 46.40 ? 118  SER C CA  1 
ATOM   4081 C  C   . SER C 1 129 ? -12.751 18.021  9.641   1.00 46.85 ? 118  SER C C   1 
ATOM   4082 O  O   . SER C 1 129 ? -13.573 18.565  8.887   1.00 44.74 ? 118  SER C O   1 
ATOM   4083 C  CB  . SER C 1 129 ? -11.138 19.376  10.985  1.00 46.70 ? 118  SER C CB  1 
ATOM   4084 O  OG  . SER C 1 129 ? -11.936 20.546  10.912  1.00 46.47 ? 118  SER C OG  1 
ATOM   4085 N  N   . TYR C 1 130 ? -13.031 16.979  10.418  1.00 47.46 ? 119  TYR C N   1 
ATOM   4086 C  CA  . TYR C 1 130 ? -14.244 16.198  10.254  1.00 47.70 ? 119  TYR C CA  1 
ATOM   4087 C  C   . TYR C 1 130 ? -14.856 15.927  11.599  1.00 50.46 ? 119  TYR C C   1 
ATOM   4088 O  O   . TYR C 1 130 ? -14.151 15.611  12.555  1.00 51.60 ? 119  TYR C O   1 
ATOM   4089 C  CB  . TYR C 1 130 ? -13.913 14.881  9.550   1.00 46.59 ? 119  TYR C CB  1 
ATOM   4090 C  CG  . TYR C 1 130 ? -13.305 15.113  8.200   1.00 45.54 ? 119  TYR C CG  1 
ATOM   4091 C  CD1 . TYR C 1 130 ? -11.934 15.299  8.056   1.00 45.55 ? 119  TYR C CD1 1 
ATOM   4092 C  CD2 . TYR C 1 130 ? -14.105 15.207  7.071   1.00 44.69 ? 119  TYR C CD2 1 
ATOM   4093 C  CE1 . TYR C 1 130 ? -11.378 15.546  6.818   1.00 44.68 ? 119  TYR C CE1 1 
ATOM   4094 C  CE2 . TYR C 1 130 ? -13.557 15.452  5.828   1.00 44.07 ? 119  TYR C CE2 1 
ATOM   4095 C  CZ  . TYR C 1 130 ? -12.198 15.622  5.706   1.00 43.46 ? 119  TYR C CZ  1 
ATOM   4096 O  OH  . TYR C 1 130 ? -11.661 15.860  4.467   1.00 42.02 ? 119  TYR C OH  1 
ATOM   4097 N  N   . GLY C 1 131 ? -16.174 16.050  11.664  1.00 51.14 ? 120  GLY C N   1 
ATOM   4098 C  CA  . GLY C 1 131 ? -16.904 15.789  12.890  1.00 53.40 ? 120  GLY C CA  1 
ATOM   4099 C  C   . GLY C 1 131 ? -17.282 17.080  13.575  1.00 55.18 ? 120  GLY C C   1 
ATOM   4100 O  O   . GLY C 1 131 ? -16.696 18.137  13.296  1.00 56.38 ? 120  GLY C O   1 
ATOM   4101 N  N   . ASN C 1 132 ? -18.264 16.974  14.472  1.00 53.63 ? 121  ASN C N   1 
ATOM   4102 C  CA  . ASN C 1 132 ? -18.799 18.104  15.234  1.00 51.36 ? 121  ASN C CA  1 
ATOM   4103 C  C   . ASN C 1 132 ? -17.687 18.946  15.875  1.00 52.20 ? 121  ASN C C   1 
ATOM   4104 O  O   . ASN C 1 132 ? -16.885 18.422  16.657  1.00 54.28 ? 121  ASN C O   1 
ATOM   4105 C  CB  . ASN C 1 132 ? -19.780 17.592  16.290  1.00 49.48 ? 121  ASN C CB  1 
ATOM   4106 C  CG  . ASN C 1 132 ? -20.837 16.660  15.708  1.00 50.50 ? 121  ASN C CG  1 
ATOM   4107 O  OD1 . ASN C 1 132 ? -20.536 15.797  14.882  1.00 49.42 ? 121  ASN C OD1 1 
ATOM   4108 N  ND2 . ASN C 1 132 ? -22.080 16.830  16.141  1.00 48.26 ? 121  ASN C ND2 1 
ATOM   4109 N  N   . PRO C 1 133 ? -17.616 20.245  15.518  1.00 52.16 ? 122  PRO C N   1 
ATOM   4110 C  CA  . PRO C 1 133 ? -16.534 21.155  15.953  1.00 49.68 ? 122  PRO C CA  1 
ATOM   4111 C  C   . PRO C 1 133 ? -16.508 21.397  17.461  1.00 46.55 ? 122  PRO C C   1 
ATOM   4112 O  O   . PRO C 1 133 ? -15.457 21.713  18.016  1.00 47.41 ? 122  PRO C O   1 
ATOM   4113 C  CB  . PRO C 1 133 ? -16.867 22.467  15.227  1.00 51.25 ? 122  PRO C CB  1 
ATOM   4114 C  CG  . PRO C 1 133 ? -17.746 22.060  14.090  1.00 52.24 ? 122  PRO C CG  1 
ATOM   4115 C  CD  . PRO C 1 133 ? -18.562 20.922  14.612  1.00 51.36 ? 122  PRO C CD  1 
ATOM   4116 N  N   . GLU C 1 134 ? -17.665 21.257  18.102  1.00 43.60 ? 123  GLU C N   1 
ATOM   4117 C  CA  . GLU C 1 134 ? -17.794 21.417  19.549  1.00 44.61 ? 123  GLU C CA  1 
ATOM   4118 C  C   . GLU C 1 134 ? -17.371 20.175  20.345  1.00 41.54 ? 123  GLU C C   1 
ATOM   4119 O  O   . GLU C 1 134 ? -17.475 20.169  21.564  1.00 41.33 ? 123  GLU C O   1 
ATOM   4120 C  CB  . GLU C 1 134 ? -19.229 21.823  19.923  1.00 46.81 ? 123  GLU C CB  1 
ATOM   4121 C  CG  . GLU C 1 134 ? -20.280 20.710  19.842  1.00 49.36 ? 123  GLU C CG  1 
ATOM   4122 C  CD  . GLU C 1 134 ? -20.632 20.263  18.418  1.00 52.94 ? 123  GLU C CD  1 
ATOM   4123 O  OE1 . GLU C 1 134 ? -20.112 20.831  17.427  1.00 51.65 ? 123  GLU C OE1 1 
ATOM   4124 O  OE2 . GLU C 1 134 ? -21.445 19.315  18.289  1.00 56.94 ? 123  GLU C OE2 1 
ATOM   4125 N  N   . LEU C 1 135 ? -16.933 19.119  19.661  1.00 37.48 ? 124  LEU C N   1 
ATOM   4126 C  CA  . LEU C 1 135 ? -16.315 17.976  20.340  1.00 34.54 ? 124  LEU C CA  1 
ATOM   4127 C  C   . LEU C 1 135 ? -14.801 18.127  20.267  1.00 30.64 ? 124  LEU C C   1 
ATOM   4128 O  O   . LEU C 1 135 ? -14.281 18.505  19.226  1.00 29.93 ? 124  LEU C O   1 
ATOM   4129 C  CB  . LEU C 1 135 ? -16.751 16.650  19.710  1.00 34.60 ? 124  LEU C CB  1 
ATOM   4130 C  CG  . LEU C 1 135 ? -18.170 16.158  20.000  1.00 35.69 ? 124  LEU C CG  1 
ATOM   4131 C  CD1 . LEU C 1 135 ? -18.612 15.105  18.997  1.00 37.29 ? 124  LEU C CD1 1 
ATOM   4132 C  CD2 . LEU C 1 135 ? -18.283 15.613  21.417  1.00 36.87 ? 124  LEU C CD2 1 
ATOM   4133 N  N   . PRO C 1 136 ? -14.087 17.830  21.369  1.00 28.99 ? 125  PRO C N   1 
ATOM   4134 C  CA  . PRO C 1 136 ? -12.634 17.972  21.372  1.00 28.44 ? 125  PRO C CA  1 
ATOM   4135 C  C   . PRO C 1 136 ? -11.976 17.095  20.310  1.00 29.04 ? 125  PRO C C   1 
ATOM   4136 O  O   . PRO C 1 136 ? -12.537 16.062  19.901  1.00 28.81 ? 125  PRO C O   1 
ATOM   4137 C  CB  . PRO C 1 136 ? -12.237 17.485  22.770  1.00 28.42 ? 125  PRO C CB  1 
ATOM   4138 C  CG  . PRO C 1 136 ? -13.470 17.649  23.603  1.00 29.03 ? 125  PRO C CG  1 
ATOM   4139 C  CD  . PRO C 1 136 ? -14.593 17.334  22.660  1.00 29.44 ? 125  PRO C CD  1 
ATOM   4140 N  N   . GLU C 1 137 ? -10.782 17.491  19.889  1.00 28.38 ? 126  GLU C N   1 
ATOM   4141 C  CA  . GLU C 1 137 ? -10.074 16.794  18.821  1.00 29.07 ? 126  GLU C CA  1 
ATOM   4142 C  C   . GLU C 1 137 ? -9.749  15.322  19.168  1.00 28.31 ? 126  GLU C C   1 
ATOM   4143 O  O   . GLU C 1 137 ? -9.872  14.448  18.311  1.00 26.79 ? 126  GLU C O   1 
ATOM   4144 C  CB  . GLU C 1 137 ? -8.815  17.576  18.418  1.00 30.20 ? 126  GLU C CB  1 
ATOM   4145 C  CG  . GLU C 1 137 ? -8.238  17.211  17.054  1.00 31.52 ? 126  GLU C CG  1 
ATOM   4146 N  N   . ASP C 1 138 ? -9.353  15.053  20.419  1.00 28.10 ? 127  ASP C N   1 
ATOM   4147 C  CA  . ASP C 1 138 ? -8.991  13.698  20.838  1.00 27.52 ? 127  ASP C CA  1 
ATOM   4148 C  C   . ASP C 1 138 ? -10.190 12.760  20.770  1.00 26.84 ? 127  ASP C C   1 
ATOM   4149 O  O   . ASP C 1 138 ? -10.037 11.575  20.507  1.00 26.89 ? 127  ASP C O   1 
ATOM   4150 C  CB  . ASP C 1 138 ? -8.389  13.682  22.244  1.00 28.61 ? 127  ASP C CB  1 
ATOM   4151 C  CG  . ASP C 1 138 ? -9.331  14.213  23.295  1.00 31.04 ? 127  ASP C CG  1 
ATOM   4152 O  OD1 . ASP C 1 138 ? -9.656  15.423  23.250  1.00 30.54 ? 127  ASP C OD1 1 
ATOM   4153 O  OD2 . ASP C 1 138 ? -9.742  13.420  24.178  1.00 32.49 ? 127  ASP C OD2 1 
ATOM   4154 N  N   . VAL C 1 139 ? -11.376 13.310  20.992  1.00 25.25 ? 128  VAL C N   1 
ATOM   4155 C  CA  . VAL C 1 139 ? -12.604 12.553  20.964  1.00 26.35 ? 128  VAL C CA  1 
ATOM   4156 C  C   . VAL C 1 139 ? -13.031 12.230  19.529  1.00 27.96 ? 128  VAL C C   1 
ATOM   4157 O  O   . VAL C 1 139 ? -13.486 11.106  19.263  1.00 27.04 ? 128  VAL C O   1 
ATOM   4158 C  CB  . VAL C 1 139 ? -13.721 13.298  21.703  1.00 25.75 ? 128  VAL C CB  1 
ATOM   4159 C  CG1 . VAL C 1 139 ? -15.084 12.703  21.391  1.00 26.80 ? 128  VAL C CG1 1 
ATOM   4160 C  CG2 . VAL C 1 139 ? -13.465 13.266  23.194  1.00 25.54 ? 128  VAL C CG2 1 
ATOM   4161 N  N   . LEU C 1 140 ? -12.912 13.210  18.628  1.00 27.16 ? 129  LEU C N   1 
ATOM   4162 C  CA  . LEU C 1 140 ? -13.179 12.992  17.206  1.00 28.16 ? 129  LEU C CA  1 
ATOM   4163 C  C   . LEU C 1 140 ? -12.203 11.970  16.620  1.00 27.54 ? 129  LEU C C   1 
ATOM   4164 O  O   . LEU C 1 140 ? -12.598 11.126  15.814  1.00 25.42 ? 129  LEU C O   1 
ATOM   4165 C  CB  . LEU C 1 140 ? -13.089 14.294  16.407  1.00 28.28 ? 129  LEU C CB  1 
ATOM   4166 C  CG  . LEU C 1 140 ? -14.144 15.366  16.708  1.00 32.63 ? 129  LEU C CG  1 
ATOM   4167 C  CD1 . LEU C 1 140 ? -14.010 16.530  15.724  1.00 33.64 ? 129  LEU C CD1 1 
ATOM   4168 C  CD2 . LEU C 1 140 ? -15.570 14.815  16.692  1.00 32.49 ? 129  LEU C CD2 1 
ATOM   4169 N  N   . ASP C 1 141 ? -10.932 12.075  17.015  1.00 27.31 ? 130  ASP C N   1 
ATOM   4170 C  CA  . ASP C 1 141 ? -9.911  11.098  16.648  1.00 27.93 ? 130  ASP C CA  1 
ATOM   4171 C  C   . ASP C 1 141 ? -10.335 9.674   17.036  1.00 25.98 ? 130  ASP C C   1 
ATOM   4172 O  O   . ASP C 1 141 ? -10.158 8.748   16.283  1.00 24.33 ? 130  ASP C O   1 
ATOM   4173 C  CB  . ASP C 1 141 ? -8.599  11.417  17.357  1.00 32.47 ? 130  ASP C CB  1 
ATOM   4174 C  CG  . ASP C 1 141 ? -7.826  12.560  16.705  1.00 38.03 ? 130  ASP C CG  1 
ATOM   4175 O  OD1 . ASP C 1 141 ? -8.304  13.112  15.686  1.00 43.13 ? 130  ASP C OD1 1 
ATOM   4176 O  OD2 . ASP C 1 141 ? -6.739  12.910  17.233  1.00 39.71 ? 130  ASP C OD2 1 
ATOM   4177 N  N   . VAL C 1 142 ? -10.872 9.511   18.235  1.00 24.83 ? 131  VAL C N   1 
ATOM   4178 C  CA  . VAL C 1 142 ? -11.307 8.201   18.692  1.00 25.05 ? 131  VAL C CA  1 
ATOM   4179 C  C   . VAL C 1 142 ? -12.513 7.709   17.886  1.00 25.64 ? 131  VAL C C   1 
ATOM   4180 O  O   . VAL C 1 142 ? -12.569 6.533   17.502  1.00 24.56 ? 131  VAL C O   1 
ATOM   4181 C  CB  . VAL C 1 142 ? -11.573 8.217   20.215  1.00 24.77 ? 131  VAL C CB  1 
ATOM   4182 C  CG1 . VAL C 1 142 ? -12.435 7.039   20.659  1.00 24.18 ? 131  VAL C CG1 1 
ATOM   4183 C  CG2 . VAL C 1 142 ? -10.245 8.236   20.976  1.00 22.08 ? 131  VAL C CG2 1 
ATOM   4184 N  N   . GLN C 1 143 ? -13.461 8.609   17.609  1.00 24.90 ? 132  GLN C N   1 
ATOM   4185 C  CA  . GLN C 1 143 ? -14.679 8.219   16.886  1.00 24.61 ? 132  GLN C CA  1 
ATOM   4186 C  C   . GLN C 1 143 ? -14.307 7.732   15.499  1.00 24.38 ? 132  GLN C C   1 
ATOM   4187 O  O   . GLN C 1 143 ? -14.805 6.695   15.057  1.00 23.45 ? 132  GLN C O   1 
ATOM   4188 C  CB  . GLN C 1 143 ? -15.695 9.363   16.814  1.00 23.49 ? 132  GLN C CB  1 
ATOM   4189 C  CG  . GLN C 1 143 ? -16.307 9.725   18.164  1.00 23.98 ? 132  GLN C CG  1 
ATOM   4190 C  CD  . GLN C 1 143 ? -17.292 8.693   18.679  1.00 24.19 ? 132  GLN C CD  1 
ATOM   4191 O  OE1 . GLN C 1 143 ? -17.110 7.475   18.509  1.00 24.52 ? 132  GLN C OE1 1 
ATOM   4192 N  NE2 . GLN C 1 143 ? -18.353 9.170   19.306  1.00 23.21 ? 132  GLN C NE2 1 
ATOM   4193 N  N   . LEU C 1 144 ? -13.404 8.467   14.845  1.00 23.76 ? 133  LEU C N   1 
ATOM   4194 C  CA  . LEU C 1 144 ? -12.844 8.072   13.550  1.00 24.69 ? 133  LEU C CA  1 
ATOM   4195 C  C   . LEU C 1 144 ? -12.048 6.757   13.569  1.00 25.92 ? 133  LEU C C   1 
ATOM   4196 O  O   . LEU C 1 144 ? -12.086 5.992   12.594  1.00 25.94 ? 133  LEU C O   1 
ATOM   4197 C  CB  . LEU C 1 144 ? -11.942 9.181   13.005  1.00 26.02 ? 133  LEU C CB  1 
ATOM   4198 C  CG  . LEU C 1 144 ? -12.605 10.427  12.430  1.00 27.47 ? 133  LEU C CG  1 
ATOM   4199 C  CD1 . LEU C 1 144 ? -11.508 11.393  12.002  1.00 29.85 ? 133  LEU C CD1 1 
ATOM   4200 C  CD2 . LEU C 1 144 ? -13.468 10.042  11.245  1.00 27.95 ? 133  LEU C CD2 1 
ATOM   4201 N  N   . ALA C 1 145 ? -11.287 6.518   14.643  1.00 23.71 ? 134  ALA C N   1 
ATOM   4202 C  CA  . ALA C 1 145 ? -10.542 5.272   14.761  1.00 24.33 ? 134  ALA C CA  1 
ATOM   4203 C  C   . ALA C 1 145 ? -11.512 4.084   14.779  1.00 24.52 ? 134  ALA C C   1 
ATOM   4204 O  O   . ALA C 1 145 ? -11.298 3.117   14.068  1.00 24.32 ? 134  ALA C O   1 
ATOM   4205 C  CB  . ALA C 1 145 ? -9.626  5.282   15.996  1.00 23.61 ? 134  ALA C CB  1 
ATOM   4206 N  N   . PHE C 1 146 ? -12.586 4.190   15.564  1.00 23.74 ? 135  PHE C N   1 
ATOM   4207 C  CA  . PHE C 1 146 ? -13.616 3.157   15.641  1.00 25.50 ? 135  PHE C CA  1 
ATOM   4208 C  C   . PHE C 1 146 ? -14.379 2.978   14.342  1.00 29.88 ? 135  PHE C C   1 
ATOM   4209 O  O   . PHE C 1 146 ? -14.755 1.852   14.003  1.00 30.82 ? 135  PHE C O   1 
ATOM   4210 C  CB  . PHE C 1 146 ? -14.642 3.477   16.716  1.00 23.78 ? 135  PHE C CB  1 
ATOM   4211 C  CG  . PHE C 1 146 ? -14.311 2.928   18.068  1.00 23.41 ? 135  PHE C CG  1 
ATOM   4212 C  CD1 . PHE C 1 146 ? -13.543 3.674   18.970  1.00 23.12 ? 135  PHE C CD1 1 
ATOM   4213 C  CD2 . PHE C 1 146 ? -14.764 1.666   18.453  1.00 23.04 ? 135  PHE C CD2 1 
ATOM   4214 C  CE1 . PHE C 1 146 ? -13.254 3.177   20.240  1.00 23.65 ? 135  PHE C CE1 1 
ATOM   4215 C  CE2 . PHE C 1 146 ? -14.467 1.162   19.720  1.00 23.43 ? 135  PHE C CE2 1 
ATOM   4216 C  CZ  . PHE C 1 146 ? -13.724 1.918   20.618  1.00 22.46 ? 135  PHE C CZ  1 
ATOM   4217 N  N   . LEU C 1 147 ? -14.642 4.073   13.646  1.00 32.16 ? 136  LEU C N   1 
ATOM   4218 C  CA  . LEU C 1 147 ? -15.392 4.044   12.410  1.00 34.44 ? 136  LEU C CA  1 
ATOM   4219 C  C   . LEU C 1 147 ? -14.647 3.253   11.375  1.00 34.45 ? 136  LEU C C   1 
ATOM   4220 O  O   . LEU C 1 147 ? -15.237 2.550   10.608  1.00 37.82 ? 136  LEU C O   1 
ATOM   4221 C  CB  . LEU C 1 147 ? -15.722 5.442   11.899  1.00 34.91 ? 136  LEU C CB  1 
ATOM   4222 C  CG  . LEU C 1 147 ? -17.168 5.838   12.112  1.00 36.33 ? 136  LEU C CG  1 
ATOM   4223 C  CD1 . LEU C 1 147 ? -17.388 7.284   11.751  1.00 35.37 ? 136  LEU C CD1 1 
ATOM   4224 C  CD2 . LEU C 1 147 ? -18.079 4.928   11.320  1.00 37.60 ? 136  LEU C CD2 1 
ATOM   4225 N  N   . ARG C 1 148 ? -13.322 3.360   11.383  1.00 32.70 ? 137  ARG C N   1 
ATOM   4226 C  CA  . ARG C 1 148 ? -12.492 2.540   10.507  1.00 35.27 ? 137  ARG C CA  1 
ATOM   4227 C  C   . ARG C 1 148 ? -12.600 1.045   10.826  1.00 38.60 ? 137  ARG C C   1 
ATOM   4228 O  O   . ARG C 1 148 ? -12.685 0.216   9.920   1.00 40.86 ? 137  ARG C O   1 
ATOM   4229 C  CB  . ARG C 1 148 ? -11.030 2.987   10.583  1.00 32.09 ? 137  ARG C CB  1 
ATOM   4230 C  CG  . ARG C 1 148 ? -10.840 4.495   10.545  1.00 31.27 ? 137  ARG C CG  1 
ATOM   4231 C  CD  . ARG C 1 148 ? -9.446  4.863   10.063  1.00 32.09 ? 137  ARG C CD  1 
ATOM   4232 N  NE  . ARG C 1 148 ? -9.340  6.280   9.728   1.00 33.98 ? 137  ARG C NE  1 
ATOM   4233 C  CZ  . ARG C 1 148 ? -9.027  7.233   10.600  1.00 34.95 ? 137  ARG C CZ  1 
ATOM   4234 N  NH1 . ARG C 1 148 ? -8.788  6.923   11.866  1.00 36.17 ? 137  ARG C NH1 1 
ATOM   4235 N  NH2 . ARG C 1 148 ? -8.953  8.497   10.206  1.00 36.42 ? 137  ARG C NH2 1 
ATOM   4236 N  N   . LEU C 1 149 ? -12.595 0.706   12.114  1.00 36.85 ? 138  LEU C N   1 
ATOM   4237 C  CA  . LEU C 1 149 ? -12.679 -0.692  12.543  1.00 35.60 ? 138  LEU C CA  1 
ATOM   4238 C  C   . LEU C 1 149 ? -14.007 -1.327  12.142  1.00 34.69 ? 138  LEU C C   1 
ATOM   4239 O  O   . LEU C 1 149 ? -14.054 -2.467  11.679  1.00 34.71 ? 138  LEU C O   1 
ATOM   4240 C  CB  . LEU C 1 149 ? -12.482 -0.800  14.057  1.00 32.94 ? 138  LEU C CB  1 
ATOM   4241 C  CG  . LEU C 1 149 ? -12.602 -2.201  14.658  1.00 33.01 ? 138  LEU C CG  1 
ATOM   4242 C  CD1 . LEU C 1 149 ? -13.979 -2.788  14.384  1.00 31.13 ? 138  LEU C CD1 1 
ATOM   4243 C  CD2 . LEU C 1 149 ? -11.510 -3.113  14.119  1.00 31.45 ? 138  LEU C CD2 1 
ATOM   4244 N  N   . LEU C 1 150 ? -15.080 -0.566  12.319  1.00 36.88 ? 139  LEU C N   1 
ATOM   4245 C  CA  . LEU C 1 150 ? -16.422 -0.953  11.870  1.00 34.78 ? 139  LEU C CA  1 
ATOM   4246 C  C   . LEU C 1 150 ? -16.584 -0.928  10.348  1.00 36.50 ? 139  LEU C C   1 
ATOM   4247 O  O   . LEU C 1 150 ? -17.702 -1.084  9.865   1.00 35.08 ? 139  LEU C O   1 
ATOM   4248 C  CB  . LEU C 1 150 ? -17.453 -0.025  12.491  1.00 33.78 ? 139  LEU C CB  1 
ATOM   4249 C  CG  . LEU C 1 150 ? -17.636 -0.079  14.012  1.00 34.33 ? 139  LEU C CG  1 
ATOM   4250 C  CD1 . LEU C 1 150 ? -18.004 1.299   14.556  1.00 31.77 ? 139  LEU C CD1 1 
ATOM   4251 C  CD2 . LEU C 1 150 ? -18.683 -1.126  14.387  1.00 31.45 ? 139  LEU C CD2 1 
ATOM   4252 N  N   . SER C 1 151 ? -15.486 -0.745  9.600   1.00 35.10 ? 140  SER C N   1 
ATOM   4253 C  CA  . SER C 1 151 ? -15.562 -0.593  8.139   1.00 33.50 ? 140  SER C CA  1 
ATOM   4254 C  C   . SER C 1 151 ? -14.630 -1.520  7.373   1.00 30.86 ? 140  SER C C   1 
ATOM   4255 O  O   . SER C 1 151 ? -13.502 -1.719  7.779   1.00 28.12 ? 140  SER C O   1 
ATOM   4256 C  CB  . SER C 1 151 ? -15.242 0.850   7.742   1.00 32.06 ? 140  SER C CB  1 
ATOM   4257 O  OG  . SER C 1 151 ? -16.089 1.746   8.425   1.00 34.11 ? 140  SER C OG  1 
ATOM   4258 N  N   . SER C 1 152 ? -15.118 -2.042  6.250   1.00 32.22 ? 141  SER C N   1 
ATOM   4259 C  CA  . SER C 1 152 ? -14.320 -2.825  5.295   1.00 35.62 ? 141  SER C CA  1 
ATOM   4260 C  C   . SER C 1 152 ? -13.586 -1.936  4.328   1.00 35.62 ? 141  SER C C   1 
ATOM   4261 O  O   . SER C 1 152 ? -12.590 -2.341  3.737   1.00 38.27 ? 141  SER C O   1 
ATOM   4262 C  CB  . SER C 1 152 ? -15.233 -3.682  4.437   1.00 34.69 ? 141  SER C CB  1 
ATOM   4263 O  OG  . SER C 1 152 ? -16.047 -4.467  5.254   1.00 39.91 ? 141  SER C OG  1 
ATOM   4264 N  N   . ARG C 1 153 ? -14.122 -0.736  4.125   1.00 34.82 ? 142  ARG C N   1 
ATOM   4265 C  CA  . ARG C 1 153 ? -13.648 0.146   3.075   1.00 35.09 ? 142  ARG C CA  1 
ATOM   4266 C  C   . ARG C 1 153 ? -14.130 1.565   3.340   1.00 33.25 ? 142  ARG C C   1 
ATOM   4267 O  O   . ARG C 1 153 ? -15.053 1.790   4.139   1.00 30.28 ? 142  ARG C O   1 
ATOM   4268 C  CB  . ARG C 1 153 ? -14.104 -0.358  1.692   1.00 36.48 ? 142  ARG C CB  1 
ATOM   4269 C  CG  . ARG C 1 153 ? -15.573 -0.137  1.412   1.00 39.65 ? 142  ARG C CG  1 
ATOM   4270 C  CD  . ARG C 1 153 ? -16.100 -1.064  0.324   1.00 46.41 ? 142  ARG C CD  1 
ATOM   4271 N  NE  . ARG C 1 153 ? -16.672 -2.285  0.893   1.00 49.44 ? 142  ARG C NE  1 
ATOM   4272 C  CZ  . ARG C 1 153 ? -16.364 -3.522  0.511   1.00 49.84 ? 142  ARG C CZ  1 
ATOM   4273 N  NH1 . ARG C 1 153 ? -15.499 -3.725  -0.479  1.00 52.47 ? 142  ARG C NH1 1 
ATOM   4274 N  NH2 . ARG C 1 153 ? -16.944 -4.559  1.114   1.00 49.92 ? 142  ARG C NH2 1 
ATOM   4275 N  N   . ALA C 1 154 ? -13.481 2.520   2.684   1.00 31.64 ? 143  ALA C N   1 
ATOM   4276 C  CA  . ALA C 1 154 ? -13.861 3.923   2.798   1.00 33.28 ? 143  ALA C CA  1 
ATOM   4277 C  C   . ALA C 1 154 ? -13.596 4.632   1.492   1.00 32.92 ? 143  ALA C C   1 
ATOM   4278 O  O   . ALA C 1 154 ? -12.799 4.163   0.685   1.00 34.03 ? 143  ALA C O   1 
ATOM   4279 C  CB  . ALA C 1 154 ? -13.103 4.602   3.925   1.00 33.08 ? 143  ALA C CB  1 
ATOM   4280 N  N   . SER C 1 155 ? -14.264 5.766   1.295   1.00 33.46 ? 144  SER C N   1 
ATOM   4281 C  CA  . SER C 1 155 ? -14.072 6.568   0.095   1.00 33.69 ? 144  SER C CA  1 
ATOM   4282 C  C   . SER C 1 155 ? -14.318 8.043   0.359   1.00 34.50 ? 144  SER C C   1 
ATOM   4283 O  O   . SER C 1 155 ? -15.022 8.408   1.319   1.00 34.39 ? 144  SER C O   1 
ATOM   4284 C  CB  . SER C 1 155 ? -14.994 6.096   -1.028  1.00 32.57 ? 144  SER C CB  1 
ATOM   4285 O  OG  . SER C 1 155 ? -16.339 6.411   -0.729  1.00 33.54 ? 144  SER C OG  1 
ATOM   4286 N  N   . GLN C 1 156 ? -13.741 8.883   -0.505  1.00 32.54 ? 145  GLN C N   1 
ATOM   4287 C  CA  . GLN C 1 156 ? -13.986 10.315  -0.449  1.00 33.78 ? 145  GLN C CA  1 
ATOM   4288 C  C   . GLN C 1 156 ? -13.804 10.976  -1.799  1.00 33.58 ? 145  GLN C C   1 
ATOM   4289 O  O   . GLN C 1 156 ? -12.849 10.681  -2.542  1.00 31.53 ? 145  GLN C O   1 
ATOM   4290 C  CB  . GLN C 1 156 ? -13.092 11.023  0.583   1.00 31.22 ? 145  GLN C CB  1 
ATOM   4291 C  CG  . GLN C 1 156 ? -13.612 12.409  0.949   1.00 32.80 ? 145  GLN C CG  1 
ATOM   4292 C  CD  . GLN C 1 156 ? -12.762 13.143  1.985   1.00 35.61 ? 145  GLN C CD  1 
ATOM   4293 O  OE1 . GLN C 1 156 ? -13.083 14.273  2.376   1.00 35.95 ? 145  GLN C OE1 1 
ATOM   4294 N  NE2 . GLN C 1 156 ? -11.676 12.515  2.424   1.00 32.50 ? 145  GLN C NE2 1 
ATOM   4295 N  N   . GLN C 1 157 ? -14.718 11.899  -2.078  1.00 32.01 ? 146  GLN C N   1 
ATOM   4296 C  CA  . GLN C 1 157 ? -14.586 12.795  -3.212  1.00 34.96 ? 146  GLN C CA  1 
ATOM   4297 C  C   . GLN C 1 157 ? -14.124 14.180  -2.777  1.00 33.48 ? 146  GLN C C   1 
ATOM   4298 O  O   . GLN C 1 157 ? -14.389 14.627  -1.659  1.00 32.55 ? 146  GLN C O   1 
ATOM   4299 C  CB  . GLN C 1 157 ? -15.914 12.896  -3.976  1.00 36.43 ? 146  GLN C CB  1 
ATOM   4300 C  CG  . GLN C 1 157 ? -16.156 11.667  -4.819  1.00 41.74 ? 146  GLN C CG  1 
ATOM   4301 C  CD  . GLN C 1 157 ? -17.516 11.629  -5.485  1.00 44.23 ? 146  GLN C CD  1 
ATOM   4302 O  OE1 . GLN C 1 157 ? -18.137 12.660  -5.725  1.00 42.80 ? 146  GLN C OE1 1 
ATOM   4303 N  NE2 . GLN C 1 157 ? -17.979 10.418  -5.797  1.00 43.84 ? 146  GLN C NE2 1 
ATOM   4304 N  N   . ILE C 1 158 ? -13.449 14.867  -3.689  1.00 34.74 ? 147  ILE C N   1 
ATOM   4305 C  CA  . ILE C 1 158 ? -13.056 16.244  -3.469  1.00 34.24 ? 147  ILE C CA  1 
ATOM   4306 C  C   . ILE C 1 158 ? -13.089 16.973  -4.810  1.00 34.78 ? 147  ILE C C   1 
ATOM   4307 O  O   . ILE C 1 158 ? -12.481 16.518  -5.791  1.00 36.23 ? 147  ILE C O   1 
ATOM   4308 C  CB  . ILE C 1 158 ? -11.685 16.335  -2.726  1.00 35.25 ? 147  ILE C CB  1 
ATOM   4309 C  CG1 . ILE C 1 158 ? -11.309 17.793  -2.454  1.00 37.14 ? 147  ILE C CG1 1 
ATOM   4310 C  CG2 . ILE C 1 158 ? -10.588 15.582  -3.478  1.00 34.73 ? 147  ILE C CG2 1 
ATOM   4311 C  CD1 . ILE C 1 158 ? -10.322 17.974  -1.316  1.00 38.83 ? 147  ILE C CD1 1 
ATOM   4312 N  N   . THR C 1 159 ? -13.823 18.085  -4.845  1.00 35.44 ? 148  THR C N   1 
ATOM   4313 C  CA  . THR C 1 159 ? -14.008 18.903  -6.055  1.00 35.03 ? 148  THR C CA  1 
ATOM   4314 C  C   . THR C 1 159 ? -13.110 20.152  -6.057  1.00 34.86 ? 148  THR C C   1 
ATOM   4315 O  O   . THR C 1 159 ? -13.215 21.026  -5.175  1.00 33.37 ? 148  THR C O   1 
ATOM   4316 C  CB  . THR C 1 159 ? -15.486 19.362  -6.222  1.00 35.06 ? 148  THR C CB  1 
ATOM   4317 O  OG1 . THR C 1 159 ? -16.356 18.229  -6.253  1.00 36.28 ? 148  THR C OG1 1 
ATOM   4318 C  CG2 . THR C 1 159 ? -15.686 20.169  -7.510  1.00 35.67 ? 148  THR C CG2 1 
ATOM   4319 N  N   . TYR C 1 160 ? -12.260 20.236  -7.075  1.00 34.23 ? 149  TYR C N   1 
ATOM   4320 C  CA  . TYR C 1 160 ? -11.415 21.416  -7.316  1.00 35.00 ? 149  TYR C CA  1 
ATOM   4321 C  C   . TYR C 1 160 ? -12.068 22.386  -8.323  1.00 34.82 ? 149  TYR C C   1 
ATOM   4322 O  O   . TYR C 1 160 ? -12.223 22.057  -9.509  1.00 33.70 ? 149  TYR C O   1 
ATOM   4323 C  CB  . TYR C 1 160 ? -10.051 20.932  -7.829  1.00 35.37 ? 149  TYR C CB  1 
ATOM   4324 C  CG  . TYR C 1 160 ? -8.987  21.985  -7.991  1.00 36.81 ? 149  TYR C CG  1 
ATOM   4325 C  CD1 . TYR C 1 160 ? -8.306  22.501  -6.877  1.00 37.20 ? 149  TYR C CD1 1 
ATOM   4326 C  CD2 . TYR C 1 160 ? -8.633  22.443  -9.261  1.00 37.15 ? 149  TYR C CD2 1 
ATOM   4327 C  CE1 . TYR C 1 160 ? -7.309  23.449  -7.028  1.00 37.67 ? 149  TYR C CE1 1 
ATOM   4328 C  CE2 . TYR C 1 160 ? -7.646  23.397  -9.429  1.00 37.61 ? 149  TYR C CE2 1 
ATOM   4329 C  CZ  . TYR C 1 160 ? -6.981  23.894  -8.318  1.00 39.88 ? 149  TYR C CZ  1 
ATOM   4330 O  OH  . TYR C 1 160 ? -5.992  24.838  -8.493  1.00 38.63 ? 149  TYR C OH  1 
ATOM   4331 N  N   . HIS C 1 161 ? -12.475 23.560  -7.848  1.00 36.29 ? 150  HIS C N   1 
ATOM   4332 C  CA  . HIS C 1 161 ? -12.995 24.622  -8.733  1.00 38.23 ? 150  HIS C CA  1 
ATOM   4333 C  C   . HIS C 1 161 ? -11.841 25.417  -9.278  1.00 38.27 ? 150  HIS C C   1 
ATOM   4334 O  O   . HIS C 1 161 ? -11.041 25.942  -8.509  1.00 39.28 ? 150  HIS C O   1 
ATOM   4335 C  CB  . HIS C 1 161 ? -13.972 25.541  -8.000  1.00 37.73 ? 150  HIS C CB  1 
ATOM   4336 C  CG  . HIS C 1 161 ? -15.238 24.853  -7.568  1.00 37.77 ? 150  HIS C CG  1 
ATOM   4337 N  ND1 . HIS C 1 161 ? -16.245 24.583  -8.422  1.00 39.67 ? 150  HIS C ND1 1 
ATOM   4338 C  CD2 . HIS C 1 161 ? -15.634 24.367  -6.328  1.00 38.55 ? 150  HIS C CD2 1 
ATOM   4339 C  CE1 . HIS C 1 161 ? -17.233 23.956  -7.763  1.00 39.27 ? 150  HIS C CE1 1 
ATOM   4340 N  NE2 . HIS C 1 161 ? -16.858 23.827  -6.479  1.00 37.80 ? 150  HIS C NE2 1 
ATOM   4341 N  N   . CYS C 1 162 ? -11.747 25.512  -10.605 1.00 36.74 ? 151  CYS C N   1 
ATOM   4342 C  CA  . CYS C 1 162 ? -10.552 26.049  -11.258 1.00 38.31 ? 151  CYS C CA  1 
ATOM   4343 C  C   . CYS C 1 162 ? -10.843 27.244  -12.183 1.00 42.14 ? 151  CYS C C   1 
ATOM   4344 O  O   . CYS C 1 162 ? -11.844 27.246  -12.918 1.00 42.98 ? 151  CYS C O   1 
ATOM   4345 C  CB  . CYS C 1 162 ? -9.884  24.940  -12.077 1.00 34.29 ? 151  CYS C CB  1 
ATOM   4346 S  SG  . CYS C 1 162 ? -10.964 24.272  -13.359 1.00 28.58 ? 151  CYS C SG  1 
ATOM   4347 N  N   . LYS C 1 163 ? -9.971  28.253  -12.140 1.00 42.50 ? 152  LYS C N   1 
ATOM   4348 C  CA  . LYS C 1 163 ? -9.921  29.270  -13.198 1.00 43.85 ? 152  LYS C CA  1 
ATOM   4349 C  C   . LYS C 1 163 ? -8.471  29.481  -13.619 1.00 43.60 ? 152  LYS C C   1 
ATOM   4350 O  O   . LYS C 1 163 ? -7.647  29.940  -12.821 1.00 42.28 ? 152  LYS C O   1 
ATOM   4351 C  CB  . LYS C 1 163 ? -10.574 30.590  -12.772 1.00 46.50 ? 152  LYS C CB  1 
ATOM   4352 C  CG  . LYS C 1 163 ? -10.614 31.630  -13.895 1.00 50.06 ? 152  LYS C CG  1 
ATOM   4353 C  CD  . LYS C 1 163 ? -11.401 32.886  -13.527 1.00 50.20 ? 152  LYS C CD  1 
ATOM   4354 C  CE  . LYS C 1 163 ? -10.506 33.984  -12.969 1.00 49.69 ? 152  LYS C CE  1 
ATOM   4355 N  NZ  . LYS C 1 163 ? -11.279 35.237  -12.711 1.00 50.81 ? 152  LYS C NZ  1 
ATOM   4356 N  N   . ASN C 1 164 ? -8.179  29.137  -14.877 1.00 43.42 ? 153  ASN C N   1 
ATOM   4357 C  CA  . ASN C 1 164 ? -6.806  29.116  -15.427 1.00 44.43 ? 153  ASN C CA  1 
ATOM   4358 C  C   . ASN C 1 164 ? -5.872  28.273  -14.569 1.00 43.93 ? 153  ASN C C   1 
ATOM   4359 O  O   . ASN C 1 164 ? -4.728  28.637  -14.314 1.00 44.38 ? 153  ASN C O   1 
ATOM   4360 C  CB  . ASN C 1 164 ? -6.240  30.531  -15.639 1.00 42.12 ? 153  ASN C CB  1 
ATOM   4361 C  CG  . ASN C 1 164 ? -7.061  31.343  -16.611 1.00 40.92 ? 153  ASN C CG  1 
ATOM   4362 O  OD1 . ASN C 1 164 ? -7.295  32.528  -16.391 1.00 42.60 ? 153  ASN C OD1 1 
ATOM   4363 N  ND2 . ASN C 1 164 ? -7.516  30.707  -17.687 1.00 37.55 ? 153  ASN C ND2 1 
ATOM   4364 N  N   . SER C 1 165 ? -6.386  27.131  -14.136 1.00 45.94 ? 154  SER C N   1 
ATOM   4365 C  CA  . SER C 1 165 ? -5.658  26.260  -13.254 1.00 46.20 ? 154  SER C CA  1 
ATOM   4366 C  C   . SER C 1 165 ? -5.945  24.815  -13.602 1.00 45.60 ? 154  SER C C   1 
ATOM   4367 O  O   . SER C 1 165 ? -7.044  24.291  -13.341 1.00 45.07 ? 154  SER C O   1 
ATOM   4368 C  CB  . SER C 1 165 ? -6.024  26.553  -11.796 1.00 47.13 ? 154  SER C CB  1 
ATOM   4369 O  OG  . SER C 1 165 ? -5.189  25.817  -10.930 1.00 47.62 ? 154  SER C OG  1 
ATOM   4370 N  N   . ILE C 1 166 ? -4.945  24.192  -14.217 1.00 44.81 ? 155  ILE C N   1 
ATOM   4371 C  CA  . ILE C 1 166 ? -4.920  22.754  -14.441 1.00 45.71 ? 155  ILE C CA  1 
ATOM   4372 C  C   . ILE C 1 166 ? -5.060  22.050  -13.091 1.00 45.64 ? 155  ILE C C   1 
ATOM   4373 O  O   . ILE C 1 166 ? -4.399  22.431  -12.110 1.00 44.10 ? 155  ILE C O   1 
ATOM   4374 C  CB  . ILE C 1 166 ? -3.604  22.308  -15.147 1.00 46.86 ? 155  ILE C CB  1 
ATOM   4375 C  CG1 . ILE C 1 166 ? -3.378  23.109  -16.446 1.00 49.01 ? 155  ILE C CG1 1 
ATOM   4376 C  CG2 . ILE C 1 166 ? -3.573  20.799  -15.408 1.00 43.29 ? 155  ILE C CG2 1 
ATOM   4377 C  CD1 . ILE C 1 166 ? -4.459  22.953  -17.493 1.00 48.58 ? 155  ILE C CD1 1 
ATOM   4378 N  N   . ALA C 1 167 ? -5.946  21.053  -13.062 1.00 43.65 ? 156  ALA C N   1 
ATOM   4379 C  CA  . ALA C 1 167 ? -6.177  20.198  -11.902 1.00 43.60 ? 156  ALA C CA  1 
ATOM   4380 C  C   . ALA C 1 167 ? -5.677  18.777  -12.163 1.00 43.54 ? 156  ALA C C   1 
ATOM   4381 O  O   . ALA C 1 167 ? -5.132  18.122  -11.277 1.00 41.16 ? 156  ALA C O   1 
ATOM   4382 C  CB  . ALA C 1 167 ? -7.662  20.168  -11.567 1.00 41.16 ? 156  ALA C CB  1 
ATOM   4383 N  N   . TYR C 1 168 ? -5.891  18.294  -13.381 1.00 46.04 ? 157  TYR C N   1 
ATOM   4384 C  CA  . TYR C 1 168 ? -5.539  16.923  -13.722 1.00 50.38 ? 157  TYR C CA  1 
ATOM   4385 C  C   . TYR C 1 168 ? -4.840  16.816  -15.083 1.00 53.19 ? 157  TYR C C   1 
ATOM   4386 O  O   . TYR C 1 168 ? -3.620  16.669  -15.137 1.00 51.89 ? 157  TYR C O   1 
ATOM   4387 C  CB  . TYR C 1 168 ? -6.773  16.010  -13.641 1.00 48.72 ? 157  TYR C CB  1 
ATOM   4388 C  CG  . TYR C 1 168 ? -6.480  14.552  -13.917 1.00 48.83 ? 157  TYR C CG  1 
ATOM   4389 C  CD1 . TYR C 1 168 ? -5.500  13.867  -13.187 1.00 48.69 ? 157  TYR C CD1 1 
ATOM   4390 C  CD2 . TYR C 1 168 ? -7.181  13.852  -14.907 1.00 46.49 ? 157  TYR C CD2 1 
ATOM   4391 C  CE1 . TYR C 1 168 ? -5.225  12.530  -13.435 1.00 48.91 ? 157  TYR C CE1 1 
ATOM   4392 C  CE2 . TYR C 1 168 ? -6.913  12.513  -15.156 1.00 48.60 ? 157  TYR C CE2 1 
ATOM   4393 C  CZ  . TYR C 1 168 ? -5.934  11.859  -14.417 1.00 48.62 ? 157  TYR C CZ  1 
ATOM   4394 O  OH  . TYR C 1 168 ? -5.655  10.538  -14.654 1.00 46.88 ? 157  TYR C OH  1 
HETATM 4395 N  N   . MSE C 1 169 ? -5.613  16.889  -16.167 1.00 58.45 ? 158  MSE C N   1 
HETATM 4396 C  CA  . MSE C 1 169 ? -5.063  16.799  -17.520 1.00 62.20 ? 158  MSE C CA  1 
HETATM 4397 C  C   . MSE C 1 169 ? -4.730  18.184  -17.998 1.00 59.93 ? 158  MSE C C   1 
HETATM 4398 O  O   . MSE C 1 169 ? -5.512  19.109  -17.804 1.00 57.63 ? 158  MSE C O   1 
HETATM 4399 C  CB  . MSE C 1 169 ? -6.106  16.142  -18.427 1.00 70.10 ? 158  MSE C CB  1 
HETATM 4400 C  CG  . MSE C 1 169 ? -5.631  15.882  -19.859 1.00 82.13 ? 158  MSE C CG  1 
HETATM 4401 SE SE  . MSE C 1 169 ? -4.984  14.025  -20.063 1.00 89.66 ? 158  MSE C SE  1 
HETATM 4402 C  CE  . MSE C 1 169 ? -6.708  13.066  -20.117 1.00 89.66 ? 158  MSE C CE  1 
ATOM   4403 N  N   . ASP C 1 170 ? -3.557  18.339  -18.610 1.00 60.09 ? 159  ASP C N   1 
ATOM   4404 C  CA  . ASP C 1 170 ? -3.189  19.582  -19.294 1.00 64.10 ? 159  ASP C CA  1 
ATOM   4405 C  C   . ASP C 1 170 ? -3.371  19.412  -20.803 1.00 63.07 ? 159  ASP C C   1 
ATOM   4406 O  O   . ASP C 1 170 ? -2.686  18.594  -21.418 1.00 63.94 ? 159  ASP C O   1 
ATOM   4407 C  CB  . ASP C 1 170 ? -1.745  19.985  -18.958 1.00 66.61 ? 159  ASP C CB  1 
ATOM   4408 C  CG  . ASP C 1 170 ? -1.297  21.245  -19.692 1.00 69.02 ? 159  ASP C CG  1 
ATOM   4409 O  OD1 . ASP C 1 170 ? -1.296  21.246  -20.938 1.00 70.83 ? 159  ASP C OD1 1 
ATOM   4410 O  OD2 . ASP C 1 170 ? -0.928  22.233  -19.023 1.00 71.78 ? 159  ASP C OD2 1 
ATOM   4411 N  N   . GLN C 1 171 ? -4.291  20.188  -21.385 1.00 63.54 ? 160  GLN C N   1 
ATOM   4412 C  CA  . GLN C 1 171 ? -4.659  20.070  -22.807 1.00 67.28 ? 160  GLN C CA  1 
ATOM   4413 C  C   . GLN C 1 171 ? -3.475  20.271  -23.755 1.00 69.42 ? 160  GLN C C   1 
ATOM   4414 O  O   . GLN C 1 171 ? -3.317  19.519  -24.723 1.00 67.57 ? 160  GLN C O   1 
ATOM   4415 C  CB  . GLN C 1 171 ? -5.798  21.032  -23.170 1.00 66.33 ? 160  GLN C CB  1 
ATOM   4416 N  N   . ALA C 1 172 ? -2.648  21.275  -23.450 1.00 71.93 ? 161  ALA C N   1 
ATOM   4417 C  CA  . ALA C 1 172 ? -1.465  21.636  -24.246 1.00 73.56 ? 161  ALA C CA  1 
ATOM   4418 C  C   . ALA C 1 172 ? -0.333  20.587  -24.258 1.00 76.68 ? 161  ALA C C   1 
ATOM   4419 O  O   . ALA C 1 172 ? 0.507   20.588  -25.161 1.00 79.14 ? 161  ALA C O   1 
ATOM   4420 C  CB  . ALA C 1 172 ? -0.929  22.997  -23.808 1.00 69.75 ? 161  ALA C CB  1 
ATOM   4421 N  N   . SER C 1 173 ? -0.308  19.691  -23.275 1.00 75.35 ? 162  SER C N   1 
ATOM   4422 C  CA  . SER C 1 173 ? 0.756   18.690  -23.208 1.00 73.97 ? 162  SER C CA  1 
ATOM   4423 C  C   . SER C 1 173 ? 0.261   17.242  -23.294 1.00 70.43 ? 162  SER C C   1 
ATOM   4424 O  O   . SER C 1 173 ? 1.070   16.322  -23.429 1.00 69.27 ? 162  SER C O   1 
ATOM   4425 C  CB  . SER C 1 173 ? 1.599   18.895  -21.945 1.00 77.95 ? 162  SER C CB  1 
ATOM   4426 O  OG  . SER C 1 173 ? 0.820   18.693  -20.778 1.00 79.82 ? 162  SER C OG  1 
ATOM   4427 N  N   . GLY C 1 174 ? -1.055  17.044  -23.214 1.00 67.07 ? 163  GLY C N   1 
ATOM   4428 C  CA  . GLY C 1 174 ? -1.655  15.699  -23.243 1.00 64.90 ? 163  GLY C CA  1 
ATOM   4429 C  C   . GLY C 1 174 ? -1.344  14.775  -22.061 1.00 65.87 ? 163  GLY C C   1 
ATOM   4430 O  O   . GLY C 1 174 ? -1.792  13.622  -22.038 1.00 62.69 ? 163  GLY C O   1 
ATOM   4431 N  N   . ASN C 1 175 ? -0.690  15.345  -21.052 1.00 62.68 ? 164  ASN C N   1 
ATOM   4432 C  CA  . ASN C 1 175 ? -0.195  14.642  -19.880 1.00 64.34 ? 164  ASN C CA  1 
ATOM   4433 C  C   . ASN C 1 175 ? -0.624  15.193  -18.523 1.00 64.46 ? 164  ASN C C   1 
ATOM   4434 O  O   . ASN C 1 175 ? -1.266  16.227  -18.395 1.00 64.75 ? 164  ASN C O   1 
ATOM   4435 C  CB  . ASN C 1 175 ? 1.321   14.534  -19.895 1.00 63.47 ? 164  ASN C CB  1 
ATOM   4436 C  CG  . ASN C 1 175 ? 1.999   15.837  -19.567 1.00 65.35 ? 164  ASN C CG  1 
ATOM   4437 O  OD1 . ASN C 1 175 ? 1.637   16.519  -18.630 1.00 66.19 ? 164  ASN C OD1 1 
ATOM   4438 N  ND2 . ASN C 1 175 ? 2.990   16.185  -20.347 1.00 66.75 ? 164  ASN C ND2 1 
ATOM   4439 N  N   . VAL C 1 176 ? -0.294  14.424  -17.510 1.00 61.24 ? 165  VAL C N   1 
ATOM   4440 C  CA  . VAL C 1 176 ? -0.776  14.635  -16.178 1.00 57.89 ? 165  VAL C CA  1 
ATOM   4441 C  C   . VAL C 1 176 ? 0.225   15.215  -15.199 1.00 58.04 ? 165  VAL C C   1 
ATOM   4442 O  O   . VAL C 1 176 ? -0.033  15.258  -14.022 1.00 59.31 ? 165  VAL C O   1 
ATOM   4443 C  CB  . VAL C 1 176 ? -1.270  13.306  -15.655 1.00 57.90 ? 165  VAL C CB  1 
ATOM   4444 C  CG1 . VAL C 1 176 ? -0.977  13.170  -14.184 1.00 59.14 ? 165  VAL C CG1 1 
ATOM   4445 C  CG2 . VAL C 1 176 ? -2.725  13.125  -16.003 1.00 55.06 ? 165  VAL C CG2 1 
ATOM   4446 N  N   . LYS C 1 177 ? 1.363   15.674  -15.675 1.00 57.57 ? 166  LYS C N   1 
ATOM   4447 C  CA  . LYS C 1 177 ? 2.470   16.024  -14.798 1.00 58.76 ? 166  LYS C CA  1 
ATOM   4448 C  C   . LYS C 1 177 ? 2.180   17.164  -13.860 1.00 59.48 ? 166  LYS C C   1 
ATOM   4449 O  O   . LYS C 1 177 ? 2.864   17.354  -12.876 1.00 62.30 ? 166  LYS C O   1 
ATOM   4450 C  CB  . LYS C 1 177 ? 3.721   16.344  -15.604 1.00 61.22 ? 166  LYS C CB  1 
ATOM   4451 N  N   . LYS C 1 178 ? 1.201   17.961  -14.223 1.00 57.84 ? 167  LYS C N   1 
ATOM   4452 C  CA  . LYS C 1 178 ? 0.772   19.153  -13.481 1.00 54.82 ? 167  LYS C CA  1 
ATOM   4453 C  C   . LYS C 1 178 ? -0.415  18.852  -12.554 1.00 53.25 ? 167  LYS C C   1 
ATOM   4454 O  O   . LYS C 1 178 ? -0.911  19.753  -11.860 1.00 49.88 ? 167  LYS C O   1 
ATOM   4455 C  CB  . LYS C 1 178 ? 0.384   20.288  -14.443 1.00 58.36 ? 167  LYS C CB  1 
ATOM   4456 C  CG  . LYS C 1 178 ? 1.532   20.976  -15.169 1.00 58.26 ? 167  LYS C CG  1 
ATOM   4457 C  CD  . LYS C 1 178 ? 0.985   22.077  -16.070 1.00 60.76 ? 167  LYS C CD  1 
ATOM   4458 C  CE  . LYS C 1 178 ? 2.072   22.898  -16.758 1.00 61.15 ? 167  LYS C CE  1 
ATOM   4459 N  NZ  . LYS C 1 178 ? 1.497   24.110  -17.419 1.00 61.41 ? 167  LYS C NZ  1 
ATOM   4460 N  N   . ALA C 1 179 ? -0.870  17.595  -12.556 1.00 47.85 ? 168  ALA C N   1 
ATOM   4461 C  CA  . ALA C 1 179 ? -2.045  17.181  -11.781 1.00 45.67 ? 168  ALA C CA  1 
ATOM   4462 C  C   . ALA C 1 179 ? -1.845  17.428  -10.294 1.00 44.21 ? 168  ALA C C   1 
ATOM   4463 O  O   . ALA C 1 179 ? -0.751  17.204  -9.762  1.00 44.54 ? 168  ALA C O   1 
ATOM   4464 C  CB  . ALA C 1 179 ? -2.373  15.717  -12.037 1.00 43.92 ? 168  ALA C CB  1 
ATOM   4465 N  N   . LEU C 1 180 ? -2.898  17.900  -9.624  1.00 43.18 ? 169  LEU C N   1 
ATOM   4466 C  CA  . LEU C 1 180 ? -2.822  18.171  -8.183  1.00 40.51 ? 169  LEU C CA  1 
ATOM   4467 C  C   . LEU C 1 180 ? -2.631  16.898  -7.337  1.00 39.68 ? 169  LEU C C   1 
ATOM   4468 O  O   . LEU C 1 180 ? -2.805  15.775  -7.832  1.00 38.16 ? 169  LEU C O   1 
ATOM   4469 C  CB  . LEU C 1 180 ? -4.027  18.994  -7.699  1.00 38.86 ? 169  LEU C CB  1 
ATOM   4470 C  CG  . LEU C 1 180 ? -5.454  18.434  -7.765  1.00 38.35 ? 169  LEU C CG  1 
ATOM   4471 C  CD1 . LEU C 1 180 ? -5.698  17.370  -6.711  1.00 38.73 ? 169  LEU C CD1 1 
ATOM   4472 C  CD2 . LEU C 1 180 ? -6.464  19.559  -7.608  1.00 37.01 ? 169  LEU C CD2 1 
ATOM   4473 N  N   . LYS C 1 181 ? -2.266  17.100  -6.071  1.00 38.94 ? 170  LYS C N   1 
ATOM   4474 C  CA  . LYS C 1 181 ? -2.105  16.024  -5.094  1.00 42.58 ? 170  LYS C CA  1 
ATOM   4475 C  C   . LYS C 1 181 ? -2.967  16.264  -3.849  1.00 41.42 ? 170  LYS C C   1 
ATOM   4476 O  O   . LYS C 1 181 ? -3.262  17.419  -3.475  1.00 39.71 ? 170  LYS C O   1 
ATOM   4477 C  CB  . LYS C 1 181 ? -0.641  15.895  -4.654  1.00 43.91 ? 170  LYS C CB  1 
ATOM   4478 C  CG  . LYS C 1 181 ? 0.346   15.503  -5.742  1.00 46.68 ? 170  LYS C CG  1 
ATOM   4479 C  CD  . LYS C 1 181 ? 1.740   15.331  -5.142  1.00 49.94 ? 170  LYS C CD  1 
ATOM   4480 C  CE  . LYS C 1 181 ? 2.241   16.615  -4.487  1.00 51.61 ? 170  LYS C CE  1 
ATOM   4481 N  NZ  . LYS C 1 181 ? 3.448   16.415  -3.632  1.00 54.74 ? 170  LYS C NZ  1 
ATOM   4482 N  N   . LEU C 1 182 ? -3.351  15.186  -3.195  1.00 40.18 ? 171  LEU C N   1 
ATOM   4483 C  CA  . LEU C 1 182 ? -4.133  15.263  -1.974  1.00 40.92 ? 171  LEU C CA  1 
ATOM   4484 C  C   . LEU C 1 182 ? -3.407  14.596  -0.826  1.00 41.30 ? 171  LEU C C   1 
ATOM   4485 O  O   . LEU C 1 182 ? -2.729  13.618  -1.030  1.00 42.33 ? 171  LEU C O   1 
ATOM   4486 C  CB  . LEU C 1 182 ? -5.465  14.576  -2.174  1.00 39.26 ? 171  LEU C CB  1 
ATOM   4487 C  CG  . LEU C 1 182 ? -6.315  14.994  -3.357  1.00 37.54 ? 171  LEU C CG  1 
ATOM   4488 C  CD1 . LEU C 1 182 ? -7.272  13.868  -3.669  1.00 34.94 ? 171  LEU C CD1 1 
ATOM   4489 C  CD2 . LEU C 1 182 ? -7.078  16.225  -2.931  1.00 37.01 ? 171  LEU C CD2 1 
HETATM 4490 N  N   . MSE C 1 183 ? -3.555  15.131  0.376   1.00 43.60 ? 172  MSE C N   1 
HETATM 4491 C  CA  . MSE C 1 183 ? -2.975  14.515  1.553   1.00 47.56 ? 172  MSE C CA  1 
HETATM 4492 C  C   . MSE C 1 183 ? -4.010  13.723  2.291   1.00 48.03 ? 172  MSE C C   1 
HETATM 4493 O  O   . MSE C 1 183 ? -5.011  14.255  2.790   1.00 46.31 ? 172  MSE C O   1 
HETATM 4494 C  CB  . MSE C 1 183 ? -2.435  15.557  2.514   1.00 51.03 ? 172  MSE C CB  1 
HETATM 4495 C  CG  . MSE C 1 183 ? -1.614  14.985  3.671   1.00 60.36 ? 172  MSE C CG  1 
HETATM 4496 SE SE  . MSE C 1 183 ? -0.272  13.654  3.118   1.00 78.18 ? 172  MSE C SE  1 
HETATM 4497 C  CE  . MSE C 1 183 ? 0.433   13.152  4.877   1.00 74.28 ? 172  MSE C CE  1 
ATOM   4498 N  N   . GLY C 1 184 ? -3.762  12.432  2.396   1.00 46.40 ? 173  GLY C N   1 
ATOM   4499 C  CA  . GLY C 1 184 ? -4.624  11.528  3.151   1.00 50.22 ? 173  GLY C CA  1 
ATOM   4500 C  C   . GLY C 1 184 ? -4.283  11.563  4.628   1.00 52.27 ? 173  GLY C C   1 
ATOM   4501 O  O   . GLY C 1 184 ? -3.410  12.321  5.059   1.00 53.37 ? 173  GLY C O   1 
ATOM   4502 N  N   . SER C 1 185 ? -4.990  10.757  5.411   1.00 54.17 ? 174  SER C N   1 
ATOM   4503 C  CA  . SER C 1 185 ? -4.598  10.501  6.795   1.00 54.66 ? 174  SER C CA  1 
ATOM   4504 C  C   . SER C 1 185 ? -3.402  9.554   6.793   1.00 56.45 ? 174  SER C C   1 
ATOM   4505 O  O   . SER C 1 185 ? -3.061  8.979   5.746   1.00 57.20 ? 174  SER C O   1 
ATOM   4506 C  CB  . SER C 1 185 ? -5.769  9.931   7.599   1.00 50.08 ? 174  SER C CB  1 
ATOM   4507 O  OG  . SER C 1 185 ? -6.643  10.980  7.976   1.00 47.46 ? 174  SER C OG  1 
ATOM   4508 N  N   . ASN C 1 186 ? -2.760  9.410   7.952   1.00 57.30 ? 175  ASN C N   1 
ATOM   4509 C  CA  . ASN C 1 186 ? -1.532  8.622   8.063   1.00 58.88 ? 175  ASN C CA  1 
ATOM   4510 C  C   . ASN C 1 186 ? -0.480  9.166   7.078   1.00 56.98 ? 175  ASN C C   1 
ATOM   4511 O  O   . ASN C 1 186 ? 0.210   8.416   6.384   1.00 56.37 ? 175  ASN C O   1 
ATOM   4512 C  CB  . ASN C 1 186 ? -1.812  7.116   7.856   1.00 54.45 ? 175  ASN C CB  1 
ATOM   4513 N  N   . GLY C 1 188 ? 0.710   10.194  4.086   1.00 46.15 ? 177  GLY C N   1 
ATOM   4514 C  CA  . GLY C 1 188 ? 0.341   9.434   2.883   1.00 52.12 ? 177  GLY C CA  1 
ATOM   4515 C  C   . GLY C 1 188 ? -0.370  10.271  1.818   1.00 54.72 ? 177  GLY C C   1 
ATOM   4516 O  O   . GLY C 1 188 ? -1.446  10.833  2.066   1.00 58.83 ? 177  GLY C O   1 
ATOM   4517 N  N   . GLU C 1 189 ? 0.220   10.342  0.626   1.00 52.21 ? 178  GLU C N   1 
ATOM   4518 C  CA  . GLU C 1 189 ? -0.281  11.220  -0.439  1.00 50.28 ? 178  GLU C CA  1 
ATOM   4519 C  C   . GLU C 1 189 ? -1.057  10.478  -1.538  1.00 47.42 ? 178  GLU C C   1 
ATOM   4520 O  O   . GLU C 1 189 ? -0.679  9.360   -1.940  1.00 41.38 ? 178  GLU C O   1 
ATOM   4521 C  CB  . GLU C 1 189 ? 0.875   12.006  -1.067  1.00 52.08 ? 178  GLU C CB  1 
ATOM   4522 C  CG  . GLU C 1 189 ? 1.333   13.234  -0.280  1.00 53.18 ? 178  GLU C CG  1 
ATOM   4523 C  CD  . GLU C 1 189 ? 2.496   13.963  -0.947  1.00 51.58 ? 178  GLU C CD  1 
ATOM   4524 O  OE1 . GLU C 1 189 ? 3.099   13.413  -1.891  1.00 52.13 ? 178  GLU C OE1 1 
ATOM   4525 O  OE2 . GLU C 1 189 ? 2.819   15.091  -0.526  1.00 55.15 ? 178  GLU C OE2 1 
ATOM   4526 N  N   . PHE C 1 190 ? -2.143  11.102  -2.010  1.00 43.92 ? 179  PHE C N   1 
ATOM   4527 C  CA  . PHE C 1 190 ? -2.878  10.572  -3.168  1.00 46.28 ? 179  PHE C CA  1 
ATOM   4528 C  C   . PHE C 1 190 ? -2.534  11.352  -4.431  1.00 45.81 ? 179  PHE C C   1 
ATOM   4529 O  O   . PHE C 1 190 ? -2.626  12.582  -4.451  1.00 46.68 ? 179  PHE C O   1 
ATOM   4530 C  CB  . PHE C 1 190 ? -4.395  10.546  -2.936  1.00 46.42 ? 179  PHE C CB  1 
ATOM   4531 C  CG  . PHE C 1 190 ? -4.796  9.925   -1.631  1.00 46.84 ? 179  PHE C CG  1 
ATOM   4532 C  CD1 . PHE C 1 190 ? -4.291  8.678   -1.249  1.00 45.24 ? 179  PHE C CD1 1 
ATOM   4533 C  CD2 . PHE C 1 190 ? -5.669  10.597  -0.771  1.00 46.32 ? 179  PHE C CD2 1 
ATOM   4534 C  CE1 . PHE C 1 190 ? -4.642  8.120   -0.032  1.00 45.62 ? 179  PHE C CE1 1 
ATOM   4535 C  CE2 . PHE C 1 190 ? -6.035  10.037  0.444   1.00 46.14 ? 179  PHE C CE2 1 
ATOM   4536 C  CZ  . PHE C 1 190 ? -5.516  8.799   0.814   1.00 46.46 ? 179  PHE C CZ  1 
ATOM   4537 N  N   . LYS C 1 191 ? -2.124  10.633  -5.473  1.00 46.26 ? 180  LYS C N   1 
ATOM   4538 C  CA  . LYS C 1 191 ? -1.578  11.271  -6.670  1.00 45.79 ? 180  LYS C CA  1 
ATOM   4539 C  C   . LYS C 1 191 ? -2.222  10.761  -7.953  1.00 44.10 ? 180  LYS C C   1 
ATOM   4540 O  O   . LYS C 1 191 ? -2.999  9.810   -7.932  1.00 43.26 ? 180  LYS C O   1 
ATOM   4541 C  CB  . LYS C 1 191 ? -0.056  11.085  -6.723  1.00 47.69 ? 180  LYS C CB  1 
ATOM   4542 C  CG  . LYS C 1 191 ? 0.691   11.606  -5.497  1.00 49.87 ? 180  LYS C CG  1 
ATOM   4543 C  CD  . LYS C 1 191 ? 2.189   11.800  -5.722  1.00 51.76 ? 180  LYS C CD  1 
ATOM   4544 C  CE  . LYS C 1 191 ? 2.802   10.795  -6.693  1.00 52.49 ? 180  LYS C CE  1 
ATOM   4545 N  NZ  . LYS C 1 191 ? 2.784   9.390   -6.211  1.00 54.87 ? 180  LYS C NZ  1 
ATOM   4546 N  N   . ALA C 1 192 ? -1.887  11.401  -9.068  1.00 44.03 ? 181  ALA C N   1 
ATOM   4547 C  CA  . ALA C 1 192 ? -2.401  11.003  -10.380 1.00 46.48 ? 181  ALA C CA  1 
ATOM   4548 C  C   . ALA C 1 192 ? -1.685  9.760   -10.898 1.00 46.64 ? 181  ALA C C   1 
ATOM   4549 O  O   . ALA C 1 192 ? -2.267  8.955   -11.627 1.00 45.08 ? 181  ALA C O   1 
ATOM   4550 C  CB  . ALA C 1 192 ? -2.264  12.149  -11.373 1.00 42.74 ? 181  ALA C CB  1 
ATOM   4551 N  N   . GLU C 1 193 ? -0.418  9.625   -10.518 1.00 48.41 ? 182  GLU C N   1 
ATOM   4552 C  CA  . GLU C 1 193 ? 0.412   8.492   -10.920 1.00 54.19 ? 182  GLU C CA  1 
ATOM   4553 C  C   . GLU C 1 193 ? 1.215   7.990   -9.718  1.00 56.52 ? 182  GLU C C   1 
ATOM   4554 O  O   . GLU C 1 193 ? 0.936   8.376   -8.577  1.00 55.22 ? 182  GLU C O   1 
ATOM   4555 C  CB  . GLU C 1 193 ? 1.344   8.893   -12.068 1.00 54.96 ? 182  GLU C CB  1 
ATOM   4556 C  CG  . GLU C 1 193 ? 0.617   9.217   -13.368 1.00 57.08 ? 182  GLU C CG  1 
ATOM   4557 C  CD  . GLU C 1 193 ? 1.497   9.900   -14.402 1.00 57.58 ? 182  GLU C CD  1 
ATOM   4558 O  OE1 . GLU C 1 193 ? 2.267   10.823  -14.036 1.00 58.55 ? 182  GLU C OE1 1 
ATOM   4559 O  OE2 . GLU C 1 193 ? 1.400   9.514   -15.588 1.00 54.82 ? 182  GLU C OE2 1 
ATOM   4560 N  N   . GLY C 1 194 ? 2.207   7.139   -9.979  1.00 59.72 ? 183  GLY C N   1 
ATOM   4561 C  CA  . GLY C 1 194 ? 3.028   6.539   -8.923  1.00 62.17 ? 183  GLY C CA  1 
ATOM   4562 C  C   . GLY C 1 194 ? 2.435   5.212   -8.490  1.00 60.76 ? 183  GLY C C   1 
ATOM   4563 O  O   . GLY C 1 194 ? 1.795   4.530   -9.294  1.00 58.68 ? 183  GLY C O   1 
ATOM   4564 N  N   . ASN C 1 195 ? 2.637   4.848   -7.222  1.00 63.21 ? 184  ASN C N   1 
ATOM   4565 C  CA  . ASN C 1 195 ? 2.093   3.594   -6.684  1.00 65.12 ? 184  ASN C CA  1 
ATOM   4566 C  C   . ASN C 1 195 ? 0.578   3.498   -6.854  1.00 63.65 ? 184  ASN C C   1 
ATOM   4567 O  O   . ASN C 1 195 ? -0.154  4.431   -6.514  1.00 63.40 ? 184  ASN C O   1 
ATOM   4568 C  CB  . ASN C 1 195 ? 2.473   3.414   -5.213  1.00 67.51 ? 184  ASN C CB  1 
ATOM   4569 C  CG  . ASN C 1 195 ? 2.202   2.005   -4.699  1.00 71.84 ? 184  ASN C CG  1 
ATOM   4570 O  OD1 . ASN C 1 195 ? 1.861   1.095   -5.464  1.00 73.54 ? 184  ASN C OD1 1 
ATOM   4571 N  ND2 . ASN C 1 195 ? 2.366   1.817   -3.394  1.00 69.55 ? 184  ASN C ND2 1 
ATOM   4572 N  N   . SER C 1 196 ? 0.116   2.367   -7.354  1.00 62.16 ? 185  SER C N   1 
ATOM   4573 C  CA  . SER C 1 196 ? -1.286  2.183   -7.674  1.00 60.83 ? 185  SER C CA  1 
ATOM   4574 C  C   . SER C 1 196 ? -2.165  2.266   -6.453  1.00 60.59 ? 185  SER C C   1 
ATOM   4575 O  O   . SER C 1 196 ? -3.264  2.767   -6.510  1.00 62.75 ? 185  SER C O   1 
ATOM   4576 C  CB  . SER C 1 196 ? -1.523  0.865   -8.423  1.00 59.73 ? 185  SER C CB  1 
ATOM   4577 O  OG  . SER C 1 196 ? -1.208  -0.256  -7.639  1.00 59.56 ? 185  SER C OG  1 
ATOM   4578 N  N   . LYS C 1 197 ? -1.688  1.730   -5.351  1.00 58.23 ? 186  LYS C N   1 
ATOM   4579 C  CA  . LYS C 1 197 ? -2.457  1.701   -4.104  1.00 55.65 ? 186  LYS C CA  1 
ATOM   4580 C  C   . LYS C 1 197 ? -2.824  3.117   -3.646  1.00 53.29 ? 186  LYS C C   1 
ATOM   4581 O  O   . LYS C 1 197 ? -3.745  3.291   -2.839  1.00 46.44 ? 186  LYS C O   1 
ATOM   4582 C  CB  . LYS C 1 197 ? -1.676  0.974   -2.992  1.00 56.04 ? 186  LYS C CB  1 
ATOM   4583 C  CG  . LYS C 1 197 ? -1.650  -0.548  -3.117  1.00 55.31 ? 186  LYS C CG  1 
ATOM   4584 C  CD  . LYS C 1 197 ? -0.467  -1.134  -2.351  1.00 54.04 ? 186  LYS C CD  1 
ATOM   4585 N  N   . PHE C 1 198 ? -2.108  4.116   -4.174  1.00 50.61 ? 187  PHE C N   1 
ATOM   4586 C  CA  . PHE C 1 198 ? -2.219  5.506   -3.703  1.00 48.61 ? 187  PHE C CA  1 
ATOM   4587 C  C   . PHE C 1 198 ? -2.750  6.511   -4.730  1.00 44.33 ? 187  PHE C C   1 
ATOM   4588 O  O   . PHE C 1 198 ? -2.848  7.712   -4.444  1.00 44.94 ? 187  PHE C O   1 
ATOM   4589 C  CB  . PHE C 1 198 ? -0.881  5.982   -3.116  1.00 49.53 ? 187  PHE C CB  1 
ATOM   4590 C  CG  . PHE C 1 198 ? -0.594  5.426   -1.743  1.00 54.32 ? 187  PHE C CG  1 
ATOM   4591 C  CD1 . PHE C 1 198 ? -0.046  4.151   -1.588  1.00 54.04 ? 187  PHE C CD1 1 
ATOM   4592 C  CD2 . PHE C 1 198 ? -0.888  6.169   -0.600  1.00 55.15 ? 187  PHE C CD2 1 
ATOM   4593 C  CE1 . PHE C 1 198 ? 0.213   3.639   -0.322  1.00 54.69 ? 187  PHE C CE1 1 
ATOM   4594 C  CE2 . PHE C 1 198 ? -0.631  5.658   0.668   1.00 55.89 ? 187  PHE C CE2 1 
ATOM   4595 C  CZ  . PHE C 1 198 ? -0.080  4.391   0.806   1.00 52.58 ? 187  PHE C CZ  1 
ATOM   4596 N  N   . THR C 1 199 ? -3.093  6.025   -5.915  1.00 41.29 ? 188  THR C N   1 
ATOM   4597 C  CA  . THR C 1 199 ? -3.666  6.884   -6.958  1.00 40.85 ? 188  THR C CA  1 
ATOM   4598 C  C   . THR C 1 199 ? -5.153  7.128   -6.758  1.00 38.02 ? 188  THR C C   1 
ATOM   4599 O  O   . THR C 1 199 ? -5.921  6.185   -6.560  1.00 37.36 ? 188  THR C O   1 
ATOM   4600 C  CB  . THR C 1 199 ? -3.515  6.263   -8.350  1.00 40.72 ? 188  THR C CB  1 
ATOM   4601 O  OG1 . THR C 1 199 ? -4.092  4.948   -8.335  1.00 38.39 ? 188  THR C OG1 1 
ATOM   4602 C  CG2 . THR C 1 199 ? -2.041  6.210   -8.757  1.00 40.88 ? 188  THR C CG2 1 
ATOM   4603 N  N   . TYR C 1 200 ? -5.551  8.396   -6.831  1.00 37.58 ? 189  TYR C N   1 
ATOM   4604 C  CA  . TYR C 1 200 ? -6.957  8.759   -6.905  1.00 36.99 ? 189  TYR C CA  1 
ATOM   4605 C  C   . TYR C 1 200 ? -7.514  8.450   -8.297  1.00 39.35 ? 189  TYR C C   1 
ATOM   4606 O  O   . TYR C 1 200 ? -6.757  8.130   -9.209  1.00 39.84 ? 189  TYR C O   1 
ATOM   4607 C  CB  . TYR C 1 200 ? -7.158  10.233  -6.540  1.00 37.03 ? 189  TYR C CB  1 
ATOM   4608 C  CG  . TYR C 1 200 ? -6.315  11.266  -7.295  1.00 36.27 ? 189  TYR C CG  1 
ATOM   4609 C  CD1 . TYR C 1 200 ? -6.400  11.407  -8.682  1.00 36.30 ? 189  TYR C CD1 1 
ATOM   4610 C  CD2 . TYR C 1 200 ? -5.483  12.141  -6.606  1.00 37.22 ? 189  TYR C CD2 1 
ATOM   4611 C  CE1 . TYR C 1 200 ? -5.656  12.365  -9.358  1.00 37.38 ? 189  TYR C CE1 1 
ATOM   4612 C  CE2 . TYR C 1 200 ? -4.740  13.108  -7.272  1.00 37.47 ? 189  TYR C CE2 1 
ATOM   4613 C  CZ  . TYR C 1 200 ? -4.828  13.212  -8.652  1.00 38.42 ? 189  TYR C CZ  1 
ATOM   4614 O  OH  . TYR C 1 200 ? -4.094  14.174  -9.322  1.00 39.61 ? 189  TYR C OH  1 
ATOM   4615 N  N   . THR C 1 201 ? -8.838  8.503   -8.446  1.00 41.67 ? 190  THR C N   1 
ATOM   4616 C  CA  . THR C 1 201 ? -9.475  8.468   -9.768  1.00 41.08 ? 190  THR C CA  1 
ATOM   4617 C  C   . THR C 1 201 ? -10.165 9.805   -10.005 1.00 41.72 ? 190  THR C C   1 
ATOM   4618 O  O   . THR C 1 201 ? -10.523 10.504  -9.054  1.00 41.37 ? 190  THR C O   1 
ATOM   4619 C  CB  . THR C 1 201 ? -10.517 7.333   -9.928  1.00 39.85 ? 190  THR C CB  1 
ATOM   4620 O  OG1 . THR C 1 201 ? -11.578 7.516   -8.986  1.00 42.96 ? 190  THR C OG1 1 
ATOM   4621 C  CG2 . THR C 1 201 ? -9.889  5.961   -9.725  1.00 39.52 ? 190  THR C CG2 1 
ATOM   4622 N  N   . VAL C 1 202 ? -10.350 10.149  -11.276 1.00 40.93 ? 191  VAL C N   1 
ATOM   4623 C  CA  . VAL C 1 202 ? -10.948 11.413  -11.666 1.00 40.37 ? 191  VAL C CA  1 
ATOM   4624 C  C   . VAL C 1 202 ? -12.314 11.165  -12.309 1.00 41.23 ? 191  VAL C C   1 
ATOM   4625 O  O   . VAL C 1 202 ? -12.425 10.324  -13.191 1.00 40.37 ? 191  VAL C O   1 
ATOM   4626 C  CB  . VAL C 1 202 ? -10.009 12.147  -12.632 1.00 40.54 ? 191  VAL C CB  1 
ATOM   4627 C  CG1 . VAL C 1 202 ? -10.535 13.539  -12.954 1.00 41.33 ? 191  VAL C CG1 1 
ATOM   4628 C  CG2 . VAL C 1 202 ? -8.619  12.233  -12.016 1.00 42.61 ? 191  VAL C CG2 1 
ATOM   4629 N  N   . LEU C 1 203 ? -13.313 11.889  -11.858 1.00 44.00 ? 192  LEU C N   1 
ATOM   4630 C  CA  . LEU C 1 203 ? -14.652 11.739  -12.349 1.00 45.06 ? 192  LEU C CA  1 
ATOM   4631 C  C   . LEU C 1 203 ? -15.059 12.706  -13.452 1.00 44.96 ? 192  LEU C C   1 
ATOM   4632 O  O   . LEU C 1 203 ? -15.596 12.242  -14.383 1.00 47.29 ? 192  LEU C O   1 
ATOM   4633 C  CB  . LEU C 1 203 ? -15.651 11.744  -11.219 1.00 45.47 ? 192  LEU C CB  1 
ATOM   4634 C  CG  . LEU C 1 203 ? -15.393 10.814  -10.057 1.00 47.97 ? 192  LEU C CG  1 
ATOM   4635 C  CD1 . LEU C 1 203 ? -16.547 10.885  -9.095  1.00 48.75 ? 192  LEU C CD1 1 
ATOM   4636 C  CD2 . LEU C 1 203 ? -15.159 9.401   -10.503 1.00 46.54 ? 192  LEU C CD2 1 
ATOM   4637 N  N   . GLU C 1 204 ? -14.841 14.021  -13.336 1.00 47.42 ? 193  GLU C N   1 
ATOM   4638 C  CA  . GLU C 1 204 ? -14.911 14.983  -14.476 1.00 44.62 ? 193  GLU C CA  1 
ATOM   4639 C  C   . GLU C 1 204 ? -13.651 15.750  -14.427 1.00 42.39 ? 193  GLU C C   1 
ATOM   4640 O  O   . GLU C 1 204 ? -13.101 15.948  -13.397 1.00 43.76 ? 193  GLU C O   1 
ATOM   4641 C  CB  . GLU C 1 204 ? -16.139 15.986  -14.589 1.00 45.20 ? 193  GLU C CB  1 
ATOM   4642 C  CG  . GLU C 1 204 ? -16.616 16.321  -16.076 1.00 40.58 ? 193  GLU C CG  1 
ATOM   4643 C  CD  . GLU C 1 204 ? -16.849 17.829  -16.500 1.00 42.54 ? 193  GLU C CD  1 
ATOM   4644 O  OE1 . GLU C 1 204 ? -16.970 18.804  -15.651 1.00 28.84 ? 193  GLU C OE1 1 
ATOM   4645 O  OE2 . GLU C 1 204 ? -16.886 18.030  -17.706 1.00 44.06 ? 193  GLU C OE2 1 
ATOM   4646 N  N   . ASP C 1 205 ? -13.200 16.157  -15.580 1.00 41.11 ? 194  ASP C N   1 
ATOM   4647 C  CA  . ASP C 1 205 ? -12.060 17.005  -15.688 1.00 43.05 ? 194  ASP C CA  1 
ATOM   4648 C  C   . ASP C 1 205 ? -12.401 18.133  -16.649 1.00 43.35 ? 194  ASP C C   1 
ATOM   4649 O  O   . ASP C 1 205 ? -12.263 17.984  -17.837 1.00 45.18 ? 194  ASP C O   1 
ATOM   4650 C  CB  . ASP C 1 205 ? -10.883 16.181  -16.192 1.00 40.42 ? 194  ASP C CB  1 
ATOM   4651 C  CG  . ASP C 1 205 ? -9.582  16.868  -16.012 1.00 43.21 ? 194  ASP C CG  1 
ATOM   4652 O  OD1 . ASP C 1 205 ? -9.578  17.976  -15.482 1.00 41.35 ? 194  ASP C OD1 1 
ATOM   4653 O  OD2 . ASP C 1 205 ? -8.555  16.297  -16.398 1.00 45.58 ? 194  ASP C OD2 1 
ATOM   4654 N  N   . GLY C 1 206 ? -12.824 19.266  -16.122 1.00 41.96 ? 195  GLY C N   1 
ATOM   4655 C  CA  . GLY C 1 206 ? -13.138 20.423  -16.938 1.00 42.20 ? 195  GLY C CA  1 
ATOM   4656 C  C   . GLY C 1 206 ? -12.079 21.504  -16.842 1.00 44.85 ? 195  GLY C C   1 
ATOM   4657 O  O   . GLY C 1 206 ? -12.255 22.599  -17.380 1.00 43.09 ? 195  GLY C O   1 
ATOM   4658 N  N   . CYS C 1 207 ? -10.976 21.190  -16.160 1.00 43.98 ? 196  CYS C N   1 
ATOM   4659 C  CA  . CYS C 1 207 ? -9.914  22.152  -15.879 1.00 41.08 ? 196  CYS C CA  1 
ATOM   4660 C  C   . CYS C 1 207 ? -8.740  22.030  -16.851 1.00 46.09 ? 196  CYS C C   1 
ATOM   4661 O  O   . CYS C 1 207 ? -7.677  22.626  -16.621 1.00 47.03 ? 196  CYS C O   1 
ATOM   4662 C  CB  . CYS C 1 207 ? -9.427  21.969  -14.432 1.00 39.27 ? 196  CYS C CB  1 
ATOM   4663 S  SG  . CYS C 1 207 ? -10.723 22.261  -13.205 1.00 30.84 ? 196  CYS C SG  1 
ATOM   4664 N  N   . THR C 1 208 ? -8.930  21.276  -17.937 1.00 46.67 ? 197  THR C N   1 
ATOM   4665 C  CA  . THR C 1 208 ? -7.824  20.968  -18.869 1.00 51.89 ? 197  THR C CA  1 
ATOM   4666 C  C   . THR C 1 208 ? -7.168  22.182  -19.571 1.00 54.52 ? 197  THR C C   1 
ATOM   4667 O  O   . THR C 1 208 ? -5.982  22.128  -19.937 1.00 53.09 ? 197  THR C O   1 
ATOM   4668 C  CB  . THR C 1 208 ? -8.219  19.913  -19.931 1.00 53.35 ? 197  THR C CB  1 
ATOM   4669 O  OG1 . THR C 1 208 ? -9.224  20.453  -20.802 1.00 56.11 ? 197  THR C OG1 1 
ATOM   4670 C  CG2 . THR C 1 208 ? -8.735  18.638  -19.275 1.00 48.40 ? 197  THR C CG2 1 
ATOM   4671 N  N   . LYS C 1 209 ? -7.921  23.269  -19.744 1.00 55.20 ? 198  LYS C N   1 
ATOM   4672 C  CA  . LYS C 1 209 ? -7.422  24.422  -20.495 1.00 57.62 ? 198  LYS C CA  1 
ATOM   4673 C  C   . LYS C 1 209 ? -7.567  25.733  -19.728 1.00 57.23 ? 198  LYS C C   1 
ATOM   4674 O  O   . LYS C 1 209 ? -8.562  25.944  -19.033 1.00 56.40 ? 198  LYS C O   1 
ATOM   4675 C  CB  . LYS C 1 209 ? -8.147  24.519  -21.851 1.00 62.40 ? 198  LYS C CB  1 
ATOM   4676 C  CG  . LYS C 1 209 ? -7.348  25.175  -22.979 1.00 67.35 ? 198  LYS C CG  1 
ATOM   4677 C  CD  . LYS C 1 209 ? -8.171  25.274  -24.265 1.00 70.01 ? 198  LYS C CD  1 
ATOM   4678 C  CE  . LYS C 1 209 ? -7.380  25.855  -25.434 1.00 66.15 ? 198  LYS C CE  1 
ATOM   4679 N  NZ  . LYS C 1 209 ? -7.230  27.336  -25.382 1.00 64.69 ? 198  LYS C NZ  1 
ATOM   4680 N  N   . HIS C 1 210 ? -6.564  26.603  -19.851 1.00 55.51 ? 199  HIS C N   1 
ATOM   4681 C  CA  . HIS C 1 210 ? -6.710  28.006  -19.470 1.00 54.83 ? 199  HIS C CA  1 
ATOM   4682 C  C   . HIS C 1 210 ? -7.739  28.595  -20.398 1.00 52.68 ? 199  HIS C C   1 
ATOM   4683 O  O   . HIS C 1 210 ? -7.441  28.840  -21.567 1.00 51.29 ? 199  HIS C O   1 
ATOM   4684 C  CB  . HIS C 1 210 ? -5.385  28.766  -19.628 1.00 55.07 ? 199  HIS C CB  1 
ATOM   4685 C  CG  . HIS C 1 210 ? -4.362  28.478  -18.546 1.00 57.81 ? 199  HIS C CG  1 
ATOM   4686 N  ND1 . HIS C 1 210 ? -3.786  29.456  -17.816 1.00 58.62 ? 199  HIS C ND1 1 
ATOM   4687 C  CD2 . HIS C 1 210 ? -3.812  27.278  -18.095 1.00 59.74 ? 199  HIS C CD2 1 
ATOM   4688 C  CE1 . HIS C 1 210 ? -2.920  28.914  -16.941 1.00 58.03 ? 199  HIS C CE1 1 
ATOM   4689 N  NE2 . HIS C 1 210 ? -2.939  27.579  -17.109 1.00 61.56 ? 199  HIS C NE2 1 
ATOM   4690 N  N   . THR C 1 211 ? -8.966  28.794  -19.915 1.00 48.81 ? 200  THR C N   1 
ATOM   4691 C  CA  . THR C 1 211 ? -10.019 29.402  -20.758 1.00 48.53 ? 200  THR C CA  1 
ATOM   4692 C  C   . THR C 1 211 ? -10.458 30.785  -20.251 1.00 46.78 ? 200  THR C C   1 
ATOM   4693 O  O   . THR C 1 211 ? -11.165 31.510  -20.956 1.00 46.10 ? 200  THR C O   1 
ATOM   4694 C  CB  . THR C 1 211 ? -11.280 28.510  -20.906 1.00 48.58 ? 200  THR C CB  1 
ATOM   4695 O  OG1 . THR C 1 211 ? -11.967 28.433  -19.650 1.00 48.31 ? 200  THR C OG1 1 
ATOM   4696 C  CG2 . THR C 1 211 ? -10.940 27.091  -21.415 1.00 48.09 ? 200  THR C CG2 1 
ATOM   4697 N  N   . GLY C 1 212 ? -10.051 31.123  -19.035 1.00 43.74 ? 201  GLY C N   1 
ATOM   4698 C  CA  . GLY C 1 212 ? -10.473 32.330  -18.361 1.00 43.36 ? 201  GLY C CA  1 
ATOM   4699 C  C   . GLY C 1 212 ? -11.787 32.185  -17.628 1.00 44.94 ? 201  GLY C C   1 
ATOM   4700 O  O   . GLY C 1 212 ? -12.294 33.103  -17.029 1.00 43.25 ? 201  GLY C O   1 
ATOM   4701 N  N   . GLU C 1 213 ? -12.325 30.990  -17.650 1.00 49.35 ? 202  GLU C N   1 
ATOM   4702 C  CA  . GLU C 1 213 ? -13.627 30.746  -17.089 1.00 51.23 ? 202  GLU C CA  1 
ATOM   4703 C  C   . GLU C 1 213 ? -13.558 29.719  -15.980 1.00 48.57 ? 202  GLU C C   1 
ATOM   4704 O  O   . GLU C 1 213 ? -12.595 29.001  -15.860 1.00 47.02 ? 202  GLU C O   1 
ATOM   4705 C  CB  . GLU C 1 213 ? -14.590 30.335  -18.189 1.00 54.58 ? 202  GLU C CB  1 
ATOM   4706 C  CG  . GLU C 1 213 ? -14.616 31.363  -19.293 1.00 62.11 ? 202  GLU C CG  1 
ATOM   4707 C  CD  . GLU C 1 213 ? -15.892 31.372  -20.098 1.00 66.55 ? 202  GLU C CD  1 
ATOM   4708 O  OE1 . GLU C 1 213 ? -16.306 30.300  -20.545 1.00 68.42 ? 202  GLU C OE1 1 
ATOM   4709 O  OE2 . GLU C 1 213 ? -16.454 32.456  -20.298 1.00 70.70 ? 202  GLU C OE2 1 
ATOM   4710 N  N   . TRP C 1 214 ? -14.567 29.719  -15.129 1.00 45.61 ? 203  TRP C N   1 
ATOM   4711 C  CA  . TRP C 1 214 ? -14.639 28.775  -14.021 1.00 42.10 ? 203  TRP C CA  1 
ATOM   4712 C  C   . TRP C 1 214 ? -15.120 27.430  -14.483 1.00 40.93 ? 203  TRP C C   1 
ATOM   4713 O  O   . TRP C 1 214 ? -16.090 27.332  -15.241 1.00 39.37 ? 203  TRP C O   1 
ATOM   4714 C  CB  . TRP C 1 214 ? -15.573 29.303  -12.941 1.00 41.94 ? 203  TRP C CB  1 
ATOM   4715 C  CG  . TRP C 1 214 ? -14.912 30.340  -12.076 1.00 42.57 ? 203  TRP C CG  1 
ATOM   4716 C  CD1 . TRP C 1 214 ? -15.031 31.728  -12.162 1.00 41.08 ? 203  TRP C CD1 1 
ATOM   4717 C  CD2 . TRP C 1 214 ? -13.980 30.104  -10.969 1.00 41.84 ? 203  TRP C CD2 1 
ATOM   4718 N  NE1 . TRP C 1 214 ? -14.262 32.342  -11.211 1.00 41.13 ? 203  TRP C NE1 1 
ATOM   4719 C  CE2 . TRP C 1 214 ? -13.609 31.431  -10.457 1.00 41.20 ? 203  TRP C CE2 1 
ATOM   4720 C  CE3 . TRP C 1 214 ? -13.432 28.970  -10.372 1.00 41.66 ? 203  TRP C CE3 1 
ATOM   4721 C  CZ2 . TRP C 1 214 ? -12.733 31.590  -9.391  1.00 40.99 ? 203  TRP C CZ2 1 
ATOM   4722 C  CZ3 . TRP C 1 214 ? -12.546 29.145  -9.298  1.00 41.27 ? 203  TRP C CZ3 1 
ATOM   4723 C  CH2 . TRP C 1 214 ? -12.209 30.424  -8.821  1.00 41.84 ? 203  TRP C CH2 1 
ATOM   4724 N  N   . SER C 1 215 ? -14.425 26.384  -14.048 1.00 38.88 ? 204  SER C N   1 
ATOM   4725 C  CA  . SER C 1 215 ? -14.884 25.012  -14.229 1.00 38.83 ? 204  SER C CA  1 
ATOM   4726 C  C   . SER C 1 215 ? -14.451 24.191  -13.000 1.00 38.23 ? 204  SER C C   1 
ATOM   4727 O  O   . SER C 1 215 ? -14.119 24.759  -11.964 1.00 40.09 ? 204  SER C O   1 
ATOM   4728 C  CB  . SER C 1 215 ? -14.359 24.430  -15.545 1.00 38.75 ? 204  SER C CB  1 
ATOM   4729 O  OG  . SER C 1 215 ? -14.959 23.173  -15.811 1.00 39.17 ? 204  SER C OG  1 
ATOM   4730 N  N   . LYS C 1 216 ? -14.455 22.867  -13.106 1.00 37.79 ? 205  LYS C N   1 
ATOM   4731 C  CA  . LYS C 1 216 ? -14.180 22.007  -11.948 1.00 37.47 ? 205  LYS C CA  1 
ATOM   4732 C  C   . LYS C 1 216 ? -13.731 20.602  -12.343 1.00 35.58 ? 205  LYS C C   1 
ATOM   4733 O  O   . LYS C 1 216 ? -14.111 20.101  -13.408 1.00 33.15 ? 205  LYS C O   1 
ATOM   4734 C  CB  . LYS C 1 216 ? -15.409 21.920  -11.030 1.00 35.11 ? 205  LYS C CB  1 
ATOM   4735 C  CG  . LYS C 1 216 ? -16.616 21.303  -11.706 1.00 35.50 ? 205  LYS C CG  1 
ATOM   4736 C  CD  . LYS C 1 216 ? -17.670 20.913  -10.703 1.00 35.33 ? 205  LYS C CD  1 
ATOM   4737 C  CE  . LYS C 1 216 ? -18.744 20.068  -11.350 1.00 37.38 ? 205  LYS C CE  1 
ATOM   4738 N  NZ  . LYS C 1 216 ? -19.616 19.528  -10.278 1.00 41.26 ? 205  LYS C NZ  1 
ATOM   4739 N  N   . THR C 1 217 ? -12.923 19.988  -11.471 1.00 34.48 ? 206  THR C N   1 
ATOM   4740 C  CA  . THR C 1 217 ? -12.461 18.603  -11.628 1.00 34.27 ? 206  THR C CA  1 
ATOM   4741 C  C   . THR C 1 217 ? -12.804 17.819  -10.352 1.00 34.86 ? 206  THR C C   1 
ATOM   4742 O  O   . THR C 1 217 ? -12.579 18.310  -9.236  1.00 32.54 ? 206  THR C O   1 
ATOM   4743 C  CB  . THR C 1 217 ? -10.944 18.553  -11.947 1.00 34.60 ? 206  THR C CB  1 
ATOM   4744 O  OG1 . THR C 1 217 ? -10.709 19.174  -13.218 1.00 33.54 ? 206  THR C OG1 1 
ATOM   4745 C  CG2 . THR C 1 217 ? -10.409 17.113  -11.990 1.00 31.54 ? 206  THR C CG2 1 
ATOM   4746 N  N   . VAL C 1 218 ? -13.382 16.627  -10.515 1.00 34.13 ? 207  VAL C N   1 
ATOM   4747 C  CA  . VAL C 1 218 ? -13.811 15.834  -9.364  1.00 33.86 ? 207  VAL C CA  1 
ATOM   4748 C  C   . VAL C 1 218 ? -12.897 14.630  -9.152  1.00 35.66 ? 207  VAL C C   1 
ATOM   4749 O  O   . VAL C 1 218 ? -12.687 13.822  -10.068 1.00 37.13 ? 207  VAL C O   1 
ATOM   4750 C  CB  . VAL C 1 218 ? -15.286 15.395  -9.473  1.00 34.05 ? 207  VAL C CB  1 
ATOM   4751 C  CG1 . VAL C 1 218 ? -15.718 14.644  -8.220  1.00 31.38 ? 207  VAL C CG1 1 
ATOM   4752 C  CG2 . VAL C 1 218 ? -16.190 16.602  -9.702  1.00 34.40 ? 207  VAL C CG2 1 
ATOM   4753 N  N   . PHE C 1 219 ? -12.350 14.533  -7.941  1.00 34.19 ? 208  PHE C N   1 
ATOM   4754 C  CA  . PHE C 1 219 ? -11.431 13.466  -7.550  1.00 33.87 ? 208  PHE C CA  1 
ATOM   4755 C  C   . PHE C 1 219 ? -12.081 12.518  -6.555  1.00 34.62 ? 208  PHE C C   1 
ATOM   4756 O  O   . PHE C 1 219 ? -12.951 12.909  -5.776  1.00 32.47 ? 208  PHE C O   1 
ATOM   4757 C  CB  . PHE C 1 219 ? -10.199 14.060  -6.875  1.00 32.19 ? 208  PHE C CB  1 
ATOM   4758 C  CG  . PHE C 1 219 ? -9.436  14.997  -7.741  1.00 33.22 ? 208  PHE C CG  1 
ATOM   4759 C  CD1 . PHE C 1 219 ? -9.783  16.352  -7.804  1.00 34.65 ? 208  PHE C CD1 1 
ATOM   4760 C  CD2 . PHE C 1 219 ? -8.372  14.539  -8.505  1.00 32.10 ? 208  PHE C CD2 1 
ATOM   4761 C  CE1 . PHE C 1 219 ? -9.070  17.229  -8.619  1.00 33.54 ? 208  PHE C CE1 1 
ATOM   4762 C  CE2 . PHE C 1 219 ? -7.658  15.413  -9.314  1.00 32.98 ? 208  PHE C CE2 1 
ATOM   4763 C  CZ  . PHE C 1 219 ? -8.008  16.754  -9.369  1.00 33.14 ? 208  PHE C CZ  1 
ATOM   4764 N  N   . GLU C 1 220 ? -11.625 11.274  -6.562  1.00 36.34 ? 209  GLU C N   1 
ATOM   4765 C  CA  . GLU C 1 220 ? -12.122 10.280  -5.632  1.00 37.78 ? 209  GLU C CA  1 
ATOM   4766 C  C   . GLU C 1 220 ? -11.019 9.285   -5.294  1.00 39.20 ? 209  GLU C C   1 
ATOM   4767 O  O   . GLU C 1 220 ? -10.291 8.804   -6.184  1.00 40.11 ? 209  GLU C O   1 
ATOM   4768 C  CB  . GLU C 1 220 ? -13.333 9.558   -6.215  1.00 39.56 ? 209  GLU C CB  1 
ATOM   4769 C  CG  . GLU C 1 220 ? -14.132 8.762   -5.200  1.00 44.67 ? 209  GLU C CG  1 
ATOM   4770 C  CD  . GLU C 1 220 ? -15.166 7.872   -5.863  1.00 50.62 ? 209  GLU C CD  1 
ATOM   4771 O  OE1 . GLU C 1 220 ? -14.822 7.205   -6.862  1.00 56.53 ? 209  GLU C OE1 1 
ATOM   4772 O  OE2 . GLU C 1 220 ? -16.320 7.830   -5.388  1.00 51.70 ? 209  GLU C OE2 1 
ATOM   4773 N  N   . TYR C 1 221 ? -10.873 9.015   -4.003  1.00 37.04 ? 210  TYR C N   1 
ATOM   4774 C  CA  . TYR C 1 221 ? -9.990  7.959   -3.547  1.00 36.23 ? 210  TYR C CA  1 
ATOM   4775 C  C   . TYR C 1 221 ? -10.813 6.897   -2.825  1.00 36.15 ? 210  TYR C C   1 
ATOM   4776 O  O   . TYR C 1 221 ? -11.641 7.231   -1.970  1.00 38.79 ? 210  TYR C O   1 
ATOM   4777 C  CB  . TYR C 1 221 ? -8.880  8.511   -2.644  1.00 35.99 ? 210  TYR C CB  1 
ATOM   4778 C  CG  . TYR C 1 221 ? -7.916  7.424   -2.224  1.00 35.39 ? 210  TYR C CG  1 
ATOM   4779 C  CD1 . TYR C 1 221 ? -7.079  6.813   -3.156  1.00 34.29 ? 210  TYR C CD1 1 
ATOM   4780 C  CD2 . TYR C 1 221 ? -7.892  6.964   -0.913  1.00 35.60 ? 210  TYR C CD2 1 
ATOM   4781 C  CE1 . TYR C 1 221 ? -6.215  5.795   -2.785  1.00 35.82 ? 210  TYR C CE1 1 
ATOM   4782 C  CE2 . TYR C 1 221 ? -7.037  5.941   -0.529  1.00 34.64 ? 210  TYR C CE2 1 
ATOM   4783 C  CZ  . TYR C 1 221 ? -6.202  5.364   -1.460  1.00 34.95 ? 210  TYR C CZ  1 
ATOM   4784 O  OH  . TYR C 1 221 ? -5.356  4.368   -1.064  1.00 33.05 ? 210  TYR C OH  1 
ATOM   4785 N  N   . ARG C 1 222 ? -10.615 5.640   -3.210  1.00 35.96 ? 211  ARG C N   1 
ATOM   4786 C  CA  . ARG C 1 222 ? -11.315 4.494   -2.623  1.00 40.07 ? 211  ARG C CA  1 
ATOM   4787 C  C   . ARG C 1 222 ? -10.321 3.447   -2.135  1.00 40.58 ? 211  ARG C C   1 
ATOM   4788 O  O   . ARG C 1 222 ? -9.348  3.157   -2.821  1.00 38.15 ? 211  ARG C O   1 
ATOM   4789 C  CB  . ARG C 1 222 ? -12.227 3.841   -3.654  1.00 42.18 ? 211  ARG C CB  1 
ATOM   4790 C  CG  . ARG C 1 222 ? -13.623 4.391   -3.642  1.00 44.60 ? 211  ARG C CG  1 
ATOM   4791 C  CD  . ARG C 1 222 ? -14.427 4.017   -4.873  1.00 47.44 ? 211  ARG C CD  1 
ATOM   4792 N  NE  . ARG C 1 222 ? -15.595 4.890   -4.955  1.00 51.29 ? 211  ARG C NE  1 
ATOM   4793 C  CZ  . ARG C 1 222 ? -16.682 4.777   -4.191  1.00 52.82 ? 211  ARG C CZ  1 
ATOM   4794 N  NH1 . ARG C 1 222 ? -16.777 3.806   -3.288  1.00 54.42 ? 211  ARG C NH1 1 
ATOM   4795 N  NH2 . ARG C 1 222 ? -17.682 5.635   -4.333  1.00 53.77 ? 211  ARG C NH2 1 
ATOM   4796 N  N   . THR C 1 223 ? -10.579 2.859   -0.967  1.00 41.21 ? 212  THR C N   1 
ATOM   4797 C  CA  . THR C 1 223 ? -9.635  1.892   -0.393  1.00 40.20 ? 212  THR C CA  1 
ATOM   4798 C  C   . THR C 1 223 ? -10.263 0.975   0.659   1.00 41.40 ? 212  THR C C   1 
ATOM   4799 O  O   . THR C 1 223 ? -11.242 1.341   1.322   1.00 40.30 ? 212  THR C O   1 
ATOM   4800 C  CB  . THR C 1 223 ? -8.399  2.625   0.198   1.00 40.38 ? 212  THR C CB  1 
ATOM   4801 O  OG1 . THR C 1 223 ? -7.430  1.678   0.666   1.00 39.99 ? 212  THR C OG1 1 
ATOM   4802 C  CG2 . THR C 1 223 ? -8.810  3.579   1.340   1.00 38.85 ? 212  THR C CG2 1 
ATOM   4803 N  N   . ARG C 1 224 ? -9.694  -0.222  0.772   1.00 40.81 ? 213  ARG C N   1 
ATOM   4804 C  CA  . ARG C 1 224 ? -9.921  -1.142  1.887   1.00 45.17 ? 213  ARG C CA  1 
ATOM   4805 C  C   . ARG C 1 224 ? -9.213  -0.635  3.162   1.00 46.42 ? 213  ARG C C   1 
ATOM   4806 O  O   . ARG C 1 224 ? -9.689  -0.824  4.279   1.00 49.25 ? 213  ARG C O   1 
ATOM   4807 C  CB  . ARG C 1 224 ? -9.387  -2.518  1.495   1.00 47.72 ? 213  ARG C CB  1 
ATOM   4808 C  CG  . ARG C 1 224 ? -9.820  -3.683  2.360   1.00 52.72 ? 213  ARG C CG  1 
ATOM   4809 C  CD  . ARG C 1 224 ? -9.854  -4.961  1.527   1.00 52.77 ? 213  ARG C CD  1 
ATOM   4810 N  NE  . ARG C 1 224 ? -10.908 -4.905  0.516   1.00 55.48 ? 213  ARG C NE  1 
ATOM   4811 C  CZ  . ARG C 1 224 ? -12.201 -5.144  0.756   1.00 57.53 ? 213  ARG C CZ  1 
ATOM   4812 N  NH1 . ARG C 1 224 ? -12.621 -5.469  1.981   1.00 52.95 ? 213  ARG C NH1 1 
ATOM   4813 N  NH2 . ARG C 1 224 ? -13.080 -5.054  -0.234  1.00 53.14 ? 213  ARG C NH2 1 
ATOM   4814 N  N   . LYS C 1 225 ? -8.078  0.025   2.989   1.00 45.80 ? 214  LYS C N   1 
ATOM   4815 C  CA  . LYS C 1 225 ? -7.329  0.541   4.123   1.00 44.43 ? 214  LYS C CA  1 
ATOM   4816 C  C   . LYS C 1 225 ? -7.850  1.888   4.597   1.00 42.75 ? 214  LYS C C   1 
ATOM   4817 O  O   . LYS C 1 225 ? -7.314  2.950   4.253   1.00 44.37 ? 214  LYS C O   1 
ATOM   4818 C  CB  . LYS C 1 225 ? -5.836  0.558   3.809   1.00 47.62 ? 214  LYS C CB  1 
ATOM   4819 C  CG  . LYS C 1 225 ? -5.269  -0.847  3.593   1.00 51.46 ? 214  LYS C CG  1 
ATOM   4820 C  CD  . LYS C 1 225 ? -5.222  -1.645  4.896   1.00 52.75 ? 214  LYS C CD  1 
ATOM   4821 C  CE  . LYS C 1 225 ? -4.726  -3.069  4.681   1.00 51.64 ? 214  LYS C CE  1 
ATOM   4822 N  NZ  . LYS C 1 225 ? -5.718  -3.879  3.928   1.00 47.89 ? 214  LYS C NZ  1 
ATOM   4823 N  N   . ALA C 1 226 ? -8.898  1.833   5.415   1.00 38.95 ? 215  ALA C N   1 
ATOM   4824 C  CA  . ALA C 1 226 ? -9.603  3.035   5.834   1.00 35.82 ? 215  ALA C CA  1 
ATOM   4825 C  C   . ALA C 1 226 ? -8.764  3.980   6.706   1.00 36.11 ? 215  ALA C C   1 
ATOM   4826 O  O   . ALA C 1 226 ? -9.129  5.147   6.871   1.00 35.84 ? 215  ALA C O   1 
ATOM   4827 C  CB  . ALA C 1 226 ? -10.924 2.678   6.506   1.00 35.46 ? 215  ALA C CB  1 
ATOM   4828 N  N   . VAL C 1 227 ? -7.637  3.501   7.238   1.00 34.27 ? 216  VAL C N   1 
ATOM   4829 C  CA  . VAL C 1 227 ? -6.686  4.401   7.921   1.00 35.65 ? 216  VAL C CA  1 
ATOM   4830 C  C   . VAL C 1 227 ? -6.149  5.534   7.031   1.00 36.70 ? 216  VAL C C   1 
ATOM   4831 O  O   . VAL C 1 227 ? -5.723  6.580   7.535   1.00 34.93 ? 216  VAL C O   1 
ATOM   4832 C  CB  . VAL C 1 227 ? -5.507  3.649   8.593   1.00 35.11 ? 216  VAL C CB  1 
ATOM   4833 C  CG1 . VAL C 1 227 ? -6.035  2.674   9.642   1.00 35.75 ? 216  VAL C CG1 1 
ATOM   4834 C  CG2 . VAL C 1 227 ? -4.643  2.929   7.562   1.00 32.90 ? 216  VAL C CG2 1 
ATOM   4835 N  N   . ARG C 1 228 ? -6.178  5.331   5.713   1.00 37.34 ? 217  ARG C N   1 
ATOM   4836 C  CA  . ARG C 1 228 ? -5.686  6.347   4.778   1.00 36.16 ? 217  ARG C CA  1 
ATOM   4837 C  C   . ARG C 1 228 ? -6.637  7.520   4.632   1.00 36.22 ? 217  ARG C C   1 
ATOM   4838 O  O   . ARG C 1 228 ? -6.245  8.577   4.152   1.00 37.77 ? 217  ARG C O   1 
ATOM   4839 C  CB  . ARG C 1 228 ? -5.388  5.740   3.407   1.00 39.66 ? 217  ARG C CB  1 
ATOM   4840 C  CG  . ARG C 1 228 ? -4.189  4.816   3.409   1.00 41.77 ? 217  ARG C CG  1 
ATOM   4841 C  CD  . ARG C 1 228 ? -4.057  4.087   2.089   1.00 44.84 ? 217  ARG C CD  1 
ATOM   4842 N  NE  . ARG C 1 228 ? -3.231  2.900   2.251   1.00 46.01 ? 217  ARG C NE  1 
ATOM   4843 C  CZ  . ARG C 1 228 ? -3.179  1.899   1.385   1.00 46.33 ? 217  ARG C CZ  1 
ATOM   4844 N  NH1 . ARG C 1 228 ? -3.897  1.936   0.271   1.00 46.54 ? 217  ARG C NH1 1 
ATOM   4845 N  NH2 . ARG C 1 228 ? -2.408  0.857   1.641   1.00 45.75 ? 217  ARG C NH2 1 
ATOM   4846 N  N   . LEU C 1 229 ? -7.883  7.367   5.065   1.00 34.73 ? 218  LEU C N   1 
ATOM   4847 C  CA  . LEU C 1 229 ? -8.806  8.499   4.975   1.00 34.00 ? 218  LEU C CA  1 
ATOM   4848 C  C   . LEU C 1 229 ? -9.189  9.033   6.366   1.00 35.44 ? 218  LEU C C   1 
ATOM   4849 O  O   . LEU C 1 229 ? -9.011  8.332   7.353   1.00 32.77 ? 218  LEU C O   1 
ATOM   4850 C  CB  . LEU C 1 229 ? -10.023 8.125   4.126   1.00 30.93 ? 218  LEU C CB  1 
ATOM   4851 C  CG  . LEU C 1 229 ? -9.708  7.947   2.634   1.00 30.71 ? 218  LEU C CG  1 
ATOM   4852 C  CD1 . LEU C 1 229 ? -10.832 7.193   1.937   1.00 30.08 ? 218  LEU C CD1 1 
ATOM   4853 C  CD2 . LEU C 1 229 ? -9.435  9.283   1.941   1.00 30.87 ? 218  LEU C CD2 1 
ATOM   4854 N  N   . PRO C 1 230 ? -9.712  10.272  6.453   1.00 36.22 ? 219  PRO C N   1 
ATOM   4855 C  CA  . PRO C 1 230 ? -10.102 11.185  5.368   1.00 36.81 ? 219  PRO C CA  1 
ATOM   4856 C  C   . PRO C 1 230 ? -8.934  11.961  4.745   1.00 37.71 ? 219  PRO C C   1 
ATOM   4857 O  O   . PRO C 1 230 ? -7.793  11.852  5.197   1.00 38.87 ? 219  PRO C O   1 
ATOM   4858 C  CB  . PRO C 1 230 ? -11.056 12.150  6.071   1.00 35.99 ? 219  PRO C CB  1 
ATOM   4859 C  CG  . PRO C 1 230 ? -10.529 12.222  7.466   1.00 38.18 ? 219  PRO C CG  1 
ATOM   4860 C  CD  . PRO C 1 230 ? -9.894  10.891  7.779   1.00 36.03 ? 219  PRO C CD  1 
ATOM   4861 N  N   . ILE C 1 231 ? -9.234  12.725  3.700   1.00 37.30 ? 220  ILE C N   1 
ATOM   4862 C  CA  . ILE C 1 231 ? -8.280  13.654  3.101   1.00 37.17 ? 220  ILE C CA  1 
ATOM   4863 C  C   . ILE C 1 231 ? -8.165  14.863  4.025   1.00 37.64 ? 220  ILE C C   1 
ATOM   4864 O  O   . ILE C 1 231 ? -9.176  15.322  4.576   1.00 37.06 ? 220  ILE C O   1 
ATOM   4865 C  CB  . ILE C 1 231 ? -8.737  14.082  1.684   1.00 35.24 ? 220  ILE C CB  1 
ATOM   4866 C  CG1 . ILE C 1 231 ? -8.768  12.864  0.746   1.00 35.15 ? 220  ILE C CG1 1 
ATOM   4867 C  CG2 . ILE C 1 231 ? -7.841  15.182  1.124   1.00 33.45 ? 220  ILE C CG2 1 
ATOM   4868 C  CD1 . ILE C 1 231 ? -9.624  13.047  -0.496  1.00 35.51 ? 220  ILE C CD1 1 
ATOM   4869 N  N   . VAL C 1 232 ? -6.944  15.375  4.196   1.00 38.74 ? 221  VAL C N   1 
ATOM   4870 C  CA  . VAL C 1 232 ? -6.694  16.475  5.135   1.00 37.93 ? 221  VAL C CA  1 
ATOM   4871 C  C   . VAL C 1 232 ? -6.151  17.747  4.487   1.00 38.63 ? 221  VAL C C   1 
ATOM   4872 O  O   . VAL C 1 232 ? -6.289  18.835  5.040   1.00 35.81 ? 221  VAL C O   1 
ATOM   4873 C  CB  . VAL C 1 232 ? -5.770  16.031  6.291   1.00 39.60 ? 221  VAL C CB  1 
ATOM   4874 C  CG1 . VAL C 1 232 ? -6.449  14.948  7.122   1.00 39.31 ? 221  VAL C CG1 1 
ATOM   4875 C  CG2 . VAL C 1 232 ? -4.427  15.540  5.760   1.00 40.25 ? 221  VAL C CG2 1 
ATOM   4876 N  N   . ASP C 1 233 ? -5.529  17.618  3.321   1.00 41.02 ? 222  ASP C N   1 
ATOM   4877 C  CA  . ASP C 1 233 ? -4.974  18.788  2.628   1.00 41.25 ? 222  ASP C CA  1 
ATOM   4878 C  C   . ASP C 1 233 ? -5.029  18.570  1.111   1.00 41.23 ? 222  ASP C C   1 
ATOM   4879 O  O   . ASP C 1 233 ? -5.332  17.468  0.655   1.00 41.64 ? 222  ASP C O   1 
ATOM   4880 C  CB  . ASP C 1 233 ? -3.538  19.064  3.115   1.00 43.43 ? 222  ASP C CB  1 
ATOM   4881 C  CG  . ASP C 1 233 ? -3.162  20.559  3.101   1.00 46.07 ? 222  ASP C CG  1 
ATOM   4882 O  OD1 . ASP C 1 233 ? -3.973  21.384  2.620   1.00 47.92 ? 222  ASP C OD1 1 
ATOM   4883 O  OD2 . ASP C 1 233 ? -2.042  20.906  3.574   1.00 46.29 ? 222  ASP C OD2 1 
ATOM   4884 N  N   . ILE C 1 234 ? -4.749  19.625  0.340   1.00 40.49 ? 223  ILE C N   1 
ATOM   4885 C  CA  . ILE C 1 234 ? -4.776  19.577  -1.126  1.00 39.90 ? 223  ILE C CA  1 
ATOM   4886 C  C   . ILE C 1 234 ? -3.613  20.417  -1.700  1.00 40.71 ? 223  ILE C C   1 
ATOM   4887 O  O   . ILE C 1 234 ? -3.344  21.526  -1.229  1.00 41.57 ? 223  ILE C O   1 
ATOM   4888 C  CB  . ILE C 1 234 ? -6.177  20.002  -1.667  1.00 38.25 ? 223  ILE C CB  1 
ATOM   4889 C  CG1 . ILE C 1 234 ? -6.279  19.867  -3.191  1.00 39.37 ? 223  ILE C CG1 1 
ATOM   4890 C  CG2 . ILE C 1 234 ? -6.553  21.416  -1.210  1.00 37.70 ? 223  ILE C CG2 1 
ATOM   4891 C  CD1 . ILE C 1 234 ? -7.711  19.948  -3.719  1.00 37.36 ? 223  ILE C CD1 1 
ATOM   4892 N  N   . ALA C 1 235 ? -2.913  19.863  -2.690  1.00 42.24 ? 224  ALA C N   1 
ATOM   4893 C  CA  . ALA C 1 235 ? -1.729  20.501  -3.296  1.00 41.90 ? 224  ALA C CA  1 
ATOM   4894 C  C   . ALA C 1 235 ? -1.872  20.744  -4.805  1.00 39.91 ? 224  ALA C C   1 
ATOM   4895 O  O   . ALA C 1 235 ? -1.451  19.905  -5.608  1.00 37.33 ? 224  ALA C O   1 
ATOM   4896 C  CB  . ALA C 1 235 ? -0.481  19.664  -3.019  1.00 42.94 ? 224  ALA C CB  1 
ATOM   4897 N  N   . PRO C 1 236 ? -2.450  21.898  -5.199  1.00 42.74 ? 225  PRO C N   1 
ATOM   4898 C  CA  . PRO C 1 236 ? -2.463  22.223  -6.631  1.00 47.29 ? 225  PRO C CA  1 
ATOM   4899 C  C   . PRO C 1 236 ? -1.057  22.576  -7.136  1.00 51.92 ? 225  PRO C C   1 
ATOM   4900 O  O   . PRO C 1 236 ? -0.239  23.100  -6.368  1.00 51.08 ? 225  PRO C O   1 
ATOM   4901 C  CB  . PRO C 1 236 ? -3.387  23.451  -6.728  1.00 47.20 ? 225  PRO C CB  1 
ATOM   4902 C  CG  . PRO C 1 236 ? -3.804  23.800  -5.334  1.00 46.56 ? 225  PRO C CG  1 
ATOM   4903 C  CD  . PRO C 1 236 ? -2.962  23.007  -4.373  1.00 43.23 ? 225  PRO C CD  1 
ATOM   4904 N  N   . TYR C 1 237 ? -0.784  22.275  -8.407  1.00 56.56 ? 226  TYR C N   1 
ATOM   4905 C  CA  . TYR C 1 237 ? 0.481   22.662  -9.049  1.00 59.66 ? 226  TYR C CA  1 
ATOM   4906 C  C   . TYR C 1 237 ? 0.377   23.981  -9.828  1.00 59.77 ? 226  TYR C C   1 
ATOM   4907 O  O   . TYR C 1 237 ? 1.067   24.957  -9.505  1.00 58.47 ? 226  TYR C O   1 
ATOM   4908 C  CB  . TYR C 1 237 ? 0.997   21.543  -9.962  1.00 62.60 ? 226  TYR C CB  1 
ATOM   4909 C  CG  . TYR C 1 237 ? 2.367   21.816  -10.530 1.00 66.25 ? 226  TYR C CG  1 
ATOM   4910 C  CD1 . TYR C 1 237 ? 3.516   21.536  -9.787  1.00 70.43 ? 226  TYR C CD1 1 
ATOM   4911 C  CD2 . TYR C 1 237 ? 2.518   22.364  -11.801 1.00 68.01 ? 226  TYR C CD2 1 
ATOM   4912 C  CE1 . TYR C 1 237 ? 4.778   21.789  -10.297 1.00 72.49 ? 226  TYR C CE1 1 
ATOM   4913 C  CE2 . TYR C 1 237 ? 3.776   22.620  -12.322 1.00 72.60 ? 226  TYR C CE2 1 
ATOM   4914 C  CZ  . TYR C 1 237 ? 4.902   22.330  -11.563 1.00 73.38 ? 226  TYR C CZ  1 
ATOM   4915 O  OH  . TYR C 1 237 ? 6.151   22.583  -12.073 1.00 78.47 ? 226  TYR C OH  1 
ATOM   4916 N  N   . ASP C 1 238 ? -0.485  23.991  -10.846 1.00 58.24 ? 227  ASP C N   1 
ATOM   4917 C  CA  . ASP C 1 238 ? -0.654  25.130  -11.750 1.00 56.82 ? 227  ASP C CA  1 
ATOM   4918 C  C   . ASP C 1 238 ? -1.306  26.348  -11.071 1.00 58.16 ? 227  ASP C C   1 
ATOM   4919 O  O   . ASP C 1 238 ? -2.503  26.603  -11.232 1.00 57.94 ? 227  ASP C O   1 
ATOM   4920 C  CB  . ASP C 1 238 ? -1.432  24.699  -13.007 1.00 56.34 ? 227  ASP C CB  1 
ATOM   4921 C  CG  . ASP C 1 238 ? -1.418  25.759  -14.107 1.00 56.25 ? 227  ASP C CG  1 
ATOM   4922 O  OD1 . ASP C 1 238 ? -0.599  26.702  -14.040 1.00 54.88 ? 227  ASP C OD1 1 
ATOM   4923 O  OD2 . ASP C 1 238 ? -2.237  25.653  -15.040 1.00 58.19 ? 227  ASP C OD2 1 
ATOM   4924 N  N   . ILE C 1 239 ? -0.507  27.071  -10.296 1.00 58.88 ? 228  ILE C N   1 
ATOM   4925 C  CA  . ILE C 1 239 ? -0.861  28.326  -9.643  1.00 59.08 ? 228  ILE C CA  1 
ATOM   4926 C  C   . ILE C 1 239 ? 0.458   29.053  -9.367  1.00 58.23 ? 228  ILE C C   1 
ATOM   4927 O  O   . ILE C 1 239 ? 1.484   28.429  -9.350  1.00 60.11 ? 228  ILE C O   1 
ATOM   4928 C  CB  . ILE C 1 239 ? -1.562  28.087  -8.295  1.00 61.62 ? 228  ILE C CB  1 
ATOM   4929 C  CG1 . ILE C 1 239 ? -0.737  27.148  -7.422  1.00 61.96 ? 228  ILE C CG1 1 
ATOM   4930 C  CG2 . ILE C 1 239 ? -2.970  27.533  -8.485  1.00 61.61 ? 228  ILE C CG2 1 
ATOM   4931 C  CD1 . ILE C 1 239 ? -1.188  27.056  -5.981  1.00 57.91 ? 228  ILE C CD1 1 
ATOM   4932 N  N   . GLY C 1 240 ? 0.445   30.330  -9.043  1.00 58.20 ? 229  GLY C N   1 
ATOM   4933 C  CA  . GLY C 1 240 ? -0.671  31.192  -9.268  1.00 59.37 ? 229  GLY C CA  1 
ATOM   4934 C  C   . GLY C 1 240 ? -0.159  32.414  -9.985  1.00 61.18 ? 229  GLY C C   1 
ATOM   4935 O  O   . GLY C 1 240 ? 0.584   33.203  -9.438  1.00 62.26 ? 229  GLY C O   1 
ATOM   4936 N  N   . GLY C 1 241 ? -0.631  32.591  -11.201 1.00 59.57 ? 230  GLY C N   1 
ATOM   4937 C  CA  . GLY C 1 241 ? -0.489  33.821  -11.928 1.00 61.06 ? 230  GLY C CA  1 
ATOM   4938 C  C   . GLY C 1 241 ? -1.538  34.735  -11.345 1.00 63.03 ? 230  GLY C C   1 
ATOM   4939 O  O   . GLY C 1 241 ? -2.333  34.312  -10.542 1.00 62.17 ? 230  GLY C O   1 
ATOM   4940 N  N   . PRO C 1 242 ? -1.525  35.991  -11.732 1.00 62.80 ? 231  PRO C N   1 
ATOM   4941 C  CA  . PRO C 1 242 ? -2.512  36.937  -11.238 1.00 64.66 ? 231  PRO C CA  1 
ATOM   4942 C  C   . PRO C 1 242 ? -3.903  36.453  -11.618 1.00 63.28 ? 231  PRO C C   1 
ATOM   4943 O  O   . PRO C 1 242 ? -4.854  36.691  -10.904 1.00 62.61 ? 231  PRO C O   1 
ATOM   4944 C  CB  . PRO C 1 242 ? -2.168  38.220  -11.991 1.00 66.86 ? 231  PRO C CB  1 
ATOM   4945 C  CG  . PRO C 1 242 ? -1.425  37.767  -13.201 1.00 66.08 ? 231  PRO C CG  1 
ATOM   4946 C  CD  . PRO C 1 242 ? -0.653  36.579  -12.752 1.00 63.50 ? 231  PRO C CD  1 
ATOM   4947 N  N   . ASP C 1 243 ? -3.994  35.851  -12.790 1.00 60.58 ? 232  ASP C N   1 
ATOM   4948 C  CA  . ASP C 1 243 ? -5.178  35.202  -13.324 1.00 59.20 ? 232  ASP C CA  1 
ATOM   4949 C  C   . ASP C 1 243 ? -5.647  33.922  -12.610 1.00 56.66 ? 232  ASP C C   1 
ATOM   4950 O  O   . ASP C 1 243 ? -6.811  33.571  -12.663 1.00 54.32 ? 232  ASP C O   1 
ATOM   4951 C  CB  . ASP C 1 243 ? -4.909  34.881  -14.777 1.00 58.09 ? 232  ASP C CB  1 
ATOM   4952 C  CG  . ASP C 1 243 ? -3.565  34.243  -14.967 1.00 61.55 ? 232  ASP C CG  1 
ATOM   4953 O  OD1 . ASP C 1 243 ? -2.636  34.619  -14.241 1.00 56.95 ? 232  ASP C OD1 1 
ATOM   4954 O  OD2 . ASP C 1 243 ? -3.443  33.363  -15.832 1.00 64.54 ? 232  ASP C OD2 1 
ATOM   4955 N  N   . GLN C 1 244 ? -4.709  33.174  -12.048 1.00 55.07 ? 233  GLN C N   1 
ATOM   4956 C  CA  . GLN C 1 244 ? -4.990  31.847  -11.512 1.00 51.64 ? 233  GLN C CA  1 
ATOM   4957 C  C   . GLN C 1 244 ? -5.731  31.860  -10.179 1.00 49.38 ? 233  GLN C C   1 
ATOM   4958 O  O   . GLN C 1 244 ? -5.324  32.509  -9.246  1.00 48.65 ? 233  GLN C O   1 
ATOM   4959 C  CB  . GLN C 1 244 ? -3.695  31.056  -11.408 1.00 48.27 ? 233  GLN C CB  1 
ATOM   4960 C  CG  . GLN C 1 244 ? -3.008  30.914  -12.744 1.00 49.69 ? 233  GLN C CG  1 
ATOM   4961 C  CD  . GLN C 1 244 ? -1.816  29.995  -12.716 1.00 47.23 ? 233  GLN C CD  1 
ATOM   4962 O  OE1 . GLN C 1 244 ? -0.836  30.281  -12.069 1.00 48.64 ? 233  GLN C OE1 1 
ATOM   4963 N  NE2 . GLN C 1 244 ? -1.890  28.910  -13.445 1.00 43.77 ? 233  GLN C NE2 1 
ATOM   4964 N  N   . GLU C 1 245 ? -6.829  31.120  -10.117 1.00 47.36 ? 234  GLU C N   1 
ATOM   4965 C  CA  . GLU C 1 245 ? -7.671  31.050  -8.914  1.00 45.39 ? 234  GLU C CA  1 
ATOM   4966 C  C   . GLU C 1 245 ? -8.242  29.642  -8.755  1.00 45.03 ? 234  GLU C C   1 
ATOM   4967 O  O   . GLU C 1 245 ? -8.271  28.861  -9.719  1.00 44.71 ? 234  GLU C O   1 
ATOM   4968 C  CB  . GLU C 1 245 ? -8.836  32.042  -8.983  1.00 44.74 ? 234  GLU C CB  1 
ATOM   4969 C  CG  . GLU C 1 245 ? -8.470  33.515  -8.929  1.00 48.89 ? 234  GLU C CG  1 
ATOM   4970 C  CD  . GLU C 1 245 ? -9.692  34.418  -8.990  1.00 52.89 ? 234  GLU C CD  1 
ATOM   4971 O  OE1 . GLU C 1 245 ? -10.824 33.937  -8.761  1.00 54.07 ? 234  GLU C OE1 1 
ATOM   4972 O  OE2 . GLU C 1 245 ? -9.526  35.621  -9.268  1.00 53.22 ? 234  GLU C OE2 1 
ATOM   4973 N  N   . PHE C 1 246 ? -8.687  29.335  -7.534  1.00 42.74 ? 235  PHE C N   1 
ATOM   4974 C  CA  . PHE C 1 246 ? -9.394  28.092  -7.237  1.00 42.60 ? 235  PHE C CA  1 
ATOM   4975 C  C   . PHE C 1 246 ? -10.220 28.127  -5.943  1.00 42.23 ? 235  PHE C C   1 
ATOM   4976 O  O   . PHE C 1 246 ? -10.070 29.020  -5.092  1.00 40.64 ? 235  PHE C O   1 
ATOM   4977 C  CB  . PHE C 1 246 ? -8.424  26.885  -7.223  1.00 44.64 ? 235  PHE C CB  1 
ATOM   4978 C  CG  . PHE C 1 246 ? -7.539  26.823  -6.012  1.00 44.56 ? 235  PHE C CG  1 
ATOM   4979 C  CD1 . PHE C 1 246 ? -6.299  27.466  -6.003  1.00 44.97 ? 235  PHE C CD1 1 
ATOM   4980 C  CD2 . PHE C 1 246 ? -7.947  26.131  -4.869  1.00 45.36 ? 235  PHE C CD2 1 
ATOM   4981 C  CE1 . PHE C 1 246 ? -5.483  27.422  -4.881  1.00 44.65 ? 235  PHE C CE1 1 
ATOM   4982 C  CE2 . PHE C 1 246 ? -7.133  26.086  -3.746  1.00 47.17 ? 235  PHE C CE2 1 
ATOM   4983 C  CZ  . PHE C 1 246 ? -5.897  26.732  -3.753  1.00 45.25 ? 235  PHE C CZ  1 
ATOM   4984 N  N   . GLY C 1 247 ? -11.093 27.131  -5.825  1.00 41.40 ? 236  GLY C N   1 
ATOM   4985 C  CA  . GLY C 1 247 ? -11.817 26.821  -4.601  1.00 38.48 ? 236  GLY C CA  1 
ATOM   4986 C  C   . GLY C 1 247 ? -11.928 25.306  -4.511  1.00 39.49 ? 236  GLY C C   1 
ATOM   4987 O  O   . GLY C 1 247 ? -11.534 24.598  -5.444  1.00 37.28 ? 236  GLY C O   1 
ATOM   4988 N  N   . VAL C 1 248 ? -12.453 24.811  -3.388  1.00 38.41 ? 237  VAL C N   1 
ATOM   4989 C  CA  . VAL C 1 248 ? -12.581 23.375  -3.145  1.00 37.63 ? 237  VAL C CA  1 
ATOM   4990 C  C   . VAL C 1 248 ? -13.894 23.066  -2.436  1.00 39.29 ? 237  VAL C C   1 
ATOM   4991 O  O   . VAL C 1 248 ? -14.307 23.805  -1.536  1.00 37.42 ? 237  VAL C O   1 
ATOM   4992 C  CB  . VAL C 1 248 ? -11.435 22.827  -2.265  1.00 37.98 ? 237  VAL C CB  1 
ATOM   4993 C  CG1 . VAL C 1 248 ? -11.453 21.314  -2.274  1.00 37.66 ? 237  VAL C CG1 1 
ATOM   4994 C  CG2 . VAL C 1 248 ? -10.070 23.331  -2.731  1.00 38.46 ? 237  VAL C CG2 1 
ATOM   4995 N  N   . ASP C 1 249 ? -14.558 21.997  -2.867  1.00 39.09 ? 238  ASP C N   1 
ATOM   4996 C  CA  . ASP C 1 249 ? -15.638 21.389  -2.093  1.00 40.00 ? 238  ASP C CA  1 
ATOM   4997 C  C   . ASP C 1 249 ? -15.137 20.035  -1.595  1.00 38.84 ? 238  ASP C C   1 
ATOM   4998 O  O   . ASP C 1 249 ? -14.911 19.113  -2.389  1.00 38.07 ? 238  ASP C O   1 
ATOM   4999 C  CB  . ASP C 1 249 ? -16.913 21.183  -2.926  1.00 43.10 ? 238  ASP C CB  1 
ATOM   5000 C  CG  . ASP C 1 249 ? -17.504 22.481  -3.448  1.00 45.79 ? 238  ASP C CG  1 
ATOM   5001 O  OD1 . ASP C 1 249 ? -17.583 23.472  -2.694  1.00 48.04 ? 238  ASP C OD1 1 
ATOM   5002 O  OD2 . ASP C 1 249 ? -17.927 22.492  -4.621  1.00 47.70 ? 238  ASP C OD2 1 
ATOM   5003 N  N   . VAL C 1 250 ? -14.935 19.930  -0.284  1.00 38.62 ? 239  VAL C N   1 
ATOM   5004 C  CA  . VAL C 1 250 ? -14.523 18.665  0.314   1.00 38.00 ? 239  VAL C CA  1 
ATOM   5005 C  C   . VAL C 1 250 ? -15.793 17.884  0.620   1.00 36.67 ? 239  VAL C C   1 
ATOM   5006 O  O   . VAL C 1 250 ? -16.618 18.316  1.422   1.00 37.19 ? 239  VAL C O   1 
ATOM   5007 C  CB  . VAL C 1 250 ? -13.672 18.845  1.587   1.00 39.16 ? 239  VAL C CB  1 
ATOM   5008 C  CG1 . VAL C 1 250 ? -12.984 17.539  1.933   1.00 40.04 ? 239  VAL C CG1 1 
ATOM   5009 C  CG2 . VAL C 1 250 ? -12.636 19.955  1.412   1.00 39.77 ? 239  VAL C CG2 1 
ATOM   5010 N  N   . GLY C 1 251 ? -15.955 16.759  -0.069  1.00 35.38 ? 240  GLY C N   1 
ATOM   5011 C  CA  . GLY C 1 251 ? -17.093 15.881  0.129   1.00 33.42 ? 240  GLY C CA  1 
ATOM   5012 C  C   . GLY C 1 251 ? -16.894 15.027  1.364   1.00 33.87 ? 240  GLY C C   1 
ATOM   5013 O  O   . GLY C 1 251 ? -15.759 14.852  1.829   1.00 33.13 ? 240  GLY C O   1 
ATOM   5014 N  N   . PRO C 1 252 ? -17.997 14.486  1.909   1.00 33.19 ? 241  PRO C N   1 
ATOM   5015 C  CA  . PRO C 1 252 ? -17.874 13.747  3.157   1.00 32.23 ? 241  PRO C CA  1 
ATOM   5016 C  C   . PRO C 1 252 ? -16.951 12.524  3.006   1.00 31.99 ? 241  PRO C C   1 
ATOM   5017 O  O   . PRO C 1 252 ? -16.842 11.960  1.910   1.00 29.71 ? 241  PRO C O   1 
ATOM   5018 C  CB  . PRO C 1 252 ? -19.326 13.320  3.459   1.00 33.90 ? 241  PRO C CB  1 
ATOM   5019 C  CG  . PRO C 1 252 ? -20.035 13.341  2.129   1.00 33.69 ? 241  PRO C CG  1 
ATOM   5020 C  CD  . PRO C 1 252 ? -19.367 14.436  1.345   1.00 34.34 ? 241  PRO C CD  1 
ATOM   5021 N  N   . VAL C 1 253 ? -16.265 12.147  4.084   1.00 30.82 ? 242  VAL C N   1 
ATOM   5022 C  CA  . VAL C 1 253 ? -15.563 10.870  4.095   1.00 29.73 ? 242  VAL C CA  1 
ATOM   5023 C  C   . VAL C 1 253 ? -16.600 9.815   4.473   1.00 29.50 ? 242  VAL C C   1 
ATOM   5024 O  O   . VAL C 1 253 ? -17.419 10.023  5.398   1.00 28.61 ? 242  VAL C O   1 
ATOM   5025 C  CB  . VAL C 1 253 ? -14.294 10.886  4.979   1.00 30.55 ? 242  VAL C CB  1 
ATOM   5026 C  CG1 . VAL C 1 253 ? -14.615 11.291  6.412   1.00 29.11 ? 242  VAL C CG1 1 
ATOM   5027 C  CG2 . VAL C 1 253 ? -13.543 9.559   4.900   1.00 29.32 ? 242  VAL C CG2 1 
ATOM   5028 N  N   . CYS C 1 254 ? -16.616 8.733   3.696   1.00 29.19 ? 243  CYS C N   1 
ATOM   5029 C  CA  . CYS C 1 254 ? -17.673 7.733   3.787   1.00 29.27 ? 243  CYS C CA  1 
ATOM   5030 C  C   . CYS C 1 254 ? -17.099 6.346   4.067   1.00 29.25 ? 243  CYS C C   1 
ATOM   5031 O  O   . CYS C 1 254 ? -16.221 5.875   3.343   1.00 28.81 ? 243  CYS C O   1 
ATOM   5032 C  CB  . CYS C 1 254 ? -18.532 7.731   2.503   1.00 30.07 ? 243  CYS C CB  1 
ATOM   5033 S  SG  . CYS C 1 254 ? -19.570 9.198   2.245   1.00 27.27 ? 243  CYS C SG  1 
ATOM   5034 N  N   . PHE C 1 255 ? -17.609 5.708   5.120   1.00 28.25 ? 244  PHE C N   1 
ATOM   5035 C  CA  . PHE C 1 255 ? -17.151 4.391   5.580   1.00 29.12 ? 244  PHE C CA  1 
ATOM   5036 C  C   . PHE C 1 255 ? -18.255 3.349   5.438   1.00 30.04 ? 244  PHE C C   1 
ATOM   5037 O  O   . PHE C 1 255 ? -19.403 3.614   5.802   1.00 29.88 ? 244  PHE C O   1 
ATOM   5038 C  CB  . PHE C 1 255 ? -16.763 4.435   7.067   1.00 28.78 ? 244  PHE C CB  1 
ATOM   5039 C  CG  . PHE C 1 255 ? -15.624 5.368   7.388   1.00 28.38 ? 244  PHE C CG  1 
ATOM   5040 C  CD1 . PHE C 1 255 ? -14.309 4.919   7.360   1.00 29.32 ? 244  PHE C CD1 1 
ATOM   5041 C  CD2 . PHE C 1 255 ? -15.868 6.682   7.752   1.00 28.29 ? 244  PHE C CD2 1 
ATOM   5042 C  CE1 . PHE C 1 255 ? -13.259 5.776   7.664   1.00 29.50 ? 244  PHE C CE1 1 
ATOM   5043 C  CE2 . PHE C 1 255 ? -14.823 7.546   8.056   1.00 28.24 ? 244  PHE C CE2 1 
ATOM   5044 C  CZ  . PHE C 1 255 ? -13.519 7.094   8.014   1.00 28.75 ? 244  PHE C CZ  1 
ATOM   5045 N  N   . LEU C 1 256 ? -17.896 2.170   4.929   1.00 31.11 ? 245  LEU C N   1 
ATOM   5046 C  CA  . LEU C 1 256 ? -18.788 1.015   4.912   1.00 35.36 ? 245  LEU C CA  1 
ATOM   5047 C  C   . LEU C 1 256 ? -18.059 -0.233  5.380   1.00 36.76 ? 245  LEU C C   1 
ATOM   5048 O  O   . LEU C 1 256 ? -18.533 -0.977  6.245   1.00 39.54 ? 245  LEU C O   1 
ATOM   5049 C  CB  . LEU C 1 256 ? -19.370 0.789   3.509   1.00 38.60 ? 245  LEU C CB  1 
ATOM   5050 C  CG  . LEU C 1 256 ? -20.166 -0.493  3.210   1.00 38.69 ? 245  LEU C CG  1 
ATOM   5051 C  CD1 . LEU C 1 256 ? -21.390 -0.647  4.106   1.00 37.36 ? 245  LEU C CD1 1 
ATOM   5052 C  CD2 . LEU C 1 256 ? -20.565 -0.495  1.737   1.00 39.20 ? 245  LEU C CD2 1 
ATOM   5053 O  OXT . LEU C 1 256 ? -16.968 -0.531  4.911   1.00 38.58 ? 245  LEU C OXT 1 
HETATM 5054 CA CA  . CA  D 2 .   ? -15.447 -6.463  29.322  1.00 21.39 ? 246  CA  A CA  1 
HETATM 5055 C  C1  . GOL E 3 .   ? -1.137  11.108  34.337  1.00 29.39 ? 1246 GOL A C1  1 
HETATM 5056 O  O1  . GOL E 3 .   ? -2.052  11.683  35.281  1.00 27.54 ? 1246 GOL A O1  1 
HETATM 5057 C  C2  . GOL E 3 .   ? -0.314  12.213  33.677  1.00 33.26 ? 1246 GOL A C2  1 
HETATM 5058 O  O2  . GOL E 3 .   ? -1.174  13.175  33.051  1.00 30.74 ? 1246 GOL A O2  1 
HETATM 5059 C  C3  . GOL E 3 .   ? 0.584   11.604  32.609  1.00 35.37 ? 1246 GOL A C3  1 
HETATM 5060 O  O3  . GOL E 3 .   ? 1.645   10.917  33.276  1.00 41.30 ? 1246 GOL A O3  1 
HETATM 5061 C  C1  . GOL F 3 .   ? -8.017  17.183  38.903  1.00 42.58 ? 1247 GOL A C1  1 
HETATM 5062 O  O1  . GOL F 3 .   ? -6.913  16.758  39.721  1.00 42.31 ? 1247 GOL A O1  1 
HETATM 5063 C  C2  . GOL F 3 .   ? -9.347  16.953  39.632  1.00 39.39 ? 1247 GOL A C2  1 
HETATM 5064 O  O2  . GOL F 3 .   ? -9.285  15.758  40.396  1.00 37.26 ? 1247 GOL A O2  1 
HETATM 5065 C  C3  . GOL F 3 .   ? -10.493 16.805  38.644  1.00 38.83 ? 1247 GOL A C3  1 
HETATM 5066 O  O3  . GOL F 3 .   ? -11.455 17.833  38.918  1.00 41.25 ? 1247 GOL A O3  1 
HETATM 5067 C  C1  . GOL G 3 .   ? 9.344   16.771  36.668  1.00 33.84 ? 1248 GOL A C1  1 
HETATM 5068 O  O1  . GOL G 3 .   ? 9.321   17.332  37.979  1.00 34.75 ? 1248 GOL A O1  1 
HETATM 5069 C  C2  . GOL G 3 .   ? 10.780  16.871  36.153  1.00 35.22 ? 1248 GOL A C2  1 
HETATM 5070 O  O2  . GOL G 3 .   ? 11.073  18.182  35.659  1.00 36.06 ? 1248 GOL A O2  1 
HETATM 5071 C  C3  . GOL G 3 .   ? 10.869  15.904  34.993  1.00 34.22 ? 1248 GOL A C3  1 
HETATM 5072 O  O3  . GOL G 3 .   ? 11.026  14.598  35.533  1.00 33.81 ? 1248 GOL A O3  1 
HETATM 5073 C  C1  . GOL H 3 .   ? 9.265   15.513  42.316  1.00 46.68 ? 1249 GOL A C1  1 
HETATM 5074 O  O1  . GOL H 3 .   ? 7.859   15.573  42.018  1.00 41.55 ? 1249 GOL A O1  1 
HETATM 5075 C  C2  . GOL H 3 .   ? 10.046  15.058  41.088  1.00 49.72 ? 1249 GOL A C2  1 
HETATM 5076 O  O2  . GOL H 3 .   ? 9.711   15.894  39.964  1.00 46.41 ? 1249 GOL A O2  1 
HETATM 5077 C  C3  . GOL H 3 .   ? 11.541  15.139  41.384  1.00 50.44 ? 1249 GOL A C3  1 
HETATM 5078 O  O3  . GOL H 3 .   ? 12.254  15.067  40.138  1.00 48.95 ? 1249 GOL A O3  1 
HETATM 5079 C  C1  . GOL I 3 .   ? 10.937  19.332  31.877  1.00 32.87 ? 1250 GOL A C1  1 
HETATM 5080 O  O1  . GOL I 3 .   ? 11.926  18.712  31.063  1.00 30.14 ? 1250 GOL A O1  1 
HETATM 5081 C  C2  . GOL I 3 .   ? 9.648   18.531  31.810  1.00 36.97 ? 1250 GOL A C2  1 
HETATM 5082 O  O2  . GOL I 3 .   ? 8.863   18.980  30.689  1.00 39.66 ? 1250 GOL A O2  1 
HETATM 5083 C  C3  . GOL I 3 .   ? 8.900   18.743  33.119  1.00 37.42 ? 1250 GOL A C3  1 
HETATM 5084 O  O3  . GOL I 3 .   ? 7.714   19.492  32.841  1.00 37.96 ? 1250 GOL A O3  1 
HETATM 5085 CA CA  . CA  J 2 .   ? -23.721 -6.197  16.008  1.00 19.48 ? 246  CA  B CA  1 
HETATM 5086 C  C1  . GOL K 3 .   ? -16.628 -13.303 4.454   1.00 46.75 ? 1246 GOL B C1  1 
HETATM 5087 O  O1  . GOL K 3 .   ? -17.028 -12.860 3.158   1.00 49.15 ? 1246 GOL B O1  1 
HETATM 5088 C  C2  . GOL K 3 .   ? -15.161 -12.943 4.594   1.00 46.48 ? 1246 GOL B C2  1 
HETATM 5089 O  O2  . GOL K 3 .   ? -14.408 -14.145 4.749   1.00 43.72 ? 1246 GOL B O2  1 
HETATM 5090 C  C3  . GOL K 3 .   ? -14.974 -12.057 5.811   1.00 44.95 ? 1246 GOL B C3  1 
HETATM 5091 O  O3  . GOL K 3 .   ? -13.580 -11.754 5.919   1.00 43.25 ? 1246 GOL B O3  1 
HETATM 5092 C  C1  . GOL L 3 .   ? 11.043  -20.582 1.056   1.00 47.13 ? 1247 GOL B C1  1 
HETATM 5093 O  O1  . GOL L 3 .   ? 11.591  -19.676 2.025   1.00 41.77 ? 1247 GOL B O1  1 
HETATM 5094 C  C2  . GOL L 3 .   ? 9.721   -21.222 1.513   1.00 43.36 ? 1247 GOL B C2  1 
HETATM 5095 O  O2  . GOL L 3 .   ? 9.976   -22.153 2.550   1.00 43.29 ? 1247 GOL B O2  1 
HETATM 5096 C  C3  . GOL L 3 .   ? 9.071   -22.018 0.382   1.00 45.51 ? 1247 GOL B C3  1 
HETATM 5097 O  O3  . GOL L 3 .   ? 8.006   -21.316 -0.270  1.00 44.72 ? 1247 GOL B O3  1 
HETATM 5098 CA CA  . CA  M 2 .   ? -19.633 7.220   22.869  1.00 23.13 ? 246  CA  C CA  1 
HETATM 5099 O  O   . HOH N 4 .   ? -18.973 -1.631  42.771  1.00 30.66 ? 2001 HOH A O   1 
HETATM 5100 O  O   . HOH N 4 .   ? -14.555 -6.843  38.433  1.00 31.04 ? 2002 HOH A O   1 
HETATM 5101 O  O   . HOH N 4 .   ? -20.749 -0.845  33.682  1.00 30.00 ? 2003 HOH A O   1 
HETATM 5102 O  O   . HOH N 4 .   ? -18.944 0.129   30.391  1.00 28.44 ? 2004 HOH A O   1 
HETATM 5103 O  O   . HOH N 4 .   ? -18.406 4.537   29.332  1.00 34.61 ? 2005 HOH A O   1 
HETATM 5104 O  O   . HOH N 4 .   ? -13.135 1.015   23.983  1.00 28.68 ? 2006 HOH A O   1 
HETATM 5105 O  O   . HOH N 4 .   ? -10.694 4.607   23.044  1.00 27.78 ? 2007 HOH A O   1 
HETATM 5106 O  O   . HOH N 4 .   ? -11.488 7.711   24.161  1.00 37.06 ? 2008 HOH A O   1 
HETATM 5107 O  O   . HOH N 4 .   ? -12.972 9.347   23.474  1.00 35.97 ? 2009 HOH A O   1 
HETATM 5108 O  O   . HOH N 4 .   ? -8.991  7.711   28.491  1.00 22.40 ? 2010 HOH A O   1 
HETATM 5109 O  O   . HOH N 4 .   ? -10.395 16.448  25.558  1.00 30.59 ? 2011 HOH A O   1 
HETATM 5110 O  O   . HOH N 4 .   ? -17.814 7.620   24.492  1.00 25.26 ? 2012 HOH A O   1 
HETATM 5111 O  O   . HOH N 4 .   ? -15.109 9.972   25.110  1.00 30.07 ? 2013 HOH A O   1 
HETATM 5112 O  O   . HOH N 4 .   ? -4.755  5.013   41.390  1.00 28.04 ? 2014 HOH A O   1 
HETATM 5113 O  O   . HOH N 4 .   ? -20.363 -1.732  23.167  1.00 25.89 ? 2015 HOH A O   1 
HETATM 5114 O  O   . HOH N 4 .   ? -23.544 1.045   26.155  1.00 42.64 ? 2016 HOH A O   1 
HETATM 5115 O  O   . HOH N 4 .   ? -7.334  10.025  43.850  1.00 24.30 ? 2017 HOH A O   1 
HETATM 5116 O  O   . HOH N 4 .   ? -5.710  15.372  37.560  1.00 21.85 ? 2018 HOH A O   1 
HETATM 5117 O  O   . HOH N 4 .   ? -8.325  7.548   44.257  1.00 22.15 ? 2019 HOH A O   1 
HETATM 5118 O  O   . HOH N 4 .   ? -12.039 7.127   43.345  1.00 25.74 ? 2020 HOH A O   1 
HETATM 5119 O  O   . HOH N 4 .   ? -4.848  2.116   40.398  1.00 41.21 ? 2021 HOH A O   1 
HETATM 5120 O  O   . HOH N 4 .   ? -1.116  6.102   38.530  1.00 24.00 ? 2022 HOH A O   1 
HETATM 5121 O  O   . HOH N 4 .   ? -14.985 -1.296  23.176  1.00 29.58 ? 2023 HOH A O   1 
HETATM 5122 O  O   . HOH N 4 .   ? -16.812 -4.246  22.690  1.00 28.13 ? 2024 HOH A O   1 
HETATM 5123 O  O   . HOH N 4 .   ? -15.302 -8.648  28.312  1.00 22.61 ? 2025 HOH A O   1 
HETATM 5124 O  O   . HOH N 4 .   ? -20.710 0.427   25.126  1.00 36.04 ? 2026 HOH A O   1 
HETATM 5125 O  O   . HOH N 4 .   ? -20.860 -4.181  24.847  1.00 23.91 ? 2027 HOH A O   1 
HETATM 5126 O  O   . HOH N 4 .   ? -21.434 -8.329  32.833  1.00 35.57 ? 2028 HOH A O   1 
HETATM 5127 O  O   . HOH N 4 .   ? -12.251 -7.463  36.734  1.00 22.97 ? 2029 HOH A O   1 
HETATM 5128 O  O   . HOH N 4 .   ? -12.976 -11.408 27.978  1.00 27.53 ? 2030 HOH A O   1 
HETATM 5129 O  O   . HOH N 4 .   ? -3.387  0.576   37.085  1.00 24.12 ? 2031 HOH A O   1 
HETATM 5130 O  O   . HOH N 4 .   ? -6.941  -18.681 32.032  1.00 34.29 ? 2032 HOH A O   1 
HETATM 5131 O  O   . HOH N 4 .   ? -3.193  16.847  35.115  1.00 32.77 ? 2033 HOH A O   1 
HETATM 5132 O  O   . HOH N 4 .   ? 4.225   8.830   35.186  1.00 22.44 ? 2034 HOH A O   1 
HETATM 5133 O  O   . HOH N 4 .   ? -1.286  10.313  27.528  1.00 27.93 ? 2035 HOH A O   1 
HETATM 5134 O  O   . HOH N 4 .   ? -2.098  3.692   37.318  1.00 24.53 ? 2036 HOH A O   1 
HETATM 5135 O  O   . HOH N 4 .   ? -1.912  -2.671  36.730  1.00 30.92 ? 2037 HOH A O   1 
HETATM 5136 O  O   . HOH N 4 .   ? 3.458   2.045   36.765  1.00 23.01 ? 2038 HOH A O   1 
HETATM 5137 O  O   . HOH N 4 .   ? 0.942   -1.609  40.707  1.00 33.88 ? 2039 HOH A O   1 
HETATM 5138 O  O   . HOH N 4 .   ? 6.299   -8.117  34.963  1.00 43.88 ? 2040 HOH A O   1 
HETATM 5139 O  O   . HOH N 4 .   ? 16.028  18.730  35.941  1.00 14.46 ? 2041 HOH A O   1 
HETATM 5140 O  O   . HOH N 4 .   ? 20.321  19.006  34.650  1.00 27.69 ? 2042 HOH A O   1 
HETATM 5141 O  O   . HOH N 4 .   ? 22.956  4.655   23.038  1.00 29.34 ? 2043 HOH A O   1 
HETATM 5142 O  O   . HOH N 4 .   ? 16.531  -12.324 31.797  1.00 31.86 ? 2044 HOH A O   1 
HETATM 5143 O  O   . HOH N 4 .   ? 4.805   -8.221  28.912  1.00 41.99 ? 2045 HOH A O   1 
HETATM 5144 O  O   . HOH N 4 .   ? -1.811  -12.147 34.656  1.00 37.40 ? 2046 HOH A O   1 
HETATM 5145 O  O   . HOH N 4 .   ? -9.091  -13.152 25.683  1.00 32.52 ? 2047 HOH A O   1 
HETATM 5146 O  O   . HOH N 4 .   ? -7.701  -17.319 29.627  1.00 27.71 ? 2048 HOH A O   1 
HETATM 5147 O  O   . HOH N 4 .   ? -2.279  -5.762  23.863  1.00 18.98 ? 2049 HOH A O   1 
HETATM 5148 O  O   . HOH N 4 .   ? -0.569  -7.259  28.903  1.00 41.56 ? 2050 HOH A O   1 
HETATM 5149 O  O   . HOH N 4 .   ? -2.618  -6.192  19.723  1.00 34.29 ? 2051 HOH A O   1 
HETATM 5150 O  O   . HOH N 4 .   ? 2.882   9.462   30.856  1.00 22.59 ? 2052 HOH A O   1 
HETATM 5151 O  O   . HOH N 4 .   ? 3.791   7.396   32.684  1.00 22.32 ? 2053 HOH A O   1 
HETATM 5152 O  O   . HOH N 4 .   ? 8.760   7.296   35.929  1.00 31.75 ? 2054 HOH A O   1 
HETATM 5153 O  O   . HOH N 4 .   ? 26.970  8.351   40.015  1.00 34.42 ? 2055 HOH A O   1 
HETATM 5154 O  O   . HOH N 4 .   ? 25.935  8.094   36.870  1.00 35.09 ? 2056 HOH A O   1 
HETATM 5155 O  O   . HOH N 4 .   ? 23.196  3.437   29.496  1.00 28.83 ? 2057 HOH A O   1 
HETATM 5156 O  O   . HOH N 4 .   ? 22.978  10.427  31.756  1.00 23.32 ? 2058 HOH A O   1 
HETATM 5157 O  O   . HOH N 4 .   ? 26.104  8.995   26.373  1.00 33.36 ? 2059 HOH A O   1 
HETATM 5158 O  O   . HOH N 4 .   ? 19.091  5.177   23.035  1.00 26.03 ? 2060 HOH A O   1 
HETATM 5159 O  O   . HOH N 4 .   ? 6.866   -0.318  19.252  1.00 25.52 ? 2061 HOH A O   1 
HETATM 5160 O  O   . HOH N 4 .   ? 2.324   -4.964  25.424  1.00 34.04 ? 2062 HOH A O   1 
HETATM 5161 O  O   . HOH N 4 .   ? 16.044  12.386  22.449  1.00 28.83 ? 2063 HOH A O   1 
HETATM 5162 O  O   . HOH N 4 .   ? 20.403  6.347   19.645  1.00 30.40 ? 2064 HOH A O   1 
HETATM 5163 O  O   . HOH N 4 .   ? 9.182   10.247  18.857  1.00 29.49 ? 2065 HOH A O   1 
HETATM 5164 O  O   . HOH N 4 .   ? 8.579   10.819  22.486  1.00 29.15 ? 2066 HOH A O   1 
HETATM 5165 O  O   . HOH N 4 .   ? 9.830   16.634  26.527  1.00 29.48 ? 2067 HOH A O   1 
HETATM 5166 O  O   . HOH N 4 .   ? 13.718  18.723  34.659  1.00 16.68 ? 2068 HOH A O   1 
HETATM 5167 O  O   . HOH N 4 .   ? 17.589  14.122  38.232  1.00 25.57 ? 2069 HOH A O   1 
HETATM 5168 O  O   . HOH N 4 .   ? 18.205  17.348  35.240  1.00 16.79 ? 2070 HOH A O   1 
HETATM 5169 O  O   . HOH N 4 .   ? 22.353  17.207  33.068  1.00 30.76 ? 2071 HOH A O   1 
HETATM 5170 O  O   . HOH N 4 .   ? 21.354  15.640  29.503  1.00 19.44 ? 2072 HOH A O   1 
HETATM 5171 O  O   . HOH N 4 .   ? 18.932  16.145  37.577  1.00 26.18 ? 2073 HOH A O   1 
HETATM 5172 O  O   . HOH N 4 .   ? 2.138   9.297   36.081  1.00 35.21 ? 2074 HOH A O   1 
HETATM 5173 O  O   . HOH O 4 .   ? -28.109 -14.196 10.145  1.00 27.31 ? 2001 HOH B O   1 
HETATM 5174 O  O   . HOH O 4 .   ? -26.826 -9.807  23.209  1.00 25.97 ? 2002 HOH B O   1 
HETATM 5175 O  O   . HOH O 4 .   ? -23.276 -8.997  23.229  1.00 24.72 ? 2003 HOH B O   1 
HETATM 5176 O  O   . HOH O 4 .   ? -20.590 -10.535 26.027  1.00 25.48 ? 2004 HOH B O   1 
HETATM 5177 O  O   . HOH O 4 .   ? -13.029 -8.465  19.197  1.00 28.64 ? 2005 HOH B O   1 
HETATM 5178 O  O   . HOH O 4 .   ? -15.328 -7.097  20.450  1.00 25.38 ? 2006 HOH B O   1 
HETATM 5179 O  O   . HOH O 4 .   ? -11.525 -9.373  21.719  1.00 21.37 ? 2007 HOH B O   1 
HETATM 5180 O  O   . HOH O 4 .   ? -11.033 -11.137 26.152  1.00 33.84 ? 2008 HOH B O   1 
HETATM 5181 O  O   . HOH O 4 .   ? -11.364 -11.949 20.551  1.00 33.77 ? 2009 HOH B O   1 
HETATM 5182 O  O   . HOH O 4 .   ? -25.567 -6.974  22.417  1.00 36.27 ? 2010 HOH B O   1 
HETATM 5183 O  O   . HOH O 4 .   ? -12.811 -15.876 22.025  1.00 17.23 ? 2011 HOH B O   1 
HETATM 5184 O  O   . HOH O 4 .   ? -12.852 -17.327 32.429  1.00 28.41 ? 2012 HOH B O   1 
HETATM 5185 O  O   . HOH O 4 .   ? -20.751 -23.522 13.370  1.00 42.96 ? 2013 HOH B O   1 
HETATM 5186 O  O   . HOH O 4 .   ? -23.987 -25.910 28.066  1.00 26.33 ? 2014 HOH B O   1 
HETATM 5187 O  O   . HOH O 4 .   ? -17.348 -28.695 27.070  1.00 24.18 ? 2015 HOH B O   1 
HETATM 5188 O  O   . HOH O 4 .   ? -13.678 -27.798 24.478  1.00 18.02 ? 2016 HOH B O   1 
HETATM 5189 O  O   . HOH O 4 .   ? -24.794 -24.927 22.097  1.00 24.27 ? 2017 HOH B O   1 
HETATM 5190 O  O   . HOH O 4 .   ? -23.359 -27.508 19.972  1.00 28.32 ? 2018 HOH B O   1 
HETATM 5191 O  O   . HOH O 4 .   ? -17.538 -4.227  20.061  1.00 29.78 ? 2019 HOH B O   1 
HETATM 5192 O  O   . HOH O 4 .   ? -21.875 -2.328  15.307  1.00 31.59 ? 2020 HOH B O   1 
HETATM 5193 O  O   . HOH O 4 .   ? -23.928 -4.274  14.470  1.00 17.93 ? 2021 HOH B O   1 
HETATM 5194 O  O   . HOH O 4 .   ? -21.585 -2.105  12.623  1.00 38.20 ? 2022 HOH B O   1 
HETATM 5195 O  O   . HOH O 4 .   ? 8.568   -27.241 -22.983 1.00 35.49 ? 2023 HOH B O   1 
HETATM 5196 O  O   . HOH O 4 .   ? -22.930 -1.971  21.768  1.00 24.17 ? 2024 HOH B O   1 
HETATM 5197 O  O   . HOH O 4 .   ? -30.478 -5.431  18.823  1.00 30.85 ? 2025 HOH B O   1 
HETATM 5198 O  O   . HOH O 4 .   ? -27.284 -12.633 12.144  1.00 20.15 ? 2026 HOH B O   1 
HETATM 5199 O  O   . HOH O 4 .   ? -23.247 -3.758  10.884  1.00 30.71 ? 2027 HOH B O   1 
HETATM 5200 O  O   . HOH O 4 .   ? -18.823 -20.910 12.336  1.00 20.04 ? 2028 HOH B O   1 
HETATM 5201 O  O   . HOH O 4 .   ? -6.456  -20.323 27.132  1.00 39.50 ? 2029 HOH B O   1 
HETATM 5202 O  O   . HOH O 4 .   ? -16.567 -23.351 13.861  1.00 18.86 ? 2030 HOH B O   1 
HETATM 5203 O  O   . HOH O 4 .   ? -19.215 -20.001 8.826   1.00 28.69 ? 2031 HOH B O   1 
HETATM 5204 O  O   . HOH O 4 .   ? -13.927 -24.631 8.625   1.00 15.77 ? 2032 HOH B O   1 
HETATM 5205 O  O   . HOH O 4 .   ? 12.031  -22.563 -0.732  1.00 38.04 ? 2033 HOH B O   1 
HETATM 5206 O  O   . HOH O 4 .   ? -14.190 -20.700 1.870   1.00 35.08 ? 2034 HOH B O   1 
HETATM 5207 O  O   . HOH O 4 .   ? -13.493 -34.577 -2.955  1.00 37.63 ? 2035 HOH B O   1 
HETATM 5208 O  O   . HOH O 4 .   ? -1.706  -31.165 -11.063 1.00 34.74 ? 2036 HOH B O   1 
HETATM 5209 O  O   . HOH O 4 .   ? 2.709   -24.947 -13.217 1.00 34.98 ? 2037 HOH B O   1 
HETATM 5210 O  O   . HOH O 4 .   ? -4.661  -25.311 -16.106 1.00 33.47 ? 2038 HOH B O   1 
HETATM 5211 O  O   . HOH O 4 .   ? 4.020   -29.098 -14.447 1.00 30.29 ? 2039 HOH B O   1 
HETATM 5212 O  O   . HOH O 4 .   ? 0.156   -26.656 -20.401 1.00 30.00 ? 2040 HOH B O   1 
HETATM 5213 O  O   . HOH O 4 .   ? 9.486   -27.376 -20.573 1.00 24.94 ? 2041 HOH B O   1 
HETATM 5214 O  O   . HOH O 4 .   ? 3.544   -26.235 -10.656 1.00 35.63 ? 2042 HOH B O   1 
HETATM 5215 O  O   . HOH O 4 .   ? -0.557  -18.224 -8.978  1.00 29.78 ? 2043 HOH B O   1 
HETATM 5216 O  O   . HOH O 4 .   ? 7.634   -20.802 -6.595  1.00 39.08 ? 2044 HOH B O   1 
HETATM 5217 O  O   . HOH O 4 .   ? 8.446   -24.306 -1.406  1.00 30.09 ? 2045 HOH B O   1 
HETATM 5218 O  O   . HOH O 4 .   ? -13.176 -16.066 -4.263  1.00 43.41 ? 2046 HOH B O   1 
HETATM 5219 O  O   . HOH O 4 .   ? -18.928 -17.217 4.527   1.00 31.92 ? 2047 HOH B O   1 
HETATM 5220 O  O   . HOH O 4 .   ? -21.641 -13.808 2.195   1.00 38.05 ? 2048 HOH B O   1 
HETATM 5221 O  O   . HOH O 4 .   ? -22.707 -10.072 0.327   1.00 25.73 ? 2049 HOH B O   1 
HETATM 5222 O  O   . HOH O 4 .   ? -11.904 -8.950  8.122   1.00 18.36 ? 2050 HOH B O   1 
HETATM 5223 O  O   . HOH O 4 .   ? -3.602  -8.541  15.224  1.00 33.88 ? 2051 HOH B O   1 
HETATM 5224 O  O   . HOH O 4 .   ? -9.052  -5.530  8.084   1.00 28.03 ? 2052 HOH B O   1 
HETATM 5225 O  O   . HOH O 4 .   ? -3.660  -10.595 18.175  1.00 30.93 ? 2053 HOH B O   1 
HETATM 5226 O  O   . HOH O 4 .   ? -6.921  -23.959 15.032  1.00 20.30 ? 2054 HOH B O   1 
HETATM 5227 O  O   . HOH O 4 .   ? -8.483  -24.879 12.643  1.00 16.58 ? 2055 HOH B O   1 
HETATM 5228 O  O   . HOH O 4 .   ? 1.994   -37.161 -2.601  1.00 32.02 ? 2056 HOH B O   1 
HETATM 5229 O  O   . HOH O 4 .   ? 3.716   -28.579 -3.151  1.00 21.38 ? 2057 HOH B O   1 
HETATM 5230 O  O   . HOH O 4 .   ? 4.604   -33.792 1.805   1.00 18.12 ? 2058 HOH B O   1 
HETATM 5231 O  O   . HOH O 4 .   ? 9.643   -30.734 -0.601  1.00 26.23 ? 2059 HOH B O   1 
HETATM 5232 O  O   . HOH O 4 .   ? 12.695  -31.588 -2.522  1.00 26.04 ? 2060 HOH B O   1 
HETATM 5233 O  O   . HOH O 4 .   ? 10.950  -24.469 1.411   1.00 29.40 ? 2061 HOH B O   1 
HETATM 5234 O  O   . HOH O 4 .   ? 14.940  -28.792 4.478   1.00 40.48 ? 2062 HOH B O   1 
HETATM 5235 O  O   . HOH O 4 .   ? 6.406   -22.808 1.798   1.00 20.70 ? 2063 HOH B O   1 
HETATM 5236 O  O   . HOH O 4 .   ? -0.900  -12.063 6.497   1.00 19.93 ? 2064 HOH B O   1 
HETATM 5237 O  O   . HOH O 4 .   ? -9.797  -12.421 5.188   1.00 27.74 ? 2065 HOH B O   1 
HETATM 5238 O  O   . HOH O 4 .   ? 1.323   -9.890  7.227   1.00 32.87 ? 2066 HOH B O   1 
HETATM 5239 O  O   . HOH O 4 .   ? 8.352   -17.498 6.365   1.00 30.67 ? 2067 HOH B O   1 
HETATM 5240 O  O   . HOH O 4 .   ? 15.368  -23.895 7.212   1.00 37.09 ? 2068 HOH B O   1 
HETATM 5241 O  O   . HOH O 4 .   ? 2.805   -21.099 13.311  1.00 21.43 ? 2069 HOH B O   1 
HETATM 5242 O  O   . HOH O 4 .   ? 0.704   -36.413 13.763  1.00 23.51 ? 2070 HOH B O   1 
HETATM 5243 O  O   . HOH O 4 .   ? -2.872  -33.717 12.736  1.00 29.32 ? 2071 HOH B O   1 
HETATM 5244 O  O   . HOH O 4 .   ? 2.443   -38.168 9.401   1.00 26.73 ? 2072 HOH B O   1 
HETATM 5245 O  O   . HOH O 4 .   ? -6.072  -43.842 -1.946  1.00 33.74 ? 2073 HOH B O   1 
HETATM 5246 O  O   . HOH O 4 .   ? 3.103   -14.744 16.986  1.00 34.50 ? 2074 HOH B O   1 
HETATM 5247 O  O   . HOH O 4 .   ? 5.262   -11.773 14.723  1.00 37.82 ? 2075 HOH B O   1 
HETATM 5248 O  O   . HOH O 4 .   ? 8.523   -19.583 -2.004  1.00 36.43 ? 2076 HOH B O   1 
HETATM 5249 O  O   . HOH P 4 .   ? -27.896 4.582   22.223  1.00 32.23 ? 2001 HOH C O   1 
HETATM 5250 O  O   . HOH P 4 .   ? -25.565 2.850   19.924  1.00 36.41 ? 2002 HOH C O   1 
HETATM 5251 O  O   . HOH P 4 .   ? -26.488 0.396   18.098  1.00 35.11 ? 2003 HOH C O   1 
HETATM 5252 O  O   . HOH P 4 .   ? -18.148 -1.881  21.982  1.00 28.44 ? 2004 HOH C O   1 
HETATM 5253 O  O   . HOH P 4 .   ? -15.903 -1.938  20.365  1.00 31.42 ? 2005 HOH C O   1 
HETATM 5254 O  O   . HOH P 4 .   ? -16.455 0.585   22.633  1.00 30.53 ? 2006 HOH C O   1 
HETATM 5255 O  O   . HOH P 4 .   ? -21.768 2.376   8.178   1.00 27.64 ? 2007 HOH C O   1 
HETATM 5256 O  O   . HOH P 4 .   ? -19.629 0.416   8.196   1.00 40.91 ? 2008 HOH C O   1 
HETATM 5257 O  O   . HOH P 4 .   ? -20.233 -2.073  10.547  1.00 38.69 ? 2009 HOH C O   1 
HETATM 5258 O  O   . HOH P 4 .   ? -33.499 6.246   1.315   1.00 39.13 ? 2010 HOH C O   1 
HETATM 5259 O  O   . HOH P 4 .   ? -23.548 4.520   23.253  1.00 31.48 ? 2011 HOH C O   1 
HETATM 5260 O  O   . HOH P 4 .   ? -22.963 8.839   -0.306  1.00 30.00 ? 2012 HOH C O   1 
HETATM 5261 O  O   . HOH P 4 .   ? -17.648 4.484   1.230   1.00 35.42 ? 2013 HOH C O   1 
HETATM 5262 O  O   . HOH P 4 .   ? -20.551 20.412  7.446   1.00 40.32 ? 2014 HOH C O   1 
HETATM 5263 O  O   . HOH P 4 .   ? -2.791  31.350  -7.817  1.00 30.00 ? 2015 HOH C O   1 
HETATM 5264 O  O   . HOH P 4 .   ? 3.348   23.901  0.802   1.00 37.17 ? 2016 HOH C O   1 
HETATM 5265 O  O   . HOH P 4 .   ? -10.578 10.867  23.437  1.00 26.95 ? 2017 HOH C O   1 
HETATM 5266 O  O   . HOH P 4 .   ? -8.457  8.826   14.281  1.00 29.27 ? 2018 HOH C O   1 
HETATM 5267 O  O   . HOH P 4 .   ? -10.194 -1.986  10.832  1.00 36.12 ? 2019 HOH C O   1 
HETATM 5268 O  O   . HOH P 4 .   ? -9.445  1.280   9.176   1.00 39.54 ? 2020 HOH C O   1 
HETATM 5269 O  O   . HOH P 4 .   ? -6.231  6.667   10.512  1.00 40.83 ? 2021 HOH C O   1 
HETATM 5270 O  O   . HOH P 4 .   ? -17.486 9.043   -1.303  1.00 41.42 ? 2022 HOH C O   1 
HETATM 5271 O  O   . HOH P 4 .   ? -17.450 11.980  -0.730  1.00 37.00 ? 2023 HOH C O   1 
HETATM 5272 O  O   . HOH P 4 .   ? -16.541 16.773  -4.042  1.00 28.77 ? 2024 HOH C O   1 
HETATM 5273 O  O   . HOH P 4 .   ? -18.851 18.518  -7.414  1.00 30.58 ? 2025 HOH C O   1 
HETATM 5274 O  O   . HOH P 4 .   ? -9.908  28.291  -17.159 1.00 30.17 ? 2026 HOH C O   1 
HETATM 5275 O  O   . HOH P 4 .   ? -7.403  19.442  -15.511 1.00 33.76 ? 2027 HOH C O   1 
HETATM 5276 O  O   . HOH P 4 .   ? 1.586   12.486  -9.899  1.00 39.29 ? 2028 HOH C O   1 
HETATM 5277 O  O   . HOH P 4 .   ? -16.810 -20.450 -3.223  1.00 42.58 ? 2029 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   -10 ?   ?   ?   A . n 
A 1 2   THR 2   -9  ?   ?   ?   A . n 
A 1 3   GLY 3   -8  ?   ?   ?   A . n 
A 1 4   HIS 4   -7  ?   ?   ?   A . n 
A 1 5   HIS 5   -6  ?   ?   ?   A . n 
A 1 6   HIS 6   -5  ?   ?   ?   A . n 
A 1 7   HIS 7   -4  ?   ?   ?   A . n 
A 1 8   HIS 8   -3  ?   ?   ?   A . n 
A 1 9   HIS 9   -2  ?   ?   ?   A . n 
A 1 10  SER 10  -1  ?   ?   ?   A . n 
A 1 11  ALA 11  0   ?   ?   ?   A . n 
A 1 12  ASP 12  1   ?   ?   ?   A . n 
A 1 13  GLU 13  2   ?   ?   ?   A . n 
A 1 14  PRO 14  3   ?   ?   ?   A . n 
A 1 15  MSE 15  4   ?   ?   ?   A . n 
A 1 16  ASP 16  5   ?   ?   ?   A . n 
A 1 17  PHE 17  6   ?   ?   ?   A . n 
A 1 18  LYS 18  7   ?   ?   ?   A . n 
A 1 19  ILE 19  8   ?   ?   ?   A . n 
A 1 20  ASN 20  9   ?   ?   ?   A . n 
A 1 21  THR 21  10  ?   ?   ?   A . n 
A 1 22  ASP 22  11  ?   ?   ?   A . n 
A 1 23  GLU 23  12  ?   ?   ?   A . n 
A 1 24  ILE 24  13  ?   ?   ?   A . n 
A 1 25  MSE 25  14  ?   ?   ?   A . n 
A 1 26  THR 26  15  ?   ?   ?   A . n 
A 1 27  SER 27  16  ?   ?   ?   A . n 
A 1 28  LEU 28  17  ?   ?   ?   A . n 
A 1 29  LYS 29  18  ?   ?   ?   A . n 
A 1 30  SER 30  19  ?   ?   ?   A . n 
A 1 31  VAL 31  20  ?   ?   ?   A . n 
A 1 32  ASN 32  21  ?   ?   ?   A . n 
A 1 33  GLY 33  22  ?   ?   ?   A . n 
A 1 34  GLN 34  23  ?   ?   ?   A . n 
A 1 35  ILE 35  24  ?   ?   ?   A . n 
A 1 36  GLU 36  25  ?   ?   ?   A . n 
A 1 37  SER 37  26  ?   ?   ?   A . n 
A 1 38  LEU 38  27  ?   ?   ?   A . n 
A 1 39  ILE 39  28  ?   ?   ?   A . n 
A 1 40  SER 40  29  29  SER SER A . n 
A 1 41  PRO 41  30  30  PRO PRO A . n 
A 1 42  ASP 42  31  31  ASP ASP A . n 
A 1 43  GLY 43  32  32  GLY GLY A . n 
A 1 44  SER 44  33  33  SER SER A . n 
A 1 45  ARG 45  34  34  ARG ARG A . n 
A 1 46  LYS 46  35  35  LYS LYS A . n 
A 1 47  ASN 47  36  36  ASN ASN A . n 
A 1 48  PRO 48  37  37  PRO PRO A . n 
A 1 49  ALA 49  38  38  ALA ALA A . n 
A 1 50  ARG 50  39  39  ARG ARG A . n 
A 1 51  ASN 51  40  40  ASN ASN A . n 
A 1 52  CYS 52  41  41  CYS CYS A . n 
A 1 53  ARG 53  42  42  ARG ARG A . n 
A 1 54  ASP 54  43  43  ASP ASP A . n 
A 1 55  LEU 55  44  44  LEU LEU A . n 
A 1 56  LYS 56  45  45  LYS LYS A . n 
A 1 57  PHE 57  46  46  PHE PHE A . n 
A 1 58  CYS 58  47  47  CYS CYS A . n 
A 1 59  HIS 59  48  48  HIS HIS A . n 
A 1 60  PRO 60  49  49  PRO PRO A . n 
A 1 61  GLU 61  50  50  GLU GLU A . n 
A 1 62  LEU 62  51  51  LEU LEU A . n 
A 1 63  LYS 63  52  52  LYS LYS A . n 
A 1 64  SER 64  53  53  SER SER A . n 
A 1 65  GLY 65  54  54  GLY GLY A . n 
A 1 66  GLU 66  55  55  GLU GLU A . n 
A 1 67  TYR 67  56  56  TYR TYR A . n 
A 1 68  TRP 68  57  57  TRP TRP A . n 
A 1 69  VAL 69  58  58  VAL VAL A . n 
A 1 70  ASP 70  59  59  ASP ASP A . n 
A 1 71  PRO 71  60  60  PRO PRO A . n 
A 1 72  ASN 72  61  61  ASN ASN A . n 
A 1 73  GLN 73  62  62  GLN GLN A . n 
A 1 74  GLY 74  63  63  GLY GLY A . n 
A 1 75  CYS 75  64  64  CYS CYS A . n 
A 1 76  LYS 76  65  65  LYS LYS A . n 
A 1 77  LEU 77  66  66  LEU LEU A . n 
A 1 78  ASP 78  67  67  ASP ASP A . n 
A 1 79  ALA 79  68  68  ALA ALA A . n 
A 1 80  ILE 80  69  69  ILE ILE A . n 
A 1 81  LYS 81  70  70  LYS LYS A . n 
A 1 82  VAL 82  71  71  VAL VAL A . n 
A 1 83  PHE 83  72  72  PHE PHE A . n 
A 1 84  CYS 84  73  73  CYS CYS A . n 
A 1 85  ASN 85  74  74  ASN ASN A . n 
A 1 86  MSE 86  75  75  MSE MSE A . n 
A 1 87  GLU 87  76  76  GLU GLU A . n 
A 1 88  THR 88  77  77  THR THR A . n 
A 1 89  GLY 89  78  78  GLY GLY A . n 
A 1 90  GLU 90  79  79  GLU GLU A . n 
A 1 91  THR 91  80  80  THR THR A . n 
A 1 92  CYS 92  81  81  CYS CYS A . n 
A 1 93  ILE 93  82  82  ILE ILE A . n 
A 1 94  SER 94  83  83  SER SER A . n 
A 1 95  ALA 95  84  84  ALA ALA A . n 
A 1 96  ASN 96  85  85  ASN ASN A . n 
A 1 97  PRO 97  86  86  PRO PRO A . n 
A 1 98  LEU 98  87  87  LEU LEU A . n 
A 1 99  ASN 99  88  88  ASN ASN A . n 
A 1 100 VAL 100 89  89  VAL VAL A . n 
A 1 101 PRO 101 90  90  PRO PRO A . n 
A 1 102 ARG 102 91  91  ARG ARG A . n 
A 1 103 LYS 103 92  92  LYS LYS A . n 
A 1 104 HIS 104 93  93  HIS HIS A . n 
A 1 105 TRP 105 94  94  TRP TRP A . n 
A 1 106 TRP 106 95  95  TRP TRP A . n 
A 1 107 THR 107 96  96  THR THR A . n 
A 1 108 ASP 108 97  97  ASP ASP A . n 
A 1 109 SER 109 98  ?   ?   ?   A . n 
A 1 110 SER 110 99  ?   ?   ?   A . n 
A 1 111 ALA 111 100 ?   ?   ?   A . n 
A 1 112 GLU 112 101 ?   ?   ?   A . n 
A 1 113 LYS 113 102 102 LYS LYS A . n 
A 1 114 LYS 114 103 103 LYS LYS A . n 
A 1 115 HIS 115 104 104 HIS HIS A . n 
A 1 116 VAL 116 105 105 VAL VAL A . n 
A 1 117 TRP 117 106 106 TRP TRP A . n 
A 1 118 PHE 118 107 107 PHE PHE A . n 
A 1 119 GLY 119 108 108 GLY GLY A . n 
A 1 120 GLU 120 109 109 GLU GLU A . n 
A 1 121 SER 121 110 110 SER SER A . n 
A 1 122 MSE 122 111 111 MSE MSE A . n 
A 1 123 ASP 123 112 112 ASP ASP A . n 
A 1 124 GLY 124 113 113 GLY GLY A . n 
A 1 125 GLY 125 114 114 GLY GLY A . n 
A 1 126 PHE 126 115 115 PHE PHE A . n 
A 1 127 GLN 127 116 116 GLN GLN A . n 
A 1 128 PHE 128 117 117 PHE PHE A . n 
A 1 129 SER 129 118 118 SER SER A . n 
A 1 130 TYR 130 119 119 TYR TYR A . n 
A 1 131 GLY 131 120 120 GLY GLY A . n 
A 1 132 ASN 132 121 121 ASN ASN A . n 
A 1 133 PRO 133 122 122 PRO PRO A . n 
A 1 134 GLU 134 123 123 GLU GLU A . n 
A 1 135 LEU 135 124 124 LEU LEU A . n 
A 1 136 PRO 136 125 125 PRO PRO A . n 
A 1 137 GLU 137 126 126 GLU GLU A . n 
A 1 138 ASP 138 127 127 ASP ASP A . n 
A 1 139 VAL 139 128 128 VAL VAL A . n 
A 1 140 LEU 140 129 129 LEU LEU A . n 
A 1 141 ASP 141 130 130 ASP ASP A . n 
A 1 142 VAL 142 131 131 VAL VAL A . n 
A 1 143 GLN 143 132 132 GLN GLN A . n 
A 1 144 LEU 144 133 133 LEU LEU A . n 
A 1 145 ALA 145 134 134 ALA ALA A . n 
A 1 146 PHE 146 135 135 PHE PHE A . n 
A 1 147 LEU 147 136 136 LEU LEU A . n 
A 1 148 ARG 148 137 137 ARG ARG A . n 
A 1 149 LEU 149 138 138 LEU LEU A . n 
A 1 150 LEU 150 139 139 LEU LEU A . n 
A 1 151 SER 151 140 140 SER SER A . n 
A 1 152 SER 152 141 141 SER SER A . n 
A 1 153 ARG 153 142 142 ARG ARG A . n 
A 1 154 ALA 154 143 143 ALA ALA A . n 
A 1 155 SER 155 144 144 SER SER A . n 
A 1 156 GLN 156 145 145 GLN GLN A . n 
A 1 157 GLN 157 146 146 GLN GLN A . n 
A 1 158 ILE 158 147 147 ILE ILE A . n 
A 1 159 THR 159 148 148 THR THR A . n 
A 1 160 TYR 160 149 149 TYR TYR A . n 
A 1 161 HIS 161 150 150 HIS HIS A . n 
A 1 162 CYS 162 151 151 CYS CYS A . n 
A 1 163 LYS 163 152 152 LYS LYS A . n 
A 1 164 ASN 164 153 153 ASN ASN A . n 
A 1 165 SER 165 154 154 SER SER A . n 
A 1 166 ILE 166 155 155 ILE ILE A . n 
A 1 167 ALA 167 156 156 ALA ALA A . n 
A 1 168 TYR 168 157 157 TYR TYR A . n 
A 1 169 MSE 169 158 158 MSE MSE A . n 
A 1 170 ASP 170 159 159 ASP ASP A . n 
A 1 171 GLN 171 160 160 GLN GLN A . n 
A 1 172 ALA 172 161 161 ALA ALA A . n 
A 1 173 SER 173 162 162 SER SER A . n 
A 1 174 GLY 174 163 163 GLY GLY A . n 
A 1 175 ASN 175 164 164 ASN ASN A . n 
A 1 176 VAL 176 165 165 VAL VAL A . n 
A 1 177 LYS 177 166 166 LYS LYS A . n 
A 1 178 LYS 178 167 167 LYS LYS A . n 
A 1 179 ALA 179 168 168 ALA ALA A . n 
A 1 180 LEU 180 169 169 LEU LEU A . n 
A 1 181 LYS 181 170 170 LYS LYS A . n 
A 1 182 LEU 182 171 171 LEU LEU A . n 
A 1 183 MSE 183 172 172 MSE MSE A . n 
A 1 184 GLY 184 173 173 GLY GLY A . n 
A 1 185 SER 185 174 174 SER SER A . n 
A 1 186 ASN 186 175 175 ASN ASN A . n 
A 1 187 GLU 187 176 176 GLU GLU A . n 
A 1 188 GLY 188 177 177 GLY GLY A . n 
A 1 189 GLU 189 178 178 GLU GLU A . n 
A 1 190 PHE 190 179 179 PHE PHE A . n 
A 1 191 LYS 191 180 180 LYS LYS A . n 
A 1 192 ALA 192 181 181 ALA ALA A . n 
A 1 193 GLU 193 182 182 GLU GLU A . n 
A 1 194 GLY 194 183 183 GLY GLY A . n 
A 1 195 ASN 195 184 184 ASN ASN A . n 
A 1 196 SER 196 185 185 SER SER A . n 
A 1 197 LYS 197 186 186 LYS LYS A . n 
A 1 198 PHE 198 187 187 PHE PHE A . n 
A 1 199 THR 199 188 188 THR THR A . n 
A 1 200 TYR 200 189 189 TYR TYR A . n 
A 1 201 THR 201 190 190 THR THR A . n 
A 1 202 VAL 202 191 191 VAL VAL A . n 
A 1 203 LEU 203 192 192 LEU LEU A . n 
A 1 204 GLU 204 193 193 GLU GLU A . n 
A 1 205 ASP 205 194 194 ASP ASP A . n 
A 1 206 GLY 206 195 195 GLY GLY A . n 
A 1 207 CYS 207 196 196 CYS CYS A . n 
A 1 208 THR 208 197 197 THR THR A . n 
A 1 209 LYS 209 198 198 LYS LYS A . n 
A 1 210 HIS 210 199 199 HIS HIS A . n 
A 1 211 THR 211 200 200 THR THR A . n 
A 1 212 GLY 212 201 201 GLY GLY A . n 
A 1 213 GLU 213 202 202 GLU GLU A . n 
A 1 214 TRP 214 203 203 TRP TRP A . n 
A 1 215 SER 215 204 204 SER SER A . n 
A 1 216 LYS 216 205 205 LYS LYS A . n 
A 1 217 THR 217 206 206 THR THR A . n 
A 1 218 VAL 218 207 207 VAL VAL A . n 
A 1 219 PHE 219 208 208 PHE PHE A . n 
A 1 220 GLU 220 209 209 GLU GLU A . n 
A 1 221 TYR 221 210 210 TYR TYR A . n 
A 1 222 ARG 222 211 211 ARG ARG A . n 
A 1 223 THR 223 212 212 THR THR A . n 
A 1 224 ARG 224 213 213 ARG ARG A . n 
A 1 225 LYS 225 214 214 LYS LYS A . n 
A 1 226 ALA 226 215 215 ALA ALA A . n 
A 1 227 VAL 227 216 216 VAL VAL A . n 
A 1 228 ARG 228 217 217 ARG ARG A . n 
A 1 229 LEU 229 218 218 LEU LEU A . n 
A 1 230 PRO 230 219 219 PRO PRO A . n 
A 1 231 ILE 231 220 220 ILE ILE A . n 
A 1 232 VAL 232 221 221 VAL VAL A . n 
A 1 233 ASP 233 222 222 ASP ASP A . n 
A 1 234 ILE 234 223 223 ILE ILE A . n 
A 1 235 ALA 235 224 224 ALA ALA A . n 
A 1 236 PRO 236 225 225 PRO PRO A . n 
A 1 237 TYR 237 226 226 TYR TYR A . n 
A 1 238 ASP 238 227 227 ASP ASP A . n 
A 1 239 ILE 239 228 228 ILE ILE A . n 
A 1 240 GLY 240 229 229 GLY GLY A . n 
A 1 241 GLY 241 230 230 GLY GLY A . n 
A 1 242 PRO 242 231 231 PRO PRO A . n 
A 1 243 ASP 243 232 232 ASP ASP A . n 
A 1 244 GLN 244 233 233 GLN GLN A . n 
A 1 245 GLU 245 234 234 GLU GLU A . n 
A 1 246 PHE 246 235 235 PHE PHE A . n 
A 1 247 GLY 247 236 236 GLY GLY A . n 
A 1 248 VAL 248 237 237 VAL VAL A . n 
A 1 249 ASP 249 238 238 ASP ASP A . n 
A 1 250 VAL 250 239 239 VAL VAL A . n 
A 1 251 GLY 251 240 240 GLY GLY A . n 
A 1 252 PRO 252 241 241 PRO PRO A . n 
A 1 253 VAL 253 242 242 VAL VAL A . n 
A 1 254 CYS 254 243 243 CYS CYS A . n 
A 1 255 PHE 255 244 244 PHE PHE A . n 
A 1 256 LEU 256 245 245 LEU LEU A . n 
B 1 1   GLU 1   -10 ?   ?   ?   B . n 
B 1 2   THR 2   -9  ?   ?   ?   B . n 
B 1 3   GLY 3   -8  ?   ?   ?   B . n 
B 1 4   HIS 4   -7  ?   ?   ?   B . n 
B 1 5   HIS 5   -6  ?   ?   ?   B . n 
B 1 6   HIS 6   -5  ?   ?   ?   B . n 
B 1 7   HIS 7   -4  ?   ?   ?   B . n 
B 1 8   HIS 8   -3  ?   ?   ?   B . n 
B 1 9   HIS 9   -2  ?   ?   ?   B . n 
B 1 10  SER 10  -1  ?   ?   ?   B . n 
B 1 11  ALA 11  0   ?   ?   ?   B . n 
B 1 12  ASP 12  1   ?   ?   ?   B . n 
B 1 13  GLU 13  2   ?   ?   ?   B . n 
B 1 14  PRO 14  3   ?   ?   ?   B . n 
B 1 15  MSE 15  4   ?   ?   ?   B . n 
B 1 16  ASP 16  5   ?   ?   ?   B . n 
B 1 17  PHE 17  6   ?   ?   ?   B . n 
B 1 18  LYS 18  7   ?   ?   ?   B . n 
B 1 19  ILE 19  8   ?   ?   ?   B . n 
B 1 20  ASN 20  9   ?   ?   ?   B . n 
B 1 21  THR 21  10  ?   ?   ?   B . n 
B 1 22  ASP 22  11  ?   ?   ?   B . n 
B 1 23  GLU 23  12  ?   ?   ?   B . n 
B 1 24  ILE 24  13  ?   ?   ?   B . n 
B 1 25  MSE 25  14  ?   ?   ?   B . n 
B 1 26  THR 26  15  ?   ?   ?   B . n 
B 1 27  SER 27  16  ?   ?   ?   B . n 
B 1 28  LEU 28  17  ?   ?   ?   B . n 
B 1 29  LYS 29  18  ?   ?   ?   B . n 
B 1 30  SER 30  19  ?   ?   ?   B . n 
B 1 31  VAL 31  20  ?   ?   ?   B . n 
B 1 32  ASN 32  21  ?   ?   ?   B . n 
B 1 33  GLY 33  22  ?   ?   ?   B . n 
B 1 34  GLN 34  23  ?   ?   ?   B . n 
B 1 35  ILE 35  24  ?   ?   ?   B . n 
B 1 36  GLU 36  25  ?   ?   ?   B . n 
B 1 37  SER 37  26  ?   ?   ?   B . n 
B 1 38  LEU 38  27  ?   ?   ?   B . n 
B 1 39  ILE 39  28  28  ILE ILE B . n 
B 1 40  SER 40  29  29  SER SER B . n 
B 1 41  PRO 41  30  30  PRO PRO B . n 
B 1 42  ASP 42  31  31  ASP ASP B . n 
B 1 43  GLY 43  32  32  GLY GLY B . n 
B 1 44  SER 44  33  33  SER SER B . n 
B 1 45  ARG 45  34  34  ARG ARG B . n 
B 1 46  LYS 46  35  35  LYS LYS B . n 
B 1 47  ASN 47  36  36  ASN ASN B . n 
B 1 48  PRO 48  37  37  PRO PRO B . n 
B 1 49  ALA 49  38  38  ALA ALA B . n 
B 1 50  ARG 50  39  39  ARG ARG B . n 
B 1 51  ASN 51  40  40  ASN ASN B . n 
B 1 52  CYS 52  41  41  CYS CYS B . n 
B 1 53  ARG 53  42  42  ARG ARG B . n 
B 1 54  ASP 54  43  43  ASP ASP B . n 
B 1 55  LEU 55  44  44  LEU LEU B . n 
B 1 56  LYS 56  45  45  LYS LYS B . n 
B 1 57  PHE 57  46  46  PHE PHE B . n 
B 1 58  CYS 58  47  47  CYS CYS B . n 
B 1 59  HIS 59  48  48  HIS HIS B . n 
B 1 60  PRO 60  49  49  PRO PRO B . n 
B 1 61  GLU 61  50  50  GLU GLU B . n 
B 1 62  LEU 62  51  51  LEU LEU B . n 
B 1 63  LYS 63  52  52  LYS LYS B . n 
B 1 64  SER 64  53  53  SER SER B . n 
B 1 65  GLY 65  54  54  GLY GLY B . n 
B 1 66  GLU 66  55  55  GLU GLU B . n 
B 1 67  TYR 67  56  56  TYR TYR B . n 
B 1 68  TRP 68  57  57  TRP TRP B . n 
B 1 69  VAL 69  58  58  VAL VAL B . n 
B 1 70  ASP 70  59  59  ASP ASP B . n 
B 1 71  PRO 71  60  60  PRO PRO B . n 
B 1 72  ASN 72  61  61  ASN ASN B . n 
B 1 73  GLN 73  62  62  GLN GLN B . n 
B 1 74  GLY 74  63  63  GLY GLY B . n 
B 1 75  CYS 75  64  64  CYS CYS B . n 
B 1 76  LYS 76  65  65  LYS LYS B . n 
B 1 77  LEU 77  66  66  LEU LEU B . n 
B 1 78  ASP 78  67  67  ASP ASP B . n 
B 1 79  ALA 79  68  68  ALA ALA B . n 
B 1 80  ILE 80  69  69  ILE ILE B . n 
B 1 81  LYS 81  70  70  LYS LYS B . n 
B 1 82  VAL 82  71  71  VAL VAL B . n 
B 1 83  PHE 83  72  72  PHE PHE B . n 
B 1 84  CYS 84  73  73  CYS CYS B . n 
B 1 85  ASN 85  74  74  ASN ASN B . n 
B 1 86  MSE 86  75  75  MSE MSE B . n 
B 1 87  GLU 87  76  76  GLU GLU B . n 
B 1 88  THR 88  77  77  THR THR B . n 
B 1 89  GLY 89  78  78  GLY GLY B . n 
B 1 90  GLU 90  79  79  GLU GLU B . n 
B 1 91  THR 91  80  80  THR THR B . n 
B 1 92  CYS 92  81  81  CYS CYS B . n 
B 1 93  ILE 93  82  82  ILE ILE B . n 
B 1 94  SER 94  83  83  SER SER B . n 
B 1 95  ALA 95  84  84  ALA ALA B . n 
B 1 96  ASN 96  85  85  ASN ASN B . n 
B 1 97  PRO 97  86  86  PRO PRO B . n 
B 1 98  LEU 98  87  87  LEU LEU B . n 
B 1 99  ASN 99  88  88  ASN ASN B . n 
B 1 100 VAL 100 89  89  VAL VAL B . n 
B 1 101 PRO 101 90  90  PRO PRO B . n 
B 1 102 ARG 102 91  91  ARG ARG B . n 
B 1 103 LYS 103 92  92  LYS LYS B . n 
B 1 104 HIS 104 93  93  HIS HIS B . n 
B 1 105 TRP 105 94  94  TRP TRP B . n 
B 1 106 TRP 106 95  95  TRP TRP B . n 
B 1 107 THR 107 96  96  THR THR B . n 
B 1 108 ASP 108 97  97  ASP ASP B . n 
B 1 109 SER 109 98  98  SER SER B . n 
B 1 110 SER 110 99  99  SER SER B . n 
B 1 111 ALA 111 100 100 ALA ALA B . n 
B 1 112 GLU 112 101 101 GLU GLU B . n 
B 1 113 LYS 113 102 102 LYS LYS B . n 
B 1 114 LYS 114 103 103 LYS LYS B . n 
B 1 115 HIS 115 104 104 HIS HIS B . n 
B 1 116 VAL 116 105 105 VAL VAL B . n 
B 1 117 TRP 117 106 106 TRP TRP B . n 
B 1 118 PHE 118 107 107 PHE PHE B . n 
B 1 119 GLY 119 108 108 GLY GLY B . n 
B 1 120 GLU 120 109 109 GLU GLU B . n 
B 1 121 SER 121 110 110 SER SER B . n 
B 1 122 MSE 122 111 111 MSE MSE B . n 
B 1 123 ASP 123 112 112 ASP ASP B . n 
B 1 124 GLY 124 113 113 GLY GLY B . n 
B 1 125 GLY 125 114 114 GLY GLY B . n 
B 1 126 PHE 126 115 115 PHE PHE B . n 
B 1 127 GLN 127 116 116 GLN GLN B . n 
B 1 128 PHE 128 117 117 PHE PHE B . n 
B 1 129 SER 129 118 118 SER SER B . n 
B 1 130 TYR 130 119 119 TYR TYR B . n 
B 1 131 GLY 131 120 120 GLY GLY B . n 
B 1 132 ASN 132 121 121 ASN ASN B . n 
B 1 133 PRO 133 122 122 PRO PRO B . n 
B 1 134 GLU 134 123 123 GLU GLU B . n 
B 1 135 LEU 135 124 124 LEU LEU B . n 
B 1 136 PRO 136 125 125 PRO PRO B . n 
B 1 137 GLU 137 126 126 GLU GLU B . n 
B 1 138 ASP 138 127 127 ASP ASP B . n 
B 1 139 VAL 139 128 128 VAL VAL B . n 
B 1 140 LEU 140 129 129 LEU LEU B . n 
B 1 141 ASP 141 130 130 ASP ASP B . n 
B 1 142 VAL 142 131 131 VAL VAL B . n 
B 1 143 GLN 143 132 132 GLN GLN B . n 
B 1 144 LEU 144 133 133 LEU LEU B . n 
B 1 145 ALA 145 134 134 ALA ALA B . n 
B 1 146 PHE 146 135 135 PHE PHE B . n 
B 1 147 LEU 147 136 136 LEU LEU B . n 
B 1 148 ARG 148 137 137 ARG ARG B . n 
B 1 149 LEU 149 138 138 LEU LEU B . n 
B 1 150 LEU 150 139 139 LEU LEU B . n 
B 1 151 SER 151 140 140 SER SER B . n 
B 1 152 SER 152 141 141 SER SER B . n 
B 1 153 ARG 153 142 142 ARG ARG B . n 
B 1 154 ALA 154 143 143 ALA ALA B . n 
B 1 155 SER 155 144 144 SER SER B . n 
B 1 156 GLN 156 145 145 GLN GLN B . n 
B 1 157 GLN 157 146 146 GLN GLN B . n 
B 1 158 ILE 158 147 147 ILE ILE B . n 
B 1 159 THR 159 148 148 THR THR B . n 
B 1 160 TYR 160 149 149 TYR TYR B . n 
B 1 161 HIS 161 150 150 HIS HIS B . n 
B 1 162 CYS 162 151 151 CYS CYS B . n 
B 1 163 LYS 163 152 152 LYS LYS B . n 
B 1 164 ASN 164 153 153 ASN ASN B . n 
B 1 165 SER 165 154 154 SER SER B . n 
B 1 166 ILE 166 155 155 ILE ILE B . n 
B 1 167 ALA 167 156 156 ALA ALA B . n 
B 1 168 TYR 168 157 157 TYR TYR B . n 
B 1 169 MSE 169 158 158 MSE MSE B . n 
B 1 170 ASP 170 159 159 ASP ASP B . n 
B 1 171 GLN 171 160 160 GLN GLN B . n 
B 1 172 ALA 172 161 161 ALA ALA B . n 
B 1 173 SER 173 162 162 SER SER B . n 
B 1 174 GLY 174 163 163 GLY GLY B . n 
B 1 175 ASN 175 164 164 ASN ASN B . n 
B 1 176 VAL 176 165 165 VAL VAL B . n 
B 1 177 LYS 177 166 166 LYS LYS B . n 
B 1 178 LYS 178 167 167 LYS LYS B . n 
B 1 179 ALA 179 168 168 ALA ALA B . n 
B 1 180 LEU 180 169 169 LEU LEU B . n 
B 1 181 LYS 181 170 170 LYS LYS B . n 
B 1 182 LEU 182 171 171 LEU LEU B . n 
B 1 183 MSE 183 172 172 MSE MSE B . n 
B 1 184 GLY 184 173 173 GLY GLY B . n 
B 1 185 SER 185 174 174 SER SER B . n 
B 1 186 ASN 186 175 175 ASN ASN B . n 
B 1 187 GLU 187 176 176 GLU GLU B . n 
B 1 188 GLY 188 177 177 GLY GLY B . n 
B 1 189 GLU 189 178 178 GLU GLU B . n 
B 1 190 PHE 190 179 179 PHE PHE B . n 
B 1 191 LYS 191 180 180 LYS LYS B . n 
B 1 192 ALA 192 181 181 ALA ALA B . n 
B 1 193 GLU 193 182 182 GLU GLU B . n 
B 1 194 GLY 194 183 183 GLY GLY B . n 
B 1 195 ASN 195 184 184 ASN ASN B . n 
B 1 196 SER 196 185 185 SER SER B . n 
B 1 197 LYS 197 186 186 LYS LYS B . n 
B 1 198 PHE 198 187 187 PHE PHE B . n 
B 1 199 THR 199 188 188 THR THR B . n 
B 1 200 TYR 200 189 189 TYR TYR B . n 
B 1 201 THR 201 190 190 THR THR B . n 
B 1 202 VAL 202 191 191 VAL VAL B . n 
B 1 203 LEU 203 192 192 LEU LEU B . n 
B 1 204 GLU 204 193 193 GLU GLU B . n 
B 1 205 ASP 205 194 194 ASP ASP B . n 
B 1 206 GLY 206 195 195 GLY GLY B . n 
B 1 207 CYS 207 196 196 CYS CYS B . n 
B 1 208 THR 208 197 197 THR THR B . n 
B 1 209 LYS 209 198 198 LYS LYS B . n 
B 1 210 HIS 210 199 199 HIS HIS B . n 
B 1 211 THR 211 200 200 THR THR B . n 
B 1 212 GLY 212 201 201 GLY GLY B . n 
B 1 213 GLU 213 202 202 GLU GLU B . n 
B 1 214 TRP 214 203 203 TRP TRP B . n 
B 1 215 SER 215 204 204 SER SER B . n 
B 1 216 LYS 216 205 205 LYS LYS B . n 
B 1 217 THR 217 206 206 THR THR B . n 
B 1 218 VAL 218 207 207 VAL VAL B . n 
B 1 219 PHE 219 208 208 PHE PHE B . n 
B 1 220 GLU 220 209 209 GLU GLU B . n 
B 1 221 TYR 221 210 210 TYR TYR B . n 
B 1 222 ARG 222 211 211 ARG ARG B . n 
B 1 223 THR 223 212 212 THR THR B . n 
B 1 224 ARG 224 213 213 ARG ARG B . n 
B 1 225 LYS 225 214 214 LYS LYS B . n 
B 1 226 ALA 226 215 215 ALA ALA B . n 
B 1 227 VAL 227 216 216 VAL VAL B . n 
B 1 228 ARG 228 217 217 ARG ARG B . n 
B 1 229 LEU 229 218 218 LEU LEU B . n 
B 1 230 PRO 230 219 219 PRO PRO B . n 
B 1 231 ILE 231 220 220 ILE ILE B . n 
B 1 232 VAL 232 221 221 VAL VAL B . n 
B 1 233 ASP 233 222 222 ASP ASP B . n 
B 1 234 ILE 234 223 223 ILE ILE B . n 
B 1 235 ALA 235 224 224 ALA ALA B . n 
B 1 236 PRO 236 225 225 PRO PRO B . n 
B 1 237 TYR 237 226 226 TYR TYR B . n 
B 1 238 ASP 238 227 227 ASP ASP B . n 
B 1 239 ILE 239 228 228 ILE ILE B . n 
B 1 240 GLY 240 229 229 GLY GLY B . n 
B 1 241 GLY 241 230 230 GLY GLY B . n 
B 1 242 PRO 242 231 231 PRO PRO B . n 
B 1 243 ASP 243 232 232 ASP ASP B . n 
B 1 244 GLN 244 233 233 GLN GLN B . n 
B 1 245 GLU 245 234 234 GLU GLU B . n 
B 1 246 PHE 246 235 235 PHE PHE B . n 
B 1 247 GLY 247 236 236 GLY GLY B . n 
B 1 248 VAL 248 237 237 VAL VAL B . n 
B 1 249 ASP 249 238 238 ASP ASP B . n 
B 1 250 VAL 250 239 239 VAL VAL B . n 
B 1 251 GLY 251 240 240 GLY GLY B . n 
B 1 252 PRO 252 241 241 PRO PRO B . n 
B 1 253 VAL 253 242 242 VAL VAL B . n 
B 1 254 CYS 254 243 243 CYS CYS B . n 
B 1 255 PHE 255 244 244 PHE PHE B . n 
B 1 256 LEU 256 245 245 LEU LEU B . n 
C 1 1   GLU 1   -10 ?   ?   ?   C . n 
C 1 2   THR 2   -9  ?   ?   ?   C . n 
C 1 3   GLY 3   -8  ?   ?   ?   C . n 
C 1 4   HIS 4   -7  ?   ?   ?   C . n 
C 1 5   HIS 5   -6  ?   ?   ?   C . n 
C 1 6   HIS 6   -5  ?   ?   ?   C . n 
C 1 7   HIS 7   -4  ?   ?   ?   C . n 
C 1 8   HIS 8   -3  ?   ?   ?   C . n 
C 1 9   HIS 9   -2  ?   ?   ?   C . n 
C 1 10  SER 10  -1  ?   ?   ?   C . n 
C 1 11  ALA 11  0   ?   ?   ?   C . n 
C 1 12  ASP 12  1   ?   ?   ?   C . n 
C 1 13  GLU 13  2   ?   ?   ?   C . n 
C 1 14  PRO 14  3   ?   ?   ?   C . n 
C 1 15  MSE 15  4   ?   ?   ?   C . n 
C 1 16  ASP 16  5   ?   ?   ?   C . n 
C 1 17  PHE 17  6   ?   ?   ?   C . n 
C 1 18  LYS 18  7   ?   ?   ?   C . n 
C 1 19  ILE 19  8   ?   ?   ?   C . n 
C 1 20  ASN 20  9   ?   ?   ?   C . n 
C 1 21  THR 21  10  ?   ?   ?   C . n 
C 1 22  ASP 22  11  ?   ?   ?   C . n 
C 1 23  GLU 23  12  ?   ?   ?   C . n 
C 1 24  ILE 24  13  ?   ?   ?   C . n 
C 1 25  MSE 25  14  ?   ?   ?   C . n 
C 1 26  THR 26  15  ?   ?   ?   C . n 
C 1 27  SER 27  16  ?   ?   ?   C . n 
C 1 28  LEU 28  17  ?   ?   ?   C . n 
C 1 29  LYS 29  18  ?   ?   ?   C . n 
C 1 30  SER 30  19  ?   ?   ?   C . n 
C 1 31  VAL 31  20  ?   ?   ?   C . n 
C 1 32  ASN 32  21  ?   ?   ?   C . n 
C 1 33  GLY 33  22  ?   ?   ?   C . n 
C 1 34  GLN 34  23  ?   ?   ?   C . n 
C 1 35  ILE 35  24  ?   ?   ?   C . n 
C 1 36  GLU 36  25  ?   ?   ?   C . n 
C 1 37  SER 37  26  ?   ?   ?   C . n 
C 1 38  LEU 38  27  ?   ?   ?   C . n 
C 1 39  ILE 39  28  28  ILE ILE C . n 
C 1 40  SER 40  29  29  SER SER C . n 
C 1 41  PRO 41  30  30  PRO PRO C . n 
C 1 42  ASP 42  31  31  ASP ASP C . n 
C 1 43  GLY 43  32  32  GLY GLY C . n 
C 1 44  SER 44  33  33  SER SER C . n 
C 1 45  ARG 45  34  34  ARG ARG C . n 
C 1 46  LYS 46  35  35  LYS LYS C . n 
C 1 47  ASN 47  36  36  ASN ASN C . n 
C 1 48  PRO 48  37  37  PRO PRO C . n 
C 1 49  ALA 49  38  38  ALA ALA C . n 
C 1 50  ARG 50  39  39  ARG ARG C . n 
C 1 51  ASN 51  40  40  ASN ASN C . n 
C 1 52  CYS 52  41  41  CYS CYS C . n 
C 1 53  ARG 53  42  42  ARG ARG C . n 
C 1 54  ASP 54  43  43  ASP ASP C . n 
C 1 55  LEU 55  44  44  LEU LEU C . n 
C 1 56  LYS 56  45  45  LYS LYS C . n 
C 1 57  PHE 57  46  46  PHE PHE C . n 
C 1 58  CYS 58  47  47  CYS CYS C . n 
C 1 59  HIS 59  48  48  HIS HIS C . n 
C 1 60  PRO 60  49  49  PRO PRO C . n 
C 1 61  GLU 61  50  50  GLU GLU C . n 
C 1 62  LEU 62  51  51  LEU LEU C . n 
C 1 63  LYS 63  52  52  LYS LYS C . n 
C 1 64  SER 64  53  53  SER SER C . n 
C 1 65  GLY 65  54  54  GLY GLY C . n 
C 1 66  GLU 66  55  55  GLU GLU C . n 
C 1 67  TYR 67  56  56  TYR TYR C . n 
C 1 68  TRP 68  57  57  TRP TRP C . n 
C 1 69  VAL 69  58  58  VAL VAL C . n 
C 1 70  ASP 70  59  59  ASP ASP C . n 
C 1 71  PRO 71  60  60  PRO PRO C . n 
C 1 72  ASN 72  61  61  ASN ASN C . n 
C 1 73  GLN 73  62  62  GLN GLN C . n 
C 1 74  GLY 74  63  63  GLY GLY C . n 
C 1 75  CYS 75  64  64  CYS CYS C . n 
C 1 76  LYS 76  65  65  LYS LYS C . n 
C 1 77  LEU 77  66  66  LEU LEU C . n 
C 1 78  ASP 78  67  67  ASP ASP C . n 
C 1 79  ALA 79  68  68  ALA ALA C . n 
C 1 80  ILE 80  69  69  ILE ILE C . n 
C 1 81  LYS 81  70  70  LYS LYS C . n 
C 1 82  VAL 82  71  71  VAL VAL C . n 
C 1 83  PHE 83  72  72  PHE PHE C . n 
C 1 84  CYS 84  73  73  CYS CYS C . n 
C 1 85  ASN 85  74  74  ASN ASN C . n 
C 1 86  MSE 86  75  75  MSE MSE C . n 
C 1 87  GLU 87  76  76  GLU GLU C . n 
C 1 88  THR 88  77  77  THR THR C . n 
C 1 89  GLY 89  78  78  GLY GLY C . n 
C 1 90  GLU 90  79  79  GLU GLU C . n 
C 1 91  THR 91  80  80  THR THR C . n 
C 1 92  CYS 92  81  81  CYS CYS C . n 
C 1 93  ILE 93  82  82  ILE ILE C . n 
C 1 94  SER 94  83  83  SER SER C . n 
C 1 95  ALA 95  84  84  ALA ALA C . n 
C 1 96  ASN 96  85  85  ASN ASN C . n 
C 1 97  PRO 97  86  86  PRO PRO C . n 
C 1 98  LEU 98  87  87  LEU LEU C . n 
C 1 99  ASN 99  88  88  ASN ASN C . n 
C 1 100 VAL 100 89  89  VAL VAL C . n 
C 1 101 PRO 101 90  90  PRO PRO C . n 
C 1 102 ARG 102 91  91  ARG ARG C . n 
C 1 103 LYS 103 92  92  LYS LYS C . n 
C 1 104 HIS 104 93  93  HIS HIS C . n 
C 1 105 TRP 105 94  94  TRP TRP C . n 
C 1 106 TRP 106 95  95  TRP TRP C . n 
C 1 107 THR 107 96  96  THR THR C . n 
C 1 108 ASP 108 97  97  ASP ASP C . n 
C 1 109 SER 109 98  ?   ?   ?   C . n 
C 1 110 SER 110 99  ?   ?   ?   C . n 
C 1 111 ALA 111 100 ?   ?   ?   C . n 
C 1 112 GLU 112 101 ?   ?   ?   C . n 
C 1 113 LYS 113 102 ?   ?   ?   C . n 
C 1 114 LYS 114 103 103 LYS LYS C . n 
C 1 115 HIS 115 104 104 HIS HIS C . n 
C 1 116 VAL 116 105 105 VAL VAL C . n 
C 1 117 TRP 117 106 106 TRP TRP C . n 
C 1 118 PHE 118 107 107 PHE PHE C . n 
C 1 119 GLY 119 108 108 GLY GLY C . n 
C 1 120 GLU 120 109 109 GLU GLU C . n 
C 1 121 SER 121 110 110 SER SER C . n 
C 1 122 MSE 122 111 111 MSE MSE C . n 
C 1 123 ASP 123 112 112 ASP ASP C . n 
C 1 124 GLY 124 113 113 GLY GLY C . n 
C 1 125 GLY 125 114 114 GLY GLY C . n 
C 1 126 PHE 126 115 115 PHE PHE C . n 
C 1 127 GLN 127 116 116 GLN GLN C . n 
C 1 128 PHE 128 117 117 PHE PHE C . n 
C 1 129 SER 129 118 118 SER SER C . n 
C 1 130 TYR 130 119 119 TYR TYR C . n 
C 1 131 GLY 131 120 120 GLY GLY C . n 
C 1 132 ASN 132 121 121 ASN ASN C . n 
C 1 133 PRO 133 122 122 PRO PRO C . n 
C 1 134 GLU 134 123 123 GLU GLU C . n 
C 1 135 LEU 135 124 124 LEU LEU C . n 
C 1 136 PRO 136 125 125 PRO PRO C . n 
C 1 137 GLU 137 126 126 GLU GLU C . n 
C 1 138 ASP 138 127 127 ASP ASP C . n 
C 1 139 VAL 139 128 128 VAL VAL C . n 
C 1 140 LEU 140 129 129 LEU LEU C . n 
C 1 141 ASP 141 130 130 ASP ASP C . n 
C 1 142 VAL 142 131 131 VAL VAL C . n 
C 1 143 GLN 143 132 132 GLN GLN C . n 
C 1 144 LEU 144 133 133 LEU LEU C . n 
C 1 145 ALA 145 134 134 ALA ALA C . n 
C 1 146 PHE 146 135 135 PHE PHE C . n 
C 1 147 LEU 147 136 136 LEU LEU C . n 
C 1 148 ARG 148 137 137 ARG ARG C . n 
C 1 149 LEU 149 138 138 LEU LEU C . n 
C 1 150 LEU 150 139 139 LEU LEU C . n 
C 1 151 SER 151 140 140 SER SER C . n 
C 1 152 SER 152 141 141 SER SER C . n 
C 1 153 ARG 153 142 142 ARG ARG C . n 
C 1 154 ALA 154 143 143 ALA ALA C . n 
C 1 155 SER 155 144 144 SER SER C . n 
C 1 156 GLN 156 145 145 GLN GLN C . n 
C 1 157 GLN 157 146 146 GLN GLN C . n 
C 1 158 ILE 158 147 147 ILE ILE C . n 
C 1 159 THR 159 148 148 THR THR C . n 
C 1 160 TYR 160 149 149 TYR TYR C . n 
C 1 161 HIS 161 150 150 HIS HIS C . n 
C 1 162 CYS 162 151 151 CYS CYS C . n 
C 1 163 LYS 163 152 152 LYS LYS C . n 
C 1 164 ASN 164 153 153 ASN ASN C . n 
C 1 165 SER 165 154 154 SER SER C . n 
C 1 166 ILE 166 155 155 ILE ILE C . n 
C 1 167 ALA 167 156 156 ALA ALA C . n 
C 1 168 TYR 168 157 157 TYR TYR C . n 
C 1 169 MSE 169 158 158 MSE MSE C . n 
C 1 170 ASP 170 159 159 ASP ASP C . n 
C 1 171 GLN 171 160 160 GLN GLN C . n 
C 1 172 ALA 172 161 161 ALA ALA C . n 
C 1 173 SER 173 162 162 SER SER C . n 
C 1 174 GLY 174 163 163 GLY GLY C . n 
C 1 175 ASN 175 164 164 ASN ASN C . n 
C 1 176 VAL 176 165 165 VAL VAL C . n 
C 1 177 LYS 177 166 166 LYS LYS C . n 
C 1 178 LYS 178 167 167 LYS LYS C . n 
C 1 179 ALA 179 168 168 ALA ALA C . n 
C 1 180 LEU 180 169 169 LEU LEU C . n 
C 1 181 LYS 181 170 170 LYS LYS C . n 
C 1 182 LEU 182 171 171 LEU LEU C . n 
C 1 183 MSE 183 172 172 MSE MSE C . n 
C 1 184 GLY 184 173 173 GLY GLY C . n 
C 1 185 SER 185 174 174 SER SER C . n 
C 1 186 ASN 186 175 175 ASN ASN C . n 
C 1 187 GLU 187 176 ?   ?   ?   C . n 
C 1 188 GLY 188 177 177 GLY GLY C . n 
C 1 189 GLU 189 178 178 GLU GLU C . n 
C 1 190 PHE 190 179 179 PHE PHE C . n 
C 1 191 LYS 191 180 180 LYS LYS C . n 
C 1 192 ALA 192 181 181 ALA ALA C . n 
C 1 193 GLU 193 182 182 GLU GLU C . n 
C 1 194 GLY 194 183 183 GLY GLY C . n 
C 1 195 ASN 195 184 184 ASN ASN C . n 
C 1 196 SER 196 185 185 SER SER C . n 
C 1 197 LYS 197 186 186 LYS LYS C . n 
C 1 198 PHE 198 187 187 PHE PHE C . n 
C 1 199 THR 199 188 188 THR THR C . n 
C 1 200 TYR 200 189 189 TYR TYR C . n 
C 1 201 THR 201 190 190 THR THR C . n 
C 1 202 VAL 202 191 191 VAL VAL C . n 
C 1 203 LEU 203 192 192 LEU LEU C . n 
C 1 204 GLU 204 193 193 GLU GLU C . n 
C 1 205 ASP 205 194 194 ASP ASP C . n 
C 1 206 GLY 206 195 195 GLY GLY C . n 
C 1 207 CYS 207 196 196 CYS CYS C . n 
C 1 208 THR 208 197 197 THR THR C . n 
C 1 209 LYS 209 198 198 LYS LYS C . n 
C 1 210 HIS 210 199 199 HIS HIS C . n 
C 1 211 THR 211 200 200 THR THR C . n 
C 1 212 GLY 212 201 201 GLY GLY C . n 
C 1 213 GLU 213 202 202 GLU GLU C . n 
C 1 214 TRP 214 203 203 TRP TRP C . n 
C 1 215 SER 215 204 204 SER SER C . n 
C 1 216 LYS 216 205 205 LYS LYS C . n 
C 1 217 THR 217 206 206 THR THR C . n 
C 1 218 VAL 218 207 207 VAL VAL C . n 
C 1 219 PHE 219 208 208 PHE PHE C . n 
C 1 220 GLU 220 209 209 GLU GLU C . n 
C 1 221 TYR 221 210 210 TYR TYR C . n 
C 1 222 ARG 222 211 211 ARG ARG C . n 
C 1 223 THR 223 212 212 THR THR C . n 
C 1 224 ARG 224 213 213 ARG ARG C . n 
C 1 225 LYS 225 214 214 LYS LYS C . n 
C 1 226 ALA 226 215 215 ALA ALA C . n 
C 1 227 VAL 227 216 216 VAL VAL C . n 
C 1 228 ARG 228 217 217 ARG ARG C . n 
C 1 229 LEU 229 218 218 LEU LEU C . n 
C 1 230 PRO 230 219 219 PRO PRO C . n 
C 1 231 ILE 231 220 220 ILE ILE C . n 
C 1 232 VAL 232 221 221 VAL VAL C . n 
C 1 233 ASP 233 222 222 ASP ASP C . n 
C 1 234 ILE 234 223 223 ILE ILE C . n 
C 1 235 ALA 235 224 224 ALA ALA C . n 
C 1 236 PRO 236 225 225 PRO PRO C . n 
C 1 237 TYR 237 226 226 TYR TYR C . n 
C 1 238 ASP 238 227 227 ASP ASP C . n 
C 1 239 ILE 239 228 228 ILE ILE C . n 
C 1 240 GLY 240 229 229 GLY GLY C . n 
C 1 241 GLY 241 230 230 GLY GLY C . n 
C 1 242 PRO 242 231 231 PRO PRO C . n 
C 1 243 ASP 243 232 232 ASP ASP C . n 
C 1 244 GLN 244 233 233 GLN GLN C . n 
C 1 245 GLU 245 234 234 GLU GLU C . n 
C 1 246 PHE 246 235 235 PHE PHE C . n 
C 1 247 GLY 247 236 236 GLY GLY C . n 
C 1 248 VAL 248 237 237 VAL VAL C . n 
C 1 249 ASP 249 238 238 ASP ASP C . n 
C 1 250 VAL 250 239 239 VAL VAL C . n 
C 1 251 GLY 251 240 240 GLY GLY C . n 
C 1 252 PRO 252 241 241 PRO PRO C . n 
C 1 253 VAL 253 242 242 VAL VAL C . n 
C 1 254 CYS 254 243 243 CYS CYS C . n 
C 1 255 PHE 255 244 244 PHE PHE C . n 
C 1 256 LEU 256 245 245 LEU LEU C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 CA  1  246  246  CA  CA  A . 
E 3 GOL 1  1246 1246 GOL GOL A . 
F 3 GOL 1  1247 1247 GOL GOL A . 
G 3 GOL 1  1248 1248 GOL GOL A . 
H 3 GOL 1  1249 1249 GOL GOL A . 
I 3 GOL 1  1250 1250 GOL GOL A . 
J 2 CA  1  246  246  CA  CA  B . 
K 3 GOL 1  1246 1246 GOL GOL B . 
L 3 GOL 1  1247 1247 GOL GOL B . 
M 2 CA  1  246  246  CA  CA  C . 
N 4 HOH 1  2001 2001 HOH HOH A . 
N 4 HOH 2  2002 2002 HOH HOH A . 
N 4 HOH 3  2003 2003 HOH HOH A . 
N 4 HOH 4  2004 2004 HOH HOH A . 
N 4 HOH 5  2005 2005 HOH HOH A . 
N 4 HOH 6  2006 2006 HOH HOH A . 
N 4 HOH 7  2007 2007 HOH HOH A . 
N 4 HOH 8  2008 2008 HOH HOH A . 
N 4 HOH 9  2009 2009 HOH HOH A . 
N 4 HOH 10 2010 2010 HOH HOH A . 
N 4 HOH 11 2011 2011 HOH HOH A . 
N 4 HOH 12 2012 2012 HOH HOH A . 
N 4 HOH 13 2013 2013 HOH HOH A . 
N 4 HOH 14 2014 2014 HOH HOH A . 
N 4 HOH 15 2015 2015 HOH HOH A . 
N 4 HOH 16 2016 2016 HOH HOH A . 
N 4 HOH 17 2017 2017 HOH HOH A . 
N 4 HOH 18 2018 2018 HOH HOH A . 
N 4 HOH 19 2019 2019 HOH HOH A . 
N 4 HOH 20 2020 2020 HOH HOH A . 
N 4 HOH 21 2021 2021 HOH HOH A . 
N 4 HOH 22 2022 2022 HOH HOH A . 
N 4 HOH 23 2023 2023 HOH HOH A . 
N 4 HOH 24 2024 2024 HOH HOH A . 
N 4 HOH 25 2025 2025 HOH HOH A . 
N 4 HOH 26 2026 2026 HOH HOH A . 
N 4 HOH 27 2027 2027 HOH HOH A . 
N 4 HOH 28 2028 2028 HOH HOH A . 
N 4 HOH 29 2029 2029 HOH HOH A . 
N 4 HOH 30 2030 2030 HOH HOH A . 
N 4 HOH 31 2031 2031 HOH HOH A . 
N 4 HOH 32 2032 2032 HOH HOH A . 
N 4 HOH 33 2033 2033 HOH HOH A . 
N 4 HOH 34 2034 2034 HOH HOH A . 
N 4 HOH 35 2035 2035 HOH HOH A . 
N 4 HOH 36 2036 2036 HOH HOH A . 
N 4 HOH 37 2037 2037 HOH HOH A . 
N 4 HOH 38 2038 2038 HOH HOH A . 
N 4 HOH 39 2039 2039 HOH HOH A . 
N 4 HOH 40 2040 2040 HOH HOH A . 
N 4 HOH 41 2041 2041 HOH HOH A . 
N 4 HOH 42 2042 2042 HOH HOH A . 
N 4 HOH 43 2043 2043 HOH HOH A . 
N 4 HOH 44 2044 2044 HOH HOH A . 
N 4 HOH 45 2045 2045 HOH HOH A . 
N 4 HOH 46 2046 2046 HOH HOH A . 
N 4 HOH 47 2047 2047 HOH HOH A . 
N 4 HOH 48 2048 2048 HOH HOH A . 
N 4 HOH 49 2049 2049 HOH HOH A . 
N 4 HOH 50 2050 2050 HOH HOH A . 
N 4 HOH 51 2051 2051 HOH HOH A . 
N 4 HOH 52 2052 2052 HOH HOH A . 
N 4 HOH 53 2053 2053 HOH HOH A . 
N 4 HOH 54 2054 2054 HOH HOH A . 
N 4 HOH 55 2055 2055 HOH HOH A . 
N 4 HOH 56 2056 2056 HOH HOH A . 
N 4 HOH 57 2057 2057 HOH HOH A . 
N 4 HOH 58 2058 2058 HOH HOH A . 
N 4 HOH 59 2059 2059 HOH HOH A . 
N 4 HOH 60 2060 2060 HOH HOH A . 
N 4 HOH 61 2061 2061 HOH HOH A . 
N 4 HOH 62 2062 2062 HOH HOH A . 
N 4 HOH 63 2063 2063 HOH HOH A . 
N 4 HOH 64 2064 2064 HOH HOH A . 
N 4 HOH 65 2065 2065 HOH HOH A . 
N 4 HOH 66 2066 2066 HOH HOH A . 
N 4 HOH 67 2067 2067 HOH HOH A . 
N 4 HOH 68 2068 2068 HOH HOH A . 
N 4 HOH 69 2069 2069 HOH HOH A . 
N 4 HOH 70 2070 2070 HOH HOH A . 
N 4 HOH 71 2071 2071 HOH HOH A . 
N 4 HOH 72 2072 2072 HOH HOH A . 
N 4 HOH 73 2073 2073 HOH HOH A . 
N 4 HOH 74 2074 2074 HOH HOH A . 
O 4 HOH 1  2001 2001 HOH HOH B . 
O 4 HOH 2  2002 2002 HOH HOH B . 
O 4 HOH 3  2003 2003 HOH HOH B . 
O 4 HOH 4  2004 2004 HOH HOH B . 
O 4 HOH 5  2005 2005 HOH HOH B . 
O 4 HOH 6  2006 2006 HOH HOH B . 
O 4 HOH 7  2007 2007 HOH HOH B . 
O 4 HOH 8  2008 2008 HOH HOH B . 
O 4 HOH 9  2009 2009 HOH HOH B . 
O 4 HOH 10 2010 2010 HOH HOH B . 
O 4 HOH 11 2011 2011 HOH HOH B . 
O 4 HOH 12 2012 2012 HOH HOH B . 
O 4 HOH 13 2013 2013 HOH HOH B . 
O 4 HOH 14 2014 2014 HOH HOH B . 
O 4 HOH 15 2015 2015 HOH HOH B . 
O 4 HOH 16 2016 2016 HOH HOH B . 
O 4 HOH 17 2017 2017 HOH HOH B . 
O 4 HOH 18 2018 2018 HOH HOH B . 
O 4 HOH 19 2019 2019 HOH HOH B . 
O 4 HOH 20 2020 2020 HOH HOH B . 
O 4 HOH 21 2021 2021 HOH HOH B . 
O 4 HOH 22 2022 2022 HOH HOH B . 
O 4 HOH 23 2023 2023 HOH HOH B . 
O 4 HOH 24 2024 2024 HOH HOH B . 
O 4 HOH 25 2025 2025 HOH HOH B . 
O 4 HOH 26 2026 2026 HOH HOH B . 
O 4 HOH 27 2027 2027 HOH HOH B . 
O 4 HOH 28 2028 2028 HOH HOH B . 
O 4 HOH 29 2029 2029 HOH HOH B . 
O 4 HOH 30 2030 2030 HOH HOH B . 
O 4 HOH 31 2031 2031 HOH HOH B . 
O 4 HOH 32 2032 2032 HOH HOH B . 
O 4 HOH 33 2033 2033 HOH HOH B . 
O 4 HOH 34 2034 2034 HOH HOH B . 
O 4 HOH 35 2035 2035 HOH HOH B . 
O 4 HOH 36 2036 2036 HOH HOH B . 
O 4 HOH 37 2037 2037 HOH HOH B . 
O 4 HOH 38 2038 2038 HOH HOH B . 
O 4 HOH 39 2039 2039 HOH HOH B . 
O 4 HOH 40 2040 2040 HOH HOH B . 
O 4 HOH 41 2041 2041 HOH HOH B . 
O 4 HOH 42 2042 2042 HOH HOH B . 
O 4 HOH 43 2043 2043 HOH HOH B . 
O 4 HOH 44 2044 2044 HOH HOH B . 
O 4 HOH 45 2045 2045 HOH HOH B . 
O 4 HOH 46 2046 2046 HOH HOH B . 
O 4 HOH 47 2047 2047 HOH HOH B . 
O 4 HOH 48 2048 2048 HOH HOH B . 
O 4 HOH 49 2049 2049 HOH HOH B . 
O 4 HOH 50 2050 2050 HOH HOH B . 
O 4 HOH 51 2051 2051 HOH HOH B . 
O 4 HOH 52 2052 2052 HOH HOH B . 
O 4 HOH 53 2053 2053 HOH HOH B . 
O 4 HOH 54 2054 2054 HOH HOH B . 
O 4 HOH 55 2055 2055 HOH HOH B . 
O 4 HOH 56 2056 2056 HOH HOH B . 
O 4 HOH 57 2057 2057 HOH HOH B . 
O 4 HOH 58 2058 2058 HOH HOH B . 
O 4 HOH 59 2059 2059 HOH HOH B . 
O 4 HOH 60 2060 2060 HOH HOH B . 
O 4 HOH 61 2061 2061 HOH HOH B . 
O 4 HOH 62 2062 2062 HOH HOH B . 
O 4 HOH 63 2063 2063 HOH HOH B . 
O 4 HOH 64 2064 2064 HOH HOH B . 
O 4 HOH 65 2065 2065 HOH HOH B . 
O 4 HOH 66 2066 2066 HOH HOH B . 
O 4 HOH 67 2067 2067 HOH HOH B . 
O 4 HOH 68 2068 2068 HOH HOH B . 
O 4 HOH 69 2069 2069 HOH HOH B . 
O 4 HOH 70 2070 2070 HOH HOH B . 
O 4 HOH 71 2071 2071 HOH HOH B . 
O 4 HOH 72 2072 2072 HOH HOH B . 
O 4 HOH 73 2073 2073 HOH HOH B . 
O 4 HOH 74 2074 2074 HOH HOH B . 
O 4 HOH 75 2075 2075 HOH HOH B . 
O 4 HOH 76 2076 2076 HOH HOH B . 
P 4 HOH 1  2001 2001 HOH HOH C . 
P 4 HOH 2  2002 2002 HOH HOH C . 
P 4 HOH 3  2003 2003 HOH HOH C . 
P 4 HOH 4  2004 2004 HOH HOH C . 
P 4 HOH 5  2005 2005 HOH HOH C . 
P 4 HOH 6  2006 2006 HOH HOH C . 
P 4 HOH 7  2007 2007 HOH HOH C . 
P 4 HOH 8  2008 2008 HOH HOH C . 
P 4 HOH 9  2009 2009 HOH HOH C . 
P 4 HOH 10 2010 2010 HOH HOH C . 
P 4 HOH 11 2011 2011 HOH HOH C . 
P 4 HOH 12 2012 2012 HOH HOH C . 
P 4 HOH 13 2013 2013 HOH HOH C . 
P 4 HOH 14 2014 2014 HOH HOH C . 
P 4 HOH 15 2015 2015 HOH HOH C . 
P 4 HOH 16 2016 2016 HOH HOH C . 
P 4 HOH 17 2017 2017 HOH HOH C . 
P 4 HOH 18 2018 2018 HOH HOH C . 
P 4 HOH 19 2019 2019 HOH HOH C . 
P 4 HOH 20 2020 2020 HOH HOH C . 
P 4 HOH 21 2021 2021 HOH HOH C . 
P 4 HOH 22 2022 2022 HOH HOH C . 
P 4 HOH 23 2023 2023 HOH HOH C . 
P 4 HOH 24 2024 2024 HOH HOH C . 
P 4 HOH 25 2025 2025 HOH HOH C . 
P 4 HOH 26 2026 2026 HOH HOH C . 
P 4 HOH 27 2027 2027 HOH HOH C . 
P 4 HOH 28 2028 2028 HOH HOH C . 
P 4 HOH 29 2029 2029 HOH HOH C . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 86  A MSE 75  ? MET SELENOMETHIONINE 
2  A MSE 122 A MSE 111 ? MET SELENOMETHIONINE 
3  A MSE 169 A MSE 158 ? MET SELENOMETHIONINE 
4  A MSE 183 A MSE 172 ? MET SELENOMETHIONINE 
5  B MSE 86  B MSE 75  ? MET SELENOMETHIONINE 
6  B MSE 122 B MSE 111 ? MET SELENOMETHIONINE 
7  B MSE 169 B MSE 158 ? MET SELENOMETHIONINE 
8  B MSE 183 B MSE 172 ? MET SELENOMETHIONINE 
9  C MSE 86  C MSE 75  ? MET SELENOMETHIONINE 
10 C MSE 122 C MSE 111 ? MET SELENOMETHIONINE 
11 C MSE 169 C MSE 158 ? MET SELENOMETHIONINE 
12 C MSE 183 C MSE 172 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5630  ? 
1 MORE         -68.7 ? 
1 'SSA (A^2)'  27990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? N HOH .  ? A HOH 2025 ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 70 ? A ASP 59   ? 1_555 146.4 ? 
2  O   ? N HOH .  ? A HOH 2025 ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD2 ? A ASP 70 ? A ASP 59   ? 1_555 161.4 ? 
3  OD1 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD2 ? A ASP 70 ? A ASP 59   ? 1_555 52.1  ? 
4  O   ? N HOH .  ? A HOH 2025 ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASN 72 ? A ASN 61   ? 1_555 83.9  ? 
5  OD1 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASN 72 ? A ASN 61   ? 1_555 78.6  ? 
6  OD2 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASN 72 ? A ASN 61   ? 1_555 107.3 ? 
7  O   ? N HOH .  ? A HOH 2025 ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A GLN 73 ? A GLN 62   ? 1_555 86.5  ? 
8  OD1 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A GLN 73 ? A GLN 62   ? 1_555 118.7 ? 
9  OD2 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A GLN 73 ? A GLN 62   ? 1_555 80.5  ? 
10 OD1 ? A ASN 72 ? A ASN 61   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A GLN 73 ? A GLN 62   ? 1_555 82.4  ? 
11 O   ? N HOH .  ? A HOH 2025 ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A CYS 75 ? A CYS 64   ? 1_555 82.3  ? 
12 OD1 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A CYS 75 ? A CYS 64   ? 1_555 115.2 ? 
13 OD2 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A CYS 75 ? A CYS 64   ? 1_555 85.2  ? 
14 OD1 ? A ASN 72 ? A ASN 61   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A CYS 75 ? A CYS 64   ? 1_555 165.7 ? 
15 O   ? A GLN 73 ? A GLN 62   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 O   ? A CYS 75 ? A CYS 64   ? 1_555 93.2  ? 
16 O   ? N HOH .  ? A HOH 2025 ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 78 ? A ASP 67   ? 1_555 74.2  ? 
17 OD1 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 78 ? A ASP 67   ? 1_555 81.2  ? 
18 OD2 ? A ASP 70 ? A ASP 59   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 78 ? A ASP 67   ? 1_555 116.7 ? 
19 OD1 ? A ASN 72 ? A ASN 61   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 78 ? A ASP 67   ? 1_555 100.7 ? 
20 O   ? A GLN 73 ? A GLN 62   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 78 ? A ASP 67   ? 1_555 159.9 ? 
21 O   ? A CYS 75 ? A CYS 64   ? 1_555 CA ? D CA . ? A CA 246 ? 1_555 OD1 ? A ASP 78 ? A ASP 67   ? 1_555 78.9  ? 
22 O   ? B GLN 73 ? B GLN 62   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? O HOH .  ? B HOH 2021 ? 1_555 86.7  ? 
23 O   ? B GLN 73 ? B GLN 62   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD2 ? B ASP 70 ? B ASP 59   ? 1_555 76.7  ? 
24 O   ? O HOH .  ? B HOH 2021 ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD2 ? B ASP 70 ? B ASP 59   ? 1_555 159.2 ? 
25 O   ? B GLN 73 ? B GLN 62   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASN 72 ? B ASN 61   ? 1_555 91.0  ? 
26 O   ? O HOH .  ? B HOH 2021 ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASN 72 ? B ASN 61   ? 1_555 81.1  ? 
27 OD2 ? B ASP 70 ? B ASP 59   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASN 72 ? B ASN 61   ? 1_555 111.2 ? 
28 O   ? B GLN 73 ? B GLN 62   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 78 ? B ASP 67   ? 1_555 162.1 ? 
29 O   ? O HOH .  ? B HOH 2021 ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 78 ? B ASP 67   ? 1_555 78.3  ? 
30 OD2 ? B ASP 70 ? B ASP 59   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 78 ? B ASP 67   ? 1_555 115.3 ? 
31 OD1 ? B ASN 72 ? B ASN 61   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 78 ? B ASP 67   ? 1_555 96.2  ? 
32 O   ? B GLN 73 ? B GLN 62   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 70 ? B ASP 59   ? 1_555 115.9 ? 
33 O   ? O HOH .  ? B HOH 2021 ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 70 ? B ASP 59   ? 1_555 146.0 ? 
34 OD2 ? B ASP 70 ? B ASP 59   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 70 ? B ASP 59   ? 1_555 54.6  ? 
35 OD1 ? B ASN 72 ? B ASN 61   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 70 ? B ASP 59   ? 1_555 73.8  ? 
36 OD1 ? B ASP 78 ? B ASP 67   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 OD1 ? B ASP 70 ? B ASP 59   ? 1_555 81.9  ? 
37 O   ? B GLN 73 ? B GLN 62   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? B CYS 75 ? B CYS 64   ? 1_555 87.4  ? 
38 O   ? O HOH .  ? B HOH 2021 ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? B CYS 75 ? B CYS 64   ? 1_555 91.1  ? 
39 OD2 ? B ASP 70 ? B ASP 59   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? B CYS 75 ? B CYS 64   ? 1_555 75.9  ? 
40 OD1 ? B ASN 72 ? B ASN 61   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? B CYS 75 ? B CYS 64   ? 1_555 172.1 ? 
41 OD1 ? B ASP 78 ? B ASP 67   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? B CYS 75 ? B CYS 64   ? 1_555 83.2  ? 
42 OD1 ? B ASP 70 ? B ASP 59   ? 1_555 CA ? J CA . ? B CA 246 ? 1_555 O   ? B CYS 75 ? B CYS 64   ? 1_555 113.7 ? 
43 OD2 ? C ASP 70 ? C ASP 59   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? C GLN 73 ? C GLN 62   ? 1_555 83.5  ? 
44 OD2 ? C ASP 70 ? C ASP 59   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? C CYS 75 ? C CYS 64   ? 1_555 80.3  ? 
45 O   ? C GLN 73 ? C GLN 62   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? C CYS 75 ? C CYS 64   ? 1_555 88.9  ? 
46 OD2 ? C ASP 70 ? C ASP 59   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 78 ? C ASP 67   ? 1_555 112.3 ? 
47 O   ? C GLN 73 ? C GLN 62   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 78 ? C ASP 67   ? 1_555 159.0 ? 
48 O   ? C CYS 75 ? C CYS 64   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 78 ? C ASP 67   ? 1_555 80.6  ? 
49 OD2 ? C ASP 70 ? C ASP 59   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASN 72 ? C ASN 61   ? 1_555 112.1 ? 
50 O   ? C GLN 73 ? C GLN 62   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASN 72 ? C ASN 61   ? 1_555 86.2  ? 
51 O   ? C CYS 75 ? C CYS 64   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASN 72 ? C ASN 61   ? 1_555 166.0 ? 
52 OD1 ? C ASP 78 ? C ASP 67   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASN 72 ? C ASN 61   ? 1_555 99.6  ? 
53 OD2 ? C ASP 70 ? C ASP 59   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? N HOH .  ? A HOH 2012 ? 1_555 160.7 ? 
54 O   ? C GLN 73 ? C GLN 62   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? N HOH .  ? A HOH 2012 ? 1_555 83.1  ? 
55 O   ? C CYS 75 ? C CYS 64   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? N HOH .  ? A HOH 2012 ? 1_555 85.7  ? 
56 OD1 ? C ASP 78 ? C ASP 67   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? N HOH .  ? A HOH 2012 ? 1_555 78.0  ? 
57 OD1 ? C ASN 72 ? C ASN 61   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 O   ? N HOH .  ? A HOH 2012 ? 1_555 80.8  ? 
58 OD2 ? C ASP 70 ? C ASP 59   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 70 ? C ASP 59   ? 1_555 52.9  ? 
59 O   ? C GLN 73 ? C GLN 62   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 70 ? C ASP 59   ? 1_555 123.4 ? 
60 O   ? C CYS 75 ? C CYS 64   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 70 ? C ASP 59   ? 1_555 112.9 ? 
61 OD1 ? C ASP 78 ? C ASP 67   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 70 ? C ASP 59   ? 1_555 77.6  ? 
62 OD1 ? C ASN 72 ? C ASN 61   ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 70 ? C ASP 59   ? 1_555 80.6  ? 
63 O   ? N HOH .  ? A HOH 2012 ? 1_555 CA ? M CA . ? C CA 246 ? 1_555 OD1 ? C ASP 70 ? C ASP 59   ? 1_555 146.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-09-12 
2 'Structure model' 1 1 2013-01-16 
3 'Structure model' 1 2 2019-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' Other                  
3 3 'Structure model' 'Data collection'      
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' Other                  
6 3 'Structure model' 'Source and taxonomy'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' entity_src_gen              
2 3 'Structure model' pdbx_database_proc          
3 3 'Structure model' pdbx_database_status        
4 3 'Structure model' pdbx_seq_map_depositor_info 
5 3 'Structure model' struct_conn                 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'          
2 3 'Structure model' '_pdbx_database_status.recvd_author_approval'      
3 3 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.6.0117 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
PHENIX phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             4AEJ 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, ASN1064 TO GLN
ENGINEERED RESIDUE IN CHAIN B, ASN1064 TO GLN
ENGINEERED RESIDUE IN CHAIN C, ASN1064 TO GLN
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    127 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    42 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.04 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 ND1 B HIS 48 ? ? 1_555 OE2 C GLU 193 ? ? 2_455 1.74 
2 1 OE2 B GLU 50 ? ? 1_555 OE2 C GLU 193 ? ? 2_455 2.09 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 62  ? ? 49.35   -136.64 
2  1 SER A 110 ? ? -141.34 -8.60   
3  1 ASN A 121 ? ? -37.97  113.75  
4  1 TYR A 157 ? ? -135.00 -79.00  
5  1 GLU A 176 ? ? 52.72   8.50    
6  1 LYS A 214 ? ? -113.89 79.51   
7  1 GLN B 62  ? ? 52.11   -139.12 
8  1 TYR B 157 ? ? -142.37 -74.50  
9  1 LYS B 214 ? ? -108.78 79.06   
10 1 GLN C 62  ? ? 56.45   -140.22 
11 1 TYR C 157 ? ? -135.90 -77.71  
12 1 TYR C 226 ? ? -95.03  -61.83  
13 1 ASP C 227 ? ? -69.13  77.72   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 35  ? CE  ? A LYS 46  CE  
2  1 Y 1 A LYS 35  ? NZ  ? A LYS 46  NZ  
3  1 Y 1 A LYS 103 ? CG  ? A LYS 114 CG  
4  1 Y 1 A LYS 103 ? CD  ? A LYS 114 CD  
5  1 Y 1 A LYS 103 ? CE  ? A LYS 114 CE  
6  1 Y 1 A LYS 103 ? NZ  ? A LYS 114 NZ  
7  1 Y 1 A LYS 166 ? CD  ? A LYS 177 CD  
8  1 Y 1 A LYS 166 ? CE  ? A LYS 177 CE  
9  1 Y 1 A LYS 166 ? NZ  ? A LYS 177 NZ  
10 1 Y 1 A GLU 176 ? CG  ? A GLU 187 CG  
11 1 Y 1 A GLU 176 ? CD  ? A GLU 187 CD  
12 1 Y 1 A GLU 176 ? OE1 ? A GLU 187 OE1 
13 1 Y 1 A GLU 176 ? OE2 ? A GLU 187 OE2 
14 1 Y 1 A LYS 186 ? CD  ? A LYS 197 CD  
15 1 Y 1 A LYS 186 ? CE  ? A LYS 197 CE  
16 1 Y 1 A LYS 186 ? NZ  ? A LYS 197 NZ  
17 1 Y 1 A LYS 198 ? CE  ? A LYS 209 CE  
18 1 Y 1 A LYS 198 ? NZ  ? A LYS 209 NZ  
19 1 Y 1 B ILE 28  ? CG1 ? B ILE 39  CG1 
20 1 Y 1 B ILE 28  ? CG2 ? B ILE 39  CG2 
21 1 Y 1 B ILE 28  ? CD1 ? B ILE 39  CD1 
22 1 Y 1 B GLU 76  ? CD  ? B GLU 87  CD  
23 1 Y 1 B GLU 76  ? OE1 ? B GLU 87  OE1 
24 1 Y 1 B GLU 76  ? OE2 ? B GLU 87  OE2 
25 1 Y 1 C ILE 28  ? CG1 ? C ILE 39  CG1 
26 1 Y 1 C ILE 28  ? CG2 ? C ILE 39  CG2 
27 1 Y 1 C ILE 28  ? CD1 ? C ILE 39  CD1 
28 1 Y 1 C GLU 76  ? CG  ? C GLU 87  CG  
29 1 Y 1 C GLU 76  ? CD  ? C GLU 87  CD  
30 1 Y 1 C GLU 76  ? OE1 ? C GLU 87  OE1 
31 1 Y 1 C GLU 76  ? OE2 ? C GLU 87  OE2 
32 1 Y 1 C LYS 103 ? CG  ? C LYS 114 CG  
33 1 Y 1 C LYS 103 ? CD  ? C LYS 114 CD  
34 1 Y 1 C LYS 103 ? CE  ? C LYS 114 CE  
35 1 Y 1 C LYS 103 ? NZ  ? C LYS 114 NZ  
36 1 Y 1 C ASP 112 ? CG  ? C ASP 123 CG  
37 1 Y 1 C ASP 112 ? OD1 ? C ASP 123 OD1 
38 1 Y 1 C ASP 112 ? OD2 ? C ASP 123 OD2 
39 1 Y 1 C GLU 126 ? CD  ? C GLU 137 CD  
40 1 Y 1 C GLU 126 ? OE1 ? C GLU 137 OE1 
41 1 Y 1 C GLU 126 ? OE2 ? C GLU 137 OE2 
42 1 Y 1 C GLN 160 ? CG  ? C GLN 171 CG  
43 1 Y 1 C GLN 160 ? CD  ? C GLN 171 CD  
44 1 Y 1 C GLN 160 ? OE1 ? C GLN 171 OE1 
45 1 Y 1 C GLN 160 ? NE2 ? C GLN 171 NE2 
46 1 Y 1 C LYS 166 ? CG  ? C LYS 177 CG  
47 1 Y 1 C LYS 166 ? CD  ? C LYS 177 CD  
48 1 Y 1 C LYS 166 ? CE  ? C LYS 177 CE  
49 1 Y 1 C LYS 166 ? NZ  ? C LYS 177 NZ  
50 1 Y 1 C ASN 175 ? CG  ? C ASN 186 CG  
51 1 Y 1 C ASN 175 ? OD1 ? C ASN 186 OD1 
52 1 Y 1 C ASN 175 ? ND2 ? C ASN 186 ND2 
53 1 Y 1 C LYS 186 ? CE  ? C LYS 197 CE  
54 1 Y 1 C LYS 186 ? NZ  ? C LYS 197 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLU -10 ? A GLU 1   
2   1 Y 1 A THR -9  ? A THR 2   
3   1 Y 1 A GLY -8  ? A GLY 3   
4   1 Y 1 A HIS -7  ? A HIS 4   
5   1 Y 1 A HIS -6  ? A HIS 5   
6   1 Y 1 A HIS -5  ? A HIS 6   
7   1 Y 1 A HIS -4  ? A HIS 7   
8   1 Y 1 A HIS -3  ? A HIS 8   
9   1 Y 1 A HIS -2  ? A HIS 9   
10  1 Y 1 A SER -1  ? A SER 10  
11  1 Y 1 A ALA 0   ? A ALA 11  
12  1 Y 1 A ASP 1   ? A ASP 12  
13  1 Y 1 A GLU 2   ? A GLU 13  
14  1 Y 1 A PRO 3   ? A PRO 14  
15  1 Y 1 A MSE 4   ? A MSE 15  
16  1 Y 1 A ASP 5   ? A ASP 16  
17  1 Y 1 A PHE 6   ? A PHE 17  
18  1 Y 1 A LYS 7   ? A LYS 18  
19  1 Y 1 A ILE 8   ? A ILE 19  
20  1 Y 1 A ASN 9   ? A ASN 20  
21  1 Y 1 A THR 10  ? A THR 21  
22  1 Y 1 A ASP 11  ? A ASP 22  
23  1 Y 1 A GLU 12  ? A GLU 23  
24  1 Y 1 A ILE 13  ? A ILE 24  
25  1 Y 1 A MSE 14  ? A MSE 25  
26  1 Y 1 A THR 15  ? A THR 26  
27  1 Y 1 A SER 16  ? A SER 27  
28  1 Y 1 A LEU 17  ? A LEU 28  
29  1 Y 1 A LYS 18  ? A LYS 29  
30  1 Y 1 A SER 19  ? A SER 30  
31  1 Y 1 A VAL 20  ? A VAL 31  
32  1 Y 1 A ASN 21  ? A ASN 32  
33  1 Y 1 A GLY 22  ? A GLY 33  
34  1 Y 1 A GLN 23  ? A GLN 34  
35  1 Y 1 A ILE 24  ? A ILE 35  
36  1 Y 1 A GLU 25  ? A GLU 36  
37  1 Y 1 A SER 26  ? A SER 37  
38  1 Y 1 A LEU 27  ? A LEU 38  
39  1 Y 1 A ILE 28  ? A ILE 39  
40  1 Y 1 A SER 98  ? A SER 109 
41  1 Y 1 A SER 99  ? A SER 110 
42  1 Y 1 A ALA 100 ? A ALA 111 
43  1 Y 1 A GLU 101 ? A GLU 112 
44  1 Y 1 B GLU -10 ? B GLU 1   
45  1 Y 1 B THR -9  ? B THR 2   
46  1 Y 1 B GLY -8  ? B GLY 3   
47  1 Y 1 B HIS -7  ? B HIS 4   
48  1 Y 1 B HIS -6  ? B HIS 5   
49  1 Y 1 B HIS -5  ? B HIS 6   
50  1 Y 1 B HIS -4  ? B HIS 7   
51  1 Y 1 B HIS -3  ? B HIS 8   
52  1 Y 1 B HIS -2  ? B HIS 9   
53  1 Y 1 B SER -1  ? B SER 10  
54  1 Y 1 B ALA 0   ? B ALA 11  
55  1 Y 1 B ASP 1   ? B ASP 12  
56  1 Y 1 B GLU 2   ? B GLU 13  
57  1 Y 1 B PRO 3   ? B PRO 14  
58  1 Y 1 B MSE 4   ? B MSE 15  
59  1 Y 1 B ASP 5   ? B ASP 16  
60  1 Y 1 B PHE 6   ? B PHE 17  
61  1 Y 1 B LYS 7   ? B LYS 18  
62  1 Y 1 B ILE 8   ? B ILE 19  
63  1 Y 1 B ASN 9   ? B ASN 20  
64  1 Y 1 B THR 10  ? B THR 21  
65  1 Y 1 B ASP 11  ? B ASP 22  
66  1 Y 1 B GLU 12  ? B GLU 23  
67  1 Y 1 B ILE 13  ? B ILE 24  
68  1 Y 1 B MSE 14  ? B MSE 25  
69  1 Y 1 B THR 15  ? B THR 26  
70  1 Y 1 B SER 16  ? B SER 27  
71  1 Y 1 B LEU 17  ? B LEU 28  
72  1 Y 1 B LYS 18  ? B LYS 29  
73  1 Y 1 B SER 19  ? B SER 30  
74  1 Y 1 B VAL 20  ? B VAL 31  
75  1 Y 1 B ASN 21  ? B ASN 32  
76  1 Y 1 B GLY 22  ? B GLY 33  
77  1 Y 1 B GLN 23  ? B GLN 34  
78  1 Y 1 B ILE 24  ? B ILE 35  
79  1 Y 1 B GLU 25  ? B GLU 36  
80  1 Y 1 B SER 26  ? B SER 37  
81  1 Y 1 B LEU 27  ? B LEU 38  
82  1 Y 1 C GLU -10 ? C GLU 1   
83  1 Y 1 C THR -9  ? C THR 2   
84  1 Y 1 C GLY -8  ? C GLY 3   
85  1 Y 1 C HIS -7  ? C HIS 4   
86  1 Y 1 C HIS -6  ? C HIS 5   
87  1 Y 1 C HIS -5  ? C HIS 6   
88  1 Y 1 C HIS -4  ? C HIS 7   
89  1 Y 1 C HIS -3  ? C HIS 8   
90  1 Y 1 C HIS -2  ? C HIS 9   
91  1 Y 1 C SER -1  ? C SER 10  
92  1 Y 1 C ALA 0   ? C ALA 11  
93  1 Y 1 C ASP 1   ? C ASP 12  
94  1 Y 1 C GLU 2   ? C GLU 13  
95  1 Y 1 C PRO 3   ? C PRO 14  
96  1 Y 1 C MSE 4   ? C MSE 15  
97  1 Y 1 C ASP 5   ? C ASP 16  
98  1 Y 1 C PHE 6   ? C PHE 17  
99  1 Y 1 C LYS 7   ? C LYS 18  
100 1 Y 1 C ILE 8   ? C ILE 19  
101 1 Y 1 C ASN 9   ? C ASN 20  
102 1 Y 1 C THR 10  ? C THR 21  
103 1 Y 1 C ASP 11  ? C ASP 22  
104 1 Y 1 C GLU 12  ? C GLU 23  
105 1 Y 1 C ILE 13  ? C ILE 24  
106 1 Y 1 C MSE 14  ? C MSE 25  
107 1 Y 1 C THR 15  ? C THR 26  
108 1 Y 1 C SER 16  ? C SER 27  
109 1 Y 1 C LEU 17  ? C LEU 28  
110 1 Y 1 C LYS 18  ? C LYS 29  
111 1 Y 1 C SER 19  ? C SER 30  
112 1 Y 1 C VAL 20  ? C VAL 31  
113 1 Y 1 C ASN 21  ? C ASN 32  
114 1 Y 1 C GLY 22  ? C GLY 33  
115 1 Y 1 C GLN 23  ? C GLN 34  
116 1 Y 1 C ILE 24  ? C ILE 35  
117 1 Y 1 C GLU 25  ? C GLU 36  
118 1 Y 1 C SER 26  ? C SER 37  
119 1 Y 1 C LEU 27  ? C LEU 38  
120 1 Y 1 C SER 98  ? C SER 109 
121 1 Y 1 C SER 99  ? C SER 110 
122 1 Y 1 C ALA 100 ? C ALA 111 
123 1 Y 1 C GLU 101 ? C GLU 112 
124 1 Y 1 C LYS 102 ? C LYS 113 
125 1 Y 1 C GLU 176 ? C GLU 187 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 GLYCEROL      GOL 
4 water         HOH 
#