data_4AOR
# 
_entry.id   4AOR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4AOR         
PDBE  EBI-51903    
WWPDB D_1290051903 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1AQ7 unspecified 'TRYPSIN WITH INHIBITOR AERUGINOSIN 98-B' 
PDB 1AUJ unspecified 'BOVINE TRYPSIN COMPLEXED TO META-CYANO-BENZYLIC INHIBITOR' 
PDB 1AZ8 unspecified 'BOVINE TRYPSIN COMPLEXED TO BIS-PHENYLAMIDINE INHIBITOR' 
PDB 1BJU unspecified 'BETA-TRYPSIN COMPLEXED WITH ACPU' 
PDB 1BJV unspecified 'BETA-TRYPSIN COMPLEXED WITH APPU' 
PDB 1BTP unspecified . 
PDB 1BTW unspecified . 
PDB 1BTX unspecified . 
PDB 1BTY unspecified . 
PDB 1BTZ unspecified . 
PDB 1C1N unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C1O unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C1P unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C1Q unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C1R unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C1S unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C1T unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2D unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2E unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2F unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2G unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2H unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2I unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2J unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2K unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OFSERINE PROTEASES' 
PDB 1C2L unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C2M unspecified 'RECRUITING ZINC TO MEDIATE POTENT, SPECIFIC INHIBITION OF SERINE PROTEASES' 
PDB 1C5P unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C5Q unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C5R unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C5S unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C5T unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C5U unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C5V unspecified 
'STRUCTURAL BASIS FOR SELECTIVITY OF A SMALL MOLECULE, S1-BINDING, SUB- MICROMOLAR INHIBITOR OF UROKINASE TYPE PLASMINOGEN ACTIVATOR' 
PDB 1C9T unspecified 'COMPLEX OF BDELLASTASIN WITH BOVINE TRYPSIN' 
PDB 1CE5 unspecified 'BOVINE PANCREAS BETA-TRYPSIN IN COMPLEX WITH BENZAMIDINE' 
PDB 1CU7 unspecified 
;BOVINE TRYPSIN COMPLEXED WITH 2-[3-AMINO(IMINOMETHYL) PHENOXY]-6-[3-(AMINOMETHYL)PHENOXY]-3,5-DIFLUORO-4- METHYLPYRIDINE (ZK-806299), BINDING MODEL FROM DOUBLE REDOR NMR AND MD SIMULATIONS
;
PDB 1CU8 unspecified 
;BOVINE TRYPSIN COMPLEXED WITH 2,6-BIS[3-AMINO(IMINO )METHYL PHENOXY]-3,5-DIFLUORO-4-METHYLPYRIDINE (ZK- 805623), BINDING MODEL FROM DOUBLE REDOR NMR AND MD SIMULATIONS
;
PDB 1CU9 unspecified 
;BOVINE TRYPSIN COMPLEXED WITH 2,6-BIS[3-AMINO(IMINO )METHYL PHENOXY]-3,5-DIFLUORO-4-METHYLPYRIDINE (ZK- 805623), BINDING MODEL FROM DOUBLE REDOR NMR AND MD SIMULATIONS
;
PDB 1D6R unspecified 
;CRYSTAL STRUCTURE OF CANCER CHEMOPREVENTIVE BOWMAN-BIRK INHIBITOR IN TERNARY COMPLEX WITH BOVINE TRYPSIN AT 2 .3 A RESOLUTION. STRUCTURAL BASIS OF JANUS-FACED SERINE PROTEASE INHIBITOR SPECIFICITY
;
PDB 1EB2 unspecified 'TRYPSIN INHIBITOR COMPLEX (FRA)' 
PDB 1EJM unspecified 'CRYSTAL STRUCTURE OF THE BPTI ALA16LEU MUTANT IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1EZX unspecified 'CRYSTAL STRUCTURE OF A SERPIN:PROTEASE COMPLEX' 
PDB 1F0T unspecified 'BOVINE TRYPSIN COMPLEXED WITH RPR131247' 
PDB 1F0U unspecified 'BOVINE TRYPSIN COMPLEXED WITH RPR128515' 
PDB 1F2S unspecified 
;CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN BOVINE BETA- TRYPSIN AND MCTI-A, A TRYPSIN INHIBITOR OF SQUASH FAMILY AT 1.8 A RESOLUTION
;
PDB 1G36 unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1G3B unspecified 'BOVINE BETA-TRYPSIN BOUND TO META-AMIDINO SCHIFF BASEMAGNESIUM(II) CHELATE' 
PDB 1G3C unspecified 'BOVINE BETA-TRYPSIN BOUND TO PARA-AMIDINO SCHIFF BASEIRON(III) CHELATE' 
PDB 1G3D unspecified 'BOVINE BETA-TRYPSIN BOUND TO META-AMIDINO SCHIFF BASECOPPER (II) CHELATE' 
PDB 1G3E unspecified 'BOVINE BETA-TRYPSIN BOUND TO PARA-AMIDINO SCHIFF- BASECOPPER (II) CHELATE' 
PDB 1G9I unspecified 'CRYSTAL STRUCTURE OF BETA-TRYSIN COMPLEX IN CYCLOHEXANE' 
PDB 1GBT unspecified 'BETA-TRYPSIN GUANIDINOBENZOYLATED AT SERINE 195 (PH 5. 5)' 
PDB 1GHZ unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI0 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI1 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI2 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI3 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI4 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI5 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GI6 unspecified 
'A NOVEL SERINE PROTEASE INHIBITION MOTIF INVOLVING A MULTI-CENTERED SHORT HYDROGEN BONDING NETWORK AT THE ACTIVE SITE' 
PDB 1GJ6 unspecified 'ENGINEERING INHIBITORS HIGHLY SELECTIVE FOR THE S1 SITES OFSER190 TRYPSIN-LIKE SERINE PROTEASE DRUG TARGETS' 
PDB 1HJ9 unspecified 'ATOMIC RESOLUTION STRUCTURES OF TRYPSIN PROVIDE INSIGHT INTO STRUCTURAL RADIATION DAMAGE' 
PDB 1J8A unspecified 
;CRYSTAL STRUCTURE OF BENZAMIDINE INHIBITED BOVINEPANCREATIC TRYPSIN AT 105K TO 1.21A RESOLUTION FROMLABORATORY SOURCE WITH HIGH NUMBER OF WATERS MODELLED
;
PDB 1JIR unspecified 'CRYSTAL STRUCTURE OF TRYPSIN COMPLEX WITH AMYLAMINE INCYCLOHEXANE' 
PDB 1JRS unspecified 'HEMIACETAL COMPLEX BETWEEN LEUPEPTIN AND TRYPSIN' 
PDB 1JRT unspecified 'HEMIACETAL COMPLEX BETWEEN LEUPEPTIN AND TRYPSIN' 
PDB 1K1I unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1K1J unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1K1L unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1K1M unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1K1N unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1K1O unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1K1P unspecified 'BOVINE TRYPSIN-INHIBITOR COMPLEX' 
PDB 1LQE unspecified 'CRYSTAL STRUCTURE OF TRYPSIN IN COMPLEX WITH 79.' 
PDB 1MAX unspecified 'BETA-TRYPSIN PHOSPHONATE INHIBITED' 
PDB 1MAY unspecified 'BETA-TRYPSIN PHOSPHONATE INHIBITED' 
PDB 1MTS unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1MTU unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1MTV unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1MTW unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1N6X unspecified 'RIP-PHASING ON BOVINE TRYPSIN' 
PDB 1N6Y unspecified 'RIP-PHASING ON BOVINE TRYPSIN' 
PDB 1NC6 unspecified 
;POTENT, SMALL MOLECULE INHIBITORS OF HUMAN MAST CELLTRYPTASE. ANTI-ASTHMATIC ACTION OF A DIPEPTIDE- BASEDTRANSITION STATE ANALOGUE CONTAINING BENZOTHIAZOLE KETONE
;
PDB 1NTP unspecified 'MODIFIED BETA TRYPSIN (MONOISOPROPYLPHOSPHORYL INHIBITED) ( NEUTRON DATA)' 
PDB 1O2H unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2I unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2J unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2K unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2L unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2M unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2N unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2O unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2P unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2Q unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2R unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2S unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2T unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2U unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2V unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2W unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2X unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2Y unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O2Z unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O30 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O31 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O32 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O33 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O34 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O35 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O36 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O37 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O38 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O39 unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3A unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3B unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3C unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3D unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3E unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3F unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3G unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3H unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3I unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3J unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3K unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3L unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3M unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3N unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1O3O unspecified 
'ELABORATE MANIFOLD OF SHORT HYDROGEN BOND ARRAYS MEDIATINGBINDING OF ACTIVE SITE-DIRECTED SERINE PROTEASE INHIBITORS' 
PDB 1OPH unspecified 'NON-COVALENT COMPLEX BETWEEN ALPHA-1-PI-PITTSBURGH ANDS195A TRYPSIN' 
PDB 1OX1 unspecified 'CRYSTAL STRUCTURE OF THE BOVINE TRYPSIN COMPLEX WITH ASYNTHETIC 11 PEPTIDE INHIBITOR' 
PDB 1OYQ unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1P2I unspecified 
;STRUCTURAL CONSEQUENCES OF ACCOMMODATION OF FOUR NON- COGNATE AMINO-ACID RESIDUES IN THE S1 POCKET OF BOVINETRYPSIN AND CHYMOTRYPSIN
;
PDB 1P2J unspecified 
;STRUCTURAL CONSEQUENCES OF ACCOMMODATION OF FOUR NON- COGNATE AMINO-ACID RESIDUES IN THE S1 POCKET OF BOVINETRYPSIN AND CHYMOTRYPSIN
;
PDB 1P2K unspecified 
;STRUCTURAL CONSEQUENCES OF ACCOMMODATION OF FOUR NON- COGNATE AMINO-ACID RESIDUES IN THE S1 POCKET OF BOVINETRYPSIN AND CHYMOTRYPSIN
;
PDB 1PPC unspecified 'TRYPSIN COMPLEX WITH NONCOVALENTLY BOUND NAPAP' 
PDB 1PPE unspecified 'TRYPSIN COMPLEX WITH (CUCURBITA MAXIMA) TRYPSIN INHIBITOR (CMTI-I)' 
PDB 1PPH unspecified 'TRYPSIN COMPLEX WITH NONCOVALENTLY BOUND 3-TAPAP' 
PDB 1QA0 unspecified 'BOVINE TRYPSIN 2-AMINOBENZIMIDAZOLE COMPLEX' 
PDB 1QB1 unspecified 
;BOVINE TRYPSIN WITH 1-[2-[5-[AMINO(IMINO)METHYL]-2 - HYDROXYPHENOXY]-6-[3-(4,5-DIHYDRO-1-METHYL-1H- IMIDAZOL-2-YL) PHENOXY]PYRIDIN-4-YL]PIPERIDINE-3- CARBOXYLIC ACID (ZK- 806974)
;
PDB 1QB6 unspecified 
;BOVINE TRYPSIN 3,3'-[3,5-DIFLUORO-4-METHYL-2, 6- PYRIDINEDIYLBIS(OXY)]BIS(BENZENECARBOXIMIDAMIDE) (ZK-805623 ) COMPLEX
;
PDB 1QB9 unspecified 
;BOVINE TRYPSIN 7-[[2-[[1-(1-IMINOETHYL)PIPERIDIN-4- YL]OXY]- 9H-CARBOZOL-9-YL] METHYL]NAPHTHALENE-2- CARBOXIMIDAMIDE (ZK- 806450) COMPLEX
;
PDB 1QBN unspecified 
;BOVINE TRYPSIN 2-[AMINO(IMINO)METHYL]-2-HYDROXYPHENOXY ]-6- [3-(4,5-DIHYDRO-1H-IMIDAZOL-2-YL)PHENOXY] PYRIDINE-4- CARBOXYLIC ACID (ZK-806688) COMPLEX
;
PDB 1QBO unspecified 
;BOVINE TRYPSIN 7-[[6-[[1-(1-IMINOETHYL)PIPERIDIN-4- YL]OXY]- 2-METHYL-BENZIMIDAZOL-1-YL]METHYL]NAPHTHALENE -2- CARBOXIMIDAMID ZK-806711 INHIBITOR COMPLEX
;
PDB 1QCP unspecified 'CRYSTAL STRUCTURE OF THE RWJ-51084 BOVINE PANCREATIC BETA- TRYPSIN AT 1.8 A' 
PDB 1QL7 unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1QL8 unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 1RXP unspecified 
;STRUCTURE OF TRYPSIN (ORTHORHOMBIC) WITH 1-(4-TERT- BUTYLCARBAMOYL- PIPERAZINE-1-CARBONYL)-3-(3-GUANIDINO- PROPYL)-4-OXO-AZETIDINE-2-CARBOXYLIC ACID
;
PDB 1S0Q unspecified 'NATIVE BOVINE PANCREATIC TRYPSIN' 
PDB 1S0R unspecified 'BOVINE PANCREATIC TRYPSIN INHIBITED WITH BENZAMIDINE ATATOMIC RESOLUTION' 
PDB 1SBW unspecified 
'CRYSTAL STRUCTURE OF MUNG BEAN INHIBITOR LYSINE ACTIVE FRAGMENT COMPLEX WITH BOVINE BETA-TRYPSIN AT 1.8A RESOLUTION' 
PDB 1SFI unspecified 'HIGH RESOLUTION STRUCTURE OF A POTENT, CYCLIC PROTEASE INHIBITOR FROM SUNFLOWER SEEDS' 
PDB 1SMF unspecified 'TRYPSIN COMPLEXED WITH BOWMAN-BIRK INHIBITOR' 
PDB 1TAB unspecified 'TRYPSIN COMPLEX WITH BOWMAN-BIRK INHIBITOR (AB-I)' 
PDB 1TAW unspecified 'BOVINE TRYPSIN COMPLEXED TO APPI' 
PDB 1TGB unspecified 'TRYPSINOGEN-CA FROM PEG' 
PDB 1TGC unspecified 'TRYPSINOGEN (0.50 METHANOL, 0.50 WATER)' 
PDB 1TGN unspecified TRYPSINOGEN 
PDB 1TGS unspecified 'TRYPSINOGEN COMPLEX WITH PORCINE PANCREATIC SECRETORY TRYPSIN INHIBITOR' 
PDB 1TGT unspecified 'TRYPSINOGEN (173 DEGREES K, 0.70 METHANOL, 0.30 WATER)' 
PDB 1TIO unspecified 'HIGH PACKING DENSITY FORM OF BOVINE BETA-TRYPSIN IN CYCLOHEXANE' 
PDB 1TLD unspecified 'BETA-TRYPSIN (ORTHORHOMBIC) AT PH 5.3' 
PDB 1TNG unspecified 'TRYPSIN COMPLEXED WITH THE INHIBITOR AMINOMETHYLCYCLOHEXANE' 
PDB 1TNH unspecified 'TRYPSIN COMPLEXED WITH THE INHIBITOR 4-FLUOROBENZYLAMINE' 
PDB 1TNI unspecified 'TRYPSIN COMPLEXED WITH THE INHIBITOR 4-PHENYLBUTYLAMINE' 
PDB 1TNJ unspecified 'TRYPSIN COMPLEXED WITH THE INHIBITOR 2-PHENYLETHYLAMINE' 
PDB 1TNK unspecified 'TRYPSIN COMPLEXED WITH THE INHIBITOR 3-PHENYLPROPYLAMINE' 
PDB 1TNL unspecified 'TRYPSIN COMPLEXED WITH THE INHIBITOR TRANYLCYPROMINE' 
PDB 1TPA unspecified 'ANHYDRO-TRYPSIN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR' 
PDB 1TPO unspecified 'BETA-TRYPSIN (ORTHORHOMBIC) AT PH5.0' 
PDB 1TPP unspecified 'BETA-TRYPSIN COMPLEX WITH P-AMIDINO-PHENYL-PYRUVATE ( APPA)' 
PDB 1TPS unspecified 'TRYPSIN COMPLEXED WITH INHIBITOR A90720A' 
PDB 1TX7 unspecified 'BOVINE TRYPSIN COMPLEXED WITH P- AMIDINOPHENYLMETHYLPHOSPHINIC ACID (AMPA)' 
PDB 1TX8 unspecified 'BOVINE TRYPSIN COMPLEXED WITH AMSO' 
PDB 1TYN unspecified 'BETA TRYPSIN COMPLEXED WITH CYCLOTHEONAMIDE A' 
PDB 1UTN unspecified 
'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' 
PDB 1UTO unspecified 
'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' 
PDB 1UTP unspecified 
'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' 
PDB 1UTQ unspecified 
'TRYPSIN SPECIFICITY AS ELUCIDATED BY LIE CALCULATIONS, X -RAY STRUCTURES AND ASSOCIATION CONSTANT MEASUREMENTS' 
PDB 1V2J unspecified 'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANT X( SSRI)BT.C1' 
PDB 1V2K unspecified 'FACTOR XA SPECIFIC INHIBITOR IN COMPLEX WITH BOVINE TRYPSINVARIANT X(TRIPLE.GLU)BT.D2' 
PDB 1V2L unspecified 'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANTX( TRIPLE.GLU)BT.D1' 
PDB 1V2M unspecified 'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANTX( TRIPLE.GLU)BT.A1' 
PDB 1V2N unspecified 'POTENT FACTOR XA INHIBITOR IN COMPLEX WITH BOVINE TRYPSINVARIANT X(99/175/190)BT' 
PDB 1V2O unspecified 'TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSYI)BT.B4' 
PDB 1V2P unspecified 'TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSYI)BT.A4' 
PDB 1V2Q unspecified 'TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSWI)BT.B4' 
PDB 1V2R unspecified 'TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSRI)BT.B4' 
PDB 1V2S unspecified 'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSFI .GLU)BT.D1' 
PDB 1V2T unspecified 'TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSFI.GLU)BT.B4' 
PDB 1V2U unspecified 'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARINAT X( SSAI)BT.D1' 
PDB 1V2V unspecified 'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANT X( SSAI)BT.C1' 
PDB 1V2W unspecified 'TRYPSIN INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN VARIANTX(SSAI)BT.B4' 
PDB 1XUF unspecified 'TRYPSIN-BABIM-ZN+2, PH 8.2' 
PDB 1XUG unspecified 'TRYPSIN-BABIM-ZN+2, PH 8.2' 
PDB 1XUH unspecified 'TRYPSIN-KETO-BABIM-CO+2, PH 8.2' 
PDB 1XUI unspecified 'TRYPSIN-KETO-BABIM, ZN+2-FREE, PH 8.2' 
PDB 1XUJ unspecified 'TRYPSIN-KETO-BABIM-ZN+2, PH 8.2' 
PDB 1XUK unspecified 'TRYPSIN-BABIM-SULFATE, PH 5.9' 
PDB 1Y3U unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1Y3V unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1Y3W unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1Y3X unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1Y3Y unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1Y59 unspecified 'DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT' 
PDB 1Y5A unspecified 'DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT' 
PDB 1Y5B unspecified 'DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT' 
PDB 1Y5U unspecified 'DIANHYDROSUGAR-BASED BENZAMIDINE, FACTOR XA SPECIFICINHIBITOR IN COMPLEX WITH BOVINE TRYPSIN MUTANT' 
PDB 1YP9 unspecified 'TRYPSIN INHIBITOR COMPLEX' 
PDB 1YYY unspecified 'TRYPSIN INHIBITORS WITH RIGID TRIPEPTIDYL ALDEHYDES' 
PDB 1ZR0 unspecified 'CRYSTAL STRUCTURE OF KUNITZ DOMAIN 1 OF TISSUE FACTORPATHWAY INHIBITOR-2 WITH BOVINE TRYPSIN' 
PDB 1ZZZ unspecified 'TRYPSIN INHIBITORS WITH RIGID TRIPEPTIDYL ALDEHYDES' 
PDB 2A7H unspecified 
'ON THE ROUTINE USE OF SOFT X-RAYS IN MACROMOLECULARCRYSTALLOGRAPHY, PART III- THE OPTIMAL DATA COLLECTIONWAVELENGTH' 
PDB 2AH4 unspecified 'GUANIDINOBENZOYL-TRYPSIN ACYL-ENZYME AT 1.13 A RESOLUTION' 
PDB 2AYW unspecified 
;CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN TRYPSIN ANDA DESIGNED SYNTHETIC HIGHLY POTENT INHIBITOR IN THEPRESENCE OF BENZAMIDINE AT 0.97 A RESOLUTION
;
PDB 2BLV unspecified 
;TRYPSIN BEFORE A HIGH DOSE X-RAY "BURN"
;
PDB 2BLW unspecified 
;TRYPSIN AFTER A HIGH DOSE X-RAY "BURN"
;
PDB 2BTC unspecified 'BOVINE TRYPSIN IN COMPLEX WITH SQUASH SEED INHIBITOR ( CUCURBITA PEPO TRYPSIN INHIBITOR II)' 
PDB 2BY5 unspecified 'IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION' 
PDB 2BY6 unspecified 'IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION' 
PDB 2BY7 unspecified 'IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION' 
PDB 2BY8 unspecified 'IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION' 
PDB 2BY9 unspecified 'IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION' 
PDB 2BYA unspecified 'IS RADIATION DAMAGE DEPENDENT ON THE DOSE-RATE USED DURING MACROMOLECULAR CRYSTALLOGRAPHY DATA COLLECTION' 
PDB 2BZA unspecified 'BOVINE PANCREAS BETA-TRYPSIN IN COMPLEX WITH BENZYLAMINE' 
PDB 2CMY unspecified 'CRYSTAL COMPLEX BETWEEN BOVINE TRYPSIN AND VERONICA HEDERIFOLIA TRYPSIN INHIBITOR' 
PDB 2FI3 unspecified 'CRYSTAL STRUCTURE OF A BPTI VARIANT (CYS14->SER, CYS38 ->SER) IN COMPLEX WITH TRYPSIN' 
PDB 2FI4 unspecified 'CRYSTAL STRUCTURE OF A BPTI VARIANT (CYS14->SER) IN COMPLEXWITH TRYPSIN' 
PDB 2FI5 unspecified 'CRYSTAL STRUCTURE OF A BPTI VARIANT (CYS38->SER) IN COMPLEXWITH TRYPSIN' 
PDB 2FTL unspecified 'CRYSTAL STRUCTURE OF TRYPSIN COMPLEXED WITH BPTI AT 100K' 
PDB 2FTM unspecified 'CRYSTAL STRUCTURE OF TRYPSIN COMPLEXED WITH THE BPTIVARIANT (TYR35->GLY)' 
PDB 2FX4 unspecified 'BOVINE TRYPSIN BOUND BY 4-PIPERIDINEBUTYRATE TO MAKEACYLENZYME COMPLEX' 
PDB 2FX6 unspecified 'BOVINE TRYPSIN COMPLEXED WITH 2-AMINOBENZAMIDAZOLE' 
PDB 2J9N unspecified 'ROBOTICALLY HARVESTED TRYPSIN COMPLEXED WITH BENZAMIDINE CONTAINING POLYPEPTIDE MEDIATED CRYSTAL CONTACTS' 
PDB 2PTC unspecified 'BETA-TRYPSIN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR' 
PDB 2PTN unspecified 'TRYPSIN (ORTHORHOMBIC, 2.4 M AMMONIUM SULFATE)' 
PDB 2TGA unspecified 'TRYPSINOGEN (2.4 M MAGNESIUM SULFATE)' 
PDB 2TGD unspecified 'TRYPSINOGEN, DIISOPROPYLPHOSPHORYL INHIBITED' 
PDB 2TGP unspecified 'TRYPSINOGEN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR' 
PDB 2TGT unspecified 'TRYPSINOGEN (103 DEGREES K, 0.70 METHANOL, 0.30 WATER)' 
PDB 2TIO unspecified 'LOW PACKING DENSITY FORM OF BOVINE BETA-TRYPSIN IN CYCLOHEXANE' 
PDB 2TLD unspecified 
;BOVINE TRYPSIN COMPLEX WITH A MODIFIED SSI (STREPTOMYCES SUBTILISIN INHIBITOR) WITH MET 70 REPLACED BY GLY AND MET 73 REPLACED BY LYS (SSI(M70G,M73K))
;
PDB 2TPI unspecified 'TRYPSINOGEN - PANCREATIC TRYPSIN INHIBITOR - ILE-VAL COMPLEX (2.4 M MAGNESIUM SULFATE)' 
PDB 2UUY unspecified 'STRUCTURE OF A TICK TRYPTASE INHIBITOR IN COMPLEX WITH BOVINE TRYPSIN' 
PDB 2XTT unspecified 
'BOVINE TRYPSIN IN COMPLEX WITH EVOLUTIONARY ENHANCED SCHISTOCERCA GREGARIA PROTEASE INHIBITOR 1 (SGPI-1-P02)' 
PDB 3BTD unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN THE BOVINE BETA-TRYPSIN AND TEN P1 VARIANTS OF BPTI.' 
PDB 3BTE unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI.' 
PDB 3BTF unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI.' 
PDB 3BTG unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3BTH unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3BTK unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3BTM unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3BTQ unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3BTT unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3BTW unspecified 'THE CRYSTAL STRUCTURES OF THE COMPLEXES BETWEEN BOVINE BETA- TRYPSIN AND TEN P1 VARIANTS OF BPTI' 
PDB 3PTB unspecified 'BETA-TRYPSIN (BENZAMIDINE INHIBITED) AT PH7' 
PDB 3PTN unspecified 'TRYPSIN (TRIGONAL, 2.4 M AMMONIUM SULFATE)' 
PDB 3TPI unspecified 'TRYPSINOGEN COMPLEX WITH PANCREATIC TRYPSIN INHIBITOR AND ILE-VAL' 
PDB 4AB8 unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4AB9 unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABA unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABB unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABD unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABE unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABF unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABG unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABH unspecified 'FRAGMENTS BOUND TO BOVINE TRYPSIN FOR THE SAMPL CHALLENGE' 
PDB 4ABI unspecified 
;CO-COMPLEX STRUCTURE OF BOVINE TRYPSIN WITH A MODIFIED BOWMAN-BIRK INHIBITOR (PTA)SFTI-1(1,14), THAT WAS 1,4-DISUBSTITUTED WITH A 1,2,3-TRIZOL TO MIMIC A TRANS AMIDE BOND
;
PDB 4ABJ unspecified 
;CO-COMPLEX STRUCTURE OF BOVINE TRYPSIN WITH A MODIFIED BOWMAN-BIRK INHIBITOR (ICA)SFTI-1(1,14), THAT WAS 1,5-DISUBSTITUTED WITH 1,2,3-TRIZOL TO MIMIC A CIS AMIDE BOND
;
PDB 4TPI unspecified 'TRYPSINOGEN COMPLEX WITH THE ARG==15==-ANALOGUE OF PANCREATIC TRYPSIN INHIBITOR AND VAL-VAL' 
PDB 5PTP unspecified 'STRUCTURE OF HYDROLASE (SERINE PROTEINASE)' 
PDB 4AOQ unspecified 'CATIONIC TRYPSIN IN COMPLEX WITH MUTATED SPINACIA OLERACEA TRYPSIN INHIBITOR III (SOTI-III) (F14A)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4AOR 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-03-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schmelz, S.'    1 
'Glotzbach, B.'  2 
'Reinwarth, M.'  3 
'Christmann, A.' 4 
'Kolmar, H.'     5 
'Heinz, D.W.'    6 
# 
_citation.id                        primary 
_citation.title                     'Structural Characterization of Spinacia Oleracea Trypsin Inhibitor III (Soti-III)' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            69 
_citation.page_first                114 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23275169 
_citation.pdbx_database_id_DOI      10.1107/S0907444912043880 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Glotzbach, B.'  1 ? 
primary 'Schmelz, S.'    2 ? 
primary 'Reinwarth, M.'  3 ? 
primary 'Christmann, A.' 4 ? 
primary 'Heinz, D.W.'    5 ? 
primary 'Kolmar, H.'     6 ? 
# 
_cell.entry_id           4AOR 
_cell.length_a           49.350 
_cell.length_b           66.820 
_cell.length_c           108.890 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.17 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4AOR 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CATIONIC TRYPSIN'                     23324.287 3   3.4.21.4 ? ? ? 
2 polymer     syn 'TRYPSIN INHIBITOR 3'                  3840.454  3   ?        ? ? ? 
3 non-polymer syn GLYCEROL                               92.094    6   ?        ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                         35.453    2   ?        ? ? ? 
5 non-polymer syn IMIDAZOLE                              69.085    7   ?        ? ? ? 
6 non-polymer syn 'CALCIUM ION'                          40.078    4   ?        ? ? ? 
7 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   1   ?        ? ? ? 
8 water       nat water                                  18.015    580 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BETA-TRYPSIN, ALPHA-TRYPSIN CHAIN 1, ALPHA-TRYPSIN CHAIN 2' 
2 'SOTI-III, SOTI III, TRYPSIN INHIBITOR III'                  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
A,B,C ? 
2 'polypeptide(L)' no no EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ EDKCSPSGAICSGFGPPEQCCSGACVPHPILRIFVCQ D,E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 GLN n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
2 1   GLU n 
2 2   ASP n 
2 3   LYS n 
2 4   CYS n 
2 5   SER n 
2 6   PRO n 
2 7   SER n 
2 8   GLY n 
2 9   ALA n 
2 10  ILE n 
2 11  CYS n 
2 12  SER n 
2 13  GLY n 
2 14  PHE n 
2 15  GLY n 
2 16  PRO n 
2 17  PRO n 
2 18  GLU n 
2 19  GLN n 
2 20  CYS n 
2 21  CYS n 
2 22  SER n 
2 23  GLY n 
2 24  ALA n 
2 25  CYS n 
2 26  VAL n 
2 27  PRO n 
2 28  HIS n 
2 29  PRO n 
2 30  ILE n 
2 31  LEU n 
2 32  ARG n 
2 33  ILE n 
2 34  PHE n 
2 35  VAL n 
2 36  CYS n 
2 37  GLN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'BOS TAURUS' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'SIGMA ALDRICH (T1426)' 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'SPINACIA OLERACEA' 
_pdbx_entity_src_syn.organism_common_name   SPINACH 
_pdbx_entity_src_syn.ncbi_taxonomy_id       3562 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TRY1_BOVIN 1 ? ? P00760 ? 
2 UNP ITR3_SPIOL 2 ? ? P84781 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4AOR A 1 ? 223 ? P00760 24 ? 246 ? 24 246 
2 1 4AOR B 1 ? 223 ? P00760 24 ? 246 ? 24 246 
3 1 4AOR C 1 ? 223 ? P00760 24 ? 246 ? 24 246 
4 2 4AOR D 1 ? 37  ? P84781 1  ? 37  ? 1  37  
5 2 4AOR E 1 ? 37  ? P84781 1  ? 37  ? 1  37  
6 2 4AOR F 1 ? 37  ? P84781 1  ? 37  ? 1  37  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                               'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                          ?                               'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'                         ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                               ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                               'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                              ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                               'C6 H13 N O2'    131.173 
IMD non-polymer         . IMIDAZOLE                              ?                               'C3 H5 N2 1'     69.085  
LEU 'L-peptide linking' y LEUCINE                                ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                               'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ?                               'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                             ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4AOR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.04 
_exptl_crystal.density_percent_sol   39.76 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;TRYPSIN (SIGMA T1426) WAS DUSIKVED UB 1MM HCL (PH 2.0), 10 MM CACL2, PURIFIED ON A SUPERDEX 75 16/60 COLUMN (BUFFER: 25 MM MES PH 5.5, 50 MM NACL AND 10 MM CACL2). CRYSTALS GREW FROM EQUAL VOL. OF TRYPSIN (11.5 MG/ML) INCUBATED WITH LYOPHILIZED SOTI-III (2.5 MM) AND PRECIPITANT SOLUTION (0.1 M IMIDAZOLE PH 7.5, 12 % (W/V) PEG 8K) IN HANGING DROP CRYSTALLIZATION PLATES AT 19C.
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-11-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91841 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             0.91841 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4AOR 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.00 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   75899 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.60 
_reflns.B_iso_Wilson_estimate        13.88 
_reflns.pdbx_redundancy              3.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.80 
_reflns_shell.percent_possible_all   93.7 
_reflns_shell.Rmerge_I_obs           0.49 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.85 
_reflns_shell.pdbx_redundancy        3.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4AOR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     75888 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.040 
_refine.ls_d_res_high                            1.702 
_refine.ls_percent_reflns_obs                    97.72 
_refine.ls_R_factor_obs                          0.1808 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1787 
_refine.ls_R_factor_R_free                       0.2209 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3794 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            2.6926 
_refine.aniso_B[2][2]                            0.6962 
_refine.aniso_B[3][3]                            -3.3888 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.6891 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.335 
_refine.solvent_model_param_bsol                 30.821 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.11 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2XTT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.36 
_refine.pdbx_overall_phase_error                 20.80 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5600 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         89 
_refine_hist.number_atoms_solvent             580 
_refine_hist.number_atoms_total               6269 
_refine_hist.d_res_high                       1.702 
_refine_hist.d_res_low                        32.040 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 5937 'X-RAY DIFFRACTION' ? 
f_angle_d          1.304  ? ? 8016 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.606 ? ? 2100 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.090  ? ? 888  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1040 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7022 1.7237  2487 0.2136 93.00 0.2809 . . 130 . . 
'X-RAY DIFFRACTION' . 1.7237 1.7464  2617 0.2130 97.00 0.2616 . . 138 . . 
'X-RAY DIFFRACTION' . 1.7464 1.7703  2664 0.2033 97.00 0.2424 . . 140 . . 
'X-RAY DIFFRACTION' . 1.7703 1.7956  2637 0.1961 97.00 0.2558 . . 139 . . 
'X-RAY DIFFRACTION' . 1.7956 1.8224  2643 0.2032 97.00 0.2447 . . 139 . . 
'X-RAY DIFFRACTION' . 1.8224 1.8509  2682 0.1989 97.00 0.2630 . . 142 . . 
'X-RAY DIFFRACTION' . 1.8509 1.8812  2615 0.1930 97.00 0.2545 . . 137 . . 
'X-RAY DIFFRACTION' . 1.8812 1.9136  2660 0.1798 97.00 0.2451 . . 140 . . 
'X-RAY DIFFRACTION' . 1.9136 1.9484  2619 0.1877 97.00 0.2383 . . 138 . . 
'X-RAY DIFFRACTION' . 1.9484 1.9859  2706 0.1744 98.00 0.2278 . . 142 . . 
'X-RAY DIFFRACTION' . 1.9859 2.0264  2662 0.1778 98.00 0.2107 . . 141 . . 
'X-RAY DIFFRACTION' . 2.0264 2.0705  2645 0.1805 98.00 0.2403 . . 139 . . 
'X-RAY DIFFRACTION' . 2.0705 2.1186  2639 0.1824 98.00 0.2178 . . 139 . . 
'X-RAY DIFFRACTION' . 2.1186 2.1716  2698 0.1765 98.00 0.2648 . . 142 . . 
'X-RAY DIFFRACTION' . 2.1716 2.2303  2657 0.1768 98.00 0.2037 . . 139 . . 
'X-RAY DIFFRACTION' . 2.2303 2.2959  2695 0.1726 98.00 0.2351 . . 142 . . 
'X-RAY DIFFRACTION' . 2.2959 2.3700  2683 0.1789 98.00 0.2388 . . 141 . . 
'X-RAY DIFFRACTION' . 2.3700 2.4547  2688 0.1803 98.00 0.2141 . . 142 . . 
'X-RAY DIFFRACTION' . 2.4547 2.5529  2648 0.1842 98.00 0.2228 . . 139 . . 
'X-RAY DIFFRACTION' . 2.5529 2.6691  2702 0.1798 98.00 0.2363 . . 143 . . 
'X-RAY DIFFRACTION' . 2.6691 2.8097  2680 0.1949 98.00 0.2667 . . 141 . . 
'X-RAY DIFFRACTION' . 2.8097 2.9856  2718 0.1897 98.00 0.2348 . . 143 . . 
'X-RAY DIFFRACTION' . 2.9856 3.2160  2691 0.1748 98.00 0.2297 . . 141 . . 
'X-RAY DIFFRACTION' . 3.2160 3.5392  2722 0.1738 99.00 0.1809 . . 144 . . 
'X-RAY DIFFRACTION' . 3.5392 4.0505  2709 0.1585 98.00 0.1985 . . 142 . . 
'X-RAY DIFFRACTION' . 4.0505 5.0999  2740 0.1543 99.00 0.1828 . . 144 . . 
'X-RAY DIFFRACTION' . 5.0999 32.0456 2787 0.1833 98.00 0.1936 . . 147 . . 
# 
_struct.entry_id                  4AOR 
_struct.title                     'Cationic trypsin in complex with the Spinacia oleracea trypsin inhibitor III (SOTI-III)' 
_struct.pdbx_descriptor           'CATIONIC TRYPSIN (E.C.3.4.21.4), TRYPSIN INHIBITOR 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4AOR 
_struct_keywords.pdbx_keywords   HYDROLASE/INHIBITOR 
_struct_keywords.text            'HYDROLASE-INHIBITOR COMPLEX, MINIPROTEIN SCAFFOLD, KNOTTINS, SERINE PROTEASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 6 ? 
P  N N 3 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 6 ? 
V  N N 6 ? 
W  N N 7 ? 
X  N N 3 ? 
Y  N N 5 ? 
Z  N N 6 ? 
AA N N 8 ? 
BA N N 8 ? 
CA N N 8 ? 
DA N N 8 ? 
EA N N 8 ? 
FA N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 38  ? TYR A 42  ? ALA A 61  TYR A 65  5 ? 5  
HELX_P HELX_P2  2  SER A 144 ? TYR A 152 ? SER A 167 TYR A 175 1 ? 9  
HELX_P HELX_P3  3  TYR A 212 ? ASN A 223 ? TYR A 235 ASN A 246 1 ? 12 
HELX_P HELX_P4  4  ALA B 38  ? TYR B 42  ? ALA B 61  TYR B 65  5 ? 5  
HELX_P HELX_P5  5  SER B 144 ? TYR B 152 ? SER B 167 TYR B 175 1 ? 9  
HELX_P HELX_P6  6  TYR B 212 ? ASN B 223 ? TYR B 235 ASN B 246 1 ? 12 
HELX_P HELX_P7  7  ALA C 38  ? TYR C 42  ? ALA C 61  TYR C 65  5 ? 5  
HELX_P HELX_P8  8  SER C 144 ? TYR C 152 ? SER C 167 TYR C 175 1 ? 9  
HELX_P HELX_P9  9  TYR C 212 ? SER C 222 ? TYR C 235 SER C 245 1 ? 11 
HELX_P HELX_P10 10 PRO D 16  ? GLN D 19  ? PRO D 16  GLN D 19  5 ? 4  
HELX_P HELX_P11 11 PRO E 16  ? GLN E 19  ? PRO E 16  GLN E 19  5 ? 4  
HELX_P HELX_P12 12 PRO F 16  ? GLN F 19  ? PRO F 16  GLN F 19  5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 7   SG ? ? ? 1_555 A  CYS 137 SG  ? ? A CYS 30   A CYS 160  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf2  disulf ? ? A CYS 25  SG ? ? ? 1_555 A  CYS 41  SG  ? ? A CYS 48   A CYS 64   1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf3  disulf ? ? A CYS 109 SG ? ? ? 1_555 A  CYS 210 SG  ? ? A CYS 132  A CYS 233  1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf4  disulf ? ? A CYS 116 SG ? ? ? 1_555 A  CYS 183 SG  ? ? A CYS 139  A CYS 206  1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf5  disulf ? ? A CYS 148 SG ? ? ? 1_555 A  CYS 162 SG  ? ? A CYS 171  A CYS 185  1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf6  disulf ? ? A CYS 173 SG ? ? ? 1_555 A  CYS 197 SG  A ? A CYS 196  A CYS 220  1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf7  disulf ? ? A CYS 173 SG ? ? ? 1_555 A  CYS 197 SG  B ? A CYS 196  A CYS 220  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf8  disulf ? ? B CYS 7   SG ? ? ? 1_555 B  CYS 137 SG  ? ? B CYS 30   B CYS 160  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf9  disulf ? ? B CYS 25  SG ? ? ? 1_555 B  CYS 41  SG  ? ? B CYS 48   B CYS 64   1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf10 disulf ? ? B CYS 109 SG ? ? ? 1_555 B  CYS 210 SG  ? ? B CYS 132  B CYS 233  1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf11 disulf ? ? B CYS 116 SG ? ? ? 1_555 B  CYS 183 SG  ? ? B CYS 139  B CYS 206  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf12 disulf ? ? B CYS 148 SG ? ? ? 1_555 B  CYS 162 SG  ? ? B CYS 171  B CYS 185  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf13 disulf ? ? B CYS 173 SG ? ? ? 1_555 B  CYS 197 SG  ? ? B CYS 196  B CYS 220  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf14 disulf ? ? C CYS 7   SG ? ? ? 1_555 C  CYS 137 SG  ? ? C CYS 30   C CYS 160  1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf15 disulf ? ? C CYS 25  SG ? ? ? 1_555 C  CYS 41  SG  ? ? C CYS 48   C CYS 64   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf16 disulf ? ? C CYS 109 SG ? ? ? 1_555 C  CYS 210 SG  ? ? C CYS 132  C CYS 233  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf17 disulf ? ? C CYS 116 SG ? ? ? 1_555 C  CYS 183 SG  ? ? C CYS 139  C CYS 206  1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf18 disulf ? ? C CYS 148 SG ? ? ? 1_555 C  CYS 162 SG  ? ? C CYS 171  C CYS 185  1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf19 disulf ? ? C CYS 173 SG ? ? ? 1_555 C  CYS 197 SG  ? ? C CYS 196  C CYS 220  1_555 ? ? ? ? ? ? ? 2.071 ? 
disulf20 disulf ? ? D CYS 4   SG ? ? ? 1_555 D  CYS 21  SG  ? ? D CYS 4    D CYS 21   1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf21 disulf ? ? D CYS 11  SG ? ? ? 1_555 D  CYS 25  SG  ? ? D CYS 11   D CYS 25   1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf22 disulf ? ? D CYS 20  SG ? ? ? 1_555 D  CYS 36  SG  ? ? D CYS 20   D CYS 36   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf23 disulf ? ? E CYS 4   SG ? ? ? 1_555 E  CYS 21  SG  ? ? E CYS 4    E CYS 21   1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf24 disulf ? ? E CYS 11  SG ? ? ? 1_555 E  CYS 25  SG  ? ? E CYS 11   E CYS 25   1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf25 disulf ? ? E CYS 20  SG ? ? ? 1_555 E  CYS 36  SG  ? ? E CYS 20   E CYS 36   1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf26 disulf ? ? F CYS 4   SG ? ? ? 1_555 F  CYS 21  SG  ? ? F CYS 4    F CYS 21   1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf27 disulf ? ? F CYS 11  SG ? ? ? 1_555 F  CYS 25  SG  A ? F CYS 11   F CYS 25   1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf28 disulf ? ? F CYS 20  SG ? ? ? 1_555 F  CYS 25  SG  B ? F CYS 20   F CYS 25   1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf29 disulf ? ? F CYS 20  SG ? ? ? 1_555 F  CYS 36  SG  ? ? F CYS 20   F CYS 36   1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc1  metalc ? ? O CA  .   CA ? ? ? 1_555 A  GLU 52  OE1 ? ? A CA  1255 A GLU 75   1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc2  metalc ? ? O CA  .   CA ? ? ? 1_555 A  ASN 54  O   ? ? A CA  1255 A ASN 77   1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc3  metalc ? ? O CA  .   CA ? ? ? 1_555 A  VAL 57  O   ? ? A CA  1255 A VAL 80   1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc4  metalc ? ? O CA  .   CA ? ? ? 1_555 A  GLU 62  OE2 ? ? A CA  1255 A GLU 85   1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc5  metalc ? ? O CA  .   CA ? ? ? 1_555 AA HOH .   O   ? ? A CA  1255 A HOH 2068 1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc6  metalc ? ? O CA  .   CA ? ? ? 1_555 AA HOH .   O   ? ? A CA  1255 A HOH 2069 1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc7  metalc ? ? U CA  .   CA ? ? ? 1_555 B  GLU 62  OE2 ? ? B CA  1252 B GLU 85   1_555 ? ? ? ? ? ? ? 2.554 ? 
metalc8  metalc ? ? U CA  .   CA ? ? ? 1_555 B  GLU 52  OE1 ? ? B CA  1252 B GLU 75   1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc9  metalc ? ? U CA  .   CA ? ? ? 1_555 BA HOH .   O   ? ? B CA  1252 B HOH 2059 1_555 ? ? ? ? ? ? ? 2.597 ? 
metalc10 metalc ? ? U CA  .   CA ? ? ? 1_555 B  ASN 54  O   ? ? B CA  1252 B ASN 77   1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc11 metalc ? ? U CA  .   CA ? ? ? 1_555 B  VAL 57  O   ? ? B CA  1252 B VAL 80   1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc12 metalc ? ? U CA  .   CA ? ? ? 1_555 BA HOH .   O   ? ? B CA  1252 B HOH 2060 1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc13 metalc ? ? V CA  .   CA ? ? ? 1_555 B  SER 147 OG  ? ? B CA  1253 B SER 170  1_555 ? ? ? ? ? ? ? 3.101 ? 
metalc14 metalc ? ? V CA  .   CA ? ? ? 1_555 BA HOH .   O   ? ? B CA  1253 B HOH 2187 1_555 ? ? ? ? ? ? ? 2.933 ? 
metalc15 metalc ? ? V CA  .   CA ? ? ? 1_555 BA HOH .   O   ? ? B CA  1253 B HOH 2141 1_555 ? ? ? ? ? ? ? 2.895 ? 
metalc16 metalc ? ? Z CA  .   CA ? ? ? 1_555 C  GLU 52  OE1 ? ? C CA  1249 C GLU 75   1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc17 metalc ? ? Z CA  .   CA ? ? ? 1_555 C  ASN 54  O   ? ? C CA  1249 C ASN 77   1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc18 metalc ? ? Z CA  .   CA ? ? ? 1_555 CA HOH .   O   ? ? C CA  1249 C HOH 2051 1_555 ? ? ? ? ? ? ? 2.631 ? 
metalc19 metalc ? ? Z CA  .   CA ? ? ? 1_555 C  GLU 62  OE2 ? ? C CA  1249 C GLU 85   1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc20 metalc ? ? Z CA  .   CA ? ? ? 1_555 C  VAL 57  O   ? ? C CA  1249 C VAL 80   1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc21 metalc ? ? Z CA  .   CA ? ? ? 1_555 AA HOH .   O   ? ? C CA  1249 A HOH 2172 1_555 ? ? ? ? ? ? ? 2.568 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 7 ? 
AB ? 7 ? 
BA ? 7 ? 
BB ? 7 ? 
CA ? 7 ? 
CB ? 7 ? 
DA ? 3 ? 
EA ? 3 ? 
FA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CA 4 5 ? anti-parallel 
CA 5 6 ? anti-parallel 
CA 6 7 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CB 5 6 ? anti-parallel 
CB 6 7 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 5   ? THR A 6   ? TYR A 28  THR A 29  
AA 2 LYS A 136 ? PRO A 141 ? LYS A 159 PRO A 164 
AA 3 GLN A 115 ? GLY A 120 ? GLN A 138 GLY A 143 
AA 4 PRO A 180 ? CYS A 183 ? PRO A 203 CYS A 206 
AA 5 LYS A 186 ? TRP A 193 ? LYS A 209 TRP A 216 
AA 6 GLY A 204 ? LYS A 208 ? GLY A 227 LYS A 231 
AA 7 MET A 160 ? ALA A 163 ? MET A 183 ALA A 186 
AB 1 GLN A 15  ? ASN A 19  ? GLN A 38  ASN A 42  
AB 2 HIS A 23  ? ASN A 31  ? HIS A 46  ASN A 54  
AB 3 TRP A 34  ? SER A 37  ? TRP A 57  SER A 60  
AB 4 MET A 86  ? LEU A 90  ? MET A 109 LEU A 113 
AB 5 GLN A 63  ? VAL A 72  ? GLN A 86  VAL A 95  
AB 6 GLN A 47  ? LEU A 50  ? GLN A 70  LEU A 73  
AB 7 GLN A 15  ? ASN A 19  ? GLN A 38  ASN A 42  
BA 1 TYR B 5   ? THR B 6   ? TYR B 28  THR B 29  
BA 2 LYS B 136 ? PRO B 141 ? LYS B 159 PRO B 164 
BA 3 GLN B 115 ? GLY B 120 ? GLN B 138 GLY B 143 
BA 4 PRO B 180 ? CYS B 183 ? PRO B 203 CYS B 206 
BA 5 LYS B 186 ? TRP B 193 ? LYS B 209 TRP B 216 
BA 6 GLY B 204 ? LYS B 208 ? GLY B 227 LYS B 231 
BA 7 MET B 160 ? ALA B 163 ? MET B 183 ALA B 186 
BB 1 GLN B 15  ? ASN B 19  ? GLN B 38  ASN B 42  
BB 2 HIS B 23  ? ASN B 31  ? HIS B 46  ASN B 54  
BB 3 TRP B 34  ? SER B 37  ? TRP B 57  SER B 60  
BB 4 MET B 86  ? LEU B 90  ? MET B 109 LEU B 113 
BB 5 GLN B 63  ? VAL B 72  ? GLN B 86  VAL B 95  
BB 6 GLN B 47  ? LEU B 50  ? GLN B 70  LEU B 73  
BB 7 GLN B 15  ? ASN B 19  ? GLN B 38  ASN B 42  
CA 1 TYR C 5   ? THR C 6   ? TYR C 28  THR C 29  
CA 2 LYS C 136 ? PRO C 141 ? LYS C 159 PRO C 164 
CA 3 GLN C 115 ? GLY C 120 ? GLN C 138 GLY C 143 
CA 4 PRO C 180 ? CYS C 183 ? PRO C 203 CYS C 206 
CA 5 LYS C 186 ? TRP C 193 ? LYS C 209 TRP C 216 
CA 6 GLY C 204 ? LYS C 208 ? GLY C 227 LYS C 231 
CA 7 MET C 160 ? ALA C 163 ? MET C 183 ALA C 186 
CB 1 GLN C 15  ? ASN C 19  ? GLN C 38  ASN C 42  
CB 2 HIS C 23  ? ASN C 31  ? HIS C 46  ASN C 54  
CB 3 TRP C 34  ? SER C 37  ? TRP C 57  SER C 60  
CB 4 MET C 86  ? LEU C 90  ? MET C 109 LEU C 113 
CB 5 GLN C 63  ? VAL C 72  ? GLN C 86  VAL C 95  
CB 6 GLN C 47  ? LEU C 50  ? GLN C 70  LEU C 73  
CB 7 GLN C 15  ? ASN C 19  ? GLN C 38  ASN C 42  
DA 1 ILE D 10  ? CYS D 11  ? ILE D 10  CYS D 11  
DA 2 PHE D 34  ? CYS D 36  ? PHE D 34  CYS D 36  
DA 3 CYS D 25  ? PRO D 27  ? CYS D 25  PRO D 27  
EA 1 ILE E 10  ? CYS E 11  ? ILE E 10  CYS E 11  
EA 2 PHE E 34  ? CYS E 36  ? PHE E 34  CYS E 36  
EA 3 CYS E 25  ? PRO E 27  ? CYS E 25  PRO E 27  
FA 1 ILE F 10  ? CYS F 11  ? ILE F 10  CYS F 11  
FA 2 PHE F 34  ? CYS F 36  ? PHE F 34  CYS F 36  
FA 3 CYS F 25  ? PRO F 27  ? CYS F 25  PRO F 27  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 5   ? N TYR A 28  O CYS A 137 ? O CYS A 160 
AA 2 3 N ALA A 140 ? N ALA A 163 O CYS A 116 ? O CYS A 139 
AA 3 4 N SER A 119 ? N SER A 142 O PRO A 180 ? O PRO A 203 
AA 4 5 N CYS A 183 ? N CYS A 206 O LYS A 186 ? O LYS A 209 
AA 5 6 N TRP A 193 ? N TRP A 216 O VAL A 205 ? O VAL A 228 
AA 6 7 N TYR A 206 ? N TYR A 229 O PHE A 161 ? O PHE A 184 
AB 1 2 O LEU A 18  ? O LEU A 41  N PHE A 24  ? N PHE A 47  
AB 2 3 N ILE A 30  ? N ILE A 53  O TRP A 34  ? O TRP A 57  
AB 3 4 N SER A 37  ? N SER A 60  O MET A 86  ? O MET A 109 
AB 4 5 O LYS A 89  ? O LYS A 112 N SER A 68  ? N SER A 91  
AB 5 6 N ILE A 65  ? N ILE A 88  O VAL A 48  ? O VAL A 71  
AB 6 7 N ARG A 49  ? N ARG A 72  O SER A 17  ? O SER A 40  
BA 1 2 N TYR B 5   ? N TYR B 28  O CYS B 137 ? O CYS B 160 
BA 2 3 N ALA B 140 ? N ALA B 163 O CYS B 116 ? O CYS B 139 
BA 3 4 N SER B 119 ? N SER B 142 O PRO B 180 ? O PRO B 203 
BA 4 5 N CYS B 183 ? N CYS B 206 O LYS B 186 ? O LYS B 209 
BA 5 6 N TRP B 193 ? N TRP B 216 O VAL B 205 ? O VAL B 228 
BA 6 7 N TYR B 206 ? N TYR B 229 O PHE B 161 ? O PHE B 184 
BB 1 2 O LEU B 18  ? O LEU B 41  N PHE B 24  ? N PHE B 47  
BB 2 3 N ILE B 30  ? N ILE B 53  O TRP B 34  ? O TRP B 57  
BB 3 4 N SER B 37  ? N SER B 60  O MET B 86  ? O MET B 109 
BB 4 5 O LYS B 89  ? O LYS B 112 N SER B 68  ? N SER B 91  
BB 5 6 N ILE B 65  ? N ILE B 88  O VAL B 48  ? O VAL B 71  
BB 6 7 N ARG B 49  ? N ARG B 72  O SER B 17  ? O SER B 40  
CA 1 2 N TYR C 5   ? N TYR C 28  O CYS C 137 ? O CYS C 160 
CA 2 3 N ALA C 140 ? N ALA C 163 O CYS C 116 ? O CYS C 139 
CA 3 4 N SER C 119 ? N SER C 142 O PRO C 180 ? O PRO C 203 
CA 4 5 N CYS C 183 ? N CYS C 206 O LYS C 186 ? O LYS C 209 
CA 5 6 N TRP C 193 ? N TRP C 216 O VAL C 205 ? O VAL C 228 
CA 6 7 N TYR C 206 ? N TYR C 229 O PHE C 161 ? O PHE C 184 
CB 1 2 O LEU C 18  ? O LEU C 41  N PHE C 24  ? N PHE C 47  
CB 2 3 N ILE C 30  ? N ILE C 53  O TRP C 34  ? O TRP C 57  
CB 3 4 N SER C 37  ? N SER C 60  O MET C 86  ? O MET C 109 
CB 4 5 O LYS C 89  ? O LYS C 112 N SER C 68  ? N SER C 91  
CB 5 6 N ILE C 65  ? N ILE C 88  O VAL C 48  ? O VAL C 71  
CB 6 7 N ARG C 49  ? N ARG C 72  O SER C 17  ? O SER C 40  
DA 1 2 N CYS D 11  ? N CYS D 11  O PHE D 34  ? O PHE D 34  
DA 2 3 N VAL D 35  ? N VAL D 35  O VAL D 26  ? O VAL D 26  
EA 1 2 N CYS E 11  ? N CYS E 11  O PHE E 34  ? O PHE E 34  
EA 2 3 N VAL E 35  ? N VAL E 35  O VAL E 26  ? O VAL E 26  
FA 1 2 N CYS F 11  ? N CYS F 11  O PHE F 34  ? O PHE F 34  
FA 2 3 N VAL F 35  ? N VAL F 35  O VAL F 26  ? O VAL F 26  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 1247' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE GOL A 1248' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 1249' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 1250' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 1251'  
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 1252'  
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IMD A 1253' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IMD A 1254' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 1255'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL B 1247' 
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE IMD B 1248' 
BC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE IMD B 1249' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IMD B 1250' 
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE IMD B 1251' 
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 1252'  
BC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA B 1253'  
BC8 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE MES B 1254' 
BC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL C 1247' 
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE IMD C 1248' 
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 1249'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  LYS A  43  ? LYS A 66   . ? 1_555 ? 
2   AC1 9  SER A  44  ? SER A 67   . ? 1_555 ? 
3   AC1 9  GLY A  45  ? GLY A 68   . ? 1_555 ? 
4   AC1 9  ILE A  46  ? ILE A 69   . ? 1_555 ? 
5   AC1 9  ALA A  67  ? ALA A 90   . ? 1_555 ? 
6   AC1 9  SER A  70  ? SER A 93   . ? 1_555 ? 
7   AC1 9  HOH AA .   ? HOH A 2063 . ? 1_555 ? 
8   AC1 9  HOH AA .   ? HOH A 2210 . ? 1_555 ? 
9   AC1 9  SER B  111 ? SER B 134  . ? 1_555 ? 
10  AC2 8  GLN A  115 ? GLN A 138  . ? 1_555 ? 
11  AC2 8  LEU A  117 ? LEU A 140  . ? 1_555 ? 
12  AC2 8  VAL A  182 ? VAL A 205  . ? 1_555 ? 
13  AC2 8  CYS A  183 ? CYS A 206  . ? 1_555 ? 
14  AC2 8  SER A  184 ? SER A 207  . ? 1_555 ? 
15  AC2 8  GLY A  185 ? GLY A 208  . ? 1_555 ? 
16  AC2 8  HOH AA .   ? HOH A 2211 . ? 1_555 ? 
17  AC2 8  HOH EA .   ? HOH E 2014 . ? 1_645 ? 
18  AC3 4  GLN A  115 ? GLN A 138  . ? 1_555 ? 
19  AC3 4  PRO A  141 ? PRO A 164  . ? 1_555 ? 
20  AC3 4  TYR A  165 ? TYR A 188  . ? 1_555 ? 
21  AC3 4  HOH AA .   ? HOH A 2178 . ? 1_555 ? 
22  AC4 4  HIS A  73  ? HIS A 96   . ? 1_555 ? 
23  AC4 4  ASN A  83  ? ASN A 106  . ? 1_555 ? 
24  AC4 4  ASN A  159 ? ASN A 182  . ? 1_555 ? 
25  AC4 4  TYR A  212 ? TYR A 235  . ? 1_555 ? 
26  AC5 4  ARG A  49  ? ARG A 72   . ? 1_555 ? 
27  AC5 4  GLU A  52  ? GLU A 75   . ? 1_555 ? 
28  AC5 4  ILE A  55  ? ILE A 78   . ? 1_555 ? 
29  AC5 4  HOH AA .   ? HOH A 2029 . ? 1_555 ? 
30  AC6 3  ASN A  77  ? ASN A 100  . ? 1_555 ? 
31  AC6 3  ASN A  82  ? ASN A 105  . ? 1_555 ? 
32  AC6 3  HOH AA .   ? HOH A 2105 . ? 1_555 ? 
33  AC7 6  ASN A  19  ? ASN A 42   . ? 1_555 ? 
34  AC7 6  TYR A  22  ? TYR A 45   . ? 1_555 ? 
35  AC7 6  HIS A  23  ? HIS A 46   . ? 1_555 ? 
36  AC7 6  ILE A  55  ? ILE A 78   . ? 1_555 ? 
37  AC7 6  ASN A  56  ? ASN A 79   . ? 1_555 ? 
38  AC7 6  PHE D  14  ? PHE D 14   . ? 1_555 ? 
39  AC8 6  ASN A  79  ? ASN A 102  . ? 1_555 ? 
40  AC8 6  THR A  80  ? THR A 103  . ? 1_555 ? 
41  AC8 6  GLN A  155 ? GLN A 178  . ? 1_555 ? 
42  AC8 6  TRP A  193 ? TRP A 216  . ? 1_555 ? 
43  AC8 6  HOH AA .   ? HOH A 2104 . ? 1_555 ? 
44  AC8 6  PHE C  64  ? PHE C 87   . ? 1_555 ? 
45  AC9 6  GLU A  52  ? GLU A 75   . ? 1_555 ? 
46  AC9 6  ASN A  54  ? ASN A 77   . ? 1_555 ? 
47  AC9 6  VAL A  57  ? VAL A 80   . ? 1_555 ? 
48  AC9 6  GLU A  62  ? GLU A 85   . ? 1_555 ? 
49  AC9 6  HOH AA .   ? HOH A 2068 . ? 1_555 ? 
50  AC9 6  HOH AA .   ? HOH A 2069 . ? 1_555 ? 
51  BC1 5  TYR B  152 ? TYR B 175  . ? 1_555 ? 
52  BC1 5  GLN B  155 ? GLN B 178  . ? 1_555 ? 
53  BC1 5  SER B  195 ? SER B 218  . ? 1_555 ? 
54  BC1 5  IMD S  .   ? IMD B 1250 . ? 1_555 ? 
55  BC1 5  ILE E  30  ? ILE E 30   . ? 1_555 ? 
56  BC2 5  LYS B  43  ? LYS B 66   . ? 1_555 ? 
57  BC2 5  GLY B  45  ? GLY B 68   . ? 1_555 ? 
58  BC2 5  ILE B  46  ? ILE B 69   . ? 1_555 ? 
59  BC2 5  ALA B  67  ? ALA B 90   . ? 1_555 ? 
60  BC2 5  SER B  70  ? SER B 93   . ? 1_555 ? 
61  BC3 4  TYR B  22  ? TYR B 45   . ? 1_555 ? 
62  BC3 4  HIS B  23  ? HIS B 46   . ? 1_555 ? 
63  BC3 4  ILE B  55  ? ILE B 78   . ? 1_555 ? 
64  BC3 4  ASN B  56  ? ASN B 79   . ? 1_555 ? 
65  BC4 6  ASN B  79  ? ASN B 102  . ? 1_555 ? 
66  BC4 6  THR B  80  ? THR B 103  . ? 1_555 ? 
67  BC4 6  GLN B  155 ? GLN B 178  . ? 1_555 ? 
68  BC4 6  GOL P  .   ? GOL B 1247 . ? 1_555 ? 
69  BC4 6  IMD T  .   ? IMD B 1251 . ? 1_555 ? 
70  BC4 6  HOH BA .   ? HOH B 2089 . ? 1_555 ? 
71  BC5 4  SER B  78  ? SER B 101  . ? 1_555 ? 
72  BC5 4  ASN B  79  ? ASN B 102  . ? 1_555 ? 
73  BC5 4  IMD S  .   ? IMD B 1250 . ? 1_555 ? 
74  BC5 4  HIS E  28  ? HIS E 28   . ? 1_555 ? 
75  BC6 6  GLU B  52  ? GLU B 75   . ? 1_555 ? 
76  BC6 6  ASN B  54  ? ASN B 77   . ? 1_555 ? 
77  BC6 6  VAL B  57  ? VAL B 80   . ? 1_555 ? 
78  BC6 6  GLU B  62  ? GLU B 85   . ? 1_555 ? 
79  BC6 6  HOH BA .   ? HOH B 2059 . ? 1_555 ? 
80  BC6 6  HOH BA .   ? HOH B 2060 . ? 1_555 ? 
81  BC7 3  SER B  147 ? SER B 170  . ? 1_555 ? 
82  BC7 3  HOH BA .   ? HOH B 2141 . ? 1_555 ? 
83  BC7 3  HOH BA .   ? HOH B 2187 . ? 1_555 ? 
84  BC8 13 PRO A  106 ? PRO A 129  . ? 1_455 ? 
85  BC8 13 THR A  107 ? THR A 130  . ? 1_455 ? 
86  BC8 13 SER A  108 ? SER A 131  . ? 1_455 ? 
87  BC8 13 CYS A  210 ? CYS A 233  . ? 1_455 ? 
88  BC8 13 VAL A  213 ? VAL A 236  . ? 1_455 ? 
89  BC8 13 SER A  214 ? SER A 237  . ? 1_455 ? 
90  BC8 13 LYS A  217 ? LYS A 240  . ? 1_455 ? 
91  BC8 13 HOH AA .   ? HOH A 2197 . ? 1_455 ? 
92  BC8 13 SER B  214 ? SER B 237  . ? 1_555 ? 
93  BC8 13 TRP B  215 ? TRP B 238  . ? 1_555 ? 
94  BC8 13 GLN B  218 ? GLN B 241  . ? 1_555 ? 
95  BC8 13 HOH BA .   ? HOH B 2082 . ? 1_555 ? 
96  BC8 13 HOH BA .   ? HOH B 2177 . ? 1_555 ? 
97  BC9 4  ASN C  79  ? ASN C 102  . ? 1_555 ? 
98  BC9 4  THR C  80  ? THR C 103  . ? 1_555 ? 
99  BC9 4  GLN C  155 ? GLN C 178  . ? 1_555 ? 
100 BC9 4  TRP C  193 ? TRP C 216  . ? 1_555 ? 
101 CC1 6  ASN C  19  ? ASN C 42   . ? 1_555 ? 
102 CC1 6  TYR C  22  ? TYR C 45   . ? 1_555 ? 
103 CC1 6  HIS C  23  ? HIS C 46   . ? 1_555 ? 
104 CC1 6  ILE C  55  ? ILE C 78   . ? 1_555 ? 
105 CC1 6  ASN C  56  ? ASN C 79   . ? 1_555 ? 
106 CC1 6  PHE F  14  ? PHE F 14   . ? 1_555 ? 
107 CC2 6  HOH AA .   ? HOH A 2172 . ? 1_555 ? 
108 CC2 6  GLU C  52  ? GLU C 75   . ? 1_555 ? 
109 CC2 6  ASN C  54  ? ASN C 77   . ? 1_555 ? 
110 CC2 6  VAL C  57  ? VAL C 80   . ? 1_555 ? 
111 CC2 6  GLU C  62  ? GLU C 85   . ? 1_555 ? 
112 CC2 6  HOH CA .   ? HOH C 2051 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4AOR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4AOR 
_atom_sites.fract_transf_matrix[1][1]   0.020263 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000060 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014966 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009184 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A  1 1   ? 15.497  7.199  33.644  1.00 9.09  ? 24   ILE A N   1 
ATOM   2    C  CA  . ILE A  1 1   ? 16.638  6.555  32.970  1.00 9.73  ? 24   ILE A CA  1 
ATOM   3    C  C   . ILE A  1 1   ? 16.150  5.301  32.238  1.00 10.94 ? 24   ILE A C   1 
ATOM   4    O  O   . ILE A  1 1   ? 15.595  4.404  32.888  1.00 10.36 ? 24   ILE A O   1 
ATOM   5    C  CB  . ILE A  1 1   ? 17.679  6.127  34.033  1.00 11.93 ? 24   ILE A CB  1 
ATOM   6    C  CG1 . ILE A  1 1   ? 18.235  7.335  34.834  1.00 10.64 ? 24   ILE A CG1 1 
ATOM   7    C  CG2 . ILE A  1 1   ? 18.783  5.259  33.408  1.00 12.41 ? 24   ILE A CG2 1 
ATOM   8    C  CD1 . ILE A  1 1   ? 19.163  8.338  34.013  1.00 11.06 ? 24   ILE A CD1 1 
ATOM   9    N  N   . VAL A  1 2   ? 16.361  5.230  30.920  1.00 11.41 ? 25   VAL A N   1 
ATOM   10   C  CA  . VAL A  1 2   ? 15.995  4.067  30.101  1.00 12.22 ? 25   VAL A CA  1 
ATOM   11   C  C   . VAL A  1 2   ? 17.257  3.246  29.784  1.00 10.91 ? 25   VAL A C   1 
ATOM   12   O  O   . VAL A  1 2   ? 18.304  3.802  29.429  1.00 11.51 ? 25   VAL A O   1 
ATOM   13   C  CB  . VAL A  1 2   ? 15.289  4.506  28.802  1.00 13.17 ? 25   VAL A CB  1 
ATOM   14   C  CG1 . VAL A  1 2   ? 14.946  3.292  27.925  1.00 13.57 ? 25   VAL A CG1 1 
ATOM   15   C  CG2 . VAL A  1 2   ? 14.014  5.295  29.126  1.00 16.33 ? 25   VAL A CG2 1 
ATOM   16   N  N   . GLY A  1 3   ? 17.170  1.928  29.970  1.00 13.04 ? 26   GLY A N   1 
ATOM   17   C  CA  . GLY A  1 3   ? 18.275  1.030  29.661  1.00 13.57 ? 26   GLY A CA  1 
ATOM   18   C  C   . GLY A  1 3   ? 19.449  1.073  30.624  1.00 13.75 ? 26   GLY A C   1 
ATOM   19   O  O   . GLY A  1 3   ? 20.577  0.675  30.263  1.00 16.76 ? 26   GLY A O   1 
ATOM   20   N  N   . GLY A  1 4   ? 19.196  1.551  31.840  1.00 15.68 ? 27   GLY A N   1 
ATOM   21   C  CA  . GLY A  1 4   ? 20.215  1.632  32.868  1.00 13.52 ? 27   GLY A CA  1 
ATOM   22   C  C   . GLY A  1 4   ? 20.093  0.505  33.877  1.00 12.91 ? 27   GLY A C   1 
ATOM   23   O  O   . GLY A  1 4   ? 19.456  -0.510 33.593  1.00 16.07 ? 27   GLY A O   1 
ATOM   24   N  N   . TYR A  1 5   ? 20.678  0.690  35.057  1.00 12.03 ? 28   TYR A N   1 
ATOM   25   C  CA  . TYR A  1 5   ? 20.653  -0.336 36.096  1.00 13.64 ? 28   TYR A CA  1 
ATOM   26   C  C   . TYR A  1 5   ? 20.321  0.270  37.458  1.00 12.58 ? 28   TYR A C   1 
ATOM   27   O  O   . TYR A  1 5   ? 20.447  1.485  37.676  1.00 12.52 ? 28   TYR A O   1 
ATOM   28   C  CB  . TYR A  1 5   ? 21.994  -1.093 36.154  1.00 10.79 ? 28   TYR A CB  1 
ATOM   29   C  CG  . TYR A  1 5   ? 23.189  -0.193 36.430  1.00 11.22 ? 28   TYR A CG  1 
ATOM   30   C  CD1 . TYR A  1 5   ? 23.816  0.500  35.403  1.00 18.22 ? 28   TYR A CD1 1 
ATOM   31   C  CD2 . TYR A  1 5   ? 23.667  -0.015 37.726  1.00 12.08 ? 28   TYR A CD2 1 
ATOM   32   C  CE1 . TYR A  1 5   ? 24.908  1.331  35.663  1.00 11.84 ? 28   TYR A CE1 1 
ATOM   33   C  CE2 . TYR A  1 5   ? 24.759  0.823  37.993  1.00 12.24 ? 28   TYR A CE2 1 
ATOM   34   C  CZ  . TYR A  1 5   ? 25.359  1.495  36.948  1.00 11.30 ? 28   TYR A CZ  1 
ATOM   35   O  OH  . TYR A  1 5   ? 26.441  2.322  37.191  1.00 15.66 ? 28   TYR A OH  1 
ATOM   36   N  N   . THR A  1 6   ? 19.869  -0.569 38.379  1.00 13.42 ? 29   THR A N   1 
ATOM   37   C  CA  . THR A  1 6   ? 19.645  -0.103 39.742  1.00 12.25 ? 29   THR A CA  1 
ATOM   38   C  C   . THR A  1 6   ? 20.975  0.324  40.382  1.00 12.72 ? 29   THR A C   1 
ATOM   39   O  O   . THR A  1 6   ? 21.926  -0.477 40.425  1.00 12.73 ? 29   THR A O   1 
ATOM   40   C  CB  . THR A  1 6   ? 18.961  -1.212 40.554  1.00 13.25 ? 29   THR A CB  1 
ATOM   41   O  OG1 . THR A  1 6   ? 17.635  -1.401 40.046  1.00 14.11 ? 29   THR A OG1 1 
ATOM   42   C  CG2 . THR A  1 6   ? 18.864  -0.836 42.016  1.00 13.80 ? 29   THR A CG2 1 
ATOM   43   N  N   . CYS A  1 7   ? 21.067  1.583  40.843  1.00 9.58  ? 30   CYS A N   1 
ATOM   44   C  CA  . CYS A  1 7   ? 22.331  2.103  41.409  1.00 11.13 ? 30   CYS A CA  1 
ATOM   45   C  C   . CYS A  1 7   ? 22.805  1.329  42.618  1.00 15.36 ? 30   CYS A C   1 
ATOM   46   O  O   . CYS A  1 7   ? 23.988  0.987  42.731  1.00 15.94 ? 30   CYS A O   1 
ATOM   47   C  CB  . CYS A  1 7   ? 22.203  3.587  41.806  1.00 8.18  ? 30   CYS A CB  1 
ATOM   48   S  SG  . CYS A  1 7   ? 21.734  4.692  40.435  1.00 11.80 ? 30   CYS A SG  1 
ATOM   49   N  N   . GLY A  1 8   ? 21.866  1.070  43.518  1.00 12.14 ? 31   GLY A N   1 
ATOM   50   C  CA  . GLY A  1 8   ? 22.160  0.601  44.854  1.00 8.49  ? 31   GLY A CA  1 
ATOM   51   C  C   . GLY A  1 8   ? 21.903  1.758  45.798  1.00 11.23 ? 31   GLY A C   1 
ATOM   52   O  O   . GLY A  1 8   ? 22.198  2.909  45.462  1.00 13.14 ? 31   GLY A O   1 
ATOM   53   N  N   . ALA A  1 9   ? 21.374  1.458  46.978  1.00 13.05 ? 32   ALA A N   1 
ATOM   54   C  CA  . ALA A  1 9   ? 20.985  2.505  47.928  1.00 17.65 ? 32   ALA A CA  1 
ATOM   55   C  C   . ALA A  1 9   ? 22.141  3.443  48.290  1.00 14.79 ? 32   ALA A C   1 
ATOM   56   O  O   . ALA A  1 9   ? 23.204  2.995  48.744  1.00 12.41 ? 32   ALA A O   1 
ATOM   57   C  CB  . ALA A  1 9   ? 20.398  1.880  49.193  1.00 18.45 ? 32   ALA A CB  1 
ATOM   58   N  N   . ASN A  1 10  ? 21.925  4.744  48.073  1.00 11.51 ? 33   ASN A N   1 
ATOM   59   C  CA  . ASN A  1 10  ? 22.872  5.798  48.442  1.00 12.46 ? 33   ASN A CA  1 
ATOM   60   C  C   . ASN A  1 10  ? 24.266  5.696  47.833  1.00 14.05 ? 33   ASN A C   1 
ATOM   61   O  O   . ASN A  1 10  ? 25.219  6.324  48.330  1.00 14.29 ? 33   ASN A O   1 
ATOM   62   C  CB  . ASN A  1 10  ? 22.947  5.943  49.967  1.00 16.75 ? 33   ASN A CB  1 
ATOM   63   C  CG  . ASN A  1 10  ? 21.575  6.001  50.593  1.00 17.41 ? 33   ASN A CG  1 
ATOM   64   O  OD1 . ASN A  1 10  ? 21.141  5.049  51.239  1.00 16.08 ? 33   ASN A OD1 1 
ATOM   65   N  ND2 . ASN A  1 10  ? 20.859  7.104  50.362  1.00 16.32 ? 33   ASN A ND2 1 
ATOM   66   N  N   . THR A  1 11  ? 24.386  4.951  46.737  1.00 12.76 ? 34   THR A N   1 
ATOM   67   C  CA  . THR A  1 11  ? 25.673  4.872  46.025  1.00 13.34 ? 34   THR A CA  1 
ATOM   68   C  C   . THR A  1 11  ? 25.978  6.108  45.166  1.00 13.99 ? 34   THR A C   1 
ATOM   69   O  O   . THR A  1 11  ? 27.078  6.227  44.621  1.00 11.54 ? 34   THR A O   1 
ATOM   70   C  CB  . THR A  1 11  ? 25.748  3.621  45.147  1.00 11.08 ? 34   THR A CB  1 
ATOM   71   O  OG1 . THR A  1 11  ? 24.700  3.668  44.172  1.00 11.73 ? 34   THR A OG1 1 
ATOM   72   C  CG2 . THR A  1 11  ? 25.576  2.369  46.019  1.00 14.03 ? 34   THR A CG2 1 
ATOM   73   N  N   . VAL A  1 12  ? 24.991  6.999  45.045  1.00 11.12 ? 35   VAL A N   1 
ATOM   74   C  CA  . VAL A  1 12  ? 25.113  8.269  44.336  1.00 10.53 ? 35   VAL A CA  1 
ATOM   75   C  C   . VAL A  1 12  ? 24.688  9.361  45.339  1.00 10.00 ? 35   VAL A C   1 
ATOM   76   O  O   . VAL A  1 12  ? 23.590  9.935  45.250  1.00 10.09 ? 35   VAL A O   1 
ATOM   77   C  CB  . VAL A  1 12  ? 24.197  8.266  43.087  1.00 8.76  ? 35   VAL A CB  1 
ATOM   78   C  CG1 . VAL A  1 12  ? 24.409  9.540  42.226  1.00 11.46 ? 35   VAL A CG1 1 
ATOM   79   C  CG2 . VAL A  1 12  ? 24.432  7.016  42.251  1.00 11.44 ? 35   VAL A CG2 1 
ATOM   80   N  N   . PRO A  1 13  ? 25.558  9.649  46.308  1.00 9.72  ? 36   PRO A N   1 
ATOM   81   C  CA  . PRO A  1 13  ? 25.110  10.363 47.504  1.00 9.37  ? 36   PRO A CA  1 
ATOM   82   C  C   . PRO A  1 13  ? 24.873  11.845 47.292  1.00 8.15  ? 36   PRO A C   1 
ATOM   83   O  O   . PRO A  1 13  ? 24.354  12.509 48.200  1.00 9.36  ? 36   PRO A O   1 
ATOM   84   C  CB  . PRO A  1 13  ? 26.256  10.127 48.508  1.00 12.61 ? 36   PRO A CB  1 
ATOM   85   C  CG  . PRO A  1 13  ? 27.483  9.905  47.644  1.00 15.86 ? 36   PRO A CG  1 
ATOM   86   C  CD  . PRO A  1 13  ? 26.950  9.152  46.437  1.00 10.38 ? 36   PRO A CD  1 
ATOM   87   N  N   . TYR A  1 14  ? 25.252  12.343 46.112  1.00 8.53  ? 37   TYR A N   1 
ATOM   88   C  CA  . TYR A  1 14  ? 25.019  13.731 45.738  1.00 7.57  ? 37   TYR A CA  1 
ATOM   89   C  C   . TYR A  1 14  ? 23.712  13.906 44.960  1.00 7.16  ? 37   TYR A C   1 
ATOM   90   O  O   . TYR A  1 14  ? 23.314  15.042 44.669  1.00 8.13  ? 37   TYR A O   1 
ATOM   91   C  CB  . TYR A  1 14  ? 26.176  14.251 44.852  1.00 7.72  ? 37   TYR A CB  1 
ATOM   92   C  CG  . TYR A  1 14  ? 26.495  13.317 43.709  1.00 8.14  ? 37   TYR A CG  1 
ATOM   93   C  CD1 . TYR A  1 14  ? 25.796  13.392 42.502  1.00 5.03  ? 37   TYR A CD1 1 
ATOM   94   C  CD2 . TYR A  1 14  ? 27.480  12.348 43.836  1.00 8.08  ? 37   TYR A CD2 1 
ATOM   95   C  CE1 . TYR A  1 14  ? 26.074  12.531 41.456  1.00 5.47  ? 37   TYR A CE1 1 
ATOM   96   C  CE2 . TYR A  1 14  ? 27.767  11.488 42.808  1.00 9.99  ? 37   TYR A CE2 1 
ATOM   97   C  CZ  . TYR A  1 14  ? 27.062  11.575 41.620  1.00 7.66  ? 37   TYR A CZ  1 
ATOM   98   O  OH  . TYR A  1 14  ? 27.352  10.708 40.601  1.00 10.01 ? 37   TYR A OH  1 
ATOM   99   N  N   . GLN A  1 15  ? 23.059  12.799 44.600  1.00 8.91  ? 38   GLN A N   1 
ATOM   100  C  CA  . GLN A  1 15  ? 21.781  12.879 43.874  1.00 6.15  ? 38   GLN A CA  1 
ATOM   101  C  C   . GLN A  1 15  ? 20.666  13.323 44.798  1.00 5.51  ? 38   GLN A C   1 
ATOM   102  O  O   . GLN A  1 15  ? 20.452  12.714 45.851  1.00 8.46  ? 38   GLN A O   1 
ATOM   103  C  CB  . GLN A  1 15  ? 21.395  11.520 43.263  1.00 8.61  ? 38   GLN A CB  1 
ATOM   104  C  CG  . GLN A  1 15  ? 19.955  11.506 42.693  1.00 5.81  ? 38   GLN A CG  1 
ATOM   105  C  CD  . GLN A  1 15  ? 19.923  11.941 41.242  1.00 6.54  ? 38   GLN A CD  1 
ATOM   106  O  OE1 . GLN A  1 15  ? 20.714  11.464 40.441  1.00 10.07 ? 38   GLN A OE1 1 
ATOM   107  N  NE2 . GLN A  1 15  ? 19.012  12.863 40.889  1.00 7.23  ? 38   GLN A NE2 1 
ATOM   108  N  N   . VAL A  1 16  ? 19.949  14.363 44.401  1.00 5.52  ? 39   VAL A N   1 
ATOM   109  C  CA  . VAL A  1 16  ? 18.792  14.811 45.200  1.00 5.28  ? 39   VAL A CA  1 
ATOM   110  C  C   . VAL A  1 16  ? 17.543  14.777 44.327  1.00 5.27  ? 39   VAL A C   1 
ATOM   111  O  O   . VAL A  1 16  ? 17.620  14.705 43.087  1.00 6.32  ? 39   VAL A O   1 
ATOM   112  C  CB  . VAL A  1 16  ? 18.979  16.254 45.800  1.00 7.66  ? 39   VAL A CB  1 
ATOM   113  C  CG1 . VAL A  1 16  ? 20.249  16.333 46.668  1.00 8.98  ? 39   VAL A CG1 1 
ATOM   114  C  CG2 . VAL A  1 16  ? 18.924  17.323 44.715  1.00 8.13  ? 39   VAL A CG2 1 
ATOM   115  N  N   . SER A  1 17  ? 16.384  14.762 44.973  1.00 5.36  ? 40   SER A N   1 
ATOM   116  C  CA  . SER A  1 17  ? 15.108  14.883 44.275  1.00 4.65  ? 40   SER A CA  1 
ATOM   117  C  C   . SER A  1 17  ? 14.528  16.243 44.614  1.00 6.56  ? 40   SER A C   1 
ATOM   118  O  O   . SER A  1 17  ? 14.494  16.626 45.787  1.00 8.93  ? 40   SER A O   1 
ATOM   119  C  CB  . SER A  1 17  ? 14.152  13.781 44.735  1.00 5.29  ? 40   SER A CB  1 
ATOM   120  O  OG  . SER A  1 17  ? 12.789  14.097 44.430  1.00 7.52  ? 40   SER A OG  1 
ATOM   121  N  N   . LEU A  1 18  ? 14.115  16.996 43.600  1.00 5.04  ? 41   LEU A N   1 
ATOM   122  C  CA  . LEU A  1 18  ? 13.336  18.215 43.800  1.00 6.46  ? 41   LEU A CA  1 
ATOM   123  C  C   . LEU A  1 18  ? 11.855  17.823 43.850  1.00 8.67  ? 41   LEU A C   1 
ATOM   124  O  O   . LEU A  1 18  ? 11.354  17.175 42.945  1.00 8.12  ? 41   LEU A O   1 
ATOM   125  C  CB  . LEU A  1 18  ? 13.584  19.213 42.669  1.00 7.58  ? 41   LEU A CB  1 
ATOM   126  C  CG  . LEU A  1 18  ? 15.064  19.575 42.481  1.00 9.15  ? 41   LEU A CG  1 
ATOM   127  C  CD1 . LEU A  1 18  ? 15.108  20.754 41.513  1.00 10.78 ? 41   LEU A CD1 1 
ATOM   128  C  CD2 . LEU A  1 18  ? 15.732  19.923 43.792  1.00 9.56  ? 41   LEU A CD2 1 
ATOM   129  N  N   . ASN A  1 19  ? 11.182  18.217 44.924  1.00 5.44  ? 42   ASN A N   1 
ATOM   130  C  CA  . ASN A  1 19  ? 9.848   17.714 45.238  1.00 8.99  ? 42   ASN A CA  1 
ATOM   131  C  C   . ASN A  1 19  ? 8.884   18.871 45.456  1.00 9.47  ? 42   ASN A C   1 
ATOM   132  O  O   . ASN A  1 19  ? 9.244   19.884 46.039  1.00 10.67 ? 42   ASN A O   1 
ATOM   133  C  CB  . ASN A  1 19  ? 9.950   16.861 46.510  1.00 11.56 ? 42   ASN A CB  1 
ATOM   134  C  CG  . ASN A  1 19  ? 8.603   16.359 47.011  1.00 9.48  ? 42   ASN A CG  1 
ATOM   135  O  OD1 . ASN A  1 19  ? 7.860   17.118 47.654  1.00 12.20 ? 42   ASN A OD1 1 
ATOM   136  N  ND2 . ASN A  1 19  ? 8.307   15.056 46.785  1.00 9.21  ? 42   ASN A ND2 1 
ATOM   137  N  N   . SER A  1 20  ? 7.662   18.708 44.969  1.00 11.37 ? 43   SER A N   1 
ATOM   138  C  CA  . SER A  1 20  ? 6.590   19.679 45.214  1.00 11.46 ? 43   SER A CA  1 
ATOM   139  C  C   . SER A  1 20  ? 5.357   18.830 45.419  1.00 14.70 ? 43   SER A C   1 
ATOM   140  O  O   . SER A  1 20  ? 4.512   18.731 44.528  1.00 25.76 ? 43   SER A O   1 
ATOM   141  C  CB  . SER A  1 20  ? 6.383   20.552 43.994  1.00 17.00 ? 43   SER A CB  1 
ATOM   142  O  OG  . SER A  1 20  ? 5.476   21.594 44.301  1.00 29.55 ? 43   SER A OG  1 
ATOM   143  N  N   . GLY A  1 21  ? 5.291   18.174 46.575  1.00 14.95 ? 44   GLY A N   1 
ATOM   144  C  CA  . GLY A  1 21  ? 4.343   17.100 46.804  1.00 17.61 ? 44   GLY A CA  1 
ATOM   145  C  C   . GLY A  1 21  ? 4.966   15.819 46.283  1.00 13.26 ? 44   GLY A C   1 
ATOM   146  O  O   . GLY A  1 21  ? 5.252   14.884 47.044  1.00 13.38 ? 44   GLY A O   1 
ATOM   147  N  N   . TYR A  1 22  ? 5.241   15.807 44.979  1.00 11.83 ? 45   TYR A N   1 
ATOM   148  C  CA  . TYR A  1 22  ? 5.881   14.656 44.339  1.00 11.55 ? 45   TYR A CA  1 
ATOM   149  C  C   . TYR A  1 22  ? 7.192   15.065 43.673  1.00 8.67  ? 45   TYR A C   1 
ATOM   150  O  O   . TYR A  1 22  ? 7.394   16.236 43.385  1.00 8.83  ? 45   TYR A O   1 
ATOM   151  C  CB  . TYR A  1 22  ? 4.940   14.060 43.285  1.00 13.01 ? 45   TYR A CB  1 
ATOM   152  C  CG  . TYR A  1 22  ? 3.782   13.278 43.876  1.00 13.22 ? 45   TYR A CG  1 
ATOM   153  C  CD1 . TYR A  1 22  ? 2.599   13.910 44.219  1.00 16.11 ? 45   TYR A CD1 1 
ATOM   154  C  CD2 . TYR A  1 22  ? 3.893   11.912 44.100  1.00 16.95 ? 45   TYR A CD2 1 
ATOM   155  C  CE1 . TYR A  1 22  ? 1.552   13.195 44.761  1.00 17.37 ? 45   TYR A CE1 1 
ATOM   156  C  CE2 . TYR A  1 22  ? 2.856   11.188 44.632  1.00 20.37 ? 45   TYR A CE2 1 
ATOM   157  C  CZ  . TYR A  1 22  ? 1.686   11.834 44.966  1.00 16.10 ? 45   TYR A CZ  1 
ATOM   158  O  OH  . TYR A  1 22  ? 0.650   11.085 45.512  1.00 24.74 ? 45   TYR A OH  1 
ATOM   159  N  N   . HIS A  1 23  ? 8.072   14.085 43.456  1.00 8.90  ? 46   HIS A N   1 
ATOM   160  C  CA  . HIS A  1 23  ? 9.304   14.269 42.676  1.00 12.31 ? 46   HIS A CA  1 
ATOM   161  C  C   . HIS A  1 23  ? 9.002   14.855 41.309  1.00 9.39  ? 46   HIS A C   1 
ATOM   162  O  O   . HIS A  1 23  ? 8.127   14.358 40.621  1.00 9.18  ? 46   HIS A O   1 
ATOM   163  C  CB  . HIS A  1 23  ? 9.944   12.908 42.408  1.00 9.50  ? 46   HIS A CB  1 
ATOM   164  C  CG  . HIS A  1 23  ? 11.036  12.963 41.394  1.00 7.41  ? 46   HIS A CG  1 
ATOM   165  N  ND1 . HIS A  1 23  ? 12.337  13.276 41.722  1.00 7.97  ? 46   HIS A ND1 1 
ATOM   166  C  CD2 . HIS A  1 23  ? 11.026  12.783 40.049  1.00 11.76 ? 46   HIS A CD2 1 
ATOM   167  C  CE1 . HIS A  1 23  ? 13.082  13.282 40.637  1.00 9.83  ? 46   HIS A CE1 1 
ATOM   168  N  NE2 . HIS A  1 23  ? 12.312  12.998 39.602  1.00 8.81  ? 46   HIS A NE2 1 
ATOM   169  N  N   . PHE A  1 24  ? 9.759   15.861 40.880  1.00 6.90  ? 47   PHE A N   1 
ATOM   170  C  CA  . PHE A  1 24  ? 9.564   16.381 39.526  1.00 8.00  ? 47   PHE A CA  1 
ATOM   171  C  C   . PHE A  1 24  ? 10.869  16.664 38.772  1.00 6.66  ? 47   PHE A C   1 
ATOM   172  O  O   . PHE A  1 24  ? 10.854  16.829 37.538  1.00 8.10  ? 47   PHE A O   1 
ATOM   173  C  CB  . PHE A  1 24  ? 8.668   17.630 39.553  1.00 9.13  ? 47   PHE A CB  1 
ATOM   174  C  CG  . PHE A  1 24  ? 9.323   18.832 40.176  1.00 8.64  ? 47   PHE A CG  1 
ATOM   175  C  CD1 . PHE A  1 24  ? 10.128  19.663 39.420  1.00 11.28 ? 47   PHE A CD1 1 
ATOM   176  C  CD2 . PHE A  1 24  ? 9.147   19.126 41.530  1.00 12.32 ? 47   PHE A CD2 1 
ATOM   177  C  CE1 . PHE A  1 24  ? 10.743  20.772 39.973  1.00 7.89  ? 47   PHE A CE1 1 
ATOM   178  C  CE2 . PHE A  1 24  ? 9.775   20.253 42.099  1.00 10.17 ? 47   PHE A CE2 1 
ATOM   179  C  CZ  . PHE A  1 24  ? 10.587  21.064 41.304  1.00 7.96  ? 47   PHE A CZ  1 
ATOM   180  N  N   . CYS A  1 25  ? 11.994  16.734 39.492  1.00 9.01  ? 48   CYS A N   1 
ATOM   181  C  CA  . CYS A  1 25  ? 13.283  16.956 38.833  1.00 7.15  ? 48   CYS A CA  1 
ATOM   182  C  C   . CYS A  1 25  ? 14.390  16.405 39.693  1.00 7.70  ? 48   CYS A C   1 
ATOM   183  O  O   . CYS A  1 25  ? 14.226  16.263 40.899  1.00 6.46  ? 48   CYS A O   1 
ATOM   184  C  CB  . CYS A  1 25  ? 13.553  18.459 38.622  1.00 7.79  ? 48   CYS A CB  1 
ATOM   185  S  SG  . CYS A  1 25  ? 12.919  19.153 37.054  1.00 9.31  ? 48   CYS A SG  1 
ATOM   186  N  N   . GLY A  1 26  ? 15.523  16.096 39.082  1.00 8.03  ? 49   GLY A N   1 
ATOM   187  C  CA  . GLY A  1 26  ? 16.694  15.767 39.872  1.00 8.07  ? 49   GLY A CA  1 
ATOM   188  C  C   . GLY A  1 26  ? 17.555  17.005 40.127  1.00 7.86  ? 49   GLY A C   1 
ATOM   189  O  O   . GLY A  1 26  ? 17.238  18.129 39.703  1.00 6.17  ? 49   GLY A O   1 
ATOM   190  N  N   . GLY A  1 27  ? 18.644  16.792 40.864  1.00 5.23  ? 50   GLY A N   1 
ATOM   191  C  CA  . GLY A  1 27  ? 19.624  17.823 41.122  1.00 5.40  ? 50   GLY A CA  1 
ATOM   192  C  C   . GLY A  1 27  ? 20.840  17.192 41.761  1.00 7.05  ? 50   GLY A C   1 
ATOM   193  O  O   . GLY A  1 27  ? 20.858  15.991 42.061  1.00 8.95  ? 50   GLY A O   1 
ATOM   194  N  N   . SER A  1 28  ? 21.872  18.010 41.924  1.00 5.57  ? 51   SER A N   1 
ATOM   195  C  CA  . SER A  1 28  ? 23.155  17.540 42.459  1.00 8.45  ? 51   SER A CA  1 
ATOM   196  C  C   . SER A  1 28  ? 23.571  18.404 43.635  1.00 5.80  ? 51   SER A C   1 
ATOM   197  O  O   . SER A  1 28  ? 23.604  19.641 43.538  1.00 5.92  ? 51   SER A O   1 
ATOM   198  C  CB  . SER A  1 28  ? 24.231  17.626 41.383  1.00 8.93  ? 51   SER A CB  1 
ATOM   199  O  OG  . SER A  1 28  ? 23.890  16.805 40.288  1.00 8.21  ? 51   SER A OG  1 
ATOM   200  N  N   . LEU A  1 29  ? 23.919  17.765 44.743  1.00 6.00  ? 52   LEU A N   1 
ATOM   201  C  CA  . LEU A  1 29  ? 24.386  18.496 45.915  1.00 6.85  ? 52   LEU A CA  1 
ATOM   202  C  C   . LEU A  1 29  ? 25.864  18.911 45.756  1.00 6.53  ? 52   LEU A C   1 
ATOM   203  O  O   . LEU A  1 29  ? 26.730  18.049 45.577  1.00 9.28  ? 52   LEU A O   1 
ATOM   204  C  CB  . LEU A  1 29  ? 24.266  17.590 47.137  1.00 8.34  ? 52   LEU A CB  1 
ATOM   205  C  CG  . LEU A  1 29  ? 24.495  18.305 48.460  1.00 8.29  ? 52   LEU A CG  1 
ATOM   206  C  CD1 . LEU A  1 29  ? 23.368  19.309 48.780  1.00 9.40  ? 52   LEU A CD1 1 
ATOM   207  C  CD2 . LEU A  1 29  ? 24.612  17.232 49.572  1.00 9.52  ? 52   LEU A CD2 1 
ATOM   208  N  N   . ILE A  1 30  ? 26.134  20.216 45.772  1.00 7.54  ? 53   ILE A N   1 
ATOM   209  C  CA  . ILE A  1 30  ? 27.524  20.685 45.544  1.00 10.84 ? 53   ILE A CA  1 
ATOM   210  C  C   . ILE A  1 30  ? 28.227  21.225 46.806  1.00 10.92 ? 53   ILE A C   1 
ATOM   211  O  O   . ILE A  1 30  ? 29.452  21.340 46.859  1.00 9.20  ? 53   ILE A O   1 
ATOM   212  C  CB  . ILE A  1 30  ? 27.645  21.657 44.368  1.00 6.98  ? 53   ILE A CB  1 
ATOM   213  C  CG1 . ILE A  1 30  ? 26.777  22.916 44.584  1.00 9.47  ? 53   ILE A CG1 1 
ATOM   214  C  CG2 . ILE A  1 30  ? 27.346  20.912 43.069  1.00 7.99  ? 53   ILE A CG2 1 
ATOM   215  C  CD1 . ILE A  1 30  ? 27.175  24.098 43.705  1.00 11.69 ? 53   ILE A CD1 1 
ATOM   216  N  N   . ASN A  1 31  ? 27.449  21.541 47.821  1.00 9.69  ? 54   ASN A N   1 
ATOM   217  C  CA  . ASN A  1 31  ? 27.972  21.693 49.179  1.00 10.91 ? 54   ASN A CA  1 
ATOM   218  C  C   . ASN A  1 31  ? 26.820  21.491 50.146  1.00 15.64 ? 54   ASN A C   1 
ATOM   219  O  O   . ASN A  1 31  ? 25.699  21.168 49.703  1.00 11.54 ? 54   ASN A O   1 
ATOM   220  C  CB  . ASN A  1 31  ? 28.719  23.034 49.390  1.00 10.69 ? 54   ASN A CB  1 
ATOM   221  C  CG  . ASN A  1 31  ? 27.840  24.258 49.171  1.00 14.06 ? 54   ASN A CG  1 
ATOM   222  O  OD1 . ASN A  1 31  ? 26.696  24.338 49.648  1.00 14.88 ? 54   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A  1 31  ? 28.383  25.242 48.455  1.00 15.66 ? 54   ASN A ND2 1 
ATOM   224  N  N   . SER A  1 32  ? 27.052  21.666 51.445  1.00 12.89 ? 55   SER A N   1 
ATOM   225  C  CA  . SER A  1 32  ? 25.966  21.403 52.401  1.00 12.51 ? 55   SER A CA  1 
ATOM   226  C  C   . SER A  1 32  ? 24.734  22.283 52.222  1.00 11.05 ? 55   SER A C   1 
ATOM   227  O  O   . SER A  1 32  ? 23.682  21.936 52.761  1.00 15.18 ? 55   SER A O   1 
ATOM   228  C  CB  . SER A  1 32  ? 26.438  21.484 53.863  1.00 11.92 ? 55   SER A CB  1 
ATOM   229  O  OG  . SER A  1 32  ? 26.774  22.806 54.213  1.00 15.10 ? 55   SER A OG  1 
ATOM   230  N  N   . GLN A  1 33  ? 24.837  23.406 51.493  1.00 8.00  ? 56   GLN A N   1 
ATOM   231  C  CA  . GLN A  1 33  ? 23.700  24.331 51.395  1.00 11.23 ? 56   GLN A CA  1 
ATOM   232  C  C   . GLN A  1 33  ? 23.178  24.585 49.982  1.00 11.24 ? 56   GLN A C   1 
ATOM   233  O  O   . GLN A  1 33  ? 22.200  25.320 49.812  1.00 10.11 ? 56   GLN A O   1 
ATOM   234  C  CB  . GLN A  1 33  ? 24.070  25.677 52.016  1.00 12.55 ? 56   GLN A CB  1 
ATOM   235  C  CG  . GLN A  1 33  ? 24.211  25.637 53.523  1.00 25.98 ? 56   GLN A CG  1 
ATOM   236  C  CD  . GLN A  1 33  ? 24.632  26.980 54.058  1.00 28.93 ? 56   GLN A CD  1 
ATOM   237  O  OE1 . GLN A  1 33  ? 25.795  27.389 53.919  1.00 32.48 ? 56   GLN A OE1 1 
ATOM   238  N  NE2 . GLN A  1 33  ? 23.690  27.694 54.638  1.00 19.53 ? 56   GLN A NE2 1 
ATOM   239  N  N   . TRP A  1 34  ? 23.810  23.984 48.976  1.00 9.47  ? 57   TRP A N   1 
ATOM   240  C  CA  . TRP A  1 34  ? 23.504  24.328 47.581  1.00 9.06  ? 57   TRP A CA  1 
ATOM   241  C  C   . TRP A  1 34  ? 23.360  23.129 46.660  1.00 9.88  ? 57   TRP A C   1 
ATOM   242  O  O   . TRP A  1 34  ? 24.139  22.161 46.739  1.00 8.92  ? 57   TRP A O   1 
ATOM   243  C  CB  . TRP A  1 34  ? 24.565  25.275 47.019  1.00 11.60 ? 57   TRP A CB  1 
ATOM   244  C  CG  . TRP A  1 34  ? 24.512  26.675 47.615  1.00 11.63 ? 57   TRP A CG  1 
ATOM   245  C  CD1 . TRP A  1 34  ? 25.183  27.120 48.716  1.00 10.88 ? 57   TRP A CD1 1 
ATOM   246  C  CD2 . TRP A  1 34  ? 23.758  27.800 47.123  1.00 10.54 ? 57   TRP A CD2 1 
ATOM   247  N  NE1 . TRP A  1 34  ? 24.893  28.447 48.948  1.00 9.93  ? 57   TRP A NE1 1 
ATOM   248  C  CE2 . TRP A  1 34  ? 24.028  28.890 47.980  1.00 9.31  ? 57   TRP A CE2 1 
ATOM   249  C  CE3 . TRP A  1 34  ? 22.870  27.987 46.050  1.00 9.53  ? 57   TRP A CE3 1 
ATOM   250  C  CZ2 . TRP A  1 34  ? 23.447  30.158 47.792  1.00 14.70 ? 57   TRP A CZ2 1 
ATOM   251  C  CZ3 . TRP A  1 34  ? 22.308  29.239 45.850  1.00 11.53 ? 57   TRP A CZ3 1 
ATOM   252  C  CH2 . TRP A  1 34  ? 22.600  30.314 46.714  1.00 14.02 ? 57   TRP A CH2 1 
ATOM   253  N  N   . VAL A  1 35  ? 22.379  23.232 45.766  1.00 6.50  ? 58   VAL A N   1 
ATOM   254  C  CA  . VAL A  1 35  ? 22.070  22.204 44.780  1.00 5.34  ? 58   VAL A CA  1 
ATOM   255  C  C   . VAL A  1 35  ? 22.087  22.828 43.387  1.00 7.92  ? 58   VAL A C   1 
ATOM   256  O  O   . VAL A  1 35  ? 21.586  23.950 43.197  1.00 8.91  ? 58   VAL A O   1 
ATOM   257  C  CB  . VAL A  1 35  ? 20.679  21.580 45.077  1.00 7.07  ? 58   VAL A CB  1 
ATOM   258  C  CG1 . VAL A  1 35  ? 20.147  20.754 43.891  1.00 5.74  ? 58   VAL A CG1 1 
ATOM   259  C  CG2 . VAL A  1 35  ? 20.718  20.773 46.346  1.00 6.10  ? 58   VAL A CG2 1 
ATOM   260  N  N   . VAL A  1 36  ? 22.687  22.117 42.439  1.00 4.71  ? 59   VAL A N   1 
ATOM   261  C  CA  . VAL A  1 36  ? 22.648  22.443 41.009  1.00 5.88  ? 59   VAL A CA  1 
ATOM   262  C  C   . VAL A  1 36  ? 21.527  21.660 40.303  1.00 6.90  ? 59   VAL A C   1 
ATOM   263  O  O   . VAL A  1 36  ? 21.426  20.443 40.445  1.00 7.29  ? 59   VAL A O   1 
ATOM   264  C  CB  . VAL A  1 36  ? 23.968  22.036 40.333  1.00 6.46  ? 59   VAL A CB  1 
ATOM   265  C  CG1 . VAL A  1 36  ? 23.832  22.178 38.798  1.00 9.56  ? 59   VAL A CG1 1 
ATOM   266  C  CG2 . VAL A  1 36  ? 25.112  22.915 40.876  1.00 11.64 ? 59   VAL A CG2 1 
ATOM   267  N  N   . SER A  1 37  ? 20.712  22.342 39.512  1.00 5.61  ? 60   SER A N   1 
ATOM   268  C  CA  . SER A  1 37  ? 19.664  21.679 38.737  1.00 4.69  ? 60   SER A CA  1 
ATOM   269  C  C   . SER A  1 37  ? 19.492  22.408 37.388  1.00 5.83  ? 60   SER A C   1 
ATOM   270  O  O   . SER A  1 37  ? 20.329  23.224 37.039  1.00 6.12  ? 60   SER A O   1 
ATOM   271  C  CB  . SER A  1 37  ? 18.341  21.624 39.539  1.00 5.81  ? 60   SER A CB  1 
ATOM   272  O  OG  . SER A  1 37  ? 17.429  20.699 38.949  1.00 6.56  ? 60   SER A OG  1 
ATOM   273  N  N   . ALA A  1 38  ? 18.428  22.106 36.629  1.00 4.43  ? 61   ALA A N   1 
ATOM   274  C  CA  . ALA A  1 38  ? 18.183  22.752 35.340  1.00 6.60  ? 61   ALA A CA  1 
ATOM   275  C  C   . ALA A  1 38  ? 17.332  24.006 35.544  1.00 5.78  ? 61   ALA A C   1 
ATOM   276  O  O   . ALA A  1 38  ? 16.433  23.999 36.388  1.00 8.89  ? 61   ALA A O   1 
ATOM   277  C  CB  . ALA A  1 38  ? 17.470  21.779 34.371  1.00 5.41  ? 61   ALA A CB  1 
ATOM   278  N  N   . ALA A  1 39  ? 17.613  25.065 34.780  1.00 6.43  ? 62   ALA A N   1 
ATOM   279  C  CA  . ALA A  1 39  ? 16.768  26.272 34.801  1.00 6.64  ? 62   ALA A CA  1 
ATOM   280  C  C   . ALA A  1 39  ? 15.300  25.912 34.502  1.00 9.74  ? 62   ALA A C   1 
ATOM   281  O  O   . ALA A  1 39  ? 14.387  26.521 35.063  1.00 10.79 ? 62   ALA A O   1 
ATOM   282  C  CB  . ALA A  1 39  ? 17.259  27.289 33.770  1.00 9.40  ? 62   ALA A CB  1 
ATOM   283  N  N   . HIS A  1 40  ? 15.057  24.939 33.622  1.00 7.76  ? 63   HIS A N   1 
ATOM   284  C  CA  . HIS A  1 40  ? 13.660  24.596 33.309  1.00 7.36  ? 63   HIS A CA  1 
ATOM   285  C  C   . HIS A  1 40  ? 12.912  23.849 34.394  1.00 11.81 ? 63   HIS A C   1 
ATOM   286  O  O   . HIS A  1 40  ? 11.699  23.649 34.279  1.00 10.22 ? 63   HIS A O   1 
ATOM   287  C  CB  . HIS A  1 40  ? 13.519  23.904 31.942  1.00 9.64  ? 63   HIS A CB  1 
ATOM   288  C  CG  . HIS A  1 40  ? 13.967  22.470 31.926  1.00 9.04  ? 63   HIS A CG  1 
ATOM   289  N  ND1 . HIS A  1 40  ? 15.209  22.107 31.493  1.00 9.02  ? 63   HIS A ND1 1 
ATOM   290  C  CD2 . HIS A  1 40  ? 13.301  21.334 32.248  1.00 9.83  ? 63   HIS A CD2 1 
ATOM   291  C  CE1 . HIS A  1 40  ? 15.314  20.769 31.564  1.00 8.01  ? 63   HIS A CE1 1 
ATOM   292  N  NE2 . HIS A  1 40  ? 14.177  20.294 32.006  1.00 7.92  ? 63   HIS A NE2 1 
ATOM   293  N  N   . CYS A  1 41  ? 13.619  23.472 35.460  1.00 9.44  ? 64   CYS A N   1 
ATOM   294  C  CA  . CYS A  1 41  ? 13.012  22.924 36.672  1.00 9.45  ? 64   CYS A CA  1 
ATOM   295  C  C   . CYS A  1 41  ? 12.533  24.002 37.660  1.00 7.41  ? 64   CYS A C   1 
ATOM   296  O  O   . CYS A  1 41  ? 12.005  23.668 38.705  1.00 10.34 ? 64   CYS A O   1 
ATOM   297  C  CB  . CYS A  1 41  ? 14.006  22.007 37.387  1.00 7.15  ? 64   CYS A CB  1 
ATOM   298  S  SG  . CYS A  1 41  ? 14.370  20.479 36.466  1.00 10.26 ? 64   CYS A SG  1 
ATOM   299  N  N   . TYR A  1 42  ? 12.705  25.280 37.318  1.00 6.66  ? 65   TYR A N   1 
ATOM   300  C  CA  . TYR A  1 42  ? 12.337  26.369 38.225  1.00 7.00  ? 65   TYR A CA  1 
ATOM   301  C  C   . TYR A  1 42  ? 10.834  26.484 38.477  1.00 13.24 ? 65   TYR A C   1 
ATOM   302  O  O   . TYR A  1 42  ? 10.047  26.540 37.532  1.00 13.52 ? 65   TYR A O   1 
ATOM   303  C  CB  . TYR A  1 42  ? 12.806  27.684 37.649  1.00 7.40  ? 65   TYR A CB  1 
ATOM   304  C  CG  . TYR A  1 42  ? 12.432  28.893 38.477  1.00 13.51 ? 65   TYR A CG  1 
ATOM   305  C  CD1 . TYR A  1 42  ? 12.875  29.026 39.778  1.00 19.08 ? 65   TYR A CD1 1 
ATOM   306  C  CD2 . TYR A  1 42  ? 11.681  29.923 37.927  1.00 20.31 ? 65   TYR A CD2 1 
ATOM   307  C  CE1 . TYR A  1 42  ? 12.562  30.161 40.531  1.00 25.94 ? 65   TYR A CE1 1 
ATOM   308  C  CE2 . TYR A  1 42  ? 11.362  31.061 38.667  1.00 26.45 ? 65   TYR A CE2 1 
ATOM   309  C  CZ  . TYR A  1 42  ? 11.810  31.173 39.966  1.00 30.07 ? 65   TYR A CZ  1 
ATOM   310  O  OH  . TYR A  1 42  ? 11.493  32.299 40.708  1.00 33.53 ? 65   TYR A OH  1 
ATOM   311  N  N   . LYS A  1 43  ? 10.464  26.524 39.757  1.00 14.03 ? 66   LYS A N   1 
ATOM   312  C  CA  . LYS A  1 43  ? 9.094   26.799 40.197  1.00 14.61 ? 66   LYS A CA  1 
ATOM   313  C  C   . LYS A  1 43  ? 9.217   27.126 41.666  1.00 15.04 ? 66   LYS A C   1 
ATOM   314  O  O   . LYS A  1 43  ? 10.244  26.844 42.271  1.00 13.42 ? 66   LYS A O   1 
ATOM   315  C  CB  . LYS A  1 43  ? 8.182   25.589 39.996  1.00 10.52 ? 66   LYS A CB  1 
ATOM   316  C  CG  . LYS A  1 43  ? 8.631   24.317 40.727  1.00 10.08 ? 66   LYS A CG  1 
ATOM   317  C  CD  . LYS A  1 43  ? 7.615   23.190 40.518  1.00 17.82 ? 66   LYS A CD  1 
ATOM   318  C  CE  . LYS A  1 43  ? 6.382   23.418 41.383  1.00 20.41 ? 66   LYS A CE  1 
ATOM   319  N  NZ  . LYS A  1 43  ? 5.255   22.454 41.049  1.00 19.01 ? 66   LYS A NZ  1 
ATOM   320  N  N   . SER A  1 44  ? 8.202   27.759 42.235  1.00 8.96  ? 67   SER A N   1 
ATOM   321  C  CA  . SER A  1 44  ? 8.213   27.998 43.672  1.00 9.65  ? 67   SER A CA  1 
ATOM   322  C  C   . SER A  1 44  ? 7.799   26.768 44.487  1.00 10.63 ? 67   SER A C   1 
ATOM   323  O  O   . SER A  1 44  ? 7.205   25.826 43.959  1.00 14.28 ? 67   SER A O   1 
ATOM   324  C  CB  . SER A  1 44  ? 7.286   29.164 44.004  1.00 13.98 ? 67   SER A CB  1 
ATOM   325  O  OG  . SER A  1 44  ? 5.959   28.819 43.659  1.00 15.16 ? 67   SER A OG  1 
ATOM   326  N  N   . GLY A  1 45  ? 8.091   26.803 45.785  1.00 13.65 ? 68   GLY A N   1 
ATOM   327  C  CA  . GLY A  1 45  ? 7.608   25.778 46.700  1.00 13.28 ? 68   GLY A CA  1 
ATOM   328  C  C   . GLY A  1 45  ? 8.375   24.458 46.584  1.00 11.68 ? 68   GLY A C   1 
ATOM   329  O  O   . GLY A  1 45  ? 7.807   23.374 46.715  1.00 18.39 ? 68   GLY A O   1 
ATOM   330  N  N   . ILE A  1 46  ? 9.665   24.544 46.304  1.00 10.43 ? 69   ILE A N   1 
ATOM   331  C  CA  . ILE A  1 46  ? 10.473  23.329 46.176  1.00 10.07 ? 69   ILE A CA  1 
ATOM   332  C  C   . ILE A  1 46  ? 10.983  22.826 47.537  1.00 10.30 ? 69   ILE A C   1 
ATOM   333  O  O   . ILE A  1 46  ? 11.430  23.612 48.386  1.00 11.76 ? 69   ILE A O   1 
ATOM   334  C  CB  . ILE A  1 46  ? 11.646  23.576 45.231  1.00 11.03 ? 69   ILE A CB  1 
ATOM   335  C  CG1 . ILE A  1 46  ? 11.123  23.796 43.805  1.00 10.09 ? 69   ILE A CG1 1 
ATOM   336  C  CG2 . ILE A  1 46  ? 12.669  22.417 45.293  1.00 13.37 ? 69   ILE A CG2 1 
ATOM   337  C  CD1 . ILE A  1 46  ? 12.210  24.270 42.810  1.00 10.59 ? 69   ILE A CD1 1 
ATOM   338  N  N   . GLN A  1 47  ? 10.874  21.512 47.738  1.00 8.30  ? 70   GLN A N   1 
ATOM   339  C  CA  . GLN A  1 47  ? 11.536  20.819 48.820  1.00 8.27  ? 70   GLN A CA  1 
ATOM   340  C  C   . GLN A  1 47  ? 12.617  19.928 48.230  1.00 12.45 ? 70   GLN A C   1 
ATOM   341  O  O   . GLN A  1 47  ? 12.379  19.212 47.255  1.00 10.18 ? 70   GLN A O   1 
ATOM   342  C  CB  . GLN A  1 47  ? 10.539  19.972 49.616  1.00 9.63  ? 70   GLN A CB  1 
ATOM   343  C  CG  . GLN A  1 47  ? 11.133  19.292 50.850  1.00 10.98 ? 70   GLN A CG  1 
ATOM   344  C  CD  . GLN A  1 47  ? 10.111  18.384 51.538  1.00 14.64 ? 70   GLN A CD  1 
ATOM   345  O  OE1 . GLN A  1 47  ? 9.804   17.299 51.045  1.00 12.84 ? 70   GLN A OE1 1 
ATOM   346  N  NE2 . GLN A  1 47  ? 9.566   18.840 52.657  1.00 14.60 ? 70   GLN A NE2 1 
ATOM   347  N  N   . VAL A  1 48  ? 13.814  19.979 48.804  1.00 7.71  ? 71   VAL A N   1 
ATOM   348  C  CA  . VAL A  1 48  ? 14.877  19.107 48.320  1.00 8.13  ? 71   VAL A CA  1 
ATOM   349  C  C   . VAL A  1 48  ? 14.893  17.874 49.156  1.00 7.11  ? 71   VAL A C   1 
ATOM   350  O  O   . VAL A  1 48  ? 14.866  17.954 50.402  1.00 6.62  ? 71   VAL A O   1 
ATOM   351  C  CB  . VAL A  1 48  ? 16.251  19.820 48.402  1.00 7.89  ? 71   VAL A CB  1 
ATOM   352  C  CG1 . VAL A  1 48  ? 17.367  18.890 47.940  1.00 9.18  ? 71   VAL A CG1 1 
ATOM   353  C  CG2 . VAL A  1 48  ? 16.214  21.085 47.566  1.00 10.40 ? 71   VAL A CG2 1 
ATOM   354  N  N   . ARG A  1 49  ? 14.938  16.729 48.501  1.00 7.28  ? 72   ARG A N   1 
ATOM   355  C  CA  . ARG A  1 49  ? 15.042  15.471 49.226  1.00 7.57  ? 72   ARG A CA  1 
ATOM   356  C  C   . ARG A  1 49  ? 16.371  14.790 48.985  1.00 9.44  ? 72   ARG A C   1 
ATOM   357  O  O   . ARG A  1 49  ? 16.688  14.399 47.871  1.00 8.33  ? 72   ARG A O   1 
ATOM   358  C  CB  . ARG A  1 49  ? 13.867  14.551 48.887  1.00 8.03  ? 72   ARG A CB  1 
ATOM   359  C  CG  . ARG A  1 49  ? 12.542  15.214 49.222  1.00 8.23  ? 72   ARG A CG  1 
ATOM   360  C  CD  . ARG A  1 49  ? 11.339  14.246 49.165  1.00 6.07  ? 72   ARG A CD  1 
ATOM   361  N  NE  . ARG A  1 49  ? 10.164  14.924 49.731  1.00 8.27  ? 72   ARG A NE  1 
ATOM   362  C  CZ  . ARG A  1 49  ? 8.974   14.355 49.911  1.00 11.02 ? 72   ARG A CZ  1 
ATOM   363  N  NH1 . ARG A  1 49  ? 8.783   13.108 49.524  1.00 8.64  ? 72   ARG A NH1 1 
ATOM   364  N  NH2 . ARG A  1 49  ? 7.975   15.066 50.471  1.00 9.10  ? 72   ARG A NH2 1 
ATOM   365  N  N   . LEU A  1 50  ? 17.148  14.682 50.058  1.00 8.26  ? 73   LEU A N   1 
ATOM   366  C  CA  . LEU A  1 50  ? 18.506  14.132 50.026  1.00 7.09  ? 73   LEU A CA  1 
ATOM   367  C  C   . LEU A  1 50  ? 18.498  12.737 50.611  1.00 7.66  ? 73   LEU A C   1 
ATOM   368  O  O   . LEU A  1 50  ? 17.585  12.384 51.354  1.00 10.24 ? 73   LEU A O   1 
ATOM   369  C  CB  . LEU A  1 50  ? 19.456  15.028 50.816  1.00 8.88  ? 73   LEU A CB  1 
ATOM   370  C  CG  . LEU A  1 50  ? 19.456  16.491 50.372  1.00 9.51  ? 73   LEU A CG  1 
ATOM   371  C  CD1 . LEU A  1 50  ? 18.524  17.341 51.213  1.00 10.76 ? 73   LEU A CD1 1 
ATOM   372  C  CD2 . LEU A  1 50  ? 20.889  17.106 50.349  1.00 11.35 ? 73   LEU A CD2 1 
ATOM   373  N  N   . GLY A  1 51  ? 19.489  11.923 50.253  1.00 9.23  ? 74   GLY A N   1 
ATOM   374  C  CA  . GLY A  1 51  ? 19.594  10.594 50.832  1.00 11.10 ? 74   GLY A CA  1 
ATOM   375  C  C   . GLY A  1 51  ? 18.505  9.627  50.417  1.00 10.64 ? 74   GLY A C   1 
ATOM   376  O  O   . GLY A  1 51  ? 18.293  8.603  51.079  1.00 12.09 ? 74   GLY A O   1 
ATOM   377  N  N   . GLU A  1 52  ? 17.816  9.931  49.319  1.00 9.56  ? 75   GLU A N   1 
ATOM   378  C  CA  . GLU A  1 52  ? 16.780  9.057  48.801  1.00 9.69  ? 75   GLU A CA  1 
ATOM   379  C  C   . GLU A  1 52  ? 17.343  7.885  48.016  1.00 11.13 ? 75   GLU A C   1 
ATOM   380  O  O   . GLU A  1 52  ? 18.313  8.034  47.258  1.00 11.80 ? 75   GLU A O   1 
ATOM   381  C  CB  . GLU A  1 52  ? 15.853  9.858  47.883  1.00 10.10 ? 75   GLU A CB  1 
ATOM   382  C  CG  . GLU A  1 52  ? 14.955  10.883 48.606  1.00 9.21  ? 75   GLU A CG  1 
ATOM   383  C  CD  . GLU A  1 52  ? 13.724  10.236 49.179  1.00 10.63 ? 75   GLU A CD  1 
ATOM   384  O  OE1 . GLU A  1 52  ? 13.769  9.010  49.279  1.00 9.34  ? 75   GLU A OE1 1 
ATOM   385  O  OE2 . GLU A  1 52  ? 12.728  10.898 49.524  1.00 9.24  ? 75   GLU A OE2 1 
ATOM   386  N  N   . ASP A  1 53  ? 16.724  6.714  48.188  1.00 10.35 ? 76   ASP A N   1 
ATOM   387  C  CA  . ASP A  1 53  ? 16.866  5.644  47.219  1.00 10.56 ? 76   ASP A CA  1 
ATOM   388  C  C   . ASP A  1 53  ? 15.494  5.313  46.626  1.00 9.07  ? 76   ASP A C   1 
ATOM   389  O  O   . ASP A  1 53  ? 15.193  5.681  45.503  1.00 11.17 ? 76   ASP A O   1 
ATOM   390  C  CB  . ASP A  1 53  ? 17.525  4.385  47.802  1.00 12.49 ? 76   ASP A CB  1 
ATOM   391  C  CG  . ASP A  1 53  ? 17.798  3.355  46.730  1.00 18.05 ? 76   ASP A CG  1 
ATOM   392  O  OD1 . ASP A  1 53  ? 18.215  3.769  45.621  1.00 14.00 ? 76   ASP A OD1 1 
ATOM   393  O  OD2 . ASP A  1 53  ? 17.573  2.144  46.965  1.00 15.94 ? 76   ASP A OD2 1 
ATOM   394  N  N   . ASN A  1 54  ? 14.655  4.623  47.387  1.00 9.72  ? 77   ASN A N   1 
ATOM   395  C  CA  . ASN A  1 54  ? 13.294  4.408  46.943  1.00 12.45 ? 77   ASN A CA  1 
ATOM   396  C  C   . ASN A  1 54  ? 12.519  5.663  47.201  1.00 11.68 ? 77   ASN A C   1 
ATOM   397  O  O   . ASN A  1 54  ? 12.278  5.972  48.324  1.00 12.25 ? 77   ASN A O   1 
ATOM   398  C  CB  . ASN A  1 54  ? 12.659  3.261  47.742  1.00 12.07 ? 77   ASN A CB  1 
ATOM   399  C  CG  . ASN A  1 54  ? 11.278  2.900  47.243  1.00 14.22 ? 77   ASN A CG  1 
ATOM   400  O  OD1 . ASN A  1 54  ? 10.460  3.780  46.909  1.00 15.29 ? 77   ASN A OD1 1 
ATOM   401  N  ND2 . ASN A  1 54  ? 11.000  1.586  47.170  1.00 15.91 ? 77   ASN A ND2 1 
ATOM   402  N  N   . ILE A  1 55  ? 12.086  6.357  46.166  1.00 10.86 ? 78   ILE A N   1 
ATOM   403  C  CA  . ILE A  1 55  ? 11.479  7.679  46.298  1.00 12.18 ? 78   ILE A CA  1 
ATOM   404  C  C   . ILE A  1 55  ? 10.059  7.636  46.913  1.00 16.43 ? 78   ILE A C   1 
ATOM   405  O  O   . ILE A  1 55  ? 9.523   8.662  47.375  1.00 12.95 ? 78   ILE A O   1 
ATOM   406  C  CB  . ILE A  1 55  ? 11.523  8.369  44.904  1.00 14.96 ? 78   ILE A CB  1 
ATOM   407  C  CG1 . ILE A  1 55  ? 11.470  9.900  45.005  1.00 16.14 ? 78   ILE A CG1 1 
ATOM   408  C  CG2 . ILE A  1 55  ? 10.476  7.785  43.997  1.00 13.65 ? 78   ILE A CG2 1 
ATOM   409  C  CD1 . ILE A  1 55  ? 12.787  10.524 45.497  1.00 14.52 ? 78   ILE A CD1 1 
ATOM   410  N  N   . ASN A  1 56  ? 9.464   6.442  46.965  1.00 10.66 ? 79   ASN A N   1 
ATOM   411  C  CA  . ASN A  1 56  ? 8.094   6.278  47.475  1.00 14.05 ? 79   ASN A CA  1 
ATOM   412  C  C   . ASN A  1 56  ? 7.985   5.839  48.931  1.00 14.26 ? 79   ASN A C   1 
ATOM   413  O  O   . ASN A  1 56  ? 6.938   6.012  49.549  1.00 18.53 ? 79   ASN A O   1 
ATOM   414  C  CB  . ASN A  1 56  ? 7.323   5.280  46.604  1.00 15.10 ? 79   ASN A CB  1 
ATOM   415  C  CG  . ASN A  1 56  ? 7.165   5.756  45.187  1.00 22.65 ? 79   ASN A CG  1 
ATOM   416  O  OD1 . ASN A  1 56  ? 6.844   6.924  44.941  1.00 23.64 ? 79   ASN A OD1 1 
ATOM   417  N  ND2 . ASN A  1 56  ? 7.414   4.861  44.233  1.00 22.49 ? 79   ASN A ND2 1 
ATOM   418  N  N   . VAL A  1 57  ? 9.072   5.293  49.470  1.00 11.39 ? 80   VAL A N   1 
ATOM   419  C  CA  . VAL A  1 57  ? 9.094   4.585  50.751  1.00 15.20 ? 80   VAL A CA  1 
ATOM   420  C  C   . VAL A  1 57  ? 10.153  5.159  51.681  1.00 15.61 ? 80   VAL A C   1 
ATOM   421  O  O   . VAL A  1 57  ? 11.285  5.331  51.258  1.00 14.47 ? 80   VAL A O   1 
ATOM   422  C  CB  . VAL A  1 57  ? 9.474   3.119  50.497  1.00 13.06 ? 80   VAL A CB  1 
ATOM   423  C  CG1 . VAL A  1 57  ? 9.836   2.400  51.821  1.00 15.66 ? 80   VAL A CG1 1 
ATOM   424  C  CG2 . VAL A  1 57  ? 8.359   2.417  49.741  1.00 19.12 ? 80   VAL A CG2 1 
ATOM   425  N  N   . VAL A  1 58  ? 9.835   5.419  52.947  1.00 11.35 ? 81   VAL A N   1 
ATOM   426  C  CA  . VAL A  1 58  ? 10.840  5.948  53.861  1.00 13.48 ? 81   VAL A CA  1 
ATOM   427  C  C   . VAL A  1 58  ? 11.781  4.844  54.293  1.00 12.89 ? 81   VAL A C   1 
ATOM   428  O  O   . VAL A  1 58  ? 11.340  3.836  54.871  1.00 15.95 ? 81   VAL A O   1 
ATOM   429  C  CB  . VAL A  1 58  ? 10.217  6.529  55.122  1.00 13.59 ? 81   VAL A CB  1 
ATOM   430  C  CG1 . VAL A  1 58  ? 11.318  7.078  56.058  1.00 11.24 ? 81   VAL A CG1 1 
ATOM   431  C  CG2 . VAL A  1 58  ? 9.172   7.584  54.779  1.00 12.88 ? 81   VAL A CG2 1 
ATOM   432  N  N   . GLU A  1 59  ? 13.078  5.032  54.048  1.00 15.32 ? 82   GLU A N   1 
ATOM   433  C  CA  . GLU A  1 59  ? 14.060  3.983  54.337  1.00 12.15 ? 82   GLU A CA  1 
ATOM   434  C  C   . GLU A  1 59  ? 15.020  4.351  55.443  1.00 16.44 ? 82   GLU A C   1 
ATOM   435  O  O   . GLU A  1 59  ? 15.738  3.482  55.971  1.00 16.23 ? 82   GLU A O   1 
ATOM   436  C  CB  . GLU A  1 59  ? 14.833  3.606  53.061  1.00 12.71 ? 82   GLU A CB  1 
ATOM   437  C  CG  . GLU A  1 59  ? 13.903  3.017  52.015  1.00 12.00 ? 82   GLU A CG  1 
ATOM   438  C  CD  . GLU A  1 59  ? 14.628  2.662  50.739  1.00 19.79 ? 82   GLU A CD  1 
ATOM   439  O  OE1 . GLU A  1 59  ? 15.184  3.588  50.094  1.00 15.36 ? 82   GLU A OE1 1 
ATOM   440  O  OE2 . GLU A  1 59  ? 14.652  1.462  50.401  1.00 19.58 ? 82   GLU A OE2 1 
ATOM   441  N  N   . GLY A  1 60  ? 15.052  5.637  55.777  1.00 13.17 ? 83   GLY A N   1 
ATOM   442  C  CA  . GLY A  1 60  ? 15.770  6.082  56.953  1.00 11.85 ? 83   GLY A CA  1 
ATOM   443  C  C   . GLY A  1 60  ? 16.961  6.988  56.719  1.00 14.02 ? 83   GLY A C   1 
ATOM   444  O  O   . GLY A  1 60  ? 17.532  7.529  57.665  1.00 21.13 ? 83   GLY A O   1 
ATOM   445  N  N   . ASN A  1 61  ? 17.368  7.160  55.468  1.00 10.07 ? 84   ASN A N   1 
ATOM   446  C  CA  . ASN A  1 61  ? 18.498  8.042  55.235  1.00 10.90 ? 84   ASN A CA  1 
ATOM   447  C  C   . ASN A  1 61  ? 18.122  9.385  54.613  1.00 9.40  ? 84   ASN A C   1 
ATOM   448  O  O   . ASN A  1 61  ? 19.001  10.194 54.327  1.00 9.99  ? 84   ASN A O   1 
ATOM   449  C  CB  . ASN A  1 61  ? 19.589  7.316  54.459  1.00 12.66 ? 84   ASN A CB  1 
ATOM   450  C  CG  . ASN A  1 61  ? 20.150  6.163  55.248  1.00 18.40 ? 84   ASN A CG  1 
ATOM   451  O  OD1 . ASN A  1 61  ? 20.762  6.377  56.300  1.00 19.50 ? 84   ASN A OD1 1 
ATOM   452  N  ND2 . ASN A  1 61  ? 19.935  4.938  54.774  1.00 17.86 ? 84   ASN A ND2 1 
ATOM   453  N  N   . GLU A  1 62  ? 16.821  9.636  54.476  1.00 9.52  ? 85   GLU A N   1 
ATOM   454  C  CA  . GLU A  1 62  ? 16.327  10.882 53.861  1.00 9.67  ? 85   GLU A CA  1 
ATOM   455  C  C   . GLU A  1 62  ? 16.528  12.099 54.730  1.00 10.91 ? 85   GLU A C   1 
ATOM   456  O  O   . GLU A  1 62  ? 16.386  12.043 55.946  1.00 10.54 ? 85   GLU A O   1 
ATOM   457  C  CB  . GLU A  1 62  ? 14.816  10.819 53.536  1.00 10.65 ? 85   GLU A CB  1 
ATOM   458  C  CG  . GLU A  1 62  ? 14.398  9.643  52.653  1.00 13.30 ? 85   GLU A CG  1 
ATOM   459  C  CD  . GLU A  1 62  ? 14.166  8.337  53.427  1.00 10.31 ? 85   GLU A CD  1 
ATOM   460  O  OE1 . GLU A  1 62  ? 14.469  8.187  54.606  1.00 9.31  ? 85   GLU A OE1 1 
ATOM   461  O  OE2 . GLU A  1 62  ? 13.667  7.402  52.812  1.00 11.65 ? 85   GLU A OE2 1 
ATOM   462  N  N   . GLN A  1 63  ? 16.847  13.217 54.089  1.00 8.43  ? 86   GLN A N   1 
ATOM   463  C  CA  . GLN A  1 63  ? 16.678  14.526 54.708  1.00 9.68  ? 86   GLN A CA  1 
ATOM   464  C  C   . GLN A  1 63  ? 15.767  15.351 53.823  1.00 9.54  ? 86   GLN A C   1 
ATOM   465  O  O   . GLN A  1 63  ? 15.943  15.403 52.588  1.00 10.43 ? 86   GLN A O   1 
ATOM   466  C  CB  . GLN A  1 63  ? 18.030  15.230 54.902  1.00 12.91 ? 86   GLN A CB  1 
ATOM   467  C  CG  . GLN A  1 63  ? 18.973  14.505 55.855  1.00 11.82 ? 86   GLN A CG  1 
ATOM   468  C  CD  . GLN A  1 63  ? 20.337  15.167 55.922  1.00 13.02 ? 86   GLN A CD  1 
ATOM   469  O  OE1 . GLN A  1 63  ? 20.443  16.398 55.959  1.00 13.71 ? 86   GLN A OE1 1 
ATOM   470  N  NE2 . GLN A  1 63  ? 21.385  14.358 55.883  1.00 12.41 ? 86   GLN A NE2 1 
ATOM   471  N  N   . PHE A  1 64  ? 14.798  16.016 54.445  1.00 9.46  ? 87   PHE A N   1 
ATOM   472  C  CA  . PHE A  1 64  ? 13.836  16.820 53.703  1.00 8.94  ? 87   PHE A CA  1 
ATOM   473  C  C   . PHE A  1 64  ? 14.040  18.297 54.062  1.00 11.34 ? 87   PHE A C   1 
ATOM   474  O  O   . PHE A  1 64  ? 13.747  18.738 55.183  1.00 12.41 ? 87   PHE A O   1 
ATOM   475  C  CB  . PHE A  1 64  ? 12.378  16.433 54.026  1.00 13.89 ? 87   PHE A CB  1 
ATOM   476  C  CG  . PHE A  1 64  ? 12.067  14.949 53.948  1.00 11.09 ? 87   PHE A CG  1 
ATOM   477  C  CD1 . PHE A  1 64  ? 12.230  14.127 55.053  1.00 15.04 ? 87   PHE A CD1 1 
ATOM   478  C  CD2 . PHE A  1 64  ? 11.504  14.408 52.803  1.00 17.58 ? 87   PHE A CD2 1 
ATOM   479  C  CE1 . PHE A  1 64  ? 11.908  12.767 54.989  1.00 18.04 ? 87   PHE A CE1 1 
ATOM   480  C  CE2 . PHE A  1 64  ? 11.177  13.048 52.727  1.00 20.53 ? 87   PHE A CE2 1 
ATOM   481  C  CZ  . PHE A  1 64  ? 11.382  12.222 53.824  1.00 12.96 ? 87   PHE A CZ  1 
ATOM   482  N  N   . ILE A  1 65  ? 14.530  19.086 53.112  1.00 6.65  ? 88   ILE A N   1 
ATOM   483  C  CA  . ILE A  1 65  ? 14.870  20.476 53.417  1.00 6.57  ? 88   ILE A CA  1 
ATOM   484  C  C   . ILE A  1 65  ? 14.245  21.427 52.379  1.00 8.00  ? 88   ILE A C   1 
ATOM   485  O  O   . ILE A  1 65  ? 14.423  21.249 51.178  1.00 9.74  ? 88   ILE A O   1 
ATOM   486  C  CB  . ILE A  1 65  ? 16.388  20.681 53.448  1.00 9.42  ? 88   ILE A CB  1 
ATOM   487  C  CG1 . ILE A  1 65  ? 17.061  19.635 54.368  1.00 8.01  ? 88   ILE A CG1 1 
ATOM   488  C  CG2 . ILE A  1 65  ? 16.700  22.114 53.890  1.00 13.64 ? 88   ILE A CG2 1 
ATOM   489  C  CD1 . ILE A  1 65  ? 18.590  19.689 54.348  1.00 13.37 ? 88   ILE A CD1 1 
ATOM   490  N  N   . SER A  1 66  ? 13.526  22.442 52.844  1.00 10.83 ? 89   SER A N   1 
ATOM   491  C  CA  . SER A  1 66  ? 12.917  23.383 51.906  1.00 10.89 ? 89   SER A CA  1 
ATOM   492  C  C   . SER A  1 66  ? 13.984  24.183 51.196  1.00 10.82 ? 89   SER A C   1 
ATOM   493  O  O   . SER A  1 66  ? 15.016  24.493 51.785  1.00 11.92 ? 89   SER A O   1 
ATOM   494  C  CB  . SER A  1 66  ? 11.993  24.356 52.640  1.00 15.47 ? 89   SER A CB  1 
ATOM   495  O  OG  . SER A  1 66  ? 10.941  23.654 53.277  1.00 18.79 ? 89   SER A OG  1 
ATOM   496  N  N   . ALA A  1 67  ? 13.732  24.532 49.940  1.00 9.64  ? 90   ALA A N   1 
ATOM   497  C  CA  . ALA A  1 67  ? 14.550  25.528 49.271  1.00 8.57  ? 90   ALA A CA  1 
ATOM   498  C  C   . ALA A  1 67  ? 14.218  26.919 49.817  1.00 12.23 ? 90   ALA A C   1 
ATOM   499  O  O   . ALA A  1 67  ? 13.065  27.235 50.071  1.00 18.13 ? 90   ALA A O   1 
ATOM   500  C  CB  . ALA A  1 67  ? 14.347  25.471 47.785  1.00 8.33  ? 90   ALA A CB  1 
ATOM   501  N  N   . SER A  1 68  ? 15.247  27.712 50.059  1.00 12.75 ? 91   SER A N   1 
ATOM   502  C  CA  . SER A  1 68  ? 15.061  29.106 50.473  1.00 13.90 ? 91   SER A CA  1 
ATOM   503  C  C   . SER A  1 68  ? 15.260  30.078 49.313  1.00 18.54 ? 91   SER A C   1 
ATOM   504  O  O   . SER A  1 68  ? 14.654  31.153 49.291  1.00 18.21 ? 91   SER A O   1 
ATOM   505  C  CB  . SER A  1 68  ? 16.017  29.451 51.601  1.00 15.11 ? 91   SER A CB  1 
ATOM   506  O  OG  . SER A  1 68  ? 17.355  29.103 51.247  1.00 16.50 ? 91   SER A OG  1 
ATOM   507  N  N   . LYS A  1 69  ? 16.125  29.719 48.363  1.00 12.41 ? 92   LYS A N   1 
ATOM   508  C  CA  . LYS A  1 69  ? 16.328  30.537 47.162  1.00 13.97 ? 92   LYS A CA  1 
ATOM   509  C  C   . LYS A  1 69  ? 16.464  29.640 45.963  1.00 10.52 ? 92   LYS A C   1 
ATOM   510  O  O   . LYS A  1 69  ? 17.011  28.545 46.071  1.00 10.63 ? 92   LYS A O   1 
ATOM   511  C  CB  . LYS A  1 69  ? 17.599  31.390 47.282  1.00 17.47 ? 92   LYS A CB  1 
ATOM   512  C  CG  . LYS A  1 69  ? 17.589  32.361 48.454  1.00 25.69 ? 92   LYS A CG  1 
ATOM   513  C  CD  . LYS A  1 69  ? 18.902  33.138 48.540  1.00 29.15 ? 92   LYS A CD  1 
ATOM   514  C  CE  . LYS A  1 69  ? 18.799  34.229 49.614  1.00 37.33 ? 92   LYS A CE  1 
ATOM   515  N  NZ  . LYS A  1 69  ? 20.135  34.661 50.106  1.00 39.65 ? 92   LYS A NZ  1 
ATOM   516  N  N   . SER A  1 70  ? 15.952  30.094 44.821  1.00 10.36 ? 93   SER A N   1 
ATOM   517  C  CA  . SER A  1 70  ? 16.149  29.391 43.547  1.00 10.07 ? 93   SER A CA  1 
ATOM   518  C  C   . SER A  1 70  ? 16.659  30.441 42.571  1.00 20.92 ? 93   SER A C   1 
ATOM   519  O  O   . SER A  1 70  ? 16.003  31.468 42.366  1.00 22.26 ? 93   SER A O   1 
ATOM   520  C  CB  . SER A  1 70  ? 14.851  28.759 43.060  1.00 16.88 ? 93   SER A CB  1 
ATOM   521  O  OG  . SER A  1 70  ? 14.361  27.824 44.015  1.00 23.27 ? 93   SER A OG  1 
ATOM   522  N  N   . ILE A  1 71  ? 17.849  30.224 42.006  1.00 12.31 ? 94   ILE A N   1 
ATOM   523  C  CA  . ILE A  1 71  ? 18.485  31.268 41.211  1.00 9.48  ? 94   ILE A CA  1 
ATOM   524  C  C   . ILE A  1 71  ? 18.770  30.719 39.816  1.00 10.88 ? 94   ILE A C   1 
ATOM   525  O  O   . ILE A  1 71  ? 19.679  29.906 39.614  1.00 9.20  ? 94   ILE A O   1 
ATOM   526  C  CB  . ILE A  1 71  ? 19.773  31.805 41.874  1.00 11.12 ? 94   ILE A CB  1 
ATOM   527  C  CG1 . ILE A  1 71  ? 19.430  32.349 43.269  1.00 15.20 ? 94   ILE A CG1 1 
ATOM   528  C  CG2 . ILE A  1 71  ? 20.390  32.892 40.993  1.00 10.73 ? 94   ILE A CG2 1 
ATOM   529  C  CD1 . ILE A  1 71  ? 20.607  32.451 44.196  1.00 12.53 ? 94   ILE A CD1 1 
ATOM   530  N  N   . VAL A  1 72  ? 17.924  31.106 38.868  1.00 10.72 ? 95   VAL A N   1 
ATOM   531  C  CA  . VAL A  1 72  ? 18.098  30.690 37.481  1.00 11.37 ? 95   VAL A CA  1 
ATOM   532  C  C   . VAL A  1 72  ? 19.231  31.491 36.842  1.00 11.20 ? 95   VAL A C   1 
ATOM   533  O  O   . VAL A  1 72  ? 19.398  32.673 37.143  1.00 10.14 ? 95   VAL A O   1 
ATOM   534  C  CB  . VAL A  1 72  ? 16.791  30.935 36.720  1.00 10.59 ? 95   VAL A CB  1 
ATOM   535  C  CG1 . VAL A  1 72  ? 16.979  30.775 35.213  1.00 13.10 ? 95   VAL A CG1 1 
ATOM   536  C  CG2 . VAL A  1 72  ? 15.692  30.009 37.269  1.00 15.39 ? 95   VAL A CG2 1 
ATOM   537  N  N   . HIS A  1 73  ? 20.005  30.872 35.950  1.00 8.05  ? 96   HIS A N   1 
ATOM   538  C  CA  . HIS A  1 73  ? 21.062  31.631 35.286  1.00 9.04  ? 96   HIS A CA  1 
ATOM   539  C  C   . HIS A  1 73  ? 20.453  32.863 34.603  1.00 7.54  ? 96   HIS A C   1 
ATOM   540  O  O   . HIS A  1 73  ? 19.451  32.735 33.893  1.00 10.34 ? 96   HIS A O   1 
ATOM   541  C  CB  . HIS A  1 73  ? 21.770  30.800 34.237  1.00 7.80  ? 96   HIS A CB  1 
ATOM   542  C  CG  . HIS A  1 73  ? 23.073  31.390 33.802  1.00 9.54  ? 96   HIS A CG  1 
ATOM   543  N  ND1 . HIS A  1 73  ? 23.165  32.347 32.816  1.00 12.13 ? 96   HIS A ND1 1 
ATOM   544  C  CD2 . HIS A  1 73  ? 24.328  31.206 34.278  1.00 12.81 ? 96   HIS A CD2 1 
ATOM   545  C  CE1 . HIS A  1 73  ? 24.437  32.692 32.664  1.00 13.32 ? 96   HIS A CE1 1 
ATOM   546  N  NE2 . HIS A  1 73  ? 25.160  32.014 33.536  1.00 11.99 ? 96   HIS A NE2 1 
ATOM   547  N  N   . PRO A  1 74  ? 21.076  34.037 34.783  1.00 8.53  ? 97   PRO A N   1 
ATOM   548  C  CA  . PRO A  1 74  ? 20.510  35.286 34.246  1.00 13.98 ? 97   PRO A CA  1 
ATOM   549  C  C   . PRO A  1 74  ? 20.411  35.336 32.722  1.00 15.96 ? 97   PRO A C   1 
ATOM   550  O  O   . PRO A  1 74  ? 19.678  36.189 32.199  1.00 17.82 ? 97   PRO A O   1 
ATOM   551  C  CB  . PRO A  1 74  ? 21.485  36.364 34.742  1.00 14.20 ? 97   PRO A CB  1 
ATOM   552  C  CG  . PRO A  1 74  ? 22.777  35.632 34.955  1.00 17.38 ? 97   PRO A CG  1 
ATOM   553  C  CD  . PRO A  1 74  ? 22.335  34.284 35.516  1.00 11.99 ? 97   PRO A CD  1 
ATOM   554  N  N   . SER A  1 75  ? 21.133  34.468 32.019  1.00 11.05 ? 98   SER A N   1 
ATOM   555  C  CA  . SER A  1 75  ? 21.008  34.387 30.559  1.00 14.81 ? 98   SER A CA  1 
ATOM   556  C  C   . SER A  1 75  ? 20.305  33.122 30.070  1.00 10.30 ? 98   SER A C   1 
ATOM   557  O  O   . SER A  1 75  ? 20.403  32.778 28.880  1.00 13.73 ? 98   SER A O   1 
ATOM   558  C  CB  . SER A  1 75  ? 22.382  34.479 29.892  1.00 17.60 ? 98   SER A CB  1 
ATOM   559  O  OG  . SER A  1 75  ? 23.064  35.645 30.301  1.00 21.85 ? 98   SER A OG  1 
ATOM   560  N  N   . TYR A  1 76  ? 19.599  32.424 30.953  1.00 10.08 ? 99   TYR A N   1 
ATOM   561  C  CA  . TYR A  1 76  ? 18.780  31.292 30.499  1.00 10.96 ? 99   TYR A CA  1 
ATOM   562  C  C   . TYR A  1 76  ? 17.858  31.716 29.362  1.00 12.07 ? 99   TYR A C   1 
ATOM   563  O  O   . TYR A  1 76  ? 17.145  32.721 29.479  1.00 11.82 ? 99   TYR A O   1 
ATOM   564  C  CB  . TYR A  1 76  ? 17.952  30.701 31.640  1.00 9.54  ? 99   TYR A CB  1 
ATOM   565  C  CG  . TYR A  1 76  ? 16.975  29.639 31.192  1.00 8.07  ? 99   TYR A CG  1 
ATOM   566  C  CD1 . TYR A  1 76  ? 17.410  28.500 30.502  1.00 7.92  ? 99   TYR A CD1 1 
ATOM   567  C  CD2 . TYR A  1 76  ? 15.627  29.734 31.494  1.00 10.98 ? 99   TYR A CD2 1 
ATOM   568  C  CE1 . TYR A  1 76  ? 16.520  27.536 30.100  1.00 6.99  ? 99   TYR A CE1 1 
ATOM   569  C  CE2 . TYR A  1 76  ? 14.730  28.761 31.103  1.00 12.70 ? 99   TYR A CE2 1 
ATOM   570  C  CZ  . TYR A  1 76  ? 15.175  27.667 30.411  1.00 9.13  ? 99   TYR A CZ  1 
ATOM   571  O  OH  . TYR A  1 76  ? 14.265  26.699 30.046  1.00 14.92 ? 99   TYR A OH  1 
ATOM   572  N  N   . ASN A  1 77  ? 17.927  30.972 28.261  1.00 8.91  ? 100  ASN A N   1 
ATOM   573  C  CA  . ASN A  1 77  ? 17.152  31.256 27.057  1.00 11.04 ? 100  ASN A CA  1 
ATOM   574  C  C   . ASN A  1 77  ? 16.202  30.082 26.888  1.00 12.10 ? 100  ASN A C   1 
ATOM   575  O  O   . ASN A  1 77  ? 16.599  28.978 26.491  1.00 12.96 ? 100  ASN A O   1 
ATOM   576  C  CB  . ASN A  1 77  ? 18.102  31.390 25.869  1.00 13.49 ? 100  ASN A CB  1 
ATOM   577  C  CG  . ASN A  1 77  ? 17.386  31.750 24.569  1.00 13.75 ? 100  ASN A CG  1 
ATOM   578  O  OD1 . ASN A  1 77  ? 16.250  31.346 24.339  1.00 15.16 ? 100  ASN A OD1 1 
ATOM   579  N  ND2 . ASN A  1 77  ? 18.055  32.522 23.723  1.00 18.70 ? 100  ASN A ND2 1 
ATOM   580  N  N   . SER A  1 78  ? 14.943  30.294 27.219  1.00 10.97 ? 101  SER A N   1 
ATOM   581  C  CA  . SER A  1 78  ? 13.997  29.186 27.145  1.00 10.10 ? 101  SER A CA  1 
ATOM   582  C  C   . SER A  1 78  ? 13.657  28.806 25.699  1.00 13.86 ? 101  SER A C   1 
ATOM   583  O  O   . SER A  1 78  ? 13.061  27.755 25.450  1.00 14.93 ? 101  SER A O   1 
ATOM   584  C  CB  . SER A  1 78  ? 12.737  29.517 27.935  1.00 16.56 ? 101  SER A CB  1 
ATOM   585  O  OG  . SER A  1 78  ? 12.076  30.602 27.310  1.00 17.65 ? 101  SER A OG  1 
ATOM   586  N  N   . ASN A  1 79  ? 14.036  29.648 24.743  1.00 10.89 ? 102  ASN A N   1 
ATOM   587  C  CA  . ASN A  1 79  ? 13.772  29.300 23.343  1.00 13.57 ? 102  ASN A CA  1 
ATOM   588  C  C   . ASN A  1 79  ? 14.802  28.310 22.808  1.00 8.43  ? 102  ASN A C   1 
ATOM   589  O  O   . ASN A  1 79  ? 14.457  27.395 22.038  1.00 12.90 ? 102  ASN A O   1 
ATOM   590  C  CB  . ASN A  1 79  ? 13.734  30.552 22.455  1.00 14.62 ? 102  ASN A CB  1 
ATOM   591  C  CG  . ASN A  1 79  ? 12.577  31.484 22.799  1.00 19.42 ? 102  ASN A CG  1 
ATOM   592  O  OD1 . ASN A  1 79  ? 11.458  31.032 23.037  1.00 19.62 ? 102  ASN A OD1 1 
ATOM   593  N  ND2 . ASN A  1 79  ? 12.849  32.793 22.823  1.00 23.11 ? 102  ASN A ND2 1 
ATOM   594  N  N   . THR A  1 80  ? 16.066  28.505 23.184  1.00 9.98  ? 103  THR A N   1 
ATOM   595  C  CA  . THR A  1 80  ? 17.151  27.698 22.626  1.00 9.53  ? 103  THR A CA  1 
ATOM   596  C  C   . THR A  1 80  ? 17.680  26.706 23.655  1.00 11.72 ? 103  THR A C   1 
ATOM   597  O  O   . THR A  1 80  ? 18.471  25.821 23.301  1.00 12.51 ? 103  THR A O   1 
ATOM   598  C  CB  . THR A  1 80  ? 18.344  28.567 22.214  1.00 13.46 ? 103  THR A CB  1 
ATOM   599  O  OG1 . THR A  1 80  ? 18.796  29.280 23.373  1.00 12.03 ? 103  THR A OG1 1 
ATOM   600  C  CG2 . THR A  1 80  ? 17.933  29.558 21.094  1.00 13.78 ? 103  THR A CG2 1 
ATOM   601  N  N   . LEU A  1 81  ? 17.244  26.871 24.909  1.00 9.91  ? 104  LEU A N   1 
ATOM   602  C  CA  . LEU A  1 81  ? 17.691  26.093 26.074  1.00 9.96  ? 104  LEU A CA  1 
ATOM   603  C  C   . LEU A  1 81  ? 19.148  26.348 26.479  1.00 9.16  ? 104  LEU A C   1 
ATOM   604  O  O   . LEU A  1 81  ? 19.739  25.637 27.319  1.00 10.46 ? 104  LEU A O   1 
ATOM   605  C  CB  . LEU A  1 81  ? 17.401  24.601 25.891  1.00 9.03  ? 104  LEU A CB  1 
ATOM   606  C  CG  . LEU A  1 81  ? 15.924  24.278 25.706  1.00 11.59 ? 104  LEU A CG  1 
ATOM   607  C  CD1 . LEU A  1 81  ? 15.742  22.783 25.687  1.00 13.46 ? 104  LEU A CD1 1 
ATOM   608  C  CD2 . LEU A  1 81  ? 15.054  24.925 26.811  1.00 14.99 ? 104  LEU A CD2 1 
ATOM   609  N  N   . ASN A  1 82  ? 19.726  27.401 25.915  1.00 10.22 ? 105  ASN A N   1 
ATOM   610  C  CA  . ASN A  1 82  ? 21.052  27.832 26.316  1.00 11.73 ? 105  ASN A CA  1 
ATOM   611  C  C   . ASN A  1 82  ? 21.071  28.302 27.779  1.00 7.57  ? 105  ASN A C   1 
ATOM   612  O  O   . ASN A  1 82  ? 20.123  28.938 28.254  1.00 10.20 ? 105  ASN A O   1 
ATOM   613  C  CB  . ASN A  1 82  ? 21.526  28.970 25.400  1.00 11.08 ? 105  ASN A CB  1 
ATOM   614  C  CG  . ASN A  1 82  ? 23.033  29.149 25.428  1.00 11.10 ? 105  ASN A CG  1 
ATOM   615  O  OD1 . ASN A  1 82  ? 23.777  28.171 25.570  1.00 11.89 ? 105  ASN A OD1 1 
ATOM   616  N  ND2 . ASN A  1 82  ? 23.494  30.391 25.264  1.00 16.48 ? 105  ASN A ND2 1 
ATOM   617  N  N   . ASN A  1 83  ? 22.132  27.944 28.490  1.00 8.66  ? 106  ASN A N   1 
ATOM   618  C  CA  . ASN A  1 83  ? 22.305  28.348 29.903  1.00 8.55  ? 106  ASN A CA  1 
ATOM   619  C  C   . ASN A  1 83  ? 21.238  27.728 30.816  1.00 7.83  ? 106  ASN A C   1 
ATOM   620  O  O   . ASN A  1 83  ? 20.713  28.388 31.712  1.00 10.16 ? 106  ASN A O   1 
ATOM   621  C  CB  . ASN A  1 83  ? 22.358  29.886 30.075  1.00 9.08  ? 106  ASN A CB  1 
ATOM   622  C  CG  . ASN A  1 83  ? 23.388  30.543 29.172  1.00 11.86 ? 106  ASN A CG  1 
ATOM   623  O  OD1 . ASN A  1 83  ? 24.584  30.204 29.208  1.00 14.65 ? 106  ASN A OD1 1 
ATOM   624  N  ND2 . ASN A  1 83  ? 22.922  31.452 28.312  1.00 14.68 ? 106  ASN A ND2 1 
ATOM   625  N  N   . ASP A  1 84  ? 20.958  26.436 30.596  1.00 8.17  ? 107  ASP A N   1 
ATOM   626  C  CA  . ASP A  1 84  ? 19.897  25.727 31.308  1.00 7.82  ? 107  ASP A CA  1 
ATOM   627  C  C   . ASP A  1 84  ? 20.440  25.192 32.619  1.00 9.90  ? 107  ASP A C   1 
ATOM   628  O  O   . ASP A  1 84  ? 20.714  23.980 32.794  1.00 8.40  ? 107  ASP A O   1 
ATOM   629  C  CB  . ASP A  1 84  ? 19.331  24.585 30.442  1.00 7.39  ? 107  ASP A CB  1 
ATOM   630  C  CG  . ASP A  1 84  ? 18.079  23.945 31.038  1.00 8.53  ? 107  ASP A CG  1 
ATOM   631  O  OD1 . ASP A  1 84  ? 17.483  24.509 31.984  1.00 7.66  ? 107  ASP A OD1 1 
ATOM   632  O  OD2 . ASP A  1 84  ? 17.710  22.835 30.576  1.00 8.86  ? 107  ASP A OD2 1 
ATOM   633  N  N   . ILE A  1 85  ? 20.568  26.114 33.559  1.00 6.98  ? 108  ILE A N   1 
ATOM   634  C  CA  . ILE A  1 85  ? 21.149  25.813 34.863  1.00 6.91  ? 108  ILE A CA  1 
ATOM   635  C  C   . ILE A  1 85  ? 20.544  26.702 35.936  1.00 7.84  ? 108  ILE A C   1 
ATOM   636  O  O   . ILE A  1 85  ? 20.282  27.886 35.701  1.00 7.58  ? 108  ILE A O   1 
ATOM   637  C  CB  . ILE A  1 85  ? 22.718  25.914 34.841  1.00 7.28  ? 108  ILE A CB  1 
ATOM   638  C  CG1 . ILE A  1 85  ? 23.310  25.434 36.156  1.00 6.99  ? 108  ILE A CG1 1 
ATOM   639  C  CG2 . ILE A  1 85  ? 23.183  27.340 34.522  1.00 7.65  ? 108  ILE A CG2 1 
ATOM   640  C  CD1 . ILE A  1 85  ? 24.845  25.323 36.146  1.00 9.35  ? 108  ILE A CD1 1 
ATOM   641  N  N   . MET A  1 86  ? 20.315  26.113 37.105  1.00 7.91  ? 109  MET A N   1 
ATOM   642  C  CA  . MET A  1 86  ? 19.780  26.820 38.262  1.00 7.30  ? 109  MET A CA  1 
ATOM   643  C  C   . MET A  1 86  ? 20.502  26.381 39.529  1.00 10.01 ? 109  MET A C   1 
ATOM   644  O  O   . MET A  1 86  ? 20.929  25.227 39.645  1.00 6.43  ? 109  MET A O   1 
ATOM   645  C  CB  . MET A  1 86  ? 18.269  26.530 38.372  1.00 6.73  ? 109  MET A CB  1 
ATOM   646  C  CG  . MET A  1 86  ? 17.629  26.852 39.704  1.00 11.67 ? 109  MET A CG  1 
ATOM   647  S  SD  . MET A  1 86  ? 15.838  26.525 39.544  1.00 13.37 ? 109  MET A SD  1 
ATOM   648  C  CE  . MET A  1 86  ? 15.747  24.740 39.588  1.00 10.59 ? 109  MET A CE  1 
ATOM   649  N  N   . LEU A  1 87  ? 20.661  27.312 40.462  1.00 7.67  ? 110  LEU A N   1 
ATOM   650  C  CA  . LEU A  1 87  ? 21.146  26.985 41.801  1.00 8.48  ? 110  LEU A CA  1 
ATOM   651  C  C   . LEU A  1 87  ? 20.029  27.116 42.830  1.00 7.89  ? 110  LEU A C   1 
ATOM   652  O  O   . LEU A  1 87  ? 19.273  28.093 42.834  1.00 9.81  ? 110  LEU A O   1 
ATOM   653  C  CB  . LEU A  1 87  ? 22.314  27.896 42.177  1.00 9.05  ? 110  LEU A CB  1 
ATOM   654  C  CG  . LEU A  1 87  ? 23.663  27.490 41.572  1.00 12.32 ? 110  LEU A CG  1 
ATOM   655  C  CD1 . LEU A  1 87  ? 24.664  28.645 41.681  1.00 12.68 ? 110  LEU A CD1 1 
ATOM   656  C  CD2 . LEU A  1 87  ? 24.198  26.234 42.272  1.00 11.55 ? 110  LEU A CD2 1 
ATOM   657  N  N   . ILE A  1 88  ? 19.931  26.124 43.705  1.00 6.94  ? 111  ILE A N   1 
ATOM   658  C  CA  . ILE A  1 88  ? 18.976  26.150 44.792  1.00 8.63  ? 111  ILE A CA  1 
ATOM   659  C  C   . ILE A  1 88  ? 19.728  26.170 46.110  1.00 7.13  ? 111  ILE A C   1 
ATOM   660  O  O   . ILE A  1 88  ? 20.625  25.335 46.345  1.00 10.69 ? 111  ILE A O   1 
ATOM   661  C  CB  . ILE A  1 88  ? 18.091  24.884 44.773  1.00 9.14  ? 111  ILE A CB  1 
ATOM   662  C  CG1 . ILE A  1 88  ? 17.162  24.902 43.538  1.00 10.80 ? 111  ILE A CG1 1 
ATOM   663  C  CG2 . ILE A  1 88  ? 17.285  24.787 46.078  1.00 13.79 ? 111  ILE A CG2 1 
ATOM   664  C  CD1 . ILE A  1 88  ? 16.431  23.567 43.302  1.00 17.74 ? 111  ILE A CD1 1 
ATOM   665  N  N   . LYS A  1 89  ? 19.370  27.121 46.973  1.00 6.59  ? 112  LYS A N   1 
ATOM   666  C  CA  . LYS A  1 89  ? 19.943  27.190 48.332  1.00 6.95  ? 112  LYS A CA  1 
ATOM   667  C  C   . LYS A  1 89  ? 19.004  26.485 49.278  1.00 10.38 ? 112  LYS A C   1 
ATOM   668  O  O   . LYS A  1 89  ? 17.787  26.688 49.197  1.00 12.17 ? 112  LYS A O   1 
ATOM   669  C  CB  . LYS A  1 89  ? 20.127  28.642 48.799  1.00 10.58 ? 112  LYS A CB  1 
ATOM   670  C  CG  . LYS A  1 89  ? 20.977  28.703 50.073  1.00 11.37 ? 112  LYS A CG  1 
ATOM   671  C  CD  . LYS A  1 89  ? 21.069  30.119 50.651  1.00 19.20 ? 112  LYS A CD  1 
ATOM   672  C  CE  . LYS A  1 89  ? 22.221  30.194 51.629  1.00 21.39 ? 112  LYS A CE  1 
ATOM   673  N  NZ  . LYS A  1 89  ? 22.210  31.502 52.382  1.00 23.48 ? 112  LYS A NZ  1 
ATOM   674  N  N   . LEU A  1 90  ? 19.554  25.636 50.145  1.00 10.98 ? 113  LEU A N   1 
ATOM   675  C  CA  . LEU A  1 90  ? 18.756  24.986 51.195  1.00 9.20  ? 113  LEU A CA  1 
ATOM   676  C  C   . LEU A  1 90  ? 18.490  25.934 52.369  1.00 13.24 ? 113  LEU A C   1 
ATOM   677  O  O   . LEU A  1 90  ? 19.350  26.735 52.731  1.00 12.59 ? 113  LEU A O   1 
ATOM   678  C  CB  . LEU A  1 90  ? 19.465  23.721 51.718  1.00 9.51  ? 113  LEU A CB  1 
ATOM   679  C  CG  . LEU A  1 90  ? 19.815  22.752 50.600  1.00 12.89 ? 113  LEU A CG  1 
ATOM   680  C  CD1 . LEU A  1 90  ? 20.477  21.498 51.149  1.00 12.11 ? 113  LEU A CD1 1 
ATOM   681  C  CD2 . LEU A  1 90  ? 18.564  22.391 49.848  1.00 13.50 ? 113  LEU A CD2 1 
ATOM   682  N  N   . LYS A  1 91  ? 17.299  25.833 52.964  1.00 10.72 ? 114  LYS A N   1 
ATOM   683  C  CA  . LYS A  1 91  ? 16.929  26.695 54.095  1.00 12.53 ? 114  LYS A CA  1 
ATOM   684  C  C   . LYS A  1 91  ? 17.861  26.436 55.272  1.00 14.55 ? 114  LYS A C   1 
ATOM   685  O  O   . LYS A  1 91  ? 18.183  27.352 56.024  1.00 13.70 ? 114  LYS A O   1 
ATOM   686  C  CB  . LYS A  1 91  ? 15.478  26.422 54.502  1.00 13.66 ? 114  LYS A CB  1 
ATOM   687  C  CG  . LYS A  1 91  ? 14.926  27.335 55.605  1.00 18.74 ? 114  LYS A CG  1 
ATOM   688  C  CD  . LYS A  1 91  ? 13.479  26.956 55.890  1.00 28.34 ? 114  LYS A CD  1 
ATOM   689  C  CE  . LYS A  1 91  ? 12.948  27.640 57.147  1.00 38.51 ? 114  LYS A CE  1 
ATOM   690  N  NZ  . LYS A  1 91  ? 12.192  26.657 57.990  1.00 46.77 ? 114  LYS A NZ  1 
ATOM   691  N  N   . SER A  1 92  ? 18.306  25.189 55.418  1.00 11.95 ? 115  SER A N   1 
ATOM   692  C  CA  . SER A  1 92  ? 19.278  24.841 56.446  1.00 14.20 ? 115  SER A CA  1 
ATOM   693  C  C   . SER A  1 92  ? 20.269  23.881 55.826  1.00 15.84 ? 115  SER A C   1 
ATOM   694  O  O   . SER A  1 92  ? 19.943  23.192 54.862  1.00 12.38 ? 115  SER A O   1 
ATOM   695  C  CB  . SER A  1 92  ? 18.591  24.215 57.677  1.00 12.91 ? 115  SER A CB  1 
ATOM   696  O  OG  . SER A  1 92  ? 17.996  22.955 57.361  1.00 18.37 ? 115  SER A OG  1 
ATOM   697  N  N   . ALA A  1 93  ? 21.490  23.842 56.349  1.00 14.67 ? 116  ALA A N   1 
ATOM   698  C  CA  . ALA A  1 93  ? 22.509  22.978 55.765  1.00 12.70 ? 116  ALA A CA  1 
ATOM   699  C  C   . ALA A  1 93  ? 22.137  21.519 55.929  1.00 12.76 ? 116  ALA A C   1 
ATOM   700  O  O   . ALA A  1 93  ? 21.689  21.114 56.990  1.00 16.13 ? 116  ALA A O   1 
ATOM   701  C  CB  . ALA A  1 93  ? 23.844  23.217 56.439  1.00 13.08 ? 116  ALA A CB  1 
ATOM   702  N  N   . ALA A  1 94  ? 22.367  20.721 54.899  1.00 12.47 ? 117  ALA A N   1 
ATOM   703  C  CA  . ALA A  1 94  ? 22.230  19.281 55.047  1.00 14.69 ? 117  ALA A CA  1 
ATOM   704  C  C   . ALA A  1 94  ? 23.299  18.734 55.969  1.00 15.80 ? 117  ALA A C   1 
ATOM   705  O  O   . ALA A  1 94  ? 24.400  19.296 56.066  1.00 14.59 ? 117  ALA A O   1 
ATOM   706  C  CB  . ALA A  1 94  ? 22.324  18.607 53.711  1.00 10.88 ? 117  ALA A CB  1 
ATOM   707  N  N   . SER A  1 95  ? 22.985  17.621 56.626  1.00 15.72 ? 118  SER A N   1 
ATOM   708  C  CA  . SER A  1 95  ? 23.979  16.872 57.403  1.00 12.52 ? 118  SER A CA  1 
ATOM   709  C  C   . SER A  1 95  ? 24.722  15.936 56.481  1.00 11.94 ? 118  SER A C   1 
ATOM   710  O  O   . SER A  1 95  ? 24.154  14.975 55.965  1.00 19.81 ? 118  SER A O   1 
ATOM   711  C  CB  . SER A  1 95  ? 23.296  16.053 58.502  1.00 21.59 ? 118  SER A CB  1 
ATOM   712  O  OG  . SER A  1 95  ? 22.632  16.910 59.400  1.00 26.55 ? 118  SER A OG  1 
ATOM   713  N  N   . LEU A  1 96  ? 25.997  16.222 56.239  1.00 11.70 ? 119  LEU A N   1 
ATOM   714  C  CA  . LEU A  1 96  ? 26.760  15.388 55.325  1.00 10.03 ? 119  LEU A CA  1 
ATOM   715  C  C   . LEU A  1 96  ? 27.222  14.131 56.029  1.00 16.93 ? 119  LEU A C   1 
ATOM   716  O  O   . LEU A  1 96  ? 27.614  14.159 57.206  1.00 20.24 ? 119  LEU A O   1 
ATOM   717  C  CB  . LEU A  1 96  ? 27.947  16.173 54.763  1.00 14.29 ? 119  LEU A CB  1 
ATOM   718  C  CG  . LEU A  1 96  ? 27.511  17.463 54.060  1.00 14.99 ? 119  LEU A CG  1 
ATOM   719  C  CD1 . LEU A  1 96  ? 28.692  18.237 53.436  1.00 14.69 ? 119  LEU A CD1 1 
ATOM   720  C  CD2 . LEU A  1 96  ? 26.453  17.138 52.999  1.00 15.05 ? 119  LEU A CD2 1 
ATOM   721  N  N   . ASN A  1 97  ? 27.185  13.026 55.308  1.00 17.66 ? 120  ASN A N   1 
ATOM   722  C  CA  . ASN A  1 97  ? 27.568  11.736 55.854  1.00 23.63 ? 120  ASN A CA  1 
ATOM   723  C  C   . ASN A  1 97  ? 27.879  10.827 54.667  1.00 23.17 ? 120  ASN A C   1 
ATOM   724  O  O   . ASN A  1 97  ? 27.975  11.312 53.543  1.00 19.45 ? 120  ASN A O   1 
ATOM   725  C  CB  . ASN A  1 97  ? 26.458  11.172 56.750  1.00 20.96 ? 120  ASN A CB  1 
ATOM   726  C  CG  . ASN A  1 97  ? 25.120  11.029 56.018  1.00 23.95 ? 120  ASN A CG  1 
ATOM   727  O  OD1 . ASN A  1 97  ? 25.033  10.348 55.003  1.00 21.72 ? 120  ASN A OD1 1 
ATOM   728  N  ND2 . ASN A  1 97  ? 24.067  11.642 56.560  1.00 19.81 ? 120  ASN A ND2 1 
ATOM   729  N  N   . SER A  1 98  ? 28.052  9.528  54.879  1.00 16.36 ? 121  SER A N   1 
ATOM   730  C  CA  . SER A  1 98  ? 28.444  8.676  53.753  1.00 18.19 ? 121  SER A CA  1 
ATOM   731  C  C   . SER A  1 98  ? 27.353  8.595  52.688  1.00 16.17 ? 121  SER A C   1 
ATOM   732  O  O   . SER A  1 98  ? 27.620  8.264  51.523  1.00 18.66 ? 121  SER A O   1 
ATOM   733  C  CB  . SER A  1 98  ? 28.804  7.254  54.206  1.00 24.33 ? 121  SER A CB  1 
ATOM   734  O  OG  . SER A  1 98  ? 27.654  6.557  54.672  1.00 24.74 ? 121  SER A OG  1 
ATOM   735  N  N   . ARG A  1 99  ? 26.116  8.852  53.084  1.00 17.08 ? 122  ARG A N   1 
ATOM   736  C  CA  . ARG A  1 99  ? 24.993  8.656  52.163  1.00 16.15 ? 122  ARG A CA  1 
ATOM   737  C  C   . ARG A  1 99  ? 24.471  9.964  51.589  1.00 14.39 ? 122  ARG A C   1 
ATOM   738  O  O   . ARG A  1 99  ? 23.651  9.962  50.678  1.00 15.99 ? 122  ARG A O   1 
ATOM   739  C  CB  . ARG A  1 99  ? 23.862  7.896  52.859  1.00 16.04 ? 122  ARG A CB  1 
ATOM   740  C  CG  . ARG A  1 99  ? 24.219  6.450  53.236  1.00 15.87 ? 122  ARG A CG  1 
ATOM   741  C  CD  . ARG A  1 99  ? 23.044  5.757  53.916  1.00 23.88 ? 122  ARG A CD  1 
ATOM   742  N  NE  . ARG A  1 99  ? 23.359  4.427  54.440  1.00 28.80 ? 122  ARG A NE  1 
ATOM   743  C  CZ  . ARG A  1 99  ? 23.103  3.275  53.816  1.00 32.93 ? 122  ARG A CZ  1 
ATOM   744  N  NH1 . ARG A  1 99  ? 22.533  3.254  52.611  1.00 23.20 ? 122  ARG A NH1 1 
ATOM   745  N  NH2 . ARG A  1 99  ? 23.428  2.126  54.403  1.00 42.70 ? 122  ARG A NH2 1 
ATOM   746  N  N   . VAL A  1 100 ? 24.935  11.078 52.144  1.00 15.14 ? 123  VAL A N   1 
ATOM   747  C  CA  . VAL A  1 100 ? 24.560  12.392 51.670  1.00 11.77 ? 123  VAL A CA  1 
ATOM   748  C  C   . VAL A  1 100 ? 25.866  13.183 51.553  1.00 13.79 ? 123  VAL A C   1 
ATOM   749  O  O   . VAL A  1 100 ? 26.482  13.575 52.548  1.00 13.31 ? 123  VAL A O   1 
ATOM   750  C  CB  . VAL A  1 100 ? 23.518  13.087 52.600  1.00 12.28 ? 123  VAL A CB  1 
ATOM   751  C  CG1 . VAL A  1 100 ? 23.296  14.542 52.201  1.00 10.68 ? 123  VAL A CG1 1 
ATOM   752  C  CG2 . VAL A  1 100 ? 22.182  12.337 52.578  1.00 12.85 ? 123  VAL A CG2 1 
ATOM   753  N  N   . ALA A  1 101 ? 26.305  13.399 50.319  1.00 10.47 ? 124  ALA A N   1 
ATOM   754  C  CA  . ALA A  1 101 ? 27.647  13.943 50.120  1.00 8.84  ? 124  ALA A CA  1 
ATOM   755  C  C   . ALA A  1 101 ? 27.649  14.846 48.909  1.00 8.36  ? 124  ALA A C   1 
ATOM   756  O  O   . ALA A  1 101 ? 26.847  14.659 48.004  1.00 10.00 ? 124  ALA A O   1 
ATOM   757  C  CB  . ALA A  1 101 ? 28.627  12.817 49.923  1.00 13.06 ? 124  ALA A CB  1 
ATOM   758  N  N   . SER A  1 102 ? 28.507  15.849 48.914  1.00 12.85 ? 125  SER A N   1 
ATOM   759  C  CA  . SER A  1 102 ? 28.568  16.758 47.774  1.00 9.09  ? 125  SER A CA  1 
ATOM   760  C  C   . SER A  1 102 ? 29.429  16.184 46.659  1.00 10.36 ? 125  SER A C   1 
ATOM   761  O  O   . SER A  1 102 ? 30.235  15.271 46.874  1.00 13.12 ? 125  SER A O   1 
ATOM   762  C  CB  . SER A  1 102 ? 29.070  18.137 48.194  1.00 12.71 ? 125  SER A CB  1 
ATOM   763  O  OG  . SER A  1 102 ? 30.353  18.006 48.775  1.00 14.56 ? 125  SER A OG  1 
ATOM   764  N  N   . ILE A  1 103 ? 29.206  16.679 45.446  1.00 6.69  ? 126  ILE A N   1 
ATOM   765  C  CA  . ILE A  1 103 ? 30.028  16.307 44.284  1.00 9.56  ? 126  ILE A CA  1 
ATOM   766  C  C   . ILE A  1 103 ? 30.862  17.532 43.887  1.00 8.55  ? 126  ILE A C   1 
ATOM   767  O  O   . ILE A  1 103 ? 30.383  18.672 43.914  1.00 10.15 ? 126  ILE A O   1 
ATOM   768  C  CB  . ILE A  1 103 ? 29.162  15.833 43.082  1.00 11.00 ? 126  ILE A CB  1 
ATOM   769  C  CG1 . ILE A  1 103 ? 30.054  15.331 41.936  1.00 11.15 ? 126  ILE A CG1 1 
ATOM   770  C  CG2 . ILE A  1 103 ? 28.236  16.952 42.581  1.00 7.90  ? 126  ILE A CG2 1 
ATOM   771  C  CD1 . ILE A  1 103 ? 30.654  13.932 42.185  1.00 11.86 ? 126  ILE A CD1 1 
ATOM   772  N  N   . SER A  1 104 ? 32.125  17.306 43.549  1.00 11.74 ? 127  SER A N   1 
ATOM   773  C  CA  . SER A  1 104 ? 33.003  18.396 43.145  1.00 10.08 ? 127  SER A CA  1 
ATOM   774  C  C   . SER A  1 104 ? 32.603  19.040 41.820  1.00 8.81  ? 127  SER A C   1 
ATOM   775  O  O   . SER A  1 104 ? 32.190  18.344 40.893  1.00 11.15 ? 127  SER A O   1 
ATOM   776  C  CB  . SER A  1 104 ? 34.432  17.865 42.998  1.00 11.11 ? 127  SER A CB  1 
ATOM   777  O  OG  . SER A  1 104 ? 34.902  17.376 44.234  1.00 15.61 ? 127  SER A OG  1 
ATOM   778  N  N   . LEU A  1 105 ? 32.776  20.362 41.728  1.00 6.88  ? 128  LEU A N   1 
ATOM   779  C  CA  . LEU A  1 105 ? 32.672  21.057 40.451  1.00 10.22 ? 128  LEU A CA  1 
ATOM   780  C  C   . LEU A  1 105 ? 33.892  20.745 39.576  1.00 11.31 ? 128  LEU A C   1 
ATOM   781  O  O   . LEU A  1 105 ? 34.972  20.446 40.104  1.00 14.62 ? 128  LEU A O   1 
ATOM   782  C  CB  . LEU A  1 105 ? 32.563  22.562 40.694  1.00 12.34 ? 128  LEU A CB  1 
ATOM   783  C  CG  . LEU A  1 105 ? 31.272  22.992 41.387  1.00 12.60 ? 128  LEU A CG  1 
ATOM   784  C  CD1 . LEU A  1 105 ? 31.232  24.515 41.577  1.00 16.70 ? 128  LEU A CD1 1 
ATOM   785  C  CD2 . LEU A  1 105 ? 30.050  22.506 40.671  1.00 13.66 ? 128  LEU A CD2 1 
ATOM   786  N  N   . PRO A  1 106 ? 33.725  20.789 38.245  1.00 10.58 ? 129  PRO A N   1 
ATOM   787  C  CA  . PRO A  1 106 ? 34.841  20.497 37.323  1.00 9.67  ? 129  PRO A CA  1 
ATOM   788  C  C   . PRO A  1 106 ? 35.924  21.573 37.368  1.00 12.99 ? 129  PRO A C   1 
ATOM   789  O  O   . PRO A  1 106 ? 35.640  22.741 37.640  1.00 10.66 ? 129  PRO A O   1 
ATOM   790  C  CB  . PRO A  1 106 ? 34.167  20.462 35.948  1.00 14.06 ? 129  PRO A CB  1 
ATOM   791  C  CG  . PRO A  1 106 ? 32.977  21.298 36.098  1.00 16.14 ? 129  PRO A CG  1 
ATOM   792  C  CD  . PRO A  1 106 ? 32.498  21.126 37.516  1.00 8.69  ? 129  PRO A CD  1 
ATOM   793  N  N   . THR A  1 107 ? 37.170  21.168 37.119  1.00 12.68 ? 130  THR A N   1 
ATOM   794  C  CA  . THR A  1 107 ? 38.253  22.143 36.995  1.00 13.83 ? 130  THR A CA  1 
ATOM   795  C  C   . THR A  1 107 ? 38.593  22.407 35.519  1.00 14.43 ? 130  THR A C   1 
ATOM   796  O  O   . THR A  1 107 ? 39.349  23.341 35.190  1.00 12.81 ? 130  THR A O   1 
ATOM   797  C  CB  . THR A  1 107 ? 39.494  21.657 37.708  1.00 16.93 ? 130  THR A CB  1 
ATOM   798  O  OG1 . THR A  1 107 ? 39.788  20.334 37.259  1.00 13.19 ? 130  THR A OG1 1 
ATOM   799  C  CG2 . THR A  1 107 ? 39.266  21.660 39.227  1.00 16.79 ? 130  THR A CG2 1 
ATOM   800  N  N   . SER A  1 108 ? 38.033  21.586 34.643  1.00 11.16 ? 131  SER A N   1 
ATOM   801  C  CA  . SER A  1 108 ? 38.129  21.773 33.201  1.00 12.27 ? 131  SER A CA  1 
ATOM   802  C  C   . SER A  1 108 ? 36.956  21.066 32.536  1.00 15.86 ? 131  SER A C   1 
ATOM   803  O  O   . SER A  1 108 ? 36.235  20.280 33.183  1.00 15.94 ? 131  SER A O   1 
ATOM   804  C  CB  . SER A  1 108 ? 39.415  21.152 32.671  1.00 13.93 ? 131  SER A CB  1 
ATOM   805  O  OG  . SER A  1 108 ? 39.365  19.742 32.859  1.00 17.58 ? 131  SER A OG  1 
ATOM   806  N  N   . CYS A  1 109 ? 36.770  21.334 31.249  1.00 12.90 ? 132  CYS A N   1 
ATOM   807  C  CA  . CYS A  1 109 ? 35.730  20.653 30.478  1.00 16.52 ? 132  CYS A CA  1 
ATOM   808  C  C   . CYS A  1 109 ? 36.201  19.240 30.141  1.00 22.37 ? 132  CYS A C   1 
ATOM   809  O  O   . CYS A  1 109 ? 37.401  18.994 29.994  1.00 25.41 ? 132  CYS A O   1 
ATOM   810  C  CB  . CYS A  1 109 ? 35.371  21.463 29.229  1.00 16.36 ? 132  CYS A CB  1 
ATOM   811  S  SG  . CYS A  1 109 ? 34.721  23.126 29.623  1.00 20.21 ? 132  CYS A SG  1 
ATOM   812  N  N   . ALA A  1 110 ? 35.271  18.299 30.053  1.00 13.74 ? 133  ALA A N   1 
ATOM   813  C  CA  . ALA A  1 110 ? 35.638  16.927 29.737  1.00 13.05 ? 133  ALA A CA  1 
ATOM   814  C  C   . ALA A  1 110 ? 35.779  16.739 28.231  1.00 20.02 ? 133  ALA A C   1 
ATOM   815  O  O   . ALA A  1 110 ? 35.131  17.434 27.439  1.00 21.99 ? 133  ALA A O   1 
ATOM   816  C  CB  . ALA A  1 110 ? 34.621  15.965 30.288  1.00 16.05 ? 133  ALA A CB  1 
ATOM   817  N  N   . SER A  1 111 ? 36.638  15.808 27.834  1.00 23.29 ? 134  SER A N   1 
ATOM   818  C  CA  . SER A  1 111 ? 36.801  15.517 26.417  1.00 19.03 ? 134  SER A CA  1 
ATOM   819  C  C   . SER A  1 111 ? 35.808  14.471 25.920  1.00 20.85 ? 134  SER A C   1 
ATOM   820  O  O   . SER A  1 111 ? 35.276  13.667 26.693  1.00 18.58 ? 134  SER A O   1 
ATOM   821  C  CB  . SER A  1 111 ? 38.233  15.060 26.123  1.00 24.96 ? 134  SER A CB  1 
ATOM   822  O  OG  . SER A  1 111 ? 38.526  13.876 26.833  1.00 29.45 ? 134  SER A OG  1 
ATOM   823  N  N   . ALA A  1 112 ? 35.557  14.498 24.613  1.00 15.41 ? 135  ALA A N   1 
ATOM   824  C  CA  . ALA A  1 112 ? 34.742  13.478 23.974  1.00 16.33 ? 135  ALA A CA  1 
ATOM   825  C  C   . ALA A  1 112 ? 35.303  12.099 24.301  1.00 17.39 ? 135  ALA A C   1 
ATOM   826  O  O   . ALA A  1 112 ? 36.532  11.907 24.369  1.00 17.69 ? 135  ALA A O   1 
ATOM   827  C  CB  . ALA A  1 112 ? 34.725  13.702 22.466  1.00 19.42 ? 135  ALA A CB  1 
ATOM   828  N  N   . GLY A  1 113 ? 34.406  11.145 24.514  1.00 13.19 ? 136  GLY A N   1 
ATOM   829  C  CA  . GLY A  1 113 ? 34.793  9.799  24.878  1.00 16.24 ? 136  GLY A CA  1 
ATOM   830  C  C   . GLY A  1 113 ? 34.873  9.548  26.374  1.00 16.61 ? 136  GLY A C   1 
ATOM   831  O  O   . GLY A  1 113 ? 34.913  8.399  26.796  1.00 20.05 ? 136  GLY A O   1 
ATOM   832  N  N   . THR A  1 114 ? 34.917  10.615 27.171  1.00 15.50 ? 137  THR A N   1 
ATOM   833  C  CA  . THR A  1 114 ? 34.944  10.489 28.629  1.00 14.50 ? 137  THR A CA  1 
ATOM   834  C  C   . THR A  1 114 ? 33.688  9.763  29.079  1.00 18.20 ? 137  THR A C   1 
ATOM   835  O  O   . THR A  1 114 ? 32.578  10.099 28.626  1.00 13.13 ? 137  THR A O   1 
ATOM   836  C  CB  . THR A  1 114 ? 34.997  11.868 29.325  1.00 16.40 ? 137  THR A CB  1 
ATOM   837  O  OG1 . THR A  1 114 ? 36.199  12.562 28.979  1.00 21.47 ? 137  THR A OG1 1 
ATOM   838  C  CG2 . THR A  1 114 ? 34.925  11.719 30.861  1.00 17.27 ? 137  THR A CG2 1 
ATOM   839  N  N   . GLN A  1 115 ? 33.842  8.747  29.935  1.00 12.66 ? 138  GLN A N   1 
ATOM   840  C  CA  . GLN A  1 115 ? 32.694  7.987  30.415  1.00 16.19 ? 138  GLN A CA  1 
ATOM   841  C  C   . GLN A  1 115 ? 32.100  8.613  31.675  1.00 15.17 ? 138  GLN A C   1 
ATOM   842  O  O   . GLN A  1 115 ? 32.814  9.095  32.548  1.00 15.77 ? 138  GLN A O   1 
ATOM   843  C  CB  . GLN A  1 115 ? 33.051  6.508  30.645  1.00 19.06 ? 138  GLN A CB  1 
ATOM   844  C  CG  . GLN A  1 115 ? 32.835  5.661  29.397  1.00 27.05 ? 138  GLN A CG  1 
ATOM   845  C  CD  . GLN A  1 115 ? 31.472  5.012  29.374  1.00 26.77 ? 138  GLN A CD  1 
ATOM   846  O  OE1 . GLN A  1 115 ? 30.998  4.507  30.394  1.00 36.58 ? 138  GLN A OE1 1 
ATOM   847  N  NE2 . GLN A  1 115 ? 30.843  4.990  28.206  1.00 30.89 ? 138  GLN A NE2 1 
ATOM   848  N  N   . CYS A  1 116 ? 30.775  8.661  31.733  1.00 11.63 ? 139  CYS A N   1 
ATOM   849  C  CA  . CYS A  1 116 ? 30.127  9.392  32.816  1.00 13.45 ? 139  CYS A CA  1 
ATOM   850  C  C   . CYS A  1 116 ? 28.987  8.586  33.423  1.00 9.83  ? 139  CYS A C   1 
ATOM   851  O  O   . CYS A  1 116 ? 28.492  7.641  32.805  1.00 14.68 ? 139  CYS A O   1 
ATOM   852  C  CB  . CYS A  1 116 ? 29.559  10.699 32.284  1.00 14.15 ? 139  CYS A CB  1 
ATOM   853  S  SG  . CYS A  1 116 ? 30.749  11.768 31.464  1.00 15.58 ? 139  CYS A SG  1 
ATOM   854  N  N   . LEU A  1 117 ? 28.570  8.980  34.631  1.00 10.73 ? 140  LEU A N   1 
ATOM   855  C  CA  . LEU A  1 117 ? 27.436  8.367  35.315  1.00 7.24  ? 140  LEU A CA  1 
ATOM   856  C  C   . LEU A  1 117 ? 26.264  9.338  35.314  1.00 7.09  ? 140  LEU A C   1 
ATOM   857  O  O   . LEU A  1 117 ? 26.382  10.460 35.814  1.00 9.30  ? 140  LEU A O   1 
ATOM   858  C  CB  . LEU A  1 117 ? 27.812  8.044  36.762  1.00 11.65 ? 140  LEU A CB  1 
ATOM   859  C  CG  . LEU A  1 117 ? 26.685  7.520  37.658  1.00 10.80 ? 140  LEU A CG  1 
ATOM   860  C  CD1 . LEU A  1 117 ? 26.169  6.175  37.130  1.00 14.26 ? 140  LEU A CD1 1 
ATOM   861  C  CD2 . LEU A  1 117 ? 27.101  7.408  39.107  1.00 12.98 ? 140  LEU A CD2 1 
ATOM   862  N  N   . ILE A  1 118 ? 25.136  8.888  34.778  1.00 9.90  ? 141  ILE A N   1 
ATOM   863  C  CA  . ILE A  1 118 ? 23.912  9.703  34.738  1.00 7.45  ? 141  ILE A CA  1 
ATOM   864  C  C   . ILE A  1 118 ? 22.876  8.998  35.595  1.00 9.76  ? 141  ILE A C   1 
ATOM   865  O  O   . ILE A  1 118 ? 22.776  7.781  35.562  1.00 9.43  ? 141  ILE A O   1 
ATOM   866  C  CB  . ILE A  1 118 ? 23.430  9.781  33.285  1.00 8.91  ? 141  ILE A CB  1 
ATOM   867  C  CG1 . ILE A  1 118 ? 24.574  10.325 32.419  1.00 9.68  ? 141  ILE A CG1 1 
ATOM   868  C  CG2 . ILE A  1 118 ? 22.203  10.690 33.188  1.00 10.47 ? 141  ILE A CG2 1 
ATOM   869  C  CD1 . ILE A  1 118 ? 24.223  10.418 30.938  1.00 13.63 ? 141  ILE A CD1 1 
ATOM   870  N  N   . SER A  1 119 ? 22.107  9.739  36.397  1.00 5.82  ? 142  SER A N   1 
ATOM   871  C  CA  . SER A  1 119 ? 21.228  9.061  37.321  1.00 6.77  ? 142  SER A CA  1 
ATOM   872  C  C   . SER A  1 119 ? 19.917  9.812  37.496  1.00 8.24  ? 142  SER A C   1 
ATOM   873  O  O   . SER A  1 119 ? 19.841  11.028 37.277  1.00 7.09  ? 142  SER A O   1 
ATOM   874  C  CB  . SER A  1 119 ? 21.933  8.871  38.685  1.00 8.36  ? 142  SER A CB  1 
ATOM   875  O  OG  . SER A  1 119 ? 22.598  10.060 39.130  1.00 9.93  ? 142  SER A OG  1 
ATOM   876  N  N   . GLY A  1 120 ? 18.894  9.091  37.931  1.00 7.47  ? 143  GLY A N   1 
ATOM   877  C  CA  . GLY A  1 120 ? 17.637  9.763  38.225  1.00 8.44  ? 143  GLY A CA  1 
ATOM   878  C  C   . GLY A  1 120 ? 16.473  8.823  38.425  1.00 7.22  ? 143  GLY A C   1 
ATOM   879  O  O   . GLY A  1 120 ? 16.607  7.605  38.296  1.00 9.96  ? 143  GLY A O   1 
ATOM   880  N  N   . TRP A  1 121 ? 15.310  9.418  38.700  1.00 10.29 ? 144  TRP A N   1 
ATOM   881  C  CA  . TRP A  1 121 ? 14.072  8.682  38.960  1.00 8.53  ? 144  TRP A CA  1 
ATOM   882  C  C   . TRP A  1 121 ? 13.070  8.907  37.830  1.00 12.58 ? 144  TRP A C   1 
ATOM   883  O  O   . TRP A  1 121 ? 11.847  8.798  38.025  1.00 14.72 ? 144  TRP A O   1 
ATOM   884  C  CB  . TRP A  1 121 ? 13.461  9.149  40.296  1.00 8.38  ? 144  TRP A CB  1 
ATOM   885  C  CG  . TRP A  1 121 ? 14.169  8.679  41.520  1.00 9.51  ? 144  TRP A CG  1 
ATOM   886  C  CD1 . TRP A  1 121 ? 14.061  7.436  42.135  1.00 10.62 ? 144  TRP A CD1 1 
ATOM   887  C  CD2 . TRP A  1 121 ? 15.078  9.439  42.319  1.00 8.45  ? 144  TRP A CD2 1 
ATOM   888  N  NE1 . TRP A  1 121 ? 14.852  7.408  43.266  1.00 10.96 ? 144  TRP A NE1 1 
ATOM   889  C  CE2 . TRP A  1 121 ? 15.478  8.623  43.400  1.00 9.26  ? 144  TRP A CE2 1 
ATOM   890  C  CE3 . TRP A  1 121 ? 15.567  10.757 42.241  1.00 9.18  ? 144  TRP A CE3 1 
ATOM   891  C  CZ2 . TRP A  1 121 ? 16.382  9.067  44.384  1.00 8.29  ? 144  TRP A CZ2 1 
ATOM   892  C  CZ3 . TRP A  1 121 ? 16.444  11.203 43.225  1.00 9.26  ? 144  TRP A CZ3 1 
ATOM   893  C  CH2 . TRP A  1 121 ? 16.854  10.356 44.280  1.00 7.44  ? 144  TRP A CH2 1 
ATOM   894  N  N   . GLY A  1 122 ? 13.582  9.197  36.640  1.00 9.61  ? 145  GLY A N   1 
ATOM   895  C  CA  . GLY A  1 122 ? 12.723  9.444  35.488  1.00 9.90  ? 145  GLY A CA  1 
ATOM   896  C  C   . GLY A  1 122 ? 12.143  8.158  34.917  1.00 12.96 ? 145  GLY A C   1 
ATOM   897  O  O   . GLY A  1 122 ? 12.390  7.041  35.426  1.00 12.87 ? 145  GLY A O   1 
ATOM   898  N  N   . ASN A  1 123 ? 11.378  8.313  33.846  1.00 8.66  ? 146  ASN A N   1 
ATOM   899  C  CA  . ASN A  1 123 ? 10.773  7.182  33.135  1.00 10.97 ? 146  ASN A CA  1 
ATOM   900  C  C   . ASN A  1 123 ? 11.845  6.166  32.759  1.00 9.73  ? 146  ASN A C   1 
ATOM   901  O  O   . ASN A  1 123 ? 12.958  6.546  32.400  1.00 10.78 ? 146  ASN A O   1 
ATOM   902  C  CB  . ASN A  1 123 ? 10.105  7.674  31.856  1.00 13.80 ? 146  ASN A CB  1 
ATOM   903  C  CG  . ASN A  1 123 ? 8.704   8.232  32.083  1.00 14.90 ? 146  ASN A CG  1 
ATOM   904  O  OD1 . ASN A  1 123 ? 8.105   8.045  33.141  1.00 19.16 ? 146  ASN A OD1 1 
ATOM   905  N  ND2 . ASN A  1 123 ? 8.161   8.874  31.056  1.00 18.90 ? 146  ASN A ND2 1 
ATOM   906  N  N   . THR A  1 124 ? 11.503  4.879  32.838  1.00 11.89 ? 147  THR A N   1 
ATOM   907  C  CA  . THR A  1 124 ? 12.438  3.796  32.500  1.00 13.75 ? 147  THR A CA  1 
ATOM   908  C  C   . THR A  1 124 ? 12.071  3.148  31.172  1.00 18.54 ? 147  THR A C   1 
ATOM   909  O  O   . THR A  1 124 ? 12.714  2.188  30.720  1.00 18.11 ? 147  THR A O   1 
ATOM   910  C  CB  . THR A  1 124 ? 12.435  2.721  33.593  1.00 20.21 ? 147  THR A CB  1 
ATOM   911  O  OG1 . THR A  1 124 ? 11.092  2.256  33.791  1.00 20.30 ? 147  THR A OG1 1 
ATOM   912  C  CG2 . THR A  1 124 ? 12.957  3.302  34.916  1.00 15.94 ? 147  THR A CG2 1 
ATOM   913  N  N   . LYS A  1 125 ? 11.024  3.670  30.551  1.00 17.76 ? 148  LYS A N   1 
ATOM   914  C  CA  . LYS A  1 125 ? 10.637  3.220  29.226  1.00 22.36 ? 148  LYS A CA  1 
ATOM   915  C  C   . LYS A  1 125 ? 10.525  4.420  28.311  1.00 20.80 ? 148  LYS A C   1 
ATOM   916  O  O   . LYS A  1 125 ? 10.118  5.509  28.738  1.00 21.77 ? 148  LYS A O   1 
ATOM   917  C  CB  . LYS A  1 125 ? 9.308   2.463  29.286  1.00 18.03 ? 148  LYS A CB  1 
ATOM   918  C  CG  . LYS A  1 125 ? 9.371   1.217  30.147  1.00 26.96 ? 148  LYS A CG  1 
ATOM   919  C  CD  . LYS A  1 125 ? 8.089   0.986  30.941  1.00 38.95 ? 148  LYS A CD  1 
ATOM   920  C  CE  . LYS A  1 125 ? 6.865   0.936  30.047  1.00 35.54 ? 148  LYS A CE  1 
ATOM   921  N  NZ  . LYS A  1 125 ? 5.881   -0.094 30.486  1.00 37.84 ? 148  LYS A NZ  1 
ATOM   922  N  N   . SER A  1 126 ? 10.893  4.222  27.053  1.00 21.55 ? 149  SER A N   1 
ATOM   923  C  CA  . SER A  1 126 ? 10.906  5.309  26.075  1.00 26.86 ? 149  SER A CA  1 
ATOM   924  C  C   . SER A  1 126 ? 9.512   5.640  25.520  1.00 32.83 ? 149  SER A C   1 
ATOM   925  O  O   . SER A  1 126 ? 9.348   6.607  24.769  1.00 40.41 ? 149  SER A O   1 
ATOM   926  C  CB  . SER A  1 126 ? 11.872  4.969  24.938  1.00 26.43 ? 149  SER A CB  1 
ATOM   927  O  OG  . SER A  1 126 ? 11.657  3.649  24.459  1.00 30.80 ? 149  SER A OG  1 
ATOM   928  N  N   . SER A  1 127 ? 8.520   4.830  25.885  1.00 31.54 ? 150  SER A N   1 
ATOM   929  C  CA  . SER A  1 127 ? 7.116   5.109  25.571  1.00 28.68 ? 150  SER A CA  1 
ATOM   930  C  C   . SER A  1 127 ? 6.244   4.377  26.577  1.00 29.17 ? 150  SER A C   1 
ATOM   931  O  O   . SER A  1 127 ? 6.614   3.303  27.055  1.00 34.51 ? 150  SER A O   1 
ATOM   932  C  CB  . SER A  1 127 ? 6.760   4.643  24.159  1.00 37.29 ? 150  SER A CB  1 
ATOM   933  O  OG  . SER A  1 127 ? 6.767   3.227  24.083  1.00 40.72 ? 150  SER A OG  1 
ATOM   934  N  N   . GLY A  1 128 ? 5.091   4.955  26.898  1.00 24.51 ? 151  GLY A N   1 
ATOM   935  C  CA  . GLY A  1 128 ? 4.180   4.353  27.858  1.00 27.04 ? 151  GLY A CA  1 
ATOM   936  C  C   . GLY A  1 128 ? 4.456   4.757  29.302  1.00 24.79 ? 151  GLY A C   1 
ATOM   937  O  O   . GLY A  1 128 ? 5.264   5.640  29.576  1.00 24.92 ? 151  GLY A O   1 
ATOM   938  N  N   . THR A  1 129 ? 3.786   4.074  30.224  1.00 27.44 ? 152  THR A N   1 
ATOM   939  C  CA  . THR A  1 129 ? 3.812   4.409  31.650  1.00 32.81 ? 152  THR A CA  1 
ATOM   940  C  C   . THR A  1 129 ? 4.849   3.605  32.429  1.00 29.30 ? 152  THR A C   1 
ATOM   941  O  O   . THR A  1 129 ? 4.767   2.376  32.474  1.00 32.51 ? 152  THR A O   1 
ATOM   942  C  CB  . THR A  1 129 ? 2.440   4.121  32.296  1.00 32.00 ? 152  THR A CB  1 
ATOM   943  O  OG1 . THR A  1 129 ? 1.407   4.751  31.529  1.00 35.67 ? 152  THR A OG1 1 
ATOM   944  C  CG2 . THR A  1 129 ? 2.401   4.624  33.737  1.00 34.27 ? 152  THR A CG2 1 
ATOM   945  N  N   . SER A  1 130 ? 5.798   4.308  33.052  1.00 23.25 ? 153  SER A N   1 
ATOM   946  C  CA  . SER A  1 130 ? 6.829   3.697  33.906  1.00 30.01 ? 153  SER A CA  1 
ATOM   947  C  C   . SER A  1 130 ? 6.367   3.727  35.364  1.00 33.07 ? 153  SER A C   1 
ATOM   948  O  O   . SER A  1 130 ? 5.510   4.537  35.722  1.00 32.67 ? 153  SER A O   1 
ATOM   949  C  CB  . SER A  1 130 ? 8.158   4.473  33.798  1.00 26.01 ? 153  SER A CB  1 
ATOM   950  O  OG  . SER A  1 130 ? 8.639   4.510  32.472  1.00 32.73 ? 153  SER A OG  1 
ATOM   951  N  N   . TYR A  1 131 ? 6.937   2.858  36.200  1.00 28.03 ? 154  TYR A N   1 
ATOM   952  C  CA  . TYR A  1 131 ? 6.643   2.851  37.637  1.00 32.09 ? 154  TYR A CA  1 
ATOM   953  C  C   . TYR A  1 131 ? 7.926   2.835  38.479  1.00 29.93 ? 154  TYR A C   1 
ATOM   954  O  O   . TYR A  1 131 ? 8.132   1.895  39.268  1.00 33.62 ? 154  TYR A O   1 
ATOM   955  C  CB  . TYR A  1 131 ? 5.773   1.633  37.999  1.00 37.90 ? 154  TYR A CB  1 
ATOM   956  C  CG  . TYR A  1 131 ? 4.651   1.380  37.007  1.00 37.65 ? 154  TYR A CG  1 
ATOM   957  C  CD1 . TYR A  1 131 ? 4.864   0.599  35.866  1.00 31.65 ? 154  TYR A CD1 1 
ATOM   958  C  CD2 . TYR A  1 131 ? 3.387   1.937  37.199  1.00 39.25 ? 154  TYR A CD2 1 
ATOM   959  C  CE1 . TYR A  1 131 ? 3.850   0.380  34.951  1.00 35.34 ? 154  TYR A CE1 1 
ATOM   960  C  CE2 . TYR A  1 131 ? 2.361   1.723  36.285  1.00 34.37 ? 154  TYR A CE2 1 
ATOM   961  C  CZ  . TYR A  1 131 ? 2.601   0.941  35.161  1.00 37.42 ? 154  TYR A CZ  1 
ATOM   962  O  OH  . TYR A  1 131 ? 1.596   0.725  34.238  1.00 38.76 ? 154  TYR A OH  1 
ATOM   963  N  N   . PRO A  1 132 ? 8.784   3.866  38.334  1.00 21.01 ? 155  PRO A N   1 
ATOM   964  C  CA  . PRO A  1 132 ? 10.095  3.808  39.003  1.00 26.16 ? 155  PRO A CA  1 
ATOM   965  C  C   . PRO A  1 132 ? 9.965   3.872  40.529  1.00 24.80 ? 155  PRO A C   1 
ATOM   966  O  O   . PRO A  1 132 ? 8.955   4.363  41.048  1.00 30.66 ? 155  PRO A O   1 
ATOM   967  C  CB  . PRO A  1 132 ? 10.817  5.064  38.477  1.00 24.51 ? 155  PRO A CB  1 
ATOM   968  C  CG  . PRO A  1 132 ? 10.061  5.489  37.291  1.00 26.87 ? 155  PRO A CG  1 
ATOM   969  C  CD  . PRO A  1 132 ? 8.628   5.123  37.584  1.00 30.69 ? 155  PRO A CD  1 
ATOM   970  N  N   . ASP A  1 133 ? 10.946  3.341  41.249  1.00 21.83 ? 156  ASP A N   1 
ATOM   971  C  CA  . ASP A  1 133 ? 10.969  3.528  42.698  1.00 15.19 ? 156  ASP A CA  1 
ATOM   972  C  C   . ASP A  1 133 ? 12.380  3.838  43.174  1.00 14.29 ? 156  ASP A C   1 
ATOM   973  O  O   . ASP A  1 133 ? 12.631  4.911  43.733  1.00 15.40 ? 156  ASP A O   1 
ATOM   974  C  CB  . ASP A  1 133 ? 10.382  2.326  43.448  1.00 19.11 ? 156  ASP A CB  1 
ATOM   975  C  CG  . ASP A  1 133 ? 10.879  0.991  42.917  1.00 27.69 ? 156  ASP A CG  1 
ATOM   976  O  OD1 . ASP A  1 133 ? 11.996  0.929  42.361  1.00 28.17 ? 156  ASP A OD1 1 
ATOM   977  O  OD2 . ASP A  1 133 ? 10.146  -0.010 43.064  1.00 35.30 ? 156  ASP A OD2 1 
ATOM   978  N  N   . VAL A  1 134 ? 13.302  2.904  42.947  1.00 11.74 ? 157  VAL A N   1 
ATOM   979  C  CA  . VAL A  1 134 ? 14.701  3.134  43.314  1.00 12.24 ? 157  VAL A CA  1 
ATOM   980  C  C   . VAL A  1 134 ? 15.466  3.910  42.249  1.00 11.36 ? 157  VAL A C   1 
ATOM   981  O  O   . VAL A  1 134 ? 15.071  3.960  41.086  1.00 12.42 ? 157  VAL A O   1 
ATOM   982  C  CB  . VAL A  1 134 ? 15.425  1.828  43.663  1.00 13.21 ? 157  VAL A CB  1 
ATOM   983  C  CG1 . VAL A  1 134 ? 14.714  1.142  44.870  1.00 16.24 ? 157  VAL A CG1 1 
ATOM   984  C  CG2 . VAL A  1 134 ? 15.529  0.906  42.431  1.00 16.82 ? 157  VAL A CG2 1 
ATOM   985  N  N   . LEU A  1 135 ? 16.557  4.538  42.665  1.00 10.99 ? 158  LEU A N   1 
ATOM   986  C  CA  . LEU A  1 135 ? 17.323  5.396  41.771  1.00 9.00  ? 158  LEU A CA  1 
ATOM   987  C  C   . LEU A  1 135 ? 17.952  4.540  40.687  1.00 11.80 ? 158  LEU A C   1 
ATOM   988  O  O   . LEU A  1 135 ? 18.457  3.448  40.969  1.00 12.32 ? 158  LEU A O   1 
ATOM   989  C  CB  . LEU A  1 135 ? 18.432  6.093  42.568  1.00 10.66 ? 158  LEU A CB  1 
ATOM   990  C  CG  . LEU A  1 135 ? 19.217  7.175  41.820  1.00 9.20  ? 158  LEU A CG  1 
ATOM   991  C  CD1 . LEU A  1 135 ? 18.327  8.352  41.389  1.00 10.42 ? 158  LEU A CD1 1 
ATOM   992  C  CD2 . LEU A  1 135 ? 20.368  7.641  42.697  1.00 9.23  ? 158  LEU A CD2 1 
ATOM   993  N  N   . LYS A  1 136 ? 17.913  5.031  39.453  1.00 8.31  ? 159  LYS A N   1 
ATOM   994  C  CA  . LYS A  1 136 ? 18.545  4.335  38.326  1.00 12.74 ? 159  LYS A CA  1 
ATOM   995  C  C   . LYS A  1 136 ? 19.807  5.049  37.812  1.00 10.83 ? 159  LYS A C   1 
ATOM   996  O  O   . LYS A  1 136 ? 19.948  6.271  37.932  1.00 7.69  ? 159  LYS A O   1 
ATOM   997  C  CB  . LYS A  1 136 ? 17.535  4.131  37.197  1.00 9.08  ? 159  LYS A CB  1 
ATOM   998  C  CG  . LYS A  1 136 ? 16.344  3.258  37.588  1.00 9.03  ? 159  LYS A CG  1 
ATOM   999  C  CD  . LYS A  1 136 ? 16.792  1.769  37.594  1.00 16.04 ? 159  LYS A CD  1 
ATOM   1000 C  CE  . LYS A  1 136 ? 15.635  0.805  37.897  1.00 25.53 ? 159  LYS A CE  1 
ATOM   1001 N  NZ  . LYS A  1 136 ? 16.097  -0.630 37.823  1.00 25.78 ? 159  LYS A NZ  1 
ATOM   1002 N  N   . CYS A  1 137 ? 20.716  4.265  37.246  1.00 9.58  ? 160  CYS A N   1 
ATOM   1003 C  CA  . CYS A  1 137 ? 22.017  4.750  36.793  1.00 12.18 ? 160  CYS A CA  1 
ATOM   1004 C  C   . CYS A  1 137 ? 22.268  4.323  35.366  1.00 13.69 ? 160  CYS A C   1 
ATOM   1005 O  O   . CYS A  1 137 ? 21.826  3.270  34.944  1.00 10.99 ? 160  CYS A O   1 
ATOM   1006 C  CB  . CYS A  1 137 ? 23.145  4.154  37.667  1.00 12.50 ? 160  CYS A CB  1 
ATOM   1007 S  SG  . CYS A  1 137 ? 23.393  4.943  39.273  1.00 14.46 ? 160  CYS A SG  1 
ATOM   1008 N  N   . LEU A  1 138 ? 23.041  5.126  34.650  1.00 12.40 ? 161  LEU A N   1 
ATOM   1009 C  CA  . LEU A  1 138 ? 23.457  4.797  33.306  1.00 12.12 ? 161  LEU A CA  1 
ATOM   1010 C  C   . LEU A  1 138 ? 24.890  5.251  33.108  1.00 11.44 ? 161  LEU A C   1 
ATOM   1011 O  O   . LEU A  1 138 ? 25.266  6.398  33.434  1.00 10.89 ? 161  LEU A O   1 
ATOM   1012 C  CB  . LEU A  1 138 ? 22.538  5.505  32.304  1.00 13.35 ? 161  LEU A CB  1 
ATOM   1013 C  CG  . LEU A  1 138 ? 22.830  5.302  30.820  1.00 15.22 ? 161  LEU A CG  1 
ATOM   1014 C  CD1 . LEU A  1 138 ? 22.500  3.858  30.386  1.00 21.35 ? 161  LEU A CD1 1 
ATOM   1015 C  CD2 . LEU A  1 138 ? 22.021  6.301  29.991  1.00 18.31 ? 161  LEU A CD2 1 
ATOM   1016 N  N   . LYS A  1 139 ? 25.731  4.355  32.603  1.00 10.93 ? 162  LYS A N   1 
ATOM   1017 C  CA  . LYS A  1 139 ? 27.061  4.778  32.191  1.00 10.98 ? 162  LYS A CA  1 
ATOM   1018 C  C   . LYS A  1 139 ? 26.973  5.167  30.711  1.00 11.06 ? 162  LYS A C   1 
ATOM   1019 O  O   . LYS A  1 139 ? 26.390  4.437  29.913  1.00 12.99 ? 162  LYS A O   1 
ATOM   1020 C  CB  . LYS A  1 139 ? 28.093  3.662  32.379  1.00 15.17 ? 162  LYS A CB  1 
ATOM   1021 C  CG  . LYS A  1 139 ? 28.248  3.188  33.818  1.00 15.09 ? 162  LYS A CG  1 
ATOM   1022 C  CD  . LYS A  1 139 ? 28.670  4.345  34.746  1.00 18.77 ? 162  LYS A CD  1 
ATOM   1023 C  CE  . LYS A  1 139 ? 30.078  4.897  34.443  1.00 24.30 ? 162  LYS A CE  1 
ATOM   1024 N  NZ  . LYS A  1 139 ? 31.173  3.975  34.930  1.00 25.79 ? 162  LYS A NZ  1 
ATOM   1025 N  N   . ALA A  1 140 ? 27.519  6.333  30.370  1.00 11.17 ? 163  ALA A N   1 
ATOM   1026 C  CA  . ALA A  1 140 ? 27.358  6.885  29.030  1.00 11.22 ? 163  ALA A CA  1 
ATOM   1027 C  C   . ALA A  1 140 ? 28.537  7.770  28.693  1.00 9.47  ? 163  ALA A C   1 
ATOM   1028 O  O   . ALA A  1 140 ? 29.001  8.552  29.509  1.00 12.55 ? 163  ALA A O   1 
ATOM   1029 C  CB  . ALA A  1 140 ? 26.033  7.698  28.929  1.00 12.27 ? 163  ALA A CB  1 
ATOM   1030 N  N   . PRO A  1 141 ? 29.024  7.661  27.459  1.00 13.09 ? 164  PRO A N   1 
ATOM   1031 C  CA  . PRO A  1 141 ? 30.152  8.485  27.037  1.00 12.14 ? 164  PRO A CA  1 
ATOM   1032 C  C   . PRO A  1 141 ? 29.706  9.849  26.526  1.00 7.67  ? 164  PRO A C   1 
ATOM   1033 O  O   . PRO A  1 141 ? 28.631  9.991  25.924  1.00 11.16 ? 164  PRO A O   1 
ATOM   1034 C  CB  . PRO A  1 141 ? 30.696  7.691  25.844  1.00 17.43 ? 164  PRO A CB  1 
ATOM   1035 C  CG  . PRO A  1 141 ? 29.435  7.116  25.247  1.00 16.00 ? 164  PRO A CG  1 
ATOM   1036 C  CD  . PRO A  1 141 ? 28.642  6.662  26.447  1.00 15.14 ? 164  PRO A CD  1 
ATOM   1037 N  N   . ILE A  1 142 ? 30.559  10.841 26.725  1.00 11.54 ? 165  ILE A N   1 
ATOM   1038 C  CA  . ILE A  1 142 ? 30.387  12.123 26.047  1.00 13.11 ? 165  ILE A CA  1 
ATOM   1039 C  C   . ILE A  1 142 ? 30.668  11.947 24.545  1.00 16.48 ? 165  ILE A C   1 
ATOM   1040 O  O   . ILE A  1 142 ? 31.722  11.414 24.149  1.00 15.13 ? 165  ILE A O   1 
ATOM   1041 C  CB  . ILE A  1 142 ? 31.335  13.179 26.661  1.00 11.19 ? 165  ILE A CB  1 
ATOM   1042 C  CG1 . ILE A  1 142 ? 30.997  13.366 28.154  1.00 11.51 ? 165  ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A  1 142 ? 31.264  14.504 25.907  1.00 15.89 ? 165  ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A  1 142 ? 31.765  14.469 28.812  1.00 18.96 ? 165  ILE A CD1 1 
ATOM   1045 N  N   . LEU A  1 143 ? 29.743  12.396 23.705  1.00 14.93 ? 166  LEU A N   1 
ATOM   1046 C  CA  . LEU A  1 143 ? 29.926  12.299 22.261  1.00 17.71 ? 166  LEU A CA  1 
ATOM   1047 C  C   . LEU A  1 143 ? 30.666  13.512 21.700  1.00 15.00 ? 166  LEU A C   1 
ATOM   1048 O  O   . LEU A  1 143 ? 30.677  14.607 22.297  1.00 14.70 ? 166  LEU A O   1 
ATOM   1049 C  CB  . LEU A  1 143 ? 28.586  12.106 21.545  1.00 14.60 ? 166  LEU A CB  1 
ATOM   1050 C  CG  . LEU A  1 143 ? 27.744  10.891 21.943  1.00 21.48 ? 166  LEU A CG  1 
ATOM   1051 C  CD1 . LEU A  1 143 ? 26.422  10.890 21.184  1.00 23.24 ? 166  LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A  1 143 ? 28.506  9.583  21.697  1.00 27.29 ? 166  LEU A CD2 1 
ATOM   1053 N  N   . SER A  1 144 ? 31.304  13.298 20.553  1.00 14.64 ? 167  SER A N   1 
ATOM   1054 C  CA  . SER A  1 144 ? 32.038  14.362 19.882  1.00 18.10 ? 167  SER A CA  1 
ATOM   1055 C  C   . SER A  1 144 ? 31.077  15.494 19.565  1.00 15.31 ? 167  SER A C   1 
ATOM   1056 O  O   . SER A  1 144 ? 29.901  15.255 19.294  1.00 15.85 ? 167  SER A O   1 
ATOM   1057 C  CB  . SER A  1 144 ? 32.709  13.836 18.594  1.00 15.13 ? 167  SER A CB  1 
ATOM   1058 O  OG  . SER A  1 144 ? 31.765  13.483 17.597  1.00 24.30 ? 167  SER A OG  1 
ATOM   1059 N  N   . ASP A  1 145 ? 31.568  16.728 19.626  1.00 19.65 ? 168  ASP A N   1 
ATOM   1060 C  CA  . ASP A  1 145 ? 30.725  17.879 19.322  1.00 19.90 ? 168  ASP A CA  1 
ATOM   1061 C  C   . ASP A  1 145 ? 30.168  17.806 17.891  1.00 19.37 ? 168  ASP A C   1 
ATOM   1062 O  O   . ASP A  1 145 ? 29.045  18.255 17.626  1.00 17.08 ? 168  ASP A O   1 
ATOM   1063 C  CB  . ASP A  1 145 ? 31.488  19.191 19.580  1.00 22.23 ? 168  ASP A CB  1 
ATOM   1064 C  CG  . ASP A  1 145 ? 30.650  20.428 19.283  1.00 31.75 ? 168  ASP A CG  1 
ATOM   1065 O  OD1 . ASP A  1 145 ? 29.747  20.756 20.102  1.00 29.86 ? 168  ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A  1 145 ? 30.899  21.073 18.231  1.00 31.65 ? 168  ASP A OD2 1 
ATOM   1067 N  N   . SER A  1 146 ? 30.936  17.219 16.969  1.00 24.45 ? 169  SER A N   1 
ATOM   1068 C  CA  . SER A  1 146 ? 30.471  17.073 15.586  1.00 18.79 ? 169  SER A CA  1 
ATOM   1069 C  C   . SER A  1 146 ? 29.334  16.050 15.463  1.00 22.51 ? 169  SER A C   1 
ATOM   1070 O  O   . SER A  1 146 ? 28.395  16.246 14.689  1.00 18.93 ? 169  SER A O   1 
ATOM   1071 C  CB  . SER A  1 146 ? 31.628  16.705 14.649  1.00 24.69 ? 169  SER A CB  1 
ATOM   1072 O  OG  . SER A  1 146 ? 32.207  15.488 15.070  1.00 31.24 ? 169  SER A OG  1 
ATOM   1073 N  N   . SER A  1 147 ? 29.402  14.956 16.218  1.00 18.94 ? 170  SER A N   1 
ATOM   1074 C  CA  . SER A  1 147 ? 28.327  13.978 16.157  1.00 20.41 ? 170  SER A CA  1 
ATOM   1075 C  C   . SER A  1 147 ? 27.081  14.532 16.847  1.00 13.71 ? 170  SER A C   1 
ATOM   1076 O  O   . SER A  1 147 ? 25.957  14.213 16.445  1.00 14.53 ? 170  SER A O   1 
ATOM   1077 C  CB  . SER A  1 147 ? 28.734  12.632 16.757  1.00 19.22 ? 170  SER A CB  1 
ATOM   1078 O  OG  . SER A  1 147 ? 28.719  12.680 18.165  1.00 26.86 ? 170  SER A OG  1 
ATOM   1079 N  N   . CYS A  1 148 ? 27.294  15.368 17.866  1.00 15.43 ? 171  CYS A N   1 
ATOM   1080 C  CA  . CYS A  1 148 ? 26.194  16.020 18.570  1.00 15.14 ? 171  CYS A CA  1 
ATOM   1081 C  C   . CYS A  1 148 ? 25.426  16.966 17.632  1.00 13.21 ? 171  CYS A C   1 
ATOM   1082 O  O   . CYS A  1 148 ? 24.176  16.907 17.504  1.00 11.53 ? 171  CYS A O   1 
ATOM   1083 C  CB  . CYS A  1 148 ? 26.729  16.775 19.794  1.00 13.37 ? 171  CYS A CB  1 
ATOM   1084 S  SG  . CYS A  1 148 ? 25.438  17.348 20.924  1.00 16.84 ? 171  CYS A SG  1 
ATOM   1085 N  N   . LYS A  1 149 ? 26.173  17.831 16.955  1.00 17.35 ? 172  LYS A N   1 
ATOM   1086 C  CA  . LYS A  1 149 ? 25.579  18.724 15.954  1.00 16.72 ? 172  LYS A CA  1 
ATOM   1087 C  C   . LYS A  1 149 ? 24.934  17.981 14.775  1.00 17.93 ? 172  LYS A C   1 
ATOM   1088 O  O   . LYS A  1 149 ? 23.911  18.420 14.236  1.00 17.58 ? 172  LYS A O   1 
ATOM   1089 C  CB  . LYS A  1 149 ? 26.624  19.749 15.493  1.00 17.01 ? 172  LYS A CB  1 
ATOM   1090 C  CG  . LYS A  1 149 ? 26.971  20.689 16.639  1.00 16.92 ? 172  LYS A CG  1 
ATOM   1091 C  CD  . LYS A  1 149 ? 28.025  21.698 16.305  1.00 20.38 ? 172  LYS A CD  1 
ATOM   1092 C  CE  . LYS A  1 149 ? 28.273  22.557 17.538  1.00 24.66 ? 172  LYS A CE  1 
ATOM   1093 N  NZ  . LYS A  1 149 ? 29.590  23.233 17.457  1.00 31.13 ? 172  LYS A NZ  1 
ATOM   1094 N  N   . SER A  1 150 ? 25.513  16.846 14.388  1.00 14.50 ? 173  SER A N   1 
ATOM   1095 C  CA  . SER A  1 150 ? 24.927  16.020 13.341  1.00 18.86 ? 173  SER A CA  1 
ATOM   1096 C  C   . SER A  1 150 ? 23.587  15.442 13.764  1.00 15.18 ? 173  SER A C   1 
ATOM   1097 O  O   . SER A  1 150 ? 22.697  15.274 12.936  1.00 15.30 ? 173  SER A O   1 
ATOM   1098 C  CB  . SER A  1 150 ? 25.882  14.879 12.953  1.00 20.50 ? 173  SER A CB  1 
ATOM   1099 O  OG  . SER A  1 150 ? 26.995  15.424 12.278  1.00 26.84 ? 173  SER A OG  1 
ATOM   1100 N  N   . ALA A  1 151 ? 23.458  15.100 15.049  1.00 11.32 ? 174  ALA A N   1 
ATOM   1101 C  CA  . ALA A  1 151 ? 22.207  14.546 15.558  1.00 14.33 ? 174  ALA A CA  1 
ATOM   1102 C  C   . ALA A  1 151 ? 21.132  15.616 15.676  1.00 8.23  ? 174  ALA A C   1 
ATOM   1103 O  O   . ALA A  1 151 ? 19.936  15.338 15.506  1.00 14.49 ? 174  ALA A O   1 
ATOM   1104 C  CB  . ALA A  1 151 ? 22.426  13.869 16.910  1.00 12.27 ? 174  ALA A CB  1 
ATOM   1105 N  N   . TYR A  1 152 ? 21.565  16.834 15.988  1.00 14.08 ? 175  TYR A N   1 
ATOM   1106 C  CA  . TYR A  1 152 ? 20.666  17.964 16.183  1.00 12.26 ? 175  TYR A CA  1 
ATOM   1107 C  C   . TYR A  1 152 ? 21.134  19.199 15.426  1.00 12.06 ? 175  TYR A C   1 
ATOM   1108 O  O   . TYR A  1 152 ? 21.570  20.169 16.044  1.00 12.80 ? 175  TYR A O   1 
ATOM   1109 C  CB  . TYR A  1 152 ? 20.599  18.316 17.676  1.00 12.47 ? 175  TYR A CB  1 
ATOM   1110 C  CG  . TYR A  1 152 ? 20.022  17.214 18.549  1.00 10.38 ? 175  TYR A CG  1 
ATOM   1111 C  CD1 . TYR A  1 152 ? 18.646  17.039 18.673  1.00 14.21 ? 175  TYR A CD1 1 
ATOM   1112 C  CD2 . TYR A  1 152 ? 20.854  16.371 19.265  1.00 10.12 ? 175  TYR A CD2 1 
ATOM   1113 C  CE1 . TYR A  1 152 ? 18.114  16.033 19.491  1.00 13.26 ? 175  TYR A CE1 1 
ATOM   1114 C  CE2 . TYR A  1 152 ? 20.338  15.354 20.068  1.00 10.98 ? 175  TYR A CE2 1 
ATOM   1115 C  CZ  . TYR A  1 152 ? 18.976  15.192 20.181  1.00 10.14 ? 175  TYR A CZ  1 
ATOM   1116 O  OH  . TYR A  1 152 ? 18.474  14.199 21.001  1.00 11.12 ? 175  TYR A OH  1 
ATOM   1117 N  N   . PRO A  1 153 ? 21.066  19.156 14.088  1.00 13.12 ? 176  PRO A N   1 
ATOM   1118 C  CA  . PRO A  1 153 ? 21.528  20.257 13.234  1.00 14.52 ? 176  PRO A CA  1 
ATOM   1119 C  C   . PRO A  1 153 ? 20.925  21.604 13.636  1.00 11.62 ? 176  PRO A C   1 
ATOM   1120 O  O   . PRO A  1 153 ? 19.701  21.714 13.768  1.00 11.82 ? 176  PRO A O   1 
ATOM   1121 C  CB  . PRO A  1 153 ? 21.022  19.854 11.838  1.00 14.92 ? 176  PRO A CB  1 
ATOM   1122 C  CG  . PRO A  1 153 ? 20.961  18.351 11.888  1.00 15.68 ? 176  PRO A CG  1 
ATOM   1123 C  CD  . PRO A  1 153 ? 20.535  18.024 13.307  1.00 13.16 ? 176  PRO A CD  1 
ATOM   1124 N  N   . GLY A  1 154 ? 21.777  22.599 13.836  1.00 10.84 ? 177  GLY A N   1 
ATOM   1125 C  CA  . GLY A  1 154 ? 21.303  23.947 14.117  1.00 11.73 ? 177  GLY A CA  1 
ATOM   1126 C  C   . GLY A  1 154 ? 20.756  24.200 15.509  1.00 14.68 ? 177  GLY A C   1 
ATOM   1127 O  O   . GLY A  1 154 ? 20.162  25.273 15.775  1.00 11.96 ? 177  GLY A O   1 
ATOM   1128 N  N   . GLN A  1 155 ? 20.979  23.257 16.427  1.00 11.64 ? 178  GLN A N   1 
ATOM   1129 C  CA  . GLN A  1 155 ? 20.383  23.356 17.776  1.00 10.34 ? 178  GLN A CA  1 
ATOM   1130 C  C   . GLN A  1 155 ? 21.334  23.239 18.955  1.00 10.54 ? 178  GLN A C   1 
ATOM   1131 O  O   . GLN A  1 155 ? 20.931  23.429 20.110  1.00 13.30 ? 178  GLN A O   1 
ATOM   1132 C  CB  . GLN A  1 155 ? 19.277  22.317 17.950  1.00 10.29 ? 178  GLN A CB  1 
ATOM   1133 C  CG  . GLN A  1 155 ? 18.138  22.547 17.007  1.00 14.36 ? 178  GLN A CG  1 
ATOM   1134 C  CD  . GLN A  1 155 ? 16.931  21.741 17.389  1.00 18.65 ? 178  GLN A CD  1 
ATOM   1135 O  OE1 . GLN A  1 155 ? 16.971  20.514 17.370  1.00 19.98 ? 178  GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A  1 155 ? 15.838  22.428 17.725  1.00 24.31 ? 178  GLN A NE2 1 
ATOM   1137 N  N   . ILE A  1 156 ? 22.588  22.908 18.694  1.00 11.11 ? 179  ILE A N   1 
ATOM   1138 C  CA  . ILE A  1 156 ? 23.526  22.724 19.792  1.00 12.98 ? 179  ILE A CA  1 
ATOM   1139 C  C   . ILE A  1 156 ? 24.357  23.978 20.058  1.00 15.55 ? 179  ILE A C   1 
ATOM   1140 O  O   . ILE A  1 156 ? 25.073  24.469 19.171  1.00 14.49 ? 179  ILE A O   1 
ATOM   1141 C  CB  . ILE A  1 156 ? 24.472  21.544 19.536  1.00 11.10 ? 179  ILE A CB  1 
ATOM   1142 C  CG1 . ILE A  1 156 ? 23.676  20.259 19.278  1.00 10.62 ? 179  ILE A CG1 1 
ATOM   1143 C  CG2 . ILE A  1 156 ? 25.485  21.424 20.713  1.00 11.70 ? 179  ILE A CG2 1 
ATOM   1144 C  CD1 . ILE A  1 156 ? 22.839  19.749 20.483  1.00 14.99 ? 179  ILE A CD1 1 
ATOM   1145 N  N   . THR A  1 157 ? 24.273  24.497 21.282  1.00 11.52 ? 180  THR A N   1 
ATOM   1146 C  CA  . THR A  1 157 ? 25.054  25.667 21.659  1.00 10.87 ? 180  THR A CA  1 
ATOM   1147 C  C   . THR A  1 157 ? 26.383  25.263 22.255  1.00 12.74 ? 180  THR A C   1 
ATOM   1148 O  O   . THR A  1 157 ? 26.628  24.073 22.563  1.00 12.84 ? 180  THR A O   1 
ATOM   1149 C  CB  . THR A  1 157 ? 24.336  26.545 22.709  1.00 13.76 ? 180  THR A CB  1 
ATOM   1150 O  OG1 . THR A  1 157 ? 24.359  25.871 23.984  1.00 9.53  ? 180  THR A OG1 1 
ATOM   1151 C  CG2 . THR A  1 157 ? 22.900  26.842 22.303  1.00 14.84 ? 180  THR A CG2 1 
ATOM   1152 N  N   . SER A  1 158 ? 27.237  26.251 22.489  1.00 8.84  ? 181  SER A N   1 
ATOM   1153 C  CA  . SER A  1 158 ? 28.529  25.953 23.088  1.00 13.54 ? 181  SER A CA  1 
ATOM   1154 C  C   . SER A  1 158 ? 28.410  25.587 24.579  1.00 14.03 ? 181  SER A C   1 
ATOM   1155 O  O   . SER A  1 158 ? 29.379  25.171 25.197  1.00 14.75 ? 181  SER A O   1 
ATOM   1156 C  CB  . SER A  1 158 ? 29.520  27.108 22.862  1.00 21.53 ? 181  SER A CB  1 
ATOM   1157 O  OG  . SER A  1 158 ? 29.142  28.261 23.598  1.00 25.66 ? 181  SER A OG  1 
ATOM   1158 N  N   . ASN A  1 159 ? 27.201  25.668 25.135  1.00 11.99 ? 182  ASN A N   1 
ATOM   1159 C  CA  . ASN A  1 159 ? 26.997  25.310 26.537  1.00 9.17  ? 182  ASN A CA  1 
ATOM   1160 C  C   . ASN A  1 159 ? 26.234  23.997 26.682  1.00 10.52 ? 182  ASN A C   1 
ATOM   1161 O  O   . ASN A  1 159 ? 25.601  23.749 27.707  1.00 8.85  ? 182  ASN A O   1 
ATOM   1162 C  CB  . ASN A  1 159 ? 26.261  26.436 27.254  1.00 6.92  ? 182  ASN A CB  1 
ATOM   1163 C  CG  . ASN A  1 159 ? 27.080  27.714 27.293  1.00 13.08 ? 182  ASN A CG  1 
ATOM   1164 O  OD1 . ASN A  1 159 ? 28.246  27.692 27.689  1.00 16.51 ? 182  ASN A OD1 1 
ATOM   1165 N  ND2 . ASN A  1 159 ? 26.496  28.815 26.833  1.00 16.18 ? 182  ASN A ND2 1 
ATOM   1166 N  N   . MET A  1 160 ? 26.327  23.159 25.657  1.00 7.88  ? 183  MET A N   1 
ATOM   1167 C  CA  . MET A  1 160 ? 25.683  21.850 25.668  1.00 8.62  ? 183  MET A CA  1 
ATOM   1168 C  C   . MET A  1 160 ? 26.651  20.834 25.149  1.00 9.85  ? 183  MET A C   1 
ATOM   1169 O  O   . MET A  1 160 ? 27.499  21.145 24.300  1.00 12.18 ? 183  MET A O   1 
ATOM   1170 C  CB  . MET A  1 160 ? 24.480  21.829 24.734  1.00 7.62  ? 183  MET A CB  1 
ATOM   1171 C  CG  . MET A  1 160 ? 23.407  22.869 25.066  1.00 7.08  ? 183  MET A CG  1 
ATOM   1172 S  SD  . MET A  1 160 ? 22.186  22.917 23.726  1.00 9.26  ? 183  MET A SD  1 
ATOM   1173 C  CE  . MET A  1 160 ? 21.131  24.240 24.336  1.00 14.03 ? 183  MET A CE  1 
ATOM   1174 N  N   . PHE A  1 161 ? 26.482  19.605 25.609  1.00 8.84  ? 184  PHE A N   1 
ATOM   1175 C  CA  . PHE A  1 161 ? 27.126  18.452 24.984  1.00 11.08 ? 184  PHE A CA  1 
ATOM   1176 C  C   . PHE A  1 161 ? 26.159  17.286 24.934  1.00 10.60 ? 184  PHE A C   1 
ATOM   1177 O  O   . PHE A  1 161 ? 25.253  17.182 25.764  1.00 11.47 ? 184  PHE A O   1 
ATOM   1178 C  CB  . PHE A  1 161 ? 28.427  18.024 25.711  1.00 11.77 ? 184  PHE A CB  1 
ATOM   1179 C  CG  . PHE A  1 161 ? 28.222  17.544 27.139  1.00 7.63  ? 184  PHE A CG  1 
ATOM   1180 C  CD1 . PHE A  1 161 ? 28.282  18.444 28.196  1.00 10.14 ? 184  PHE A CD1 1 
ATOM   1181 C  CD2 . PHE A  1 161 ? 28.019  16.197 27.417  1.00 9.71  ? 184  PHE A CD2 1 
ATOM   1182 C  CE1 . PHE A  1 161 ? 28.112  18.014 29.515  1.00 13.24 ? 184  PHE A CE1 1 
ATOM   1183 C  CE2 . PHE A  1 161 ? 27.855  15.759 28.727  1.00 9.88  ? 184  PHE A CE2 1 
ATOM   1184 C  CZ  . PHE A  1 161 ? 27.883  16.661 29.775  1.00 11.82 ? 184  PHE A CZ  1 
ATOM   1185 N  N   . CYS A  1 162 ? 26.366  16.386 23.976  1.00 6.90  ? 185  CYS A N   1 
ATOM   1186 C  CA  . CYS A  1 162 ? 25.596  15.143 23.904  1.00 8.71  ? 185  CYS A CA  1 
ATOM   1187 C  C   . CYS A  1 162 ? 26.339  14.059 24.623  1.00 9.06  ? 185  CYS A C   1 
ATOM   1188 O  O   . CYS A  1 162 ? 27.573  14.038 24.639  1.00 9.38  ? 185  CYS A O   1 
ATOM   1189 C  CB  . CYS A  1 162 ? 25.388  14.686 22.449  1.00 12.46 ? 185  CYS A CB  1 
ATOM   1190 S  SG  . CYS A  1 162 ? 24.294  15.730 21.468  1.00 13.46 ? 185  CYS A SG  1 
ATOM   1191 N  N   . ALA A  1 163 ? 25.587  13.163 25.236  1.00 10.03 ? 186  ALA A N   1 
ATOM   1192 C  CA  . ALA A  1 163 ? 26.168  12.009 25.876  1.00 13.52 ? 186  ALA A CA  1 
ATOM   1193 C  C   . ALA A  1 163 ? 25.211  10.861 25.707  1.00 14.69 ? 186  ALA A C   1 
ATOM   1194 O  O   . ALA A  1 163 ? 23.996  11.044 25.642  1.00 11.88 ? 186  ALA A O   1 
ATOM   1195 C  CB  . ALA A  1 163 ? 26.453  12.277 27.371  1.00 10.36 ? 186  ALA A CB  1 
ATOM   1196 N  N   . GLY A  1 164 ? 25.745  9.656  25.591  1.00 11.00 ? 187  GLY A N   1 
ATOM   1197 C  CA  . GLY A  1 164 ? 24.852  8.530  25.457  1.00 11.05 ? 187  GLY A CA  1 
ATOM   1198 C  C   . GLY A  1 164 ? 25.208  7.675  24.241  1.00 16.64 ? 187  GLY A C   1 
ATOM   1199 O  O   . GLY A  1 164 ? 26.384  7.443  23.951  1.00 16.45 ? 187  GLY A O   1 
ATOM   1200 N  N   . TYR A  1 165 ? 24.179  7.233  23.535  1.00 13.97 ? 188  TYR A N   1 
ATOM   1201 C  CA  . TYR A  1 165 ? 24.285  6.163  22.554  1.00 20.01 ? 188  TYR A CA  1 
ATOM   1202 C  C   . TYR A  1 165 ? 23.428  6.476  21.333  1.00 24.56 ? 188  TYR A C   1 
ATOM   1203 O  O   . TYR A  1 165 ? 22.315  6.993  21.455  1.00 27.72 ? 188  TYR A O   1 
ATOM   1204 C  CB  . TYR A  1 165 ? 23.824  4.856  23.183  1.00 19.98 ? 188  TYR A CB  1 
ATOM   1205 C  CG  . TYR A  1 165 ? 24.689  4.462  24.348  1.00 16.54 ? 188  TYR A CG  1 
ATOM   1206 C  CD1 . TYR A  1 165 ? 25.873  3.761  24.152  1.00 20.72 ? 188  TYR A CD1 1 
ATOM   1207 C  CD2 . TYR A  1 165 ? 24.344  4.825  25.649  1.00 12.76 ? 188  TYR A CD2 1 
ATOM   1208 C  CE1 . TYR A  1 165 ? 26.686  3.401  25.235  1.00 25.89 ? 188  TYR A CE1 1 
ATOM   1209 C  CE2 . TYR A  1 165 ? 25.142  4.488  26.714  1.00 13.72 ? 188  TYR A CE2 1 
ATOM   1210 C  CZ  . TYR A  1 165 ? 26.310  3.772  26.514  1.00 19.55 ? 188  TYR A CZ  1 
ATOM   1211 O  OH  . TYR A  1 165 ? 27.095  3.431  27.601  1.00 18.21 ? 188  TYR A OH  1 
ATOM   1212 N  N   . LEU A  1 166 ? 23.962  6.195  20.153  1.00 20.37 ? 189  LEU A N   1 
ATOM   1213 C  CA  . LEU A  1 166 ? 23.239  6.491  18.923  1.00 23.36 ? 189  LEU A CA  1 
ATOM   1214 C  C   . LEU A  1 166 ? 22.265  5.381  18.554  1.00 24.05 ? 189  LEU A C   1 
ATOM   1215 O  O   . LEU A  1 166 ? 21.377  5.586  17.728  1.00 24.58 ? 189  LEU A O   1 
ATOM   1216 C  CB  . LEU A  1 166 ? 24.203  6.743  17.762  1.00 17.54 ? 189  LEU A CB  1 
ATOM   1217 C  CG  . LEU A  1 166 ? 25.177  7.901  17.949  1.00 21.80 ? 189  LEU A CG  1 
ATOM   1218 C  CD1 . LEU A  1 166 ? 26.064  8.060  16.754  1.00 22.31 ? 189  LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A  1 166 ? 24.406  9.196  18.233  1.00 19.17 ? 189  LEU A CD2 1 
ATOM   1220 N  N   . GLU A  1 167 ? 22.416  4.205  19.165  1.00 24.01 ? 190  GLU A N   1 
ATOM   1221 C  CA  . GLU A  1 167 ? 21.640  3.053  18.720  1.00 21.23 ? 190  GLU A CA  1 
ATOM   1222 C  C   . GLU A  1 167 ? 20.265  2.989  19.353  1.00 27.74 ? 190  GLU A C   1 
ATOM   1223 O  O   . GLU A  1 167 ? 19.403  2.258  18.877  1.00 28.99 ? 190  GLU A O   1 
ATOM   1224 C  CB  . GLU A  1 167 ? 22.387  1.742  18.967  1.00 29.32 ? 190  GLU A CB  1 
ATOM   1225 C  CG  . GLU A  1 167 ? 22.606  1.419  20.432  1.00 27.27 ? 190  GLU A CG  1 
ATOM   1226 C  CD  . GLU A  1 167 ? 23.992  1.806  20.926  1.00 33.74 ? 190  GLU A CD  1 
ATOM   1227 O  OE1 . GLU A  1 167 ? 24.600  2.787  20.408  1.00 25.84 ? 190  GLU A OE1 1 
ATOM   1228 O  OE2 . GLU A  1 167 ? 24.471  1.113  21.851  1.00 31.83 ? 190  GLU A OE2 1 
ATOM   1229 N  N   . GLY A  1 168 ? 20.055  3.735  20.434  1.00 24.62 ? 191  GLY A N   1 
ATOM   1230 C  CA  . GLY A  1 168 ? 18.752  3.759  21.074  1.00 26.76 ? 191  GLY A CA  1 
ATOM   1231 C  C   . GLY A  1 168 ? 18.646  2.845  22.283  1.00 22.94 ? 191  GLY A C   1 
ATOM   1232 O  O   . GLY A  1 168 ? 19.443  1.915  22.457  1.00 23.16 ? 191  GLY A O   1 
ATOM   1233 N  N   . GLY A  1 169 ? 17.657  3.111  23.126  1.00 19.58 ? 192  GLY A N   1 
ATOM   1234 C  CA  . GLY A  1 169 ? 17.379  2.266  24.272  1.00 22.24 ? 192  GLY A CA  1 
ATOM   1235 C  C   . GLY A  1 169 ? 18.186  2.533  25.534  1.00 17.96 ? 192  GLY A C   1 
ATOM   1236 O  O   . GLY A  1 169 ? 17.979  1.843  26.523  1.00 14.34 ? 192  GLY A O   1 
ATOM   1237 N  N   . LYS A  1 170 ? 19.115  3.497  25.494  1.00 15.13 ? 193  LYS A N   1 
ATOM   1238 C  CA  . LYS A  1 170 ? 19.915  3.880  26.682  1.00 13.24 ? 193  LYS A CA  1 
ATOM   1239 C  C   . LYS A  1 170 ? 20.027  5.408  26.775  1.00 12.82 ? 193  LYS A C   1 
ATOM   1240 O  O   . LYS A  1 170 ? 20.732  6.024  25.976  1.00 13.33 ? 193  LYS A O   1 
ATOM   1241 C  CB  . LYS A  1 170 ? 21.321  3.262  26.633  1.00 15.10 ? 193  LYS A CB  1 
ATOM   1242 C  CG  . LYS A  1 170 ? 21.385  1.730  26.478  1.00 18.04 ? 193  LYS A CG  1 
ATOM   1243 C  CD  . LYS A  1 170 ? 22.837  1.205  26.314  1.00 25.49 ? 193  LYS A CD  1 
ATOM   1244 C  CE  . LYS A  1 170 ? 23.635  1.401  27.599  1.00 34.42 ? 193  LYS A CE  1 
ATOM   1245 N  NZ  . LYS A  1 170 ? 24.753  0.420  27.816  1.00 40.03 ? 193  LYS A NZ  1 
ATOM   1246 N  N   . ASP A  1 171 ? 19.351  6.030  27.746  1.00 12.45 ? 194  ASP A N   1 
ATOM   1247 C  CA  . ASP A  1 171 ? 19.275  7.497  27.776  1.00 13.14 ? 194  ASP A CA  1 
ATOM   1248 C  C   . ASP A  1 171 ? 18.674  7.953  29.112  1.00 7.16  ? 194  ASP A C   1 
ATOM   1249 O  O   . ASP A  1 171 ? 18.076  7.154  29.838  1.00 9.44  ? 194  ASP A O   1 
ATOM   1250 C  CB  . ASP A  1 171 ? 18.381  7.969  26.613  1.00 10.92 ? 194  ASP A CB  1 
ATOM   1251 C  CG  . ASP A  1 171 ? 18.533  9.463  26.262  1.00 9.30  ? 194  ASP A CG  1 
ATOM   1252 O  OD1 . ASP A  1 171 ? 19.387  10.175 26.839  1.00 12.97 ? 194  ASP A OD1 1 
ATOM   1253 O  OD2 . ASP A  1 171 ? 17.789  9.923  25.351  1.00 11.92 ? 194  ASP A OD2 1 
ATOM   1254 N  N   . SER A  1 172 ? 18.839  9.232  29.433  1.00 11.78 ? 195  SER A N   1 
ATOM   1255 C  CA  . SER A  1 172 ? 18.018  9.847  30.453  1.00 11.40 ? 195  SER A CA  1 
ATOM   1256 C  C   . SER A  1 172 ? 16.635  10.105 29.817  1.00 12.57 ? 195  SER A C   1 
ATOM   1257 O  O   . SER A  1 172 ? 16.479  9.999  28.603  1.00 12.15 ? 195  SER A O   1 
ATOM   1258 C  CB  . SER A  1 172 ? 18.682  11.131 31.007  1.00 9.42  ? 195  SER A CB  1 
ATOM   1259 O  OG  . SER A  1 172 ? 18.936  12.095 30.003  1.00 12.31 ? 195  SER A OG  1 
ATOM   1260 N  N   . CYS A  1 173 ? 15.630  10.400 30.633  1.00 10.77 ? 196  CYS A N   1 
ATOM   1261 C  CA  . CYS A  1 173 ? 14.262  10.494 30.129  1.00 10.27 ? 196  CYS A CA  1 
ATOM   1262 C  C   . CYS A  1 173 ? 13.431  11.434 31.011  1.00 8.23  ? 196  CYS A C   1 
ATOM   1263 O  O   . CYS A  1 173 ? 13.925  11.943 32.031  1.00 10.07 ? 196  CYS A O   1 
ATOM   1264 C  CB  . CYS A  1 173 ? 13.625  9.098  30.101  1.00 13.71 ? 196  CYS A CB  1 
ATOM   1265 S  SG  . CYS A  1 173 ? 12.189  8.944  29.003  1.00 16.97 ? 196  CYS A SG  1 
ATOM   1266 N  N   . GLN A  1 174 ? 12.169  11.652 30.643  1.00 9.98  ? 197  GLN A N   1 
ATOM   1267 C  CA  . GLN A  1 174 ? 11.329  12.559 31.432  1.00 7.84  ? 197  GLN A CA  1 
ATOM   1268 C  C   . GLN A  1 174 ? 11.271  12.200 32.920  1.00 8.93  ? 197  GLN A C   1 
ATOM   1269 O  O   . GLN A  1 174 ? 10.980  11.054 33.297  1.00 11.61 ? 197  GLN A O   1 
ATOM   1270 C  CB  . GLN A  1 174 ? 9.929   12.691 30.826  1.00 9.15  ? 197  GLN A CB  1 
ATOM   1271 C  CG  . GLN A  1 174 ? 9.892   13.647 29.629  1.00 11.21 ? 197  GLN A CG  1 
ATOM   1272 C  CD  . GLN A  1 174 ? 10.662  13.131 28.439  1.00 17.47 ? 197  GLN A CD  1 
ATOM   1273 O  OE1 . GLN A  1 174 ? 10.621  11.933 28.139  1.00 19.62 ? 197  GLN A OE1 1 
ATOM   1274 N  NE2 . GLN A  1 174 ? 11.377  14.024 27.751  1.00 14.51 ? 197  GLN A NE2 1 
ATOM   1275 N  N   . GLY A  1 175 ? 11.564  13.194 33.758  1.00 6.71  ? 198  GLY A N   1 
ATOM   1276 C  CA  . GLY A  1 175 ? 11.659  13.005 35.192  1.00 8.13  ? 198  GLY A CA  1 
ATOM   1277 C  C   . GLY A  1 175 ? 13.098  12.996 35.676  1.00 5.60  ? 198  GLY A C   1 
ATOM   1278 O  O   . GLY A  1 175 ? 13.350  13.047 36.887  1.00 8.01  ? 198  GLY A O   1 
ATOM   1279 N  N   . ASP A  1 176 ? 14.027  12.897 34.729  1.00 7.42  ? 199  ASP A N   1 
ATOM   1280 C  CA  . ASP A  1 176 ? 15.454  12.968 35.038  1.00 8.31  ? 199  ASP A CA  1 
ATOM   1281 C  C   . ASP A  1 176 ? 16.011  14.389 34.931  1.00 7.98  ? 199  ASP A C   1 
ATOM   1282 O  O   . ASP A  1 176 ? 17.112  14.630 35.426  1.00 8.71  ? 199  ASP A O   1 
ATOM   1283 C  CB  . ASP A  1 176 ? 16.271  12.049 34.116  1.00 8.28  ? 199  ASP A CB  1 
ATOM   1284 C  CG  . ASP A  1 176 ? 16.032  10.553 34.408  1.00 8.43  ? 199  ASP A CG  1 
ATOM   1285 O  OD1 . ASP A  1 176 ? 15.945  10.187 35.595  1.00 9.94  ? 199  ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A  1 176 ? 15.959  9.776  33.439  1.00 9.37  ? 199  ASP A OD2 1 
ATOM   1287 N  N   . SER A  1 177 ? 15.275  15.314 34.306  1.00 4.35  ? 200  SER A N   1 
ATOM   1288 C  CA  . SER A  1 177 ? 15.734  16.713 34.223  1.00 5.93  ? 200  SER A CA  1 
ATOM   1289 C  C   . SER A  1 177 ? 16.368  17.251 35.495  1.00 6.44  ? 200  SER A C   1 
ATOM   1290 O  O   . SER A  1 177 ? 15.860  17.052 36.609  1.00 7.62  ? 200  SER A O   1 
ATOM   1291 C  CB  . SER A  1 177 ? 14.570  17.651 33.899  1.00 4.80  ? 200  SER A CB  1 
ATOM   1292 O  OG  . SER A  1 177 ? 14.378  17.727 32.493  1.00 5.54  ? 200  SER A OG  1 
ATOM   1293 N  N   . GLY A  1 178 ? 17.495  17.942 35.325  1.00 5.75  ? 201  GLY A N   1 
ATOM   1294 C  CA  . GLY A  1 178 ? 18.142  18.584 36.451  1.00 7.00  ? 201  GLY A CA  1 
ATOM   1295 C  C   . GLY A  1 178 ? 19.172  17.720 37.147  1.00 6.99  ? 201  GLY A C   1 
ATOM   1296 O  O   . GLY A  1 178 ? 20.017  18.247 37.867  1.00 7.28  ? 201  GLY A O   1 
ATOM   1297 N  N   . GLY A  1 179 ? 19.085  16.408 36.936  1.00 7.51  ? 202  GLY A N   1 
ATOM   1298 C  CA  . GLY A  1 179 ? 20.015  15.454 37.517  1.00 9.46  ? 202  GLY A CA  1 
ATOM   1299 C  C   . GLY A  1 179 ? 21.448  15.505 36.981  1.00 5.34  ? 202  GLY A C   1 
ATOM   1300 O  O   . GLY A  1 179 ? 21.767  16.198 36.009  1.00 6.56  ? 202  GLY A O   1 
ATOM   1301 N  N   . PRO A  1 180 ? 22.330  14.767 37.645  1.00 6.38  ? 203  PRO A N   1 
ATOM   1302 C  CA  . PRO A  1 180 ? 23.782  14.820 37.416  1.00 10.18 ? 203  PRO A CA  1 
ATOM   1303 C  C   . PRO A  1 180 ? 24.284  13.985 36.240  1.00 8.73  ? 203  PRO A C   1 
ATOM   1304 O  O   . PRO A  1 180 ? 23.767  12.896 35.946  1.00 8.29  ? 203  PRO A O   1 
ATOM   1305 C  CB  . PRO A  1 180 ? 24.363  14.253 38.724  1.00 7.80  ? 203  PRO A CB  1 
ATOM   1306 C  CG  . PRO A  1 180 ? 23.317  13.329 39.215  1.00 9.83  ? 203  PRO A CG  1 
ATOM   1307 C  CD  . PRO A  1 180 ? 21.995  14.035 38.874  1.00 6.78  ? 203  PRO A CD  1 
ATOM   1308 N  N   . VAL A  1 181 ? 25.322  14.516 35.589  1.00 6.30  ? 204  VAL A N   1 
ATOM   1309 C  CA  . VAL A  1 181 ? 26.175  13.734 34.703  1.00 8.15  ? 204  VAL A CA  1 
ATOM   1310 C  C   . VAL A  1 181 ? 27.547  13.915 35.327  1.00 6.22  ? 204  VAL A C   1 
ATOM   1311 O  O   . VAL A  1 181 ? 28.077  15.024 35.366  1.00 10.06 ? 204  VAL A O   1 
ATOM   1312 C  CB  . VAL A  1 181 ? 26.140  14.290 33.270  1.00 6.81  ? 204  VAL A CB  1 
ATOM   1313 C  CG1 . VAL A  1 181 ? 27.094  13.501 32.361  1.00 6.99  ? 204  VAL A CG1 1 
ATOM   1314 C  CG2 . VAL A  1 181 ? 24.733  14.242 32.720  1.00 7.91  ? 204  VAL A CG2 1 
ATOM   1315 N  N   . VAL A  1 182 ? 28.115  12.837 35.868  1.00 7.85  ? 205  VAL A N   1 
ATOM   1316 C  CA  . VAL A  1 182 ? 29.352  12.954 36.627  1.00 6.83  ? 205  VAL A CA  1 
ATOM   1317 C  C   . VAL A  1 182 ? 30.407  12.116 35.926  1.00 8.91  ? 205  VAL A C   1 
ATOM   1318 O  O   . VAL A  1 182 ? 30.130  10.984 35.539  1.00 9.51  ? 205  VAL A O   1 
ATOM   1319 C  CB  . VAL A  1 182 ? 29.162  12.472 38.082  1.00 7.21  ? 205  VAL A CB  1 
ATOM   1320 C  CG1 . VAL A  1 182 ? 30.497  12.348 38.809  1.00 10.39 ? 205  VAL A CG1 1 
ATOM   1321 C  CG2 . VAL A  1 182 ? 28.278  13.467 38.850  1.00 8.20  ? 205  VAL A CG2 1 
ATOM   1322 N  N   . CYS A  1 183 ? 31.590  12.696 35.750  1.00 12.11 ? 206  CYS A N   1 
ATOM   1323 C  CA  . CYS A  1 183 ? 32.665  12.069 34.963  1.00 11.90 ? 206  CYS A CA  1 
ATOM   1324 C  C   . CYS A  1 183 ? 33.961  12.227 35.743  1.00 13.69 ? 206  CYS A C   1 
ATOM   1325 O  O   . CYS A  1 183 ? 34.354  13.340 36.090  1.00 13.57 ? 206  CYS A O   1 
ATOM   1326 C  CB  . CYS A  1 183 ? 32.803  12.753 33.608  1.00 10.71 ? 206  CYS A CB  1 
ATOM   1327 S  SG  . CYS A  1 183 ? 31.264  13.206 32.767  1.00 14.57 ? 206  CYS A SG  1 
ATOM   1328 N  N   . SER A  1 184 ? 34.610  11.113 36.054  1.00 15.80 ? 207  SER A N   1 
ATOM   1329 C  CA  . SER A  1 184 ? 35.801  11.157 36.906  1.00 21.13 ? 207  SER A CA  1 
ATOM   1330 C  C   . SER A  1 184 ? 35.606  11.951 38.194  1.00 19.94 ? 207  SER A C   1 
ATOM   1331 O  O   . SER A  1 184 ? 36.508  12.696 38.596  1.00 17.75 ? 207  SER A O   1 
ATOM   1332 C  CB  . SER A  1 184 ? 37.016  11.727 36.149  1.00 20.88 ? 207  SER A CB  1 
ATOM   1333 O  OG  . SER A  1 184 ? 37.169  11.135 34.864  1.00 31.16 ? 207  SER A OG  1 
ATOM   1334 N  N   . GLY A  1 185 ? 34.431  11.837 38.829  1.00 14.29 ? 208  GLY A N   1 
ATOM   1335 C  CA  . GLY A  1 185 ? 34.212  12.458 40.138  1.00 12.33 ? 208  GLY A CA  1 
ATOM   1336 C  C   . GLY A  1 185 ? 33.909  13.953 40.084  1.00 10.89 ? 208  GLY A C   1 
ATOM   1337 O  O   . GLY A  1 185 ? 33.939  14.632 41.113  1.00 13.77 ? 208  GLY A O   1 
ATOM   1338 N  N   . LYS A  1 186 ? 33.635  14.470 38.885  1.00 10.82 ? 209  LYS A N   1 
ATOM   1339 C  CA  . LYS A  1 186 ? 33.269  15.878 38.734  1.00 9.66  ? 209  LYS A CA  1 
ATOM   1340 C  C   . LYS A  1 186 ? 31.918  16.004 38.054  1.00 6.85  ? 209  LYS A C   1 
ATOM   1341 O  O   . LYS A  1 186 ? 31.594  15.258 37.128  1.00 9.48  ? 209  LYS A O   1 
ATOM   1342 C  CB  . LYS A  1 186 ? 34.296  16.636 37.881  1.00 14.02 ? 209  LYS A CB  1 
ATOM   1343 C  CG  . LYS A  1 186 ? 35.748  16.487 38.320  1.00 17.81 ? 209  LYS A CG  1 
ATOM   1344 C  CD  . LYS A  1 186 ? 35.978  17.078 39.700  1.00 14.13 ? 209  LYS A CD  1 
ATOM   1345 C  CE  . LYS A  1 186 ? 37.420  17.555 39.890  1.00 26.39 ? 209  LYS A CE  1 
ATOM   1346 N  NZ  . LYS A  1 186 ? 38.374  16.623 39.242  1.00 34.20 ? 209  LYS A NZ  1 
ATOM   1347 N  N   . LEU A  1 187 ? 31.126  16.966 38.492  1.00 9.01  ? 210  LEU A N   1 
ATOM   1348 C  CA  . LEU A  1 187 ? 29.848  17.204 37.827  1.00 6.56  ? 210  LEU A CA  1 
ATOM   1349 C  C   . LEU A  1 187 ? 30.050  17.970 36.500  1.00 7.01  ? 210  LEU A C   1 
ATOM   1350 O  O   . LEU A  1 187 ? 30.236  19.177 36.516  1.00 11.28 ? 210  LEU A O   1 
ATOM   1351 C  CB  . LEU A  1 187 ? 28.980  18.067 38.752  1.00 8.86  ? 210  LEU A CB  1 
ATOM   1352 C  CG  . LEU A  1 187 ? 27.567  18.371 38.224  1.00 7.97  ? 210  LEU A CG  1 
ATOM   1353 C  CD1 . LEU A  1 187 ? 26.740  17.095 38.183  1.00 8.37  ? 210  LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A  1 187 ? 26.902  19.408 39.091  1.00 10.57 ? 210  LEU A CD2 1 
ATOM   1355 N  N   . GLN A  1 188 ? 29.977  17.270 35.370  1.00 7.86  ? 211  GLN A N   1 
ATOM   1356 C  CA  . GLN A  1 188 ? 30.168  17.888 34.066  1.00 9.23  ? 211  GLN A CA  1 
ATOM   1357 C  C   . GLN A  1 188 ? 28.869  18.263 33.373  1.00 5.74  ? 211  GLN A C   1 
ATOM   1358 O  O   . GLN A  1 188 ? 28.848  19.142 32.501  1.00 6.77  ? 211  GLN A O   1 
ATOM   1359 C  CB  . GLN A  1 188 ? 30.961  16.952 33.164  1.00 7.77  ? 211  GLN A CB  1 
ATOM   1360 C  CG  . GLN A  1 188 ? 32.412  16.725 33.624  1.00 10.04 ? 211  GLN A CG  1 
ATOM   1361 C  CD  . GLN A  1 188 ? 33.316  17.941 33.437  1.00 13.58 ? 211  GLN A CD  1 
ATOM   1362 O  OE1 . GLN A  1 188 ? 32.866  19.031 33.074  1.00 17.85 ? 211  GLN A OE1 1 
ATOM   1363 N  NE2 . GLN A  1 188 ? 34.612  17.762 33.743  1.00 14.92 ? 211  GLN A NE2 1 
ATOM   1364 N  N   . GLY A  1 189 ? 27.775  17.606 33.745  1.00 5.42  ? 212  GLY A N   1 
ATOM   1365 C  CA  . GLY A  1 189 ? 26.546  17.847 33.016  1.00 9.10  ? 212  GLY A CA  1 
ATOM   1366 C  C   . GLY A  1 189 ? 25.286  17.900 33.863  1.00 6.86  ? 212  GLY A C   1 
ATOM   1367 O  O   . GLY A  1 189 ? 25.273  17.437 35.012  1.00 9.35  ? 212  GLY A O   1 
ATOM   1368 N  N   . ILE A  1 190 ? 24.234  18.474 33.284  1.00 6.53  ? 213  ILE A N   1 
ATOM   1369 C  CA  . ILE A  1 190 ? 22.889  18.486 33.870  1.00 6.46  ? 213  ILE A CA  1 
ATOM   1370 C  C   . ILE A  1 190 ? 21.919  17.945 32.843  1.00 6.38  ? 213  ILE A C   1 
ATOM   1371 O  O   . ILE A  1 190 ? 21.888  18.421 31.706  1.00 7.83  ? 213  ILE A O   1 
ATOM   1372 C  CB  . ILE A  1 190 ? 22.452  19.927 34.227  1.00 5.75  ? 213  ILE A CB  1 
ATOM   1373 C  CG1 . ILE A  1 190 ? 23.431  20.552 35.205  1.00 7.80  ? 213  ILE A CG1 1 
ATOM   1374 C  CG2 . ILE A  1 190 ? 21.013  19.958 34.848  1.00 7.46  ? 213  ILE A CG2 1 
ATOM   1375 C  CD1 . ILE A  1 190 ? 23.208  22.067 35.318  1.00 8.27  ? 213  ILE A CD1 1 
ATOM   1376 N  N   . VAL A  1 191 ? 21.131  16.947 33.221  1.00 5.14  ? 214  VAL A N   1 
ATOM   1377 C  CA  . VAL A  1 191 ? 20.103  16.419 32.324  1.00 7.52  ? 214  VAL A CA  1 
ATOM   1378 C  C   . VAL A  1 191 ? 19.204  17.553 31.866  1.00 7.29  ? 214  VAL A C   1 
ATOM   1379 O  O   . VAL A  1 191 ? 18.672  18.281 32.695  1.00 6.70  ? 214  VAL A O   1 
ATOM   1380 C  CB  . VAL A  1 191 ? 19.249  15.337 33.037  1.00 8.09  ? 214  VAL A CB  1 
ATOM   1381 C  CG1 . VAL A  1 191 ? 18.175  14.811 32.113  1.00 4.48  ? 214  VAL A CG1 1 
ATOM   1382 C  CG2 . VAL A  1 191 ? 20.139  14.198 33.527  1.00 8.08  ? 214  VAL A CG2 1 
ATOM   1383 N  N   . SER A  1 192 ? 19.088  17.732 30.546  1.00 5.38  ? 215  SER A N   1 
ATOM   1384 C  CA  . SER A  1 192 ? 18.392  18.890 29.969  1.00 7.29  ? 215  SER A CA  1 
ATOM   1385 C  C   . SER A  1 192 ? 17.311  18.496 28.951  1.00 8.47  ? 215  SER A C   1 
ATOM   1386 O  O   . SER A  1 192 ? 16.123  18.588 29.255  1.00 9.49  ? 215  SER A O   1 
ATOM   1387 C  CB  . SER A  1 192 ? 19.390  19.915 29.407  1.00 8.02  ? 215  SER A CB  1 
ATOM   1388 O  OG  . SER A  1 192 ? 18.751  21.087 28.877  1.00 9.79  ? 215  SER A OG  1 
ATOM   1389 N  N   . TRP A  1 193 ? 17.701  18.047 27.773  1.00 7.30  ? 216  TRP A N   1 
ATOM   1390 C  CA  . TRP A  1 193 ? 16.707  17.770 26.743  1.00 7.30  ? 216  TRP A CA  1 
ATOM   1391 C  C   . TRP A  1 193 ? 17.159  16.729 25.742  1.00 8.53  ? 216  TRP A C   1 
ATOM   1392 O  O   . TRP A  1 193 ? 18.268  16.220 25.835  1.00 8.32  ? 216  TRP A O   1 
ATOM   1393 C  CB  . TRP A  1 193 ? 16.371  19.076 26.015  1.00 8.26  ? 216  TRP A CB  1 
ATOM   1394 C  CG  . TRP A  1 193 ? 17.503  19.728 25.230  1.00 6.80  ? 216  TRP A CG  1 
ATOM   1395 C  CD1 . TRP A  1 193 ? 18.487  20.529 25.720  1.00 7.44  ? 216  TRP A CD1 1 
ATOM   1396 C  CD2 . TRP A  1 193 ? 17.704  19.662 23.802  1.00 7.85  ? 216  TRP A CD2 1 
ATOM   1397 N  NE1 . TRP A  1 193 ? 19.279  21.002 24.679  1.00 8.16  ? 216  TRP A NE1 1 
ATOM   1398 C  CE2 . TRP A  1 193 ? 18.842  20.464 23.507  1.00 7.60  ? 216  TRP A CE2 1 
ATOM   1399 C  CE3 . TRP A  1 193 ? 17.042  19.014 22.753  1.00 10.15 ? 216  TRP A CE3 1 
ATOM   1400 C  CZ2 . TRP A  1 193 ? 19.327  20.628 22.198  1.00 12.43 ? 216  TRP A CZ2 1 
ATOM   1401 C  CZ3 . TRP A  1 193 ? 17.520  19.198 21.433  1.00 9.58  ? 216  TRP A CZ3 1 
ATOM   1402 C  CH2 . TRP A  1 193 ? 18.661  19.988 21.183  1.00 9.96  ? 216  TRP A CH2 1 
ATOM   1403 N  N   . GLY A  1 194 ? 16.304  16.440 24.757  1.00 7.16  ? 217  GLY A N   1 
ATOM   1404 C  CA  . GLY A  1 194 ? 16.619  15.527 23.668  1.00 9.54  ? 217  GLY A CA  1 
ATOM   1405 C  C   . GLY A  1 194 ? 15.363  15.400 22.826  1.00 14.21 ? 217  GLY A C   1 
ATOM   1406 O  O   . GLY A  1 194 ? 14.333  15.956 23.187  1.00 10.79 ? 217  GLY A O   1 
ATOM   1407 N  N   . SER A  1 195 ? 15.436  14.715 21.696  1.00 12.76 ? 218  SER A N   1 
ATOM   1408 C  CA  . SER A  1 195 ? 14.230  14.432 20.924  1.00 13.02 ? 218  SER A CA  1 
ATOM   1409 C  C   . SER A  1 195 ? 13.622  13.142 21.462  1.00 12.99 ? 218  SER A C   1 
ATOM   1410 O  O   . SER A  1 195 ? 14.133  12.065 21.188  1.00 13.79 ? 218  SER A O   1 
ATOM   1411 C  CB  . SER A  1 195 ? 14.590  14.297 19.445  1.00 18.31 ? 218  SER A CB  1 
ATOM   1412 O  OG  . SER A  1 195 ? 13.503  13.768 18.710  1.00 19.39 ? 218  SER A OG  1 
ATOM   1413 N  N   . GLY A  1 196 ? 12.574  13.256 22.281  1.00 14.96 ? 219  GLY A N   1 
ATOM   1414 C  CA  . GLY A  1 196 ? 12.079  12.135 23.070  1.00 13.77 ? 219  GLY A CA  1 
ATOM   1415 C  C   . GLY A  1 196 ? 13.186  11.559 23.944  1.00 14.35 ? 219  GLY A C   1 
ATOM   1416 O  O   . GLY A  1 196 ? 14.105  12.281 24.350  1.00 16.66 ? 219  GLY A O   1 
ATOM   1417 N  N   A CYS A  1 197 ? 13.090  10.255 24.212  0.47 16.67 ? 220  CYS A N   1 
ATOM   1418 N  N   B CYS A  1 197 ? 13.131  10.269 24.227  0.53 16.67 ? 220  CYS A N   1 
ATOM   1419 C  CA  A CYS A  1 197 ? 14.060  9.509  25.024  0.47 14.50 ? 220  CYS A CA  1 
ATOM   1420 C  CA  B CYS A  1 197 ? 14.222  9.666  24.980  0.53 14.48 ? 220  CYS A CA  1 
ATOM   1421 C  C   A CYS A  1 197 ? 14.547  8.284  24.289  0.47 15.38 ? 220  CYS A C   1 
ATOM   1422 C  C   B CYS A  1 197 ? 14.548  8.271  24.485  0.53 15.58 ? 220  CYS A C   1 
ATOM   1423 O  O   A CYS A  1 197 ? 13.747  7.558  23.716  0.47 17.75 ? 220  CYS A O   1 
ATOM   1424 O  O   B CYS A  1 197 ? 13.659  7.465  24.215  0.53 17.04 ? 220  CYS A O   1 
ATOM   1425 C  CB  A CYS A  1 197 ? 13.405  8.957  26.287  0.47 17.24 ? 220  CYS A CB  1 
ATOM   1426 C  CB  B CYS A  1 197 ? 13.957  9.693  26.495  0.53 15.99 ? 220  CYS A CB  1 
ATOM   1427 S  SG  A CYS A  1 197 ? 12.703  10.131 27.415  0.47 24.63 ? 220  CYS A SG  1 
ATOM   1428 S  SG  B CYS A  1 197 ? 12.926  8.362  27.180  0.53 20.00 ? 220  CYS A SG  1 
ATOM   1429 N  N   . ALA A  1 198 ? 15.845  8.010  24.369  1.00 14.13 ? 221  ALA A N   1 
ATOM   1430 C  CA  . ALA A  1 198 ? 16.372  6.713  23.921  1.00 12.54 ? 221  ALA A CA  1 
ATOM   1431 C  C   . ALA A  1 198 ? 16.015  6.384  22.485  1.00 18.89 ? 221  ALA A C   1 
ATOM   1432 O  O   . ALA A  1 198 ? 15.870  5.211  22.114  1.00 21.55 ? 221  ALA A O   1 
ATOM   1433 C  CB  . ALA A  1 198 ? 15.964  5.565  24.885  1.00 12.73 ? 221  ALA A CB  1 
ATOM   1434 N  N   . GLN A  1 199 ? 15.892  7.425  21.671  1.00 16.91 ? 222  GLN A N   1 
ATOM   1435 C  CA  . GLN A  1 199 ? 15.537  7.231  20.276  1.00 18.55 ? 222  GLN A CA  1 
ATOM   1436 C  C   . GLN A  1 199 ? 16.805  7.069  19.479  1.00 17.44 ? 222  GLN A C   1 
ATOM   1437 O  O   . GLN A  1 199 ? 17.848  7.646  19.813  1.00 16.94 ? 222  GLN A O   1 
ATOM   1438 C  CB  . GLN A  1 199 ? 14.718  8.420  19.772  1.00 17.00 ? 222  GLN A CB  1 
ATOM   1439 C  CG  . GLN A  1 199 ? 13.407  8.617  20.543  1.00 19.81 ? 222  GLN A CG  1 
ATOM   1440 C  CD  . GLN A  1 199 ? 12.461  7.441  20.360  1.00 29.63 ? 222  GLN A CD  1 
ATOM   1441 O  OE1 . GLN A  1 199 ? 12.040  7.153  19.245  1.00 32.21 ? 222  GLN A OE1 1 
ATOM   1442 N  NE2 . GLN A  1 199 ? 12.141  6.741  21.457  1.00 27.03 ? 222  GLN A NE2 1 
ATOM   1443 N  N   . LYS A  1 200 ? 16.737  6.278  18.418  1.00 23.68 ? 223  LYS A N   1 
ATOM   1444 C  CA  . LYS A  1 200 ? 17.907  6.106  17.577  1.00 20.50 ? 223  LYS A CA  1 
ATOM   1445 C  C   . LYS A  1 200 ? 18.410  7.438  17.017  1.00 16.01 ? 223  LYS A C   1 
ATOM   1446 O  O   . LYS A  1 200 ? 17.636  8.264  16.557  1.00 19.04 ? 223  LYS A O   1 
ATOM   1447 C  CB  . LYS A  1 200 ? 17.618  5.131  16.435  1.00 25.96 ? 223  LYS A CB  1 
ATOM   1448 C  CG  . LYS A  1 200 ? 18.835  4.855  15.585  1.00 27.67 ? 223  LYS A CG  1 
ATOM   1449 C  CD  . LYS A  1 200 ? 18.667  3.601  14.726  1.00 41.20 ? 223  LYS A CD  1 
ATOM   1450 C  CE  . LYS A  1 200 ? 19.950  3.295  13.948  1.00 46.59 ? 223  LYS A CE  1 
ATOM   1451 N  NZ  . LYS A  1 200 ? 19.676  2.637  12.632  1.00 45.28 ? 223  LYS A NZ  1 
ATOM   1452 N  N   . ASN A  1 201 ? 19.716  7.637  17.114  1.00 14.55 ? 224  ASN A N   1 
ATOM   1453 C  CA  . ASN A  1 201 ? 20.386  8.800  16.550  1.00 18.78 ? 224  ASN A CA  1 
ATOM   1454 C  C   . ASN A  1 201 ? 20.005  10.127 17.196  1.00 17.60 ? 224  ASN A C   1 
ATOM   1455 O  O   . ASN A  1 201 ? 20.248  11.182 16.624  1.00 15.78 ? 224  ASN A O   1 
ATOM   1456 C  CB  . ASN A  1 201 ? 20.204  8.859  15.032  1.00 20.30 ? 224  ASN A CB  1 
ATOM   1457 C  CG  . ASN A  1 201 ? 21.017  7.802  14.319  1.00 32.92 ? 224  ASN A CG  1 
ATOM   1458 O  OD1 . ASN A  1 201 ? 22.159  7.518  14.708  1.00 28.99 ? 224  ASN A OD1 1 
ATOM   1459 N  ND2 . ASN A  1 201 ? 20.444  7.213  13.271  1.00 30.98 ? 224  ASN A ND2 1 
ATOM   1460 N  N   . LYS A  1 202 ? 19.419  10.053 18.390  1.00 16.94 ? 225  LYS A N   1 
ATOM   1461 C  CA  . LYS A  1 202 ? 19.029  11.239 19.164  1.00 15.99 ? 225  LYS A CA  1 
ATOM   1462 C  C   . LYS A  1 202 ? 19.461  11.087 20.617  1.00 10.51 ? 225  LYS A C   1 
ATOM   1463 O  O   . LYS A  1 202 ? 18.645  10.801 21.503  1.00 15.82 ? 225  LYS A O   1 
ATOM   1464 C  CB  . LYS A  1 202 ? 17.523  11.461 19.089  1.00 13.67 ? 225  LYS A CB  1 
ATOM   1465 C  CG  . LYS A  1 202 ? 17.037  11.828 17.711  1.00 13.04 ? 225  LYS A CG  1 
ATOM   1466 C  CD  . LYS A  1 202 ? 17.518  13.220 17.301  1.00 16.48 ? 225  LYS A CD  1 
ATOM   1467 C  CE  . LYS A  1 202 ? 16.924  13.663 15.957  1.00 21.87 ? 225  LYS A CE  1 
ATOM   1468 N  NZ  . LYS A  1 202 ? 17.311  15.081 15.606  1.00 20.28 ? 225  LYS A NZ  1 
ATOM   1469 N  N   . PRO A  1 203 ? 20.761  11.263 20.869  1.00 13.21 ? 226  PRO A N   1 
ATOM   1470 C  CA  . PRO A  1 203 ? 21.284  11.160 22.232  1.00 10.35 ? 226  PRO A CA  1 
ATOM   1471 C  C   . PRO A  1 203 ? 20.782  12.303 23.130  1.00 8.58  ? 226  PRO A C   1 
ATOM   1472 O  O   . PRO A  1 203 ? 20.302  13.335 22.644  1.00 11.28 ? 226  PRO A O   1 
ATOM   1473 C  CB  . PRO A  1 203 ? 22.799  11.319 22.028  1.00 12.86 ? 226  PRO A CB  1 
ATOM   1474 C  CG  . PRO A  1 203 ? 22.905  12.184 20.785  1.00 13.33 ? 226  PRO A CG  1 
ATOM   1475 C  CD  . PRO A  1 203 ? 21.783  11.712 19.903  1.00 13.76 ? 226  PRO A CD  1 
ATOM   1476 N  N   . GLY A  1 204 ? 20.918  12.117 24.434  1.00 8.39  ? 227  GLY A N   1 
ATOM   1477 C  CA  . GLY A  1 204 ? 20.572  13.158 25.371  1.00 9.69  ? 227  GLY A CA  1 
ATOM   1478 C  C   . GLY A  1 204 ? 21.493  14.358 25.225  1.00 11.59 ? 227  GLY A C   1 
ATOM   1479 O  O   . GLY A  1 204 ? 22.687  14.236 24.885  1.00 10.51 ? 227  GLY A O   1 
ATOM   1480 N  N   . VAL A  1 205 ? 20.931  15.532 25.486  1.00 7.45  ? 228  VAL A N   1 
ATOM   1481 C  CA  . VAL A  1 205 ? 21.687  16.783 25.455  1.00 7.58  ? 228  VAL A CA  1 
ATOM   1482 C  C   . VAL A  1 205 ? 21.734  17.369 26.866  1.00 7.71  ? 228  VAL A C   1 
ATOM   1483 O  O   . VAL A  1 205 ? 20.714  17.405 27.575  1.00 8.60  ? 228  VAL A O   1 
ATOM   1484 C  CB  . VAL A  1 205 ? 21.052  17.795 24.460  1.00 6.77  ? 228  VAL A CB  1 
ATOM   1485 C  CG1 . VAL A  1 205 ? 21.904  19.029 24.337  1.00 6.46  ? 228  VAL A CG1 1 
ATOM   1486 C  CG2 . VAL A  1 205 ? 20.880  17.150 23.086  1.00 10.03 ? 228  VAL A CG2 1 
ATOM   1487 N  N   . TYR A  1 206 ? 22.918  17.791 27.289  1.00 8.44  ? 229  TYR A N   1 
ATOM   1488 C  CA  . TYR A  1 206 ? 23.178  18.148 28.680  1.00 9.79  ? 229  TYR A CA  1 
ATOM   1489 C  C   . TYR A  1 206 ? 23.854  19.515 28.785  1.00 7.84  ? 229  TYR A C   1 
ATOM   1490 O  O   . TYR A  1 206 ? 24.647  19.877 27.932  1.00 9.12  ? 229  TYR A O   1 
ATOM   1491 C  CB  . TYR A  1 206 ? 24.088  17.065 29.306  1.00 8.99  ? 229  TYR A CB  1 
ATOM   1492 C  CG  . TYR A  1 206 ? 23.459  15.703 29.259  1.00 7.68  ? 229  TYR A CG  1 
ATOM   1493 C  CD1 . TYR A  1 206 ? 23.634  14.859 28.151  1.00 7.84  ? 229  TYR A CD1 1 
ATOM   1494 C  CD2 . TYR A  1 206 ? 22.672  15.264 30.303  1.00 9.11  ? 229  TYR A CD2 1 
ATOM   1495 C  CE1 . TYR A  1 206 ? 23.023  13.607 28.105  1.00 8.71  ? 229  TYR A CE1 1 
ATOM   1496 C  CE2 . TYR A  1 206 ? 22.076  14.029 30.272  1.00 7.54  ? 229  TYR A CE2 1 
ATOM   1497 C  CZ  . TYR A  1 206 ? 22.248  13.204 29.187  1.00 6.76  ? 229  TYR A CZ  1 
ATOM   1498 O  OH  . TYR A  1 206 ? 21.628  11.971 29.201  1.00 10.57 ? 229  TYR A OH  1 
ATOM   1499 N  N   . THR A  1 207 ? 23.549  20.271 29.843  1.00 6.71  ? 230  THR A N   1 
ATOM   1500 C  CA  . THR A  1 207 ? 24.129  21.571 30.062  1.00 6.15  ? 230  THR A CA  1 
ATOM   1501 C  C   . THR A  1 207 ? 25.564  21.318 30.460  1.00 7.64  ? 230  THR A C   1 
ATOM   1502 O  O   . THR A  1 207 ? 25.839  20.487 31.318  1.00 7.86  ? 230  THR A O   1 
ATOM   1503 C  CB  . THR A  1 207 ? 23.405  22.250 31.214  1.00 8.20  ? 230  THR A CB  1 
ATOM   1504 O  OG1 . THR A  1 207 ? 22.001  22.242 30.915  1.00 9.37  ? 230  THR A OG1 1 
ATOM   1505 C  CG2 . THR A  1 207 ? 23.891  23.684 31.435  1.00 7.37  ? 230  THR A CG2 1 
ATOM   1506 N  N   . LYS A  1 208 ? 26.465  22.022 29.799  1.00 6.94  ? 231  LYS A N   1 
ATOM   1507 C  CA  . LYS A  1 208 ? 27.903  21.886 30.049  1.00 7.55  ? 231  LYS A CA  1 
ATOM   1508 C  C   . LYS A  1 208 ? 28.364  22.688 31.288  1.00 8.05  ? 231  LYS A C   1 
ATOM   1509 O  O   . LYS A  1 208 ? 28.698  23.875 31.193  1.00 7.49  ? 231  LYS A O   1 
ATOM   1510 C  CB  . LYS A  1 208 ? 28.622  22.334 28.774  1.00 9.80  ? 231  LYS A CB  1 
ATOM   1511 C  CG  . LYS A  1 208 ? 30.087  21.970 28.727  1.00 8.87  ? 231  LYS A CG  1 
ATOM   1512 C  CD  . LYS A  1 208 ? 30.600  22.294 27.320  1.00 15.18 ? 231  LYS A CD  1 
ATOM   1513 C  CE  . LYS A  1 208 ? 32.114  22.108 27.226  1.00 16.29 ? 231  LYS A CE  1 
ATOM   1514 N  NZ  . LYS A  1 208 ? 32.502  22.151 25.759  1.00 16.65 ? 231  LYS A NZ  1 
ATOM   1515 N  N   . VAL A  1 209 ? 28.376  22.041 32.453  1.00 7.49  ? 232  VAL A N   1 
ATOM   1516 C  CA  . VAL A  1 209 ? 28.633  22.689 33.750  1.00 7.40  ? 232  VAL A CA  1 
ATOM   1517 C  C   . VAL A  1 209 ? 29.981  23.444 33.837  1.00 7.56  ? 232  VAL A C   1 
ATOM   1518 O  O   . VAL A  1 209 ? 30.083  24.450 34.519  1.00 9.33  ? 232  VAL A O   1 
ATOM   1519 C  CB  . VAL A  1 209 ? 28.494  21.658 34.913  1.00 6.19  ? 232  VAL A CB  1 
ATOM   1520 C  CG1 . VAL A  1 209 ? 28.866  22.275 36.300  1.00 8.07  ? 232  VAL A CG1 1 
ATOM   1521 C  CG2 . VAL A  1 209 ? 27.031  21.070 34.922  1.00 7.75  ? 232  VAL A CG2 1 
ATOM   1522 N  N   . CYS A  1 210 ? 30.993  22.950 33.146  1.00 10.07 ? 233  CYS A N   1 
ATOM   1523 C  CA  . CYS A  1 210 ? 32.310  23.567 33.236  1.00 10.69 ? 233  CYS A CA  1 
ATOM   1524 C  C   . CYS A  1 210 ? 32.308  25.015 32.784  1.00 15.05 ? 233  CYS A C   1 
ATOM   1525 O  O   . CYS A  1 210 ? 33.150  25.807 33.232  1.00 19.40 ? 233  CYS A O   1 
ATOM   1526 C  CB  . CYS A  1 210 ? 33.341  22.767 32.435  1.00 12.32 ? 233  CYS A CB  1 
ATOM   1527 S  SG  . CYS A  1 210 ? 33.005  22.677 30.666  1.00 14.71 ? 233  CYS A SG  1 
ATOM   1528 N  N   . ASN A  1 211 ? 31.329  25.396 31.968  1.00 11.07 ? 234  ASN A N   1 
ATOM   1529 C  CA  . ASN A  1 211 ? 31.230  26.809 31.579  1.00 7.60  ? 234  ASN A CA  1 
ATOM   1530 C  C   . ASN A  1 211 ? 30.621  27.739 32.622  1.00 10.89 ? 234  ASN A C   1 
ATOM   1531 O  O   . ASN A  1 211 ? 30.583  28.949 32.425  1.00 14.80 ? 234  ASN A O   1 
ATOM   1532 C  CB  . ASN A  1 211 ? 30.481  26.977 30.245  1.00 10.98 ? 234  ASN A CB  1 
ATOM   1533 C  CG  . ASN A  1 211 ? 31.195  26.305 29.088  1.00 13.79 ? 234  ASN A CG  1 
ATOM   1534 O  OD1 . ASN A  1 211 ? 32.387  25.991 29.165  1.00 15.28 ? 234  ASN A OD1 1 
ATOM   1535 N  ND2 . ASN A  1 211 ? 30.472  26.087 28.005  1.00 17.12 ? 234  ASN A ND2 1 
ATOM   1536 N  N   . TYR A  1 212 ? 30.174  27.181 33.737  1.00 11.03 ? 235  TYR A N   1 
ATOM   1537 C  CA  . TYR A  1 212 ? 29.411  27.943 34.719  1.00 8.68  ? 235  TYR A CA  1 
ATOM   1538 C  C   . TYR A  1 212 ? 30.069  27.990 36.079  1.00 9.35  ? 235  TYR A C   1 
ATOM   1539 O  O   . TYR A  1 212 ? 29.499  28.529 37.036  1.00 11.08 ? 235  TYR A O   1 
ATOM   1540 C  CB  . TYR A  1 212 ? 28.008  27.323 34.846  1.00 8.40  ? 235  TYR A CB  1 
ATOM   1541 C  CG  . TYR A  1 212 ? 27.280  27.428 33.554  1.00 11.50 ? 235  TYR A CG  1 
ATOM   1542 C  CD1 . TYR A  1 212 ? 26.656  28.622 33.188  1.00 10.06 ? 235  TYR A CD1 1 
ATOM   1543 C  CD2 . TYR A  1 212 ? 27.265  26.378 32.655  1.00 9.77  ? 235  TYR A CD2 1 
ATOM   1544 C  CE1 . TYR A  1 212 ? 26.001  28.753 31.964  1.00 11.62 ? 235  TYR A CE1 1 
ATOM   1545 C  CE2 . TYR A  1 212 ? 26.633  26.502 31.426  1.00 9.45  ? 235  TYR A CE2 1 
ATOM   1546 C  CZ  . TYR A  1 212 ? 25.981  27.679 31.094  1.00 11.62 ? 235  TYR A CZ  1 
ATOM   1547 O  OH  . TYR A  1 212 ? 25.354  27.789 29.873  1.00 9.51  ? 235  TYR A OH  1 
ATOM   1548 N  N   . VAL A  1 213 ? 31.282  27.455 36.194  1.00 9.29  ? 236  VAL A N   1 
ATOM   1549 C  CA  . VAL A  1 213 ? 31.888  27.398 37.524  1.00 8.17  ? 236  VAL A CA  1 
ATOM   1550 C  C   . VAL A  1 213 ? 32.040  28.766 38.203  1.00 9.53  ? 236  VAL A C   1 
ATOM   1551 O  O   . VAL A  1 213 ? 31.711  28.908 39.372  1.00 9.25  ? 236  VAL A O   1 
ATOM   1552 C  CB  . VAL A  1 213 ? 33.175  26.548 37.573  1.00 8.36  ? 236  VAL A CB  1 
ATOM   1553 C  CG1 . VAL A  1 213 ? 33.761  26.610 38.971  1.00 10.09 ? 236  VAL A CG1 1 
ATOM   1554 C  CG2 . VAL A  1 213 ? 32.823  25.072 37.213  1.00 9.91  ? 236  VAL A CG2 1 
ATOM   1555 N  N   A SER A  1 214 ? 32.503  29.780 37.468  0.35 11.84 ? 237  SER A N   1 
ATOM   1556 N  N   C SER A  1 214 ? 32.490  29.773 37.459  0.65 11.85 ? 237  SER A N   1 
ATOM   1557 C  CA  A SER A  1 214 ? 32.660  31.103 38.079  0.35 10.90 ? 237  SER A CA  1 
ATOM   1558 C  CA  C SER A  1 214 ? 32.659  31.080 38.076  0.65 10.87 ? 237  SER A CA  1 
ATOM   1559 C  C   A SER A  1 214 ? 31.311  31.692 38.486  0.35 9.60  ? 237  SER A C   1 
ATOM   1560 C  C   C SER A  1 214 ? 31.312  31.669 38.494  0.65 9.55  ? 237  SER A C   1 
ATOM   1561 O  O   A SER A  1 214 ? 31.206  32.372 39.508  0.35 11.31 ? 237  SER A O   1 
ATOM   1562 O  O   C SER A  1 214 ? 31.208  32.311 39.542  0.65 11.30 ? 237  SER A O   1 
ATOM   1563 C  CB  A SER A  1 214 ? 33.429  32.073 37.171  0.35 11.68 ? 237  SER A CB  1 
ATOM   1564 C  CB  C SER A  1 214 ? 33.449  32.022 37.163  0.65 11.65 ? 237  SER A CB  1 
ATOM   1565 O  OG  A SER A  1 214 ? 32.685  32.404 36.017  0.35 11.56 ? 237  SER A OG  1 
ATOM   1566 O  OG  C SER A  1 214 ? 34.788  31.566 37.067  0.65 15.47 ? 237  SER A OG  1 
ATOM   1567 N  N   . TRP A  1 215 ? 30.275  31.410 37.701  1.00 12.33 ? 238  TRP A N   1 
ATOM   1568 C  CA  . TRP A  1 215 ? 28.934  31.925 38.027  1.00 10.26 ? 238  TRP A CA  1 
ATOM   1569 C  C   . TRP A  1 215 ? 28.395  31.218 39.260  1.00 9.38  ? 238  TRP A C   1 
ATOM   1570 O  O   . TRP A  1 215 ? 27.801  31.838 40.145  1.00 9.06  ? 238  TRP A O   1 
ATOM   1571 C  CB  . TRP A  1 215 ? 27.971  31.732 36.864  1.00 11.34 ? 238  TRP A CB  1 
ATOM   1572 C  CG  . TRP A  1 215 ? 26.539  32.052 37.260  1.00 12.15 ? 238  TRP A CG  1 
ATOM   1573 C  CD1 . TRP A  1 215 ? 25.989  33.298 37.421  1.00 14.98 ? 238  TRP A CD1 1 
ATOM   1574 C  CD2 . TRP A  1 215 ? 25.502  31.111 37.576  1.00 10.43 ? 238  TRP A CD2 1 
ATOM   1575 N  NE1 . TRP A  1 215 ? 24.665  33.189 37.790  1.00 11.93 ? 238  TRP A NE1 1 
ATOM   1576 C  CE2 . TRP A  1 215 ? 24.340  31.860 37.899  1.00 9.86  ? 238  TRP A CE2 1 
ATOM   1577 C  CE3 . TRP A  1 215 ? 25.437  29.711 37.600  1.00 9.89  ? 238  TRP A CE3 1 
ATOM   1578 C  CZ2 . TRP A  1 215 ? 23.115  31.250 38.233  1.00 9.50  ? 238  TRP A CZ2 1 
ATOM   1579 C  CZ3 . TRP A  1 215 ? 24.226  29.105 37.939  1.00 12.17 ? 238  TRP A CZ3 1 
ATOM   1580 C  CH2 . TRP A  1 215 ? 23.083  29.880 38.260  1.00 11.43 ? 238  TRP A CH2 1 
ATOM   1581 N  N   . ILE A  1 216 ? 28.590  29.908 39.312  1.00 8.83  ? 239  ILE A N   1 
ATOM   1582 C  CA  . ILE A  1 216 ? 28.246  29.138 40.518  1.00 8.85  ? 239  ILE A CA  1 
ATOM   1583 C  C   . ILE A  1 216 ? 28.917  29.660 41.790  1.00 9.52  ? 239  ILE A C   1 
ATOM   1584 O  O   . ILE A  1 216 ? 28.260  29.915 42.795  1.00 10.62 ? 239  ILE A O   1 
ATOM   1585 C  CB  . ILE A  1 216 ? 28.558  27.641 40.345  1.00 7.71  ? 239  ILE A CB  1 
ATOM   1586 C  CG1 . ILE A  1 216 ? 27.666  27.052 39.234  1.00 9.17  ? 239  ILE A CG1 1 
ATOM   1587 C  CG2 . ILE A  1 216 ? 28.394  26.901 41.688  1.00 11.40 ? 239  ILE A CG2 1 
ATOM   1588 C  CD1 . ILE A  1 216 ? 28.078  25.643 38.801  1.00 8.00  ? 239  ILE A CD1 1 
ATOM   1589 N  N   . LYS A  1 217 ? 30.233  29.848 41.733  1.00 8.79  ? 240  LYS A N   1 
ATOM   1590 C  CA  . LYS A  1 217 ? 30.985  30.332 42.875  1.00 11.07 ? 240  LYS A CA  1 
ATOM   1591 C  C   . LYS A  1 217 ? 30.491  31.716 43.318  1.00 11.78 ? 240  LYS A C   1 
ATOM   1592 O  O   . LYS A  1 217 ? 30.328  32.000 44.515  1.00 15.52 ? 240  LYS A O   1 
ATOM   1593 C  CB  . LYS A  1 217 ? 32.472  30.351 42.501  1.00 10.03 ? 240  LYS A CB  1 
ATOM   1594 C  CG  . LYS A  1 217 ? 33.086  28.962 42.481  1.00 14.28 ? 240  LYS A CG  1 
ATOM   1595 C  CD  . LYS A  1 217 ? 34.555  28.994 42.126  1.00 16.80 ? 240  LYS A CD  1 
ATOM   1596 C  CE  . LYS A  1 217 ? 35.179  27.616 42.367  1.00 24.88 ? 240  LYS A CE  1 
ATOM   1597 N  NZ  . LYS A  1 217 ? 36.639  27.574 42.021  1.00 29.35 ? 240  LYS A NZ  1 
ATOM   1598 N  N   . GLN A  1 218 ? 30.228  32.565 42.339  1.00 12.13 ? 241  GLN A N   1 
ATOM   1599 C  CA  . GLN A  1 218 ? 29.790  33.917 42.629  1.00 13.00 ? 241  GLN A CA  1 
ATOM   1600 C  C   . GLN A  1 218 ? 28.412  33.902 43.259  1.00 14.21 ? 241  GLN A C   1 
ATOM   1601 O  O   . GLN A  1 218 ? 28.123  34.668 44.184  1.00 14.62 ? 241  GLN A O   1 
ATOM   1602 C  CB  . GLN A  1 218 ? 29.760  34.729 41.348  1.00 17.77 ? 241  GLN A CB  1 
ATOM   1603 C  CG  . GLN A  1 218 ? 29.554  36.203 41.597  1.00 26.80 ? 241  GLN A CG  1 
ATOM   1604 C  CD  . GLN A  1 218 ? 28.107  36.570 41.777  1.00 28.79 ? 241  GLN A CD  1 
ATOM   1605 O  OE1 . GLN A  1 218 ? 27.213  35.896 41.250  1.00 37.13 ? 241  GLN A OE1 1 
ATOM   1606 N  NE2 . GLN A  1 218 ? 27.857  37.644 42.530  1.00 29.39 ? 241  GLN A NE2 1 
ATOM   1607 N  N   . THR A  1 219 ? 27.551  33.012 42.779  1.00 11.33 ? 242  THR A N   1 
ATOM   1608 C  CA  . THR A  1 219 ? 26.184  32.986 43.299  1.00 10.87 ? 242  THR A CA  1 
ATOM   1609 C  C   . THR A  1 219 ? 26.158  32.487 44.743  1.00 13.11 ? 242  THR A C   1 
ATOM   1610 O  O   . THR A  1 219 ? 25.435  33.033 45.592  1.00 16.86 ? 242  THR A O   1 
ATOM   1611 C  CB  . THR A  1 219 ? 25.291  32.108 42.405  1.00 14.73 ? 242  THR A CB  1 
ATOM   1612 O  OG1 . THR A  1 219 ? 25.308  32.625 41.064  1.00 11.84 ? 242  THR A OG1 1 
ATOM   1613 C  CG2 . THR A  1 219 ? 23.867  32.091 42.940  1.00 14.80 ? 242  THR A CG2 1 
ATOM   1614 N  N   . ILE A  1 220 ? 26.931  31.439 45.019  1.00 10.24 ? 243  ILE A N   1 
ATOM   1615 C  CA  . ILE A  1 220 ? 27.093  30.934 46.385  1.00 13.27 ? 243  ILE A CA  1 
ATOM   1616 C  C   . ILE A  1 220 ? 27.622  32.000 47.334  1.00 16.86 ? 243  ILE A C   1 
ATOM   1617 O  O   . ILE A  1 220 ? 27.134  32.144 48.467  1.00 19.98 ? 243  ILE A O   1 
ATOM   1618 C  CB  . ILE A  1 220 ? 28.040  29.714 46.397  1.00 15.92 ? 243  ILE A CB  1 
ATOM   1619 C  CG1 . ILE A  1 220 ? 27.364  28.525 45.709  1.00 19.29 ? 243  ILE A CG1 1 
ATOM   1620 C  CG2 . ILE A  1 220 ? 28.512  29.379 47.825  1.00 17.85 ? 243  ILE A CG2 1 
ATOM   1621 C  CD1 . ILE A  1 220 ? 28.332  27.400 45.420  1.00 15.68 ? 243  ILE A CD1 1 
ATOM   1622 N  N   . ALA A  1 221 ? 28.623  32.746 46.873  1.00 17.13 ? 244  ALA A N   1 
ATOM   1623 C  CA  . ALA A  1 221 ? 29.290  33.737 47.718  1.00 19.54 ? 244  ALA A CA  1 
ATOM   1624 C  C   . ALA A  1 221 ? 28.382  34.920 48.040  1.00 19.68 ? 244  ALA A C   1 
ATOM   1625 O  O   . ALA A  1 221 ? 28.427  35.465 49.137  1.00 29.26 ? 244  ALA A O   1 
ATOM   1626 C  CB  . ALA A  1 221 ? 30.596  34.207 47.065  1.00 24.53 ? 244  ALA A CB  1 
ATOM   1627 N  N   . SER A  1 222 ? 27.516  35.282 47.096  1.00 11.87 ? 245  SER A N   1 
ATOM   1628 C  CA  . SER A  1 222 ? 26.729  36.500 47.209  1.00 19.04 ? 245  SER A CA  1 
ATOM   1629 C  C   . SER A  1 222 ? 25.345  36.256 47.782  1.00 22.85 ? 245  SER A C   1 
ATOM   1630 O  O   . SER A  1 222 ? 24.561  37.193 47.956  1.00 24.16 ? 245  SER A O   1 
ATOM   1631 C  CB  . SER A  1 222 ? 26.618  37.183 45.845  1.00 23.13 ? 245  SER A CB  1 
ATOM   1632 O  OG  . SER A  1 222 ? 25.931  36.379 44.902  1.00 23.97 ? 245  SER A OG  1 
ATOM   1633 N  N   . ASN A  1 223 ? 25.043  35.001 48.084  1.00 19.43 ? 246  ASN A N   1 
ATOM   1634 C  CA  . ASN A  1 223 ? 23.719  34.654 48.591  1.00 21.22 ? 246  ASN A CA  1 
ATOM   1635 C  C   . ASN A  1 223 ? 23.791  33.895 49.906  1.00 30.71 ? 246  ASN A C   1 
ATOM   1636 O  O   . ASN A  1 223 ? 22.829  33.203 50.262  1.00 28.65 ? 246  ASN A O   1 
ATOM   1637 C  CB  . ASN A  1 223 ? 22.927  33.856 47.543  1.00 17.41 ? 246  ASN A CB  1 
ATOM   1638 C  CG  . ASN A  1 223 ? 22.394  34.725 46.434  1.00 21.28 ? 246  ASN A CG  1 
ATOM   1639 O  OD1 . ASN A  1 223 ? 21.309  35.316 46.554  1.00 25.35 ? 246  ASN A OD1 1 
ATOM   1640 N  ND2 . ASN A  1 223 ? 23.151  34.823 45.338  1.00 16.27 ? 246  ASN A ND2 1 
ATOM   1641 O  OXT . ASN A  1 223 ? 24.801  33.970 50.632  1.00 27.11 ? 246  ASN A OXT 1 
ATOM   1642 N  N   . ILE B  1 1   ? 4.588   55.991 39.264  1.00 11.53 ? 24   ILE B N   1 
ATOM   1643 C  CA  . ILE B  1 1   ? 5.706   55.306 39.931  1.00 15.61 ? 24   ILE B CA  1 
ATOM   1644 C  C   . ILE B  1 1   ? 6.562   56.326 40.688  1.00 15.22 ? 24   ILE B C   1 
ATOM   1645 O  O   . ILE B  1 1   ? 7.064   57.263 40.080  1.00 15.14 ? 24   ILE B O   1 
ATOM   1646 C  CB  . ILE B  1 1   ? 6.609   54.584 38.896  1.00 11.70 ? 24   ILE B CB  1 
ATOM   1647 C  CG1 . ILE B  1 1   ? 5.824   53.525 38.090  1.00 14.30 ? 24   ILE B CG1 1 
ATOM   1648 C  CG2 . ILE B  1 1   ? 7.837   53.927 39.593  1.00 11.67 ? 24   ILE B CG2 1 
ATOM   1649 C  CD1 . ILE B  1 1   ? 5.458   52.297 38.918  1.00 13.05 ? 24   ILE B CD1 1 
ATOM   1650 N  N   . VAL B  1 2   ? 6.695   56.146 42.005  1.00 13.32 ? 25   VAL B N   1 
ATOM   1651 C  CA  . VAL B  1 2   ? 7.522   57.002 42.853  1.00 17.53 ? 25   VAL B CA  1 
ATOM   1652 C  C   . VAL B  1 2   ? 8.886   56.368 43.078  1.00 15.55 ? 25   VAL B C   1 
ATOM   1653 O  O   . VAL B  1 2   ? 8.993   55.187 43.445  1.00 14.79 ? 25   VAL B O   1 
ATOM   1654 C  CB  . VAL B  1 2   ? 6.851   57.212 44.231  1.00 16.72 ? 25   VAL B CB  1 
ATOM   1655 C  CG1 . VAL B  1 2   ? 7.689   58.144 45.127  1.00 13.91 ? 25   VAL B CG1 1 
ATOM   1656 C  CG2 . VAL B  1 2   ? 5.451   57.767 44.057  1.00 18.21 ? 25   VAL B CG2 1 
ATOM   1657 N  N   . GLY B  1 3   ? 9.948   57.152 42.887  1.00 13.32 ? 26   GLY B N   1 
ATOM   1658 C  CA  . GLY B  1 3   ? 11.282  56.675 43.227  1.00 17.01 ? 26   GLY B CA  1 
ATOM   1659 C  C   . GLY B  1 3   ? 11.838  55.639 42.261  1.00 25.27 ? 26   GLY B C   1 
ATOM   1660 O  O   . GLY B  1 3   ? 12.751  54.880 42.601  1.00 20.55 ? 26   GLY B O   1 
ATOM   1661 N  N   . GLY B  1 4   ? 11.282  55.605 41.054  1.00 17.90 ? 27   GLY B N   1 
ATOM   1662 C  CA  . GLY B  1 4   ? 11.759  54.704 40.016  1.00 15.81 ? 27   GLY B CA  1 
ATOM   1663 C  C   . GLY B  1 4   ? 12.696  55.375 39.025  1.00 15.30 ? 27   GLY B C   1 
ATOM   1664 O  O   . GLY B  1 4   ? 13.429  56.298 39.381  1.00 20.44 ? 27   GLY B O   1 
ATOM   1665 N  N   . TYR B  1 5   ? 12.675  54.894 37.786  1.00 13.25 ? 28   TYR B N   1 
ATOM   1666 C  CA  . TYR B  1 5   ? 13.546  55.402 36.731  1.00 17.07 ? 28   TYR B CA  1 
ATOM   1667 C  C   . TYR B  1 5   ? 12.825  55.358 35.398  1.00 17.56 ? 28   TYR B C   1 
ATOM   1668 O  O   . TYR B  1 5   ? 11.832  54.630 35.228  1.00 14.84 ? 28   TYR B O   1 
ATOM   1669 C  CB  . TYR B  1 5   ? 14.858  54.601 36.644  1.00 16.02 ? 28   TYR B CB  1 
ATOM   1670 C  CG  . TYR B  1 5   ? 14.688  53.120 36.344  1.00 17.23 ? 28   TYR B CG  1 
ATOM   1671 C  CD1 . TYR B  1 5   ? 14.337  52.224 37.342  1.00 20.56 ? 28   TYR B CD1 1 
ATOM   1672 C  CD2 . TYR B  1 5   ? 14.868  52.622 35.060  1.00 14.92 ? 28   TYR B CD2 1 
ATOM   1673 C  CE1 . TYR B  1 5   ? 14.178  50.867 37.072  1.00 17.45 ? 28   TYR B CE1 1 
ATOM   1674 C  CE2 . TYR B  1 5   ? 14.710  51.269 34.776  1.00 15.34 ? 28   TYR B CE2 1 
ATOM   1675 C  CZ  . TYR B  1 5   ? 14.357  50.397 35.799  1.00 18.93 ? 28   TYR B CZ  1 
ATOM   1676 O  OH  . TYR B  1 5   ? 14.200  49.045 35.551  1.00 16.28 ? 28   TYR B OH  1 
ATOM   1677 N  N   . THR B  1 6   ? 13.346  56.116 34.440  1.00 16.57 ? 29   THR B N   1 
ATOM   1678 C  CA  . THR B  1 6   ? 12.831  56.105 33.069  1.00 15.84 ? 29   THR B CA  1 
ATOM   1679 C  C   . THR B  1 6   ? 13.148  54.748 32.448  1.00 14.94 ? 29   THR B C   1 
ATOM   1680 O  O   . THR B  1 6   ? 14.309  54.344 32.356  1.00 17.72 ? 29   THR B O   1 
ATOM   1681 C  CB  . THR B  1 6   ? 13.468  57.244 32.251  1.00 17.89 ? 29   THR B CB  1 
ATOM   1682 O  OG1 . THR B  1 6   ? 13.040  58.506 32.780  1.00 19.15 ? 29   THR B OG1 1 
ATOM   1683 C  CG2 . THR B  1 6   ? 13.068  57.158 30.762  1.00 18.08 ? 29   THR B CG2 1 
ATOM   1684 N  N   . CYS B  1 7   ? 12.112  54.021 32.046  1.00 17.83 ? 30   CYS B N   1 
ATOM   1685 C  CA  . CYS B  1 7   ? 12.297  52.716 31.439  1.00 17.05 ? 30   CYS B CA  1 
ATOM   1686 C  C   . CYS B  1 7   ? 13.181  52.786 30.205  1.00 18.37 ? 30   CYS B C   1 
ATOM   1687 O  O   . CYS B  1 7   ? 14.078  51.957 30.020  1.00 18.08 ? 30   CYS B O   1 
ATOM   1688 C  CB  . CYS B  1 7   ? 10.943  52.098 31.032  1.00 12.75 ? 30   CYS B CB  1 
ATOM   1689 S  SG  . CYS B  1 7   ? 9.764   51.883 32.398  1.00 14.52 ? 30   CYS B SG  1 
ATOM   1690 N  N   . GLY B  1 8   ? 12.912  53.780 29.365  1.00 20.06 ? 31   GLY B N   1 
ATOM   1691 C  CA  . GLY B  1 8   ? 13.446  53.812 28.018  1.00 19.86 ? 31   GLY B CA  1 
ATOM   1692 C  C   . GLY B  1 8   ? 12.366  53.354 27.053  1.00 14.98 ? 31   GLY B C   1 
ATOM   1693 O  O   . GLY B  1 8   ? 11.615  52.406 27.336  1.00 12.72 ? 31   GLY B O   1 
ATOM   1694 N  N   . ALA B  1 9   ? 12.295  54.011 25.896  1.00 15.86 ? 32   ALA B N   1 
ATOM   1695 C  CA  . ALA B  1 9   ? 11.201  53.784 24.954  1.00 16.35 ? 32   ALA B CA  1 
ATOM   1696 C  C   . ALA B  1 9   ? 11.026  52.317 24.568  1.00 18.08 ? 32   ALA B C   1 
ATOM   1697 O  O   . ALA B  1 9   ? 11.956  51.667 24.089  1.00 17.25 ? 32   ALA B O   1 
ATOM   1698 C  CB  . ALA B  1 9   ? 11.378  54.637 23.702  1.00 20.32 ? 32   ALA B CB  1 
ATOM   1699 N  N   . ASN B  1 10  ? 9.820   51.814 24.800  1.00 15.01 ? 33   ASN B N   1 
ATOM   1700 C  CA  . ASN B  1 10  ? 9.415   50.470 24.392  1.00 12.45 ? 33   ASN B CA  1 
ATOM   1701 C  C   . ASN B  1 10  ? 10.239  49.302 24.958  1.00 17.26 ? 33   ASN B C   1 
ATOM   1702 O  O   . ASN B  1 10  ? 10.245  48.198 24.380  1.00 15.41 ? 33   ASN B O   1 
ATOM   1703 C  CB  . ASN B  1 10  ? 9.320   50.387 22.860  1.00 18.69 ? 33   ASN B CB  1 
ATOM   1704 C  CG  . ASN B  1 10  ? 8.627   51.596 22.253  1.00 20.41 ? 33   ASN B CG  1 
ATOM   1705 O  OD1 . ASN B  1 10  ? 9.263   52.423 21.583  1.00 19.26 ? 33   ASN B OD1 1 
ATOM   1706 N  ND2 . ASN B  1 10  ? 7.320   51.713 22.489  1.00 15.93 ? 33   ASN B ND2 1 
ATOM   1707 N  N   . THR B  1 11  ? 10.893  49.528 26.100  1.00 15.25 ? 34   THR B N   1 
ATOM   1708 C  CA  . THR B  1 11  ? 11.630  48.466 26.780  1.00 15.22 ? 34   THR B CA  1 
ATOM   1709 C  C   . THR B  1 11  ? 10.706  47.577 27.610  1.00 15.56 ? 34   THR B C   1 
ATOM   1710 O  O   . THR B  1 11  ? 11.133  46.551 28.144  1.00 15.18 ? 34   THR B O   1 
ATOM   1711 C  CB  . THR B  1 11  ? 12.757  49.030 27.679  1.00 16.64 ? 34   THR B CB  1 
ATOM   1712 O  OG1 . THR B  1 11  ? 12.198  49.877 28.684  1.00 13.06 ? 34   THR B OG1 1 
ATOM   1713 C  CG2 . THR B  1 11  ? 13.764  49.837 26.841  1.00 18.96 ? 34   THR B CG2 1 
ATOM   1714 N  N   . VAL B  1 12  ? 9.443   47.973 27.704  1.00 13.76 ? 35   VAL B N   1 
ATOM   1715 C  CA  . VAL B  1 12  ? 8.436   47.207 28.452  1.00 11.43 ? 35   VAL B CA  1 
ATOM   1716 C  C   . VAL B  1 12  ? 7.293   47.035 27.462  1.00 10.71 ? 35   VAL B C   1 
ATOM   1717 O  O   . VAL B  1 12  ? 6.254   47.657 27.607  1.00 11.25 ? 35   VAL B O   1 
ATOM   1718 C  CB  . VAL B  1 12  ? 7.996   47.975 29.758  1.00 10.95 ? 35   VAL B CB  1 
ATOM   1719 C  CG1 . VAL B  1 12  ? 7.020   47.156 30.598  1.00 12.84 ? 35   VAL B CG1 1 
ATOM   1720 C  CG2 . VAL B  1 12  ? 9.215   48.333 30.647  1.00 11.93 ? 35   VAL B CG2 1 
ATOM   1721 N  N   . PRO B  1 13  ? 7.498   46.207 26.424  1.00 13.28 ? 36   PRO B N   1 
ATOM   1722 C  CA  . PRO B  1 13  ? 6.600   46.249 25.259  1.00 11.40 ? 36   PRO B CA  1 
ATOM   1723 C  C   . PRO B  1 13  ? 5.208   45.655 25.497  1.00 10.83 ? 36   PRO B C   1 
ATOM   1724 O  O   . PRO B  1 13  ? 4.342   45.773 24.614  1.00 12.80 ? 36   PRO B O   1 
ATOM   1725 C  CB  . PRO B  1 13  ? 7.364   45.442 24.195  1.00 12.34 ? 36   PRO B CB  1 
ATOM   1726 C  CG  . PRO B  1 13  ? 8.200   44.460 25.023  1.00 14.04 ? 36   PRO B CG  1 
ATOM   1727 C  CD  . PRO B  1 13  ? 8.568   45.200 26.286  1.00 15.79 ? 36   PRO B CD  1 
ATOM   1728 N  N   . TYR B  1 14  ? 4.992   45.053 26.671  1.00 10.63 ? 37   TYR B N   1 
ATOM   1729 C  CA  . TYR B  1 14  ? 3.674   44.541 27.043  1.00 10.98 ? 37   TYR B CA  1 
ATOM   1730 C  C   . TYR B  1 14  ? 2.842   45.580 27.795  1.00 10.57 ? 37   TYR B C   1 
ATOM   1731 O  O   . TYR B  1 14  ? 1.655   45.356 28.045  1.00 8.28  ? 37   TYR B O   1 
ATOM   1732 C  CB  . TYR B  1 14  ? 3.833   43.288 27.900  1.00 10.46 ? 37   TYR B CB  1 
ATOM   1733 C  CG  . TYR B  1 14  ? 4.791   43.486 29.046  1.00 8.41  ? 37   TYR B CG  1 
ATOM   1734 C  CD1 . TYR B  1 14  ? 4.372   44.029 30.258  1.00 10.17 ? 37   TYR B CD1 1 
ATOM   1735 C  CD2 . TYR B  1 14  ? 6.131   43.142 28.910  1.00 10.45 ? 37   TYR B CD2 1 
ATOM   1736 C  CE1 . TYR B  1 14  ? 5.264   44.211 31.302  1.00 9.91  ? 37   TYR B CE1 1 
ATOM   1737 C  CE2 . TYR B  1 14  ? 7.020   43.314 29.938  1.00 10.88 ? 37   TYR B CE2 1 
ATOM   1738 C  CZ  . TYR B  1 14  ? 6.589   43.833 31.135  1.00 10.42 ? 37   TYR B CZ  1 
ATOM   1739 O  OH  . TYR B  1 14  ? 7.479   44.007 32.157  1.00 10.50 ? 37   TYR B OH  1 
ATOM   1740 N  N   . GLN B  1 15  ? 3.453   46.714 28.132  1.00 8.05  ? 38   GLN B N   1 
ATOM   1741 C  CA  . GLN B  1 15  ? 2.735   47.748 28.891  1.00 6.77  ? 38   GLN B CA  1 
ATOM   1742 C  C   . GLN B  1 15  ? 1.777   48.510 27.999  1.00 7.90  ? 38   GLN B C   1 
ATOM   1743 O  O   . GLN B  1 15  ? 2.156   49.048 26.952  1.00 10.11 ? 38   GLN B O   1 
ATOM   1744 C  CB  . GLN B  1 15  ? 3.710   48.765 29.489  1.00 8.32  ? 38   GLN B CB  1 
ATOM   1745 C  CG  . GLN B  1 15  ? 3.017   50.008 30.061  1.00 8.88  ? 38   GLN B CG  1 
ATOM   1746 C  CD  . GLN B  1 15  ? 2.591   49.851 31.510  1.00 12.52 ? 38   GLN B CD  1 
ATOM   1747 O  OE1 . GLN B  1 15  ? 3.386   49.436 32.353  1.00 13.67 ? 38   GLN B OE1 1 
ATOM   1748 N  NE2 . GLN B  1 15  ? 1.350   50.232 31.818  1.00 9.75  ? 38   GLN B NE2 1 
ATOM   1749 N  N   . VAL B  1 16  ? 0.519   48.570 28.404  1.00 6.52  ? 39   VAL B N   1 
ATOM   1750 C  CA  . VAL B  1 16  ? -0.405  49.395 27.639  1.00 11.31 ? 39   VAL B CA  1 
ATOM   1751 C  C   . VAL B  1 16  ? -0.936  50.536 28.488  1.00 13.18 ? 39   VAL B C   1 
ATOM   1752 O  O   . VAL B  1 16  ? -0.836  50.523 29.715  1.00 9.40  ? 39   VAL B O   1 
ATOM   1753 C  CB  . VAL B  1 16  ? -1.573  48.589 27.027  1.00 13.17 ? 39   VAL B CB  1 
ATOM   1754 C  CG1 . VAL B  1 16  ? -1.032  47.417 26.175  1.00 13.77 ? 39   VAL B CG1 1 
ATOM   1755 C  CG2 . VAL B  1 16  ? -2.539  48.111 28.115  1.00 13.24 ? 39   VAL B CG2 1 
ATOM   1756 N  N   . SER B  1 17  ? -1.471  51.540 27.809  1.00 7.75  ? 40   SER B N   1 
ATOM   1757 C  CA  . SER B  1 17  ? -2.218  52.605 28.467  1.00 9.19  ? 40   SER B CA  1 
ATOM   1758 C  C   . SER B  1 17  ? -3.690  52.440 28.108  1.00 9.78  ? 40   SER B C   1 
ATOM   1759 O  O   . SER B  1 17  ? -4.020  52.283 26.929  1.00 14.06 ? 40   SER B O   1 
ATOM   1760 C  CB  . SER B  1 17  ? -1.721  53.958 27.979  1.00 12.87 ? 40   SER B CB  1 
ATOM   1761 O  OG  . SER B  1 17  ? -2.603  55.000 28.375  1.00 15.34 ? 40   SER B OG  1 
ATOM   1762 N  N   . LEU B  1 18  ? -4.557  52.469 29.123  1.00 8.84  ? 41   LEU B N   1 
ATOM   1763 C  CA  . LEU B  1 18  ? -6.006  52.487 28.939  1.00 11.65 ? 41   LEU B CA  1 
ATOM   1764 C  C   . LEU B  1 18  ? -6.384  53.957 28.903  1.00 12.11 ? 41   LEU B C   1 
ATOM   1765 O  O   . LEU B  1 18  ? -6.068  54.715 29.825  1.00 9.36  ? 41   LEU B O   1 
ATOM   1766 C  CB  . LEU B  1 18  ? -6.743  51.758 30.067  1.00 10.94 ? 41   LEU B CB  1 
ATOM   1767 C  CG  . LEU B  1 18  ? -6.398  50.271 30.276  1.00 11.40 ? 41   LEU B CG  1 
ATOM   1768 C  CD1 . LEU B  1 18  ? -7.419  49.683 31.255  1.00 11.92 ? 41   LEU B CD1 1 
ATOM   1769 C  CD2 . LEU B  1 18  ? -6.401  49.512 28.955  1.00 10.55 ? 41   LEU B CD2 1 
ATOM   1770 N  N   . ASN B  1 19  ? -7.031  54.347 27.814  1.00 11.06 ? 42   ASN B N   1 
ATOM   1771 C  CA  . ASN B  1 19  ? -7.280  55.749 27.485  1.00 12.61 ? 42   ASN B CA  1 
ATOM   1772 C  C   . ASN B  1 19  ? -8.773  56.049 27.289  1.00 13.22 ? 42   ASN B C   1 
ATOM   1773 O  O   . ASN B  1 19  ? -9.488  55.275 26.660  1.00 14.61 ? 42   ASN B O   1 
ATOM   1774 C  CB  . ASN B  1 19  ? -6.511  56.074 26.206  1.00 14.03 ? 42   ASN B CB  1 
ATOM   1775 C  CG  . ASN B  1 19  ? -6.697  57.514 25.763  1.00 13.96 ? 42   ASN B CG  1 
ATOM   1776 O  OD1 . ASN B  1 19  ? -7.752  57.872 25.245  1.00 15.74 ? 42   ASN B OD1 1 
ATOM   1777 N  ND2 . ASN B  1 19  ? -5.687  58.338 25.981  1.00 11.22 ? 42   ASN B ND2 1 
ATOM   1778 N  N   . SER B  1 20  ? -9.246  57.167 27.839  1.00 13.76 ? 43   SER B N   1 
ATOM   1779 C  CA  . SER B  1 20  ? -10.617 57.617 27.555  1.00 15.66 ? 43   SER B CA  1 
ATOM   1780 C  C   . SER B  1 20  ? -10.567 59.096 27.246  1.00 20.72 ? 43   SER B C   1 
ATOM   1781 O  O   . SER B  1 20  ? -11.100 59.917 27.992  1.00 29.64 ? 43   SER B O   1 
ATOM   1782 C  CB  . SER B  1 20  ? -11.540 57.364 28.739  1.00 20.13 ? 43   SER B CB  1 
ATOM   1783 O  OG  . SER B  1 20  ? -12.888 57.564 28.334  1.00 28.13 ? 43   SER B OG  1 
ATOM   1784 N  N   . GLY B  1 21  ? -9.897  59.432 26.153  1.00 22.77 ? 44   GLY B N   1 
ATOM   1785 C  CA  . GLY B  1 21  ? -9.425  60.786 25.938  1.00 18.01 ? 44   GLY B CA  1 
ATOM   1786 C  C   . GLY B  1 21  ? -7.986  60.873 26.405  1.00 17.41 ? 44   GLY B C   1 
ATOM   1787 O  O   . GLY B  1 21  ? -7.069  61.044 25.591  1.00 16.96 ? 44   GLY B O   1 
ATOM   1788 N  N   . TYR B  1 22  ? -7.787  60.744 27.727  1.00 17.23 ? 45   TYR B N   1 
ATOM   1789 C  CA  . TYR B  1 22  ? -6.456  60.710 28.311  1.00 15.44 ? 45   TYR B CA  1 
ATOM   1790 C  C   . TYR B  1 22  ? -6.235  59.379 29.032  1.00 11.36 ? 45   TYR B C   1 
ATOM   1791 O  O   . TYR B  1 22  ? -7.189  58.648 29.331  1.00 11.62 ? 45   TYR B O   1 
ATOM   1792 C  CB  . TYR B  1 22  ? -6.283  61.830 29.333  1.00 15.40 ? 45   TYR B CB  1 
ATOM   1793 C  CG  . TYR B  1 22  ? -6.292  63.216 28.737  1.00 12.48 ? 45   TYR B CG  1 
ATOM   1794 C  CD1 . TYR B  1 22  ? -7.488  63.870 28.502  1.00 20.89 ? 45   TYR B CD1 1 
ATOM   1795 C  CD2 . TYR B  1 22  ? -5.110  63.864 28.431  1.00 14.42 ? 45   TYR B CD2 1 
ATOM   1796 C  CE1 . TYR B  1 22  ? -7.518  65.148 27.956  1.00 20.38 ? 45   TYR B CE1 1 
ATOM   1797 C  CE2 . TYR B  1 22  ? -5.121  65.157 27.883  1.00 18.93 ? 45   TYR B CE2 1 
ATOM   1798 C  CZ  . TYR B  1 22  ? -6.333  65.786 27.663  1.00 20.10 ? 45   TYR B CZ  1 
ATOM   1799 O  OH  . TYR B  1 22  ? -6.367  67.056 27.114  1.00 27.29 ? 45   TYR B OH  1 
ATOM   1800 N  N   . HIS B  1 23  ? -4.967  59.099 29.312  1.00 11.12 ? 46   HIS B N   1 
ATOM   1801 C  CA  . HIS B  1 23  ? -4.558  57.945 30.117  1.00 11.68 ? 46   HIS B CA  1 
ATOM   1802 C  C   . HIS B  1 23  ? -5.204  57.915 31.497  1.00 13.29 ? 46   HIS B C   1 
ATOM   1803 O  O   . HIS B  1 23  ? -5.196  58.916 32.230  1.00 11.48 ? 46   HIS B O   1 
ATOM   1804 C  CB  . HIS B  1 23  ? -3.037  57.977 30.292  1.00 11.62 ? 46   HIS B CB  1 
ATOM   1805 C  CG  . HIS B  1 23  ? -2.544  57.011 31.315  1.00 14.61 ? 46   HIS B CG  1 
ATOM   1806 N  ND1 . HIS B  1 23  ? -2.198  55.714 31.002  1.00 12.44 ? 46   HIS B ND1 1 
ATOM   1807 C  CD2 . HIS B  1 23  ? -2.383  57.134 32.654  1.00 12.57 ? 46   HIS B CD2 1 
ATOM   1808 C  CE1 . HIS B  1 23  ? -1.814  55.089 32.099  1.00 8.08  ? 46   HIS B CE1 1 
ATOM   1809 N  NE2 . HIS B  1 23  ? -1.921  55.924 33.119  1.00 11.40 ? 46   HIS B NE2 1 
ATOM   1810 N  N   . PHE B  1 24  ? -5.743  56.762 31.887  1.00 11.71 ? 47   PHE B N   1 
ATOM   1811 C  CA  . PHE B  1 24  ? -6.320  56.653 33.215  1.00 9.98  ? 47   PHE B CA  1 
ATOM   1812 C  C   . PHE B  1 24  ? -5.894  55.381 33.957  1.00 6.91  ? 47   PHE B C   1 
ATOM   1813 O  O   . PHE B  1 24  ? -6.085  55.276 35.160  1.00 9.94  ? 47   PHE B O   1 
ATOM   1814 C  CB  . PHE B  1 24  ? -7.861  56.799 33.172  1.00 11.05 ? 47   PHE B CB  1 
ATOM   1815 C  CG  . PHE B  1 24  ? -8.557  55.647 32.499  1.00 9.83  ? 47   PHE B CG  1 
ATOM   1816 C  CD1 . PHE B  1 24  ? -8.906  54.525 33.219  1.00 13.89 ? 47   PHE B CD1 1 
ATOM   1817 C  CD2 . PHE B  1 24  ? -8.840  55.692 31.129  1.00 12.74 ? 47   PHE B CD2 1 
ATOM   1818 C  CE1 . PHE B  1 24  ? -9.528  53.449 32.603  1.00 12.50 ? 47   PHE B CE1 1 
ATOM   1819 C  CE2 . PHE B  1 24  ? -9.468  54.627 30.495  1.00 12.70 ? 47   PHE B CE2 1 
ATOM   1820 C  CZ  . PHE B  1 24  ? -9.818  53.497 31.237  1.00 12.61 ? 47   PHE B CZ  1 
ATOM   1821 N  N   . CYS B  1 25  ? -5.337  54.401 33.244  1.00 10.69 ? 48   CYS B N   1 
ATOM   1822 C  CA  . CYS B  1 25  ? -4.900  53.166 33.916  1.00 6.22  ? 48   CYS B CA  1 
ATOM   1823 C  C   . CYS B  1 25  ? -3.879  52.473 33.062  1.00 7.83  ? 48   CYS B C   1 
ATOM   1824 O  O   . CYS B  1 25  ? -3.807  52.716 31.862  1.00 6.98  ? 48   CYS B O   1 
ATOM   1825 C  CB  . CYS B  1 25  ? -6.064  52.172 34.112  1.00 9.84  ? 48   CYS B CB  1 
ATOM   1826 S  SG  . CYS B  1 25  ? -6.944  52.328 35.689  1.00 10.46 ? 48   CYS B SG  1 
ATOM   1827 N  N   . GLY B  1 26  ? -3.114  51.576 33.679  1.00 5.87  ? 49   GLY B N   1 
ATOM   1828 C  CA  . GLY B  1 26  ? -2.207  50.739 32.924  1.00 7.70  ? 49   GLY B CA  1 
ATOM   1829 C  C   . GLY B  1 26  ? -2.841  49.395 32.621  1.00 7.82  ? 49   GLY B C   1 
ATOM   1830 O  O   . GLY B  1 26  ? -3.948  49.087 33.072  1.00 8.11  ? 49   GLY B O   1 
ATOM   1831 N  N   . GLY B  1 27  ? -2.135  48.591 31.831  1.00 8.16  ? 50   GLY B N   1 
ATOM   1832 C  CA  . GLY B  1 27  ? -2.574  47.237 31.549  1.00 11.13 ? 50   GLY B CA  1 
ATOM   1833 C  C   . GLY B  1 27  ? -1.438  46.437 30.959  1.00 8.26  ? 50   GLY B C   1 
ATOM   1834 O  O   . GLY B  1 27  ? -0.355  46.986 30.717  1.00 8.82  ? 50   GLY B O   1 
ATOM   1835 N  N   . SER B  1 28  ? -1.665  45.134 30.780  1.00 6.90  ? 51   SER B N   1 
ATOM   1836 C  CA  . SER B  1 28  ? -0.644  44.239 30.199  1.00 7.44  ? 51   SER B CA  1 
ATOM   1837 C  C   . SER B  1 28  ? -1.202  43.452 29.029  1.00 8.40  ? 51   SER B C   1 
ATOM   1838 O  O   . SER B  1 28  ? -2.278  42.827 29.115  1.00 8.54  ? 51   SER B O   1 
ATOM   1839 C  CB  . SER B  1 28  ? -0.100  43.263 31.253  1.00 9.70  ? 51   SER B CB  1 
ATOM   1840 O  OG  . SER B  1 28  ? 0.513   43.953 32.327  1.00 11.19 ? 51   SER B OG  1 
ATOM   1841 N  N   . LEU B  1 29  ? -0.480  43.474 27.913  1.00 8.62  ? 52   LEU B N   1 
ATOM   1842 C  CA  . LEU B  1 29  ? -0.873  42.685 26.743  1.00 9.92  ? 52   LEU B CA  1 
ATOM   1843 C  C   . LEU B  1 29  ? -0.492  41.216 26.956  1.00 9.87  ? 52   LEU B C   1 
ATOM   1844 O  O   . LEU B  1 29  ? 0.675   40.944 27.214  1.00 9.72  ? 52   LEU B O   1 
ATOM   1845 C  CB  . LEU B  1 29  ? -0.137  43.235 25.514  1.00 10.13 ? 52   LEU B CB  1 
ATOM   1846 C  CG  . LEU B  1 29  ? -0.653  42.746 24.176  1.00 9.65  ? 52   LEU B CG  1 
ATOM   1847 C  CD1 . LEU B  1 29  ? -2.088  43.190 24.004  1.00 13.61 ? 52   LEU B CD1 1 
ATOM   1848 C  CD2 . LEU B  1 29  ? 0.218   43.327 23.069  1.00 11.92 ? 52   LEU B CD2 1 
ATOM   1849 N  N   . ILE B  1 30  ? -1.459  40.290 26.894  1.00 8.84  ? 53   ILE B N   1 
ATOM   1850 C  CA  . ILE B  1 30  ? -1.151  38.858 27.097  1.00 12.59 ? 53   ILE B CA  1 
ATOM   1851 C  C   . ILE B  1 30  ? -1.314  38.011 25.829  1.00 13.04 ? 53   ILE B C   1 
ATOM   1852 O  O   . ILE B  1 30  ? -0.841  36.877 25.766  1.00 12.25 ? 53   ILE B O   1 
ATOM   1853 C  CB  . ILE B  1 30  ? -1.944  38.211 28.262  1.00 13.07 ? 53   ILE B CB  1 
ATOM   1854 C  CG1 . ILE B  1 30  ? -3.453  38.343 28.039  1.00 10.26 ? 53   ILE B CG1 1 
ATOM   1855 C  CG2 . ILE B  1 30  ? -1.498  38.804 29.593  1.00 11.45 ? 53   ILE B CG2 1 
ATOM   1856 C  CD1 . ILE B  1 30  ? -4.272  37.353 28.885  1.00 12.65 ? 53   ILE B CD1 1 
ATOM   1857 N  N   . ASN B  1 31  ? -2.016  38.549 24.849  1.00 11.22 ? 54   ASN B N   1 
ATOM   1858 C  CA  . ASN B  1 31  ? -1.931  38.042 23.475  1.00 15.93 ? 54   ASN B CA  1 
ATOM   1859 C  C   . ASN B  1 31  ? -2.355  39.113 22.498  1.00 15.93 ? 54   ASN B C   1 
ATOM   1860 O  O   . ASN B  1 31  ? -2.625  40.244 22.902  1.00 14.64 ? 54   ASN B O   1 
ATOM   1861 C  CB  . ASN B  1 31  ? -2.686  36.714 23.278  1.00 13.70 ? 54   ASN B CB  1 
ATOM   1862 C  CG  . ASN B  1 31  ? -4.184  36.835 23.446  1.00 16.45 ? 54   ASN B CG  1 
ATOM   1863 O  OD1 . ASN B  1 31  ? -4.796  37.867 23.158  1.00 14.61 ? 54   ASN B OD1 1 
ATOM   1864 N  ND2 . ASN B  1 31  ? -4.802  35.730 23.876  1.00 18.16 ? 54   ASN B ND2 1 
ATOM   1865 N  N   . SER B  1 32  ? -2.443  38.774 21.216  1.00 15.08 ? 55   SER B N   1 
ATOM   1866 C  CA  . SER B  1 32  ? -2.747  39.803 20.221  1.00 15.52 ? 55   SER B CA  1 
ATOM   1867 C  C   . SER B  1 32  ? -4.106  40.504 20.447  1.00 20.66 ? 55   SER B C   1 
ATOM   1868 O  O   . SER B  1 32  ? -4.318  41.620 19.989  1.00 18.24 ? 55   SER B O   1 
ATOM   1869 C  CB  . SER B  1 32  ? -2.644  39.227 18.792  1.00 18.60 ? 55   SER B CB  1 
ATOM   1870 O  OG  . SER B  1 32  ? -3.772  38.419 18.468  1.00 19.60 ? 55   SER B OG  1 
ATOM   1871 N  N   . GLN B  1 33  ? -5.029  39.874 21.167  1.00 11.03 ? 56   GLN B N   1 
ATOM   1872 C  CA  . GLN B  1 33  ? -6.362  40.423 21.248  1.00 11.77 ? 56   GLN B CA  1 
ATOM   1873 C  C   . GLN B  1 33  ? -6.838  40.694 22.663  1.00 10.64 ? 56   GLN B C   1 
ATOM   1874 O  O   . GLN B  1 33  ? -7.960  41.152 22.842  1.00 14.15 ? 56   GLN B O   1 
ATOM   1875 C  CB  . GLN B  1 33  ? -7.362  39.486 20.557  1.00 21.99 ? 56   GLN B CB  1 
ATOM   1876 C  CG  . GLN B  1 33  ? -7.419  39.684 19.053  1.00 27.55 ? 56   GLN B CG  1 
ATOM   1877 C  CD  . GLN B  1 33  ? -8.786  39.324 18.483  1.00 32.38 ? 56   GLN B CD  1 
ATOM   1878 O  OE1 . GLN B  1 33  ? -9.098  38.153 18.307  1.00 26.51 ? 56   GLN B OE1 1 
ATOM   1879 N  NE2 . GLN B  1 33  ? -9.616  40.342 18.221  1.00 33.47 ? 56   GLN B NE2 1 
ATOM   1880 N  N   . TRP B  1 34  ? -5.989  40.428 23.653  1.00 9.50  ? 57   TRP B N   1 
ATOM   1881 C  CA  . TRP B  1 34  ? -6.423  40.529 25.056  1.00 8.19  ? 57   TRP B CA  1 
ATOM   1882 C  C   . TRP B  1 34  ? -5.456  41.238 25.967  1.00 10.42 ? 57   TRP B C   1 
ATOM   1883 O  O   . TRP B  1 34  ? -4.246  40.996 25.918  1.00 10.19 ? 57   TRP B O   1 
ATOM   1884 C  CB  . TRP B  1 34  ? -6.665  39.128 25.640  1.00 9.31  ? 57   TRP B CB  1 
ATOM   1885 C  CG  . TRP B  1 34  ? -7.889  38.487 25.089  1.00 13.89 ? 57   TRP B CG  1 
ATOM   1886 C  CD1 . TRP B  1 34  ? -7.965  37.677 23.987  1.00 15.53 ? 57   TRP B CD1 1 
ATOM   1887 C  CD2 . TRP B  1 34  ? -9.226  38.611 25.597  1.00 14.13 ? 57   TRP B CD2 1 
ATOM   1888 N  NE1 . TRP B  1 34  ? -9.271  37.272 23.792  1.00 15.94 ? 57   TRP B NE1 1 
ATOM   1889 C  CE2 . TRP B  1 34  ? -10.061 37.823 24.767  1.00 15.32 ? 57   TRP B CE2 1 
ATOM   1890 C  CE3 . TRP B  1 34  ? -9.791  39.268 26.709  1.00 11.65 ? 57   TRP B CE3 1 
ATOM   1891 C  CZ2 . TRP B  1 34  ? -11.436 37.694 24.992  1.00 11.47 ? 57   TRP B CZ2 1 
ATOM   1892 C  CZ3 . TRP B  1 34  ? -11.162 39.162 26.922  1.00 13.55 ? 57   TRP B CZ3 1 
ATOM   1893 C  CH2 . TRP B  1 34  ? -11.972 38.368 26.066  1.00 15.29 ? 57   TRP B CH2 1 
ATOM   1894 N  N   . VAL B  1 35  ? -6.021  42.064 26.837  1.00 7.67  ? 58   VAL B N   1 
ATOM   1895 C  CA  . VAL B  1 35  ? -5.251  42.826 27.832  1.00 9.06  ? 58   VAL B CA  1 
ATOM   1896 C  C   . VAL B  1 35  ? -5.757  42.485 29.236  1.00 10.56 ? 58   VAL B C   1 
ATOM   1897 O  O   . VAL B  1 35  ? -6.972  42.347 29.463  1.00 11.72 ? 58   VAL B O   1 
ATOM   1898 C  CB  . VAL B  1 35  ? -5.384  44.355 27.599  1.00 7.82  ? 58   VAL B CB  1 
ATOM   1899 C  CG1 . VAL B  1 35  ? -4.987  45.168 28.837  1.00 12.04 ? 58   VAL B CG1 1 
ATOM   1900 C  CG2 . VAL B  1 35  ? -4.563  44.786 26.384  1.00 10.24 ? 58   VAL B CG2 1 
ATOM   1901 N  N   . VAL B  1 36  ? -4.821  42.326 30.162  1.00 6.59  ? 59   VAL B N   1 
ATOM   1902 C  CA  . VAL B  1 36  ? -5.137  42.211 31.594  1.00 8.82  ? 59   VAL B CA  1 
ATOM   1903 C  C   . VAL B  1 36  ? -4.944  43.535 32.342  1.00 7.43  ? 59   VAL B C   1 
ATOM   1904 O  O   . VAL B  1 36  ? -3.890  44.178 32.241  1.00 10.64 ? 59   VAL B O   1 
ATOM   1905 C  CB  . VAL B  1 36  ? -4.187  41.196 32.263  1.00 9.07  ? 59   VAL B CB  1 
ATOM   1906 C  CG1 . VAL B  1 36  ? -4.379  41.208 33.781  1.00 11.89 ? 59   VAL B CG1 1 
ATOM   1907 C  CG2 . VAL B  1 36  ? -4.431  39.841 31.706  1.00 11.95 ? 59   VAL B CG2 1 
ATOM   1908 N  N   . SER B  1 37  ? -5.925  43.906 33.152  1.00 8.64  ? 60   SER B N   1 
ATOM   1909 C  CA  . SER B  1 37  ? -5.847  45.145 33.939  1.00 8.80  ? 60   SER B CA  1 
ATOM   1910 C  C   . SER B  1 37  ? -6.550  44.927 35.267  1.00 8.90  ? 60   SER B C   1 
ATOM   1911 O  O   . SER B  1 37  ? -6.865  43.771 35.599  1.00 8.41  ? 60   SER B O   1 
ATOM   1912 C  CB  . SER B  1 37  ? -6.453  46.316 33.164  1.00 9.81  ? 60   SER B CB  1 
ATOM   1913 O  OG  . SER B  1 37  ? -6.194  47.571 33.816  1.00 7.96  ? 60   SER B OG  1 
ATOM   1914 N  N   . ALA B  1 38  ? -6.757  46.004 36.040  1.00 7.33  ? 61   ALA B N   1 
ATOM   1915 C  CA  . ALA B  1 38  ? -7.426  45.922 37.345  1.00 10.18 ? 61   ALA B CA  1 
ATOM   1916 C  C   . ALA B  1 38  ? -8.932  46.051 37.143  1.00 9.99  ? 61   ALA B C   1 
ATOM   1917 O  O   . ALA B  1 38  ? -9.368  46.836 36.300  1.00 7.94  ? 61   ALA B O   1 
ATOM   1918 C  CB  . ALA B  1 38  ? -6.943  47.021 38.272  1.00 6.56  ? 61   ALA B CB  1 
ATOM   1919 N  N   . ALA B  1 39  ? -9.722  45.280 37.885  1.00 7.66  ? 62   ALA B N   1 
ATOM   1920 C  CA  . ALA B  1 39  ? -11.184 45.441 37.851  1.00 10.16 ? 62   ALA B CA  1 
ATOM   1921 C  C   . ALA B  1 39  ? -11.598 46.889 38.114  1.00 11.69 ? 62   ALA B C   1 
ATOM   1922 O  O   . ALA B  1 39  ? -12.538 47.405 37.484  1.00 9.52  ? 62   ALA B O   1 
ATOM   1923 C  CB  . ALA B  1 39  ? -11.832 44.535 38.872  1.00 7.99  ? 62   ALA B CB  1 
ATOM   1924 N  N   . HIS B  1 40  ? -10.914 47.558 39.039  1.00 10.38 ? 63   HIS B N   1 
ATOM   1925 C  CA  . HIS B  1 40  ? -11.321 48.943 39.367  1.00 11.28 ? 63   HIS B CA  1 
ATOM   1926 C  C   . HIS B  1 40  ? -11.022 49.970 38.256  1.00 11.13 ? 63   HIS B C   1 
ATOM   1927 O  O   . HIS B  1 40  ? -11.409 51.143 38.345  1.00 9.91  ? 63   HIS B O   1 
ATOM   1928 C  CB  . HIS B  1 40  ? -10.817 49.380 40.753  1.00 10.69 ? 63   HIS B CB  1 
ATOM   1929 C  CG  . HIS B  1 40  ? -9.371  49.749 40.792  1.00 9.41  ? 63   HIS B CG  1 
ATOM   1930 N  ND1 . HIS B  1 40  ? -8.390  48.875 41.226  1.00 10.29 ? 63   HIS B ND1 1 
ATOM   1931 C  CD2 . HIS B  1 40  ? -8.730  50.897 40.468  1.00 8.29  ? 63   HIS B CD2 1 
ATOM   1932 C  CE1 . HIS B  1 40  ? -7.214  49.471 41.154  1.00 10.40 ? 63   HIS B CE1 1 
ATOM   1933 N  NE2 . HIS B  1 40  ? -7.389  50.699 40.688  1.00 11.96 ? 63   HIS B NE2 1 
ATOM   1934 N  N   . CYS B  1 41  ? -10.372 49.515 37.195  1.00 7.07  ? 64   CYS B N   1 
ATOM   1935 C  CA  . CYS B  1 41  ? -10.131 50.333 36.012  1.00 8.72  ? 64   CYS B CA  1 
ATOM   1936 C  C   . CYS B  1 41  ? -11.268 50.253 34.991  1.00 10.92 ? 64   CYS B C   1 
ATOM   1937 O  O   . CYS B  1 41  ? -11.215 50.919 33.963  1.00 12.70 ? 64   CYS B O   1 
ATOM   1938 C  CB  . CYS B  1 41  ? -8.828  49.912 35.326  1.00 10.21 ? 64   CYS B CB  1 
ATOM   1939 S  SG  . CYS B  1 41  ? -7.320  50.399 36.227  1.00 10.47 ? 64   CYS B SG  1 
ATOM   1940 N  N   . TYR B  1 42  ? -12.294 49.441 35.253  1.00 9.60  ? 65   TYR B N   1 
ATOM   1941 C  CA  . TYR B  1 42  ? -13.379 49.314 34.271  1.00 9.81  ? 65   TYR B CA  1 
ATOM   1942 C  C   . TYR B  1 42  ? -14.025 50.662 33.926  1.00 16.68 ? 65   TYR B C   1 
ATOM   1943 O  O   . TYR B  1 42  ? -14.405 51.441 34.821  1.00 14.54 ? 65   TYR B O   1 
ATOM   1944 C  CB  . TYR B  1 42  ? -14.461 48.359 34.764  1.00 16.83 ? 65   TYR B CB  1 
ATOM   1945 C  CG  . TYR B  1 42  ? -15.679 48.411 33.865  1.00 11.94 ? 65   TYR B CG  1 
ATOM   1946 C  CD1 . TYR B  1 42  ? -15.746 47.642 32.721  1.00 17.60 ? 65   TYR B CD1 1 
ATOM   1947 C  CD2 . TYR B  1 42  ? -16.757 49.239 34.172  1.00 18.35 ? 65   TYR B CD2 1 
ATOM   1948 C  CE1 . TYR B  1 42  ? -16.854 47.694 31.886  1.00 19.54 ? 65   TYR B CE1 1 
ATOM   1949 C  CE2 . TYR B  1 42  ? -17.867 49.301 33.342  1.00 24.66 ? 65   TYR B CE2 1 
ATOM   1950 C  CZ  . TYR B  1 42  ? -17.904 48.529 32.204  1.00 26.10 ? 65   TYR B CZ  1 
ATOM   1951 O  OH  . TYR B  1 42  ? -19.005 48.593 31.388  1.00 27.67 ? 65   TYR B OH  1 
ATOM   1952 N  N   . LYS B  1 43  ? -14.155 50.910 32.626  1.00 18.75 ? 66   LYS B N   1 
ATOM   1953 C  CA  . LYS B  1 43  ? -14.819 52.088 32.087  1.00 16.48 ? 66   LYS B CA  1 
ATOM   1954 C  C   . LYS B  1 43  ? -15.369 51.709 30.724  1.00 18.89 ? 66   LYS B C   1 
ATOM   1955 O  O   . LYS B  1 43  ? -14.718 51.000 29.970  1.00 18.49 ? 66   LYS B O   1 
ATOM   1956 C  CB  . LYS B  1 43  ? -13.825 53.255 31.930  1.00 19.63 ? 66   LYS B CB  1 
ATOM   1957 C  CG  . LYS B  1 43  ? -14.454 54.552 31.405  1.00 26.67 ? 66   LYS B CG  1 
ATOM   1958 C  CD  . LYS B  1 43  ? -13.601 55.764 31.746  1.00 24.17 ? 66   LYS B CD  1 
ATOM   1959 C  CE  . LYS B  1 43  ? -14.167 57.082 31.168  1.00 22.37 ? 66   LYS B CE  1 
ATOM   1960 N  NZ  . LYS B  1 43  ? -15.543 57.426 31.622  1.00 26.55 ? 66   LYS B NZ  1 
ATOM   1961 N  N   . SER B  1 44  ? -16.565 52.188 30.396  1.00 21.87 ? 67   SER B N   1 
ATOM   1962 C  CA  . SER B  1 44  ? -17.128 51.944 29.074  1.00 18.97 ? 67   SER B CA  1 
ATOM   1963 C  C   . SER B  1 44  ? -16.385 52.784 28.026  1.00 17.06 ? 67   SER B C   1 
ATOM   1964 O  O   . SER B  1 44  ? -15.983 53.907 28.307  1.00 24.14 ? 67   SER B O   1 
ATOM   1965 C  CB  . SER B  1 44  ? -18.630 52.293 29.081  1.00 20.91 ? 67   SER B CB  1 
ATOM   1966 O  OG  . SER B  1 44  ? -19.256 51.816 27.904  1.00 40.21 ? 67   SER B OG  1 
ATOM   1967 N  N   . GLY B  1 45  ? -16.223 52.244 26.821  1.00 19.94 ? 68   GLY B N   1 
ATOM   1968 C  CA  . GLY B  1 45  ? -15.644 52.973 25.696  1.00 24.65 ? 68   GLY B CA  1 
ATOM   1969 C  C   . GLY B  1 45  ? -14.138 53.189 25.782  1.00 27.61 ? 68   GLY B C   1 
ATOM   1970 O  O   . GLY B  1 45  ? -13.617 54.199 25.322  1.00 33.33 ? 68   GLY B O   1 
ATOM   1971 N  N   . ILE B  1 46  ? -13.438 52.239 26.388  1.00 24.45 ? 69   ILE B N   1 
ATOM   1972 C  CA  . ILE B  1 46  ? -11.996 52.325 26.537  1.00 27.42 ? 69   ILE B CA  1 
ATOM   1973 C  C   . ILE B  1 46  ? -11.321 52.233 25.171  1.00 21.03 ? 69   ILE B C   1 
ATOM   1974 O  O   . ILE B  1 46  ? -11.792 51.515 24.279  1.00 19.69 ? 69   ILE B O   1 
ATOM   1975 C  CB  . ILE B  1 46  ? -11.486 51.189 27.474  1.00 23.11 ? 69   ILE B CB  1 
ATOM   1976 C  CG1 . ILE B  1 46  ? -11.774 51.520 28.935  1.00 25.18 ? 69   ILE B CG1 1 
ATOM   1977 C  CG2 . ILE B  1 46  ? -10.001 50.956 27.325  1.00 17.68 ? 69   ILE B CG2 1 
ATOM   1978 C  CD1 . ILE B  1 46  ? -11.511 50.351 29.895  1.00 26.43 ? 69   ILE B CD1 1 
ATOM   1979 N  N   . GLN B  1 47  ? -10.242 52.996 24.991  1.00 14.37 ? 70   GLN B N   1 
ATOM   1980 C  CA  . GLN B  1 47  ? -9.290  52.733 23.922  1.00 12.16 ? 70   GLN B CA  1 
ATOM   1981 C  C   . GLN B  1 47  ? -7.981  52.249 24.527  1.00 13.58 ? 70   GLN B C   1 
ATOM   1982 O  O   . GLN B  1 47  ? -7.485  52.845 25.485  1.00 14.60 ? 70   GLN B O   1 
ATOM   1983 C  CB  . GLN B  1 47  ? -9.011  54.009 23.159  1.00 14.25 ? 70   GLN B CB  1 
ATOM   1984 C  CG  . GLN B  1 47  ? -8.000  53.834 22.054  1.00 17.13 ? 70   GLN B CG  1 
ATOM   1985 C  CD  . GLN B  1 47  ? -7.789  55.124 21.281  1.00 15.73 ? 70   GLN B CD  1 
ATOM   1986 O  OE1 . GLN B  1 47  ? -7.064  56.017 21.729  1.00 19.41 ? 70   GLN B OE1 1 
ATOM   1987 N  NE2 . GLN B  1 47  ? -8.427  55.229 20.119  1.00 16.96 ? 70   GLN B NE2 1 
ATOM   1988 N  N   . VAL B  1 48  ? -7.416  51.191 23.952  1.00 11.88 ? 71   VAL B N   1 
ATOM   1989 C  CA  . VAL B  1 48  ? -6.125  50.654 24.387  1.00 8.64  ? 71   VAL B CA  1 
ATOM   1990 C  C   . VAL B  1 48  ? -5.019  51.253 23.546  1.00 13.70 ? 71   VAL B C   1 
ATOM   1991 O  O   . VAL B  1 48  ? -5.081  51.201 22.305  1.00 13.33 ? 71   VAL B O   1 
ATOM   1992 C  CB  . VAL B  1 48  ? -6.098  49.113 24.260  1.00 10.24 ? 71   VAL B CB  1 
ATOM   1993 C  CG1 . VAL B  1 48  ? -4.715  48.533 24.639  1.00 13.42 ? 71   VAL B CG1 1 
ATOM   1994 C  CG2 . VAL B  1 48  ? -7.234  48.498 25.106  1.00 12.97 ? 71   VAL B CG2 1 
ATOM   1995 N  N   . ARG B  1 49  ? -4.018  51.842 24.206  1.00 10.72 ? 72   ARG B N   1 
ATOM   1996 C  CA  . ARG B  1 49  ? -2.852  52.360 23.494  1.00 10.11 ? 72   ARG B CA  1 
ATOM   1997 C  C   . ARG B  1 49  ? -1.633  51.512 23.730  1.00 10.31 ? 72   ARG B C   1 
ATOM   1998 O  O   . ARG B  1 49  ? -1.145  51.404 24.862  1.00 9.43  ? 72   ARG B O   1 
ATOM   1999 C  CB  . ARG B  1 49  ? -2.598  53.842 23.815  1.00 12.93 ? 72   ARG B CB  1 
ATOM   2000 C  CG  . ARG B  1 49  ? -3.841  54.660 23.480  1.00 11.00 ? 72   ARG B CG  1 
ATOM   2001 C  CD  . ARG B  1 49  ? -3.645  56.145 23.631  1.00 11.72 ? 72   ARG B CD  1 
ATOM   2002 N  NE  . ARG B  1 49  ? -4.791  56.824 23.028  1.00 12.05 ? 72   ARG B NE  1 
ATOM   2003 C  CZ  . ARG B  1 49  ? -4.867  58.141 22.844  1.00 18.87 ? 72   ARG B CZ  1 
ATOM   2004 N  NH1 . ARG B  1 49  ? -3.873  58.920 23.255  1.00 13.61 ? 72   ARG B NH1 1 
ATOM   2005 N  NH2 . ARG B  1 49  ? -5.936  58.673 22.252  1.00 16.21 ? 72   ARG B NH2 1 
ATOM   2006 N  N   . LEU B  1 50  ? -1.185  50.878 22.648  1.00 8.60  ? 73   LEU B N   1 
ATOM   2007 C  CA  . LEU B  1 50  ? -0.031  49.997 22.675  1.00 9.14  ? 73   LEU B CA  1 
ATOM   2008 C  C   . LEU B  1 50  ? 1.165   50.708 22.068  1.00 10.16 ? 73   LEU B C   1 
ATOM   2009 O  O   . LEU B  1 50  ? 1.021   51.679 21.310  1.00 12.14 ? 73   LEU B O   1 
ATOM   2010 C  CB  . LEU B  1 50  ? -0.327  48.702 21.915  1.00 9.12  ? 73   LEU B CB  1 
ATOM   2011 C  CG  . LEU B  1 50  ? -1.642  48.029 22.339  1.00 12.38 ? 73   LEU B CG  1 
ATOM   2012 C  CD1 . LEU B  1 50  ? -2.860  48.454 21.507  1.00 17.75 ? 73   LEU B CD1 1 
ATOM   2013 C  CD2 . LEU B  1 50  ? -1.511  46.501 22.359  1.00 15.57 ? 73   LEU B CD2 1 
ATOM   2014 N  N   . GLY B  1 51  ? 2.351   50.220 22.396  1.00 10.69 ? 74   GLY B N   1 
ATOM   2015 C  CA  . GLY B  1 51  ? 3.577   50.740 21.821  1.00 9.46  ? 74   GLY B CA  1 
ATOM   2016 C  C   . GLY B  1 51  ? 3.895   52.158 22.274  1.00 13.07 ? 74   GLY B C   1 
ATOM   2017 O  O   . GLY B  1 51  ? 4.638   52.873 21.609  1.00 15.16 ? 74   GLY B O   1 
ATOM   2018 N  N   . GLU B  1 52  ? 3.328   52.567 23.398  1.00 12.43 ? 75   GLU B N   1 
ATOM   2019 C  CA  . GLU B  1 52  ? 3.555   53.904 23.910  1.00 13.22 ? 75   GLU B CA  1 
ATOM   2020 C  C   . GLU B  1 52  ? 4.840   54.049 24.720  1.00 16.90 ? 75   GLU B C   1 
ATOM   2021 O  O   . GLU B  1 52  ? 5.175   53.171 25.527  1.00 13.98 ? 75   GLU B O   1 
ATOM   2022 C  CB  . GLU B  1 52  ? 2.368   54.322 24.785  1.00 14.27 ? 75   GLU B CB  1 
ATOM   2023 C  CG  . GLU B  1 52  ? 1.085   54.601 23.965  1.00 9.85  ? 75   GLU B CG  1 
ATOM   2024 C  CD  . GLU B  1 52  ? 1.040   56.052 23.523  1.00 12.89 ? 75   GLU B CD  1 
ATOM   2025 O  OE1 . GLU B  1 52  ? 2.131   56.598 23.464  1.00 11.70 ? 75   GLU B OE1 1 
ATOM   2026 O  OE2 . GLU B  1 52  ? -0.024  56.640 23.251  1.00 10.95 ? 75   GLU B OE2 1 
ATOM   2027 N  N   . ASP B  1 53  ? 5.551   55.162 24.512  1.00 10.71 ? 76   ASP B N   1 
ATOM   2028 C  CA  . ASP B  1 53  ? 6.495   55.653 25.521  1.00 12.45 ? 76   ASP B CA  1 
ATOM   2029 C  C   . ASP B  1 53  ? 6.043   56.998 26.061  1.00 9.19  ? 76   ASP B C   1 
ATOM   2030 O  O   . ASP B  1 53  ? 5.471   57.085 27.141  1.00 15.47 ? 76   ASP B O   1 
ATOM   2031 C  CB  . ASP B  1 53  ? 7.935   55.751 25.006  1.00 14.57 ? 76   ASP B CB  1 
ATOM   2032 C  CG  . ASP B  1 53  ? 8.920   56.034 26.134  1.00 17.68 ? 76   ASP B CG  1 
ATOM   2033 O  OD1 . ASP B  1 53  ? 8.762   55.411 27.214  1.00 15.72 ? 76   ASP B OD1 1 
ATOM   2034 O  OD2 . ASP B  1 53  ? 9.821   56.904 25.970  1.00 16.81 ? 76   ASP B OD2 1 
ATOM   2035 N  N   . ASN B  1 54  ? 6.315   58.075 25.332  1.00 13.25 ? 77   ASN B N   1 
ATOM   2036 C  CA  . ASN B  1 54  ? 5.809   59.380 25.754  1.00 15.57 ? 77   ASN B CA  1 
ATOM   2037 C  C   . ASN B  1 54  ? 4.331   59.422 25.461  1.00 15.28 ? 77   ASN B C   1 
ATOM   2038 O  O   . ASN B  1 54  ? 3.986   59.377 24.320  1.00 15.39 ? 77   ASN B O   1 
ATOM   2039 C  CB  . ASN B  1 54  ? 6.488   60.489 24.949  1.00 20.73 ? 77   ASN B CB  1 
ATOM   2040 C  CG  . ASN B  1 54  ? 6.069   61.880 25.395  1.00 21.26 ? 77   ASN B CG  1 
ATOM   2041 O  OD1 . ASN B  1 54  ? 4.881   62.150 25.661  1.00 18.31 ? 77   ASN B OD1 1 
ATOM   2042 N  ND2 . ASN B  1 54  ? 7.055   62.785 25.484  1.00 19.30 ? 77   ASN B ND2 1 
ATOM   2043 N  N   . ILE B  1 55  ? 3.443   59.532 26.438  1.00 14.78 ? 78   ILE B N   1 
ATOM   2044 C  CA  . ILE B  1 55  ? 2.025   59.374 26.111  1.00 17.20 ? 78   ILE B CA  1 
ATOM   2045 C  C   . ILE B  1 55  ? 1.360   60.636 25.550  1.00 18.04 ? 78   ILE B C   1 
ATOM   2046 O  O   . ILE B  1 55  ? 0.216   60.588 25.088  1.00 16.06 ? 78   ILE B O   1 
ATOM   2047 C  CB  . ILE B  1 55  ? 1.201   58.819 27.282  1.00 20.59 ? 78   ILE B CB  1 
ATOM   2048 C  CG1 . ILE B  1 55  ? 1.533   59.587 28.556  1.00 18.90 ? 78   ILE B CG1 1 
ATOM   2049 C  CG2 . ILE B  1 55  ? 1.421   57.300 27.404  1.00 18.04 ? 78   ILE B CG2 1 
ATOM   2050 C  CD1 . ILE B  1 55  ? 0.447   59.507 29.572  1.00 25.52 ? 78   ILE B CD1 1 
ATOM   2051 N  N   . ASN B  1 56  ? 2.094   61.748 25.554  1.00 14.30 ? 79   ASN B N   1 
ATOM   2052 C  CA  . ASN B  1 56  ? 1.546   63.020 25.096  1.00 22.41 ? 79   ASN B CA  1 
ATOM   2053 C  C   . ASN B  1 56  ? 1.935   63.329 23.666  1.00 24.28 ? 79   ASN B C   1 
ATOM   2054 O  O   . ASN B  1 56  ? 1.355   64.211 23.029  1.00 22.93 ? 79   ASN B O   1 
ATOM   2055 C  CB  . ASN B  1 56  ? 2.028   64.169 25.985  1.00 18.58 ? 79   ASN B CB  1 
ATOM   2056 C  CG  . ASN B  1 56  ? 1.419   64.132 27.369  1.00 28.07 ? 79   ASN B CG  1 
ATOM   2057 O  OD1 . ASN B  1 56  ? 0.231   63.836 27.533  1.00 27.73 ? 79   ASN B OD1 1 
ATOM   2058 N  ND2 . ASN B  1 56  ? 2.231   64.437 28.379  1.00 27.11 ? 79   ASN B ND2 1 
ATOM   2059 N  N   . VAL B  1 57  ? 2.920   62.608 23.154  1.00 15.53 ? 80   VAL B N   1 
ATOM   2060 C  CA  . VAL B  1 57  ? 3.499   62.958 21.868  1.00 16.88 ? 80   VAL B CA  1 
ATOM   2061 C  C   . VAL B  1 57  ? 3.490   61.754 20.961  1.00 17.84 ? 80   VAL B C   1 
ATOM   2062 O  O   . VAL B  1 57  ? 3.874   60.703 21.404  1.00 16.22 ? 80   VAL B O   1 
ATOM   2063 C  CB  . VAL B  1 57  ? 4.975   63.357 22.068  1.00 21.72 ? 80   VAL B CB  1 
ATOM   2064 C  CG1 . VAL B  1 57  ? 5.724   63.400 20.749  1.00 23.49 ? 80   VAL B CG1 1 
ATOM   2065 C  CG2 . VAL B  1 57  ? 5.068   64.675 22.813  1.00 16.59 ? 80   VAL B CG2 1 
ATOM   2066 N  N   . VAL B  1 58  ? 3.114   61.890 19.689  1.00 15.13 ? 81   VAL B N   1 
ATOM   2067 C  CA  . VAL B  1 58  ? 3.178   60.752 18.758  1.00 15.19 ? 81   VAL B CA  1 
ATOM   2068 C  C   . VAL B  1 58  ? 4.609   60.430 18.316  1.00 22.02 ? 81   VAL B C   1 
ATOM   2069 O  O   . VAL B  1 58  ? 5.253   61.241 17.644  1.00 20.42 ? 81   VAL B O   1 
ATOM   2070 C  CB  . VAL B  1 58  ? 2.366   61.021 17.477  1.00 11.57 ? 81   VAL B CB  1 
ATOM   2071 C  CG1 . VAL B  1 58  ? 2.459   59.829 16.514  1.00 11.37 ? 81   VAL B CG1 1 
ATOM   2072 C  CG2 . VAL B  1 58  ? 0.922   61.324 17.819  1.00 14.89 ? 81   VAL B CG2 1 
ATOM   2073 N  N   . GLU B  1 59  ? 5.099   59.231 18.637  1.00 18.54 ? 82   GLU B N   1 
ATOM   2074 C  CA  . GLU B  1 59  ? 6.476   58.881 18.296  1.00 15.84 ? 82   GLU B CA  1 
ATOM   2075 C  C   . GLU B  1 59  ? 6.610   57.852 17.184  1.00 14.49 ? 82   GLU B C   1 
ATOM   2076 O  O   . GLU B  1 59  ? 7.710   57.607 16.681  1.00 20.12 ? 82   GLU B O   1 
ATOM   2077 C  CB  . GLU B  1 59  ? 7.248   58.425 19.548  1.00 15.06 ? 82   GLU B CB  1 
ATOM   2078 C  CG  . GLU B  1 59  ? 7.273   59.492 20.652  1.00 15.41 ? 82   GLU B CG  1 
ATOM   2079 C  CD  . GLU B  1 59  ? 7.950   59.006 21.919  1.00 28.11 ? 82   GLU B CD  1 
ATOM   2080 O  OE1 . GLU B  1 59  ? 7.354   58.152 22.611  1.00 16.96 ? 82   GLU B OE1 1 
ATOM   2081 O  OE2 . GLU B  1 59  ? 9.065   59.490 22.229  1.00 25.84 ? 82   GLU B OE2 1 
ATOM   2082 N  N   . GLY B  1 60  ? 5.512   57.218 16.802  1.00 14.69 ? 83   GLY B N   1 
ATOM   2083 C  CA  . GLY B  1 60  ? 5.576   56.346 15.650  1.00 14.03 ? 83   GLY B CA  1 
ATOM   2084 C  C   . GLY B  1 60  ? 5.302   54.876 15.888  1.00 15.82 ? 83   GLY B C   1 
ATOM   2085 O  O   . GLY B  1 60  ? 4.961   54.154 14.943  1.00 18.78 ? 83   GLY B O   1 
ATOM   2086 N  N   . ASN B  1 61  ? 5.425   54.420 17.130  1.00 15.55 ? 84   ASN B N   1 
ATOM   2087 C  CA  . ASN B  1 61  ? 5.253   52.988 17.380  1.00 14.78 ? 84   ASN B CA  1 
ATOM   2088 C  C   . ASN B  1 61  ? 3.922   52.639 18.022  1.00 11.28 ? 84   ASN B C   1 
ATOM   2089 O  O   . ASN B  1 61  ? 3.694   51.484 18.383  1.00 12.93 ? 84   ASN B O   1 
ATOM   2090 C  CB  . ASN B  1 61  ? 6.446   52.430 18.169  1.00 16.86 ? 84   ASN B CB  1 
ATOM   2091 C  CG  . ASN B  1 61  ? 7.763   52.629 17.427  1.00 21.23 ? 84   ASN B CG  1 
ATOM   2092 O  OD1 . ASN B  1 61  ? 8.673   53.320 17.902  1.00 24.92 ? 84   ASN B OD1 1 
ATOM   2093 N  ND2 . ASN B  1 61  ? 7.852   52.058 16.237  1.00 14.92 ? 84   ASN B ND2 1 
ATOM   2094 N  N   . GLU B  1 62  ? 3.040   53.633 18.130  1.00 13.45 ? 85   GLU B N   1 
ATOM   2095 C  CA  . GLU B  1 62  ? 1.741   53.459 18.764  1.00 14.87 ? 85   GLU B CA  1 
ATOM   2096 C  C   . GLU B  1 62  ? 0.768   52.664 17.920  1.00 11.69 ? 85   GLU B C   1 
ATOM   2097 O  O   . GLU B  1 62  ? 0.763   52.754 16.694  1.00 13.53 ? 85   GLU B O   1 
ATOM   2098 C  CB  . GLU B  1 62  ? 1.080   54.822 19.039  1.00 13.89 ? 85   GLU B CB  1 
ATOM   2099 C  CG  . GLU B  1 62  ? 1.869   55.720 19.955  1.00 13.09 ? 85   GLU B CG  1 
ATOM   2100 C  CD  . GLU B  1 62  ? 2.852   56.609 19.198  1.00 16.54 ? 85   GLU B CD  1 
ATOM   2101 O  OE1 . GLU B  1 62  ? 3.115   56.409 18.009  1.00 14.23 ? 85   GLU B OE1 1 
ATOM   2102 O  OE2 . GLU B  1 62  ? 3.419   57.507 19.802  1.00 17.63 ? 85   GLU B OE2 1 
ATOM   2103 N  N   . GLN B  1 63  ? -0.071  51.887 18.586  1.00 10.09 ? 86   GLN B N   1 
ATOM   2104 C  CA  . GLN B  1 63  ? -1.285  51.388 17.956  1.00 9.80  ? 86   GLN B CA  1 
ATOM   2105 C  C   . GLN B  1 63  ? -2.430  51.785 18.856  1.00 11.92 ? 86   GLN B C   1 
ATOM   2106 O  O   . GLN B  1 63  ? -2.372  51.556 20.054  1.00 12.47 ? 86   GLN B O   1 
ATOM   2107 C  CB  . GLN B  1 63  ? -1.238  49.865 17.803  1.00 12.38 ? 86   GLN B CB  1 
ATOM   2108 C  CG  . GLN B  1 63  ? -0.217  49.424 16.769  1.00 12.77 ? 86   GLN B CG  1 
ATOM   2109 C  CD  . GLN B  1 63  ? -0.032  47.922 16.688  1.00 13.28 ? 86   GLN B CD  1 
ATOM   2110 O  OE1 . GLN B  1 63  ? -1.003  47.186 16.571  1.00 14.36 ? 86   GLN B OE1 1 
ATOM   2111 N  NE2 . GLN B  1 63  ? 1.218   47.468 16.734  1.00 13.80 ? 86   GLN B NE2 1 
ATOM   2112 N  N   . PHE B  1 64  ? -3.473  52.360 18.269  1.00 15.03 ? 87   PHE B N   1 
ATOM   2113 C  CA  . PHE B  1 64  ? -4.643  52.790 19.003  1.00 13.75 ? 87   PHE B CA  1 
ATOM   2114 C  C   . PHE B  1 64  ? -5.786  51.842 18.670  1.00 13.03 ? 87   PHE B C   1 
ATOM   2115 O  O   . PHE B  1 64  ? -6.225  51.773 17.515  1.00 14.75 ? 87   PHE B O   1 
ATOM   2116 C  CB  . PHE B  1 64  ? -5.003  54.240 18.603  1.00 14.07 ? 87   PHE B CB  1 
ATOM   2117 C  CG  . PHE B  1 64  ? -3.861  55.222 18.755  1.00 15.90 ? 87   PHE B CG  1 
ATOM   2118 C  CD1 . PHE B  1 64  ? -3.514  55.722 20.007  1.00 21.33 ? 87   PHE B CD1 1 
ATOM   2119 C  CD2 . PHE B  1 64  ? -3.144  55.662 17.651  1.00 21.22 ? 87   PHE B CD2 1 
ATOM   2120 C  CE1 . PHE B  1 64  ? -2.476  56.636 20.154  1.00 20.11 ? 87   PHE B CE1 1 
ATOM   2121 C  CE2 . PHE B  1 64  ? -2.098  56.565 17.796  1.00 17.12 ? 87   PHE B CE2 1 
ATOM   2122 C  CZ  . PHE B  1 64  ? -1.766  57.065 19.042  1.00 16.72 ? 87   PHE B CZ  1 
ATOM   2123 N  N   . ILE B  1 65  ? -6.262  51.077 19.654  1.00 10.14 ? 88   ILE B N   1 
ATOM   2124 C  CA  . ILE B  1 65  ? -7.299  50.065 19.394  1.00 13.30 ? 88   ILE B CA  1 
ATOM   2125 C  C   . ILE B  1 65  ? -8.434  50.088 20.431  1.00 15.80 ? 88   ILE B C   1 
ATOM   2126 O  O   . ILE B  1 65  ? -8.211  49.945 21.641  1.00 15.57 ? 88   ILE B O   1 
ATOM   2127 C  CB  . ILE B  1 65  ? -6.739  48.621 19.335  1.00 13.56 ? 88   ILE B CB  1 
ATOM   2128 C  CG1 . ILE B  1 65  ? -5.518  48.525 18.405  1.00 15.42 ? 88   ILE B CG1 1 
ATOM   2129 C  CG2 . ILE B  1 65  ? -7.854  47.644 18.902  1.00 13.62 ? 88   ILE B CG2 1 
ATOM   2130 C  CD1 . ILE B  1 65  ? -4.890  47.137 18.394  1.00 15.78 ? 88   ILE B CD1 1 
ATOM   2131 N  N   . SER B  1 66  ? -9.655  50.255 19.939  1.00 15.73 ? 89   SER B N   1 
ATOM   2132 C  CA  . SER B  1 66  ? -10.833 50.260 20.783  1.00 15.20 ? 89   SER B CA  1 
ATOM   2133 C  C   . SER B  1 66  ? -10.971 48.943 21.511  1.00 16.89 ? 89   SER B C   1 
ATOM   2134 O  O   . SER B  1 66  ? -10.705 47.897 20.932  1.00 13.97 ? 89   SER B O   1 
ATOM   2135 C  CB  . SER B  1 66  ? -12.077 50.484 19.926  1.00 18.02 ? 89   SER B CB  1 
ATOM   2136 O  OG  . SER B  1 66  ? -12.156 51.831 19.515  1.00 28.21 ? 89   SER B OG  1 
ATOM   2137 N  N   . ALA B  1 67  ? -11.388 48.993 22.774  1.00 15.27 ? 90   ALA B N   1 
ATOM   2138 C  CA  . ALA B  1 67  ? -11.769 47.788 23.487  1.00 17.04 ? 90   ALA B CA  1 
ATOM   2139 C  C   . ALA B  1 67  ? -13.148 47.356 23.000  1.00 15.75 ? 90   ALA B C   1 
ATOM   2140 O  O   . ALA B  1 67  ? -14.064 48.179 22.924  1.00 22.59 ? 90   ALA B O   1 
ATOM   2141 C  CB  . ALA B  1 67  ? -11.801 48.058 24.977  1.00 16.85 ? 90   ALA B CB  1 
ATOM   2142 N  N   . SER B  1 68  ? -13.305 46.082 22.664  1.00 15.42 ? 91   SER B N   1 
ATOM   2143 C  CA  . SER B  1 68  ? -14.622 45.591 22.269  1.00 19.21 ? 91   SER B CA  1 
ATOM   2144 C  C   . SER B  1 68  ? -15.388 44.940 23.425  1.00 20.78 ? 91   SER B C   1 
ATOM   2145 O  O   . SER B  1 68  ? -16.627 44.938 23.441  1.00 20.77 ? 91   SER B O   1 
ATOM   2146 C  CB  . SER B  1 68  ? -14.512 44.631 21.092  1.00 24.65 ? 91   SER B CB  1 
ATOM   2147 O  OG  . SER B  1 68  ? -13.719 43.502 21.419  1.00 25.12 ? 91   SER B OG  1 
ATOM   2148 N  N   . LYS B  1 69  ? -14.655 44.397 24.393  1.00 19.09 ? 92   LYS B N   1 
ATOM   2149 C  CA  . LYS B  1 69  ? -15.258 43.765 25.564  1.00 21.29 ? 92   LYS B CA  1 
ATOM   2150 C  C   . LYS B  1 69  ? -14.415 44.127 26.764  1.00 16.25 ? 92   LYS B C   1 
ATOM   2151 O  O   . LYS B  1 69  ? -13.190 44.112 26.673  1.00 16.36 ? 92   LYS B O   1 
ATOM   2152 C  CB  . LYS B  1 69  ? -15.236 42.228 25.429  1.00 13.77 ? 92   LYS B CB  1 
ATOM   2153 C  CG  . LYS B  1 69  ? -16.050 41.650 24.301  1.00 24.97 ? 92   LYS B CG  1 
ATOM   2154 C  CD  . LYS B  1 69  ? -16.038 40.117 24.390  1.00 25.75 ? 92   LYS B CD  1 
ATOM   2155 C  CE  . LYS B  1 69  ? -17.148 39.497 23.541  1.00 38.52 ? 92   LYS B CE  1 
ATOM   2156 N  NZ  . LYS B  1 69  ? -16.630 38.925 22.278  1.00 36.24 ? 92   LYS B NZ  1 
ATOM   2157 N  N   . SER B  1 70  ? -15.054 44.447 27.883  1.00 13.85 ? 93   SER B N   1 
ATOM   2158 C  CA  . SER B  1 70  ? -14.338 44.552 29.155  1.00 16.21 ? 93   SER B CA  1 
ATOM   2159 C  C   . SER B  1 70  ? -14.990 43.568 30.126  1.00 18.65 ? 93   SER B C   1 
ATOM   2160 O  O   . SER B  1 70  ? -16.182 43.684 30.427  1.00 24.99 ? 93   SER B O   1 
ATOM   2161 C  CB  . SER B  1 70  ? -14.381 45.983 29.692  1.00 16.32 ? 93   SER B CB  1 
ATOM   2162 O  OG  . SER B  1 70  ? -13.828 46.885 28.750  1.00 25.45 ? 93   SER B OG  1 
ATOM   2163 N  N   . ILE B  1 71  ? -14.225 42.576 30.583  1.00 12.25 ? 94   ILE B N   1 
ATOM   2164 C  CA  . ILE B  1 71  ? -14.795 41.503 31.412  1.00 12.80 ? 94   ILE B CA  1 
ATOM   2165 C  C   . ILE B  1 71  ? -14.161 41.543 32.806  1.00 12.50 ? 94   ILE B C   1 
ATOM   2166 O  O   . ILE B  1 71  ? -13.029 41.092 32.998  1.00 10.41 ? 94   ILE B O   1 
ATOM   2167 C  CB  . ILE B  1 71  ? -14.593 40.116 30.753  1.00 16.38 ? 94   ILE B CB  1 
ATOM   2168 C  CG1 . ILE B  1 71  ? -15.260 40.092 29.368  1.00 15.42 ? 94   ILE B CG1 1 
ATOM   2169 C  CG2 . ILE B  1 71  ? -15.158 39.013 31.619  1.00 11.92 ? 94   ILE B CG2 1 
ATOM   2170 C  CD1 . ILE B  1 71  ? -14.823 38.933 28.530  1.00 18.82 ? 94   ILE B CD1 1 
ATOM   2171 N  N   . VAL B  1 72  ? -14.891 42.097 33.770  1.00 12.26 ? 95   VAL B N   1 
ATOM   2172 C  CA  . VAL B  1 72  ? -14.381 42.217 35.143  1.00 12.90 ? 95   VAL B CA  1 
ATOM   2173 C  C   . VAL B  1 72  ? -14.552 40.848 35.771  1.00 11.53 ? 95   VAL B C   1 
ATOM   2174 O  O   . VAL B  1 72  ? -15.504 40.122 35.437  1.00 16.50 ? 95   VAL B O   1 
ATOM   2175 C  CB  . VAL B  1 72  ? -15.201 43.273 35.922  1.00 9.78  ? 95   VAL B CB  1 
ATOM   2176 C  CG1 . VAL B  1 72  ? -14.791 43.348 37.375  1.00 15.79 ? 95   VAL B CG1 1 
ATOM   2177 C  CG2 . VAL B  1 72  ? -15.071 44.685 35.258  1.00 11.71 ? 95   VAL B CG2 1 
ATOM   2178 N  N   . HIS B  1 73  ? -13.654 40.469 36.677  1.00 9.75  ? 96   HIS B N   1 
ATOM   2179 C  CA  . HIS B  1 73  ? -13.819 39.177 37.339  1.00 9.88  ? 96   HIS B CA  1 
ATOM   2180 C  C   . HIS B  1 73  ? -15.193 39.113 38.024  1.00 13.61 ? 96   HIS B C   1 
ATOM   2181 O  O   . HIS B  1 73  ? -15.605 40.063 38.691  1.00 12.60 ? 96   HIS B O   1 
ATOM   2182 C  CB  . HIS B  1 73  ? -12.710 38.937 38.362  1.00 9.69  ? 96   HIS B CB  1 
ATOM   2183 C  CG  . HIS B  1 73  ? -12.648 37.520 38.823  1.00 10.53 ? 96   HIS B CG  1 
ATOM   2184 N  ND1 . HIS B  1 73  ? -13.473 37.019 39.811  1.00 12.80 ? 96   HIS B ND1 1 
ATOM   2185 C  CD2 . HIS B  1 73  ? -11.882 36.483 38.407  1.00 8.02  ? 96   HIS B CD2 1 
ATOM   2186 C  CE1 . HIS B  1 73  ? -13.206 35.736 39.992  1.00 13.34 ? 96   HIS B CE1 1 
ATOM   2187 N  NE2 . HIS B  1 73  ? -12.243 35.385 39.156  1.00 14.35 ? 96   HIS B NE2 1 
ATOM   2188 N  N   . PRO B  1 74  ? -15.914 37.996 37.846  1.00 11.53 ? 97   PRO B N   1 
ATOM   2189 C  CA  . PRO B  1 74  ? -17.287 37.956 38.362  1.00 12.86 ? 97   PRO B CA  1 
ATOM   2190 C  C   . PRO B  1 74  ? -17.315 38.088 39.883  1.00 13.65 ? 97   PRO B C   1 
ATOM   2191 O  O   . PRO B  1 74  ? -18.326 38.557 40.427  1.00 16.28 ? 97   PRO B O   1 
ATOM   2192 C  CB  . PRO B  1 74  ? -17.791 36.577 37.928  1.00 13.89 ? 97   PRO B CB  1 
ATOM   2193 C  CG  . PRO B  1 74  ? -16.524 35.782 37.584  1.00 14.85 ? 97   PRO B CG  1 
ATOM   2194 C  CD  . PRO B  1 74  ? -15.527 36.769 37.122  1.00 11.76 ? 97   PRO B CD  1 
ATOM   2195 N  N   . SER B  1 75  ? -16.227 37.713 40.558  1.00 11.98 ? 98   SER B N   1 
ATOM   2196 C  CA  . SER B  1 75  ? -16.181 37.879 42.016  1.00 11.90 ? 98   SER B CA  1 
ATOM   2197 C  C   . SER B  1 75  ? -15.418 39.112 42.513  1.00 8.20  ? 98   SER B C   1 
ATOM   2198 O  O   . SER B  1 75  ? -15.096 39.195 43.709  1.00 10.11 ? 98   SER B O   1 
ATOM   2199 C  CB  . SER B  1 75  ? -15.636 36.624 42.697  1.00 13.91 ? 98   SER B CB  1 
ATOM   2200 O  OG  . SER B  1 75  ? -16.531 35.521 42.560  1.00 16.03 ? 98   SER B OG  1 
ATOM   2201 N  N   . TYR B  1 76  ? -15.128 40.068 41.628  1.00 9.42  ? 99   TYR B N   1 
ATOM   2202 C  CA  . TYR B  1 76  ? -14.539 41.339 42.063  1.00 8.49  ? 99   TYR B CA  1 
ATOM   2203 C  C   . TYR B  1 76  ? -15.405 41.991 43.136  1.00 14.02 ? 99   TYR B C   1 
ATOM   2204 O  O   . TYR B  1 76  ? -16.601 42.168 42.960  1.00 13.08 ? 99   TYR B O   1 
ATOM   2205 C  CB  . TYR B  1 76  ? -14.409 42.324 40.896  1.00 7.81  ? 99   TYR B CB  1 
ATOM   2206 C  CG  . TYR B  1 76  ? -14.031 43.717 41.345  1.00 9.00  ? 99   TYR B CG  1 
ATOM   2207 C  CD1 . TYR B  1 76  ? -12.866 43.940 42.110  1.00 8.14  ? 99   TYR B CD1 1 
ATOM   2208 C  CD2 . TYR B  1 76  ? -14.807 44.818 40.991  1.00 10.71 ? 99   TYR B CD2 1 
ATOM   2209 C  CE1 . TYR B  1 76  ? -12.521 45.220 42.508  1.00 11.21 ? 99   TYR B CE1 1 
ATOM   2210 C  CE2 . TYR B  1 76  ? -14.465 46.105 41.385  1.00 14.76 ? 99   TYR B CE2 1 
ATOM   2211 C  CZ  . TYR B  1 76  ? -13.322 46.301 42.135  1.00 12.97 ? 99   TYR B CZ  1 
ATOM   2212 O  OH  . TYR B  1 76  ? -12.960 47.570 42.534  1.00 15.27 ? 99   TYR B OH  1 
ATOM   2213 N  N   . ASN B  1 77  ? -14.779 42.362 44.238  1.00 10.09 ? 100  ASN B N   1 
ATOM   2214 C  CA  . ASN B  1 77  ? -15.476 42.968 45.358  1.00 9.96  ? 100  ASN B CA  1 
ATOM   2215 C  C   . ASN B  1 77  ? -14.918 44.379 45.502  1.00 9.66  ? 100  ASN B C   1 
ATOM   2216 O  O   . ASN B  1 77  ? -13.756 44.564 45.867  1.00 10.24 ? 100  ASN B O   1 
ATOM   2217 C  CB  . ASN B  1 77  ? -15.192 42.129 46.609  1.00 14.54 ? 100  ASN B CB  1 
ATOM   2218 C  CG  . ASN B  1 77  ? -15.950 42.616 47.834  1.00 11.64 ? 100  ASN B CG  1 
ATOM   2219 O  OD1 . ASN B  1 77  ? -16.090 43.816 48.046  1.00 12.04 ? 100  ASN B OD1 1 
ATOM   2220 N  ND2 . ASN B  1 77  ? -16.468 41.680 48.625  1.00 16.34 ? 100  ASN B ND2 1 
ATOM   2221 N  N   . SER B  1 78  ? -15.712 45.381 45.144  1.00 7.02  ? 101  SER B N   1 
ATOM   2222 C  CA  . SER B  1 78  ? -15.212 46.756 45.173  1.00 14.07 ? 101  SER B CA  1 
ATOM   2223 C  C   . SER B  1 78  ? -15.049 47.278 46.604  1.00 12.86 ? 101  SER B C   1 
ATOM   2224 O  O   . SER B  1 78  ? -14.521 48.381 46.813  1.00 13.45 ? 101  SER B O   1 
ATOM   2225 C  CB  . SER B  1 78  ? -16.150 47.674 44.403  1.00 16.43 ? 101  SER B CB  1 
ATOM   2226 O  OG  . SER B  1 78  ? -17.441 47.637 44.982  1.00 16.56 ? 101  SER B OG  1 
ATOM   2227 N  N   . ASN B  1 79  ? -15.540 46.525 47.585  1.00 8.86  ? 102  ASN B N   1 
ATOM   2228 C  CA  . ASN B  1 79  ? -15.356 46.945 48.973  1.00 9.62  ? 102  ASN B CA  1 
ATOM   2229 C  C   . ASN B  1 79  ? -14.053 46.431 49.577  1.00 10.80 ? 102  ASN B C   1 
ATOM   2230 O  O   . ASN B  1 79  ? -13.423 47.141 50.334  1.00 13.06 ? 102  ASN B O   1 
ATOM   2231 C  CB  . ASN B  1 79  ? -16.527 46.497 49.861  1.00 10.35 ? 102  ASN B CB  1 
ATOM   2232 C  CG  . ASN B  1 79  ? -17.826 47.175 49.505  1.00 16.64 ? 102  ASN B CG  1 
ATOM   2233 O  OD1 . ASN B  1 79  ? -17.860 48.369 49.247  1.00 22.89 ? 102  ASN B OD1 1 
ATOM   2234 N  ND2 . ASN B  1 79  ? -18.902 46.412 49.482  1.00 23.48 ? 102  ASN B ND2 1 
ATOM   2235 N  N   . THR B  1 80  ? -13.678 45.187 49.270  1.00 10.69 ? 103  THR B N   1 
ATOM   2236 C  CA  . THR B  1 80  ? -12.498 44.569 49.874  1.00 8.23  ? 103  THR B CA  1 
ATOM   2237 C  C   . THR B  1 80  ? -11.322 44.543 48.888  1.00 11.86 ? 103  THR B C   1 
ATOM   2238 O  O   . THR B  1 80  ? -10.165 44.285 49.261  1.00 9.48  ? 103  THR B O   1 
ATOM   2239 C  CB  . THR B  1 80  ? -12.768 43.110 50.305  1.00 15.29 ? 103  THR B CB  1 
ATOM   2240 O  OG1 . THR B  1 80  ? -13.074 42.312 49.148  1.00 11.67 ? 103  THR B OG1 1 
ATOM   2241 C  CG2 . THR B  1 80  ? -13.916 43.044 51.302  1.00 13.48 ? 103  THR B CG2 1 
ATOM   2242 N  N   . LEU B  1 81  ? -11.640 44.846 47.640  1.00 11.59 ? 104  LEU B N   1 
ATOM   2243 C  CA  . LEU B  1 81  ? -10.720 44.777 46.503  1.00 8.58  ? 104  LEU B CA  1 
ATOM   2244 C  C   . LEU B  1 81  ? -10.231 43.351 46.230  1.00 10.84 ? 104  LEU B C   1 
ATOM   2245 O  O   . LEU B  1 81  ? -9.273  43.167 45.481  1.00 10.50 ? 104  LEU B O   1 
ATOM   2246 C  CB  . LEU B  1 81  ? -9.554  45.775 46.622  1.00 8.51  ? 104  LEU B CB  1 
ATOM   2247 C  CG  . LEU B  1 81  ? -10.013 47.205 46.934  1.00 12.61 ? 104  LEU B CG  1 
ATOM   2248 C  CD1 . LEU B  1 81  ? -8.830  48.186 47.061  1.00 14.18 ? 104  LEU B CD1 1 
ATOM   2249 C  CD2 . LEU B  1 81  ? -11.001 47.670 45.845  1.00 17.65 ? 104  LEU B CD2 1 
ATOM   2250 N  N   . ASN B  1 82  ? -10.917 42.348 46.770  1.00 10.10 ? 105  ASN B N   1 
ATOM   2251 C  CA  . ASN B  1 82  ? -10.653 40.970 46.344  1.00 9.05  ? 105  ASN B CA  1 
ATOM   2252 C  C   . ASN B  1 82  ? -10.990 40.756 44.840  1.00 10.17 ? 105  ASN B C   1 
ATOM   2253 O  O   . ASN B  1 82  ? -11.985 41.279 44.336  1.00 9.03  ? 105  ASN B O   1 
ATOM   2254 C  CB  . ASN B  1 82  ? -11.436 39.986 47.211  1.00 8.04  ? 105  ASN B CB  1 
ATOM   2255 C  CG  . ASN B  1 82  ? -10.836 38.591 47.207  1.00 12.77 ? 105  ASN B CG  1 
ATOM   2256 O  OD1 . ASN B  1 82  ? -9.617  38.409 47.024  1.00 13.12 ? 105  ASN B OD1 1 
ATOM   2257 N  ND2 . ASN B  1 82  ? -11.686 37.592 47.442  1.00 13.50 ? 105  ASN B ND2 1 
ATOM   2258 N  N   . ASN B  1 83  ? -10.164 39.969 44.148  1.00 7.64  ? 106  ASN B N   1 
ATOM   2259 C  CA  . ASN B  1 83  ? -10.360 39.648 42.720  1.00 9.12  ? 106  ASN B CA  1 
ATOM   2260 C  C   . ASN B  1 83  ? -10.319 40.871 41.806  1.00 8.56  ? 106  ASN B C   1 
ATOM   2261 O  O   . ASN B  1 83  ? -11.108 40.982 40.866  1.00 9.84  ? 106  ASN B O   1 
ATOM   2262 C  CB  . ASN B  1 83  ? -11.652 38.873 42.495  1.00 11.07 ? 106  ASN B CB  1 
ATOM   2263 C  CG  . ASN B  1 83  ? -11.731 37.640 43.345  1.00 11.42 ? 106  ASN B CG  1 
ATOM   2264 O  OD1 . ASN B  1 83  ? -10.827 36.786 43.327  1.00 11.49 ? 106  ASN B OD1 1 
ATOM   2265 N  ND2 . ASN B  1 83  ? -12.806 37.541 44.133  1.00 10.84 ? 106  ASN B ND2 1 
ATOM   2266 N  N   . ASP B  1 84  ? -9.372  41.767 42.079  1.00 7.85  ? 107  ASP B N   1 
ATOM   2267 C  CA  . ASP B  1 84  ? -9.235  43.005 41.315  1.00 9.54  ? 107  ASP B CA  1 
ATOM   2268 C  C   . ASP B  1 84  ? -8.514  42.750 39.968  1.00 11.06 ? 107  ASP B C   1 
ATOM   2269 O  O   . ASP B  1 84  ? -7.323  43.080 39.767  1.00 7.92  ? 107  ASP B O   1 
ATOM   2270 C  CB  . ASP B  1 84  ? -8.565  44.076 42.199  1.00 6.68  ? 107  ASP B CB  1 
ATOM   2271 C  CG  . ASP B  1 84  ? -8.591  45.465 41.570  1.00 13.15 ? 107  ASP B CG  1 
ATOM   2272 O  OD1 . ASP B  1 84  ? -9.322  45.641 40.590  1.00 9.50  ? 107  ASP B OD1 1 
ATOM   2273 O  OD2 . ASP B  1 84  ? -7.871  46.368 42.052  1.00 10.86 ? 107  ASP B OD2 1 
ATOM   2274 N  N   . ILE B  1 85  ? -9.259  42.159 39.033  1.00 9.67  ? 108  ILE B N   1 
ATOM   2275 C  CA  . ILE B  1 85  ? -8.688  41.790 37.744  1.00 9.73  ? 108  ILE B CA  1 
ATOM   2276 C  C   . ILE B  1 85  ? -9.781  41.866 36.687  1.00 8.88  ? 108  ILE B C   1 
ATOM   2277 O  O   . ILE B  1 85  ? -10.979 41.572 36.962  1.00 11.54 ? 108  ILE B O   1 
ATOM   2278 C  CB  . ILE B  1 85  ? -8.029  40.377 37.795  1.00 6.29  ? 108  ILE B CB  1 
ATOM   2279 C  CG1 . ILE B  1 85  ? -7.373  40.054 36.453  1.00 10.28 ? 108  ILE B CG1 1 
ATOM   2280 C  CG2 . ILE B  1 85  ? -9.074  39.276 38.160  1.00 8.57  ? 108  ILE B CG2 1 
ATOM   2281 C  CD1 . ILE B  1 85  ? -6.541  38.779 36.520  1.00 14.38 ? 108  ILE B CD1 1 
ATOM   2282 N  N   . MET B  1 86  ? -9.381  42.339 35.508  1.00 11.16 ? 109  MET B N   1 
ATOM   2283 C  CA  . MET B  1 86  ? -10.294 42.531 34.395  1.00 12.41 ? 109  MET B CA  1 
ATOM   2284 C  C   . MET B  1 86  ? -9.577  42.152 33.109  1.00 10.79 ? 109  MET B C   1 
ATOM   2285 O  O   . MET B  1 86  ? -8.375  42.409 32.959  1.00 10.71 ? 109  MET B O   1 
ATOM   2286 C  CB  . MET B  1 86  ? -10.726 44.004 34.312  1.00 9.60  ? 109  MET B CB  1 
ATOM   2287 C  CG  . MET B  1 86  ? -11.607 44.346 33.126  1.00 12.03 ? 109  MET B CG  1 
ATOM   2288 S  SD  . MET B  1 86  ? -12.057 46.117 33.136  1.00 13.86 ? 109  MET B SD  1 
ATOM   2289 C  CE  . MET B  1 86  ? -10.438 46.849 33.154  1.00 7.59  ? 109  MET B CE  1 
ATOM   2290 N  N   . LEU B  1 87  ? -10.311 41.505 32.215  1.00 8.05  ? 110  LEU B N   1 
ATOM   2291 C  CA  . LEU B  1 87  ? -9.834  41.266 30.864  1.00 8.19  ? 110  LEU B CA  1 
ATOM   2292 C  C   . LEU B  1 87  ? -10.522 42.178 29.873  1.00 9.74  ? 110  LEU B C   1 
ATOM   2293 O  O   . LEU B  1 87  ? -11.754 42.381 29.904  1.00 10.29 ? 110  LEU B O   1 
ATOM   2294 C  CB  . LEU B  1 87  ? -10.057 39.812 30.452  1.00 8.76  ? 110  LEU B CB  1 
ATOM   2295 C  CG  . LEU B  1 87  ? -9.048  38.818 31.017  1.00 12.89 ? 110  LEU B CG  1 
ATOM   2296 C  CD1 . LEU B  1 87  ? -9.602  37.389 30.870  1.00 13.31 ? 110  LEU B CD1 1 
ATOM   2297 C  CD2 . LEU B  1 87  ? -7.704  38.941 30.309  1.00 9.74  ? 110  LEU B CD2 1 
ATOM   2298 N  N   . ILE B  1 88  ? -9.702  42.739 28.994  1.00 9.58  ? 111  ILE B N   1 
ATOM   2299 C  CA  . ILE B  1 88  ? -10.177 43.580 27.906  1.00 13.13 ? 111  ILE B CA  1 
ATOM   2300 C  C   . ILE B  1 88  ? -9.883  42.902 26.566  1.00 16.28 ? 111  ILE B C   1 
ATOM   2301 O  O   . ILE B  1 88  ? -8.733  42.532 26.272  1.00 9.63  ? 111  ILE B O   1 
ATOM   2302 C  CB  . ILE B  1 88  ? -9.465  44.952 27.955  1.00 11.58 ? 111  ILE B CB  1 
ATOM   2303 C  CG1 . ILE B  1 88  ? -9.876  45.717 29.225  1.00 11.11 ? 111  ILE B CG1 1 
ATOM   2304 C  CG2 . ILE B  1 88  ? -9.695  45.718 26.636  1.00 12.61 ? 111  ILE B CG2 1 
ATOM   2305 C  CD1 . ILE B  1 88  ? -9.083  47.022 29.461  1.00 14.59 ? 111  ILE B CD1 1 
ATOM   2306 N  N   . LYS B  1 89  ? -10.918 42.739 25.739  1.00 11.22 ? 112  LYS B N   1 
ATOM   2307 C  CA  . LYS B  1 89  ? -10.695 42.257 24.373  1.00 11.66 ? 112  LYS B CA  1 
ATOM   2308 C  C   . LYS B  1 89  ? -10.554 43.421 23.391  1.00 11.09 ? 112  LYS B C   1 
ATOM   2309 O  O   . LYS B  1 89  ? -11.315 44.391 23.436  1.00 15.80 ? 112  LYS B O   1 
ATOM   2310 C  CB  . LYS B  1 89  ? -11.801 41.319 23.906  1.00 14.75 ? 112  LYS B CB  1 
ATOM   2311 C  CG  . LYS B  1 89  ? -11.441 40.601 22.607  1.00 12.01 ? 112  LYS B CG  1 
ATOM   2312 C  CD  . LYS B  1 89  ? -12.551 39.603 22.205  1.00 18.32 ? 112  LYS B CD  1 
ATOM   2313 C  CE  . LYS B  1 89  ? -12.199 38.878 20.908  1.00 22.66 ? 112  LYS B CE  1 
ATOM   2314 N  NZ  . LYS B  1 89  ? -13.422 38.218 20.322  1.00 27.67 ? 112  LYS B NZ  1 
ATOM   2315 N  N   . LEU B  1 90  ? -9.560  43.327 22.523  1.00 13.80 ? 113  LEU B N   1 
ATOM   2316 C  CA  . LEU B  1 90  ? -9.348  44.385 21.527  1.00 13.30 ? 113  LEU B CA  1 
ATOM   2317 C  C   . LEU B  1 90  ? -10.300 44.194 20.355  1.00 14.42 ? 113  LEU B C   1 
ATOM   2318 O  O   . LEU B  1 90  ? -10.629 43.064 19.979  1.00 13.66 ? 113  LEU B O   1 
ATOM   2319 C  CB  . LEU B  1 90  ? -7.913  44.355 21.024  1.00 12.13 ? 113  LEU B CB  1 
ATOM   2320 C  CG  . LEU B  1 90  ? -6.861  44.526 22.123  1.00 14.86 ? 113  LEU B CG  1 
ATOM   2321 C  CD1 . LEU B  1 90  ? -5.467  44.561 21.531  1.00 13.49 ? 113  LEU B CD1 1 
ATOM   2322 C  CD2 . LEU B  1 90  ? -7.140  45.797 22.888  1.00 17.14 ? 113  LEU B CD2 1 
ATOM   2323 N  N   . LYS B  1 91  ? -10.750 45.301 19.779  1.00 16.01 ? 114  LYS B N   1 
ATOM   2324 C  CA  . LYS B  1 91  ? -11.727 45.237 18.685  1.00 21.07 ? 114  LYS B CA  1 
ATOM   2325 C  C   . LYS B  1 91  ? -11.107 44.577 17.457  1.00 20.01 ? 114  LYS B C   1 
ATOM   2326 O  O   . LYS B  1 91  ? -11.780 43.864 16.713  1.00 21.89 ? 114  LYS B O   1 
ATOM   2327 C  CB  . LYS B  1 91  ? -12.252 46.632 18.348  1.00 17.48 ? 114  LYS B CB  1 
ATOM   2328 C  CG  . LYS B  1 91  ? -13.199 46.674 17.174  1.00 21.62 ? 114  LYS B CG  1 
ATOM   2329 C  CD  . LYS B  1 91  ? -13.526 48.140 16.849  1.00 33.52 ? 114  LYS B CD  1 
ATOM   2330 C  CE  . LYS B  1 91  ? -14.647 48.285 15.817  1.00 52.01 ? 114  LYS B CE  1 
ATOM   2331 N  NZ  . LYS B  1 91  ? -15.045 49.721 15.634  1.00 50.45 ? 114  LYS B NZ  1 
ATOM   2332 N  N   . SER B  1 92  ? -9.816  44.811 17.267  1.00 15.65 ? 115  SER B N   1 
ATOM   2333 C  CA  . SER B  1 92  ? -9.023  44.111 16.262  1.00 18.14 ? 115  SER B CA  1 
ATOM   2334 C  C   . SER B  1 92  ? -7.710  43.631 16.875  1.00 19.72 ? 115  SER B C   1 
ATOM   2335 O  O   . SER B  1 92  ? -7.259  44.172 17.881  1.00 18.13 ? 115  SER B O   1 
ATOM   2336 C  CB  . SER B  1 92  ? -8.742  45.031 15.068  1.00 20.39 ? 115  SER B CB  1 
ATOM   2337 O  OG  . SER B  1 92  ? -8.069  46.208 15.491  1.00 24.28 ? 115  SER B OG  1 
ATOM   2338 N  N   . ALA B  1 93  ? -7.092  42.614 16.278  1.00 19.03 ? 116  ALA B N   1 
ATOM   2339 C  CA  . ALA B  1 93  ? -5.837  42.078 16.810  1.00 17.98 ? 116  ALA B CA  1 
ATOM   2340 C  C   . ALA B  1 93  ? -4.712  43.094 16.663  1.00 19.41 ? 116  ALA B C   1 
ATOM   2341 O  O   . ALA B  1 93  ? -4.554  43.717 15.617  1.00 19.61 ? 116  ALA B O   1 
ATOM   2342 C  CB  . ALA B  1 93  ? -5.456  40.776 16.117  1.00 21.25 ? 116  ALA B CB  1 
ATOM   2343 N  N   . ALA B  1 94  ? -3.927  43.255 17.717  1.00 16.92 ? 117  ALA B N   1 
ATOM   2344 C  CA  . ALA B  1 94  ? -2.780  44.148 17.669  1.00 17.74 ? 117  ALA B CA  1 
ATOM   2345 C  C   . ALA B  1 94  ? -1.790  43.551 16.700  1.00 19.03 ? 117  ALA B C   1 
ATOM   2346 O  O   . ALA B  1 94  ? -1.714  42.329 16.543  1.00 19.12 ? 117  ALA B O   1 
ATOM   2347 C  CB  . ALA B  1 94  ? -2.154  44.281 19.059  1.00 14.41 ? 117  ALA B CB  1 
ATOM   2348 N  N   . SER B  1 95  ? -1.052  44.407 16.003  1.00 15.70 ? 118  SER B N   1 
ATOM   2349 C  CA  . SER B  1 95  ? 0.029   43.899 15.198  1.00 17.72 ? 118  SER B CA  1 
ATOM   2350 C  C   . SER B  1 95  ? 1.236   43.774 16.115  1.00 18.66 ? 118  SER B C   1 
ATOM   2351 O  O   . SER B  1 95  ? 1.863   44.777 16.459  1.00 17.60 ? 118  SER B O   1 
ATOM   2352 C  CB  . SER B  1 95  ? 0.319   44.856 14.047  1.00 20.62 ? 118  SER B CB  1 
ATOM   2353 O  OG  . SER B  1 95  ? 1.380   44.352 13.265  1.00 24.28 ? 118  SER B OG  1 
ATOM   2354 N  N   . LEU B  1 96  ? 1.548   42.550 16.537  1.00 21.42 ? 119  LEU B N   1 
ATOM   2355 C  CA  . LEU B  1 96  ? 2.615   42.351 17.518  1.00 16.17 ? 119  LEU B CA  1 
ATOM   2356 C  C   . LEU B  1 96  ? 3.950   42.621 16.851  1.00 19.47 ? 119  LEU B C   1 
ATOM   2357 O  O   . LEU B  1 96  ? 4.155   42.255 15.698  1.00 17.82 ? 119  LEU B O   1 
ATOM   2358 C  CB  . LEU B  1 96  ? 2.577   40.934 18.127  1.00 13.55 ? 119  LEU B CB  1 
ATOM   2359 C  CG  . LEU B  1 96  ? 1.309   40.584 18.912  1.00 15.18 ? 119  LEU B CG  1 
ATOM   2360 C  CD1 . LEU B  1 96  ? 1.324   39.149 19.447  1.00 13.99 ? 119  LEU B CD1 1 
ATOM   2361 C  CD2 . LEU B  1 96  ? 1.143   41.561 20.075  1.00 20.99 ? 119  LEU B CD2 1 
ATOM   2362 N  N   . ASN B  1 97  ? 4.839   43.301 17.562  1.00 19.75 ? 120  ASN B N   1 
ATOM   2363 C  CA  . ASN B  1 97  ? 6.190   43.578 17.074  1.00 15.44 ? 120  ASN B CA  1 
ATOM   2364 C  C   . ASN B  1 97  ? 7.077   43.894 18.284  1.00 16.28 ? 120  ASN B C   1 
ATOM   2365 O  O   . ASN B  1 97  ? 6.660   43.695 19.422  1.00 19.13 ? 120  ASN B O   1 
ATOM   2366 C  CB  . ASN B  1 97  ? 6.190   44.732 16.043  1.00 19.30 ? 120  ASN B CB  1 
ATOM   2367 C  CG  . ASN B  1 97  ? 5.643   46.041 16.611  1.00 19.95 ? 120  ASN B CG  1 
ATOM   2368 O  OD1 . ASN B  1 97  ? 6.002   46.446 17.709  1.00 19.07 ? 120  ASN B OD1 1 
ATOM   2369 N  ND2 . ASN B  1 97  ? 4.769   46.707 15.854  1.00 19.23 ? 120  ASN B ND2 1 
ATOM   2370 N  N   . SER B  1 98  ? 8.287   44.391 18.049  1.00 17.71 ? 121  SER B N   1 
ATOM   2371 C  CA  . SER B  1 98  ? 9.232   44.579 19.144  1.00 17.84 ? 121  SER B CA  1 
ATOM   2372 C  C   . SER B  1 98  ? 8.805   45.615 20.178  1.00 18.58 ? 121  SER B C   1 
ATOM   2373 O  O   . SER B  1 98  ? 9.342   45.628 21.295  1.00 21.58 ? 121  SER B O   1 
ATOM   2374 C  CB  . SER B  1 98  ? 10.636  44.902 18.613  1.00 18.70 ? 121  SER B CB  1 
ATOM   2375 O  OG  . SER B  1 98  ? 10.658  46.159 17.974  1.00 19.01 ? 121  SER B OG  1 
ATOM   2376 N  N   . ARG B  1 99  ? 7.843   46.468 19.819  1.00 17.18 ? 122  ARG B N   1 
ATOM   2377 C  CA  . ARG B  1 99  ? 7.368   47.518 20.713  1.00 16.36 ? 122  ARG B CA  1 
ATOM   2378 C  C   . ARG B  1 99  ? 5.989   47.211 21.253  1.00 17.34 ? 122  ARG B C   1 
ATOM   2379 O  O   . ARG B  1 99  ? 5.472   47.928 22.123  1.00 16.18 ? 122  ARG B O   1 
ATOM   2380 C  CB  . ARG B  1 99  ? 7.342   48.864 19.977  1.00 17.23 ? 122  ARG B CB  1 
ATOM   2381 C  CG  . ARG B  1 99  ? 8.727   49.355 19.584  1.00 23.81 ? 122  ARG B CG  1 
ATOM   2382 C  CD  . ARG B  1 99  ? 9.037   49.066 18.125  1.00 28.82 ? 122  ARG B CD  1 
ATOM   2383 N  NE  . ARG B  1 99  ? 10.314  49.661 17.728  1.00 29.21 ? 122  ARG B NE  1 
ATOM   2384 C  CZ  . ARG B  1 99  ? 10.721  49.768 16.469  1.00 39.89 ? 122  ARG B CZ  1 
ATOM   2385 N  NH1 . ARG B  1 99  ? 9.949   49.325 15.478  1.00 35.51 ? 122  ARG B NH1 1 
ATOM   2386 N  NH2 . ARG B  1 99  ? 11.896  50.322 16.201  1.00 52.18 ? 122  ARG B NH2 1 
ATOM   2387 N  N   . VAL B  1 100 ? 5.398   46.141 20.738  1.00 15.90 ? 123  VAL B N   1 
ATOM   2388 C  CA  . VAL B  1 100 ? 4.057   45.726 21.130  1.00 12.90 ? 123  VAL B CA  1 
ATOM   2389 C  C   . VAL B  1 100 ? 4.125   44.215 21.267  1.00 17.62 ? 123  VAL B C   1 
ATOM   2390 O  O   . VAL B  1 100 ? 4.088   43.491 20.274  1.00 18.51 ? 123  VAL B O   1 
ATOM   2391 C  CB  . VAL B  1 100 ? 3.020   46.150 20.072  1.00 14.64 ? 123  VAL B CB  1 
ATOM   2392 C  CG1 . VAL B  1 100 ? 1.650   45.586 20.413  1.00 14.10 ? 123  VAL B CG1 1 
ATOM   2393 C  CG2 . VAL B  1 100 ? 2.957   47.685 19.986  1.00 11.45 ? 123  VAL B CG2 1 
ATOM   2394 N  N   . ALA B  1 101 ? 4.268   43.726 22.497  1.00 11.91 ? 124  ALA B N   1 
ATOM   2395 C  CA  . ALA B  1 101 ? 4.494   42.285 22.647  1.00 14.48 ? 124  ALA B CA  1 
ATOM   2396 C  C   . ALA B  1 101 ? 3.715   41.762 23.821  1.00 14.93 ? 124  ALA B C   1 
ATOM   2397 O  O   . ALA B  1 101 ? 3.373   42.520 24.733  1.00 14.68 ? 124  ALA B O   1 
ATOM   2398 C  CB  . ALA B  1 101 ? 5.974   41.991 22.840  1.00 18.30 ? 124  ALA B CB  1 
ATOM   2399 N  N   A SER B  1 102 ? 3.431   40.464 23.813  0.52 13.78 ? 125  SER B N   1 
ATOM   2400 N  N   B SER B  1 102 ? 3.443   40.459 23.804  0.48 13.78 ? 125  SER B N   1 
ATOM   2401 C  CA  A SER B  1 102 ? 2.735   39.853 24.930  0.52 13.73 ? 125  SER B CA  1 
ATOM   2402 C  CA  B SER B  1 102 ? 2.759   39.805 24.907  0.48 13.73 ? 125  SER B CA  1 
ATOM   2403 C  C   A SER B  1 102 ? 3.690   39.484 26.054  0.52 13.08 ? 125  SER B C   1 
ATOM   2404 C  C   B SER B  1 102 ? 3.708   39.506 26.061  0.48 13.08 ? 125  SER B C   1 
ATOM   2405 O  O   A SER B  1 102 ? 4.885   39.258 25.836  0.52 15.58 ? 125  SER B O   1 
ATOM   2406 O  O   B SER B  1 102 ? 4.918   39.359 25.872  0.48 15.55 ? 125  SER B O   1 
ATOM   2407 C  CB  A SER B  1 102 ? 1.983   38.607 24.474  0.52 12.94 ? 125  SER B CB  1 
ATOM   2408 C  CB  B SER B  1 102 ? 2.097   38.505 24.434  0.48 12.91 ? 125  SER B CB  1 
ATOM   2409 O  OG  A SER B  1 102 ? 2.866   37.739 23.804  0.52 12.17 ? 125  SER B OG  1 
ATOM   2410 O  OG  B SER B  1 102 ? 1.192   38.751 23.372  0.48 14.33 ? 125  SER B OG  1 
ATOM   2411 N  N   . ILE B  1 103 ? 3.144   39.424 27.262  1.00 10.64 ? 126  ILE B N   1 
ATOM   2412 C  CA  . ILE B  1 103 ? 3.875   38.955 28.434  1.00 9.73  ? 126  ILE B CA  1 
ATOM   2413 C  C   . ILE B  1 103 ? 3.278   37.602 28.844  1.00 11.03 ? 126  ILE B C   1 
ATOM   2414 O  O   . ILE B  1 103 ? 2.054   37.418 28.874  1.00 10.56 ? 126  ILE B O   1 
ATOM   2415 C  CB  . ILE B  1 103 ? 3.807   39.970 29.599  1.00 11.76 ? 126  ILE B CB  1 
ATOM   2416 C  CG1 . ILE B  1 103 ? 4.591   39.437 30.815  1.00 11.01 ? 126  ILE B CG1 1 
ATOM   2417 C  CG2 . ILE B  1 103 ? 2.341   40.250 29.991  1.00 11.84 ? 126  ILE B CG2 1 
ATOM   2418 C  CD1 . ILE B  1 103 ? 6.147   39.506 30.609  1.00 11.62 ? 126  ILE B CD1 1 
ATOM   2419 N  N   . SER B  1 104 ? 4.146   36.630 29.125  1.00 10.81 ? 127  SER B N   1 
ATOM   2420 C  CA  . SER B  1 104 ? 3.670   35.311 29.542  1.00 13.81 ? 127  SER B CA  1 
ATOM   2421 C  C   . SER B  1 104 ? 2.951   35.305 30.891  1.00 10.81 ? 127  SER B C   1 
ATOM   2422 O  O   . SER B  1 104 ? 3.325   36.032 31.821  1.00 11.44 ? 127  SER B O   1 
ATOM   2423 C  CB  . SER B  1 104 ? 4.856   34.332 29.636  1.00 16.32 ? 127  SER B CB  1 
ATOM   2424 O  OG  . SER B  1 104 ? 5.363   34.052 28.350  1.00 24.48 ? 127  SER B OG  1 
ATOM   2425 N  N   . LEU B  1 105 ? 1.942   34.445 30.995  1.00 10.97 ? 128  LEU B N   1 
ATOM   2426 C  CA  . LEU B  1 105 ? 1.269   34.189 32.255  1.00 12.57 ? 128  LEU B CA  1 
ATOM   2427 C  C   . LEU B  1 105 ? 2.077   33.170 33.045  1.00 15.55 ? 128  LEU B C   1 
ATOM   2428 O  O   . LEU B  1 105 ? 2.779   32.336 32.455  1.00 17.57 ? 128  LEU B O   1 
ATOM   2429 C  CB  . LEU B  1 105 ? -0.138  33.659 32.000  1.00 15.22 ? 128  LEU B CB  1 
ATOM   2430 C  CG  . LEU B  1 105 ? -1.135  34.661 31.436  1.00 14.49 ? 128  LEU B CG  1 
ATOM   2431 C  CD1 . LEU B  1 105 ? -2.492  33.992 31.190  1.00 16.94 ? 128  LEU B CD1 1 
ATOM   2432 C  CD2 . LEU B  1 105 ? -1.297  35.823 32.388  1.00 14.62 ? 128  LEU B CD2 1 
ATOM   2433 N  N   . PRO B  1 106 ? 1.990   33.230 34.379  1.00 14.43 ? 129  PRO B N   1 
ATOM   2434 C  CA  . PRO B  1 106 ? 2.728   32.254 35.194  1.00 13.93 ? 129  PRO B CA  1 
ATOM   2435 C  C   . PRO B  1 106 ? 2.079   30.860 35.186  1.00 12.47 ? 129  PRO B C   1 
ATOM   2436 O  O   . PRO B  1 106 ? 0.857   30.716 34.980  1.00 16.81 ? 129  PRO B O   1 
ATOM   2437 C  CB  . PRO B  1 106 ? 2.685   32.870 36.598  1.00 12.50 ? 129  PRO B CB  1 
ATOM   2438 C  CG  . PRO B  1 106 ? 1.424   33.757 36.604  1.00 11.81 ? 129  PRO B CG  1 
ATOM   2439 C  CD  . PRO B  1 106 ? 1.124   34.121 35.180  1.00 10.58 ? 129  PRO B CD  1 
ATOM   2440 N  N   . THR B  1 107 ? 2.909   29.833 35.385  1.00 18.88 ? 130  THR B N   1 
ATOM   2441 C  CA  . THR B  1 107 ? 2.426   28.469 35.633  1.00 17.58 ? 130  THR B CA  1 
ATOM   2442 C  C   . THR B  1 107 ? 2.636   28.144 37.105  1.00 18.54 ? 130  THR B C   1 
ATOM   2443 O  O   . THR B  1 107 ? 2.079   27.167 37.626  1.00 17.12 ? 130  THR B O   1 
ATOM   2444 C  CB  . THR B  1 107 ? 3.194   27.417 34.805  1.00 16.65 ? 130  THR B CB  1 
ATOM   2445 O  OG1 . THR B  1 107 ? 4.594   27.596 35.025  1.00 19.07 ? 130  THR B OG1 1 
ATOM   2446 C  CG2 . THR B  1 107 ? 2.873   27.567 33.310  1.00 17.60 ? 130  THR B CG2 1 
ATOM   2447 N  N   . SER B  1 108 ? 3.456   28.957 37.763  1.00 12.98 ? 131  SER B N   1 
ATOM   2448 C  CA  . SER B  1 108 ? 3.734   28.821 39.193  1.00 15.45 ? 131  SER B CA  1 
ATOM   2449 C  C   . SER B  1 108 ? 3.788   30.213 39.851  1.00 14.55 ? 131  SER B C   1 
ATOM   2450 O  O   . SER B  1 108 ? 4.265   31.177 39.227  1.00 17.31 ? 131  SER B O   1 
ATOM   2451 C  CB  . SER B  1 108 ? 5.057   28.065 39.389  1.00 20.69 ? 131  SER B CB  1 
ATOM   2452 O  OG  . SER B  1 108 ? 5.359   27.916 40.766  1.00 20.71 ? 131  SER B OG  1 
ATOM   2453 N  N   . CYS B  1 109 ? 3.284   30.340 41.085  1.00 15.52 ? 132  CYS B N   1 
ATOM   2454 C  CA  . CYS B  1 109 ? 3.253   31.632 41.758  1.00 13.35 ? 132  CYS B CA  1 
ATOM   2455 C  C   . CYS B  1 109 ? 4.659   32.037 42.131  1.00 12.21 ? 132  CYS B C   1 
ATOM   2456 O  O   . CYS B  1 109 ? 5.534   31.173 42.219  1.00 19.47 ? 132  CYS B O   1 
ATOM   2457 C  CB  . CYS B  1 109 ? 2.396   31.569 43.016  1.00 14.25 ? 132  CYS B CB  1 
ATOM   2458 S  SG  . CYS B  1 109 ? 0.659   31.185 42.706  1.00 17.22 ? 132  CYS B SG  1 
ATOM   2459 N  N   . ALA B  1 110 ? 4.885   33.333 42.365  1.00 11.77 ? 133  ALA B N   1 
ATOM   2460 C  CA  . ALA B  1 110 ? 6.219   33.817 42.734  1.00 16.91 ? 133  ALA B CA  1 
ATOM   2461 C  C   . ALA B  1 110 ? 6.428   33.786 44.250  1.00 19.08 ? 133  ALA B C   1 
ATOM   2462 O  O   . ALA B  1 110 ? 5.474   33.850 45.018  1.00 20.50 ? 133  ALA B O   1 
ATOM   2463 C  CB  . ALA B  1 110 ? 6.448   35.227 42.193  1.00 22.46 ? 133  ALA B CB  1 
ATOM   2464 N  N   A SER B  1 111 ? 7.682   33.692 44.675  0.43 17.54 ? 134  SER B N   1 
ATOM   2465 N  N   B SER B  1 111 ? 7.686   33.690 44.673  0.57 17.52 ? 134  SER B N   1 
ATOM   2466 C  CA  A SER B  1 111 ? 7.985   33.575 46.098  0.43 18.83 ? 134  SER B CA  1 
ATOM   2467 C  CA  B SER B  1 111 ? 8.010   33.578 46.096  0.57 18.85 ? 134  SER B CA  1 
ATOM   2468 C  C   A SER B  1 111 ? 8.362   34.915 46.708  0.43 17.54 ? 134  SER B C   1 
ATOM   2469 C  C   B SER B  1 111 ? 8.353   34.925 46.706  0.57 17.52 ? 134  SER B C   1 
ATOM   2470 O  O   A SER B  1 111 ? 8.825   35.813 46.005  0.43 17.49 ? 134  SER B O   1 
ATOM   2471 O  O   B SER B  1 111 ? 8.803   35.832 46.008  0.57 17.48 ? 134  SER B O   1 
ATOM   2472 C  CB  A SER B  1 111 ? 9.127   32.575 46.316  0.43 20.97 ? 134  SER B CB  1 
ATOM   2473 C  CB  B SER B  1 111 ? 9.209   32.638 46.303  0.57 20.98 ? 134  SER B CB  1 
ATOM   2474 O  OG  A SER B  1 111 ? 10.290  32.969 45.609  0.43 19.93 ? 134  SER B OG  1 
ATOM   2475 O  OG  B SER B  1 111 ? 9.068   31.427 45.583  0.57 17.62 ? 134  SER B OG  1 
ATOM   2476 N  N   . ALA B  1 112 ? 8.169   35.047 48.019  1.00 18.82 ? 135  ALA B N   1 
ATOM   2477 C  CA  . ALA B  1 112 ? 8.639   36.217 48.737  1.00 14.17 ? 135  ALA B CA  1 
ATOM   2478 C  C   . ALA B  1 112 ? 10.136  36.365 48.500  1.00 20.97 ? 135  ALA B C   1 
ATOM   2479 O  O   . ALA B  1 112 ? 10.860  35.363 48.449  1.00 17.24 ? 135  ALA B O   1 
ATOM   2480 C  CB  . ALA B  1 112 ? 8.370   36.089 50.221  1.00 21.52 ? 135  ALA B CB  1 
ATOM   2481 N  N   . GLY B  1 113 ? 10.579  37.608 48.331  1.00 15.92 ? 136  GLY B N   1 
ATOM   2482 C  CA  . GLY B  1 113 ? 11.970  37.907 48.046  1.00 21.00 ? 136  GLY B CA  1 
ATOM   2483 C  C   . GLY B  1 113 ? 12.274  38.072 46.559  1.00 22.26 ? 136  GLY B C   1 
ATOM   2484 O  O   . GLY B  1 113 ? 13.275  38.686 46.194  1.00 22.50 ? 136  GLY B O   1 
ATOM   2485 N  N   . THR B  1 114 ? 11.425  37.510 45.703  1.00 18.36 ? 137  THR B N   1 
ATOM   2486 C  CA  . THR B  1 114 ? 11.612  37.603 44.249  1.00 18.18 ? 137  THR B CA  1 
ATOM   2487 C  C   . THR B  1 114 ? 11.611  39.074 43.816  1.00 22.59 ? 137  THR B C   1 
ATOM   2488 O  O   . THR B  1 114 ? 10.769  39.841 44.270  1.00 15.84 ? 137  THR B O   1 
ATOM   2489 C  CB  . THR B  1 114 ? 10.484  36.856 43.505  1.00 16.24 ? 137  THR B CB  1 
ATOM   2490 O  OG1 . THR B  1 114 ? 10.540  35.449 43.825  1.00 21.65 ? 137  THR B OG1 1 
ATOM   2491 C  CG2 . THR B  1 114 ? 10.605  37.048 41.990  1.00 21.96 ? 137  THR B CG2 1 
ATOM   2492 N  N   . GLN B  1 115 ? 12.547  39.477 42.961  1.00 18.09 ? 138  GLN B N   1 
ATOM   2493 C  CA  . GLN B  1 115 ? 12.608  40.866 42.482  1.00 15.98 ? 138  GLN B CA  1 
ATOM   2494 C  C   . GLN B  1 115 ? 11.748  40.980 41.230  1.00 15.52 ? 138  GLN B C   1 
ATOM   2495 O  O   . GLN B  1 115 ? 11.833  40.135 40.337  1.00 16.67 ? 138  GLN B O   1 
ATOM   2496 C  CB  . GLN B  1 115 ? 14.050  41.261 42.115  1.00 25.01 ? 138  GLN B CB  1 
ATOM   2497 C  CG  . GLN B  1 115 ? 14.923  41.746 43.280  1.00 32.51 ? 138  GLN B CG  1 
ATOM   2498 C  CD  . GLN B  1 115 ? 14.629  43.192 43.689  1.00 32.40 ? 138  GLN B CD  1 
ATOM   2499 O  OE1 . GLN B  1 115 ? 14.041  43.437 44.738  1.00 34.17 ? 138  GLN B OE1 1 
ATOM   2500 N  NE2 . GLN B  1 115 ? 15.059  44.153 42.866  1.00 35.95 ? 138  GLN B NE2 1 
ATOM   2501 N  N   . CYS B  1 116 ? 10.929  42.024 41.162  1.00 14.89 ? 139  CYS B N   1 
ATOM   2502 C  CA  . CYS B  1 116 ? 10.030  42.181 40.034  1.00 13.46 ? 139  CYS B CA  1 
ATOM   2503 C  C   . CYS B  1 116 ? 10.140  43.571 39.437  1.00 14.46 ? 139  CYS B C   1 
ATOM   2504 O  O   . CYS B  1 116 ? 10.717  44.465 40.052  1.00 14.29 ? 139  CYS B O   1 
ATOM   2505 C  CB  . CYS B  1 116 ? 8.589   41.989 40.497  1.00 12.93 ? 139  CYS B CB  1 
ATOM   2506 S  SG  . CYS B  1 116 ? 8.245   40.407 41.263  1.00 17.71 ? 139  CYS B SG  1 
ATOM   2507 N  N   . LEU B  1 117 ? 9.556   43.750 38.243  1.00 10.78 ? 140  LEU B N   1 
ATOM   2508 C  CA  . LEU B  1 117 ? 9.515   45.055 37.580  1.00 9.61  ? 140  LEU B CA  1 
ATOM   2509 C  C   . LEU B  1 117 ? 8.070   45.571 37.485  1.00 12.10 ? 140  LEU B C   1 
ATOM   2510 O  O   . LEU B  1 117 ? 7.180   44.877 36.959  1.00 12.79 ? 140  LEU B O   1 
ATOM   2511 C  CB  . LEU B  1 117 ? 10.077  44.940 36.165  1.00 11.17 ? 140  LEU B CB  1 
ATOM   2512 C  CG  . LEU B  1 117 ? 10.162  46.264 35.397  1.00 10.30 ? 140  LEU B CG  1 
ATOM   2513 C  CD1 . LEU B  1 117 ? 11.173  47.204 36.040  1.00 12.59 ? 140  LEU B CD1 1 
ATOM   2514 C  CD2 . LEU B  1 117 ? 10.512  46.012 33.930  1.00 16.79 ? 140  LEU B CD2 1 
ATOM   2515 N  N   . ILE B  1 118 ? 7.865   46.781 37.991  1.00 10.60 ? 141  ILE B N   1 
ATOM   2516 C  CA  . ILE B  1 118 ? 6.550   47.418 38.029  1.00 8.24  ? 141  ILE B CA  1 
ATOM   2517 C  C   . ILE B  1 118 ? 6.668   48.688 37.194  1.00 12.03 ? 141  ILE B C   1 
ATOM   2518 O  O   . ILE B  1 118 ? 7.669   49.382 37.261  1.00 13.59 ? 141  ILE B O   1 
ATOM   2519 C  CB  . ILE B  1 118 ? 6.176   47.780 39.468  1.00 11.41 ? 141  ILE B CB  1 
ATOM   2520 C  CG1 . ILE B  1 118 ? 6.343   46.553 40.378  1.00 12.44 ? 141  ILE B CG1 1 
ATOM   2521 C  CG2 . ILE B  1 118 ? 4.733   48.305 39.541  1.00 10.41 ? 141  ILE B CG2 1 
ATOM   2522 C  CD1 . ILE B  1 118 ? 6.331   46.900 41.817  1.00 13.99 ? 141  ILE B CD1 1 
ATOM   2523 N  N   . SER B  1 119 ? 5.662   48.989 36.389  1.00 8.94  ? 142  SER B N   1 
ATOM   2524 C  CA  . SER B  1 119 ? 5.801   50.108 35.475  1.00 11.65 ? 142  SER B CA  1 
ATOM   2525 C  C   . SER B  1 119 ? 4.487   50.846 35.294  1.00 8.24  ? 142  SER B C   1 
ATOM   2526 O  O   . SER B  1 119 ? 3.411   50.290 35.537  1.00 11.11 ? 142  SER B O   1 
ATOM   2527 C  CB  . SER B  1 119 ? 6.362   49.633 34.136  1.00 9.68  ? 142  SER B CB  1 
ATOM   2528 O  OG  . SER B  1 119 ? 5.649   48.498 33.667  1.00 10.39 ? 142  SER B OG  1 
ATOM   2529 N  N   . GLY B  1 120 ? 4.580   52.100 34.884  1.00 10.38 ? 143  GLY B N   1 
ATOM   2530 C  CA  . GLY B  1 120 ? 3.393   52.887 34.632  1.00 10.83 ? 143  GLY B CA  1 
ATOM   2531 C  C   . GLY B  1 120 ? 3.635   54.368 34.416  1.00 7.97  ? 143  GLY B C   1 
ATOM   2532 O  O   . GLY B  1 120 ? 4.763   54.858 34.490  1.00 11.58 ? 143  GLY B O   1 
ATOM   2533 N  N   . TRP B  1 121 ? 2.554   55.088 34.148  1.00 10.91 ? 144  TRP B N   1 
ATOM   2534 C  CA  . TRP B  1 121 ? 2.636   56.544 33.927  1.00 9.81  ? 144  TRP B CA  1 
ATOM   2535 C  C   . TRP B  1 121 ? 1.985   57.320 35.068  1.00 19.32 ? 144  TRP B C   1 
ATOM   2536 O  O   . TRP B  1 121 ? 1.535   58.461 34.884  1.00 14.95 ? 144  TRP B O   1 
ATOM   2537 C  CB  . TRP B  1 121 ? 1.974   56.936 32.595  1.00 10.86 ? 144  TRP B CB  1 
ATOM   2538 C  CG  . TRP B  1 121 ? 2.714   56.534 31.312  1.00 11.79 ? 144  TRP B CG  1 
ATOM   2539 C  CD1 . TRP B  1 121 ? 3.703   57.243 30.665  1.00 11.57 ? 144  TRP B CD1 1 
ATOM   2540 C  CD2 . TRP B  1 121 ? 2.495   55.350 30.520  1.00 10.52 ? 144  TRP B CD2 1 
ATOM   2541 N  NE1 . TRP B  1 121 ? 4.098   56.570 29.523  1.00 11.09 ? 144  TRP B NE1 1 
ATOM   2542 C  CE2 . TRP B  1 121 ? 3.381   55.411 29.416  1.00 10.75 ? 144  TRP B CE2 1 
ATOM   2543 C  CE3 . TRP B  1 121 ? 1.637   54.250 30.639  1.00 10.14 ? 144  TRP B CE3 1 
ATOM   2544 C  CZ2 . TRP B  1 121 ? 3.447   54.404 28.447  1.00 14.18 ? 144  TRP B CZ2 1 
ATOM   2545 C  CZ3 . TRP B  1 121 ? 1.693   53.255 29.673  1.00 14.02 ? 144  TRP B CZ3 1 
ATOM   2546 C  CH2 . TRP B  1 121 ? 2.593   53.336 28.589  1.00 16.48 ? 144  TRP B CH2 1 
ATOM   2547 N  N   . GLY B  1 122 ? 1.950   56.713 36.252  1.00 11.95 ? 145  GLY B N   1 
ATOM   2548 C  CA  . GLY B  1 122 ? 1.313   57.334 37.401  1.00 11.38 ? 145  GLY B CA  1 
ATOM   2549 C  C   . GLY B  1 122 ? 2.165   58.429 38.024  1.00 12.11 ? 145  GLY B C   1 
ATOM   2550 O  O   . GLY B  1 122 ? 3.305   58.671 37.617  1.00 14.09 ? 145  GLY B O   1 
ATOM   2551 N  N   . ASN B  1 123 ? 1.596   59.094 39.026  1.00 15.21 ? 146  ASN B N   1 
ATOM   2552 C  CA  . ASN B  1 123 ? 2.272   60.182 39.725  1.00 16.58 ? 146  ASN B CA  1 
ATOM   2553 C  C   . ASN B  1 123 ? 3.676   59.743 40.166  1.00 16.41 ? 146  ASN B C   1 
ATOM   2554 O  O   . ASN B  1 123 ? 3.882   58.581 40.540  1.00 15.95 ? 146  ASN B O   1 
ATOM   2555 C  CB  . ASN B  1 123 ? 1.428   60.550 40.931  1.00 18.52 ? 146  ASN B CB  1 
ATOM   2556 C  CG  . ASN B  1 123 ? 1.951   61.766 41.678  1.00 28.01 ? 146  ASN B CG  1 
ATOM   2557 O  OD1 . ASN B  1 123 ? 2.856   62.473 41.216  1.00 30.34 ? 146  ASN B OD1 1 
ATOM   2558 N  ND2 . ASN B  1 123 ? 1.359   62.029 42.840  1.00 29.82 ? 146  ASN B ND2 1 
ATOM   2559 N  N   . THR B  1 124 ? 4.661   60.640 40.083  1.00 18.80 ? 147  THR B N   1 
ATOM   2560 C  CA  . THR B  1 124 ? 6.018   60.274 40.507  1.00 18.49 ? 147  THR B CA  1 
ATOM   2561 C  C   . THR B  1 124 ? 6.369   60.906 41.853  1.00 18.85 ? 147  THR B C   1 
ATOM   2562 O  O   . THR B  1 124 ? 7.457   60.691 42.389  1.00 19.45 ? 147  THR B O   1 
ATOM   2563 C  CB  . THR B  1 124 ? 7.081   60.676 39.477  1.00 20.29 ? 147  THR B CB  1 
ATOM   2564 O  OG1 . THR B  1 124 ? 7.011   62.090 39.271  1.00 22.01 ? 147  THR B OG1 1 
ATOM   2565 C  CG2 . THR B  1 124 ? 6.863   59.943 38.144  1.00 17.78 ? 147  THR B CG2 1 
ATOM   2566 N  N   . LYS B  1 125 ? 5.443   61.683 42.393  1.00 18.42 ? 148  LYS B N   1 
ATOM   2567 C  CA  . LYS B  1 125 ? 5.668   62.320 43.681  1.00 24.87 ? 148  LYS B CA  1 
ATOM   2568 C  C   . LYS B  1 125 ? 4.828   61.665 44.760  1.00 22.67 ? 148  LYS B C   1 
ATOM   2569 O  O   . LYS B  1 125 ? 3.665   61.322 44.526  1.00 21.11 ? 148  LYS B O   1 
ATOM   2570 C  CB  . LYS B  1 125 ? 5.329   63.804 43.592  1.00 25.11 ? 148  LYS B CB  1 
ATOM   2571 C  CG  . LYS B  1 125 ? 6.304   64.610 42.757  1.00 21.52 ? 148  LYS B CG  1 
ATOM   2572 C  CD  . LYS B  1 125 ? 5.957   66.087 42.862  1.00 32.98 ? 148  LYS B CD  1 
ATOM   2573 C  CE  . LYS B  1 125 ? 6.768   66.947 41.906  1.00 35.22 ? 148  LYS B CE  1 
ATOM   2574 N  NZ  . LYS B  1 125 ? 6.171   68.317 41.857  1.00 40.81 ? 148  LYS B NZ  1 
ATOM   2575 N  N   . SER B  1 126 ? 5.414   61.508 45.946  1.00 32.10 ? 149  SER B N   1 
ATOM   2576 C  CA  . SER B  1 126 ? 4.708   60.911 47.079  1.00 33.01 ? 149  SER B CA  1 
ATOM   2577 C  C   . SER B  1 126 ? 3.833   61.930 47.806  1.00 38.32 ? 149  SER B C   1 
ATOM   2578 O  O   . SER B  1 126 ? 2.931   61.556 48.550  1.00 39.71 ? 149  SER B O   1 
ATOM   2579 C  CB  . SER B  1 126 ? 5.692   60.267 48.057  1.00 37.70 ? 149  SER B CB  1 
ATOM   2580 O  OG  . SER B  1 126 ? 6.586   61.232 48.586  1.00 41.41 ? 149  SER B OG  1 
ATOM   2581 N  N   . SER B  1 127 ? 4.127   63.213 47.603  1.00 32.20 ? 150  SER B N   1 
ATOM   2582 C  CA  . SER B  1 127 ? 3.270   64.297 48.063  1.00 37.25 ? 150  SER B CA  1 
ATOM   2583 C  C   . SER B  1 127 ? 3.071   65.263 46.905  1.00 44.82 ? 150  SER B C   1 
ATOM   2584 O  O   . SER B  1 127 ? 4.026   65.604 46.201  1.00 38.97 ? 150  SER B O   1 
ATOM   2585 C  CB  . SER B  1 127 ? 3.899   65.032 49.242  1.00 44.67 ? 150  SER B CB  1 
ATOM   2586 O  OG  . SER B  1 127 ? 3.380   66.353 49.323  1.00 50.30 ? 150  SER B OG  1 
ATOM   2587 N  N   . GLY B  1 128 ? 1.839   65.706 46.693  1.00 36.93 ? 151  GLY B N   1 
ATOM   2588 C  CA  . GLY B  1 128 ? 1.554   66.511 45.524  1.00 39.91 ? 151  GLY B CA  1 
ATOM   2589 C  C   . GLY B  1 128 ? 1.605   65.615 44.298  1.00 41.89 ? 151  GLY B C   1 
ATOM   2590 O  O   . GLY B  1 128 ? 1.854   64.408 44.414  1.00 32.46 ? 151  GLY B O   1 
ATOM   2591 N  N   . THR B  1 129 ? 1.385   66.197 43.122  1.00 30.56 ? 152  THR B N   1 
ATOM   2592 C  CA  . THR B  1 129 ? 1.177   65.402 41.920  1.00 30.65 ? 152  THR B CA  1 
ATOM   2593 C  C   . THR B  1 129 ? 2.111   65.801 40.779  1.00 40.11 ? 152  THR B C   1 
ATOM   2594 O  O   . THR B  1 129 ? 2.234   66.980 40.444  1.00 31.67 ? 152  THR B O   1 
ATOM   2595 C  CB  . THR B  1 129 ? -0.293  65.499 41.426  1.00 38.59 ? 152  THR B CB  1 
ATOM   2596 O  OG1 . THR B  1 129 ? -1.194  65.389 42.535  1.00 44.44 ? 152  THR B OG1 1 
ATOM   2597 C  CG2 . THR B  1 129 ? -0.595  64.392 40.423  1.00 37.46 ? 152  THR B CG2 1 
ATOM   2598 N  N   . SER B  1 130 ? 2.763   64.810 40.181  1.00 34.49 ? 153  SER B N   1 
ATOM   2599 C  CA  . SER B  1 130 ? 3.539   65.031 38.967  1.00 28.04 ? 153  SER B CA  1 
ATOM   2600 C  C   . SER B  1 130 ? 3.063   64.032 37.915  1.00 37.77 ? 153  SER B C   1 
ATOM   2601 O  O   . SER B  1 130 ? 2.737   62.889 38.241  1.00 35.57 ? 153  SER B O   1 
ATOM   2602 C  CB  . SER B  1 130 ? 5.032   64.850 39.248  1.00 31.42 ? 153  SER B CB  1 
ATOM   2603 O  OG  . SER B  1 130 ? 5.827   65.307 38.163  1.00 45.52 ? 153  SER B OG  1 
ATOM   2604 N  N   . TYR B  1 131 ? 2.984   64.457 36.660  1.00 29.47 ? 154  TYR B N   1 
ATOM   2605 C  CA  . TYR B  1 131 ? 2.591   63.527 35.600  1.00 27.52 ? 154  TYR B CA  1 
ATOM   2606 C  C   . TYR B  1 131 ? 3.747   63.303 34.642  1.00 30.12 ? 154  TYR B C   1 
ATOM   2607 O  O   . TYR B  1 131 ? 4.174   64.228 33.946  1.00 30.06 ? 154  TYR B O   1 
ATOM   2608 C  CB  . TYR B  1 131 ? 1.361   64.044 34.850  1.00 29.10 ? 154  TYR B CB  1 
ATOM   2609 C  CG  . TYR B  1 131 ? 0.200   64.369 35.761  1.00 38.23 ? 154  TYR B CG  1 
ATOM   2610 C  CD1 . TYR B  1 131 ? -0.641  63.369 36.232  1.00 39.56 ? 154  TYR B CD1 1 
ATOM   2611 C  CD2 . TYR B  1 131 ? -0.048  65.678 36.159  1.00 36.32 ? 154  TYR B CD2 1 
ATOM   2612 C  CE1 . TYR B  1 131 ? -1.699  63.668 37.075  1.00 39.81 ? 154  TYR B CE1 1 
ATOM   2613 C  CE2 . TYR B  1 131 ? -1.105  65.984 36.994  1.00 41.51 ? 154  TYR B CE2 1 
ATOM   2614 C  CZ  . TYR B  1 131 ? -1.928  64.976 37.443  1.00 42.20 ? 154  TYR B CZ  1 
ATOM   2615 O  OH  . TYR B  1 131 ? -2.979  65.283 38.275  1.00 36.83 ? 154  TYR B OH  1 
ATOM   2616 N  N   . PRO B  1 132 ? 4.273   62.072 34.614  1.00 26.16 ? 155  PRO B N   1 
ATOM   2617 C  CA  . PRO B  1 132 ? 5.376   61.800 33.700  1.00 20.76 ? 155  PRO B CA  1 
ATOM   2618 C  C   . PRO B  1 132 ? 4.879   61.707 32.277  1.00 24.01 ? 155  PRO B C   1 
ATOM   2619 O  O   . PRO B  1 132 ? 3.769   61.225 32.024  1.00 27.75 ? 155  PRO B O   1 
ATOM   2620 C  CB  . PRO B  1 132 ? 5.881   60.427 34.156  1.00 26.09 ? 155  PRO B CB  1 
ATOM   2621 C  CG  . PRO B  1 132 ? 4.686   59.783 34.766  1.00 26.02 ? 155  PRO B CG  1 
ATOM   2622 C  CD  . PRO B  1 132 ? 3.934   60.900 35.440  1.00 26.17 ? 155  PRO B CD  1 
ATOM   2623 N  N   . ASP B  1 133 ? 5.718   62.178 31.369  1.00 25.72 ? 156  ASP B N   1 
ATOM   2624 C  CA  . ASP B  1 133 ? 5.543   61.997 29.937  1.00 28.83 ? 156  ASP B CA  1 
ATOM   2625 C  C   . ASP B  1 133 ? 5.845   60.543 29.518  1.00 21.43 ? 156  ASP B C   1 
ATOM   2626 O  O   . ASP B  1 133 ? 5.029   59.886 28.871  1.00 21.52 ? 156  ASP B O   1 
ATOM   2627 C  CB  . ASP B  1 133 ? 6.483   62.974 29.216  1.00 33.38 ? 156  ASP B CB  1 
ATOM   2628 C  CG  . ASP B  1 133 ? 7.879   63.060 29.879  1.00 40.90 ? 156  ASP B CG  1 
ATOM   2629 O  OD1 . ASP B  1 133 ? 8.042   62.618 31.051  1.00 38.81 ? 156  ASP B OD1 1 
ATOM   2630 O  OD2 . ASP B  1 133 ? 8.822   63.567 29.220  1.00 48.63 ? 156  ASP B OD2 1 
ATOM   2631 N  N   . VAL B  1 134 ? 7.030   60.056 29.886  1.00 15.76 ? 157  VAL B N   1 
ATOM   2632 C  CA  . VAL B  1 134 ? 7.493   58.737 29.472  1.00 13.68 ? 157  VAL B CA  1 
ATOM   2633 C  C   . VAL B  1 134 ? 7.281   57.683 30.546  1.00 11.29 ? 157  VAL B C   1 
ATOM   2634 O  O   . VAL B  1 134 ? 7.011   57.990 31.712  1.00 13.45 ? 157  VAL B O   1 
ATOM   2635 C  CB  . VAL B  1 134 ? 8.951   58.783 29.072  1.00 13.81 ? 157  VAL B CB  1 
ATOM   2636 C  CG1 . VAL B  1 134 ? 9.111   59.743 27.881  1.00 18.42 ? 157  VAL B CG1 1 
ATOM   2637 C  CG2 . VAL B  1 134 ? 9.815   59.226 30.259  1.00 15.26 ? 157  VAL B CG2 1 
ATOM   2638 N  N   . LEU B  1 135 ? 7.370   56.425 30.132  1.00 10.83 ? 158  LEU B N   1 
ATOM   2639 C  CA  . LEU B  1 135 ? 7.059   55.320 31.023  1.00 11.75 ? 158  LEU B CA  1 
ATOM   2640 C  C   . LEU B  1 135 ? 8.131   55.183 32.104  1.00 12.96 ? 158  LEU B C   1 
ATOM   2641 O  O   . LEU B  1 135 ? 9.335   55.296 31.832  1.00 13.94 ? 158  LEU B O   1 
ATOM   2642 C  CB  . LEU B  1 135 ? 6.949   54.022 30.216  1.00 11.17 ? 158  LEU B CB  1 
ATOM   2643 C  CG  . LEU B  1 135 ? 6.521   52.787 31.004  1.00 11.32 ? 158  LEU B CG  1 
ATOM   2644 C  CD1 . LEU B  1 135 ? 5.117   53.001 31.562  1.00 11.91 ? 158  LEU B CD1 1 
ATOM   2645 C  CD2 . LEU B  1 135 ? 6.582   51.526 30.157  1.00 13.43 ? 158  LEU B CD2 1 
ATOM   2646 N  N   . LYS B  1 136 ? 7.677   54.954 33.331  1.00 12.12 ? 159  LYS B N   1 
ATOM   2647 C  CA  . LYS B  1 136 ? 8.546   54.805 34.495  1.00 10.59 ? 159  LYS B CA  1 
ATOM   2648 C  C   . LYS B  1 136 ? 8.543   53.368 34.985  1.00 13.09 ? 159  LYS B C   1 
ATOM   2649 O  O   . LYS B  1 136 ? 7.535   52.667 34.856  1.00 12.60 ? 159  LYS B O   1 
ATOM   2650 C  CB  . LYS B  1 136 ? 8.080   55.718 35.612  1.00 11.06 ? 159  LYS B CB  1 
ATOM   2651 C  CG  . LYS B  1 136 ? 8.170   57.194 35.274  1.00 10.92 ? 159  LYS B CG  1 
ATOM   2652 C  CD  . LYS B  1 136 ? 9.613   57.646 35.109  1.00 18.40 ? 159  LYS B CD  1 
ATOM   2653 C  CE  . LYS B  1 136 ? 9.644   59.113 34.641  1.00 25.90 ? 159  LYS B CE  1 
ATOM   2654 N  NZ  . LYS B  1 136 ? 11.031  59.668 34.498  1.00 30.07 ? 159  LYS B NZ  1 
ATOM   2655 N  N   . CYS B  1 137 ? 9.683   52.935 35.519  1.00 11.87 ? 160  CYS B N   1 
ATOM   2656 C  CA  . CYS B  1 137 ? 9.883   51.572 36.008  1.00 13.21 ? 160  CYS B CA  1 
ATOM   2657 C  C   . CYS B  1 137 ? 10.384  51.570 37.450  1.00 13.12 ? 160  CYS B C   1 
ATOM   2658 O  O   . CYS B  1 137 ? 10.964  52.544 37.930  1.00 12.67 ? 160  CYS B O   1 
ATOM   2659 C  CB  . CYS B  1 137 ? 10.927  50.838 35.143  1.00 13.65 ? 160  CYS B CB  1 
ATOM   2660 S  SG  . CYS B  1 137 ? 10.338  50.280 33.528  1.00 16.79 ? 160  CYS B SG  1 
ATOM   2661 N  N   . LEU B  1 138 ? 10.151  50.460 38.136  1.00 10.39 ? 161  LEU B N   1 
ATOM   2662 C  CA  A LEU B  1 138 ? 10.644  50.279 39.491  0.59 10.79 ? 161  LEU B CA  1 
ATOM   2663 C  CA  B LEU B  1 138 ? 10.642  50.280 39.491  0.41 10.83 ? 161  LEU B CA  1 
ATOM   2664 C  C   . LEU B  1 138 ? 10.947  48.816 39.711  1.00 14.59 ? 161  LEU B C   1 
ATOM   2665 O  O   . LEU B  1 138 ? 10.123  47.953 39.399  1.00 10.94 ? 161  LEU B O   1 
ATOM   2666 C  CB  A LEU B  1 138 ? 9.599   50.731 40.517  0.59 13.00 ? 161  LEU B CB  1 
ATOM   2667 C  CB  B LEU B  1 138 ? 9.593   50.734 40.509  0.41 13.01 ? 161  LEU B CB  1 
ATOM   2668 C  CG  A LEU B  1 138 ? 9.942   50.424 41.970  0.59 14.79 ? 161  LEU B CG  1 
ATOM   2669 C  CG  B LEU B  1 138 ? 9.934   50.437 41.966  0.41 14.78 ? 161  LEU B CG  1 
ATOM   2670 C  CD1 A LEU B  1 138 ? 11.132  51.277 42.423  0.59 13.79 ? 161  LEU B CD1 1 
ATOM   2671 C  CD1 B LEU B  1 138 ? 11.113  51.299 42.416  0.41 13.81 ? 161  LEU B CD1 1 
ATOM   2672 C  CD2 A LEU B  1 138 ? 8.723   50.682 42.849  0.59 15.37 ? 161  LEU B CD2 1 
ATOM   2673 C  CD2 B LEU B  1 138 ? 8.715   50.680 42.846  0.41 15.35 ? 161  LEU B CD2 1 
ATOM   2674 N  N   . LYS B  1 139 ? 12.137  48.526 40.231  1.00 15.21 ? 162  LYS B N   1 
ATOM   2675 C  CA  . LYS B  1 139 ? 12.408  47.166 40.657  1.00 14.40 ? 162  LYS B CA  1 
ATOM   2676 C  C   . LYS B  1 139 ? 12.042  47.065 42.125  1.00 14.90 ? 162  LYS B C   1 
ATOM   2677 O  O   . LYS B  1 139 ? 12.432  47.906 42.926  1.00 16.53 ? 162  LYS B O   1 
ATOM   2678 C  CB  . LYS B  1 139 ? 13.869  46.777 40.428  1.00 15.43 ? 162  LYS B CB  1 
ATOM   2679 C  CG  . LYS B  1 139 ? 14.175  46.551 38.978  1.00 19.99 ? 162  LYS B CG  1 
ATOM   2680 C  CD  . LYS B  1 139 ? 15.387  45.658 38.802  1.00 37.55 ? 162  LYS B CD  1 
ATOM   2681 C  CE  . LYS B  1 139 ? 15.409  45.087 37.403  1.00 43.45 ? 162  LYS B CE  1 
ATOM   2682 N  NZ  . LYS B  1 139 ? 15.307  46.176 36.402  1.00 31.99 ? 162  LYS B NZ  1 
ATOM   2683 N  N   . ALA B  1 140 ? 11.269  46.038 42.467  1.00 15.60 ? 163  ALA B N   1 
ATOM   2684 C  CA  . ALA B  1 140 ? 10.798  45.871 43.835  1.00 16.95 ? 163  ALA B CA  1 
ATOM   2685 C  C   . ALA B  1 140 ? 10.608  44.395 44.163  1.00 13.97 ? 163  ALA B C   1 
ATOM   2686 O  O   . ALA B  1 140 ? 10.160  43.621 43.326  1.00 13.34 ? 163  ALA B O   1 
ATOM   2687 C  CB  . ALA B  1 140 ? 9.478   46.634 44.038  1.00 15.43 ? 163  ALA B CB  1 
ATOM   2688 N  N   . PRO B  1 141 ? 10.942  44.003 45.408  1.00 14.77 ? 164  PRO B N   1 
ATOM   2689 C  CA  . PRO B  1 141 ? 10.795  42.613 45.854  1.00 18.49 ? 164  PRO B CA  1 
ATOM   2690 C  C   . PRO B  1 141 ? 9.385   42.296 46.345  1.00 13.19 ? 164  PRO B C   1 
ATOM   2691 O  O   . PRO B  1 141 ? 8.741   43.144 46.949  1.00 15.66 ? 164  PRO B O   1 
ATOM   2692 C  CB  . PRO B  1 141 ? 11.760  42.534 47.045  1.00 16.26 ? 164  PRO B CB  1 
ATOM   2693 C  CG  . PRO B  1 141 ? 11.771  43.948 47.606  1.00 12.45 ? 164  PRO B CG  1 
ATOM   2694 C  CD  . PRO B  1 141 ? 11.671  44.837 46.381  1.00 16.59 ? 164  PRO B CD  1 
ATOM   2695 N  N   . ILE B  1 142 ? 8.935   41.071 46.104  1.00 11.82 ? 165  ILE B N   1 
ATOM   2696 C  CA  . ILE B  1 142 ? 7.732   40.569 46.769  1.00 11.12 ? 165  ILE B CA  1 
ATOM   2697 C  C   . ILE B  1 142 ? 7.997   40.451 48.277  1.00 16.64 ? 165  ILE B C   1 
ATOM   2698 O  O   . ILE B  1 142 ? 9.028   39.894 48.705  1.00 16.35 ? 165  ILE B O   1 
ATOM   2699 C  CB  . ILE B  1 142 ? 7.312   39.226 46.197  1.00 14.52 ? 165  ILE B CB  1 
ATOM   2700 C  CG1 . ILE B  1 142 ? 6.993   39.384 44.705  1.00 10.37 ? 165  ILE B CG1 1 
ATOM   2701 C  CG2 . ILE B  1 142 ? 6.109   38.681 46.965  1.00 13.28 ? 165  ILE B CG2 1 
ATOM   2702 C  CD1 . ILE B  1 142 ? 6.435   38.136 44.049  1.00 12.66 ? 165  ILE B CD1 1 
ATOM   2703 N  N   . LEU B  1 143 ? 7.088   40.990 49.089  1.00 15.29 ? 166  LEU B N   1 
ATOM   2704 C  CA  . LEU B  1 143 ? 7.202   40.863 50.555  1.00 14.74 ? 166  LEU B CA  1 
ATOM   2705 C  C   . LEU B  1 143 ? 6.484   39.631 51.091  1.00 16.66 ? 166  LEU B C   1 
ATOM   2706 O  O   . LEU B  1 143 ? 5.549   39.111 50.467  1.00 14.80 ? 166  LEU B O   1 
ATOM   2707 C  CB  . LEU B  1 143 ? 6.662   42.114 51.252  1.00 14.45 ? 166  LEU B CB  1 
ATOM   2708 C  CG  . LEU B  1 143 ? 7.317   43.422 50.803  1.00 16.00 ? 166  LEU B CG  1 
ATOM   2709 C  CD1 . LEU B  1 143 ? 6.681   44.606 51.504  1.00 18.35 ? 166  LEU B CD1 1 
ATOM   2710 C  CD2 . LEU B  1 143 ? 8.829   43.381 51.048  1.00 24.67 ? 166  LEU B CD2 1 
ATOM   2711 N  N   . SER B  1 144 ? 6.924   39.165 52.261  1.00 20.85 ? 167  SER B N   1 
ATOM   2712 C  CA  . SER B  1 144 ? 6.320   37.988 52.875  1.00 23.42 ? 167  SER B CA  1 
ATOM   2713 C  C   . SER B  1 144 ? 4.866   38.303 53.194  1.00 17.41 ? 167  SER B C   1 
ATOM   2714 O  O   . SER B  1 144 ? 4.538   39.447 53.520  1.00 14.81 ? 167  SER B O   1 
ATOM   2715 C  CB  . SER B  1 144 ? 7.044   37.629 54.173  1.00 23.16 ? 167  SER B CB  1 
ATOM   2716 O  OG  . SER B  1 144 ? 6.793   38.613 55.171  1.00 17.34 ? 167  SER B OG  1 
ATOM   2717 N  N   . ASP B  1 145 ? 4.010   37.295 53.078  1.00 23.01 ? 168  ASP B N   1 
ATOM   2718 C  CA  . ASP B  1 145 ? 2.602   37.409 53.453  1.00 18.68 ? 168  ASP B CA  1 
ATOM   2719 C  C   . ASP B  1 145 ? 2.455   37.896 54.891  1.00 18.56 ? 168  ASP B C   1 
ATOM   2720 O  O   . ASP B  1 145 ? 1.563   38.686 55.203  1.00 18.73 ? 168  ASP B O   1 
ATOM   2721 C  CB  . ASP B  1 145 ? 1.901   36.061 53.281  1.00 20.97 ? 168  ASP B CB  1 
ATOM   2722 C  CG  . ASP B  1 145 ? 1.889   35.589 51.836  1.00 37.39 ? 168  ASP B CG  1 
ATOM   2723 O  OD1 . ASP B  1 145 ? 1.851   36.453 50.925  1.00 44.06 ? 168  ASP B OD1 1 
ATOM   2724 O  OD2 . ASP B  1 145 ? 1.911   34.357 51.611  1.00 49.15 ? 168  ASP B OD2 1 
ATOM   2725 N  N   . SER B  1 146 ? 3.348   37.461 55.774  1.00 16.91 ? 169  SER B N   1 
ATOM   2726 C  CA  . SER B  1 146 ? 3.277   37.923 57.159  1.00 21.80 ? 169  SER B CA  1 
ATOM   2727 C  C   . SER B  1 146 ? 3.521   39.434 57.250  1.00 16.51 ? 169  SER B C   1 
ATOM   2728 O  O   . SER B  1 146 ? 2.820   40.147 57.975  1.00 18.35 ? 169  SER B O   1 
ATOM   2729 C  CB  . SER B  1 146 ? 4.228   37.138 58.072  1.00 28.35 ? 169  SER B CB  1 
ATOM   2730 O  OG  . SER B  1 146 ? 5.568   37.595 57.935  1.00 27.15 ? 169  SER B OG  1 
ATOM   2731 N  N   . SER B  1 147 ? 4.476   39.944 56.479  1.00 15.88 ? 170  SER B N   1 
ATOM   2732 C  CA  . SER B  1 147 ? 4.754   41.372 56.510  1.00 14.20 ? 170  SER B CA  1 
ATOM   2733 C  C   . SER B  1 147 ? 3.623   42.187 55.883  1.00 15.37 ? 170  SER B C   1 
ATOM   2734 O  O   . SER B  1 147 ? 3.309   43.296 56.324  1.00 17.04 ? 170  SER B O   1 
ATOM   2735 C  CB  . SER B  1 147 ? 6.039   41.680 55.747  1.00 23.53 ? 170  SER B CB  1 
ATOM   2736 O  OG  . SER B  1 147 ? 6.392   43.037 55.929  1.00 34.38 ? 170  SER B OG  1 
ATOM   2737 N  N   . CYS B  1 148 ? 3.043   41.629 54.836  1.00 15.44 ? 171  CYS B N   1 
ATOM   2738 C  CA  . CYS B  1 148 ? 1.935   42.266 54.135  1.00 14.22 ? 171  CYS B CA  1 
ATOM   2739 C  C   . CYS B  1 148 ? 0.738   42.411 55.080  1.00 16.64 ? 171  CYS B C   1 
ATOM   2740 O  O   . CYS B  1 148 ? 0.158   43.501 55.236  1.00 16.21 ? 171  CYS B O   1 
ATOM   2741 C  CB  . CYS B  1 148 ? 1.584   41.415 52.917  1.00 16.72 ? 171  CYS B CB  1 
ATOM   2742 S  SG  . CYS B  1 148 ? 0.478   42.189 51.736  1.00 16.76 ? 171  CYS B SG  1 
ATOM   2743 N  N   . LYS B  1 149 ? 0.392   41.316 55.745  1.00 13.80 ? 172  LYS B N   1 
ATOM   2744 C  CA  . LYS B  1 149 ? -0.708  41.347 56.711  1.00 16.09 ? 172  LYS B CA  1 
ATOM   2745 C  C   . LYS B  1 149 ? -0.440  42.275 57.905  1.00 21.81 ? 172  LYS B C   1 
ATOM   2746 O  O   . LYS B  1 149 ? -1.358  42.896 58.439  1.00 19.35 ? 172  LYS B O   1 
ATOM   2747 C  CB  . LYS B  1 149 ? -1.051  39.921 57.157  1.00 18.35 ? 172  LYS B CB  1 
ATOM   2748 C  CG  . LYS B  1 149 ? -1.559  39.068 56.000  1.00 24.64 ? 172  LYS B CG  1 
ATOM   2749 C  CD  . LYS B  1 149 ? -2.139  37.754 56.458  1.00 30.13 ? 172  LYS B CD  1 
ATOM   2750 C  CE  . LYS B  1 149 ? -2.705  37.007 55.259  1.00 29.13 ? 172  LYS B CE  1 
ATOM   2751 N  NZ  . LYS B  1 149 ? -3.258  35.678 55.616  1.00 40.68 ? 172  LYS B NZ  1 
ATOM   2752 N  N   . SER B  1 150 ? 0.813   42.388 58.335  1.00 18.13 ? 173  SER B N   1 
ATOM   2753 C  CA  . SER B  1 150 ? 1.127   43.331 59.401  1.00 19.44 ? 173  SER B CA  1 
ATOM   2754 C  C   . SER B  1 150 ? 1.000   44.771 58.917  1.00 15.14 ? 173  SER B C   1 
ATOM   2755 O  O   . SER B  1 150 ? 0.701   45.679 59.692  1.00 14.02 ? 173  SER B O   1 
ATOM   2756 C  CB  . SER B  1 150 ? 2.542   43.098 59.956  1.00 22.80 ? 173  SER B CB  1 
ATOM   2757 O  OG  . SER B  1 150 ? 2.606   41.877 60.673  1.00 30.57 ? 173  SER B OG  1 
ATOM   2758 N  N   . ALA B  1 151 ? 1.211   45.001 57.629  1.00 12.31 ? 174  ALA B N   1 
ATOM   2759 C  CA  . ALA B  1 151 ? 1.178   46.375 57.140  1.00 10.76 ? 174  ALA B CA  1 
ATOM   2760 C  C   . ALA B  1 151 ? -0.271  46.823 57.012  1.00 10.29 ? 174  ALA B C   1 
ATOM   2761 O  O   . ALA B  1 151 ? -0.591  47.995 57.212  1.00 13.80 ? 174  ALA B O   1 
ATOM   2762 C  CB  . ALA B  1 151 ? 1.881   46.479 55.786  1.00 15.98 ? 174  ALA B CB  1 
ATOM   2763 N  N   . TYR B  1 152 ? -1.136  45.870 56.678  1.00 12.05 ? 175  TYR B N   1 
ATOM   2764 C  CA  . TYR B  1 152 ? -2.563  46.160 56.422  1.00 11.92 ? 175  TYR B CA  1 
ATOM   2765 C  C   . TYR B  1 152 ? -3.478  45.192 57.161  1.00 10.36 ? 175  TYR B C   1 
ATOM   2766 O  O   . TYR B  1 152 ? -4.082  44.305 56.553  1.00 11.76 ? 175  TYR B O   1 
ATOM   2767 C  CB  . TYR B  1 152 ? -2.855  46.032 54.929  1.00 10.90 ? 175  TYR B CB  1 
ATOM   2768 C  CG  . TYR B  1 152 ? -2.155  47.063 54.088  1.00 10.72 ? 175  TYR B CG  1 
ATOM   2769 C  CD1 . TYR B  1 152 ? -2.600  48.379 54.067  1.00 13.82 ? 175  TYR B CD1 1 
ATOM   2770 C  CD2 . TYR B  1 152 ? -1.034  46.727 53.336  1.00 9.35  ? 175  TYR B CD2 1 
ATOM   2771 C  CE1 . TYR B  1 152 ? -1.955  49.336 53.310  1.00 12.84 ? 175  TYR B CE1 1 
ATOM   2772 C  CE2 . TYR B  1 152 ? -0.383  47.679 52.574  1.00 10.17 ? 175  TYR B CE2 1 
ATOM   2773 C  CZ  . TYR B  1 152 ? -0.842  48.977 52.573  1.00 13.62 ? 175  TYR B CZ  1 
ATOM   2774 O  OH  . TYR B  1 152 ? -0.223  49.930 51.820  1.00 14.56 ? 175  TYR B OH  1 
ATOM   2775 N  N   . PRO B  1 153 ? -3.589  45.353 58.485  1.00 11.15 ? 176  PRO B N   1 
ATOM   2776 C  CA  . PRO B  1 153 ? -4.274  44.353 59.304  1.00 11.56 ? 176  PRO B CA  1 
ATOM   2777 C  C   . PRO B  1 153 ? -5.743  44.238 58.920  1.00 10.60 ? 176  PRO B C   1 
ATOM   2778 O  O   . PRO B  1 153 ? -6.408  45.270 58.767  1.00 10.62 ? 176  PRO B O   1 
ATOM   2779 C  CB  . PRO B  1 153 ? -4.156  44.915 60.722  1.00 11.39 ? 176  PRO B CB  1 
ATOM   2780 C  CG  . PRO B  1 153 ? -2.979  45.884 60.665  1.00 17.53 ? 176  PRO B CG  1 
ATOM   2781 C  CD  . PRO B  1 153 ? -3.030  46.457 59.278  1.00 14.27 ? 176  PRO B CD  1 
ATOM   2782 N  N   . GLY B  1 154 ? -6.218  43.013 58.771  1.00 10.22 ? 177  GLY B N   1 
ATOM   2783 C  CA  . GLY B  1 154 ? -7.612  42.761 58.405  1.00 12.20 ? 177  GLY B CA  1 
ATOM   2784 C  C   . GLY B  1 154 ? -8.000  43.115 56.971  1.00 11.59 ? 177  GLY B C   1 
ATOM   2785 O  O   . GLY B  1 154 ? -9.204  43.154 56.659  1.00 12.28 ? 177  GLY B O   1 
ATOM   2786 N  N   . GLN B  1 155 ? -7.018  43.332 56.086  1.00 7.22  ? 178  GLN B N   1 
ATOM   2787 C  CA  . GLN B  1 155 ? -7.306  43.817 54.720  1.00 7.58  ? 178  GLN B CA  1 
ATOM   2788 C  C   . GLN B  1 155 ? -6.765  42.968 53.565  1.00 9.48  ? 178  GLN B C   1 
ATOM   2789 O  O   . GLN B  1 155 ? -7.120  43.180 52.385  1.00 10.94 ? 178  GLN B O   1 
ATOM   2790 C  CB  . GLN B  1 155 ? -6.836  45.289 54.543  1.00 8.04  ? 178  GLN B CB  1 
ATOM   2791 C  CG  . GLN B  1 155 ? -7.625  46.259 55.431  1.00 11.26 ? 178  GLN B CG  1 
ATOM   2792 C  CD  . GLN B  1 155 ? -7.344  47.713 55.129  1.00 13.55 ? 178  GLN B CD  1 
ATOM   2793 O  OE1 . GLN B  1 155 ? -8.239  48.452 54.724  1.00 27.27 ? 178  GLN B OE1 1 
ATOM   2794 N  NE2 . GLN B  1 155 ? -6.121  48.143 55.365  1.00 18.75 ? 178  GLN B NE2 1 
ATOM   2795 N  N   . ILE B  1 156 ? -5.912  42.003 53.876  1.00 9.50  ? 179  ILE B N   1 
ATOM   2796 C  CA  . ILE B  1 156 ? -5.210  41.295 52.801  1.00 10.29 ? 179  ILE B CA  1 
ATOM   2797 C  C   . ILE B  1 156 ? -5.857  39.959 52.539  1.00 12.72 ? 179  ILE B C   1 
ATOM   2798 O  O   . ILE B  1 156 ? -6.044  39.181 53.471  1.00 12.46 ? 179  ILE B O   1 
ATOM   2799 C  CB  . ILE B  1 156 ? -3.729  41.007 53.172  1.00 12.94 ? 179  ILE B CB  1 
ATOM   2800 C  CG1 . ILE B  1 156 ? -2.997  42.319 53.429  1.00 8.66  ? 179  ILE B CG1 1 
ATOM   2801 C  CG2 . ILE B  1 156 ? -3.034  40.242 52.044  1.00 11.74 ? 179  ILE B CG2 1 
ATOM   2802 C  CD1 . ILE B  1 156 ? -3.069  43.266 52.203  1.00 12.86 ? 179  ILE B CD1 1 
ATOM   2803 N  N   . THR B  1 157 ? -6.168  39.660 51.277  1.00 10.07 ? 180  THR B N   1 
ATOM   2804 C  CA  . THR B  1 157 ? -6.762  38.353 50.952  1.00 10.82 ? 180  THR B CA  1 
ATOM   2805 C  C   . THR B  1 157 ? -5.708  37.447 50.339  1.00 10.02 ? 180  THR B C   1 
ATOM   2806 O  O   . THR B  1 157 ? -4.592  37.883 50.074  1.00 10.19 ? 180  THR B O   1 
ATOM   2807 C  CB  . THR B  1 157 ? -7.911  38.460 49.954  1.00 13.45 ? 180  THR B CB  1 
ATOM   2808 O  OG1 . THR B  1 157 ? -7.398  38.774 48.641  1.00 10.60 ? 180  THR B OG1 1 
ATOM   2809 C  CG2 . THR B  1 157 ? -8.911  39.541 50.398  1.00 14.56 ? 180  THR B CG2 1 
ATOM   2810 N  N   . SER B  1 158 ? -6.078  36.194 50.113  1.00 11.37 ? 181  SER B N   1 
ATOM   2811 C  CA  . SER B  1 158 ? -5.161  35.261 49.472  1.00 11.90 ? 181  SER B CA  1 
ATOM   2812 C  C   . SER B  1 158 ? -4.928  35.558 47.988  1.00 11.95 ? 181  SER B C   1 
ATOM   2813 O  O   . SER B  1 158 ? -4.115  34.878 47.328  1.00 13.18 ? 181  SER B O   1 
ATOM   2814 C  CB  . SER B  1 158 ? -5.633  33.817 49.657  1.00 20.68 ? 181  SER B CB  1 
ATOM   2815 O  OG  . SER B  1 158 ? -6.807  33.559 48.905  1.00 22.44 ? 181  SER B OG  1 
ATOM   2816 N  N   . ASN B  1 159 ? -5.612  36.575 47.471  1.00 10.92 ? 182  ASN B N   1 
ATOM   2817 C  CA  . ASN B  1 159 ? -5.486  36.957 46.061  1.00 10.22 ? 182  ASN B CA  1 
ATOM   2818 C  C   . ASN B  1 159 ? -4.750  38.276 45.951  1.00 10.48 ? 182  ASN B C   1 
ATOM   2819 O  O   . ASN B  1 159 ? -4.826  38.981 44.923  1.00 9.16  ? 182  ASN B O   1 
ATOM   2820 C  CB  . ASN B  1 159 ? -6.856  37.051 45.410  1.00 12.40 ? 182  ASN B CB  1 
ATOM   2821 C  CG  . ASN B  1 159 ? -7.566  35.704 45.356  1.00 15.70 ? 182  ASN B CG  1 
ATOM   2822 O  OD1 . ASN B  1 159 ? -6.977  34.692 44.951  1.00 12.00 ? 182  ASN B OD1 1 
ATOM   2823 N  ND2 . ASN B  1 159 ? -8.844  35.685 45.736  1.00 14.53 ? 182  ASN B ND2 1 
ATOM   2824 N  N   . MET B  1 160 ? -4.053  38.632 47.033  1.00 7.33  ? 183  MET B N   1 
ATOM   2825 C  CA  . MET B  1 160 ? -3.204  39.803 47.020  1.00 7.77  ? 183  MET B CA  1 
ATOM   2826 C  C   . MET B  1 160 ? -1.795  39.465 47.496  1.00 12.59 ? 183  MET B C   1 
ATOM   2827 O  O   . MET B  1 160 ? -1.599  38.557 48.313  1.00 11.71 ? 183  MET B O   1 
ATOM   2828 C  CB  . MET B  1 160 ? -3.767  40.849 47.969  1.00 8.44  ? 183  MET B CB  1 
ATOM   2829 C  CG  . MET B  1 160 ? -5.240  41.143 47.727  1.00 8.35  ? 183  MET B CG  1 
ATOM   2830 S  SD  . MET B  1 160 ? -5.863  42.293 48.964  1.00 9.82  ? 183  MET B SD  1 
ATOM   2831 C  CE  . MET B  1 160 ? -7.592  42.432 48.431  1.00 12.07 ? 183  MET B CE  1 
ATOM   2832 N  N   . PHE B  1 161 ? -0.818  40.233 47.039  1.00 9.84  ? 184  PHE B N   1 
ATOM   2833 C  CA  . PHE B  1 161 ? 0.502   40.231 47.688  1.00 12.15 ? 184  PHE B CA  1 
ATOM   2834 C  C   . PHE B  1 161 ? 1.045   41.656 47.786  1.00 14.28 ? 184  PHE B C   1 
ATOM   2835 O  O   . PHE B  1 161 ? 0.641   42.540 47.015  1.00 12.95 ? 184  PHE B O   1 
ATOM   2836 C  CB  . PHE B  1 161 ? 1.513   39.308 46.973  1.00 8.79  ? 184  PHE B CB  1 
ATOM   2837 C  CG  . PHE B  1 161 ? 1.873   39.741 45.550  1.00 8.72  ? 184  PHE B CG  1 
ATOM   2838 C  CD1 . PHE B  1 161 ? 1.131   39.298 44.467  1.00 14.44 ? 184  PHE B CD1 1 
ATOM   2839 C  CD2 . PHE B  1 161 ? 2.979   40.574 45.311  1.00 11.31 ? 184  PHE B CD2 1 
ATOM   2840 C  CE1 . PHE B  1 161 ? 1.472   39.669 43.159  1.00 11.60 ? 184  PHE B CE1 1 
ATOM   2841 C  CE2 . PHE B  1 161 ? 3.330   40.947 43.996  1.00 9.58  ? 184  PHE B CE2 1 
ATOM   2842 C  CZ  . PHE B  1 161 ? 2.570   40.496 42.930  1.00 10.84 ? 184  PHE B CZ  1 
ATOM   2843 N  N   . CYS B  1 162 ? 1.954   41.881 48.734  1.00 9.69  ? 185  CYS B N   1 
ATOM   2844 C  CA  . CYS B  1 162 ? 2.605   43.176 48.844  1.00 9.66  ? 185  CYS B CA  1 
ATOM   2845 C  C   . CYS B  1 162 ? 3.954   43.088 48.161  1.00 12.25 ? 185  CYS B C   1 
ATOM   2846 O  O   . CYS B  1 162 ? 4.593   42.035 48.146  1.00 11.77 ? 185  CYS B O   1 
ATOM   2847 C  CB  . CYS B  1 162 ? 2.808   43.624 50.300  1.00 14.04 ? 185  CYS B CB  1 
ATOM   2848 S  SG  . CYS B  1 162 ? 1.320   43.969 51.274  1.00 14.37 ? 185  CYS B SG  1 
ATOM   2849 N  N   . ALA B  1 163 ? 4.359   44.188 47.551  1.00 11.40 ? 186  ALA B N   1 
ATOM   2850 C  CA  . ALA B  1 163 ? 5.692   44.283 46.966  1.00 9.09  ? 186  ALA B CA  1 
ATOM   2851 C  C   . ALA B  1 163 ? 6.197   45.688 47.187  1.00 11.70 ? 186  ALA B C   1 
ATOM   2852 O  O   . ALA B  1 163 ? 5.415   46.646 47.222  1.00 14.53 ? 186  ALA B O   1 
ATOM   2853 C  CB  . ALA B  1 163 ? 5.649   43.951 45.484  1.00 13.50 ? 186  ALA B CB  1 
ATOM   2854 N  N   . GLY B  1 164 ? 7.510   45.842 47.350  1.00 12.32 ? 187  GLY B N   1 
ATOM   2855 C  CA  . GLY B  1 164 ? 8.040   47.176 47.535  1.00 10.69 ? 187  GLY B CA  1 
ATOM   2856 C  C   . GLY B  1 164 ? 9.012   47.202 48.697  1.00 17.10 ? 187  GLY B C   1 
ATOM   2857 O  O   . GLY B  1 164 ? 9.730   46.224 48.934  1.00 15.93 ? 187  GLY B O   1 
ATOM   2858 N  N   . TYR B  1 165 ? 9.009   48.322 49.411  1.00 15.04 ? 188  TYR B N   1 
ATOM   2859 C  CA  . TYR B  1 165 ? 10.014  48.631 50.430  1.00 16.02 ? 188  TYR B CA  1 
ATOM   2860 C  C   . TYR B  1 165 ? 9.361   49.226 51.662  1.00 20.46 ? 188  TYR B C   1 
ATOM   2861 O  O   . TYR B  1 165 ? 8.729   50.287 51.591  1.00 20.31 ? 188  TYR B O   1 
ATOM   2862 C  CB  . TYR B  1 165 ? 11.005  49.642 49.863  1.00 20.55 ? 188  TYR B CB  1 
ATOM   2863 C  CG  . TYR B  1 165 ? 11.725  49.103 48.664  1.00 22.74 ? 188  TYR B CG  1 
ATOM   2864 C  CD1 . TYR B  1 165 ? 11.191  49.255 47.386  1.00 18.53 ? 188  TYR B CD1 1 
ATOM   2865 C  CD2 . TYR B  1 165 ? 12.910  48.393 48.804  1.00 23.07 ? 188  TYR B CD2 1 
ATOM   2866 C  CE1 . TYR B  1 165 ? 11.822  48.736 46.290  1.00 18.38 ? 188  TYR B CE1 1 
ATOM   2867 C  CE2 . TYR B  1 165 ? 13.563  47.873 47.700  1.00 23.45 ? 188  TYR B CE2 1 
ATOM   2868 C  CZ  . TYR B  1 165 ? 13.016  48.053 46.445  1.00 23.45 ? 188  TYR B CZ  1 
ATOM   2869 O  OH  . TYR B  1 165 ? 13.647  47.531 45.348  1.00 19.42 ? 188  TYR B OH  1 
ATOM   2870 N  N   . LEU B  1 166 ? 9.517   48.567 52.801  1.00 14.82 ? 189  LEU B N   1 
ATOM   2871 C  CA  . LEU B  1 166 ? 8.847   49.067 53.990  1.00 25.14 ? 189  LEU B CA  1 
ATOM   2872 C  C   . LEU B  1 166 ? 9.393   50.414 54.458  1.00 22.12 ? 189  LEU B C   1 
ATOM   2873 O  O   . LEU B  1 166 ? 8.721   51.126 55.203  1.00 19.04 ? 189  LEU B O   1 
ATOM   2874 C  CB  . LEU B  1 166 ? 8.914   48.051 55.116  1.00 18.25 ? 189  LEU B CB  1 
ATOM   2875 C  CG  . LEU B  1 166 ? 8.224   46.715 54.853  1.00 22.50 ? 189  LEU B CG  1 
ATOM   2876 C  CD1 . LEU B  1 166 ? 8.387   45.814 56.065  1.00 26.21 ? 189  LEU B CD1 1 
ATOM   2877 C  CD2 . LEU B  1 166 ? 6.742   46.933 54.530  1.00 20.85 ? 189  LEU B CD2 1 
ATOM   2878 N  N   . GLU B  1 167 ? 10.605  50.760 54.019  1.00 21.32 ? 190  GLU B N   1 
ATOM   2879 C  CA  . GLU B  1 167 ? 11.225  52.019 54.436  1.00 21.69 ? 190  GLU B CA  1 
ATOM   2880 C  C   . GLU B  1 167 ? 10.552  53.244 53.821  1.00 22.97 ? 190  GLU B C   1 
ATOM   2881 O  O   . GLU B  1 167 ? 10.711  54.358 54.310  1.00 28.95 ? 190  GLU B O   1 
ATOM   2882 C  CB  . GLU B  1 167 ? 12.736  52.019 54.135  1.00 24.65 ? 190  GLU B CB  1 
ATOM   2883 C  CG  . GLU B  1 167 ? 13.132  51.639 52.691  1.00 30.10 ? 190  GLU B CG  1 
ATOM   2884 C  CD  . GLU B  1 167 ? 13.392  50.127 52.485  1.00 43.57 ? 190  GLU B CD  1 
ATOM   2885 O  OE1 . GLU B  1 167 ? 12.533  49.289 52.866  1.00 27.64 ? 190  GLU B OE1 1 
ATOM   2886 O  OE2 . GLU B  1 167 ? 14.468  49.782 51.928  1.00 38.87 ? 190  GLU B OE2 1 
ATOM   2887 N  N   . GLY B  1 168 ? 9.781   53.033 52.754  1.00 21.50 ? 191  GLY B N   1 
ATOM   2888 C  CA  . GLY B  1 168 ? 9.150   54.134 52.039  1.00 23.01 ? 191  GLY B CA  1 
ATOM   2889 C  C   . GLY B  1 168 ? 9.981   54.574 50.842  1.00 25.63 ? 191  GLY B C   1 
ATOM   2890 O  O   . GLY B  1 168 ? 11.062  54.040 50.615  1.00 27.07 ? 191  GLY B O   1 
ATOM   2891 N  N   . GLY B  1 169 ? 9.469   55.528 50.070  1.00 19.81 ? 192  GLY B N   1 
ATOM   2892 C  CA  . GLY B  1 169 ? 10.233  56.144 48.996  1.00 23.91 ? 192  GLY B CA  1 
ATOM   2893 C  C   . GLY B  1 169 ? 10.130  55.531 47.606  1.00 20.28 ? 192  GLY B C   1 
ATOM   2894 O  O   . GLY B  1 169 ? 10.360  56.213 46.604  1.00 16.74 ? 192  GLY B O   1 
ATOM   2895 N  N   . LYS B  1 170 ? 9.800   54.245 47.534  1.00 14.78 ? 193  LYS B N   1 
ATOM   2896 C  CA  . LYS B  1 170 ? 9.717   53.554 46.246  1.00 20.79 ? 193  LYS B CA  1 
ATOM   2897 C  C   . LYS B  1 170 ? 8.417   52.736 46.167  1.00 12.29 ? 193  LYS B C   1 
ATOM   2898 O  O   . LYS B  1 170 ? 8.225   51.812 46.947  1.00 11.52 ? 193  LYS B O   1 
ATOM   2899 C  CB  . LYS B  1 170 ? 10.960  52.666 46.060  1.00 17.97 ? 193  LYS B CB  1 
ATOM   2900 C  CG  . LYS B  1 170 ? 12.251  53.486 45.857  1.00 21.26 ? 193  LYS B CG  1 
ATOM   2901 C  CD  . LYS B  1 170 ? 13.496  52.701 46.211  1.00 25.62 ? 193  LYS B CD  1 
ATOM   2902 C  CE  . LYS B  1 170 ? 13.725  51.563 45.259  1.00 31.46 ? 193  LYS B CE  1 
ATOM   2903 N  NZ  . LYS B  1 170 ? 15.053  50.914 45.512  1.00 30.85 ? 193  LYS B NZ  1 
ATOM   2904 N  N   . ASP B  1 171 ? 7.531   53.079 45.236  1.00 12.62 ? 194  ASP B N   1 
ATOM   2905 C  CA  . ASP B  1 171 ? 6.209   52.445 45.175  1.00 10.47 ? 194  ASP B CA  1 
ATOM   2906 C  C   . ASP B  1 171 ? 5.519   52.780 43.844  1.00 12.89 ? 194  ASP B C   1 
ATOM   2907 O  O   . ASP B  1 171 ? 5.934   53.682 43.124  1.00 16.17 ? 194  ASP B O   1 
ATOM   2908 C  CB  . ASP B  1 171 ? 5.365   52.989 46.320  1.00 12.16 ? 194  ASP B CB  1 
ATOM   2909 C  CG  . ASP B  1 171 ? 4.182   52.109 46.684  1.00 14.73 ? 194  ASP B CG  1 
ATOM   2910 O  OD1 . ASP B  1 171 ? 3.964   51.036 46.075  1.00 16.34 ? 194  ASP B OD1 1 
ATOM   2911 O  OD2 . ASP B  1 171 ? 3.481   52.507 47.624  1.00 18.22 ? 194  ASP B OD2 1 
ATOM   2912 N  N   . SER B  1 172 ? 4.457   52.057 43.524  1.00 13.78 ? 195  SER B N   1 
ATOM   2913 C  CA  . SER B  1 172 ? 3.580   52.511 42.445  1.00 12.24 ? 195  SER B CA  1 
ATOM   2914 C  C   . SER B  1 172 ? 2.618   53.541 43.041  1.00 10.85 ? 195  SER B C   1 
ATOM   2915 O  O   . SER B  1 172 ? 2.559   53.708 44.269  1.00 16.98 ? 195  SER B O   1 
ATOM   2916 C  CB  . SER B  1 172 ? 2.857   51.327 41.782  1.00 14.91 ? 195  SER B CB  1 
ATOM   2917 O  OG  . SER B  1 172 ? 2.145   50.563 42.730  1.00 14.78 ? 195  SER B OG  1 
ATOM   2918 N  N   . CYS B  1 173 ? 1.896   54.264 42.189  1.00 12.67 ? 196  CYS B N   1 
ATOM   2919 C  CA  . CYS B  1 173 ? 1.115   55.391 42.669  1.00 10.46 ? 196  CYS B CA  1 
ATOM   2920 C  C   . CYS B  1 173 ? -0.114  55.662 41.796  1.00 9.68  ? 196  CYS B C   1 
ATOM   2921 O  O   . CYS B  1 173 ? -0.350  54.935 40.847  1.00 12.73 ? 196  CYS B O   1 
ATOM   2922 C  CB  . CYS B  1 173 ? 2.017   56.616 42.755  1.00 15.52 ? 196  CYS B CB  1 
ATOM   2923 S  SG  . CYS B  1 173 ? 1.434   57.893 43.869  1.00 17.77 ? 196  CYS B SG  1 
ATOM   2924 N  N   . GLN B  1 174 ? -0.883  56.704 42.106  1.00 12.68 ? 197  GLN B N   1 
ATOM   2925 C  CA  . GLN B  1 174 ? -2.124  56.966 41.367  1.00 11.38 ? 197  GLN B CA  1 
ATOM   2926 C  C   . GLN B  1 174 ? -1.858  57.206 39.887  1.00 15.32 ? 197  GLN B C   1 
ATOM   2927 O  O   . GLN B  1 174 ? -1.007  58.018 39.520  1.00 15.18 ? 197  GLN B O   1 
ATOM   2928 C  CB  . GLN B  1 174 ? -2.925  58.133 41.990  1.00 11.39 ? 197  GLN B CB  1 
ATOM   2929 C  CG  . GLN B  1 174 ? -3.812  57.724 43.167  1.00 13.33 ? 197  GLN B CG  1 
ATOM   2930 C  CD  . GLN B  1 174 ? -3.030  57.306 44.398  1.00 20.03 ? 197  GLN B CD  1 
ATOM   2931 O  OE1 . GLN B  1 174 ? -2.059  57.964 44.789  1.00 19.36 ? 197  GLN B OE1 1 
ATOM   2932 N  NE2 . GLN B  1 174 ? -3.460  56.206 45.030  1.00 14.90 ? 197  GLN B NE2 1 
ATOM   2933 N  N   . GLY B  1 175 ? -2.569  56.471 39.039  1.00 9.60  ? 198  GLY B N   1 
ATOM   2934 C  CA  . GLY B  1 175 ? -2.302  56.476 37.621  1.00 9.13  ? 198  GLY B CA  1 
ATOM   2935 C  C   . GLY B  1 175 ? -1.579  55.222 37.155  1.00 10.45 ? 198  GLY B C   1 
ATOM   2936 O  O   . GLY B  1 175 ? -1.479  54.957 35.938  1.00 10.70 ? 198  GLY B O   1 
ATOM   2937 N  N   . ASP B  1 176 ? -1.079  54.439 38.104  1.00 11.99 ? 199  ASP B N   1 
ATOM   2938 C  CA  . ASP B  1 176 ? -0.413  53.172 37.769  1.00 10.24 ? 199  ASP B CA  1 
ATOM   2939 C  C   . ASP B  1 176 ? -1.349  51.980 37.823  1.00 10.90 ? 199  ASP B C   1 
ATOM   2940 O  O   . ASP B  1 176 ? -0.997  50.909 37.356  1.00 9.58  ? 199  ASP B O   1 
ATOM   2941 C  CB  . ASP B  1 176 ? 0.772   52.902 38.705  1.00 13.26 ? 199  ASP B CB  1 
ATOM   2942 C  CG  . ASP B  1 176 ? 1.930   53.863 38.476  1.00 11.48 ? 199  ASP B CG  1 
ATOM   2943 O  OD1 . ASP B  1 176 ? 2.254   54.160 37.311  1.00 12.43 ? 199  ASP B OD1 1 
ATOM   2944 O  OD2 . ASP B  1 176 ? 2.541   54.305 39.464  1.00 15.09 ? 199  ASP B OD2 1 
ATOM   2945 N  N   . SER B  1 177 ? -2.525  52.142 38.421  1.00 9.27  ? 200  SER B N   1 
ATOM   2946 C  CA  . SER B  1 177 ? -3.481  51.031 38.530  1.00 9.33  ? 200  SER B CA  1 
ATOM   2947 C  C   . SER B  1 177 ? -3.649  50.212 37.269  1.00 7.23  ? 200  SER B C   1 
ATOM   2948 O  O   . SER B  1 177 ? -3.716  50.753 36.154  1.00 8.79  ? 200  SER B O   1 
ATOM   2949 C  CB  . SER B  1 177 ? -4.855  51.571 38.932  1.00 7.68  ? 200  SER B CB  1 
ATOM   2950 O  OG  . SER B  1 177 ? -4.972  51.694 40.352  1.00 7.57  ? 200  SER B OG  1 
ATOM   2951 N  N   . GLY B  1 178 ? -3.727  48.887 37.419  1.00 6.36  ? 201  GLY B N   1 
ATOM   2952 C  CA  . GLY B  1 178 ? -3.930  48.034 36.254  1.00 6.30  ? 201  GLY B CA  1 
ATOM   2953 C  C   . GLY B  1 178 ? -2.662  47.568 35.584  1.00 8.16  ? 201  GLY B C   1 
ATOM   2954 O  O   . GLY B  1 178 ? -2.687  46.608 34.805  1.00 9.75  ? 201  GLY B O   1 
ATOM   2955 N  N   . GLY B  1 179 ? -1.560  48.258 35.876  1.00 7.37  ? 202  GLY B N   1 
ATOM   2956 C  CA  . GLY B  1 179 ? -0.273  47.985 35.246  1.00 9.44  ? 202  GLY B CA  1 
ATOM   2957 C  C   . GLY B  1 179 ? 0.389   46.694 35.707  1.00 7.80  ? 202  GLY B C   1 
ATOM   2958 O  O   . GLY B  1 179 ? -0.036  46.060 36.669  1.00 8.00  ? 202  GLY B O   1 
ATOM   2959 N  N   . PRO B  1 180 ? 1.473   46.301 35.025  1.00 8.68  ? 203  PRO B N   1 
ATOM   2960 C  CA  . PRO B  1 180 ? 2.100   45.010 35.336  1.00 9.71  ? 203  PRO B CA  1 
ATOM   2961 C  C   . PRO B  1 180 ? 3.089   45.005 36.497  1.00 9.48  ? 203  PRO B C   1 
ATOM   2962 O  O   . PRO B  1 180 ? 3.745   46.006 36.829  1.00 9.04  ? 203  PRO B O   1 
ATOM   2963 C  CB  . PRO B  1 180 ? 2.881   44.704 34.055  1.00 8.78  ? 203  PRO B CB  1 
ATOM   2964 C  CG  . PRO B  1 180 ? 3.226   46.043 33.529  1.00 8.82  ? 203  PRO B CG  1 
ATOM   2965 C  CD  . PRO B  1 180 ? 1.959   46.842 33.749  1.00 9.21  ? 203  PRO B CD  1 
ATOM   2966 N  N   . VAL B  1 181 ? 3.175   43.817 37.095  1.00 8.22  ? 204  VAL B N   1 
ATOM   2967 C  CA  . VAL B  1 181 ? 4.258   43.438 37.967  1.00 8.74  ? 204  VAL B CA  1 
ATOM   2968 C  C   . VAL B  1 181 ? 4.810   42.158 37.387  1.00 10.90 ? 204  VAL B C   1 
ATOM   2969 O  O   . VAL B  1 181 ? 4.126   41.115 37.370  1.00 7.83  ? 204  VAL B O   1 
ATOM   2970 C  CB  . VAL B  1 181 ? 3.751   43.133 39.343  1.00 8.27  ? 204  VAL B CB  1 
ATOM   2971 C  CG1 . VAL B  1 181 ? 4.956   42.766 40.266  1.00 8.73  ? 204  VAL B CG1 1 
ATOM   2972 C  CG2 . VAL B  1 181 ? 3.006   44.333 39.882  1.00 12.84 ? 204  VAL B CG2 1 
ATOM   2973 N  N   . VAL B  1 182 ? 6.037   42.229 36.882  1.00 10.93 ? 205  VAL B N   1 
ATOM   2974 C  CA  . VAL B  1 182 ? 6.572   41.110 36.129  1.00 10.64 ? 205  VAL B CA  1 
ATOM   2975 C  C   . VAL B  1 182 ? 7.806   40.595 36.840  1.00 10.65 ? 205  VAL B C   1 
ATOM   2976 O  O   . VAL B  1 182 ? 8.680   41.387 37.224  1.00 11.63 ? 205  VAL B O   1 
ATOM   2977 C  CB  . VAL B  1 182 ? 6.867   41.479 34.666  1.00 8.42  ? 205  VAL B CB  1 
ATOM   2978 C  CG1 . VAL B  1 182 ? 7.814   40.459 33.989  1.00 11.62 ? 205  VAL B CG1 1 
ATOM   2979 C  CG2 . VAL B  1 182 ? 5.566   41.539 33.881  1.00 10.92 ? 205  VAL B CG2 1 
ATOM   2980 N  N   . CYS B  1 183 ? 7.821   39.283 37.051  1.00 11.62 ? 206  CYS B N   1 
ATOM   2981 C  CA  . CYS B  1 183 ? 8.879   38.593 37.795  1.00 13.90 ? 206  CYS B CA  1 
ATOM   2982 C  C   . CYS B  1 183 ? 9.364   37.418 36.947  1.00 14.06 ? 206  CYS B C   1 
ATOM   2983 O  O   . CYS B  1 183 ? 8.573   36.550 36.581  1.00 13.22 ? 206  CYS B O   1 
ATOM   2984 C  CB  . CYS B  1 183 ? 8.337   38.064 39.122  1.00 13.45 ? 206  CYS B CB  1 
ATOM   2985 S  SG  . CYS B  1 183 ? 7.193   39.169 40.045  1.00 15.58 ? 206  CYS B SG  1 
ATOM   2986 N  N   . SER B  1 184 ? 10.656  37.403 36.624  1.00 15.22 ? 207  SER B N   1 
ATOM   2987 C  CA  . SER B  1 184 ? 11.238  36.324 35.809  1.00 24.49 ? 207  SER B CA  1 
ATOM   2988 C  C   . SER B  1 184 ? 10.468  36.131 34.499  1.00 20.38 ? 207  SER B C   1 
ATOM   2989 O  O   . SER B  1 184 ? 10.195  34.999 34.071  1.00 18.13 ? 207  SER B O   1 
ATOM   2990 C  CB  . SER B  1 184 ? 11.274  35.010 36.601  1.00 26.35 ? 207  SER B CB  1 
ATOM   2991 O  OG  . SER B  1 184 ? 11.895  35.171 37.872  1.00 21.41 ? 207  SER B OG  1 
ATOM   2992 N  N   . GLY B  1 185 ? 10.083  37.244 33.878  1.00 16.64 ? 208  GLY B N   1 
ATOM   2993 C  CA  . GLY B  1 185 ? 9.388   37.202 32.604  1.00 17.99 ? 208  GLY B CA  1 
ATOM   2994 C  C   . GLY B  1 185 ? 7.953   36.696 32.640  1.00 11.18 ? 208  GLY B C   1 
ATOM   2995 O  O   . GLY B  1 185 ? 7.401   36.356 31.589  1.00 12.01 ? 208  GLY B O   1 
ATOM   2996 N  N   . LYS B  1 186 ? 7.355   36.632 33.830  1.00 12.16 ? 209  LYS B N   1 
ATOM   2997 C  CA  . LYS B  1 186 ? 5.945   36.219 33.943  1.00 9.80  ? 209  LYS B CA  1 
ATOM   2998 C  C   . LYS B  1 186 ? 5.141   37.341 34.601  1.00 8.19  ? 209  LYS B C   1 
ATOM   2999 O  O   . LYS B  1 186 ? 5.611   37.988 35.535  1.00 10.58 ? 209  LYS B O   1 
ATOM   3000 C  CB  . LYS B  1 186 ? 5.812   34.965 34.816  1.00 12.91 ? 209  LYS B CB  1 
ATOM   3001 C  CG  . LYS B  1 186 ? 6.753   33.813 34.435  1.00 18.19 ? 209  LYS B CG  1 
ATOM   3002 C  CD  . LYS B  1 186 ? 6.385   33.255 33.071  1.00 15.19 ? 209  LYS B CD  1 
ATOM   3003 C  CE  . LYS B  1 186 ? 7.270   32.033 32.699  1.00 19.80 ? 209  LYS B CE  1 
ATOM   3004 N  NZ  . LYS B  1 186 ? 6.825   31.490 31.396  1.00 26.35 ? 209  LYS B NZ  1 
ATOM   3005 N  N   . LEU B  1 187 ? 3.899   37.519 34.164  1.00 9.30  ? 210  LEU B N   1 
ATOM   3006 C  CA  . LEU B  1 187 ? 3.022   38.516 34.791  1.00 9.35  ? 210  LEU B CA  1 
ATOM   3007 C  C   . LEU B  1 187 ? 2.471   37.948 36.109  1.00 7.84  ? 210  LEU B C   1 
ATOM   3008 O  O   . LEU B  1 187 ? 1.559   37.106 36.089  1.00 13.54 ? 210  LEU B O   1 
ATOM   3009 C  CB  . LEU B  1 187 ? 1.864   38.865 33.851  1.00 7.71  ? 210  LEU B CB  1 
ATOM   3010 C  CG  . LEU B  1 187 ? 0.874   39.922 34.376  1.00 10.38 ? 210  LEU B CG  1 
ATOM   3011 C  CD1 . LEU B  1 187 ? 1.546   41.313 34.450  1.00 6.79  ? 210  LEU B CD1 1 
ATOM   3012 C  CD2 . LEU B  1 187 ? -0.420  39.945 33.526  1.00 9.66  ? 210  LEU B CD2 1 
ATOM   3013 N  N   . GLN B  1 188 ? 2.994   38.415 37.237  1.00 7.84  ? 211  GLN B N   1 
ATOM   3014 C  CA  . GLN B  1 188 ? 2.579   37.875 38.543  1.00 9.90  ? 211  GLN B CA  1 
ATOM   3015 C  C   . GLN B  1 188 ? 1.634   38.813 39.285  1.00 9.17  ? 211  GLN B C   1 
ATOM   3016 O  O   . GLN B  1 188 ? 0.931   38.390 40.212  1.00 8.45  ? 211  GLN B O   1 
ATOM   3017 C  CB  . GLN B  1 188 ? 3.794   37.613 39.455  1.00 11.02 ? 211  GLN B CB  1 
ATOM   3018 C  CG  . GLN B  1 188 ? 4.732   36.463 39.016  1.00 14.70 ? 211  GLN B CG  1 
ATOM   3019 C  CD  . GLN B  1 188 ? 4.123   35.057 39.138  1.00 17.80 ? 211  GLN B CD  1 
ATOM   3020 O  OE1 . GLN B  1 188 ? 2.922   34.886 39.433  1.00 13.30 ? 211  GLN B OE1 1 
ATOM   3021 N  NE2 . GLN B  1 188 ? 4.954   34.031 38.865  1.00 12.93 ? 211  GLN B NE2 1 
ATOM   3022 N  N   . GLY B  1 189 ? 1.660   40.091 38.928  1.00 9.03  ? 212  GLY B N   1 
ATOM   3023 C  CA  . GLY B  1 189 ? 0.864   41.050 39.680  1.00 8.19  ? 212  GLY B CA  1 
ATOM   3024 C  C   . GLY B  1 189 ? 0.233   42.139 38.841  1.00 8.17  ? 212  GLY B C   1 
ATOM   3025 O  O   . GLY B  1 189 ? 0.693   42.432 37.736  1.00 9.22  ? 212  GLY B O   1 
ATOM   3026 N  N   . ILE B  1 190 ? -0.812  42.754 39.392  1.00 8.32  ? 213  ILE B N   1 
ATOM   3027 C  CA  . ILE B  1 190 ? -1.478  43.906 38.783  1.00 7.78  ? 213  ILE B CA  1 
ATOM   3028 C  C   . ILE B  1 190 ? -1.523  45.024 39.823  1.00 6.62  ? 213  ILE B C   1 
ATOM   3029 O  O   . ILE B  1 190 ? -1.939  44.800 40.956  1.00 6.30  ? 213  ILE B O   1 
ATOM   3030 C  CB  . ILE B  1 190 ? -2.925  43.584 38.406  1.00 8.54  ? 213  ILE B CB  1 
ATOM   3031 C  CG1 . ILE B  1 190 ? -2.996  42.413 37.429  1.00 6.04  ? 213  ILE B CG1 1 
ATOM   3032 C  CG2 . ILE B  1 190 ? -3.577  44.814 37.753  1.00 8.33  ? 213  ILE B CG2 1 
ATOM   3033 C  CD1 . ILE B  1 190 ? -4.398  41.854 37.274  1.00 9.89  ? 213  ILE B CD1 1 
ATOM   3034 N  N   . VAL B  1 191 ? -1.070  46.223 39.464  1.00 6.92  ? 214  VAL B N   1 
ATOM   3035 C  CA  . VAL B  1 191 ? -1.085  47.351 40.390  1.00 6.23  ? 214  VAL B CA  1 
ATOM   3036 C  C   . VAL B  1 191 ? -2.520  47.588 40.869  1.00 8.30  ? 214  VAL B C   1 
ATOM   3037 O  O   . VAL B  1 191 ? -3.430  47.737 40.056  1.00 8.31  ? 214  VAL B O   1 
ATOM   3038 C  CB  . VAL B  1 191 ? -0.573  48.623 39.701  1.00 12.60 ? 214  VAL B CB  1 
ATOM   3039 C  CG1 . VAL B  1 191 ? -0.593  49.801 40.665  1.00 10.36 ? 214  VAL B CG1 1 
ATOM   3040 C  CG2 . VAL B  1 191 ? 0.839   48.388 39.149  1.00 12.36 ? 214  VAL B CG2 1 
ATOM   3041 N  N   . SER B  1 192 ? -2.726  47.633 42.183  1.00 8.56  ? 215  SER B N   1 
ATOM   3042 C  CA  . SER B  1 192 ? -4.095  47.689 42.686  1.00 11.91 ? 215  SER B CA  1 
ATOM   3043 C  C   . SER B  1 192 ? -4.261  48.799 43.718  1.00 13.32 ? 215  SER B C   1 
ATOM   3044 O  O   . SER B  1 192 ? -4.869  49.845 43.430  1.00 11.54 ? 215  SER B O   1 
ATOM   3045 C  CB  . SER B  1 192 ? -4.514  46.308 43.222  1.00 12.05 ? 215  SER B CB  1 
ATOM   3046 O  OG  . SER B  1 192 ? -5.844  46.310 43.753  1.00 13.26 ? 215  SER B OG  1 
ATOM   3047 N  N   . TRP B  1 193 ? -3.692  48.622 44.906  1.00 8.44  ? 216  TRP B N   1 
ATOM   3048 C  CA  . TRP B  1 193 ? -3.950  49.617 45.961  1.00 10.74 ? 216  TRP B CA  1 
ATOM   3049 C  C   . TRP B  1 193 ? -2.849  49.751 46.981  1.00 12.90 ? 216  TRP B C   1 
ATOM   3050 O  O   . TRP B  1 193 ? -1.839  49.047 46.928  1.00 10.52 ? 216  TRP B O   1 
ATOM   3051 C  CB  . TRP B  1 193 ? -5.281  49.346 46.664  1.00 9.98  ? 216  TRP B CB  1 
ATOM   3052 C  CG  . TRP B  1 193 ? -5.347  48.050 47.434  1.00 9.21  ? 216  TRP B CG  1 
ATOM   3053 C  CD1 . TRP B  1 193 ? -5.629  46.812 46.934  1.00 7.25  ? 216  TRP B CD1 1 
ATOM   3054 C  CD2 . TRP B  1 193 ? -5.197  47.887 48.850  1.00 10.90 ? 216  TRP B CD2 1 
ATOM   3055 N  NE1 . TRP B  1 193 ? -5.656  45.881 47.955  1.00 8.06  ? 216  TRP B NE1 1 
ATOM   3056 C  CE2 . TRP B  1 193 ? -5.375  46.514 49.137  1.00 13.56 ? 216  TRP B CE2 1 
ATOM   3057 C  CE3 . TRP B  1 193 ? -4.897  48.760 49.901  1.00 12.77 ? 216  TRP B CE3 1 
ATOM   3058 C  CZ2 . TRP B  1 193 ? -5.263  45.996 50.434  1.00 10.49 ? 216  TRP B CZ2 1 
ATOM   3059 C  CZ3 . TRP B  1 193 ? -4.800  48.243 51.193  1.00 12.43 ? 216  TRP B CZ3 1 
ATOM   3060 C  CH2 . TRP B  1 193 ? -4.996  46.881 51.444  1.00 13.17 ? 216  TRP B CH2 1 
ATOM   3061 N  N   . GLY B  1 194 ? -3.051  50.696 47.901  1.00 8.24  ? 217  GLY B N   1 
ATOM   3062 C  CA  . GLY B  1 194 ? -2.162  50.878 49.043  1.00 13.50 ? 217  GLY B CA  1 
ATOM   3063 C  C   . GLY B  1 194 ? -2.614  52.086 49.833  1.00 14.56 ? 217  GLY B C   1 
ATOM   3064 O  O   . GLY B  1 194 ? -3.538  52.784 49.438  1.00 16.19 ? 217  GLY B O   1 
ATOM   3065 N  N   . SER B  1 195 ? -1.992  52.341 50.974  1.00 16.37 ? 218  SER B N   1 
ATOM   3066 C  CA  A SER B  1 195 ? -2.333  53.523 51.752  0.14 14.54 ? 218  SER B CA  1 
ATOM   3067 C  CA  B SER B  1 195 ? -2.338  53.524 51.748  0.86 14.30 ? 218  SER B CA  1 
ATOM   3068 C  C   . SER B  1 195 ? -1.450  54.672 51.296  1.00 12.68 ? 218  SER B C   1 
ATOM   3069 O  O   . SER B  1 195 ? -0.294  54.774 51.711  1.00 19.33 ? 218  SER B O   1 
ATOM   3070 C  CB  A SER B  1 195 ? -2.139  53.268 53.247  0.14 19.56 ? 218  SER B CB  1 
ATOM   3071 C  CB  B SER B  1 195 ? -2.159  53.251 53.249  0.86 19.55 ? 218  SER B CB  1 
ATOM   3072 O  OG  A SER B  1 195 ? -2.420  54.438 54.000  0.14 25.05 ? 218  SER B OG  1 
ATOM   3073 O  OG  B SER B  1 195 ? -2.384  54.437 54.008  0.86 25.30 ? 218  SER B OG  1 
ATOM   3074 N  N   . GLY B  1 196 ? -1.979  55.523 50.425  1.00 14.45 ? 219  GLY B N   1 
ATOM   3075 C  CA  . GLY B  1 196 ? -1.170  56.566 49.813  1.00 20.49 ? 219  GLY B CA  1 
ATOM   3076 C  C   . GLY B  1 196 ? -0.111  55.888 48.962  1.00 15.97 ? 219  GLY B C   1 
ATOM   3077 O  O   . GLY B  1 196 ? -0.304  54.724 48.569  1.00 17.06 ? 219  GLY B O   1 
ATOM   3078 N  N   . CYS B  1 197 ? 0.993   56.590 48.683  1.00 20.17 ? 220  CYS B N   1 
ATOM   3079 C  CA  . CYS B  1 197 ? 2.094   56.050 47.874  1.00 14.81 ? 220  CYS B CA  1 
ATOM   3080 C  C   . CYS B  1 197 ? 3.429   56.247 48.555  1.00 18.84 ? 220  CYS B C   1 
ATOM   3081 O  O   . CYS B  1 197 ? 3.719   57.339 49.037  1.00 22.03 ? 220  CYS B O   1 
ATOM   3082 C  CB  . CYS B  1 197 ? 2.232   56.794 46.535  1.00 16.29 ? 220  CYS B CB  1 
ATOM   3083 S  SG  . CYS B  1 197 ? 0.775   56.898 45.541  1.00 30.97 ? 220  CYS B SG  1 
ATOM   3084 N  N   . ALA B  1 198 ? 4.257   55.204 48.534  1.00 14.00 ? 221  ALA B N   1 
ATOM   3085 C  CA  . ALA B  1 198 ? 5.642   55.257 49.013  1.00 16.13 ? 221  ALA B CA  1 
ATOM   3086 C  C   . ALA B  1 198 ? 5.788   55.617 50.480  1.00 22.92 ? 221  ALA B C   1 
ATOM   3087 O  O   . ALA B  1 198 ? 6.850   56.084 50.890  1.00 21.19 ? 221  ALA B O   1 
ATOM   3088 C  CB  . ALA B  1 198 ? 6.500   56.201 48.145  1.00 16.94 ? 221  ALA B CB  1 
ATOM   3089 N  N   . GLN B  1 199 ? 4.749   55.373 51.280  1.00 18.37 ? 222  GLN B N   1 
ATOM   3090 C  CA  . GLN B  1 199 ? 4.810   55.737 52.698  1.00 22.15 ? 222  GLN B CA  1 
ATOM   3091 C  C   . GLN B  1 199 ? 5.432   54.611 53.506  1.00 23.32 ? 222  GLN B C   1 
ATOM   3092 O  O   . GLN B  1 199 ? 5.306   53.437 53.146  1.00 21.27 ? 222  GLN B O   1 
ATOM   3093 C  CB  . GLN B  1 199 ? 3.421   56.079 53.245  1.00 21.45 ? 222  GLN B CB  1 
ATOM   3094 C  CG  . GLN B  1 199 ? 2.751   57.267 52.567  1.00 26.50 ? 222  GLN B CG  1 
ATOM   3095 C  CD  . GLN B  1 199 ? 3.540   58.562 52.715  1.00 33.24 ? 222  GLN B CD  1 
ATOM   3096 O  OE1 . GLN B  1 199 ? 3.900   58.969 53.824  1.00 40.42 ? 222  GLN B OE1 1 
ATOM   3097 N  NE2 . GLN B  1 199 ? 3.819   59.214 51.590  1.00 31.33 ? 222  GLN B NE2 1 
ATOM   3098 N  N   . LYS B  1 200 ? 6.099   54.967 54.603  1.00 20.91 ? 223  LYS B N   1 
ATOM   3099 C  CA  . LYS B  1 200 ? 6.748   53.964 55.432  1.00 22.56 ? 223  LYS B CA  1 
ATOM   3100 C  C   . LYS B  1 200 ? 5.721   52.968 55.933  1.00 17.85 ? 223  LYS B C   1 
ATOM   3101 O  O   . LYS B  1 200 ? 4.615   53.356 56.342  1.00 22.49 ? 223  LYS B O   1 
ATOM   3102 C  CB  . LYS B  1 200 ? 7.453   54.625 56.628  1.00 29.54 ? 223  LYS B CB  1 
ATOM   3103 C  CG  . LYS B  1 200 ? 8.334   53.662 57.422  1.00 26.85 ? 223  LYS B CG  1 
ATOM   3104 C  CD  . LYS B  1 200 ? 9.036   54.352 58.596  1.00 39.98 ? 223  LYS B CD  1 
ATOM   3105 C  CE  . LYS B  1 200 ? 10.061  53.422 59.259  1.00 36.10 ? 223  LYS B CE  1 
ATOM   3106 N  NZ  . LYS B  1 200 ? 9.462   52.137 59.739  1.00 46.09 ? 223  LYS B NZ  1 
ATOM   3107 N  N   . ASN B  1 201 ? 6.086   51.689 55.864  1.00 18.17 ? 224  ASN B N   1 
ATOM   3108 C  CA  . ASN B  1 201 ? 5.266   50.583 56.365  1.00 19.45 ? 224  ASN B CA  1 
ATOM   3109 C  C   . ASN B  1 201 ? 3.950   50.388 55.630  1.00 19.74 ? 224  ASN B C   1 
ATOM   3110 O  O   . ASN B  1 201 ? 3.057   49.709 56.136  1.00 18.45 ? 224  ASN B O   1 
ATOM   3111 C  CB  . ASN B  1 201 ? 5.006   50.725 57.867  1.00 17.75 ? 224  ASN B CB  1 
ATOM   3112 C  CG  . ASN B  1 201 ? 6.247   50.501 58.676  1.00 34.15 ? 224  ASN B CG  1 
ATOM   3113 O  OD1 . ASN B  1 201 ? 7.162   49.802 58.233  1.00 28.68 ? 224  ASN B OD1 1 
ATOM   3114 N  ND2 . ASN B  1 201 ? 6.301   51.096 59.867  1.00 39.15 ? 224  ASN B ND2 1 
ATOM   3115 N  N   . LYS B  1 202 ? 3.852   50.975 54.440  1.00 18.92 ? 225  LYS B N   1 
ATOM   3116 C  CA  . LYS B  1 202 ? 2.640   50.895 53.611  1.00 17.46 ? 225  LYS B CA  1 
ATOM   3117 C  C   . LYS B  1 202 ? 3.002   50.580 52.159  1.00 11.58 ? 225  LYS B C   1 
ATOM   3118 O  O   . LYS B  1 202 ? 2.890   51.434 51.273  1.00 16.36 ? 225  LYS B O   1 
ATOM   3119 C  CB  . LYS B  1 202 ? 1.853   52.209 53.683  1.00 12.65 ? 225  LYS B CB  1 
ATOM   3120 C  CG  . LYS B  1 202 ? 1.267   52.497 55.072  1.00 19.20 ? 225  LYS B CG  1 
ATOM   3121 C  CD  . LYS B  1 202 ? 0.227   51.437 55.434  1.00 22.12 ? 225  LYS B CD  1 
ATOM   3122 C  CE  . LYS B  1 202 ? -0.528  51.805 56.701  1.00 20.81 ? 225  LYS B CE  1 
ATOM   3123 N  NZ  . LYS B  1 202 ? -1.326  50.631 57.176  1.00 28.12 ? 225  LYS B NZ  1 
ATOM   3124 N  N   . PRO B  1 203 ? 3.430   49.339 51.910  1.00 12.84 ? 226  PRO B N   1 
ATOM   3125 C  CA  . PRO B  1 203 ? 3.876   48.957 50.572  1.00 10.27 ? 226  PRO B CA  1 
ATOM   3126 C  C   . PRO B  1 203 ? 2.690   48.798 49.620  1.00 12.81 ? 226  PRO B C   1 
ATOM   3127 O  O   . PRO B  1 203 ? 1.532   48.755 50.061  1.00 14.82 ? 226  PRO B O   1 
ATOM   3128 C  CB  . PRO B  1 203 ? 4.505   47.589 50.826  1.00 15.71 ? 226  PRO B CB  1 
ATOM   3129 C  CG  . PRO B  1 203 ? 3.649   47.007 51.881  1.00 16.07 ? 226  PRO B CG  1 
ATOM   3130 C  CD  . PRO B  1 203 ? 3.413   48.179 52.820  1.00 15.58 ? 226  PRO B CD  1 
ATOM   3131 N  N   . GLY B  1 204 ? 2.967   48.698 48.329  1.00 11.30 ? 227  GLY B N   1 
ATOM   3132 C  CA  . GLY B  1 204 ? 1.890   48.475 47.386  1.00 12.80 ? 227  GLY B CA  1 
ATOM   3133 C  C   . GLY B  1 204 ? 1.282   47.097 47.561  1.00 10.84 ? 227  GLY B C   1 
ATOM   3134 O  O   . GLY B  1 204 ? 1.975   46.133 47.927  1.00 12.00 ? 227  GLY B O   1 
ATOM   3135 N  N   . VAL B  1 205 ? -0.016  47.000 47.267  1.00 7.59  ? 228  VAL B N   1 
ATOM   3136 C  CA  . VAL B  1 205 ? -0.747  45.733 47.250  1.00 9.79  ? 228  VAL B CA  1 
ATOM   3137 C  C   . VAL B  1 205 ? -1.151  45.440 45.806  1.00 9.34  ? 228  VAL B C   1 
ATOM   3138 O  O   . VAL B  1 205 ? -1.648  46.318 45.107  1.00 11.36 ? 228  VAL B O   1 
ATOM   3139 C  CB  . VAL B  1 205 ? -2.007  45.759 48.162  1.00 9.71  ? 228  VAL B CB  1 
ATOM   3140 C  CG1 . VAL B  1 205 ? -2.573  44.348 48.341  1.00 7.96  ? 228  VAL B CG1 1 
ATOM   3141 C  CG2 . VAL B  1 205 ? -1.645  46.355 49.512  1.00 9.79  ? 228  VAL B CG2 1 
ATOM   3142 N  N   . TYR B  1 206 ? -0.944  44.204 45.371  1.00 9.97  ? 229  TYR B N   1 
ATOM   3143 C  CA  . TYR B  1 206 ? -1.081  43.817 43.972  1.00 5.96  ? 229  TYR B CA  1 
ATOM   3144 C  C   . TYR B  1 206 ? -1.953  42.579 43.840  1.00 6.41  ? 229  TYR B C   1 
ATOM   3145 O  O   . TYR B  1 206 ? -1.935  41.685 44.708  1.00 8.04  ? 229  TYR B O   1 
ATOM   3146 C  CB  . TYR B  1 206 ? 0.321   43.493 43.427  1.00 8.35  ? 229  TYR B CB  1 
ATOM   3147 C  CG  . TYR B  1 206 ? 1.197   44.709 43.475  1.00 6.99  ? 229  TYR B CG  1 
ATOM   3148 C  CD1 . TYR B  1 206 ? 1.192   45.610 42.430  1.00 10.48 ? 229  TYR B CD1 1 
ATOM   3149 C  CD2 . TYR B  1 206 ? 1.975   45.001 44.599  1.00 8.77  ? 229  TYR B CD2 1 
ATOM   3150 C  CE1 . TYR B  1 206 ? 1.968   46.768 42.478  1.00 8.32  ? 229  TYR B CE1 1 
ATOM   3151 C  CE2 . TYR B  1 206 ? 2.761   46.151 44.658  1.00 9.68  ? 229  TYR B CE2 1 
ATOM   3152 C  CZ  . TYR B  1 206 ? 2.750   47.031 43.591  1.00 13.72 ? 229  TYR B CZ  1 
ATOM   3153 O  OH  . TYR B  1 206 ? 3.507   48.178 43.633  1.00 11.42 ? 229  TYR B OH  1 
ATOM   3154 N  N   . THR B  1 207 ? -2.707  42.499 42.752  1.00 10.26 ? 230  THR B N   1 
ATOM   3155 C  CA  . THR B  1 207 ? -3.517  41.305 42.509  1.00 8.84  ? 230  THR B CA  1 
ATOM   3156 C  C   . THR B  1 207 ? -2.626  40.130 42.118  1.00 8.48  ? 230  THR B C   1 
ATOM   3157 O  O   . THR B  1 207 ? -1.732  40.298 41.298  1.00 8.48  ? 230  THR B O   1 
ATOM   3158 C  CB  . THR B  1 207 ? -4.471  41.567 41.365  1.00 10.74 ? 230  THR B CB  1 
ATOM   3159 O  OG1 . THR B  1 207 ? -5.231  42.739 41.685  1.00 9.14  ? 230  THR B OG1 1 
ATOM   3160 C  CG2 . THR B  1 207 ? -5.406  40.385 41.153  1.00 8.07  ? 230  THR B CG2 1 
ATOM   3161 N  N   . LYS B  1 208 ? -2.862  38.970 42.737  1.00 9.24  ? 231  LYS B N   1 
ATOM   3162 C  CA  . LYS B  1 208 ? -2.023  37.778 42.545  1.00 12.42 ? 231  LYS B CA  1 
ATOM   3163 C  C   . LYS B  1 208 ? -2.483  36.978 41.313  1.00 9.16  ? 231  LYS B C   1 
ATOM   3164 O  O   . LYS B  1 208 ? -3.358  36.098 41.383  1.00 8.66  ? 231  LYS B O   1 
ATOM   3165 C  CB  . LYS B  1 208 ? -2.015  36.931 43.843  1.00 10.33 ? 231  LYS B CB  1 
ATOM   3166 C  CG  . LYS B  1 208 ? -1.004  35.750 43.857  1.00 11.32 ? 231  LYS B CG  1 
ATOM   3167 C  CD  . LYS B  1 208 ? -0.872  35.203 45.283  1.00 14.14 ? 231  LYS B CD  1 
ATOM   3168 C  CE  . LYS B  1 208 ? 0.129   34.049 45.364  1.00 19.42 ? 231  LYS B CE  1 
ATOM   3169 N  NZ  . LYS B  1 208 ? 0.264   33.524 46.769  1.00 21.42 ? 231  LYS B NZ  1 
ATOM   3170 N  N   . VAL B  1 209 ? -1.875  37.297 40.173  1.00 7.43  ? 232  VAL B N   1 
ATOM   3171 C  CA  . VAL B  1 209 ? -2.319  36.843 38.863  1.00 7.44  ? 232  VAL B CA  1 
ATOM   3172 C  C   . VAL B  1 209 ? -2.289  35.328 38.713  1.00 7.28  ? 232  VAL B C   1 
ATOM   3173 O  O   . VAL B  1 209 ? -3.134  34.739 38.029  1.00 9.06  ? 232  VAL B O   1 
ATOM   3174 C  CB  . VAL B  1 209 ? -1.498  37.520 37.719  1.00 7.22  ? 232  VAL B CB  1 
ATOM   3175 C  CG1 . VAL B  1 209 ? -1.836  36.910 36.364  1.00 7.21  ? 232  VAL B CG1 1 
ATOM   3176 C  CG2 . VAL B  1 209 ? -1.766  39.047 37.703  1.00 7.93  ? 232  VAL B CG2 1 
ATOM   3177 N  N   . CYS B  1 210 ? -1.320  34.700 39.369  1.00 8.18  ? 233  CYS B N   1 
ATOM   3178 C  CA  . CYS B  1 210 ? -1.198  33.248 39.304  1.00 9.95  ? 233  CYS B CA  1 
ATOM   3179 C  C   . CYS B  1 210 ? -2.470  32.506 39.719  1.00 12.11 ? 233  CYS B C   1 
ATOM   3180 O  O   . CYS B  1 210 ? -2.717  31.396 39.231  1.00 15.35 ? 233  CYS B O   1 
ATOM   3181 C  CB  . CYS B  1 210 ? 0.013   32.779 40.111  1.00 9.49  ? 233  CYS B CB  1 
ATOM   3182 S  SG  . CYS B  1 210 ? -0.080  32.949 41.909  1.00 13.33 ? 233  CYS B SG  1 
ATOM   3183 N  N   . ASN B  1 211 ? -3.275  33.107 40.595  1.00 8.91  ? 234  ASN B N   1 
ATOM   3184 C  CA  . ASN B  1 211 ? -4.551  32.500 40.990  1.00 9.49  ? 234  ASN B CA  1 
ATOM   3185 C  C   . ASN B  1 211 ? -5.647  32.576 39.935  1.00 9.99  ? 234  ASN B C   1 
ATOM   3186 O  O   . ASN B  1 211 ? -6.730  32.000 40.139  1.00 13.67 ? 234  ASN B O   1 
ATOM   3187 C  CB  . ASN B  1 211 ? -5.089  33.102 42.313  1.00 14.64 ? 234  ASN B CB  1 
ATOM   3188 C  CG  . ASN B  1 211 ? -4.194  32.811 43.519  1.00 18.79 ? 234  ASN B CG  1 
ATOM   3189 O  OD1 . ASN B  1 211 ? -3.283  31.992 43.451  1.00 18.25 ? 234  ASN B OD1 1 
ATOM   3190 N  ND2 . ASN B  1 211 ? -4.469  33.486 44.634  1.00 13.78 ? 234  ASN B ND2 1 
ATOM   3191 N  N   . TYR B  1 212 ? -5.386  33.274 38.822  1.00 7.78  ? 235  TYR B N   1 
ATOM   3192 C  CA  . TYR B  1 212 ? -6.425  33.575 37.850  1.00 10.47 ? 235  TYR B CA  1 
ATOM   3193 C  C   . TYR B  1 212 ? -6.123  33.004 36.498  1.00 9.31  ? 235  TYR B C   1 
ATOM   3194 O  O   . TYR B  1 212 ? -6.833  33.294 35.541  1.00 9.85  ? 235  TYR B O   1 
ATOM   3195 C  CB  . TYR B  1 212 ? -6.617  35.094 37.714  1.00 10.35 ? 235  TYR B CB  1 
ATOM   3196 C  CG  . TYR B  1 212 ? -7.086  35.678 39.026  1.00 6.84  ? 235  TYR B CG  1 
ATOM   3197 C  CD1 . TYR B  1 212 ? -8.423  35.626 39.375  1.00 9.89  ? 235  TYR B CD1 1 
ATOM   3198 C  CD2 . TYR B  1 212 ? -6.185  36.215 39.939  1.00 8.92  ? 235  TYR B CD2 1 
ATOM   3199 C  CE1 . TYR B  1 212 ? -8.867  36.131 40.598  1.00 10.01 ? 235  TYR B CE1 1 
ATOM   3200 C  CE2 . TYR B  1 212 ? -6.610  36.710 41.172  1.00 7.56  ? 235  TYR B CE2 1 
ATOM   3201 C  CZ  . TYR B  1 212 ? -7.962  36.680 41.481  1.00 11.33 ? 235  TYR B CZ  1 
ATOM   3202 O  OH  . TYR B  1 212 ? -8.385  37.157 42.701  1.00 12.27 ? 235  TYR B OH  1 
ATOM   3203 N  N   . VAL B  1 213 ? -5.069  32.195 36.387  1.00 9.59  ? 236  VAL B N   1 
ATOM   3204 C  CA  . VAL B  1 213 ? -4.735  31.679 35.062  1.00 10.46 ? 236  VAL B CA  1 
ATOM   3205 C  C   . VAL B  1 213 ? -5.854  30.824 34.434  1.00 7.51  ? 236  VAL B C   1 
ATOM   3206 O  O   . VAL B  1 213 ? -6.147  30.970 33.245  1.00 10.93 ? 236  VAL B O   1 
ATOM   3207 C  CB  . VAL B  1 213 ? -3.370  30.934 35.063  1.00 13.58 ? 236  VAL B CB  1 
ATOM   3208 C  CG1 . VAL B  1 213 ? -3.122  30.296 33.725  1.00 17.57 ? 236  VAL B CG1 1 
ATOM   3209 C  CG2 . VAL B  1 213 ? -2.240  31.930 35.394  1.00 15.76 ? 236  VAL B CG2 1 
ATOM   3210 N  N   . SER B  1 214 ? -6.495  29.958 35.217  1.00 10.71 ? 237  SER B N   1 
ATOM   3211 C  CA  . SER B  1 214 ? -7.617  29.192 34.683  1.00 12.98 ? 237  SER B CA  1 
ATOM   3212 C  C   . SER B  1 214 ? -8.769  30.078 34.224  1.00 10.30 ? 237  SER B C   1 
ATOM   3213 O  O   . SER B  1 214 ? -9.341  29.856 33.151  1.00 11.14 ? 237  SER B O   1 
ATOM   3214 C  CB  . SER B  1 214 ? -8.138  28.139 35.686  1.00 14.89 ? 237  SER B CB  1 
ATOM   3215 O  OG  . SER B  1 214 ? -7.122  27.179 35.942  1.00 21.77 ? 237  SER B OG  1 
ATOM   3216 N  N   . TRP B  1 215 ? -9.112  31.071 35.035  1.00 9.77  ? 238  TRP B N   1 
ATOM   3217 C  CA  . TRP B  1 215 ? -10.158 32.020 34.659  1.00 8.70  ? 238  TRP B CA  1 
ATOM   3218 C  C   . TRP B  1 215 ? -9.819  32.767 33.372  1.00 13.29 ? 238  TRP B C   1 
ATOM   3219 O  O   . TRP B  1 215 ? -10.681 32.936 32.490  1.00 12.11 ? 238  TRP B O   1 
ATOM   3220 C  CB  . TRP B  1 215 ? -10.378 33.026 35.793  1.00 11.21 ? 238  TRP B CB  1 
ATOM   3221 C  CG  . TRP B  1 215 ? -11.382 34.070 35.431  1.00 10.91 ? 238  TRP B CG  1 
ATOM   3222 C  CD1 . TRP B  1 215 ? -12.737 33.911 35.350  1.00 11.68 ? 238  TRP B CD1 1 
ATOM   3223 C  CD2 . TRP B  1 215 ? -11.111 35.428 35.086  1.00 10.07 ? 238  TRP B CD2 1 
ATOM   3224 N  NE1 . TRP B  1 215 ? -13.334 35.095 34.966  1.00 13.79 ? 238  TRP B NE1 1 
ATOM   3225 C  CE2 . TRP B  1 215 ? -12.354 36.041 34.790  1.00 8.31  ? 238  TRP B CE2 1 
ATOM   3226 C  CE3 . TRP B  1 215 ? -9.940  36.184 34.990  1.00 8.96  ? 238  TRP B CE3 1 
ATOM   3227 C  CZ2 . TRP B  1 215 ? -12.456 37.376 34.424  1.00 10.86 ? 238  TRP B CZ2 1 
ATOM   3228 C  CZ3 . TRP B  1 215 ? -10.047 37.515 34.619  1.00 9.89  ? 238  TRP B CZ3 1 
ATOM   3229 C  CH2 . TRP B  1 215 ? -11.293 38.095 34.341  1.00 11.04 ? 238  TRP B CH2 1 
ATOM   3230 N  N   . ILE B  1 216 ? -8.569  33.236 33.274  1.00 8.30  ? 239  ILE B N   1 
ATOM   3231 C  CA  . ILE B  1 216 ? -8.147  33.943 32.061  1.00 9.30  ? 239  ILE B CA  1 
ATOM   3232 C  C   . ILE B  1 216 ? -8.283  33.060 30.815  1.00 8.58  ? 239  ILE B C   1 
ATOM   3233 O  O   . ILE B  1 216 ? -8.884  33.460 29.812  1.00 11.57 ? 239  ILE B O   1 
ATOM   3234 C  CB  . ILE B  1 216 ? -6.693  34.471 32.176  1.00 10.57 ? 239  ILE B CB  1 
ATOM   3235 C  CG1 . ILE B  1 216 ? -6.598  35.561 33.242  1.00 13.07 ? 239  ILE B CG1 1 
ATOM   3236 C  CG2 . ILE B  1 216 ? -6.242  35.026 30.818  1.00 12.67 ? 239  ILE B CG2 1 
ATOM   3237 C  CD1 . ILE B  1 216 ? -5.163  35.923 33.610  1.00 9.93  ? 239  ILE B CD1 1 
ATOM   3238 N  N   . LYS B  1 217 ? -7.723  31.851 30.870  1.00 9.18  ? 240  LYS B N   1 
ATOM   3239 C  CA  . LYS B  1 217 ? -7.841  30.902 29.776  1.00 16.85 ? 240  LYS B CA  1 
ATOM   3240 C  C   . LYS B  1 217 ? -9.299  30.593 29.393  1.00 14.87 ? 240  LYS B C   1 
ATOM   3241 O  O   . LYS B  1 217 ? -9.659  30.604 28.203  1.00 14.37 ? 240  LYS B O   1 
ATOM   3242 C  CB  . LYS B  1 217 ? -7.071  29.627 30.130  1.00 15.98 ? 240  LYS B CB  1 
ATOM   3243 C  CG  . LYS B  1 217 ? -7.315  28.447 29.198  1.00 26.81 ? 240  LYS B CG  1 
ATOM   3244 C  CD  . LYS B  1 217 ? -6.546  27.213 29.695  1.00 33.39 ? 240  LYS B CD  1 
ATOM   3245 C  CE  . LYS B  1 217 ? -6.942  25.954 28.946  1.00 40.86 ? 240  LYS B CE  1 
ATOM   3246 N  NZ  . LYS B  1 217 ? -6.204  24.766 29.473  1.00 45.72 ? 240  LYS B NZ  1 
ATOM   3247 N  N   . GLN B  1 218 ? -10.143 30.336 30.391  1.00 14.01 ? 241  GLN B N   1 
ATOM   3248 C  CA  . GLN B  1 218 ? -11.551 30.034 30.108  1.00 17.24 ? 241  GLN B CA  1 
ATOM   3249 C  C   . GLN B  1 218 ? -12.263 31.246 29.493  1.00 16.72 ? 241  GLN B C   1 
ATOM   3250 O  O   . GLN B  1 218 ? -13.045 31.122 28.544  1.00 16.15 ? 241  GLN B O   1 
ATOM   3251 C  CB  . GLN B  1 218 ? -12.263 29.552 31.379  1.00 15.72 ? 241  GLN B CB  1 
ATOM   3252 C  CG  . GLN B  1 218 ? -13.760 29.309 31.203  1.00 21.17 ? 241  GLN B CG  1 
ATOM   3253 C  CD  . GLN B  1 218 ? -14.068 28.144 30.283  1.00 30.19 ? 241  GLN B CD  1 
ATOM   3254 O  OE1 . GLN B  1 218 ? -13.255 27.229 30.122  1.00 28.18 ? 241  GLN B OE1 1 
ATOM   3255 N  NE2 . GLN B  1 218 ? -15.247 28.179 29.663  1.00 23.31 ? 241  GLN B NE2 1 
ATOM   3256 N  N   . THR B  1 219 ? -11.969 32.429 30.023  1.00 13.02 ? 242  THR B N   1 
ATOM   3257 C  CA  . THR B  1 219 ? -12.643 33.633 29.553  1.00 12.85 ? 242  THR B CA  1 
ATOM   3258 C  C   . THR B  1 219 ? -12.251 33.944 28.103  1.00 13.99 ? 242  THR B C   1 
ATOM   3259 O  O   . THR B  1 219 ? -13.087 34.337 27.295  1.00 16.68 ? 242  THR B O   1 
ATOM   3260 C  CB  . THR B  1 219 ? -12.341 34.825 30.465  1.00 14.33 ? 242  THR B CB  1 
ATOM   3261 O  OG1 . THR B  1 219 ? -12.728 34.497 31.809  1.00 13.32 ? 242  THR B OG1 1 
ATOM   3262 C  CG2 . THR B  1 219 ? -13.080 36.084 29.981  1.00 18.08 ? 242  THR B CG2 1 
ATOM   3263 N  N   . ILE B  1 220 ? -10.973 33.779 27.771  1.00 13.75 ? 243  ILE B N   1 
ATOM   3264 C  CA  . ILE B  1 220 ? -10.539 34.040 26.400  1.00 14.80 ? 243  ILE B CA  1 
ATOM   3265 C  C   . ILE B  1 220 ? -11.176 33.030 25.451  1.00 18.02 ? 243  ILE B C   1 
ATOM   3266 O  O   . ILE B  1 220 ? -11.618 33.377 24.352  1.00 20.66 ? 243  ILE B O   1 
ATOM   3267 C  CB  . ILE B  1 220 ? -9.005  33.985 26.297  1.00 19.76 ? 243  ILE B CB  1 
ATOM   3268 C  CG1 . ILE B  1 220 ? -8.421  35.261 26.903  1.00 16.58 ? 243  ILE B CG1 1 
ATOM   3269 C  CG2 . ILE B  1 220 ? -8.536  33.809 24.850  1.00 23.84 ? 243  ILE B CG2 1 
ATOM   3270 C  CD1 . ILE B  1 220 ? -6.884  35.241 27.004  1.00 23.71 ? 243  ILE B CD1 1 
ATOM   3271 N  N   . ALA B  1 221 ? -11.250 31.786 25.903  1.00 16.95 ? 244  ALA B N   1 
ATOM   3272 C  CA  . ALA B  1 221 ? -11.818 30.711 25.090  1.00 16.81 ? 244  ALA B CA  1 
ATOM   3273 C  C   . ALA B  1 221 ? -13.304 30.896 24.804  1.00 21.28 ? 244  ALA B C   1 
ATOM   3274 O  O   . ALA B  1 221 ? -13.801 30.455 23.761  1.00 26.72 ? 244  ALA B O   1 
ATOM   3275 C  CB  . ALA B  1 221 ? -11.570 29.361 25.749  1.00 23.11 ? 244  ALA B CB  1 
ATOM   3276 N  N   . SER B  1 222 ? -14.008 31.555 25.720  1.00 20.51 ? 245  SER B N   1 
ATOM   3277 C  CA  . SER B  1 222 ? -15.465 31.684 25.646  1.00 24.93 ? 245  SER B CA  1 
ATOM   3278 C  C   . SER B  1 222 ? -15.920 33.021 25.076  1.00 25.84 ? 245  SER B C   1 
ATOM   3279 O  O   . SER B  1 222 ? -17.126 33.251 24.904  1.00 26.48 ? 245  SER B O   1 
ATOM   3280 C  CB  . SER B  1 222 ? -16.102 31.456 27.027  1.00 31.22 ? 245  SER B CB  1 
ATOM   3281 O  OG  . SER B  1 222 ? -15.450 32.201 28.045  1.00 33.52 ? 245  SER B OG  1 
ATOM   3282 N  N   . ASN B  1 223 ? -14.961 33.895 24.776  1.00 22.37 ? 246  ASN B N   1 
ATOM   3283 C  CA  . ASN B  1 223 ? -15.271 35.260 24.353  1.00 23.80 ? 246  ASN B CA  1 
ATOM   3284 C  C   . ASN B  1 223 ? -14.510 35.720 23.114  1.00 24.49 ? 246  ASN B C   1 
ATOM   3285 O  O   . ASN B  1 223 ? -14.532 36.909 22.786  1.00 31.75 ? 246  ASN B O   1 
ATOM   3286 C  CB  . ASN B  1 223 ? -15.032 36.250 25.504  1.00 17.30 ? 246  ASN B CB  1 
ATOM   3287 C  CG  . ASN B  1 223 ? -16.115 36.179 26.568  1.00 22.39 ? 246  ASN B CG  1 
ATOM   3288 O  OD1 . ASN B  1 223 ? -17.184 36.781 26.419  1.00 32.54 ? 246  ASN B OD1 1 
ATOM   3289 N  ND2 . ASN B  1 223 ? -15.845 35.451 27.655  1.00 24.11 ? 246  ASN B ND2 1 
ATOM   3290 O  OXT . ASN B  1 223 ? -13.863 34.945 22.418  1.00 28.39 ? 246  ASN B OXT 1 
ATOM   3291 N  N   . ILE C  1 1   ? 19.647  31.899 -3.379  1.00 16.54 ? 24   ILE C N   1 
ATOM   3292 C  CA  . ILE C  1 1   ? 19.660  33.215 -4.051  1.00 14.30 ? 24   ILE C CA  1 
ATOM   3293 C  C   . ILE C  1 1   ? 20.946  33.397 -4.835  1.00 19.00 ? 24   ILE C C   1 
ATOM   3294 O  O   . ILE C  1 1   ? 22.037  33.270 -4.270  1.00 15.97 ? 24   ILE C O   1 
ATOM   3295 C  CB  . ILE C  1 1   ? 19.586  34.364 -3.037  1.00 14.89 ? 24   ILE C CB  1 
ATOM   3296 C  CG1 . ILE C  1 1   ? 18.396  34.205 -2.069  1.00 13.75 ? 24   ILE C CG1 1 
ATOM   3297 C  CG2 . ILE C  1 1   ? 19.562  35.715 -3.760  1.00 16.28 ? 24   ILE C CG2 1 
ATOM   3298 C  CD1 . ILE C  1 1   ? 17.029  34.500 -2.674  1.00 15.70 ? 24   ILE C CD1 1 
ATOM   3299 N  N   . VAL C  1 2   ? 20.809  33.720 -6.126  1.00 16.81 ? 25   VAL C N   1 
ATOM   3300 C  CA  . VAL C  1 2   ? 21.940  33.887 -7.029  1.00 22.90 ? 25   VAL C CA  1 
ATOM   3301 C  C   . VAL C  1 2   ? 22.088  35.372 -7.342  1.00 17.91 ? 25   VAL C C   1 
ATOM   3302 O  O   . VAL C  1 2   ? 21.087  36.056 -7.589  1.00 16.95 ? 25   VAL C O   1 
ATOM   3303 C  CB  . VAL C  1 2   ? 21.722  33.108 -8.343  1.00 24.25 ? 25   VAL C CB  1 
ATOM   3304 C  CG1 . VAL C  1 2   ? 22.799  33.468 -9.371  1.00 21.34 ? 25   VAL C CG1 1 
ATOM   3305 C  CG2 . VAL C  1 2   ? 21.701  31.596 -8.075  1.00 19.73 ? 25   VAL C CG2 1 
ATOM   3306 N  N   . GLY C  1 3   ? 23.322  35.880 -7.279  1.00 23.55 ? 26   GLY C N   1 
ATOM   3307 C  CA  . GLY C  1 3   ? 23.568  37.271 -7.634  1.00 24.81 ? 26   GLY C CA  1 
ATOM   3308 C  C   . GLY C  1 3   ? 23.098  38.249 -6.580  1.00 22.60 ? 26   GLY C C   1 
ATOM   3309 O  O   . GLY C  1 3   ? 22.958  39.446 -6.835  1.00 22.54 ? 26   GLY C O   1 
ATOM   3310 N  N   . GLY C  1 4   ? 22.854  37.736 -5.380  1.00 25.68 ? 27   GLY C N   1 
ATOM   3311 C  CA  . GLY C  1 4   ? 22.388  38.558 -4.278  1.00 20.42 ? 27   GLY C CA  1 
ATOM   3312 C  C   . GLY C  1 4   ? 23.506  38.897 -3.311  1.00 25.36 ? 27   GLY C C   1 
ATOM   3313 O  O   . GLY C  1 4   ? 24.693  38.787 -3.658  1.00 25.90 ? 27   GLY C O   1 
ATOM   3314 N  N   . TYR C  1 5   ? 23.125  39.293 -2.095  1.00 17.80 ? 28   TYR C N   1 
ATOM   3315 C  CA  . TYR C  1 5   ? 24.079  39.682 -1.047  1.00 20.72 ? 28   TYR C CA  1 
ATOM   3316 C  C   . TYR C  1 5   ? 23.730  39.081 0.317   1.00 23.37 ? 28   TYR C C   1 
ATOM   3317 O  O   . TYR C  1 5   ? 22.568  38.756 0.574   1.00 21.60 ? 28   TYR C O   1 
ATOM   3318 C  CB  . TYR C  1 5   ? 24.134  41.214 -0.921  1.00 20.29 ? 28   TYR C CB  1 
ATOM   3319 C  CG  . TYR C  1 5   ? 22.817  41.885 -0.559  1.00 21.34 ? 28   TYR C CG  1 
ATOM   3320 C  CD1 . TYR C  1 5   ? 21.845  42.128 -1.523  1.00 18.74 ? 28   TYR C CD1 1 
ATOM   3321 C  CD2 . TYR C  1 5   ? 22.573  42.328 0.741   1.00 19.77 ? 28   TYR C CD2 1 
ATOM   3322 C  CE1 . TYR C  1 5   ? 20.651  42.743 -1.191  1.00 20.42 ? 28   TYR C CE1 1 
ATOM   3323 C  CE2 . TYR C  1 5   ? 21.380  42.961 1.080   1.00 21.23 ? 28   TYR C CE2 1 
ATOM   3324 C  CZ  . TYR C  1 5   ? 20.432  43.168 0.103   1.00 21.06 ? 28   TYR C CZ  1 
ATOM   3325 O  OH  . TYR C  1 5   ? 19.251  43.783 0.429   1.00 26.61 ? 28   TYR C OH  1 
ATOM   3326 N  N   . THR C  1 6   ? 24.732  38.955 1.191   1.00 18.07 ? 29   THR C N   1 
ATOM   3327 C  CA  . THR C  1 6   ? 24.488  38.541 2.583   1.00 21.87 ? 29   THR C CA  1 
ATOM   3328 C  C   . THR C  1 6   ? 23.588  39.571 3.280   1.00 21.05 ? 29   THR C C   1 
ATOM   3329 O  O   . THR C  1 6   ? 23.984  40.721 3.455   1.00 19.13 ? 29   THR C O   1 
ATOM   3330 C  CB  . THR C  1 6   ? 25.817  38.367 3.339   1.00 17.17 ? 29   THR C CB  1 
ATOM   3331 O  OG1 . THR C  1 6   ? 26.605  37.347 2.703   1.00 21.76 ? 29   THR C OG1 1 
ATOM   3332 C  CG2 . THR C  1 6   ? 25.601  37.998 4.801   1.00 19.51 ? 29   THR C CG2 1 
ATOM   3333 N  N   . CYS C  1 7   ? 22.371  39.168 3.652   1.00 18.07 ? 30   CYS C N   1 
ATOM   3334 C  CA  . CYS C  1 7   ? 21.382  40.110 4.170   1.00 16.24 ? 30   CYS C CA  1 
ATOM   3335 C  C   . CYS C  1 7   ? 21.943  40.871 5.347   1.00 21.89 ? 30   CYS C C   1 
ATOM   3336 O  O   . CYS C  1 7   ? 21.825  42.094 5.427   1.00 20.15 ? 30   CYS C O   1 
ATOM   3337 C  CB  . CYS C  1 7   ? 20.137  39.392 4.663   1.00 15.11 ? 30   CYS C CB  1 
ATOM   3338 S  SG  . CYS C  1 7   ? 19.262  38.503 3.384   1.00 17.04 ? 30   CYS C SG  1 
ATOM   3339 N  N   . GLY C  1 8   ? 22.561  40.123 6.252   1.00 17.71 ? 31   GLY C N   1 
ATOM   3340 C  CA  . GLY C  1 8   ? 22.886  40.636 7.573   1.00 14.36 ? 31   GLY C CA  1 
ATOM   3341 C  C   . GLY C  1 8   ? 21.935  39.978 8.565   1.00 22.33 ? 31   GLY C C   1 
ATOM   3342 O  O   . GLY C  1 8   ? 20.759  39.758 8.253   1.00 22.13 ? 31   GLY C O   1 
ATOM   3343 N  N   . ALA C  1 9   ? 22.442  39.670 9.755   1.00 18.61 ? 32   ALA C N   1 
ATOM   3344 C  CA  . ALA C  1 9   ? 21.689  38.921 10.777  1.00 19.76 ? 32   ALA C CA  1 
ATOM   3345 C  C   . ALA C  1 9   ? 20.332  39.529 11.137  1.00 15.25 ? 32   ALA C C   1 
ATOM   3346 O  O   . ALA C  1 9   ? 20.249  40.667 11.591  1.00 17.00 ? 32   ALA C O   1 
ATOM   3347 C  CB  . ALA C  1 9   ? 22.538  38.764 12.039  1.00 22.17 ? 32   ALA C CB  1 
ATOM   3348 N  N   . ASN C  1 10  ? 19.270  38.753 10.943  1.00 17.79 ? 33   ASN C N   1 
ATOM   3349 C  CA  . ASN C  1 10  ? 17.922  39.164 11.305  1.00 17.78 ? 33   ASN C CA  1 
ATOM   3350 C  C   . ASN C  1 10  ? 17.460  40.476 10.651  1.00 15.91 ? 33   ASN C C   1 
ATOM   3351 O  O   . ASN C  1 10  ? 16.570  41.157 11.175  1.00 16.17 ? 33   ASN C O   1 
ATOM   3352 C  CB  . ASN C  1 10  ? 17.768  39.220 12.835  1.00 19.87 ? 33   ASN C CB  1 
ATOM   3353 C  CG  . ASN C  1 10  ? 18.364  37.988 13.539  1.00 23.07 ? 33   ASN C CG  1 
ATOM   3354 O  OD1 . ASN C  1 10  ? 19.385  38.092 14.244  1.00 21.39 ? 33   ASN C OD1 1 
ATOM   3355 N  ND2 . ASN C  1 10  ? 17.730  36.814 13.350  1.00 20.50 ? 33   ASN C ND2 1 
ATOM   3356 N  N   . THR C  1 11  ? 18.025  40.809 9.489   1.00 18.38 ? 34   THR C N   1 
ATOM   3357 C  CA  . THR C  1 11  ? 17.599  42.026 8.784   1.00 19.27 ? 34   THR C CA  1 
ATOM   3358 C  C   . THR C  1 11  ? 16.363  41.776 7.943   1.00 19.50 ? 34   THR C C   1 
ATOM   3359 O  O   . THR C  1 11  ? 15.781  42.716 7.379   1.00 22.28 ? 34   THR C O   1 
ATOM   3360 C  CB  . THR C  1 11  ? 18.702  42.596 7.893   1.00 20.34 ? 34   THR C CB  1 
ATOM   3361 O  OG1 . THR C  1 11  ? 19.099  41.607 6.934   1.00 19.92 ? 34   THR C OG1 1 
ATOM   3362 C  CG2 . THR C  1 11  ? 19.890  42.984 8.742   1.00 19.52 ? 34   THR C CG2 1 
ATOM   3363 N  N   . VAL C  1 12  ? 15.970  40.500 7.861   1.00 14.83 ? 35   VAL C N   1 
ATOM   3364 C  CA  . VAL C  1 12  ? 14.730  40.100 7.217   1.00 16.11 ? 35   VAL C CA  1 
ATOM   3365 C  C   . VAL C  1 12  ? 13.930  39.297 8.239   1.00 15.26 ? 35   VAL C C   1 
ATOM   3366 O  O   . VAL C  1 12  ? 13.840  38.060 8.153   1.00 19.61 ? 35   VAL C O   1 
ATOM   3367 C  CB  . VAL C  1 12  ? 15.023  39.231 5.978   1.00 15.76 ? 35   VAL C CB  1 
ATOM   3368 C  CG1 . VAL C  1 12  ? 13.753  39.003 5.175   1.00 17.36 ? 35   VAL C CG1 1 
ATOM   3369 C  CG2 . VAL C  1 12  ? 16.110  39.881 5.106   1.00 17.43 ? 35   VAL C CG2 1 
ATOM   3370 N  N   . PRO C  1 13  ? 13.353  39.987 9.230   1.00 13.85 ? 36   PRO C N   1 
ATOM   3371 C  CA  . PRO C  1 13  ? 12.882  39.314 10.442  1.00 11.43 ? 36   PRO C CA  1 
ATOM   3372 C  C   . PRO C  1 13  ? 11.644  38.448 10.247  1.00 15.26 ? 36   PRO C C   1 
ATOM   3373 O  O   . PRO C  1 13  ? 11.330  37.638 11.133  1.00 14.83 ? 36   PRO C O   1 
ATOM   3374 C  CB  . PRO C  1 13  ? 12.613  40.484 11.403  1.00 16.70 ? 36   PRO C CB  1 
ATOM   3375 C  CG  . PRO C  1 13  ? 12.322  41.636 10.488  1.00 16.57 ? 36   PRO C CG  1 
ATOM   3376 C  CD  . PRO C  1 13  ? 13.262  41.457 9.352   1.00 19.18 ? 36   PRO C CD  1 
ATOM   3377 N  N   . TYR C  1 14  ? 10.978  38.575 9.102   1.00 14.13 ? 37   TYR C N   1 
ATOM   3378 C  CA  . TYR C  1 14  ? 9.826   37.738 8.789   1.00 17.83 ? 37   TYR C CA  1 
ATOM   3379 C  C   . TYR C  1 14  ? 10.207  36.425 8.097   1.00 13.92 ? 37   TYR C C   1 
ATOM   3380 O  O   . TYR C  1 14  ? 9.343   35.576 7.904   1.00 12.66 ? 37   TYR C O   1 
ATOM   3381 C  CB  . TYR C  1 14  ? 8.813   38.516 7.910   1.00 17.21 ? 37   TYR C CB  1 
ATOM   3382 C  CG  . TYR C  1 14  ? 9.445   39.174 6.704   1.00 18.92 ? 37   TYR C CG  1 
ATOM   3383 C  CD1 . TYR C  1 14  ? 9.604   38.481 5.509   1.00 12.67 ? 37   TYR C CD1 1 
ATOM   3384 C  CD2 . TYR C  1 14  ? 9.886   40.504 6.757   1.00 14.87 ? 37   TYR C CD2 1 
ATOM   3385 C  CE1 . TYR C  1 14  ? 10.204  39.076 4.419   1.00 18.44 ? 37   TYR C CE1 1 
ATOM   3386 C  CE2 . TYR C  1 14  ? 10.492  41.113 5.664   1.00 19.67 ? 37   TYR C CE2 1 
ATOM   3387 C  CZ  . TYR C  1 14  ? 10.630  40.405 4.486   1.00 15.63 ? 37   TYR C CZ  1 
ATOM   3388 O  OH  . TYR C  1 14  ? 11.247  40.990 3.394   1.00 18.75 ? 37   TYR C OH  1 
ATOM   3389 N  N   . GLN C  1 15  ? 11.486  36.254 7.734   1.00 12.59 ? 38   GLN C N   1 
ATOM   3390 C  CA  . GLN C  1 15  ? 11.918  35.048 7.001   1.00 10.50 ? 38   GLN C CA  1 
ATOM   3391 C  C   . GLN C  1 15  ? 11.986  33.882 7.976   1.00 13.19 ? 38   GLN C C   1 
ATOM   3392 O  O   . GLN C  1 15  ? 12.654  33.975 9.006   1.00 15.02 ? 38   GLN C O   1 
ATOM   3393 C  CB  . GLN C  1 15  ? 13.308  35.240 6.374   1.00 12.95 ? 38   GLN C CB  1 
ATOM   3394 C  CG  . GLN C  1 15  ? 13.926  33.949 5.761   1.00 10.82 ? 38   GLN C CG  1 
ATOM   3395 C  CD  . GLN C  1 15  ? 13.475  33.707 4.314   1.00 16.92 ? 38   GLN C CD  1 
ATOM   3396 O  OE1 . GLN C  1 15  ? 13.547  34.612 3.452   1.00 14.29 ? 38   GLN C OE1 1 
ATOM   3397 N  NE2 . GLN C  1 15  ? 13.015  32.471 4.030   1.00 13.41 ? 38   GLN C NE2 1 
ATOM   3398 N  N   . VAL C  1 16  ? 11.321  32.778 7.651   1.00 11.97 ? 39   VAL C N   1 
ATOM   3399 C  CA  . VAL C  1 16  ? 11.493  31.568 8.447   1.00 12.10 ? 39   VAL C CA  1 
ATOM   3400 C  C   . VAL C  1 16  ? 12.079  30.461 7.595   1.00 14.45 ? 39   VAL C C   1 
ATOM   3401 O  O   . VAL C  1 16  ? 12.078  30.540 6.364   1.00 11.62 ? 39   VAL C O   1 
ATOM   3402 C  CB  . VAL C  1 16  ? 10.181  31.085 9.080   1.00 11.69 ? 39   VAL C CB  1 
ATOM   3403 C  CG1 . VAL C  1 16  ? 9.530   32.201 9.912   1.00 15.60 ? 39   VAL C CG1 1 
ATOM   3404 C  CG2 . VAL C  1 16  ? 9.243   30.591 8.034   1.00 13.47 ? 39   VAL C CG2 1 
ATOM   3405 N  N   . SER C  1 17  ? 12.608  29.447 8.269   1.00 12.88 ? 40   SER C N   1 
ATOM   3406 C  CA  . SER C  1 17  ? 13.056  28.201 7.625   1.00 11.83 ? 40   SER C CA  1 
ATOM   3407 C  C   . SER C  1 17  ? 12.093  27.083 8.031   1.00 13.86 ? 40   SER C C   1 
ATOM   3408 O  O   . SER C  1 17  ? 11.779  26.926 9.216   1.00 11.65 ? 40   SER C O   1 
ATOM   3409 C  CB  . SER C  1 17  ? 14.471  27.848 8.102   1.00 12.08 ? 40   SER C CB  1 
ATOM   3410 O  OG  . SER C  1 17  ? 14.842  26.540 7.666   1.00 13.97 ? 40   SER C OG  1 
ATOM   3411 N  N   . LEU C  1 18  ? 11.624  26.314 7.052   1.00 10.15 ? 41   LEU C N   1 
ATOM   3412 C  CA  . LEU C  1 18  ? 10.854  25.096 7.324   1.00 11.01 ? 41   LEU C CA  1 
ATOM   3413 C  C   . LEU C  1 18  ? 11.863  23.968 7.378   1.00 13.37 ? 41   LEU C C   1 
ATOM   3414 O  O   . LEU C  1 18  ? 12.705  23.833 6.497   1.00 8.15  ? 41   LEU C O   1 
ATOM   3415 C  CB  . LEU C  1 18  ? 9.798   24.844 6.238   1.00 9.59  ? 41   LEU C CB  1 
ATOM   3416 C  CG  . LEU C  1 18  ? 8.791   25.953 5.897   1.00 10.93 ? 41   LEU C CG  1 
ATOM   3417 C  CD1 . LEU C  1 18  ? 7.741   25.408 4.954   1.00 15.52 ? 41   LEU C CD1 1 
ATOM   3418 C  CD2 . LEU C  1 18  ? 8.164   26.573 7.158   1.00 13.80 ? 41   LEU C CD2 1 
ATOM   3419 N  N   . ASN C  1 19  ? 11.811  23.193 8.451   1.00 10.08 ? 42   ASN C N   1 
ATOM   3420 C  CA  . ASN C  1 19  ? 12.866  22.265 8.764   1.00 10.40 ? 42   ASN C CA  1 
ATOM   3421 C  C   . ASN C  1 19  ? 12.281  20.866 9.002   1.00 12.55 ? 42   ASN C C   1 
ATOM   3422 O  O   . ASN C  1 19  ? 11.246  20.722 9.629   1.00 14.07 ? 42   ASN C O   1 
ATOM   3423 C  CB  . ASN C  1 19  ? 13.589  22.785 10.017  1.00 11.00 ? 42   ASN C CB  1 
ATOM   3424 C  CG  . ASN C  1 19  ? 14.697  21.876 10.493  1.00 11.90 ? 42   ASN C CG  1 
ATOM   3425 O  OD1 . ASN C  1 19  ? 14.426  20.855 11.117  1.00 14.76 ? 42   ASN C OD1 1 
ATOM   3426 N  ND2 . ASN C  1 19  ? 15.944  22.267 10.263  1.00 10.58 ? 42   ASN C ND2 1 
ATOM   3427 N  N   A SER C  1 20  ? 12.944  19.842 8.476   0.54 13.80 ? 43   SER C N   1 
ATOM   3428 N  N   B SER C  1 20  ? 12.943  19.840 8.482   0.46 13.81 ? 43   SER C N   1 
ATOM   3429 C  CA  A SER C  1 20  ? 12.605  18.462 8.825   0.54 16.51 ? 43   SER C CA  1 
ATOM   3430 C  CA  B SER C  1 20  ? 12.599  18.467 8.849   0.46 16.52 ? 43   SER C CA  1 
ATOM   3431 C  C   A SER C  1 20  ? 13.899  17.719 9.134   0.54 18.76 ? 43   SER C C   1 
ATOM   3432 C  C   B SER C  1 20  ? 13.894  17.723 9.135   0.46 18.75 ? 43   SER C C   1 
ATOM   3433 O  O   A SER C  1 20  ? 14.275  16.782 8.438   0.54 23.79 ? 43   SER C O   1 
ATOM   3434 O  O   B SER C  1 20  ? 14.268  16.795 8.425   0.46 23.75 ? 43   SER C O   1 
ATOM   3435 C  CB  A SER C  1 20  ? 11.847  17.776 7.690   0.54 20.69 ? 43   SER C CB  1 
ATOM   3436 C  CB  B SER C  1 20  ? 11.799  17.780 7.744   0.46 20.69 ? 43   SER C CB  1 
ATOM   3437 O  OG  A SER C  1 20  ? 11.241  16.577 8.147   0.54 17.90 ? 43   SER C OG  1 
ATOM   3438 O  OG  B SER C  1 20  ? 12.558  17.666 6.556   0.46 21.37 ? 43   SER C OG  1 
ATOM   3439 N  N   . GLY C  1 21  ? 14.575  18.150 10.188  1.00 15.97 ? 44   GLY C N   1 
ATOM   3440 C  CA  . GLY C  1 21  ? 15.950  17.750 10.414  1.00 15.92 ? 44   GLY C CA  1 
ATOM   3441 C  C   . GLY C  1 21  ? 16.823  18.886 9.901   1.00 14.47 ? 44   GLY C C   1 
ATOM   3442 O  O   . GLY C  1 21  ? 17.552  19.516 10.669  1.00 11.52 ? 44   GLY C O   1 
ATOM   3443 N  N   . TYR C  1 22  ? 16.748  19.134 8.592   1.00 13.53 ? 45   TYR C N   1 
ATOM   3444 C  CA  . TYR C  1 22  ? 17.492  20.220 7.952   1.00 14.62 ? 45   TYR C CA  1 
ATOM   3445 C  C   . TYR C  1 22  ? 16.529  21.157 7.218   1.00 9.22  ? 45   TYR C C   1 
ATOM   3446 O  O   . TYR C  1 22  ? 15.388  20.800 6.942   1.00 10.36 ? 45   TYR C O   1 
ATOM   3447 C  CB  . TYR C  1 22  ? 18.484  19.659 6.935   1.00 16.08 ? 45   TYR C CB  1 
ATOM   3448 C  CG  . TYR C  1 22  ? 19.722  19.009 7.541   1.00 14.47 ? 45   TYR C CG  1 
ATOM   3449 C  CD1 . TYR C  1 22  ? 19.744  17.655 7.861   1.00 15.63 ? 45   TYR C CD1 1 
ATOM   3450 C  CD2 . TYR C  1 22  ? 20.870  19.756 7.774   1.00 16.10 ? 45   TYR C CD2 1 
ATOM   3451 C  CE1 . TYR C  1 22  ? 20.887  17.063 8.402   1.00 13.62 ? 45   TYR C CE1 1 
ATOM   3452 C  CE2 . TYR C  1 22  ? 22.014  19.176 8.314   1.00 17.63 ? 45   TYR C CE2 1 
ATOM   3453 C  CZ  . TYR C  1 22  ? 22.015  17.821 8.613   1.00 17.53 ? 45   TYR C CZ  1 
ATOM   3454 O  OH  . TYR C  1 22  ? 23.164  17.262 9.162   1.00 19.77 ? 45   TYR C OH  1 
ATOM   3455 N  N   . HIS C  1 23  ? 17.019  22.355 6.894   1.00 10.13 ? 46   HIS C N   1 
ATOM   3456 C  CA  . HIS C  1 23  ? 16.269  23.337 6.107   1.00 9.28  ? 46   HIS C CA  1 
ATOM   3457 C  C   . HIS C  1 23  ? 15.852  22.774 4.755   1.00 8.27  ? 46   HIS C C   1 
ATOM   3458 O  O   . HIS C  1 23  ? 16.681  22.229 4.019   1.00 11.77 ? 46   HIS C O   1 
ATOM   3459 C  CB  . HIS C  1 23  ? 17.127  24.593 5.881   1.00 9.70  ? 46   HIS C CB  1 
ATOM   3460 C  CG  . HIS C  1 23  ? 16.586  25.503 4.826   1.00 8.17  ? 46   HIS C CG  1 
ATOM   3461 N  ND1 . HIS C  1 23  ? 15.737  26.552 5.112   1.00 12.58 ? 46   HIS C ND1 1 
ATOM   3462 C  CD2 . HIS C  1 23  ? 16.714  25.482 3.477   1.00 9.05  ? 46   HIS C CD2 1 
ATOM   3463 C  CE1 . HIS C  1 23  ? 15.383  27.153 3.991   1.00 10.78 ? 46   HIS C CE1 1 
ATOM   3464 N  NE2 . HIS C  1 23  ? 15.956  26.518 2.980   1.00 11.11 ? 46   HIS C NE2 1 
ATOM   3465 N  N   . PHE C  1 24  ? 14.576  22.904 4.408   1.00 7.38  ? 47   PHE C N   1 
ATOM   3466 C  CA  . PHE C  1 24  ? 14.177  22.480 3.058   1.00 9.19  ? 47   PHE C CA  1 
ATOM   3467 C  C   . PHE C  1 24  ? 13.343  23.498 2.268   1.00 9.04  ? 47   PHE C C   1 
ATOM   3468 O  O   . PHE C  1 24  ? 13.188  23.341 1.064   1.00 10.38 ? 47   PHE C O   1 
ATOM   3469 C  CB  . PHE C  1 24  ? 13.475  21.110 3.084   1.00 9.95  ? 47   PHE C CB  1 
ATOM   3470 C  CG  . PHE C  1 24  ? 12.096  21.147 3.677   1.00 8.84  ? 47   PHE C CG  1 
ATOM   3471 C  CD1 . PHE C  1 24  ? 10.982  21.411 2.892   1.00 9.63  ? 47   PHE C CD1 1 
ATOM   3472 C  CD2 . PHE C  1 24  ? 11.915  20.930 5.049   1.00 9.38  ? 47   PHE C CD2 1 
ATOM   3473 C  CE1 . PHE C  1 24  ? 9.713   21.457 3.466   1.00 9.85  ? 47   PHE C CE1 1 
ATOM   3474 C  CE2 . PHE C  1 24  ? 10.650  20.966 5.628   1.00 12.53 ? 47   PHE C CE2 1 
ATOM   3475 C  CZ  . PHE C  1 24  ? 9.543   21.240 4.841   1.00 12.97 ? 47   PHE C CZ  1 
ATOM   3476 N  N   . CYS C  1 25  ? 12.809  24.523 2.934   1.00 9.96  ? 48   CYS C N   1 
ATOM   3477 C  CA  . CYS C  1 25  ? 11.988  25.533 2.254   1.00 8.64  ? 48   CYS C CA  1 
ATOM   3478 C  C   . CYS C  1 25  ? 12.018  26.766 3.102   1.00 9.42  ? 48   CYS C C   1 
ATOM   3479 O  O   . CYS C  1 25  ? 12.284  26.679 4.305   1.00 9.32  ? 48   CYS C O   1 
ATOM   3480 C  CB  . CYS C  1 25  ? 10.533  25.075 2.116   1.00 10.07 ? 48   CYS C CB  1 
ATOM   3481 S  SG  . CYS C  1 25  ? 10.160  24.198 0.560   1.00 11.38 ? 48   CYS C SG  1 
ATOM   3482 N  N   . GLY C  1 26  ? 11.754  27.914 2.487   1.00 10.59 ? 49   GLY C N   1 
ATOM   3483 C  CA  . GLY C  1 26  ? 11.519  29.148 3.229   1.00 11.27 ? 49   GLY C CA  1 
ATOM   3484 C  C   . GLY C  1 26  ? 10.042  29.337 3.549   1.00 10.81 ? 49   GLY C C   1 
ATOM   3485 O  O   . GLY C  1 26  ? 9.183   28.556 3.146   1.00 10.58 ? 49   GLY C O   1 
ATOM   3486 N  N   . GLY C  1 27  ? 9.735   30.413 4.273   1.00 10.44 ? 50   GLY C N   1 
ATOM   3487 C  CA  . GLY C  1 27  ? 8.370   30.779 4.571   1.00 14.94 ? 50   GLY C CA  1 
ATOM   3488 C  C   . GLY C  1 27  ? 8.379   32.211 5.080   1.00 10.53 ? 50   GLY C C   1 
ATOM   3489 O  O   . GLY C  1 27  ? 9.442   32.797 5.277   1.00 10.77 ? 50   GLY C O   1 
ATOM   3490 N  N   . SER C  1 28  ? 7.192   32.769 5.259   1.00 12.72 ? 51   SER C N   1 
ATOM   3491 C  CA  . SER C  1 28  ? 7.036   34.147 5.747   1.00 13.71 ? 51   SER C CA  1 
ATOM   3492 C  C   . SER C  1 28  ? 6.112   34.130 6.937   1.00 14.60 ? 51   SER C C   1 
ATOM   3493 O  O   . SER C  1 28  ? 4.996   33.612 6.846   1.00 11.63 ? 51   SER C O   1 
ATOM   3494 C  CB  . SER C  1 28  ? 6.395   35.018 4.670   1.00 16.77 ? 51   SER C CB  1 
ATOM   3495 O  OG  . SER C  1 28  ? 7.217   35.117 3.537   1.00 14.53 ? 51   SER C OG  1 
ATOM   3496 N  N   . LEU C  1 29  ? 6.546   34.716 8.058   1.00 15.26 ? 52   LEU C N   1 
ATOM   3497 C  CA  . LEU C  1 29  ? 5.658   34.853 9.220   1.00 18.20 ? 52   LEU C CA  1 
ATOM   3498 C  C   . LEU C  1 29  ? 4.671   36.014 9.004   1.00 15.60 ? 52   LEU C C   1 
ATOM   3499 O  O   . LEU C  1 29  ? 5.098   37.133 8.701   1.00 15.34 ? 52   LEU C O   1 
ATOM   3500 C  CB  . LEU C  1 29  ? 6.491   35.120 10.478  1.00 14.08 ? 52   LEU C CB  1 
ATOM   3501 C  CG  . LEU C  1 29  ? 5.763   35.127 11.821  1.00 17.77 ? 52   LEU C CG  1 
ATOM   3502 C  CD1 . LEU C  1 29  ? 5.432   33.728 12.254  1.00 17.00 ? 52   LEU C CD1 1 
ATOM   3503 C  CD2 . LEU C  1 29  ? 6.623   35.798 12.882  1.00 18.63 ? 52   LEU C CD2 1 
ATOM   3504 N  N   . ILE C  1 30  ? 3.369   35.740 9.101   1.00 13.84 ? 53   ILE C N   1 
ATOM   3505 C  CA  . ILE C  1 30  ? 2.376   36.767 8.791   1.00 19.18 ? 53   ILE C CA  1 
ATOM   3506 C  C   . ILE C  1 30  ? 1.611   37.245 10.026  1.00 18.61 ? 53   ILE C C   1 
ATOM   3507 O  O   . ILE C  1 30  ? 1.003   38.299 9.995   1.00 21.24 ? 53   ILE C O   1 
ATOM   3508 C  CB  . ILE C  1 30  ? 1.359   36.339 7.695   1.00 17.90 ? 53   ILE C CB  1 
ATOM   3509 C  CG1 . ILE C  1 30  ? 0.686   35.020 8.062   1.00 20.84 ? 53   ILE C CG1 1 
ATOM   3510 C  CG2 . ILE C  1 30  ? 2.043   36.251 6.341   1.00 20.93 ? 53   ILE C CG2 1 
ATOM   3511 C  CD1 . ILE C  1 30  ? -0.482  34.696 7.190   1.00 23.36 ? 53   ILE C CD1 1 
ATOM   3512 N  N   . ASN C  1 31  ? 1.630   36.445 11.083  1.00 19.93 ? 54   ASN C N   1 
ATOM   3513 C  CA  . ASN C  1 31  ? 1.244   36.886 12.422  1.00 26.46 ? 54   ASN C CA  1 
ATOM   3514 C  C   . ASN C  1 31  ? 1.956   35.974 13.408  1.00 20.92 ? 54   ASN C C   1 
ATOM   3515 O  O   . ASN C  1 31  ? 2.747   35.119 12.997  1.00 24.47 ? 54   ASN C O   1 
ATOM   3516 C  CB  . ASN C  1 31  ? -0.288  36.913 12.629  1.00 25.83 ? 54   ASN C CB  1 
ATOM   3517 C  CG  . ASN C  1 31  ? -0.936  35.526 12.594  1.00 21.82 ? 54   ASN C CG  1 
ATOM   3518 O  OD1 . ASN C  1 31  ? -0.316  34.522 12.903  1.00 22.62 ? 54   ASN C OD1 1 
ATOM   3519 N  ND2 . ASN C  1 31  ? -2.220  35.486 12.231  1.00 32.42 ? 54   ASN C ND2 1 
ATOM   3520 N  N   . SER C  1 32  ? 1.674   36.117 14.693  1.00 22.19 ? 55   SER C N   1 
ATOM   3521 C  CA  . SER C  1 32  ? 2.377   35.318 15.680  1.00 18.27 ? 55   SER C CA  1 
ATOM   3522 C  C   . SER C  1 32  ? 2.107   33.803 15.607  1.00 22.02 ? 55   SER C C   1 
ATOM   3523 O  O   . SER C  1 32  ? 2.832   33.022 16.233  1.00 22.81 ? 55   SER C O   1 
ATOM   3524 C  CB  . SER C  1 32  ? 2.038   35.831 17.084  1.00 18.38 ? 55   SER C CB  1 
ATOM   3525 O  OG  . SER C  1 32  ? 0.739   35.396 17.413  1.00 28.68 ? 55   SER C OG  1 
ATOM   3526 N  N   . GLN C  1 33  ? 1.104   33.363 14.846  1.00 20.09 ? 56   GLN C N   1 
ATOM   3527 C  CA  . GLN C  1 33  ? 0.790   31.931 14.845  1.00 19.84 ? 56   GLN C CA  1 
ATOM   3528 C  C   . GLN C  1 33  ? 0.683   31.260 13.463  1.00 16.38 ? 56   GLN C C   1 
ATOM   3529 O  O   . GLN C  1 33  ? 0.343   30.070 13.381  1.00 20.00 ? 56   GLN C O   1 
ATOM   3530 C  CB  . GLN C  1 33  ? -0.479  31.661 15.664  1.00 25.93 ? 56   GLN C CB  1 
ATOM   3531 C  CG  . GLN C  1 33  ? -0.534  30.243 16.229  1.00 35.82 ? 56   GLN C CG  1 
ATOM   3532 C  CD  . GLN C  1 33  ? -1.398  30.104 17.477  1.00 36.44 ? 56   GLN C CD  1 
ATOM   3533 O  OE1 . GLN C  1 33  ? -2.192  30.991 17.814  1.00 35.54 ? 56   GLN C OE1 1 
ATOM   3534 N  NE2 . GLN C  1 33  ? -1.245  28.973 18.169  1.00 35.55 ? 56   GLN C NE2 1 
ATOM   3535 N  N   . TRP C  1 34  ? 0.946   32.037 12.408  1.00 17.95 ? 57   TRP C N   1 
ATOM   3536 C  CA  . TRP C  1 34  ? 0.764   31.581 11.010  1.00 13.87 ? 57   TRP C CA  1 
ATOM   3537 C  C   . TRP C  1 34  ? 1.916   31.950 10.081  1.00 16.63 ? 57   TRP C C   1 
ATOM   3538 O  O   . TRP C  1 34  ? 2.484   33.054 10.162  1.00 17.72 ? 57   TRP C O   1 
ATOM   3539 C  CB  . TRP C  1 34  ? -0.560  32.115 10.435  1.00 18.91 ? 57   TRP C CB  1 
ATOM   3540 C  CG  . TRP C  1 34  ? -1.769  31.459 11.046  1.00 19.37 ? 57   TRP C CG  1 
ATOM   3541 C  CD1 . TRP C  1 34  ? -2.486  31.898 12.132  1.00 24.50 ? 57   TRP C CD1 1 
ATOM   3542 C  CD2 . TRP C  1 34  ? -2.394  30.243 10.620  1.00 23.04 ? 57   TRP C CD2 1 
ATOM   3543 N  NE1 . TRP C  1 34  ? -3.518  31.030 12.399  1.00 25.41 ? 57   TRP C NE1 1 
ATOM   3544 C  CE2 . TRP C  1 34  ? -3.484  30.005 11.489  1.00 28.86 ? 57   TRP C CE2 1 
ATOM   3545 C  CE3 . TRP C  1 34  ? -2.141  29.330 9.586   1.00 21.53 ? 57   TRP C CE3 1 
ATOM   3546 C  CZ2 . TRP C  1 34  ? -4.323  28.891 11.355  1.00 28.81 ? 57   TRP C CZ2 1 
ATOM   3547 C  CZ3 . TRP C  1 34  ? -2.975  28.217 9.457   1.00 21.56 ? 57   TRP C CZ3 1 
ATOM   3548 C  CH2 . TRP C  1 34  ? -4.060  28.017 10.329  1.00 29.49 ? 57   TRP C CH2 1 
ATOM   3549 N  N   . VAL C  1 35  ? 2.247   31.010 9.185   1.00 14.60 ? 58   VAL C N   1 
ATOM   3550 C  CA  . VAL C  1 35  ? 3.328   31.173 8.226   1.00 13.31 ? 58   VAL C CA  1 
ATOM   3551 C  C   . VAL C  1 35  ? 2.754   30.870 6.852   1.00 13.55 ? 58   VAL C C   1 
ATOM   3552 O  O   . VAL C  1 35  ? 1.945   29.943 6.711   1.00 14.92 ? 58   VAL C O   1 
ATOM   3553 C  CB  . VAL C  1 35  ? 4.485   30.178 8.506   1.00 14.00 ? 58   VAL C CB  1 
ATOM   3554 C  CG1 . VAL C  1 35  ? 5.375   29.988 7.253   1.00 17.71 ? 58   VAL C CG1 1 
ATOM   3555 C  CG2 . VAL C  1 35  ? 5.309   30.604 9.705   1.00 16.32 ? 58   VAL C CG2 1 
ATOM   3556 N  N   . VAL C  1 36  ? 3.145   31.662 5.860   1.00 13.95 ? 59   VAL C N   1 
ATOM   3557 C  CA  . VAL C  1 36  ? 2.842   31.369 4.464   1.00 17.65 ? 59   VAL C CA  1 
ATOM   3558 C  C   . VAL C  1 36  ? 4.059   30.759 3.783   1.00 12.37 ? 59   VAL C C   1 
ATOM   3559 O  O   . VAL C  1 36  ? 5.186   31.249 3.938   1.00 13.97 ? 59   VAL C O   1 
ATOM   3560 C  CB  . VAL C  1 36  ? 2.475   32.652 3.694   1.00 16.69 ? 59   VAL C CB  1 
ATOM   3561 C  CG1 . VAL C  1 36  ? 2.224   32.336 2.220   1.00 15.92 ? 59   VAL C CG1 1 
ATOM   3562 C  CG2 . VAL C  1 36  ? 1.249   33.296 4.304   1.00 16.81 ? 59   VAL C CG2 1 
ATOM   3563 N  N   . SER C  1 37  ? 3.831   29.709 3.006   1.00 13.49 ? 60   SER C N   1 
ATOM   3564 C  CA  . SER C  1 37  ? 4.885   29.084 2.223   1.00 13.90 ? 60   SER C CA  1 
ATOM   3565 C  C   . SER C  1 37  ? 4.246   28.568 0.935   1.00 13.78 ? 60   SER C C   1 
ATOM   3566 O  O   . SER C  1 37  ? 3.094   28.930 0.625   1.00 10.06 ? 60   SER C O   1 
ATOM   3567 C  CB  . SER C  1 37  ? 5.529   27.945 3.024   1.00 14.35 ? 60   SER C CB  1 
ATOM   3568 O  OG  . SER C  1 37  ? 6.748   27.554 2.424   1.00 15.19 ? 60   SER C OG  1 
ATOM   3569 N  N   . ALA C  1 38  ? 4.970   27.716 0.204   1.00 12.35 ? 61   ALA C N   1 
ATOM   3570 C  CA  . ALA C  1 38  ? 4.476   27.146 -1.056  1.00 7.95  ? 61   ALA C CA  1 
ATOM   3571 C  C   . ALA C  1 38  ? 3.760   25.822 -0.792  1.00 11.94 ? 61   ALA C C   1 
ATOM   3572 O  O   . ALA C  1 38  ? 4.175   25.055 0.073   1.00 12.18 ? 61   ALA C O   1 
ATOM   3573 C  CB  . ALA C  1 38  ? 5.646   26.925 -2.002  1.00 10.23 ? 61   ALA C CB  1 
ATOM   3574 N  N   . ALA C  1 39  ? 2.705   25.537 -1.548  1.00 10.40 ? 62   ALA C N   1 
ATOM   3575 C  CA  . ALA C  1 39  ? 2.022   24.253 -1.406  1.00 13.41 ? 62   ALA C CA  1 
ATOM   3576 C  C   . ALA C  1 39  ? 2.976   23.105 -1.739  1.00 12.73 ? 62   ALA C C   1 
ATOM   3577 O  O   . ALA C  1 39  ? 2.886   22.011 -1.162  1.00 13.28 ? 62   ALA C O   1 
ATOM   3578 C  CB  . ALA C  1 39  ? 0.819   24.204 -2.326  1.00 14.49 ? 62   ALA C CB  1 
ATOM   3579 N  N   . HIS C  1 40  ? 3.908   23.348 -2.660  1.00 13.53 ? 63   HIS C N   1 
ATOM   3580 C  CA  . HIS C  1 40  ? 4.831   22.276 -3.051  1.00 11.48 ? 63   HIS C CA  1 
ATOM   3581 C  C   . HIS C  1 40  ? 5.875   21.956 -1.972  1.00 14.08 ? 63   HIS C C   1 
ATOM   3582 O  O   . HIS C  1 40  ? 6.632   20.977 -2.085  1.00 11.93 ? 63   HIS C O   1 
ATOM   3583 C  CB  . HIS C  1 40  ? 5.466   22.529 -4.439  1.00 10.71 ? 63   HIS C CB  1 
ATOM   3584 C  CG  . HIS C  1 40  ? 6.618   23.498 -4.440  1.00 9.65  ? 63   HIS C CG  1 
ATOM   3585 N  ND1 . HIS C  1 40  ? 6.481   24.817 -4.814  1.00 10.70 ? 63   HIS C ND1 1 
ATOM   3586 C  CD2 . HIS C  1 40  ? 7.935   23.314 -4.164  1.00 12.57 ? 63   HIS C CD2 1 
ATOM   3587 C  CE1 . HIS C  1 40  ? 7.664   25.412 -4.763  1.00 10.73 ? 63   HIS C CE1 1 
ATOM   3588 N  NE2 . HIS C  1 40  ? 8.559   24.526 -4.369  1.00 11.04 ? 63   HIS C NE2 1 
ATOM   3589 N  N   . CYS C  1 41  ? 5.895   22.764 -0.920  1.00 12.43 ? 64   CYS C N   1 
ATOM   3590 C  CA  . CYS C  1 41  ? 6.759   22.509 0.224   1.00 9.70  ? 64   CYS C CA  1 
ATOM   3591 C  C   . CYS C  1 41  ? 6.072   21.620 1.268   1.00 14.63 ? 64   CYS C C   1 
ATOM   3592 O  O   . CYS C  1 41  ? 6.632   21.357 2.318   1.00 14.13 ? 64   CYS C O   1 
ATOM   3593 C  CB  . CYS C  1 41  ? 7.161   23.823 0.897   1.00 12.69 ? 64   CYS C CB  1 
ATOM   3594 S  SG  . CYS C  1 41  ? 8.326   24.870 -0.003  1.00 12.02 ? 64   CYS C SG  1 
ATOM   3595 N  N   . TYR C  1 42  ? 4.850   21.170 0.998   1.00 12.44 ? 65   TYR C N   1 
ATOM   3596 C  CA  . TYR C  1 42  ? 4.122   20.395 2.001   1.00 14.25 ? 65   TYR C CA  1 
ATOM   3597 C  C   . TYR C  1 42  ? 4.781   19.063 2.361   1.00 16.85 ? 65   TYR C C   1 
ATOM   3598 O  O   . TYR C  1 42  ? 5.129   18.257 1.488   1.00 14.36 ? 65   TYR C O   1 
ATOM   3599 C  CB  . TYR C  1 42  ? 2.673   20.146 1.577   1.00 14.29 ? 65   TYR C CB  1 
ATOM   3600 C  CG  . TYR C  1 42  ? 2.015   19.194 2.531   1.00 14.76 ? 65   TYR C CG  1 
ATOM   3601 C  CD1 . TYR C  1 42  ? 1.520   19.645 3.749   1.00 21.49 ? 65   TYR C CD1 1 
ATOM   3602 C  CD2 . TYR C  1 42  ? 1.962   17.826 2.261   1.00 19.79 ? 65   TYR C CD2 1 
ATOM   3603 C  CE1 . TYR C  1 42  ? 0.961   18.773 4.660   1.00 20.39 ? 65   TYR C CE1 1 
ATOM   3604 C  CE2 . TYR C  1 42  ? 1.411   16.948 3.172   1.00 19.57 ? 65   TYR C CE2 1 
ATOM   3605 C  CZ  . TYR C  1 42  ? 0.895   17.432 4.357   1.00 24.22 ? 65   TYR C CZ  1 
ATOM   3606 O  OH  . TYR C  1 42  ? 0.336   16.557 5.263   1.00 22.44 ? 65   TYR C OH  1 
ATOM   3607 N  N   . LYS C  1 43  ? 4.890   18.823 3.662   1.00 16.67 ? 66   LYS C N   1 
ATOM   3608 C  CA  . LYS C  1 43  ? 5.565   17.649 4.206   1.00 17.76 ? 66   LYS C CA  1 
ATOM   3609 C  C   . LYS C  1 43  ? 4.950   17.513 5.606   1.00 15.87 ? 66   LYS C C   1 
ATOM   3610 O  O   . LYS C  1 43  ? 4.626   18.521 6.236   1.00 18.88 ? 66   LYS C O   1 
ATOM   3611 C  CB  . LYS C  1 43  ? 7.060   18.003 4.290   1.00 25.32 ? 66   LYS C CB  1 
ATOM   3612 C  CG  . LYS C  1 43  ? 8.052   16.884 4.332   1.00 35.85 ? 66   LYS C CG  1 
ATOM   3613 C  CD  . LYS C  1 43  ? 9.465   17.470 4.368   1.00 23.04 ? 66   LYS C CD  1 
ATOM   3614 C  CE  . LYS C  1 43  ? 10.502  16.362 4.327   1.00 30.71 ? 66   LYS C CE  1 
ATOM   3615 N  NZ  . LYS C  1 43  ? 9.978   15.205 5.093   1.00 36.66 ? 66   LYS C NZ  1 
ATOM   3616 N  N   . SER C  1 44  ? 4.737   16.295 6.092   1.00 19.04 ? 67   SER C N   1 
ATOM   3617 C  CA  . SER C  1 44  ? 4.315   16.146 7.485   1.00 20.90 ? 67   SER C CA  1 
ATOM   3618 C  C   . SER C  1 44  ? 5.535   16.358 8.400   1.00 17.17 ? 67   SER C C   1 
ATOM   3619 O  O   . SER C  1 44  ? 6.677   16.221 7.959   1.00 21.66 ? 67   SER C O   1 
ATOM   3620 C  CB  . SER C  1 44  ? 3.719   14.753 7.710   1.00 25.24 ? 67   SER C CB  1 
ATOM   3621 O  OG  . SER C  1 44  ? 4.719   13.777 7.496   1.00 24.00 ? 67   SER C OG  1 
ATOM   3622 N  N   . GLY C  1 45  ? 5.290   16.693 9.662   1.00 23.18 ? 68   GLY C N   1 
ATOM   3623 C  CA  . GLY C  1 45  ? 6.353   16.853 10.645  1.00 26.56 ? 68   GLY C CA  1 
ATOM   3624 C  C   . GLY C  1 45  ? 7.234   18.089 10.480  1.00 17.99 ? 68   GLY C C   1 
ATOM   3625 O  O   . GLY C  1 45  ? 8.399   18.082 10.865  1.00 25.05 ? 68   GLY C O   1 
ATOM   3626 N  N   . ILE C  1 46  ? 6.701   19.155 9.902   1.00 19.07 ? 69   ILE C N   1 
ATOM   3627 C  CA  . ILE C  1 46  ? 7.529   20.344 9.731   1.00 17.51 ? 69   ILE C CA  1 
ATOM   3628 C  C   . ILE C  1 46  ? 7.776   21.025 11.075  1.00 15.10 ? 69   ILE C C   1 
ATOM   3629 O  O   . ILE C  1 46  ? 6.877   21.129 11.902  1.00 17.02 ? 69   ILE C O   1 
ATOM   3630 C  CB  . ILE C  1 46  ? 6.888   21.334 8.752   1.00 18.89 ? 69   ILE C CB  1 
ATOM   3631 C  CG1 . ILE C  1 46  ? 6.972   20.752 7.334   1.00 18.33 ? 69   ILE C CG1 1 
ATOM   3632 C  CG2 . ILE C  1 46  ? 7.556   22.716 8.823   1.00 11.27 ? 69   ILE C CG2 1 
ATOM   3633 C  CD1 . ILE C  1 46  ? 6.140   21.490 6.320   1.00 20.91 ? 69   ILE C CD1 1 
ATOM   3634 N  N   . GLN C  1 47  ? 9.005   21.482 11.283  1.00 15.21 ? 70   GLN C N   1 
ATOM   3635 C  CA  . GLN C  1 47  ? 9.291   22.401 12.373  1.00 12.11 ? 70   GLN C CA  1 
ATOM   3636 C  C   . GLN C  1 47  ? 9.551   23.746 11.730  1.00 12.62 ? 70   GLN C C   1 
ATOM   3637 O  O   . GLN C  1 47  ? 10.259  23.813 10.730  1.00 13.04 ? 70   GLN C O   1 
ATOM   3638 C  CB  . GLN C  1 47  ? 10.537  21.946 13.141  1.00 11.52 ? 70   GLN C CB  1 
ATOM   3639 C  CG  . GLN C  1 47  ? 10.821  22.808 14.348  1.00 13.98 ? 70   GLN C CG  1 
ATOM   3640 C  CD  . GLN C  1 47  ? 12.041  22.338 15.116  1.00 11.98 ? 70   GLN C CD  1 
ATOM   3641 O  OE1 . GLN C  1 47  ? 13.177  22.569 14.693  1.00 14.46 ? 70   GLN C OE1 1 
ATOM   3642 N  NE2 . GLN C  1 47  ? 11.816  21.668 16.256  1.00 14.07 ? 70   GLN C NE2 1 
ATOM   3643 N  N   . VAL C  1 48  ? 8.986   24.813 12.291  1.00 10.32 ? 71   VAL C N   1 
ATOM   3644 C  CA  . VAL C  1 48  ? 9.295   26.154 11.817  1.00 11.95 ? 71   VAL C CA  1 
ATOM   3645 C  C   . VAL C  1 48  ? 10.434  26.762 12.638  1.00 12.62 ? 71   VAL C C   1 
ATOM   3646 O  O   . VAL C  1 48  ? 10.400  26.755 13.865  1.00 18.07 ? 71   VAL C O   1 
ATOM   3647 C  CB  . VAL C  1 48  ? 8.049   27.069 11.868  1.00 14.04 ? 71   VAL C CB  1 
ATOM   3648 C  CG1 . VAL C  1 48  ? 8.400   28.473 11.362  1.00 13.61 ? 71   VAL C CG1 1 
ATOM   3649 C  CG2 . VAL C  1 48  ? 6.951   26.465 11.001  1.00 19.94 ? 71   VAL C CG2 1 
ATOM   3650 N  N   . ARG C  1 49  ? 11.459  27.255 11.963  1.00 10.24 ? 72   ARG C N   1 
ATOM   3651 C  CA  . ARG C  1 49  ? 12.542  27.947 12.642  1.00 8.91  ? 72   ARG C CA  1 
ATOM   3652 C  C   . ARG C  1 49  ? 12.500  29.434 12.335  1.00 10.80 ? 72   ARG C C   1 
ATOM   3653 O  O   . ARG C  1 49  ? 12.668  29.869 11.193  1.00 10.35 ? 72   ARG C O   1 
ATOM   3654 C  CB  . ARG C  1 49  ? 13.876  27.334 12.258  1.00 8.60  ? 72   ARG C CB  1 
ATOM   3655 C  CG  . ARG C  1 49  ? 13.894  25.858 12.635  1.00 11.58 ? 72   ARG C CG  1 
ATOM   3656 C  CD  . ARG C  1 49  ? 15.279  25.287 12.616  1.00 12.15 ? 72   ARG C CD  1 
ATOM   3657 N  NE  . ARG C  1 49  ? 15.237  23.962 13.233  1.00 11.52 ? 72   ARG C NE  1 
ATOM   3658 C  CZ  . ARG C  1 49  ? 16.296  23.173 13.383  1.00 8.77  ? 72   ARG C CZ  1 
ATOM   3659 N  NH1 . ARG C  1 49  ? 17.493  23.551 12.962  1.00 9.35  ? 72   ARG C NH1 1 
ATOM   3660 N  NH2 . ARG C  1 49  ? 16.140  21.993 13.961  1.00 12.61 ? 72   ARG C NH2 1 
ATOM   3661 N  N   . LEU C  1 50  ? 12.247  30.202 13.385  1.00 11.30 ? 73   LEU C N   1 
ATOM   3662 C  CA  . LEU C  1 50  ? 12.211  31.661 13.295  1.00 12.94 ? 73   LEU C CA  1 
ATOM   3663 C  C   . LEU C  1 50  ? 13.471  32.280 13.881  1.00 15.18 ? 73   LEU C C   1 
ATOM   3664 O  O   . LEU C  1 50  ? 14.138  31.664 14.700  1.00 15.12 ? 73   LEU C O   1 
ATOM   3665 C  CB  . LEU C  1 50  ? 11.017  32.173 14.078  1.00 12.73 ? 73   LEU C CB  1 
ATOM   3666 C  CG  . LEU C  1 50  ? 9.662   31.623 13.659  1.00 20.63 ? 73   LEU C CG  1 
ATOM   3667 C  CD1 . LEU C  1 50  ? 9.223   30.507 14.590  1.00 21.64 ? 73   LEU C CD1 1 
ATOM   3668 C  CD2 . LEU C  1 50  ? 8.656   32.751 13.678  1.00 18.55 ? 73   LEU C CD2 1 
ATOM   3669 N  N   . GLY C  1 51  ? 13.789  33.507 13.481  1.00 14.76 ? 74   GLY C N   1 
ATOM   3670 C  CA  . GLY C  1 51  ? 14.891  34.228 14.102  1.00 15.29 ? 74   GLY C CA  1 
ATOM   3671 C  C   . GLY C  1 51  ? 16.238  33.757 13.613  1.00 13.01 ? 74   GLY C C   1 
ATOM   3672 O  O   . GLY C  1 51  ? 17.287  34.104 14.179  1.00 15.41 ? 74   GLY C O   1 
ATOM   3673 N  N   . GLU C  1 52  ? 16.224  32.974 12.539  1.00 9.22  ? 75   GLU C N   1 
ATOM   3674 C  CA  . GLU C  1 52  ? 17.447  32.411 11.981  1.00 13.14 ? 75   GLU C CA  1 
ATOM   3675 C  C   . GLU C  1 52  ? 18.284  33.379 11.148  1.00 14.61 ? 75   GLU C C   1 
ATOM   3676 O  O   . GLU C  1 52  ? 17.745  34.179 10.369  1.00 15.89 ? 75   GLU C O   1 
ATOM   3677 C  CB  . GLU C  1 52  ? 17.101  31.194 11.098  1.00 8.51  ? 75   GLU C CB  1 
ATOM   3678 C  CG  . GLU C  1 52  ? 16.555  29.952 11.865  1.00 13.65 ? 75   GLU C CG  1 
ATOM   3679 C  CD  . GLU C  1 52  ? 17.685  29.188 12.510  1.00 12.37 ? 75   GLU C CD  1 
ATOM   3680 O  OE1 . GLU C  1 52  ? 18.737  29.795 12.593  1.00 13.61 ? 75   GLU C OE1 1 
ATOM   3681 O  OE2 . GLU C  1 52  ? 17.572  28.001 12.926  1.00 11.41 ? 75   GLU C OE2 1 
ATOM   3682 N  N   . ASP C  1 53  ? 19.603  33.277 11.279  1.00 13.05 ? 76   ASP C N   1 
ATOM   3683 C  CA  . ASP C  1 53  ? 20.499  33.820 10.268  1.00 16.32 ? 76   ASP C CA  1 
ATOM   3684 C  C   . ASP C  1 53  ? 21.407  32.706 9.780   1.00 16.90 ? 76   ASP C C   1 
ATOM   3685 O  O   . ASP C  1 53  ? 21.209  32.158 8.695   1.00 16.19 ? 76   ASP C O   1 
ATOM   3686 C  CB  . ASP C  1 53  ? 21.332  35.008 10.780  1.00 20.19 ? 76   ASP C CB  1 
ATOM   3687 C  CG  . ASP C  1 53  ? 22.181  35.635 9.666   1.00 18.69 ? 76   ASP C CG  1 
ATOM   3688 O  OD1 . ASP C  1 53  ? 21.646  35.800 8.545   1.00 18.34 ? 76   ASP C OD1 1 
ATOM   3689 O  OD2 . ASP C  1 53  ? 23.384  35.932 9.882   1.00 20.23 ? 76   ASP C OD2 1 
ATOM   3690 N  N   . ASN C  1 54  ? 22.412  32.366 10.572  1.00 10.57 ? 77   ASN C N   1 
ATOM   3691 C  CA  . ASN C  1 54  ? 23.215  31.211 10.237  1.00 14.40 ? 77   ASN C CA  1 
ATOM   3692 C  C   . ASN C  1 54  ? 22.433  29.972 10.557  1.00 19.90 ? 77   ASN C C   1 
ATOM   3693 O  O   . ASN C  1 54  ? 22.244  29.663 11.697  1.00 15.29 ? 77   ASN C O   1 
ATOM   3694 C  CB  . ASN C  1 54  ? 24.539  31.209 10.985  1.00 14.73 ? 77   ASN C CB  1 
ATOM   3695 C  CG  . ASN C  1 54  ? 25.441  30.095 10.538  1.00 18.09 ? 77   ASN C CG  1 
ATOM   3696 O  OD1 . ASN C  1 54  ? 25.010  28.940 10.389  1.00 20.89 ? 77   ASN C OD1 1 
ATOM   3697 N  ND2 . ASN C  1 54  ? 26.708  30.427 10.305  1.00 16.00 ? 77   ASN C ND2 1 
ATOM   3698 N  N   . ILE C  1 55  ? 21.998  29.244 9.548   1.00 17.00 ? 78   ILE C N   1 
ATOM   3699 C  CA  . ILE C  1 55  ? 21.089  28.127 9.748   1.00 17.93 ? 78   ILE C CA  1 
ATOM   3700 C  C   . ILE C  1 55  ? 21.743  26.944 10.491  1.00 18.38 ? 78   ILE C C   1 
ATOM   3701 O  O   . ILE C  1 55  ? 21.057  26.076 11.051  1.00 14.22 ? 78   ILE C O   1 
ATOM   3702 C  CB  . ILE C  1 55  ? 20.523  27.722 8.370   1.00 16.21 ? 78   ILE C CB  1 
ATOM   3703 C  CG1 . ILE C  1 55  ? 19.110  27.168 8.499   1.00 22.17 ? 78   ILE C CG1 1 
ATOM   3704 C  CG2 . ILE C  1 55  ? 21.498  26.828 7.623   1.00 19.23 ? 78   ILE C CG2 1 
ATOM   3705 C  CD1 . ILE C  1 55  ? 18.091  28.282 8.636   1.00 14.66 ? 78   ILE C CD1 1 
ATOM   3706 N  N   . ASN C  1 56  ? 23.071  26.932 10.555  1.00 15.06 ? 79   ASN C N   1 
ATOM   3707 C  CA  . ASN C  1 56  ? 23.780  25.822 11.202  1.00 16.80 ? 79   ASN C CA  1 
ATOM   3708 C  C   . ASN C  1 56  ? 24.351  26.070 12.623  1.00 17.52 ? 79   ASN C C   1 
ATOM   3709 O  O   . ASN C  1 56  ? 24.815  25.142 13.282  1.00 22.97 ? 79   ASN C O   1 
ATOM   3710 C  CB  . ASN C  1 56  ? 24.877  25.306 10.266  1.00 25.61 ? 79   ASN C CB  1 
ATOM   3711 C  CG  . ASN C  1 56  ? 24.478  24.019 9.564   1.00 30.56 ? 79   ASN C CG  1 
ATOM   3712 O  OD1 . ASN C  1 56  ? 24.236  23.999 8.352   1.00 42.76 ? 79   ASN C OD1 1 
ATOM   3713 N  ND2 . ASN C  1 56  ? 24.400  22.932 10.331  1.00 40.59 ? 79   ASN C ND2 1 
ATOM   3714 N  N   . VAL C  1 57  ? 24.307  27.307 13.098  1.00 18.93 ? 80   VAL C N   1 
ATOM   3715 C  CA  . VAL C  1 57  ? 24.927  27.648 14.374  1.00 15.54 ? 80   VAL C CA  1 
ATOM   3716 C  C   . VAL C  1 57  ? 23.891  28.297 15.241  1.00 15.41 ? 80   VAL C C   1 
ATOM   3717 O  O   . VAL C  1 57  ? 23.205  29.147 14.749  1.00 14.74 ? 80   VAL C O   1 
ATOM   3718 C  CB  . VAL C  1 57  ? 26.002  28.717 14.164  1.00 20.08 ? 80   VAL C CB  1 
ATOM   3719 C  CG1 . VAL C  1 57  ? 26.487  29.253 15.510  1.00 22.61 ? 80   VAL C CG1 1 
ATOM   3720 C  CG2 . VAL C  1 57  ? 27.139  28.166 13.305  1.00 15.84 ? 80   VAL C CG2 1 
ATOM   3721 N  N   . VAL C  1 58  ? 23.763  27.952 16.517  1.00 13.45 ? 81   VAL C N   1 
ATOM   3722 C  CA  . VAL C  1 58  ? 22.777  28.643 17.339  1.00 15.15 ? 81   VAL C CA  1 
ATOM   3723 C  C   . VAL C  1 58  ? 23.312  30.018 17.693  1.00 21.46 ? 81   VAL C C   1 
ATOM   3724 O  O   . VAL C  1 58  ? 24.355  30.127 18.349  1.00 19.91 ? 81   VAL C O   1 
ATOM   3725 C  CB  . VAL C  1 58  ? 22.543  27.942 18.672  1.00 12.54 ? 81   VAL C CB  1 
ATOM   3726 C  CG1 . VAL C  1 58  ? 21.478  28.729 19.486  1.00 16.41 ? 81   VAL C CG1 1 
ATOM   3727 C  CG2 . VAL C  1 58  ? 22.094  26.496 18.421  1.00 13.31 ? 81   VAL C CG2 1 
ATOM   3728 N  N   . GLU C  1 59  ? 22.606  31.069 17.292  1.00 14.57 ? 82   GLU C N   1 
ATOM   3729 C  CA  . GLU C  1 59  ? 23.114  32.419 17.556  1.00 15.72 ? 82   GLU C CA  1 
ATOM   3730 C  C   . GLU C  1 59  ? 22.349  33.160 18.637  1.00 17.69 ? 82   GLU C C   1 
ATOM   3731 O  O   . GLU C  1 59  ? 22.775  34.226 19.117  1.00 24.95 ? 82   GLU C O   1 
ATOM   3732 C  CB  . GLU C  1 59  ? 23.182  33.238 16.258  1.00 16.08 ? 82   GLU C CB  1 
ATOM   3733 C  CG  . GLU C  1 59  ? 24.068  32.595 15.203  1.00 16.87 ? 82   GLU C CG  1 
ATOM   3734 C  CD  . GLU C  1 59  ? 24.143  33.422 13.934  1.00 24.28 ? 82   GLU C CD  1 
ATOM   3735 O  OE1 . GLU C  1 59  ? 23.159  33.410 13.179  1.00 16.80 ? 82   GLU C OE1 1 
ATOM   3736 O  OE2 . GLU C  1 59  ? 25.178  34.083 13.697  1.00 26.81 ? 82   GLU C OE2 1 
ATOM   3737 N  N   . GLY C  1 60  ? 21.208  32.615 19.035  1.00 14.20 ? 83   GLY C N   1 
ATOM   3738 C  CA  . GLY C  1 60  ? 20.578  33.113 20.244  1.00 19.15 ? 83   GLY C CA  1 
ATOM   3739 C  C   . GLY C  1 60  ? 19.212  33.718 20.054  1.00 14.47 ? 83   GLY C C   1 
ATOM   3740 O  O   . GLY C  1 60  ? 18.473  33.914 21.013  1.00 17.65 ? 83   GLY C O   1 
ATOM   3741 N  N   . ASN C  1 61  ? 18.854  33.997 18.807  1.00 14.60 ? 84   ASN C N   1 
ATOM   3742 C  CA  . ASN C  1 61  ? 17.576  34.620 18.547  1.00 14.72 ? 84   ASN C CA  1 
ATOM   3743 C  C   . ASN C  1 61  ? 16.575  33.683 17.909  1.00 15.69 ? 84   ASN C C   1 
ATOM   3744 O  O   . ASN C  1 61  ? 15.475  34.096 17.531  1.00 14.39 ? 84   ASN C O   1 
ATOM   3745 C  CB  . ASN C  1 61  ? 17.811  35.847 17.666  1.00 15.33 ? 84   ASN C CB  1 
ATOM   3746 C  CG  . ASN C  1 61  ? 18.718  36.848 18.343  1.00 17.88 ? 84   ASN C CG  1 
ATOM   3747 O  OD1 . ASN C  1 61  ? 19.828  37.139 17.872  1.00 20.96 ? 84   ASN C OD1 1 
ATOM   3748 N  ND2 . ASN C  1 61  ? 18.269  37.358 19.480  1.00 17.93 ? 84   ASN C ND2 1 
ATOM   3749 N  N   . GLU C  1 62  ? 16.949  32.413 17.807  1.00 14.94 ? 85   GLU C N   1 
ATOM   3750 C  CA  . GLU C  1 62  ? 16.079  31.415 17.196  1.00 14.93 ? 85   GLU C CA  1 
ATOM   3751 C  C   . GLU C  1 62  ? 14.872  31.069 18.052  1.00 13.30 ? 85   GLU C C   1 
ATOM   3752 O  O   . GLU C  1 62  ? 14.930  31.080 19.287  1.00 15.82 ? 85   GLU C O   1 
ATOM   3753 C  CB  . GLU C  1 62  ? 16.849  30.110 16.958  1.00 9.66  ? 85   GLU C CB  1 
ATOM   3754 C  CG  . GLU C  1 62  ? 18.030  30.217 16.052  1.00 11.86 ? 85   GLU C CG  1 
ATOM   3755 C  CD  . GLU C  1 62  ? 19.268  30.594 16.781  1.00 12.50 ? 85   GLU C CD  1 
ATOM   3756 O  OE1 . GLU C  1 62  ? 19.205  30.954 17.977  1.00 17.24 ? 85   GLU C OE1 1 
ATOM   3757 O  OE2 . GLU C  1 62  ? 20.341  30.516 16.183  1.00 15.52 ? 85   GLU C OE2 1 
ATOM   3758 N  N   . GLN C  1 63  ? 13.769  30.748 17.385  1.00 8.98  ? 86   GLN C N   1 
ATOM   3759 C  CA  . GLN C  1 63  ? 12.678  30.011 18.022  1.00 12.03 ? 86   GLN C CA  1 
ATOM   3760 C  C   . GLN C  1 63  ? 12.353  28.779 17.170  1.00 15.89 ? 86   GLN C C   1 
ATOM   3761 O  O   . GLN C  1 63  ? 12.267  28.882 15.937  1.00 15.81 ? 86   GLN C O   1 
ATOM   3762 C  CB  . GLN C  1 63  ? 11.434  30.909 18.165  1.00 13.66 ? 86   GLN C CB  1 
ATOM   3763 C  CG  . GLN C  1 63  ? 11.669  32.107 19.071  1.00 14.67 ? 86   GLN C CG  1 
ATOM   3764 C  CD  . GLN C  1 63  ? 10.503  33.076 19.077  1.00 16.40 ? 86   GLN C CD  1 
ATOM   3765 O  OE1 . GLN C  1 63  ? 9.342   32.663 19.166  1.00 15.69 ? 86   GLN C OE1 1 
ATOM   3766 N  NE2 . GLN C  1 63  ? 10.806  34.374 18.954  1.00 16.75 ? 86   GLN C NE2 1 
ATOM   3767 N  N   . PHE C  1 64  ? 12.164  27.622 17.812  1.00 12.51 ? 87   PHE C N   1 
ATOM   3768 C  CA  . PHE C  1 64  ? 11.889  26.374 17.106  1.00 11.68 ? 87   PHE C CA  1 
ATOM   3769 C  C   . PHE C  1 64  ? 10.502  25.895 17.479  1.00 14.62 ? 87   PHE C C   1 
ATOM   3770 O  O   . PHE C  1 64  ? 10.270  25.471 18.609  1.00 20.39 ? 87   PHE C O   1 
ATOM   3771 C  CB  . PHE C  1 64  ? 12.895  25.278 17.516  1.00 14.14 ? 87   PHE C CB  1 
ATOM   3772 C  CG  . PHE C  1 64  ? 14.334  25.696 17.419  1.00 19.37 ? 87   PHE C CG  1 
ATOM   3773 C  CD1 . PHE C  1 64  ? 15.023  25.595 16.231  1.00 18.99 ? 87   PHE C CD1 1 
ATOM   3774 C  CD2 . PHE C  1 64  ? 15.011  26.174 18.536  1.00 18.73 ? 87   PHE C CD2 1 
ATOM   3775 C  CE1 . PHE C  1 64  ? 16.368  25.972 16.157  1.00 16.57 ? 87   PHE C CE1 1 
ATOM   3776 C  CE2 . PHE C  1 64  ? 16.354  26.562 18.456  1.00 15.23 ? 87   PHE C CE2 1 
ATOM   3777 C  CZ  . PHE C  1 64  ? 17.023  26.462 17.280  1.00 12.81 ? 87   PHE C CZ  1 
ATOM   3778 N  N   . ILE C  1 65  ? 9.560   25.970 16.552  1.00 14.06 ? 88   ILE C N   1 
ATOM   3779 C  CA  . ILE C  1 65  ? 8.167   25.655 16.878  1.00 12.40 ? 88   ILE C CA  1 
ATOM   3780 C  C   . ILE C  1 65  ? 7.563   24.703 15.865  1.00 17.66 ? 88   ILE C C   1 
ATOM   3781 O  O   . ILE C  1 65  ? 7.666   24.941 14.663  1.00 17.26 ? 88   ILE C O   1 
ATOM   3782 C  CB  . ILE C  1 65  ? 7.314   26.933 16.892  1.00 17.40 ? 88   ILE C CB  1 
ATOM   3783 C  CG1 . ILE C  1 65  ? 7.980   28.006 17.767  1.00 14.36 ? 88   ILE C CG1 1 
ATOM   3784 C  CG2 . ILE C  1 65  ? 5.874   26.618 17.315  1.00 16.39 ? 88   ILE C CG2 1 
ATOM   3785 C  CD1 . ILE C  1 65  ? 7.416   29.413 17.583  1.00 20.41 ? 88   ILE C CD1 1 
ATOM   3786 N  N   . SER C  1 66  ? 6.934   23.635 16.343  1.00 16.87 ? 89   SER C N   1 
ATOM   3787 C  CA  . SER C  1 66  ? 6.345   22.627 15.461  1.00 21.46 ? 89   SER C CA  1 
ATOM   3788 C  C   . SER C  1 66  ? 5.120   23.169 14.742  1.00 21.71 ? 89   SER C C   1 
ATOM   3789 O  O   . SER C  1 66  ? 4.399   24.001 15.284  1.00 20.39 ? 89   SER C O   1 
ATOM   3790 C  CB  . SER C  1 66  ? 5.958   21.374 16.255  1.00 25.04 ? 89   SER C CB  1 
ATOM   3791 O  OG  . SER C  1 66  ? 7.083   20.800 16.895  1.00 33.95 ? 89   SER C OG  1 
ATOM   3792 N  N   . ALA C  1 67  ? 4.909   22.731 13.503  1.00 16.86 ? 90   ALA C N   1 
ATOM   3793 C  CA  . ALA C  1 67  ? 3.680   23.047 12.796  1.00 18.41 ? 90   ALA C CA  1 
ATOM   3794 C  C   . ALA C  1 67  ? 2.585   22.179 13.384  1.00 17.06 ? 90   ALA C C   1 
ATOM   3795 O  O   . ALA C  1 67  ? 2.732   20.958 13.455  1.00 27.30 ? 90   ALA C O   1 
ATOM   3796 C  CB  . ALA C  1 67  ? 3.830   22.755 11.303  1.00 21.57 ? 90   ALA C CB  1 
ATOM   3797 N  N   . SER C  1 68  ? 1.483   22.798 13.796  1.00 22.83 ? 91   SER C N   1 
ATOM   3798 C  CA  . SER C  1 68  ? 0.350   22.022 14.298  1.00 22.37 ? 91   SER C CA  1 
ATOM   3799 C  C   . SER C  1 68  ? -0.612  21.723 13.160  1.00 21.45 ? 91   SER C C   1 
ATOM   3800 O  O   . SER C  1 68  ? -1.250  20.664 13.129  1.00 22.39 ? 91   SER C O   1 
ATOM   3801 C  CB  . SER C  1 68  ? -0.366  22.748 15.446  1.00 19.41 ? 91   SER C CB  1 
ATOM   3802 O  OG  . SER C  1 68  ? -0.691  24.073 15.089  1.00 23.02 ? 91   SER C OG  1 
ATOM   3803 N  N   . LYS C  1 69  ? -0.701  22.656 12.215  1.00 22.88 ? 92   LYS C N   1 
ATOM   3804 C  CA  . LYS C  1 69  ? -1.509  22.455 11.015  1.00 27.82 ? 92   LYS C CA  1 
ATOM   3805 C  C   . LYS C  1 69  ? -0.759  22.913 9.766   1.00 22.11 ? 92   LYS C C   1 
ATOM   3806 O  O   . LYS C  1 69  ? -0.066  23.945 9.781   1.00 20.85 ? 92   LYS C O   1 
ATOM   3807 C  CB  . LYS C  1 69  ? -2.824  23.224 11.129  1.00 23.36 ? 92   LYS C CB  1 
ATOM   3808 C  CG  . LYS C  1 69  ? -3.711  22.776 12.281  1.00 31.88 ? 92   LYS C CG  1 
ATOM   3809 C  CD  . LYS C  1 69  ? -4.791  23.822 12.560  1.00 37.35 ? 92   LYS C CD  1 
ATOM   3810 C  CE  . LYS C  1 69  ? -5.960  23.202 13.314  1.00 40.41 ? 92   LYS C CE  1 
ATOM   3811 N  NZ  . LYS C  1 69  ? -6.517  22.064 12.529  1.00 50.73 ? 92   LYS C NZ  1 
ATOM   3812 N  N   . SER C  1 70  ? -0.907  22.152 8.685   1.00 23.55 ? 93   SER C N   1 
ATOM   3813 C  CA  . SER C  1 70  ? -0.351  22.547 7.401   1.00 21.77 ? 93   SER C CA  1 
ATOM   3814 C  C   . SER C  1 70  ? -1.446  22.422 6.360   1.00 20.53 ? 93   SER C C   1 
ATOM   3815 O  O   . SER C  1 70  ? -1.943  21.328 6.087   1.00 30.11 ? 93   SER C O   1 
ATOM   3816 C  CB  . SER C  1 70  ? 0.858   21.677 7.044   1.00 22.14 ? 93   SER C CB  1 
ATOM   3817 O  OG  . SER C  1 70  ? 1.866   21.826 8.033   1.00 27.53 ? 93   SER C OG  1 
ATOM   3818 N  N   . ILE C  1 71  ? -1.858  23.560 5.824   1.00 23.39 ? 94   ILE C N   1 
ATOM   3819 C  CA  . ILE C  1 71  ? -3.039  23.595 4.979   1.00 22.41 ? 94   ILE C CA  1 
ATOM   3820 C  C   . ILE C  1 71  ? -2.657  24.054 3.596   1.00 15.70 ? 94   ILE C C   1 
ATOM   3821 O  O   . ILE C  1 71  ? -2.386  25.222 3.384   1.00 17.30 ? 94   ILE C O   1 
ATOM   3822 C  CB  . ILE C  1 71  ? -4.078  24.559 5.545   1.00 24.03 ? 94   ILE C CB  1 
ATOM   3823 C  CG1 . ILE C  1 71  ? -4.360  24.220 7.014   1.00 23.05 ? 94   ILE C CG1 1 
ATOM   3824 C  CG2 . ILE C  1 71  ? -5.361  24.526 4.703   1.00 21.94 ? 94   ILE C CG2 1 
ATOM   3825 C  CD1 . ILE C  1 71  ? -5.190  25.252 7.704   1.00 21.65 ? 94   ILE C CD1 1 
ATOM   3826 N  N   . VAL C  1 72  ? -2.618  23.113 2.665   1.00 20.72 ? 95   VAL C N   1 
ATOM   3827 C  CA  . VAL C  1 72  ? -2.351  23.412 1.266   1.00 17.22 ? 95   VAL C CA  1 
ATOM   3828 C  C   . VAL C  1 72  ? -3.611  23.977 0.625   1.00 21.91 ? 95   VAL C C   1 
ATOM   3829 O  O   . VAL C  1 72  ? -4.711  23.528 0.937   1.00 22.79 ? 95   VAL C O   1 
ATOM   3830 C  CB  . VAL C  1 72  ? -1.927  22.120 0.558   1.00 20.53 ? 95   VAL C CB  1 
ATOM   3831 C  CG1 . VAL C  1 72  ? -1.973  22.276 -0.946  1.00 21.20 ? 95   VAL C CG1 1 
ATOM   3832 C  CG2 . VAL C  1 72  ? -0.538  21.706 1.030   1.00 21.01 ? 95   VAL C CG2 1 
ATOM   3833 N  N   . HIS C  1 73  ? -3.466  24.967 -0.250  1.00 17.39 ? 96   HIS C N   1 
ATOM   3834 C  CA  . HIS C  1 73  ? -4.634  25.521 -0.933  1.00 17.59 ? 96   HIS C CA  1 
ATOM   3835 C  C   . HIS C  1 73  ? -5.405  24.375 -1.567  1.00 18.46 ? 96   HIS C C   1 
ATOM   3836 O  O   . HIS C  1 73  ? -4.820  23.490 -2.173  1.00 21.09 ? 96   HIS C O   1 
ATOM   3837 C  CB  . HIS C  1 73  ? -4.250  26.528 -2.007  1.00 18.44 ? 96   HIS C CB  1 
ATOM   3838 C  CG  . HIS C  1 73  ? -5.403  27.354 -2.489  1.00 21.37 ? 96   HIS C CG  1 
ATOM   3839 N  ND1 . HIS C  1 73  ? -6.269  26.933 -3.476  1.00 18.20 ? 96   HIS C ND1 1 
ATOM   3840 C  CD2 . HIS C  1 73  ? -5.827  28.583 -2.111  1.00 21.76 ? 96   HIS C CD2 1 
ATOM   3841 C  CE1 . HIS C  1 73  ? -7.182  27.869 -3.683  1.00 28.71 ? 96   HIS C CE1 1 
ATOM   3842 N  NE2 . HIS C  1 73  ? -6.937  28.878 -2.866  1.00 24.91 ? 96   HIS C NE2 1 
ATOM   3843 N  N   . PRO C  1 74  ? -6.728  24.370 -1.389  1.00 22.75 ? 97   PRO C N   1 
ATOM   3844 C  CA  . PRO C  1 74  ? -7.481  23.179 -1.776  1.00 23.36 ? 97   PRO C CA  1 
ATOM   3845 C  C   . PRO C  1 74  ? -7.514  22.961 -3.295  1.00 25.98 ? 97   PRO C C   1 
ATOM   3846 O  O   . PRO C  1 74  ? -7.800  21.846 -3.739  1.00 27.98 ? 97   PRO C O   1 
ATOM   3847 C  CB  . PRO C  1 74  ? -8.882  23.446 -1.210  1.00 25.08 ? 97   PRO C CB  1 
ATOM   3848 C  CG  . PRO C  1 74  ? -8.967  24.936 -1.084  1.00 25.70 ? 97   PRO C CG  1 
ATOM   3849 C  CD  . PRO C  1 74  ? -7.575  25.417 -0.787  1.00 21.95 ? 97   PRO C CD  1 
ATOM   3850 N  N   . SER C  1 75  ? -7.205  23.988 -4.079  1.00 18.09 ? 98   SER C N   1 
ATOM   3851 C  CA  . SER C  1 75  ? -7.132  23.810 -5.535  1.00 23.67 ? 98   SER C CA  1 
ATOM   3852 C  C   . SER C  1 75  ? -5.699  23.941 -6.079  1.00 21.41 ? 98   SER C C   1 
ATOM   3853 O  O   . SER C  1 75  ? -5.488  24.309 -7.243  1.00 16.49 ? 98   SER C O   1 
ATOM   3854 C  CB  . SER C  1 75  ? -8.098  24.752 -6.266  1.00 26.35 ? 98   SER C CB  1 
ATOM   3855 O  OG  . SER C  1 75  ? -7.586  26.068 -6.350  1.00 34.71 ? 98   SER C OG  1 
ATOM   3856 N  N   . TYR C  1 76  ? -4.716  23.661 -5.227  1.00 15.42 ? 99   TYR C N   1 
ATOM   3857 C  CA  . TYR C  1 76  ? -3.352  23.504 -5.714  1.00 17.17 ? 99   TYR C CA  1 
ATOM   3858 C  C   . TYR C  1 76  ? -3.312  22.424 -6.806  1.00 13.54 ? 99   TYR C C   1 
ATOM   3859 O  O   . TYR C  1 76  ? -3.880  21.325 -6.657  1.00 15.92 ? 99   TYR C O   1 
ATOM   3860 C  CB  . TYR C  1 76  ? -2.411  23.131 -4.578  1.00 19.58 ? 99   TYR C CB  1 
ATOM   3861 C  CG  . TYR C  1 76  ? -1.019  22.726 -5.024  1.00 12.92 ? 99   TYR C CG  1 
ATOM   3862 C  CD1 . TYR C  1 76  ? -0.211  23.611 -5.736  1.00 14.71 ? 99   TYR C CD1 1 
ATOM   3863 C  CD2 . TYR C  1 76  ? -0.505  21.478 -4.703  1.00 14.55 ? 99   TYR C CD2 1 
ATOM   3864 C  CE1 . TYR C  1 76  ? 1.081   23.246 -6.125  1.00 16.20 ? 99   TYR C CE1 1 
ATOM   3865 C  CE2 . TYR C  1 76  ? 0.766   21.109 -5.088  1.00 13.03 ? 99   TYR C CE2 1 
ATOM   3866 C  CZ  . TYR C  1 76  ? 1.553   21.993 -5.798  1.00 12.92 ? 99   TYR C CZ  1 
ATOM   3867 O  OH  . TYR C  1 76  ? 2.823   21.621 -6.180  1.00 16.40 ? 99   TYR C OH  1 
ATOM   3868 N  N   . ASN C  1 77  ? -2.617  22.758 -7.887  1.00 15.38 ? 100  ASN C N   1 
ATOM   3869 C  CA  . ASN C  1 77  ? -2.462  21.884 -9.048  1.00 17.05 ? 100  ASN C CA  1 
ATOM   3870 C  C   . ASN C  1 77  ? -0.977  21.567 -9.173  1.00 13.61 ? 100  ASN C C   1 
ATOM   3871 O  O   . ASN C  1 77  ? -0.181  22.425 -9.551  1.00 11.68 ? 100  ASN C O   1 
ATOM   3872 C  CB  . ASN C  1 77  ? -2.958  22.611 -10.285 1.00 16.56 ? 100  ASN C CB  1 
ATOM   3873 C  CG  . ASN C  1 77  ? -3.023  21.702 -11.516 1.00 19.42 ? 100  ASN C CG  1 
ATOM   3874 O  OD1 . ASN C  1 77  ? -2.121  20.905 -11.760 1.00 15.21 ? 100  ASN C OD1 1 
ATOM   3875 N  ND2 . ASN C  1 77  ? -4.100  21.818 -12.279 1.00 16.25 ? 100  ASN C ND2 1 
ATOM   3876 N  N   . SER C  1 78  ? -0.596  20.331 -8.859  1.00 12.28 ? 101  SER C N   1 
ATOM   3877 C  CA  . SER C  1 78  ? 0.828   19.967 -8.836  1.00 12.75 ? 101  SER C CA  1 
ATOM   3878 C  C   . SER C  1 78  ? 1.450   19.831 -10.237 1.00 12.20 ? 101  SER C C   1 
ATOM   3879 O  O   . SER C  1 78  ? 2.680   19.798 -10.366 1.00 15.21 ? 101  SER C O   1 
ATOM   3880 C  CB  . SER C  1 78  ? 1.035   18.683 -8.022  1.00 16.40 ? 101  SER C CB  1 
ATOM   3881 O  OG  . SER C  1 78  ? 0.296   17.604 -8.570  1.00 18.35 ? 101  SER C OG  1 
ATOM   3882 N  N   . ASN C  1 79  ? 0.597   19.757 -11.262 1.00 11.34 ? 102  ASN C N   1 
ATOM   3883 C  CA  . ASN C  1 79  ? 1.025   19.674 -12.661 1.00 10.26 ? 102  ASN C CA  1 
ATOM   3884 C  C   . ASN C  1 79  ? 1.275   21.051 -13.276 1.00 11.75 ? 102  ASN C C   1 
ATOM   3885 O  O   . ASN C  1 79  ? 2.242   21.231 -14.026 1.00 15.22 ? 102  ASN C O   1 
ATOM   3886 C  CB  . ASN C  1 79  ? 0.009   18.908 -13.509 1.00 14.23 ? 102  ASN C CB  1 
ATOM   3887 C  CG  . ASN C  1 79  ? -0.072  17.421 -13.145 1.00 13.92 ? 102  ASN C CG  1 
ATOM   3888 O  OD1 . ASN C  1 79  ? 0.928   16.802 -12.807 1.00 14.42 ? 102  ASN C OD1 1 
ATOM   3889 N  ND2 . ASN C  1 79  ? -1.263  16.849 -13.245 1.00 19.99 ? 102  ASN C ND2 1 
ATOM   3890 N  N   . THR C  1 80  ? 0.406   22.012 -12.948 1.00 13.37 ? 103  THR C N   1 
ATOM   3891 C  CA  . THR C  1 80  ? 0.519   23.374 -13.495 1.00 17.76 ? 103  THR C CA  1 
ATOM   3892 C  C   . THR C  1 80  ? 1.108   24.383 -12.515 1.00 12.81 ? 103  THR C C   1 
ATOM   3893 O  O   . THR C  1 80  ? 1.513   25.477 -12.934 1.00 14.05 ? 103  THR C O   1 
ATOM   3894 C  CB  . THR C  1 80  ? -0.844  23.940 -13.918 1.00 14.32 ? 103  THR C CB  1 
ATOM   3895 O  OG1 . THR C  1 80  ? -1.655  24.141 -12.760 1.00 14.26 ? 103  THR C OG1 1 
ATOM   3896 C  CG2 . THR C  1 80  ? -1.549  22.998 -14.895 1.00 16.45 ? 103  THR C CG2 1 
ATOM   3897 N  N   . LEU C  1 81  ? 1.162   24.000 -11.237 1.00 12.40 ? 104  LEU C N   1 
ATOM   3898 C  CA  . LEU C  1 81  ? 1.662   24.839 -10.122 1.00 11.94 ? 104  LEU C CA  1 
ATOM   3899 C  C   . LEU C  1 81  ? 0.754   26.028 -9.828  1.00 14.88 ? 104  LEU C C   1 
ATOM   3900 O  O   . LEU C  1 81  ? 1.140   26.971 -9.128  1.00 13.58 ? 104  LEU C O   1 
ATOM   3901 C  CB  . LEU C  1 81  ? 3.105   25.289 -10.335 1.00 12.00 ? 104  LEU C CB  1 
ATOM   3902 C  CG  . LEU C  1 81  ? 4.029   24.095 -10.604 1.00 18.12 ? 104  LEU C CG  1 
ATOM   3903 C  CD1 . LEU C  1 81  ? 5.498   24.518 -10.824 1.00 12.42 ? 104  LEU C CD1 1 
ATOM   3904 C  CD2 . LEU C  1 81  ? 3.908   23.093 -9.438  1.00 17.18 ? 104  LEU C CD2 1 
ATOM   3905 N  N   . ASN C  1 82  ? -0.466  25.967 -10.347 1.00 12.68 ? 105  ASN C N   1 
ATOM   3906 C  CA  . ASN C  1 82  ? -1.482  26.953 -9.990  1.00 16.08 ? 105  ASN C CA  1 
ATOM   3907 C  C   . ASN C  1 82  ? -1.889  26.830 -8.506  1.00 13.49 ? 105  ASN C C   1 
ATOM   3908 O  O   . ASN C  1 82  ? -2.049  25.727 -7.970  1.00 11.53 ? 105  ASN C O   1 
ATOM   3909 C  CB  . ASN C  1 82  ? -2.702  26.816 -10.912 1.00 18.03 ? 105  ASN C CB  1 
ATOM   3910 C  CG  . ASN C  1 82  ? -3.587  28.063 -10.919 1.00 18.74 ? 105  ASN C CG  1 
ATOM   3911 O  OD1 . ASN C  1 82  ? -3.103  29.186 -10.806 1.00 20.13 ? 105  ASN C OD1 1 
ATOM   3912 N  ND2 . ASN C  1 82  ? -4.891  27.860 -11.052 1.00 18.20 ? 105  ASN C ND2 1 
ATOM   3913 N  N   . ASN C  1 83  ? -2.056  27.975 -7.844  1.00 14.92 ? 106  ASN C N   1 
ATOM   3914 C  CA  . ASN C  1 83  ? -2.424  28.017 -6.429  1.00 17.22 ? 106  ASN C CA  1 
ATOM   3915 C  C   . ASN C  1 83  ? -1.337  27.387 -5.548  1.00 13.16 ? 106  ASN C C   1 
ATOM   3916 O  O   . ASN C  1 83  ? -1.623  26.623 -4.636  1.00 14.12 ? 106  ASN C O   1 
ATOM   3917 C  CB  . ASN C  1 83  ? -3.798  27.366 -6.152  1.00 15.63 ? 106  ASN C CB  1 
ATOM   3918 C  CG  . ASN C  1 83  ? -4.918  27.918 -7.049  1.00 25.78 ? 106  ASN C CG  1 
ATOM   3919 O  OD1 . ASN C  1 83  ? -5.617  27.154 -7.718  1.00 25.41 ? 106  ASN C OD1 1 
ATOM   3920 N  ND2 . ASN C  1 83  ? -5.090  29.233 -7.058  1.00 17.29 ? 106  ASN C ND2 1 
ATOM   3921 N  N   . ASP C  1 84  ? -0.082  27.714 -5.845  1.00 13.62 ? 107  ASP C N   1 
ATOM   3922 C  CA  . ASP C  1 84  ? 1.042   27.172 -5.071  1.00 15.81 ? 107  ASP C CA  1 
ATOM   3923 C  C   . ASP C  1 84  ? 1.253   27.947 -3.749  1.00 11.64 ? 107  ASP C C   1 
ATOM   3924 O  O   . ASP C  1 84  ? 2.212   28.726 -3.586  1.00 12.86 ? 107  ASP C O   1 
ATOM   3925 C  CB  . ASP C  1 84  ? 2.300   27.139 -5.948  1.00 13.24 ? 107  ASP C CB  1 
ATOM   3926 C  CG  . ASP C  1 84  ? 3.446   26.358 -5.315  1.00 11.62 ? 107  ASP C CG  1 
ATOM   3927 O  OD1 . ASP C  1 84  ? 3.223   25.629 -4.327  1.00 11.17 ? 107  ASP C OD1 1 
ATOM   3928 O  OD2 . ASP C  1 84  ? 4.570   26.487 -5.814  1.00 13.89 ? 107  ASP C OD2 1 
ATOM   3929 N  N   . ILE C  1 85  ? 0.329   27.719 -2.822  1.00 11.88 ? 108  ILE C N   1 
ATOM   3930 C  CA  . ILE C  1 85  ? 0.363   28.404 -1.525  1.00 14.43 ? 108  ILE C CA  1 
ATOM   3931 C  C   . ILE C  1 85  ? -0.079  27.460 -0.415  1.00 14.86 ? 108  ILE C C   1 
ATOM   3932 O  O   . ILE C  1 85  ? -0.963  26.623 -0.596  1.00 13.88 ? 108  ILE C O   1 
ATOM   3933 C  CB  . ILE C  1 85  ? -0.495  29.700 -1.549  1.00 12.72 ? 108  ILE C CB  1 
ATOM   3934 C  CG1 . ILE C  1 85  ? -0.367  30.482 -0.221  1.00 20.01 ? 108  ILE C CG1 1 
ATOM   3935 C  CG2 . ILE C  1 85  ? -1.961  29.364 -1.842  1.00 16.35 ? 108  ILE C CG2 1 
ATOM   3936 C  CD1 . ILE C  1 85  ? -1.045  31.898 -0.230  1.00 14.27 ? 108  ILE C CD1 1 
ATOM   3937 N  N   . MET C  1 86  ? 0.545   27.602 0.752   1.00 17.69 ? 109  MET C N   1 
ATOM   3938 C  CA  . MET C  1 86  ? 0.235   26.764 1.895   1.00 16.73 ? 109  MET C CA  1 
ATOM   3939 C  C   . MET C  1 86  ? 0.280   27.647 3.126   1.00 14.77 ? 109  MET C C   1 
ATOM   3940 O  O   . MET C  1 86  ? 1.109   28.547 3.225   1.00 15.98 ? 109  MET C O   1 
ATOM   3941 C  CB  . MET C  1 86  ? 1.243   25.599 2.006   1.00 15.34 ? 109  MET C CB  1 
ATOM   3942 C  CG  . MET C  1 86  ? 1.328   24.934 3.382   1.00 22.26 ? 109  MET C CG  1 
ATOM   3943 S  SD  . MET C  1 86  ? 2.418   23.484 3.408   1.00 19.28 ? 109  MET C SD  1 
ATOM   3944 C  CE  . MET C  1 86  ? 4.050   24.248 3.340   1.00 17.23 ? 109  MET C CE  1 
ATOM   3945 N  N   . LEU C  1 87  ? -0.643  27.407 4.046   1.00 14.78 ? 110  LEU C N   1 
ATOM   3946 C  CA  . LEU C  1 87  ? -0.633  28.093 5.344   1.00 19.62 ? 110  LEU C CA  1 
ATOM   3947 C  C   . LEU C  1 87  ? -0.210  27.114 6.437   1.00 18.21 ? 110  LEU C C   1 
ATOM   3948 O  O   . LEU C  1 87  ? -0.742  26.000 6.515   1.00 19.73 ? 110  LEU C O   1 
ATOM   3949 C  CB  . LEU C  1 87  ? -2.030  28.626 5.643   1.00 19.10 ? 110  LEU C CB  1 
ATOM   3950 C  CG  . LEU C  1 87  ? -2.386  29.980 5.026   1.00 24.34 ? 110  LEU C CG  1 
ATOM   3951 C  CD1 . LEU C  1 87  ? -3.848  30.349 5.290   1.00 25.56 ? 110  LEU C CD1 1 
ATOM   3952 C  CD2 . LEU C  1 87  ? -1.471  31.058 5.574   1.00 25.89 ? 110  LEU C CD2 1 
ATOM   3953 N  N   . ILE C  1 88  ? 0.758   27.515 7.272   1.00 17.51 ? 111  ILE C N   1 
ATOM   3954 C  CA  . ILE C  1 88  ? 1.163   26.671 8.392   1.00 18.01 ? 111  ILE C CA  1 
ATOM   3955 C  C   . ILE C  1 88  ? 0.823   27.347 9.705   1.00 15.91 ? 111  ILE C C   1 
ATOM   3956 O  O   . ILE C  1 88  ? 1.189   28.510 9.930   1.00 16.66 ? 111  ILE C O   1 
ATOM   3957 C  CB  . ILE C  1 88  ? 2.675   26.368 8.380   1.00 19.69 ? 111  ILE C CB  1 
ATOM   3958 C  CG1 . ILE C  1 88  ? 3.042   25.402 7.250   1.00 17.09 ? 111  ILE C CG1 1 
ATOM   3959 C  CG2 . ILE C  1 88  ? 3.119   25.758 9.711   1.00 20.52 ? 111  ILE C CG2 1 
ATOM   3960 C  CD1 . ILE C  1 88  ? 4.540   25.369 6.976   1.00 20.23 ? 111  ILE C CD1 1 
ATOM   3961 N  N   . LYS C  1 89  ? 0.120   26.616 10.563  1.00 14.66 ? 112  LYS C N   1 
ATOM   3962 C  CA  . LYS C  1 89  ? -0.134  27.103 11.923  1.00 18.60 ? 112  LYS C CA  1 
ATOM   3963 C  C   . LYS C  1 89  ? 0.876   26.556 12.913  1.00 16.12 ? 112  LYS C C   1 
ATOM   3964 O  O   . LYS C  1 89  ? 1.101   25.345 13.004  1.00 21.56 ? 112  LYS C O   1 
ATOM   3965 C  CB  . LYS C  1 89  ? -1.542  26.740 12.387  1.00 20.54 ? 112  LYS C CB  1 
ATOM   3966 C  CG  . LYS C  1 89  ? -1.960  27.432 13.716  1.00 24.93 ? 112  LYS C CG  1 
ATOM   3967 C  CD  . LYS C  1 89  ? -2.962  26.562 14.491  1.00 28.76 ? 112  LYS C CD  1 
ATOM   3968 C  CE  . LYS C  1 89  ? -3.804  27.389 15.466  1.00 37.62 ? 112  LYS C CE  1 
ATOM   3969 N  NZ  . LYS C  1 89  ? -4.926  26.580 16.036  1.00 42.10 ? 112  LYS C NZ  1 
ATOM   3970 N  N   . LEU C  1 90  ? 1.484   27.464 13.667  1.00 20.24 ? 113  LEU C N   1 
ATOM   3971 C  CA  . LEU C  1 90  ? 2.422   27.104 14.725  1.00 17.56 ? 113  LEU C CA  1 
ATOM   3972 C  C   . LEU C  1 90  ? 1.690   26.539 15.936  1.00 21.45 ? 113  LEU C C   1 
ATOM   3973 O  O   . LEU C  1 90  ? 0.638   27.049 16.320  1.00 21.49 ? 113  LEU C O   1 
ATOM   3974 C  CB  . LEU C  1 90  ? 3.197   28.343 15.166  1.00 14.16 ? 113  LEU C CB  1 
ATOM   3975 C  CG  . LEU C  1 90  ? 3.840   29.151 14.047  1.00 16.97 ? 113  LEU C CG  1 
ATOM   3976 C  CD1 . LEU C  1 90  ? 4.591   30.351 14.621  1.00 21.21 ? 113  LEU C CD1 1 
ATOM   3977 C  CD2 . LEU C  1 90  ? 4.775   28.260 13.254  1.00 18.15 ? 113  LEU C CD2 1 
ATOM   3978 N  N   . LYS C  1 91  ? 2.260   25.493 16.529  1.00 20.93 ? 114  LYS C N   1 
ATOM   3979 C  CA  . LYS C  1 91  ? 1.735   24.861 17.739  1.00 24.30 ? 114  LYS C CA  1 
ATOM   3980 C  C   . LYS C  1 91  ? 1.555   25.867 18.883  1.00 22.55 ? 114  LYS C C   1 
ATOM   3981 O  O   . LYS C  1 91  ? 0.590   25.803 19.655  1.00 23.72 ? 114  LYS C O   1 
ATOM   3982 C  CB  . LYS C  1 91  ? 2.693   23.758 18.183  1.00 26.80 ? 114  LYS C CB  1 
ATOM   3983 C  CG  . LYS C  1 91  ? 2.060   22.692 19.059  1.00 31.90 ? 114  LYS C CG  1 
ATOM   3984 C  CD  . LYS C  1 91  ? 3.143   21.864 19.739  1.00 38.02 ? 114  LYS C CD  1 
ATOM   3985 C  CE  . LYS C  1 91  ? 2.572   20.651 20.451  1.00 45.03 ? 114  LYS C CE  1 
ATOM   3986 N  NZ  . LYS C  1 91  ? 3.669   19.735 20.893  1.00 48.36 ? 114  LYS C NZ  1 
ATOM   3987 N  N   . SER C  1 92  ? 2.488   26.804 18.990  1.00 15.53 ? 115  SER C N   1 
ATOM   3988 C  CA  . SER C  1 92  ? 2.403   27.867 19.990  1.00 24.03 ? 115  SER C CA  1 
ATOM   3989 C  C   . SER C  1 92  ? 2.769   29.194 19.352  1.00 22.10 ? 115  SER C C   1 
ATOM   3990 O  O   . SER C  1 92  ? 3.447   29.239 18.321  1.00 22.08 ? 115  SER C O   1 
ATOM   3991 C  CB  . SER C  1 92  ? 3.293   27.561 21.213  1.00 29.67 ? 115  SER C CB  1 
ATOM   3992 O  OG  . SER C  1 92  ? 4.685   27.658 20.923  1.00 27.70 ? 115  SER C OG  1 
ATOM   3993 N  N   . ALA C  1 93  ? 2.293   30.280 19.938  1.00 17.37 ? 116  ALA C N   1 
ATOM   3994 C  CA  . ALA C  1 93  ? 2.555   31.594 19.385  1.00 23.03 ? 116  ALA C CA  1 
ATOM   3995 C  C   . ALA C  1 93  ? 4.049   31.903 19.484  1.00 18.23 ? 116  ALA C C   1 
ATOM   3996 O  O   . ALA C  1 93  ? 4.673   31.695 20.517  1.00 20.89 ? 116  ALA C O   1 
ATOM   3997 C  CB  . ALA C  1 93  ? 1.731   32.663 20.115  1.00 23.51 ? 116  ALA C CB  1 
ATOM   3998 N  N   . ALA C  1 94  ? 4.613   32.403 18.395  1.00 21.17 ? 117  ALA C N   1 
ATOM   3999 C  CA  . ALA C  1 94  ? 5.979   32.904 18.426  1.00 20.38 ? 117  ALA C CA  1 
ATOM   4000 C  C   . ALA C  1 94  ? 6.039   34.173 19.261  1.00 19.53 ? 117  ALA C C   1 
ATOM   4001 O  O   . ALA C  1 94  ? 5.046   34.908 19.379  1.00 20.64 ? 117  ALA C O   1 
ATOM   4002 C  CB  . ALA C  1 94  ? 6.465   33.188 17.011  1.00 22.49 ? 117  ALA C CB  1 
ATOM   4003 N  N   . SER C  1 95  ? 7.213   34.439 19.819  1.00 20.80 ? 118  SER C N   1 
ATOM   4004 C  CA  . SER C  1 95  ? 7.461   35.667 20.556  1.00 18.15 ? 118  SER C CA  1 
ATOM   4005 C  C   . SER C  1 95  ? 8.029   36.716 19.622  1.00 19.06 ? 118  SER C C   1 
ATOM   4006 O  O   . SER C  1 95  ? 9.204   36.629 19.250  1.00 21.94 ? 118  SER C O   1 
ATOM   4007 C  CB  . SER C  1 95  ? 8.465   35.395 21.686  1.00 18.25 ? 118  SER C CB  1 
ATOM   4008 O  OG  . SER C  1 95  ? 7.848   34.654 22.720  1.00 24.52 ? 118  SER C OG  1 
ATOM   4009 N  N   . LEU C  1 96  ? 7.223   37.706 19.231  1.00 19.43 ? 119  LEU C N   1 
ATOM   4010 C  CA  . LEU C  1 96  ? 7.715   38.702 18.275  1.00 19.82 ? 119  LEU C CA  1 
ATOM   4011 C  C   . LEU C  1 96  ? 8.615   39.762 18.911  1.00 22.28 ? 119  LEU C C   1 
ATOM   4012 O  O   . LEU C  1 96  ? 8.307   40.306 19.974  1.00 24.38 ? 119  LEU C O   1 
ATOM   4013 C  CB  . LEU C  1 96  ? 6.575   39.331 17.443  1.00 22.41 ? 119  LEU C CB  1 
ATOM   4014 C  CG  . LEU C  1 96  ? 5.669   38.295 16.772  1.00 23.38 ? 119  LEU C CG  1 
ATOM   4015 C  CD1 . LEU C  1 96  ? 4.718   38.897 15.745  1.00 24.85 ? 119  LEU C CD1 1 
ATOM   4016 C  CD2 . LEU C  1 96  ? 6.506   37.231 16.116  1.00 23.16 ? 119  LEU C CD2 1 
ATOM   4017 N  N   . ASN C  1 97  ? 9.732   40.042 18.239  1.00 16.85 ? 120  ASN C N   1 
ATOM   4018 C  CA  . ASN C  1 97  ? 10.747  40.965 18.728  1.00 20.64 ? 120  ASN C CA  1 
ATOM   4019 C  C   . ASN C  1 97  ? 11.503  41.591 17.554  1.00 18.91 ? 120  ASN C C   1 
ATOM   4020 O  O   . ASN C  1 97  ? 11.127  41.386 16.390  1.00 19.84 ? 120  ASN C O   1 
ATOM   4021 C  CB  . ASN C  1 97  ? 11.684  40.231 19.696  1.00 21.00 ? 120  ASN C CB  1 
ATOM   4022 C  CG  . ASN C  1 97  ? 12.374  39.040 19.043  1.00 21.25 ? 120  ASN C CG  1 
ATOM   4023 O  OD1 . ASN C  1 97  ? 12.947  39.174 17.959  1.00 23.86 ? 120  ASN C OD1 1 
ATOM   4024 N  ND2 . ASN C  1 97  ? 12.294  37.868 19.680  1.00 22.03 ? 120  ASN C ND2 1 
ATOM   4025 N  N   . SER C  1 98  ? 12.577  42.330 17.832  1.00 20.56 ? 121  SER C N   1 
ATOM   4026 C  CA  . SER C  1 98  ? 13.297  43.028 16.752  1.00 23.22 ? 121  SER C CA  1 
ATOM   4027 C  C   . SER C  1 98  ? 13.850  42.075 15.692  1.00 29.52 ? 121  SER C C   1 
ATOM   4028 O  O   . SER C  1 98  ? 14.101  42.482 14.542  1.00 22.25 ? 121  SER C O   1 
ATOM   4029 C  CB  . SER C  1 98  ? 14.453  43.864 17.309  1.00 24.83 ? 121  SER C CB  1 
ATOM   4030 O  OG  . SER C  1 98  ? 15.351  43.053 18.041  1.00 28.91 ? 121  SER C OG  1 
ATOM   4031 N  N   . ARG C  1 99  ? 14.038  40.815 16.082  1.00 21.35 ? 122  ARG C N   1 
ATOM   4032 C  CA  . ARG C  1 99  ? 14.627  39.820 15.184  1.00 17.22 ? 122  ARG C CA  1 
ATOM   4033 C  C   . ARG C  1 99  ? 13.628  38.777 14.644  1.00 22.38 ? 122  ARG C C   1 
ATOM   4034 O  O   . ARG C  1 99  ? 13.953  38.014 13.723  1.00 22.05 ? 122  ARG C O   1 
ATOM   4035 C  CB  . ARG C  1 99  ? 15.823  39.159 15.888  1.00 18.52 ? 122  ARG C CB  1 
ATOM   4036 C  CG  . ARG C  1 99  ? 16.830  40.201 16.377  1.00 23.59 ? 122  ARG C CG  1 
ATOM   4037 C  CD  . ARG C  1 99  ? 18.180  39.584 16.624  1.00 31.39 ? 122  ARG C CD  1 
ATOM   4038 N  NE  . ARG C  1 99  ? 19.156  40.502 17.217  1.00 32.83 ? 122  ARG C NE  1 
ATOM   4039 C  CZ  . ARG C  1 99  ? 20.344  40.785 16.683  1.00 36.25 ? 122  ARG C CZ  1 
ATOM   4040 N  NH1 . ARG C  1 99  ? 20.716  40.239 15.524  1.00 27.22 ? 122  ARG C NH1 1 
ATOM   4041 N  NH2 . ARG C  1 99  ? 21.163  41.627 17.306  1.00 32.14 ? 122  ARG C NH2 1 
ATOM   4042 N  N   . VAL C  1 100 ? 12.413  38.776 15.199  1.00 17.27 ? 123  VAL C N   1 
ATOM   4043 C  CA  . VAL C  1 100 ? 11.321  37.892 14.772  1.00 18.09 ? 123  VAL C CA  1 
ATOM   4044 C  C   . VAL C  1 100 ? 10.032  38.714 14.566  1.00 22.11 ? 123  VAL C C   1 
ATOM   4045 O  O   . VAL C  1 100 ? 9.384   39.112 15.533  1.00 22.44 ? 123  VAL C O   1 
ATOM   4046 C  CB  . VAL C  1 100 ? 11.083  36.747 15.802  1.00 20.97 ? 123  VAL C CB  1 
ATOM   4047 C  CG1 . VAL C  1 100 ? 9.868   35.868 15.418  1.00 17.89 ? 123  VAL C CG1 1 
ATOM   4048 C  CG2 . VAL C  1 100 ? 12.330  35.885 15.925  1.00 16.40 ? 123  VAL C CG2 1 
ATOM   4049 N  N   . ALA C  1 101 ? 9.679   38.972 13.306  1.00 17.58 ? 124  ALA C N   1 
ATOM   4050 C  CA  . ALA C  1 101 ? 8.600   39.905 12.979  1.00 20.41 ? 124  ALA C CA  1 
ATOM   4051 C  C   . ALA C  1 101 ? 7.642   39.342 11.918  1.00 20.32 ? 124  ALA C C   1 
ATOM   4052 O  O   . ALA C  1 101 ? 8.005   38.441 11.167  1.00 16.90 ? 124  ALA C O   1 
ATOM   4053 C  CB  . ALA C  1 101 ? 9.198   41.245 12.510  1.00 15.13 ? 124  ALA C CB  1 
ATOM   4054 N  N   . SER C  1 102 ? 6.416   39.852 11.874  1.00 16.54 ? 125  SER C N   1 
ATOM   4055 C  CA  . SER C  1 102 ? 5.481   39.457 10.836  1.00 21.80 ? 125  SER C CA  1 
ATOM   4056 C  C   . SER C  1 102 ? 5.604   40.424 9.660   1.00 24.89 ? 125  SER C C   1 
ATOM   4057 O  O   . SER C  1 102 ? 6.115   41.540 9.799   1.00 24.00 ? 125  SER C O   1 
ATOM   4058 C  CB  . SER C  1 102 ? 4.052   39.433 11.385  1.00 22.77 ? 125  SER C CB  1 
ATOM   4059 O  OG  . SER C  1 102 ? 3.714   40.711 11.901  1.00 23.26 ? 125  SER C OG  1 
ATOM   4060 N  N   . ILE C  1 103 ? 5.165   39.984 8.488   1.00 20.14 ? 126  ILE C N   1 
ATOM   4061 C  CA  . ILE C  1 103 ? 5.122   40.859 7.338   1.00 19.97 ? 126  ILE C CA  1 
ATOM   4062 C  C   . ILE C  1 103 ? 3.647   41.063 7.003   1.00 20.27 ? 126  ILE C C   1 
ATOM   4063 O  O   . ILE C  1 103 ? 2.829   40.151 7.191   1.00 20.13 ? 126  ILE C O   1 
ATOM   4064 C  CB  . ILE C  1 103 ? 5.902   40.267 6.135   1.00 22.50 ? 126  ILE C CB  1 
ATOM   4065 C  CG1 . ILE C  1 103 ? 5.923   41.248 4.956   1.00 18.82 ? 126  ILE C CG1 1 
ATOM   4066 C  CG2 . ILE C  1 103 ? 5.312   38.926 5.723   1.00 22.25 ? 126  ILE C CG2 1 
ATOM   4067 C  CD1 . ILE C  1 103 ? 6.791   42.487 5.177   1.00 22.22 ? 126  ILE C CD1 1 
ATOM   4068 N  N   . SER C  1 104 ? 3.303   42.272 6.557   1.00 21.01 ? 127  SER C N   1 
ATOM   4069 C  CA  . SER C  1 104 ? 1.933   42.579 6.180   1.00 22.25 ? 127  SER C CA  1 
ATOM   4070 C  C   . SER C  1 104 ? 1.522   41.925 4.867   1.00 20.40 ? 127  SER C C   1 
ATOM   4071 O  O   . SER C  1 104 ? 2.304   41.855 3.916   1.00 23.46 ? 127  SER C O   1 
ATOM   4072 C  CB  . SER C  1 104 ? 1.732   44.094 6.060   1.00 25.18 ? 127  SER C CB  1 
ATOM   4073 O  OG  . SER C  1 104 ? 1.932   44.719 7.319   1.00 30.87 ? 127  SER C OG  1 
ATOM   4074 N  N   . LEU C  1 105 ? 0.283   41.466 4.835   1.00 19.80 ? 128  LEU C N   1 
ATOM   4075 C  CA  . LEU C  1 105 ? -0.357  41.030 3.603   1.00 21.29 ? 128  LEU C CA  1 
ATOM   4076 C  C   . LEU C  1 105 ? -0.709  42.257 2.749   1.00 24.61 ? 128  LEU C C   1 
ATOM   4077 O  O   . LEU C  1 105 ? -0.911  43.357 3.274   1.00 28.22 ? 128  LEU C O   1 
ATOM   4078 C  CB  . LEU C  1 105 ? -1.631  40.248 3.943   1.00 20.48 ? 128  LEU C CB  1 
ATOM   4079 C  CG  . LEU C  1 105 ? -1.442  38.886 4.591   1.00 25.20 ? 128  LEU C CG  1 
ATOM   4080 C  CD1 . LEU C  1 105 ? -2.792  38.253 4.829   1.00 26.74 ? 128  LEU C CD1 1 
ATOM   4081 C  CD2 . LEU C  1 105 ? -0.545  37.978 3.733   1.00 25.42 ? 128  LEU C CD2 1 
ATOM   4082 N  N   . PRO C  1 106 ? -0.792  42.069 1.427   1.00 22.47 ? 129  PRO C N   1 
ATOM   4083 C  CA  . PRO C  1 106 ? -1.093  43.169 0.496   1.00 22.87 ? 129  PRO C CA  1 
ATOM   4084 C  C   . PRO C  1 106 ? -2.528  43.660 0.633   1.00 24.82 ? 129  PRO C C   1 
ATOM   4085 O  O   . PRO C  1 106 ? -3.418  42.876 0.999   1.00 24.51 ? 129  PRO C O   1 
ATOM   4086 C  CB  . PRO C  1 106 ? -0.912  42.536 -0.895  1.00 19.64 ? 129  PRO C CB  1 
ATOM   4087 C  CG  . PRO C  1 106 ? -0.370  41.161 -0.675  1.00 19.29 ? 129  PRO C CG  1 
ATOM   4088 C  CD  . PRO C  1 106 ? -0.565  40.778 0.750   1.00 16.48 ? 129  PRO C CD  1 
ATOM   4089 N  N   . THR C  1 107 ? -2.751  44.944 0.356   1.00 27.84 ? 130  THR C N   1 
ATOM   4090 C  CA  . THR C  1 107 ? -4.116  45.438 0.216   1.00 27.15 ? 130  THR C CA  1 
ATOM   4091 C  C   . THR C  1 107 ? -4.525  45.331 -1.269  1.00 23.52 ? 130  THR C C   1 
ATOM   4092 O  O   . THR C  1 107 ? -5.670  44.989 -1.595  1.00 28.35 ? 130  THR C O   1 
ATOM   4093 C  CB  . THR C  1 107 ? -4.301  46.868 0.824   1.00 32.97 ? 130  THR C CB  1 
ATOM   4094 O  OG1 . THR C  1 107 ? -3.517  47.832 0.109   1.00 31.62 ? 130  THR C OG1 1 
ATOM   4095 C  CG2 . THR C  1 107 ? -3.889  46.880 2.292   1.00 35.12 ? 130  THR C CG2 1 
ATOM   4096 N  N   A SER C  1 108 ? -3.568  45.615 -2.148  0.72 24.40 ? 131  SER C N   1 
ATOM   4097 N  N   B SER C  1 108 ? -3.571  45.596 -2.153  0.28 24.41 ? 131  SER C N   1 
ATOM   4098 C  CA  A SER C  1 108 ? -3.753  45.507 -3.594  0.72 21.97 ? 131  SER C CA  1 
ATOM   4099 C  CA  B SER C  1 108 ? -3.786  45.455 -3.587  0.28 22.08 ? 131  SER C CA  1 
ATOM   4100 C  C   A SER C  1 108 ? -2.563  44.769 -4.198  0.72 23.35 ? 131  SER C C   1 
ATOM   4101 C  C   B SER C  1 108 ? -2.564  44.793 -4.210  0.28 23.34 ? 131  SER C C   1 
ATOM   4102 O  O   A SER C  1 108 ? -1.501  44.691 -3.577  0.72 21.83 ? 131  SER C O   1 
ATOM   4103 O  O   B SER C  1 108 ? -1.487  44.784 -3.614  0.28 21.89 ? 131  SER C O   1 
ATOM   4104 C  CB  A SER C  1 108 ? -3.827  46.900 -4.229  0.72 24.93 ? 131  SER C CB  1 
ATOM   4105 C  CB  B SER C  1 108 ? -3.998  46.826 -4.228  0.28 24.76 ? 131  SER C CB  1 
ATOM   4106 O  OG  A SER C  1 108 ? -4.893  47.663 -3.707  0.72 20.08 ? 131  SER C OG  1 
ATOM   4107 O  OG  B SER C  1 108 ? -2.761  47.514 -4.339  0.28 21.16 ? 131  SER C OG  1 
ATOM   4108 N  N   . CYS C  1 109 ? -2.726  44.248 -5.410  1.00 21.09 ? 132  CYS C N   1 
ATOM   4109 C  CA  . CYS C  1 109 ? -1.605  43.653 -6.129  1.00 20.68 ? 132  CYS C CA  1 
ATOM   4110 C  C   . CYS C  1 109 ? -0.614  44.732 -6.544  1.00 25.69 ? 132  CYS C C   1 
ATOM   4111 O  O   . CYS C  1 109 ? -0.988  45.880 -6.791  1.00 32.33 ? 132  CYS C O   1 
ATOM   4112 C  CB  . CYS C  1 109 ? -2.096  42.888 -7.371  1.00 18.71 ? 132  CYS C CB  1 
ATOM   4113 S  SG  . CYS C  1 109 ? -3.380  41.676 -7.005  1.00 31.68 ? 132  CYS C SG  1 
ATOM   4114 N  N   . ALA C  1 110 ? 0.659   44.366 -6.606  1.00 24.25 ? 133  ALA C N   1 
ATOM   4115 C  CA  . ALA C  1 110 ? 1.693   45.288 -7.037  1.00 27.82 ? 133  ALA C CA  1 
ATOM   4116 C  C   . ALA C  1 110 ? 1.771   45.404 -8.559  1.00 31.57 ? 133  ALA C C   1 
ATOM   4117 O  O   . ALA C  1 110 ? 1.280   44.540 -9.288  1.00 34.11 ? 133  ALA C O   1 
ATOM   4118 C  CB  . ALA C  1 110 ? 3.047   44.880 -6.452  1.00 30.93 ? 133  ALA C CB  1 
ATOM   4119 N  N   . SER C  1 111 ? 2.402   46.478 -9.026  1.00 23.60 ? 134  SER C N   1 
ATOM   4120 C  CA  . SER C  1 111 ? 2.452   46.783 -10.445 1.00 32.66 ? 134  SER C CA  1 
ATOM   4121 C  C   . SER C  1 111 ? 3.820   46.453 -11.008 1.00 33.19 ? 134  SER C C   1 
ATOM   4122 O  O   . SER C  1 111 ? 4.815   46.396 -10.276 1.00 30.69 ? 134  SER C O   1 
ATOM   4123 C  CB  . SER C  1 111 ? 2.132   48.266 -10.682 1.00 38.10 ? 134  SER C CB  1 
ATOM   4124 O  OG  . SER C  1 111 ? 3.161   49.116 -10.187 1.00 36.66 ? 134  SER C OG  1 
ATOM   4125 N  N   . ALA C  1 112 ? 3.861   46.224 -12.315 1.00 24.37 ? 135  ALA C N   1 
ATOM   4126 C  CA  . ALA C  1 112 ? 5.113   45.996 -13.014 1.00 26.03 ? 135  ALA C CA  1 
ATOM   4127 C  C   . ALA C  1 112 ? 6.084   47.118 -12.679 1.00 32.68 ? 135  ALA C C   1 
ATOM   4128 O  O   . ALA C  1 112 ? 5.693   48.286 -12.630 1.00 25.78 ? 135  ALA C O   1 
ATOM   4129 C  CB  . ALA C  1 112 ? 4.863   45.939 -14.518 1.00 26.51 ? 135  ALA C CB  1 
ATOM   4130 N  N   . GLY C  1 113 ? 7.337   46.762 -12.420 1.00 20.28 ? 136  GLY C N   1 
ATOM   4131 C  CA  . GLY C  1 113 ? 8.376   47.745 -12.145 1.00 29.97 ? 136  GLY C CA  1 
ATOM   4132 C  C   . GLY C  1 113 ? 8.693   47.964 -10.672 1.00 26.38 ? 136  GLY C C   1 
ATOM   4133 O  O   . GLY C  1 113 ? 9.778   48.448 -10.331 1.00 28.35 ? 136  GLY C O   1 
ATOM   4134 N  N   . THR C  1 114 ? 7.745   47.634 -9.800  1.00 25.93 ? 137  THR C N   1 
ATOM   4135 C  CA  . THR C  1 114 ? 7.954   47.753 -8.353  1.00 23.45 ? 137  THR C CA  1 
ATOM   4136 C  C   . THR C  1 114 ? 9.147   46.912 -7.887  1.00 29.19 ? 137  THR C C   1 
ATOM   4137 O  O   . THR C  1 114 ? 9.295   45.760 -8.300  1.00 24.78 ? 137  THR C O   1 
ATOM   4138 C  CB  . THR C  1 114 ? 6.710   47.292 -7.586  1.00 27.78 ? 137  THR C CB  1 
ATOM   4139 O  OG1 . THR C  1 114 ? 5.553   47.953 -8.113  1.00 29.90 ? 137  THR C OG1 1 
ATOM   4140 C  CG2 . THR C  1 114 ? 6.850   47.602 -6.098  1.00 29.15 ? 137  THR C CG2 1 
ATOM   4141 N  N   . GLN C  1 115 ? 9.991   47.490 -7.030  1.00 25.56 ? 138  GLN C N   1 
ATOM   4142 C  CA  . GLN C  1 115 ? 11.145  46.779 -6.488  1.00 26.93 ? 138  GLN C CA  1 
ATOM   4143 C  C   . GLN C  1 115 ? 10.753  45.916 -5.288  1.00 27.69 ? 138  GLN C C   1 
ATOM   4144 O  O   . GLN C  1 115 ? 9.961   46.325 -4.421  1.00 22.93 ? 138  GLN C O   1 
ATOM   4145 C  CB  . GLN C  1 115 ? 12.264  47.753 -6.102  1.00 24.12 ? 138  GLN C CB  1 
ATOM   4146 C  CG  . GLN C  1 115 ? 12.865  48.481 -7.291  1.00 36.10 ? 138  GLN C CG  1 
ATOM   4147 C  CD  . GLN C  1 115 ? 13.761  47.585 -8.135  1.00 39.36 ? 138  GLN C CD  1 
ATOM   4148 O  OE1 . GLN C  1 115 ? 14.418  46.676 -7.619  1.00 41.81 ? 138  GLN C OE1 1 
ATOM   4149 N  NE2 . GLN C  1 115 ? 13.799  47.844 -9.440  1.00 39.63 ? 138  GLN C NE2 1 
ATOM   4150 N  N   . CYS C  1 116 ? 11.295  44.706 -5.253  1.00 22.22 ? 139  CYS C N   1 
ATOM   4151 C  CA  . CYS C  1 116 ? 10.976  43.784 -4.160  1.00 17.58 ? 139  CYS C CA  1 
ATOM   4152 C  C   . CYS C  1 116 ? 12.232  43.196 -3.564  1.00 20.82 ? 139  CYS C C   1 
ATOM   4153 O  O   . CYS C  1 116 ? 13.303  43.249 -4.179  1.00 22.50 ? 139  CYS C O   1 
ATOM   4154 C  CB  . CYS C  1 116 ? 10.074  42.645 -4.631  1.00 25.26 ? 139  CYS C CB  1 
ATOM   4155 S  SG  . CYS C  1 116 ? 8.676   43.216 -5.597  1.00 28.34 ? 139  CYS C SG  1 
ATOM   4156 N  N   . LEU C  1 117 ? 12.083  42.622 -2.368  1.00 21.64 ? 140  LEU C N   1 
ATOM   4157 C  CA  . LEU C  1 117 ? 13.168  41.906 -1.712  1.00 19.76 ? 140  LEU C CA  1 
ATOM   4158 C  C   . LEU C  1 117 ? 12.808  40.423 -1.643  1.00 11.02 ? 140  LEU C C   1 
ATOM   4159 O  O   . LEU C  1 117 ? 11.767  40.067 -1.136  1.00 11.14 ? 140  LEU C O   1 
ATOM   4160 C  CB  . LEU C  1 117 ? 13.427  42.462 -0.307  1.00 17.90 ? 140  LEU C CB  1 
ATOM   4161 C  CG  . LEU C  1 117 ? 14.588  41.782 0.428   1.00 20.95 ? 140  LEU C CG  1 
ATOM   4162 C  CD1 . LEU C  1 117 ? 15.914  42.115 -0.265  1.00 23.12 ? 140  LEU C CD1 1 
ATOM   4163 C  CD2 . LEU C  1 117 ? 14.608  42.145 1.909   1.00 24.53 ? 140  LEU C CD2 1 
ATOM   4164 N  N   . ILE C  1 118 ? 13.664  39.590 -2.225  1.00 16.27 ? 141  ILE C N   1 
ATOM   4165 C  CA  . ILE C  1 118 ? 13.488  38.149 -2.193  1.00 19.10 ? 141  ILE C CA  1 
ATOM   4166 C  C   . ILE C  1 118 ? 14.646  37.584 -1.378  1.00 15.51 ? 141  ILE C C   1 
ATOM   4167 O  O   . ILE C  1 118 ? 15.780  38.020 -1.547  1.00 16.14 ? 141  ILE C O   1 
ATOM   4168 C  CB  . ILE C  1 118 ? 13.564  37.608 -3.622  1.00 16.68 ? 141  ILE C CB  1 
ATOM   4169 C  CG1 . ILE C  1 118 ? 12.674  38.456 -4.535  1.00 13.03 ? 141  ILE C CG1 1 
ATOM   4170 C  CG2 . ILE C  1 118 ? 13.175  36.121 -3.656  1.00 14.89 ? 141  ILE C CG2 1 
ATOM   4171 C  CD1 . ILE C  1 118 ? 12.787  38.105 -6.047  1.00 13.80 ? 141  ILE C CD1 1 
ATOM   4172 N  N   . SER C  1 119 ? 14.388  36.602 -0.519  1.00 13.33 ? 142  SER C N   1 
ATOM   4173 C  CA  . SER C  1 119 ? 15.408  36.152 0.436   1.00 13.23 ? 142  SER C CA  1 
ATOM   4174 C  C   . SER C  1 119 ? 15.347  34.650 0.677   1.00 12.10 ? 142  SER C C   1 
ATOM   4175 O  O   . SER C  1 119 ? 14.293  34.042 0.494   1.00 13.38 ? 142  SER C O   1 
ATOM   4176 C  CB  . SER C  1 119 ? 15.266  36.878 1.780   1.00 11.30 ? 142  SER C CB  1 
ATOM   4177 O  OG  . SER C  1 119 ? 13.908  36.992 2.237   1.00 15.04 ? 142  SER C OG  1 
ATOM   4178 N  N   . GLY C  1 120 ? 16.475  34.062 1.066   1.00 12.33 ? 143  GLY C N   1 
ATOM   4179 C  CA  . GLY C  1 120 ? 16.475  32.638 1.379   1.00 11.91 ? 143  GLY C CA  1 
ATOM   4180 C  C   . GLY C  1 120 ? 17.828  32.015 1.558   1.00 12.24 ? 143  GLY C C   1 
ATOM   4181 O  O   . GLY C  1 120 ? 18.854  32.677 1.358   1.00 10.86 ? 143  GLY C O   1 
ATOM   4182 N  N   . TRP C  1 121 ? 17.826  30.734 1.943   1.00 10.63 ? 144  TRP C N   1 
ATOM   4183 C  CA  . TRP C  1 121 ? 19.045  29.953 2.112   1.00 14.47 ? 144  TRP C CA  1 
ATOM   4184 C  C   . TRP C  1 121 ? 19.310  28.994 0.959   1.00 13.98 ? 144  TRP C C   1 
ATOM   4185 O  O   . TRP C  1 121 ? 19.975  27.971 1.137   1.00 17.72 ? 144  TRP C O   1 
ATOM   4186 C  CB  . TRP C  1 121 ? 18.998  29.169 3.422   1.00 13.27 ? 144  TRP C CB  1 
ATOM   4187 C  CG  . TRP C  1 121 ? 19.075  30.016 4.648   1.00 13.59 ? 144  TRP C CG  1 
ATOM   4188 C  CD1 . TRP C  1 121 ? 20.213  30.468 5.284   1.00 12.15 ? 144  TRP C CD1 1 
ATOM   4189 C  CD2 . TRP C  1 121 ? 17.980  30.481 5.412   1.00 9.84  ? 144  TRP C CD2 1 
ATOM   4190 N  NE1 . TRP C  1 121 ? 19.874  31.204 6.381   1.00 14.34 ? 144  TRP C NE1 1 
ATOM   4191 C  CE2 . TRP C  1 121 ? 18.511  31.234 6.489   1.00 9.84  ? 144  TRP C CE2 1 
ATOM   4192 C  CE3 . TRP C  1 121 ? 16.590  30.358 5.290   1.00 13.25 ? 144  TRP C CE3 1 
ATOM   4193 C  CZ2 . TRP C  1 121 ? 17.697  31.826 7.449   1.00 8.34  ? 144  TRP C CZ2 1 
ATOM   4194 C  CZ3 . TRP C  1 121 ? 15.789  30.946 6.238   1.00 11.10 ? 144  TRP C CZ3 1 
ATOM   4195 C  CH2 . TRP C  1 121 ? 16.345  31.679 7.316   1.00 14.90 ? 144  TRP C CH2 1 
ATOM   4196 N  N   . GLY C  1 122 ? 18.845  29.351 -0.237  1.00 11.86 ? 145  GLY C N   1 
ATOM   4197 C  CA  . GLY C  1 122 ? 18.994  28.501 -1.407  1.00 12.40 ? 145  GLY C CA  1 
ATOM   4198 C  C   . GLY C  1 122 ? 20.372  28.529 -2.049  1.00 20.56 ? 145  GLY C C   1 
ATOM   4199 O  O   . GLY C  1 122 ? 21.289  29.232 -1.589  1.00 18.41 ? 145  GLY C O   1 
ATOM   4200 N  N   . ASN C  1 123 ? 20.518  27.762 -3.125  1.00 21.18 ? 146  ASN C N   1 
ATOM   4201 C  CA  . ASN C  1 123 ? 21.754  27.752 -3.897  1.00 23.76 ? 146  ASN C CA  1 
ATOM   4202 C  C   . ASN C  1 123 ? 22.127  29.178 -4.315  1.00 23.60 ? 146  ASN C C   1 
ATOM   4203 O  O   . ASN C  1 123 ? 21.260  29.990 -4.654  1.00 16.95 ? 146  ASN C O   1 
ATOM   4204 C  CB  . ASN C  1 123 ? 21.562  26.876 -5.135  1.00 22.30 ? 146  ASN C CB  1 
ATOM   4205 C  CG  . ASN C  1 123 ? 22.877  26.453 -5.789  1.00 37.53 ? 146  ASN C CG  1 
ATOM   4206 O  OD1 . ASN C  1 123 ? 23.946  26.989 -5.497  1.00 32.90 ? 146  ASN C OD1 1 
ATOM   4207 N  ND2 . ASN C  1 123 ? 22.791  25.480 -6.691  1.00 41.00 ? 146  ASN C ND2 1 
ATOM   4208 N  N   . THR C  1 124 ? 23.423  29.471 -4.291  1.00 21.94 ? 147  THR C N   1 
ATOM   4209 C  CA  . THR C  1 124 ? 23.916  30.774 -4.717  1.00 24.42 ? 147  THR C CA  1 
ATOM   4210 C  C   . THR C  1 124 ? 24.620  30.693 -6.073  1.00 29.07 ? 147  THR C C   1 
ATOM   4211 O  O   . THR C  1 124 ? 25.053  31.710 -6.613  1.00 28.90 ? 147  THR C O   1 
ATOM   4212 C  CB  . THR C  1 124 ? 24.896  31.351 -3.693  1.00 21.76 ? 147  THR C CB  1 
ATOM   4213 O  OG1 . THR C  1 124 ? 26.036  30.489 -3.604  1.00 26.11 ? 147  THR C OG1 1 
ATOM   4214 C  CG2 . THR C  1 124 ? 24.231  31.465 -2.335  1.00 21.31 ? 147  THR C CG2 1 
ATOM   4215 N  N   . LYS C  1 125 ? 24.730  29.487 -6.623  1.00 26.27 ? 148  LYS C N   1 
ATOM   4216 C  CA  . LYS C  1 125 ? 25.369  29.326 -7.920  1.00 34.90 ? 148  LYS C CA  1 
ATOM   4217 C  C   . LYS C  1 125 ? 24.373  29.014 -9.032  1.00 34.88 ? 148  LYS C C   1 
ATOM   4218 O  O   . LYS C  1 125 ? 23.503  28.146 -8.896  1.00 32.85 ? 148  LYS C O   1 
ATOM   4219 C  CB  . LYS C  1 125 ? 26.471  28.265 -7.856  1.00 40.52 ? 148  LYS C CB  1 
ATOM   4220 C  CG  . LYS C  1 125 ? 27.687  28.708 -7.060  1.00 41.06 ? 148  LYS C CG  1 
ATOM   4221 C  CD  . LYS C  1 125 ? 27.990  30.180 -7.305  1.00 40.23 ? 148  LYS C CD  1 
ATOM   4222 C  CE  . LYS C  1 125 ? 29.247  30.625 -6.565  1.00 48.48 ? 148  LYS C CE  1 
ATOM   4223 N  NZ  . LYS C  1 125 ? 29.412  32.107 -6.614  1.00 45.57 ? 148  LYS C NZ  1 
ATOM   4224 N  N   . SER C  1 126 ? 24.498  29.748 -10.129 1.00 41.63 ? 149  SER C N   1 
ATOM   4225 C  CA  . SER C  1 126 ? 23.689  29.491 -11.313 1.00 48.36 ? 149  SER C CA  1 
ATOM   4226 C  C   . SER C  1 126 ? 24.157  28.179 -11.917 1.00 55.80 ? 149  SER C C   1 
ATOM   4227 O  O   . SER C  1 126 ? 23.371  27.433 -12.506 1.00 59.73 ? 149  SER C O   1 
ATOM   4228 C  CB  . SER C  1 126 ? 23.854  30.620 -12.331 1.00 48.65 ? 149  SER C CB  1 
ATOM   4229 O  OG  . SER C  1 126 ? 25.190  30.680 -12.808 1.00 47.19 ? 149  SER C OG  1 
ATOM   4230 N  N   . SER C  1 127 ? 25.452  27.910 -11.766 1.00 53.26 ? 150  SER C N   1 
ATOM   4231 C  CA  . SER C  1 127 ? 26.033  26.647 -12.203 1.00 59.89 ? 150  SER C CA  1 
ATOM   4232 C  C   . SER C  1 127 ? 26.710  25.957 -11.024 1.00 57.14 ? 150  SER C C   1 
ATOM   4233 O  O   . SER C  1 127 ? 27.534  26.555 -10.328 1.00 51.08 ? 150  SER C O   1 
ATOM   4234 C  CB  . SER C  1 127 ? 27.037  26.866 -13.336 1.00 55.93 ? 150  SER C CB  1 
ATOM   4235 O  OG  . SER C  1 127 ? 27.528  25.625 -13.817 1.00 59.04 ? 150  SER C OG  1 
ATOM   4236 N  N   . GLY C  1 128 ? 26.366  24.694 -10.807 1.00 53.13 ? 151  GLY C N   1 
ATOM   4237 C  CA  . GLY C  1 128 ? 26.882  23.972 -9.666  1.00 50.02 ? 151  GLY C CA  1 
ATOM   4238 C  C   . GLY C  1 128 ? 26.041  24.290 -8.449  1.00 50.04 ? 151  GLY C C   1 
ATOM   4239 O  O   . GLY C  1 128 ? 24.928  24.812 -8.568  1.00 47.42 ? 151  GLY C O   1 
ATOM   4240 N  N   . THR C  1 129 ? 26.580  23.990 -7.273  1.00 46.64 ? 152  THR C N   1 
ATOM   4241 C  CA  . THR C  1 129 ? 25.806  24.050 -6.037  1.00 49.96 ? 152  THR C CA  1 
ATOM   4242 C  C   . THR C  1 129 ? 26.622  24.575 -4.859  1.00 47.86 ? 152  THR C C   1 
ATOM   4243 O  O   . THR C  1 129 ? 27.550  23.911 -4.389  1.00 47.96 ? 152  THR C O   1 
ATOM   4244 C  CB  . THR C  1 129 ? 25.251  22.659 -5.668  1.00 53.33 ? 152  THR C CB  1 
ATOM   4245 O  OG1 . THR C  1 129 ? 26.275  21.668 -5.848  1.00 57.08 ? 152  THR C OG1 1 
ATOM   4246 C  CG2 . THR C  1 129 ? 24.038  22.305 -6.535  1.00 45.02 ? 152  THR C CG2 1 
ATOM   4247 N  N   . SER C  1 130 ? 26.271  25.768 -4.389  1.00 41.37 ? 153  SER C N   1 
ATOM   4248 C  CA  . SER C  1 130 ? 26.897  26.348 -3.205  1.00 44.18 ? 153  SER C CA  1 
ATOM   4249 C  C   . SER C  1 130 ? 25.805  26.770 -2.219  1.00 46.07 ? 153  SER C C   1 
ATOM   4250 O  O   . SER C  1 130 ? 24.938  27.585 -2.562  1.00 31.48 ? 153  SER C O   1 
ATOM   4251 C  CB  . SER C  1 130 ? 27.780  27.545 -3.581  1.00 42.28 ? 153  SER C CB  1 
ATOM   4252 O  OG  . SER C  1 130 ? 28.305  28.185 -2.424  1.00 47.80 ? 153  SER C OG  1 
ATOM   4253 N  N   . TYR C  1 131 ? 25.859  26.207 -1.007  1.00 44.99 ? 154  TYR C N   1 
ATOM   4254 C  CA  . TYR C  1 131 ? 24.818  26.394 0.010   1.00 37.07 ? 154  TYR C CA  1 
ATOM   4255 C  C   . TYR C  1 131 ? 25.299  27.306 1.139   1.00 37.51 ? 154  TYR C C   1 
ATOM   4256 O  O   . TYR C  1 131 ? 26.215  26.962 1.887   1.00 33.35 ? 154  TYR C O   1 
ATOM   4257 C  CB  . TYR C  1 131 ? 24.365  25.045 0.588   1.00 39.72 ? 154  TYR C CB  1 
ATOM   4258 C  CG  . TYR C  1 131 ? 24.226  23.949 -0.451  1.00 45.18 ? 154  TYR C CG  1 
ATOM   4259 C  CD1 . TYR C  1 131 ? 23.654  24.205 -1.692  1.00 46.25 ? 154  TYR C CD1 1 
ATOM   4260 C  CD2 . TYR C  1 131 ? 24.693  22.664 -0.199  1.00 53.23 ? 154  TYR C CD2 1 
ATOM   4261 C  CE1 . TYR C  1 131 ? 23.539  23.208 -2.649  1.00 50.52 ? 154  TYR C CE1 1 
ATOM   4262 C  CE2 . TYR C  1 131 ? 24.576  21.655 -1.154  1.00 48.16 ? 154  TYR C CE2 1 
ATOM   4263 C  CZ  . TYR C  1 131 ? 23.999  21.933 -2.372  1.00 50.46 ? 154  TYR C CZ  1 
ATOM   4264 O  OH  . TYR C  1 131 ? 23.886  20.935 -3.315  1.00 52.17 ? 154  TYR C OH  1 
ATOM   4265 N  N   . PRO C  1 132 ? 24.660  28.470 1.275   1.00 30.31 ? 155  PRO C N   1 
ATOM   4266 C  CA  . PRO C  1 132 ? 25.081  29.508 2.210   1.00 28.30 ? 155  PRO C CA  1 
ATOM   4267 C  C   . PRO C  1 132 ? 24.585  29.214 3.610   1.00 31.97 ? 155  PRO C C   1 
ATOM   4268 O  O   . PRO C  1 132 ? 23.421  28.840 3.794   1.00 28.94 ? 155  PRO C O   1 
ATOM   4269 C  CB  . PRO C  1 132 ? 24.363  30.747 1.680   1.00 30.19 ? 155  PRO C CB  1 
ATOM   4270 C  CG  . PRO C  1 132 ? 23.097  30.213 1.093   1.00 24.27 ? 155  PRO C CG  1 
ATOM   4271 C  CD  . PRO C  1 132 ? 23.428  28.838 0.555   1.00 28.50 ? 155  PRO C CD  1 
ATOM   4272 N  N   A ASP C  1 133 ? 25.447  29.389 4.603   0.59 24.21 ? 156  ASP C N   1 
ATOM   4273 N  N   B ASP C  1 133 ? 25.452  29.383 4.600   0.41 24.22 ? 156  ASP C N   1 
ATOM   4274 C  CA  A ASP C  1 133 ? 24.996  29.196 5.972   0.59 22.63 ? 156  ASP C CA  1 
ATOM   4275 C  CA  B ASP C  1 133 ? 25.041  29.212 5.987   0.41 22.65 ? 156  ASP C CA  1 
ATOM   4276 C  C   A ASP C  1 133 ? 24.151  30.371 6.457   0.59 21.33 ? 156  ASP C C   1 
ATOM   4277 C  C   B ASP C  1 133 ? 24.130  30.359 6.416   0.41 21.31 ? 156  ASP C C   1 
ATOM   4278 O  O   A ASP C  1 133 ? 23.236  30.191 7.261   0.59 18.41 ? 156  ASP C O   1 
ATOM   4279 O  O   B ASP C  1 133 ? 23.169  30.153 7.159   0.41 18.42 ? 156  ASP C O   1 
ATOM   4280 C  CB  A ASP C  1 133 ? 26.169  28.897 6.905   0.59 23.34 ? 156  ASP C CB  1 
ATOM   4281 C  CB  B ASP C  1 133 ? 26.268  29.156 6.889   0.41 23.28 ? 156  ASP C CB  1 
ATOM   4282 C  CG  A ASP C  1 133 ? 26.641  27.462 6.779   0.59 26.30 ? 156  ASP C CG  1 
ATOM   4283 C  CG  B ASP C  1 133 ? 27.227  30.279 6.610   0.41 23.02 ? 156  ASP C CG  1 
ATOM   4284 O  OD1 A ASP C  1 133 ? 26.321  26.832 5.748   0.59 29.65 ? 156  ASP C OD1 1 
ATOM   4285 O  OD1 B ASP C  1 133 ? 27.015  30.980 5.602   0.41 26.97 ? 156  ASP C OD1 1 
ATOM   4286 O  OD2 A ASP C  1 133 ? 27.304  26.959 7.707   0.59 25.84 ? 156  ASP C OD2 1 
ATOM   4287 O  OD2 B ASP C  1 133 ? 28.193  30.458 7.383   0.41 32.21 ? 156  ASP C OD2 1 
ATOM   4288 N  N   . VAL C  1 134 ? 24.429  31.567 5.946   1.00 20.10 ? 157  VAL C N   1 
ATOM   4289 C  CA  . VAL C  1 134 ? 23.635  32.739 6.330   1.00 15.66 ? 157  VAL C CA  1 
ATOM   4290 C  C   . VAL C  1 134 ? 22.644  33.163 5.252   1.00 13.12 ? 157  VAL C C   1 
ATOM   4291 O  O   . VAL C  1 134 ? 22.802  32.827 4.092   1.00 18.90 ? 157  VAL C O   1 
ATOM   4292 C  CB  . VAL C  1 134 ? 24.521  33.949 6.722   1.00 18.08 ? 157  VAL C CB  1 
ATOM   4293 C  CG1 . VAL C  1 134 ? 25.329  33.635 7.988   1.00 18.63 ? 157  VAL C CG1 1 
ATOM   4294 C  CG2 . VAL C  1 134 ? 25.440  34.328 5.578   1.00 17.90 ? 157  VAL C CG2 1 
ATOM   4295 N  N   . LEU C  1 135 ? 21.641  33.941 5.650   1.00 11.92 ? 158  LEU C N   1 
ATOM   4296 C  CA  . LEU C  1 135 ? 20.547  34.284 4.778   1.00 12.98 ? 158  LEU C CA  1 
ATOM   4297 C  C   . LEU C  1 135 ? 21.000  35.233 3.666   1.00 15.35 ? 158  LEU C C   1 
ATOM   4298 O  O   . LEU C  1 135 ? 21.738  36.198 3.915   1.00 18.59 ? 158  LEU C O   1 
ATOM   4299 C  CB  . LEU C  1 135 ? 19.433  34.944 5.592   1.00 13.33 ? 158  LEU C CB  1 
ATOM   4300 C  CG  . LEU C  1 135 ? 18.113  35.249 4.901   1.00 12.81 ? 158  LEU C CG  1 
ATOM   4301 C  CD1 . LEU C  1 135 ? 17.373  33.978 4.467   1.00 16.91 ? 158  LEU C CD1 1 
ATOM   4302 C  CD2 . LEU C  1 135 ? 17.222  36.106 5.766   1.00 15.96 ? 158  LEU C CD2 1 
ATOM   4303 N  N   . LYS C  1 136 ? 20.555  34.953 2.448   1.00 13.52 ? 159  LYS C N   1 
ATOM   4304 C  CA  . LYS C  1 136 ? 20.889  35.801 1.307   1.00 16.86 ? 159  LYS C CA  1 
ATOM   4305 C  C   . LYS C  1 136 ? 19.684  36.606 0.830   1.00 18.40 ? 159  LYS C C   1 
ATOM   4306 O  O   . LYS C  1 136 ? 18.524  36.189 0.980   1.00 15.36 ? 159  LYS C O   1 
ATOM   4307 C  CB  . LYS C  1 136 ? 21.472  34.989 0.160   1.00 18.15 ? 159  LYS C CB  1 
ATOM   4308 C  CG  . LYS C  1 136 ? 22.675  34.147 0.528   1.00 23.85 ? 159  LYS C CG  1 
ATOM   4309 C  CD  . LYS C  1 136 ? 23.833  35.006 1.004   1.00 22.25 ? 159  LYS C CD  1 
ATOM   4310 C  CE  . LYS C  1 136 ? 25.144  34.262 0.813   1.00 30.53 ? 159  LYS C CE  1 
ATOM   4311 N  NZ  . LYS C  1 136 ? 25.892  34.122 2.090   1.00 35.54 ? 159  LYS C NZ  1 
ATOM   4312 N  N   . CYS C  1 137 ? 19.976  37.782 0.273   1.00 20.59 ? 160  CYS C N   1 
ATOM   4313 C  CA  . CYS C  1 137 ? 18.960  38.742 -0.118  1.00 15.90 ? 160  CYS C CA  1 
ATOM   4314 C  C   . CYS C  1 137 ? 19.155  39.158 -1.561  1.00 16.70 ? 160  CYS C C   1 
ATOM   4315 O  O   . CYS C  1 137 ? 20.277  39.190 -2.061  1.00 16.59 ? 160  CYS C O   1 
ATOM   4316 C  CB  . CYS C  1 137 ? 19.073  40.014 0.727   1.00 23.12 ? 160  CYS C CB  1 
ATOM   4317 S  SG  . CYS C  1 137 ? 18.251  39.909 2.286   1.00 23.51 ? 160  CYS C SG  1 
ATOM   4318 N  N   . LEU C  1 138 ? 18.059  39.504 -2.222  1.00 14.53 ? 161  LEU C N   1 
ATOM   4319 C  CA  . LEU C  1 138 ? 18.131  39.988 -3.607  1.00 16.48 ? 161  LEU C CA  1 
ATOM   4320 C  C   . LEU C  1 138 ? 17.072  41.047 -3.875  1.00 18.13 ? 161  LEU C C   1 
ATOM   4321 O  O   . LEU C  1 138 ? 15.892  40.853 -3.574  1.00 14.60 ? 161  LEU C O   1 
ATOM   4322 C  CB  . LEU C  1 138 ? 17.970  38.841 -4.607  1.00 20.21 ? 161  LEU C CB  1 
ATOM   4323 C  CG  . LEU C  1 138 ? 17.789  39.292 -6.053  1.00 19.82 ? 161  LEU C CG  1 
ATOM   4324 C  CD1 . LEU C  1 138 ? 19.141  39.741 -6.613  1.00 22.11 ? 161  LEU C CD1 1 
ATOM   4325 C  CD2 . LEU C  1 138 ? 17.192  38.161 -6.899  1.00 21.61 ? 161  LEU C CD2 1 
ATOM   4326 N  N   . LYS C  1 139 ? 17.496  42.181 -4.439  1.00 18.08 ? 162  LYS C N   1 
ATOM   4327 C  CA  . LYS C  1 139 ? 16.531  43.175 -4.906  1.00 18.89 ? 162  LYS C CA  1 
ATOM   4328 C  C   . LYS C  1 139 ? 16.176  42.957 -6.389  1.00 14.52 ? 162  LYS C C   1 
ATOM   4329 O  O   . LYS C  1 139 ? 17.062  42.841 -7.234  1.00 21.28 ? 162  LYS C O   1 
ATOM   4330 C  CB  . LYS C  1 139 ? 17.059  44.592 -4.669  1.00 20.12 ? 162  LYS C CB  1 
ATOM   4331 C  CG  . LYS C  1 139 ? 16.925  45.036 -3.214  1.00 18.96 ? 162  LYS C CG  1 
ATOM   4332 C  CD  . LYS C  1 139 ? 15.456  45.193 -2.823  1.00 33.56 ? 162  LYS C CD  1 
ATOM   4333 C  CE  . LYS C  1 139 ? 15.307  45.584 -1.363  1.00 40.14 ? 162  LYS C CE  1 
ATOM   4334 N  NZ  . LYS C  1 139 ? 16.368  46.564 -0.960  1.00 39.65 ? 162  LYS C NZ  1 
ATOM   4335 N  N   . ALA C  1 140 ? 14.887  42.877 -6.684  1.00 17.01 ? 163  ALA C N   1 
ATOM   4336 C  CA  . ALA C  1 140 ? 14.432  42.518 -8.032  1.00 21.21 ? 163  ALA C CA  1 
ATOM   4337 C  C   . ALA C  1 140 ? 13.057  43.104 -8.345  1.00 15.46 ? 163  ALA C C   1 
ATOM   4338 O  O   . ALA C  1 140 ? 12.174  43.138 -7.490  1.00 20.53 ? 163  ALA C O   1 
ATOM   4339 C  CB  . ALA C  1 140 ? 14.414  40.990 -8.203  1.00 19.32 ? 163  ALA C CB  1 
ATOM   4340 N  N   . PRO C  1 141 ? 12.864  43.559 -9.588  1.00 19.16 ? 164  PRO C N   1 
ATOM   4341 C  CA  . PRO C  1 141 ? 11.581  44.164 -9.928  1.00 17.80 ? 164  PRO C CA  1 
ATOM   4342 C  C   . PRO C  1 141 ? 10.566  43.159 -10.430 1.00 18.60 ? 164  PRO C C   1 
ATOM   4343 O  O   . PRO C  1 141 ? 10.926  42.161 -11.056 1.00 19.51 ? 164  PRO C O   1 
ATOM   4344 C  CB  . PRO C  1 141 ? 11.951  45.089 -11.085 1.00 17.64 ? 164  PRO C CB  1 
ATOM   4345 C  CG  . PRO C  1 141 ? 13.038  44.366 -11.775 1.00 24.74 ? 164  PRO C CG  1 
ATOM   4346 C  CD  . PRO C  1 141 ? 13.852  43.720 -10.666 1.00 25.67 ? 164  PRO C CD  1 
ATOM   4347 N  N   . ILE C  1 142 ? 9.301   43.439 -10.162 1.00 15.51 ? 165  ILE C N   1 
ATOM   4348 C  CA  . ILE C  1 142 ? 8.211   42.743 -10.819 1.00 19.88 ? 165  ILE C CA  1 
ATOM   4349 C  C   . ILE C  1 142 ? 8.253   43.027 -12.330 1.00 24.93 ? 165  ILE C C   1 
ATOM   4350 O  O   . ILE C  1 142 ? 8.468   44.175 -12.762 1.00 23.14 ? 165  ILE C O   1 
ATOM   4351 C  CB  . ILE C  1 142 ? 6.887   43.188 -10.219 1.00 20.91 ? 165  ILE C CB  1 
ATOM   4352 C  CG1 . ILE C  1 142 ? 6.901   42.933 -8.715  1.00 25.13 ? 165  ILE C CG1 1 
ATOM   4353 C  CG2 . ILE C  1 142 ? 5.717   42.464 -10.860 1.00 21.77 ? 165  ILE C CG2 1 
ATOM   4354 C  CD1 . ILE C  1 142 ? 5.549   43.033 -8.080  1.00 22.86 ? 165  ILE C CD1 1 
ATOM   4355 N  N   . LEU C  1 143 ? 8.076   41.981 -13.139 1.00 20.20 ? 166  LEU C N   1 
ATOM   4356 C  CA  . LEU C  1 143 ? 8.122   42.123 -14.588 1.00 24.66 ? 166  LEU C CA  1 
ATOM   4357 C  C   . LEU C  1 143 ? 6.684   42.189 -15.103 1.00 24.52 ? 166  LEU C C   1 
ATOM   4358 O  O   . LEU C  1 143 ? 5.753   41.728 -14.425 1.00 21.33 ? 166  LEU C O   1 
ATOM   4359 C  CB  . LEU C  1 143 ? 8.881   40.948 -15.213 1.00 22.24 ? 166  LEU C CB  1 
ATOM   4360 C  CG  . LEU C  1 143 ? 10.328  40.745 -14.748 1.00 27.33 ? 166  LEU C CG  1 
ATOM   4361 C  CD1 . LEU C  1 143 ? 10.953  39.506 -15.377 1.00 24.66 ? 166  LEU C CD1 1 
ATOM   4362 C  CD2 . LEU C  1 143 ? 11.197  41.969 -15.055 1.00 23.34 ? 166  LEU C CD2 1 
ATOM   4363 N  N   A SER C  1 144 ? 6.485   42.800 -16.274 0.81 23.04 ? 167  SER C N   1 
ATOM   4364 N  N   B SER C  1 144 ? 6.504   42.762 -16.289 0.19 23.17 ? 167  SER C N   1 
ATOM   4365 C  CA  A SER C  1 144 ? 5.149   42.866 -16.865 0.81 27.29 ? 167  SER C CA  1 
ATOM   4366 C  CA  B SER C  1 144 ? 5.183   42.838 -16.899 0.19 27.14 ? 167  SER C CA  1 
ATOM   4367 C  C   A SER C  1 144 ? 4.614   41.464 -17.148 0.81 25.67 ? 167  SER C C   1 
ATOM   4368 C  C   B SER C  1 144 ? 4.619   41.440 -17.131 0.19 25.65 ? 167  SER C C   1 
ATOM   4369 O  O   A SER C  1 144 ? 5.379   40.541 -17.436 0.81 23.76 ? 167  SER C O   1 
ATOM   4370 O  O   B SER C  1 144 ? 5.368   40.488 -17.354 0.19 23.86 ? 167  SER C O   1 
ATOM   4371 C  CB  A SER C  1 144 ? 5.168   43.670 -18.167 0.81 23.96 ? 167  SER C CB  1 
ATOM   4372 C  CB  B SER C  1 144 ? 5.249   43.599 -18.223 0.19 24.10 ? 167  SER C CB  1 
ATOM   4373 O  OG  A SER C  1 144 ? 6.024   43.075 -19.126 0.81 21.91 ? 167  SER C OG  1 
ATOM   4374 O  OG  B SER C  1 144 ? 3.971   43.681 -18.826 0.19 26.01 ? 167  SER C OG  1 
ATOM   4375 N  N   . ASP C  1 145 ? 3.297   41.325 -17.056 1.00 22.20 ? 168  ASP C N   1 
ATOM   4376 C  CA  . ASP C  1 145 ? 2.619   40.085 -17.381 1.00 30.57 ? 168  ASP C CA  1 
ATOM   4377 C  C   . ASP C  1 145 ? 2.978   39.626 -18.800 1.00 30.84 ? 168  ASP C C   1 
ATOM   4378 O  O   . ASP C  1 145 ? 3.214   38.445 -19.036 1.00 27.01 ? 168  ASP C O   1 
ATOM   4379 C  CB  . ASP C  1 145 ? 1.107   40.278 -17.248 1.00 32.30 ? 168  ASP C CB  1 
ATOM   4380 C  CG  . ASP C  1 145 ? 0.330   39.027 -17.597 1.00 46.27 ? 168  ASP C CG  1 
ATOM   4381 O  OD1 . ASP C  1 145 ? 0.720   37.935 -17.123 1.00 47.64 ? 168  ASP C OD1 1 
ATOM   4382 O  OD2 . ASP C  1 145 ? -0.661  39.133 -18.356 1.00 48.58 ? 168  ASP C OD2 1 
ATOM   4383 N  N   . SER C  1 146 ? 3.061   40.566 -19.737 1.00 29.20 ? 169  SER C N   1 
ATOM   4384 C  CA  . SER C  1 146 ? 3.418   40.227 -21.102 1.00 24.55 ? 169  SER C CA  1 
ATOM   4385 C  C   . SER C  1 146 ? 4.814   39.606 -21.214 1.00 27.22 ? 169  SER C C   1 
ATOM   4386 O  O   . SER C  1 146 ? 4.996   38.623 -21.938 1.00 23.05 ? 169  SER C O   1 
ATOM   4387 C  CB  . SER C  1 146 ? 3.290   41.452 -22.023 1.00 32.75 ? 169  SER C CB  1 
ATOM   4388 O  OG  . SER C  1 146 ? 4.269   42.433 -21.712 1.00 33.94 ? 169  SER C OG  1 
ATOM   4389 N  N   . SER C  1 147 ? 5.802   40.168 -20.515 1.00 21.94 ? 170  SER C N   1 
ATOM   4390 C  CA  . SER C  1 147 ? 7.163   39.624 -20.577 1.00 21.68 ? 170  SER C CA  1 
ATOM   4391 C  C   . SER C  1 147 ? 7.209   38.290 -19.836 1.00 20.94 ? 170  SER C C   1 
ATOM   4392 O  O   . SER C  1 147 ? 8.038   37.428 -20.131 1.00 22.94 ? 170  SER C O   1 
ATOM   4393 C  CB  . SER C  1 147 ? 8.150   40.570 -19.898 1.00 29.29 ? 170  SER C CB  1 
ATOM   4394 O  OG  . SER C  1 147 ? 7.700   40.852 -18.591 1.00 31.55 ? 170  SER C OG  1 
ATOM   4395 N  N   . CYS C  1 148 ? 6.340   38.152 -18.846 1.00 20.16 ? 171  CYS C N   1 
ATOM   4396 C  CA  . CYS C  1 148 ? 6.295   36.919 -18.082 1.00 22.18 ? 171  CYS C CA  1 
ATOM   4397 C  C   . CYS C  1 148 ? 5.759   35.836 -19.005 1.00 20.60 ? 171  CYS C C   1 
ATOM   4398 O  O   . CYS C  1 148 ? 6.311   34.738 -19.069 1.00 21.37 ? 171  CYS C O   1 
ATOM   4399 C  CB  . CYS C  1 148 ? 5.393   37.060 -16.845 1.00 21.66 ? 171  CYS C CB  1 
ATOM   4400 S  SG  . CYS C  1 148 ? 5.564   35.715 -15.608 1.00 24.74 ? 171  CYS C SG  1 
ATOM   4401 N  N   . LYS C  1 149 ? 4.705   36.163 -19.745 1.00 20.28 ? 172  LYS C N   1 
ATOM   4402 C  CA  . LYS C  1 149 ? 4.100   35.186 -20.662 1.00 18.32 ? 172  LYS C CA  1 
ATOM   4403 C  C   . LYS C  1 149 ? 5.012   34.865 -21.833 1.00 23.19 ? 172  LYS C C   1 
ATOM   4404 O  O   . LYS C  1 149 ? 5.038   33.732 -22.320 1.00 24.19 ? 172  LYS C O   1 
ATOM   4405 C  CB  . LYS C  1 149 ? 2.716   35.631 -21.115 1.00 25.50 ? 172  LYS C CB  1 
ATOM   4406 C  CG  . LYS C  1 149 ? 1.665   35.468 -20.030 1.00 25.20 ? 172  LYS C CG  1 
ATOM   4407 C  CD  . LYS C  1 149 ? 0.322   36.043 -20.442 1.00 41.48 ? 172  LYS C CD  1 
ATOM   4408 C  CE  . LYS C  1 149 ? -0.830  35.327 -19.738 1.00 36.11 ? 172  LYS C CE  1 
ATOM   4409 N  NZ  . LYS C  1 149 ? -0.690  35.325 -18.263 1.00 41.06 ? 172  LYS C NZ  1 
ATOM   4410 N  N   . SER C  1 150 ? 5.790   35.852 -22.269 1.00 20.96 ? 173  SER C N   1 
ATOM   4411 C  CA  . SER C  1 150 ? 6.737   35.606 -23.343 1.00 23.58 ? 173  SER C CA  1 
ATOM   4412 C  C   . SER C  1 150 ? 7.902   34.739 -22.881 1.00 20.71 ? 173  SER C C   1 
ATOM   4413 O  O   . SER C  1 150 ? 8.486   33.992 -23.680 1.00 23.30 ? 173  SER C O   1 
ATOM   4414 C  CB  . SER C  1 150 ? 7.224   36.927 -23.939 1.00 25.10 ? 173  SER C CB  1 
ATOM   4415 O  OG  . SER C  1 150 ? 6.105   37.680 -24.366 1.00 31.54 ? 173  SER C OG  1 
ATOM   4416 N  N   . ALA C  1 151 ? 8.245   34.847 -21.593 1.00 18.97 ? 174  ALA C N   1 
ATOM   4417 C  CA  . ALA C  1 151 ? 9.313   34.043 -21.001 1.00 19.36 ? 174  ALA C CA  1 
ATOM   4418 C  C   . ALA C  1 151 ? 8.878   32.574 -20.835 1.00 13.99 ? 174  ALA C C   1 
ATOM   4419 O  O   . ALA C  1 151 ? 9.653   31.652 -21.087 1.00 18.12 ? 174  ALA C O   1 
ATOM   4420 C  CB  . ALA C  1 151 ? 9.703   34.628 -19.656 1.00 16.43 ? 174  ALA C CB  1 
ATOM   4421 N  N   . TYR C  1 152 ? 7.638   32.389 -20.413 1.00 13.94 ? 175  TYR C N   1 
ATOM   4422 C  CA  . TYR C  1 152 ? 7.062   31.061 -20.199 1.00 15.49 ? 175  TYR C CA  1 
ATOM   4423 C  C   . TYR C  1 152 ? 5.734   30.882 -20.955 1.00 14.55 ? 175  TYR C C   1 
ATOM   4424 O  O   . TYR C  1 152 ? 4.659   30.867 -20.347 1.00 12.88 ? 175  TYR C O   1 
ATOM   4425 C  CB  . TYR C  1 152 ? 6.847   30.841 -18.686 1.00 15.41 ? 175  TYR C CB  1 
ATOM   4426 C  CG  . TYR C  1 152 ? 8.133   30.901 -17.891 1.00 17.41 ? 175  TYR C CG  1 
ATOM   4427 C  CD1 . TYR C  1 152 ? 9.007   29.809 -17.864 1.00 14.36 ? 175  TYR C CD1 1 
ATOM   4428 C  CD2 . TYR C  1 152 ? 8.473   32.040 -17.144 1.00 16.20 ? 175  TYR C CD2 1 
ATOM   4429 C  CE1 . TYR C  1 152 ? 10.198  29.853 -17.130 1.00 18.92 ? 175  TYR C CE1 1 
ATOM   4430 C  CE2 . TYR C  1 152 ? 9.655   32.086 -16.399 1.00 13.00 ? 175  TYR C CE2 1 
ATOM   4431 C  CZ  . TYR C  1 152 ? 10.504  30.984 -16.395 1.00 16.66 ? 175  TYR C CZ  1 
ATOM   4432 O  OH  . TYR C  1 152 ? 11.671  31.018 -15.676 1.00 13.37 ? 175  TYR C OH  1 
ATOM   4433 N  N   . PRO C  1 153 ? 5.805   30.769 -22.292 1.00 16.36 ? 176  PRO C N   1 
ATOM   4434 C  CA  . PRO C  1 153 ? 4.558   30.660 -23.057 1.00 12.82 ? 176  PRO C CA  1 
ATOM   4435 C  C   . PRO C  1 153 ? 3.701   29.459 -22.648 1.00 12.37 ? 176  PRO C C   1 
ATOM   4436 O  O   . PRO C  1 153 ? 4.215   28.333 -22.511 1.00 15.47 ? 176  PRO C O   1 
ATOM   4437 C  CB  . PRO C  1 153 ? 5.035   30.478 -24.501 1.00 20.82 ? 176  PRO C CB  1 
ATOM   4438 C  CG  . PRO C  1 153 ? 6.461   30.946 -24.523 1.00 20.78 ? 176  PRO C CG  1 
ATOM   4439 C  CD  . PRO C  1 153 ? 7.004   30.703 -23.143 1.00 22.02 ? 176  PRO C CD  1 
ATOM   4440 N  N   . GLY C  1 154 ? 2.404   29.702 -22.473 1.00 18.54 ? 177  GLY C N   1 
ATOM   4441 C  CA  . GLY C  1 154 ? 1.467   28.641 -22.165 1.00 14.90 ? 177  GLY C CA  1 
ATOM   4442 C  C   . GLY C  1 154 ? 1.580   28.076 -20.755 1.00 16.83 ? 177  GLY C C   1 
ATOM   4443 O  O   . GLY C  1 154 ? 0.989   27.029 -20.466 1.00 13.97 ? 177  GLY C O   1 
ATOM   4444 N  N   . GLN C  1 155 ? 2.295   28.769 -19.864 1.00 11.41 ? 178  GLN C N   1 
ATOM   4445 C  CA  . GLN C  1 155 ? 2.524   28.237 -18.495 1.00 9.77  ? 178  GLN C CA  1 
ATOM   4446 C  C   . GLN C  1 155 ? 2.159   29.185 -17.345 1.00 15.10 ? 178  GLN C C   1 
ATOM   4447 O  O   . GLN C  1 155 ? 2.116   28.770 -16.178 1.00 14.53 ? 178  GLN C O   1 
ATOM   4448 C  CB  . GLN C  1 155 ? 3.969   27.786 -18.326 1.00 11.71 ? 178  GLN C CB  1 
ATOM   4449 C  CG  . GLN C  1 155 ? 4.304   26.539 -19.097 1.00 14.05 ? 178  GLN C CG  1 
ATOM   4450 C  CD  . GLN C  1 155 ? 5.703   26.070 -18.826 1.00 18.88 ? 178  GLN C CD  1 
ATOM   4451 O  OE1 . GLN C  1 155 ? 6.676   26.759 -19.150 1.00 19.81 ? 178  GLN C OE1 1 
ATOM   4452 N  NE2 . GLN C  1 155 ? 5.822   24.881 -18.238 1.00 25.79 ? 178  GLN C NE2 1 
ATOM   4453 N  N   . ILE C  1 156 ? 1.892   30.447 -17.661 1.00 16.59 ? 179  ILE C N   1 
ATOM   4454 C  CA  . ILE C  1 156 ? 1.624   31.424 -16.603 1.00 15.52 ? 179  ILE C CA  1 
ATOM   4455 C  C   . ILE C  1 156 ? 0.130   31.569 -16.351 1.00 14.81 ? 179  ILE C C   1 
ATOM   4456 O  O   . ILE C  1 156 ? -0.632  31.911 -17.262 1.00 19.51 ? 179  ILE C O   1 
ATOM   4457 C  CB  . ILE C  1 156 ? 2.217   32.807 -16.946 1.00 12.95 ? 179  ILE C CB  1 
ATOM   4458 C  CG1 . ILE C  1 156 ? 3.737   32.710 -17.142 1.00 11.77 ? 179  ILE C CG1 1 
ATOM   4459 C  CG2 . ILE C  1 156 ? 1.794   33.832 -15.911 1.00 14.07 ? 179  ILE C CG2 1 
ATOM   4460 C  CD1 . ILE C  1 156 ? 4.488   32.164 -15.922 1.00 15.75 ? 179  ILE C CD1 1 
ATOM   4461 N  N   . THR C  1 157 ? -0.287  31.309 -15.115 1.00 13.00 ? 180  THR C N   1 
ATOM   4462 C  CA  . THR C  1 157 ? -1.684  31.504 -14.721 1.00 14.89 ? 180  THR C CA  1 
ATOM   4463 C  C   . THR C  1 157 ? -1.858  32.899 -14.118 1.00 15.79 ? 180  THR C C   1 
ATOM   4464 O  O   . THR C  1 157 ? -0.880  33.580 -13.816 1.00 18.14 ? 180  THR C O   1 
ATOM   4465 C  CB  . THR C  1 157 ? -2.148  30.459 -13.693 1.00 22.61 ? 180  THR C CB  1 
ATOM   4466 O  OG1 . THR C  1 157 ? -1.623  30.795 -12.397 1.00 13.55 ? 180  THR C OG1 1 
ATOM   4467 C  CG2 . THR C  1 157 ? -1.669  29.063 -14.073 1.00 19.76 ? 180  THR C CG2 1 
ATOM   4468 N  N   . SER C  1 158 ? -3.100  33.308 -13.910 1.00 17.75 ? 181  SER C N   1 
ATOM   4469 C  CA  . SER C  1 158 ? -3.373  34.618 -13.324 1.00 17.84 ? 181  SER C CA  1 
ATOM   4470 C  C   . SER C  1 158 ? -2.930  34.703 -11.871 1.00 21.50 ? 181  SER C C   1 
ATOM   4471 O  O   . SER C  1 158 ? -2.938  35.783 -11.277 1.00 22.03 ? 181  SER C O   1 
ATOM   4472 C  CB  . SER C  1 158 ? -4.864  34.954 -13.420 1.00 19.02 ? 181  SER C CB  1 
ATOM   4473 O  OG  . SER C  1 158 ? -5.630  33.973 -12.748 1.00 25.92 ? 181  SER C OG  1 
ATOM   4474 N  N   . ASN C  1 159 ? -2.527  33.571 -11.307 1.00 17.04 ? 182  ASN C N   1 
ATOM   4475 C  CA  . ASN C  1 159 ? -2.068  33.519 -9.922  1.00 18.41 ? 182  ASN C CA  1 
ATOM   4476 C  C   . ASN C  1 159 ? -0.553  33.415 -9.816  1.00 18.86 ? 182  ASN C C   1 
ATOM   4477 O  O   . ASN C  1 159 ? -0.028  32.955 -8.798  1.00 15.52 ? 182  ASN C O   1 
ATOM   4478 C  CB  . ASN C  1 159 ? -2.720  32.350 -9.189  1.00 19.19 ? 182  ASN C CB  1 
ATOM   4479 C  CG  . ASN C  1 159 ? -4.223  32.469 -9.130  1.00 24.39 ? 182  ASN C CG  1 
ATOM   4480 O  OD1 . ASN C  1 159 ? -4.756  33.507 -8.731  1.00 19.74 ? 182  ASN C OD1 1 
ATOM   4481 N  ND2 . ASN C  1 159 ? -4.927  31.406 -9.528  1.00 20.82 ? 182  ASN C ND2 1 
ATOM   4482 N  N   . MET C  1 160 ? 0.134   33.837 -10.875 1.00 14.17 ? 183  MET C N   1 
ATOM   4483 C  CA  . MET C  1 160 ? 1.583   33.871 -10.901 1.00 13.73 ? 183  MET C CA  1 
ATOM   4484 C  C   . MET C  1 160 ? 2.078   35.200 -11.428 1.00 18.67 ? 183  MET C C   1 
ATOM   4485 O  O   . MET C  1 160 ? 1.385   35.849 -12.212 1.00 19.09 ? 183  MET C O   1 
ATOM   4486 C  CB  . MET C  1 160 ? 2.087   32.800 -11.844 1.00 10.01 ? 183  MET C CB  1 
ATOM   4487 C  CG  . MET C  1 160 ? 1.680   31.399 -11.440 1.00 8.63  ? 183  MET C CG  1 
ATOM   4488 S  SD  . MET C  1 160 ? 2.112   30.267 -12.762 1.00 12.91 ? 183  MET C SD  1 
ATOM   4489 C  CE  . MET C  1 160 ? 1.430   28.752 -12.089 1.00 12.38 ? 183  MET C CE  1 
ATOM   4490 N  N   . PHE C  1 161 ? 3.302   35.574 -11.059 1.00 12.81 ? 184  PHE C N   1 
ATOM   4491 C  CA  . PHE C  1 161 ? 3.954   36.707 -11.694 1.00 17.17 ? 184  PHE C CA  1 
ATOM   4492 C  C   . PHE C  1 161 ? 5.459   36.447 -11.716 1.00 18.43 ? 184  PHE C C   1 
ATOM   4493 O  O   . PHE C  1 161 ? 5.978   35.651 -10.912 1.00 16.94 ? 184  PHE C O   1 
ATOM   4494 C  CB  . PHE C  1 161 ? 3.589   38.028 -10.982 1.00 17.51 ? 184  PHE C CB  1 
ATOM   4495 C  CG  . PHE C  1 161 ? 4.243   38.204 -9.616  1.00 15.92 ? 184  PHE C CG  1 
ATOM   4496 C  CD1 . PHE C  1 161 ? 5.520   38.735 -9.508  1.00 16.86 ? 184  PHE C CD1 1 
ATOM   4497 C  CD2 . PHE C  1 161 ? 3.566   37.864 -8.456  1.00 21.82 ? 184  PHE C CD2 1 
ATOM   4498 C  CE1 . PHE C  1 161 ? 6.116   38.903 -8.267  1.00 16.80 ? 184  PHE C CE1 1 
ATOM   4499 C  CE2 . PHE C  1 161 ? 4.156   38.033 -7.204  1.00 21.60 ? 184  PHE C CE2 1 
ATOM   4500 C  CZ  . PHE C  1 161 ? 5.434   38.550 -7.123  1.00 15.34 ? 184  PHE C CZ  1 
ATOM   4501 N  N   . CYS C  1 162 ? 6.146   37.095 -12.648 1.00 15.13 ? 185  CYS C N   1 
ATOM   4502 C  CA  . CYS C  1 162 ? 7.588   36.946 -12.803 1.00 19.11 ? 185  CYS C CA  1 
ATOM   4503 C  C   . CYS C  1 162 ? 8.255   38.128 -12.131 1.00 22.01 ? 185  CYS C C   1 
ATOM   4504 O  O   . CYS C  1 162 ? 7.725   39.230 -12.174 1.00 18.32 ? 185  CYS C O   1 
ATOM   4505 C  CB  . CYS C  1 162 ? 7.971   36.947 -14.285 1.00 23.91 ? 185  CYS C CB  1 
ATOM   4506 S  SG  . CYS C  1 162 ? 7.532   35.427 -15.196 1.00 20.09 ? 185  CYS C SG  1 
ATOM   4507 N  N   . ALA C  1 163 ? 9.407   37.905 -11.513 1.00 22.14 ? 186  ALA C N   1 
ATOM   4508 C  CA  . ALA C  1 163 ? 10.189  39.014 -10.980 1.00 14.01 ? 186  ALA C CA  1 
ATOM   4509 C  C   . ALA C  1 163 ? 11.640  38.678 -11.201 1.00 23.85 ? 186  ALA C C   1 
ATOM   4510 O  O   . ALA C  1 163 ? 12.015  37.504 -11.231 1.00 15.51 ? 186  ALA C O   1 
ATOM   4511 C  CB  . ALA C  1 163 ? 9.885   39.224 -9.510  1.00 17.07 ? 186  ALA C CB  1 
ATOM   4512 N  N   . GLY C  1 164 ? 12.470  39.695 -11.392 1.00 15.41 ? 187  GLY C N   1 
ATOM   4513 C  CA  . GLY C  1 164 ? 13.875  39.444 -11.647 1.00 17.20 ? 187  GLY C CA  1 
ATOM   4514 C  C   . GLY C  1 164 ? 14.366  40.147 -12.894 1.00 19.13 ? 187  GLY C C   1 
ATOM   4515 O  O   . GLY C  1 164 ? 13.867  41.221 -13.256 1.00 24.11 ? 187  GLY C O   1 
ATOM   4516 N  N   . TYR C  1 165 ? 15.332  39.530 -13.552 1.00 19.14 ? 188  TYR C N   1 
ATOM   4517 C  CA  . TYR C  1 165 ? 16.053  40.183 -14.632 1.00 22.76 ? 188  TYR C CA  1 
ATOM   4518 C  C   . TYR C  1 165 ? 16.111  39.303 -15.851 1.00 21.45 ? 188  TYR C C   1 
ATOM   4519 O  O   . TYR C  1 165 ? 16.678  38.207 -15.817 1.00 22.02 ? 188  TYR C O   1 
ATOM   4520 C  CB  . TYR C  1 165 ? 17.474  40.538 -14.169 1.00 20.68 ? 188  TYR C CB  1 
ATOM   4521 C  CG  . TYR C  1 165 ? 17.458  41.444 -12.956 1.00 28.60 ? 188  TYR C CG  1 
ATOM   4522 C  CD1 . TYR C  1 165 ? 17.381  42.824 -13.095 1.00 27.18 ? 188  TYR C CD1 1 
ATOM   4523 C  CD2 . TYR C  1 165 ? 17.489  40.917 -11.673 1.00 25.09 ? 188  TYR C CD2 1 
ATOM   4524 C  CE1 . TYR C  1 165 ? 17.353  43.655 -11.992 1.00 25.14 ? 188  TYR C CE1 1 
ATOM   4525 C  CE2 . TYR C  1 165 ? 17.463  41.740 -10.564 1.00 21.31 ? 188  TYR C CE2 1 
ATOM   4526 C  CZ  . TYR C  1 165 ? 17.402  43.106 -10.725 1.00 26.69 ? 188  TYR C CZ  1 
ATOM   4527 O  OH  . TYR C  1 165 ? 17.377  43.909 -9.607  1.00 26.65 ? 188  TYR C OH  1 
ATOM   4528 N  N   . LEU C  1 166 ? 15.551  39.803 -16.945 1.00 21.35 ? 189  LEU C N   1 
ATOM   4529 C  CA  . LEU C  1 166 ? 15.587  39.065 -18.205 1.00 20.44 ? 189  LEU C CA  1 
ATOM   4530 C  C   . LEU C  1 166 ? 17.016  38.806 -18.662 1.00 20.50 ? 189  LEU C C   1 
ATOM   4531 O  O   . LEU C  1 166 ? 17.278  37.807 -19.330 1.00 18.23 ? 189  LEU C O   1 
ATOM   4532 C  CB  . LEU C  1 166 ? 14.785  39.791 -19.274 1.00 22.60 ? 189  LEU C CB  1 
ATOM   4533 C  CG  . LEU C  1 166 ? 13.288  39.868 -18.981 1.00 23.19 ? 189  LEU C CG  1 
ATOM   4534 C  CD1 . LEU C  1 166 ? 12.559  40.507 -20.159 1.00 39.54 ? 189  LEU C CD1 1 
ATOM   4535 C  CD2 . LEU C  1 166 ? 12.718  38.480 -18.678 1.00 26.97 ? 189  LEU C CD2 1 
ATOM   4536 N  N   . GLU C  1 167 ? 17.947  39.680 -18.260 1.00 19.65 ? 190  GLU C N   1 
ATOM   4537 C  CA  . GLU C  1 167 ? 19.368  39.498 -18.567 1.00 23.62 ? 190  GLU C CA  1 
ATOM   4538 C  C   . GLU C  1 167 ? 20.000  38.332 -17.824 1.00 20.28 ? 190  GLU C C   1 
ATOM   4539 O  O   . GLU C  1 167 ? 21.135  37.936 -18.119 1.00 19.13 ? 190  GLU C O   1 
ATOM   4540 C  CB  . GLU C  1 167 ? 20.166  40.759 -18.222 1.00 30.49 ? 190  GLU C CB  1 
ATOM   4541 C  CG  . GLU C  1 167 ? 19.442  42.056 -18.434 1.00 29.53 ? 190  GLU C CG  1 
ATOM   4542 C  CD  . GLU C  1 167 ? 18.680  42.528 -17.207 1.00 36.25 ? 190  GLU C CD  1 
ATOM   4543 O  OE1 . GLU C  1 167 ? 19.320  42.926 -16.189 1.00 31.49 ? 190  GLU C OE1 1 
ATOM   4544 O  OE2 . GLU C  1 167 ? 17.432  42.527 -17.278 1.00 29.13 ? 190  GLU C OE2 1 
ATOM   4545 N  N   . GLY C  1 168 ? 19.276  37.782 -16.850 1.00 24.46 ? 191  GLY C N   1 
ATOM   4546 C  CA  . GLY C  1 168 ? 19.812  36.706 -16.027 1.00 17.57 ? 191  GLY C CA  1 
ATOM   4547 C  C   . GLY C  1 168 ? 20.787  37.241 -14.982 1.00 29.37 ? 191  GLY C C   1 
ATOM   4548 O  O   . GLY C  1 168 ? 20.912  38.454 -14.800 1.00 22.88 ? 191  GLY C O   1 
ATOM   4549 N  N   . GLY C  1 169 ? 21.482  36.342 -14.292 1.00 24.05 ? 192  GLY C N   1 
ATOM   4550 C  CA  . GLY C  1 169 ? 22.503  36.756 -13.342 1.00 24.40 ? 192  GLY C CA  1 
ATOM   4551 C  C   . GLY C  1 169 ? 22.028  36.903 -11.906 1.00 24.55 ? 192  GLY C C   1 
ATOM   4552 O  O   . GLY C  1 169 ? 22.832  36.784 -10.989 1.00 22.94 ? 192  GLY C O   1 
ATOM   4553 N  N   . LYS C  1 170 ? 20.730  37.153 -11.719 1.00 17.78 ? 193  LYS C N   1 
ATOM   4554 C  CA  . LYS C  1 170 ? 20.161  37.488 -10.419 1.00 21.82 ? 193  LYS C CA  1 
ATOM   4555 C  C   . LYS C  1 170 ? 18.798  36.829 -10.318 1.00 24.04 ? 193  LYS C C   1 
ATOM   4556 O  O   . LYS C  1 170 ? 17.948  37.069 -11.163 1.00 18.17 ? 193  LYS C O   1 
ATOM   4557 C  CB  . LYS C  1 170 ? 19.977  39.000 -10.279 1.00 23.62 ? 193  LYS C CB  1 
ATOM   4558 C  CG  . LYS C  1 170 ? 21.261  39.817 -10.148 1.00 21.07 ? 193  LYS C CG  1 
ATOM   4559 C  CD  . LYS C  1 170 ? 20.917  41.286 -10.219 1.00 23.90 ? 193  LYS C CD  1 
ATOM   4560 C  CE  . LYS C  1 170 ? 21.621  42.091 -9.138  1.00 34.79 ? 193  LYS C CE  1 
ATOM   4561 N  NZ  . LYS C  1 170 ? 21.389  43.553 -9.347  1.00 34.79 ? 193  LYS C NZ  1 
ATOM   4562 N  N   . ASP C  1 171 ? 18.579  35.997 -9.297  1.00 19.42 ? 194  ASP C N   1 
ATOM   4563 C  CA  . ASP C  1 171 ? 17.350  35.203 -9.242  1.00 14.37 ? 194  ASP C CA  1 
ATOM   4564 C  C   . ASP C  1 171 ? 17.278  34.452 -7.929  1.00 18.00 ? 194  ASP C C   1 
ATOM   4565 O  O   . ASP C  1 171 ? 18.277  34.347 -7.218  1.00 17.62 ? 194  ASP C O   1 
ATOM   4566 C  CB  . ASP C  1 171 ? 17.391  34.146 -10.347 1.00 12.62 ? 194  ASP C CB  1 
ATOM   4567 C  CG  . ASP C  1 171 ? 16.006  33.590 -10.702 1.00 16.55 ? 194  ASP C CG  1 
ATOM   4568 O  OD1 . ASP C  1 171 ? 15.006  33.975 -10.055 1.00 18.02 ? 194  ASP C OD1 1 
ATOM   4569 O  OD2 . ASP C  1 171 ? 15.941  32.758 -11.643 1.00 19.38 ? 194  ASP C OD2 1 
ATOM   4570 N  N   . SER C  1 172 ? 16.103  33.923 -7.608  1.00 13.05 ? 195  SER C N   1 
ATOM   4571 C  CA  . SER C  1 172 ? 16.018  32.909 -6.544  1.00 17.87 ? 195  SER C CA  1 
ATOM   4572 C  C   . SER C  1 172 ? 16.381  31.528 -7.107  1.00 14.97 ? 195  SER C C   1 
ATOM   4573 O  O   . SER C  1 172 ? 16.544  31.366 -8.318  1.00 14.65 ? 195  SER C O   1 
ATOM   4574 C  CB  . SER C  1 172 ? 14.639  32.907 -5.853  1.00 12.79 ? 195  SER C CB  1 
ATOM   4575 O  OG  . SER C  1 172 ? 13.556  32.762 -6.759  1.00 18.41 ? 195  SER C OG  1 
ATOM   4576 N  N   . CYS C  1 173 ? 16.501  30.522 -6.235  1.00 12.24 ? 196  CYS C N   1 
ATOM   4577 C  CA  . CYS C  1 173 ? 17.046  29.256 -6.666  1.00 13.30 ? 196  CYS C CA  1 
ATOM   4578 C  C   . CYS C  1 173 ? 16.592  28.132 -5.745  1.00 11.57 ? 196  CYS C C   1 
ATOM   4579 O  O   . CYS C  1 173 ? 15.890  28.377 -4.768  1.00 13.08 ? 196  CYS C O   1 
ATOM   4580 C  CB  . CYS C  1 173 ? 18.579  29.332 -6.728  1.00 17.54 ? 196  CYS C CB  1 
ATOM   4581 S  SG  . CYS C  1 173 ? 19.328  28.160 -7.920  1.00 20.16 ? 196  CYS C SG  1 
ATOM   4582 N  N   . GLN C  1 174 ? 16.998  26.902 -6.047  1.00 14.20 ? 197  GLN C N   1 
ATOM   4583 C  CA  . GLN C  1 174 ? 16.543  25.749 -5.260  1.00 12.70 ? 197  GLN C CA  1 
ATOM   4584 C  C   . GLN C  1 174 ? 17.026  25.905 -3.832  1.00 13.69 ? 197  GLN C C   1 
ATOM   4585 O  O   . GLN C  1 174 ? 18.183  26.267 -3.593  1.00 13.87 ? 197  GLN C O   1 
ATOM   4586 C  CB  . GLN C  1 174 ? 17.051  24.441 -5.867  1.00 14.52 ? 197  GLN C CB  1 
ATOM   4587 C  CG  . GLN C  1 174 ? 16.236  23.968 -7.083  1.00 14.69 ? 197  GLN C CG  1 
ATOM   4588 C  CD  . GLN C  1 174 ? 16.387  24.866 -8.306  1.00 20.07 ? 197  GLN C CD  1 
ATOM   4589 O  OE1 . GLN C  1 174 ? 17.478  25.364 -8.606  1.00 18.45 ? 197  GLN C OE1 1 
ATOM   4590 N  NE2 . GLN C  1 174 ? 15.283  25.072 -9.020  1.00 16.51 ? 197  GLN C NE2 1 
ATOM   4591 N  N   . GLY C  1 175 ? 16.120  25.659 -2.892  1.00 10.66 ? 198  GLY C N   1 
ATOM   4592 C  CA  . GLY C  1 175 ? 16.367  25.890 -1.485  1.00 11.69 ? 198  GLY C CA  1 
ATOM   4593 C  C   . GLY C  1 175 ? 15.653  27.156 -1.045  1.00 8.96  ? 198  GLY C C   1 
ATOM   4594 O  O   . GLY C  1 175 ? 15.482  27.393 0.140   1.00 11.99 ? 198  GLY C O   1 
ATOM   4595 N  N   . ASP C  1 176 ? 15.241  27.988 -2.001  1.00 11.23 ? 199  ASP C N   1 
ATOM   4596 C  CA  . ASP C  1 176 ? 14.530  29.218 -1.664  1.00 10.56 ? 199  ASP C CA  1 
ATOM   4597 C  C   . ASP C  1 176 ? 13.013  29.037 -1.706  1.00 8.76  ? 199  ASP C C   1 
ATOM   4598 O  O   . ASP C  1 176 ? 12.285  29.909 -1.222  1.00 12.27 ? 199  ASP C O   1 
ATOM   4599 C  CB  . ASP C  1 176 ? 14.901  30.374 -2.627  1.00 10.93 ? 199  ASP C CB  1 
ATOM   4600 C  CG  . ASP C  1 176 ? 16.359  30.837 -2.483  1.00 14.76 ? 199  ASP C CG  1 
ATOM   4601 O  OD1 . ASP C  1 176 ? 16.875  30.869 -1.353  1.00 11.14 ? 199  ASP C OD1 1 
ATOM   4602 O  OD2 . ASP C  1 176 ? 16.999  31.159 -3.502  1.00 14.59 ? 199  ASP C OD2 1 
ATOM   4603 N  N   . SER C  1 177 ? 12.528  27.930 -2.275  1.00 9.07  ? 200  SER C N   1 
ATOM   4604 C  CA  . SER C  1 177 ? 11.088  27.674 -2.374  1.00 9.29  ? 200  SER C CA  1 
ATOM   4605 C  C   . SER C  1 177 ? 10.326  28.037 -1.120  1.00 11.45 ? 200  SER C C   1 
ATOM   4606 O  O   . SER C  1 177 ? 10.750  27.695 -0.008  1.00 11.75 ? 200  SER C O   1 
ATOM   4607 C  CB  . SER C  1 177 ? 10.793  26.177 -2.653  1.00 9.84  ? 200  SER C CB  1 
ATOM   4608 O  OG  . SER C  1 177 ? 10.622  25.958 -4.054  1.00 12.24 ? 200  SER C OG  1 
ATOM   4609 N  N   . GLY C  1 178 ? 9.198   28.723 -1.319  1.00 9.73  ? 201  GLY C N   1 
ATOM   4610 C  CA  . GLY C  1 178 ? 8.289   29.063 -0.252  1.00 11.09 ? 201  GLY C CA  1 
ATOM   4611 C  C   . GLY C  1 178 ? 8.608   30.390 0.418   1.00 8.75  ? 201  GLY C C   1 
ATOM   4612 O  O   . GLY C  1 178 ? 7.830   30.874 1.238   1.00 14.32 ? 201  GLY C O   1 
ATOM   4613 N  N   . GLY C  1 179 ? 9.763   30.962 0.077   1.00 9.72  ? 202  GLY C N   1 
ATOM   4614 C  CA  . GLY C  1 179 ? 10.256  32.146 0.747   1.00 13.88 ? 202  GLY C CA  1 
ATOM   4615 C  C   . GLY C  1 179 ? 9.527   33.383 0.276   1.00 14.59 ? 202  GLY C C   1 
ATOM   4616 O  O   . GLY C  1 179 ? 8.705   33.331 -0.650  1.00 12.18 ? 202  GLY C O   1 
ATOM   4617 N  N   . PRO C  1 180 ? 9.819   34.514 0.918   1.00 11.12 ? 203  PRO C N   1 
ATOM   4618 C  CA  . PRO C  1 180 ? 9.094   35.761 0.648   1.00 12.34 ? 203  PRO C CA  1 
ATOM   4619 C  C   . PRO C  1 180 ? 9.557   36.565 -0.573  1.00 10.56 ? 203  PRO C C   1 
ATOM   4620 O  O   . PRO C  1 180 ? 10.755  36.618 -0.935  1.00 15.23 ? 203  PRO C O   1 
ATOM   4621 C  CB  . PRO C  1 180 ? 9.304   36.567 1.950   1.00 11.32 ? 203  PRO C CB  1 
ATOM   4622 C  CG  . PRO C  1 180 ? 10.637  36.086 2.460   1.00 17.60 ? 203  PRO C CG  1 
ATOM   4623 C  CD  . PRO C  1 180 ? 10.660  34.594 2.126   1.00 12.20 ? 203  PRO C CD  1 
ATOM   4624 N  N   . VAL C  1 181 ? 8.579   37.202 -1.211  1.00 12.32 ? 204  VAL C N   1 
ATOM   4625 C  CA  . VAL C  1 181 ? 8.847   38.310 -2.125  1.00 13.06 ? 204  VAL C CA  1 
ATOM   4626 C  C   . VAL C  1 181 ? 8.121   39.503 -1.540  1.00 14.81 ? 204  VAL C C   1 
ATOM   4627 O  O   . VAL C  1 181 ? 6.885   39.522 -1.463  1.00 15.97 ? 204  VAL C O   1 
ATOM   4628 C  CB  . VAL C  1 181 ? 8.315   38.049 -3.522  1.00 13.71 ? 204  VAL C CB  1 
ATOM   4629 C  CG1 . VAL C  1 181 ? 8.595   39.271 -4.410  1.00 15.37 ? 204  VAL C CG1 1 
ATOM   4630 C  CG2 . VAL C  1 181 ? 8.985   36.823 -4.116  1.00 15.63 ? 204  VAL C CG2 1 
ATOM   4631 N  N   . VAL C  1 182 ? 8.890   40.483 -1.083  1.00 18.13 ? 205  VAL C N   1 
ATOM   4632 C  CA  . VAL C  1 182 ? 8.291   41.583 -0.346  1.00 15.38 ? 205  VAL C CA  1 
ATOM   4633 C  C   . VAL C  1 182 ? 8.553   42.884 -1.075  1.00 16.68 ? 205  VAL C C   1 
ATOM   4634 O  O   . VAL C  1 182 ? 9.695   43.167 -1.459  1.00 16.61 ? 205  VAL C O   1 
ATOM   4635 C  CB  . VAL C  1 182 ? 8.819   41.651 1.114   1.00 13.17 ? 205  VAL C CB  1 
ATOM   4636 C  CG1 . VAL C  1 182 ? 8.484   43.008 1.749   1.00 19.67 ? 205  VAL C CG1 1 
ATOM   4637 C  CG2 . VAL C  1 182 ? 8.240   40.515 1.930   1.00 14.73 ? 205  VAL C CG2 1 
ATOM   4638 N  N   . CYS C  1 183 ? 7.475   43.634 -1.302  1.00 17.74 ? 206  CYS C N   1 
ATOM   4639 C  CA  . CYS C  1 183 ? 7.531   44.887 -2.047  1.00 18.15 ? 206  CYS C CA  1 
ATOM   4640 C  C   . CYS C  1 183 ? 6.797   45.966 -1.257  1.00 18.88 ? 206  CYS C C   1 
ATOM   4641 O  O   . CYS C  1 183 ? 5.613   45.797 -0.923  1.00 20.69 ? 206  CYS C O   1 
ATOM   4642 C  CB  . CYS C  1 183 ? 6.875   44.734 -3.422  1.00 25.66 ? 206  CYS C CB  1 
ATOM   4643 S  SG  . CYS C  1 183 ? 7.135   43.142 -4.308  1.00 23.88 ? 206  CYS C SG  1 
ATOM   4644 N  N   . SER C  1 184 ? 7.503   47.054 -0.948  1.00 23.39 ? 207  SER C N   1 
ATOM   4645 C  CA  . SER C  1 184 ? 6.955   48.136 -0.117  1.00 25.52 ? 207  SER C CA  1 
ATOM   4646 C  C   . SER C  1 184 ? 6.368   47.601 1.181   1.00 24.08 ? 207  SER C C   1 
ATOM   4647 O  O   . SER C  1 184 ? 5.255   47.957 1.564   1.00 29.46 ? 207  SER C O   1 
ATOM   4648 C  CB  . SER C  1 184 ? 5.872   48.915 -0.879  1.00 31.74 ? 207  SER C CB  1 
ATOM   4649 O  OG  . SER C  1 184 ? 6.262   49.192 -2.219  1.00 34.51 ? 207  SER C OG  1 
ATOM   4650 N  N   . GLY C  1 185 ? 7.096   46.706 1.843   1.00 26.43 ? 208  GLY C N   1 
ATOM   4651 C  CA  . GLY C  1 185 ? 6.622   46.121 3.085   1.00 24.60 ? 208  GLY C CA  1 
ATOM   4652 C  C   . GLY C  1 185 ? 5.381   45.227 3.033   1.00 23.74 ? 208  GLY C C   1 
ATOM   4653 O  O   . GLY C  1 185 ? 4.771   44.956 4.069   1.00 29.46 ? 208  GLY C O   1 
ATOM   4654 N  N   . LYS C  1 186 ? 5.002   44.750 1.842   1.00 20.86 ? 209  LYS C N   1 
ATOM   4655 C  CA  . LYS C  1 186 ? 3.912   43.782 1.741   1.00 20.74 ? 209  LYS C CA  1 
ATOM   4656 C  C   . LYS C  1 186 ? 4.401   42.497 1.072   1.00 10.23 ? 209  LYS C C   1 
ATOM   4657 O  O   . LYS C  1 186 ? 5.224   42.540 0.146   1.00 18.09 ? 209  LYS C O   1 
ATOM   4658 C  CB  . LYS C  1 186 ? 2.742   44.341 0.929   1.00 21.74 ? 209  LYS C CB  1 
ATOM   4659 C  CG  . LYS C  1 186 ? 2.453   45.806 1.216   1.00 29.11 ? 209  LYS C CG  1 
ATOM   4660 C  CD  . LYS C  1 186 ? 1.873   45.991 2.605   1.00 30.17 ? 209  LYS C CD  1 
ATOM   4661 C  CE  . LYS C  1 186 ? 1.807   47.470 2.945   1.00 32.92 ? 209  LYS C CE  1 
ATOM   4662 N  NZ  . LYS C  1 186 ? 0.733   47.748 3.935   1.00 37.61 ? 209  LYS C NZ  1 
ATOM   4663 N  N   . LEU C  1 187 ? 3.895   41.379 1.571   1.00 17.83 ? 210  LEU C N   1 
ATOM   4664 C  CA  . LEU C  1 187 ? 4.200   40.069 0.987   1.00 13.96 ? 210  LEU C CA  1 
ATOM   4665 C  C   . LEU C  1 187 ? 3.400   39.928 -0.298  1.00 11.27 ? 210  LEU C C   1 
ATOM   4666 O  O   . LEU C  1 187 ? 2.205   39.610 -0.255  1.00 18.03 ? 210  LEU C O   1 
ATOM   4667 C  CB  . LEU C  1 187 ? 3.776   38.959 1.942   1.00 17.78 ? 210  LEU C CB  1 
ATOM   4668 C  CG  . LEU C  1 187 ? 4.099   37.522 1.478   1.00 13.49 ? 210  LEU C CG  1 
ATOM   4669 C  CD1 . LEU C  1 187 ? 5.610   37.352 1.375   1.00 15.32 ? 210  LEU C CD1 1 
ATOM   4670 C  CD2 . LEU C  1 187 ? 3.481   36.497 2.398   1.00 16.00 ? 210  LEU C CD2 1 
ATOM   4671 N  N   . GLN C  1 188 ? 4.061   40.118 -1.429  1.00 15.73 ? 211  GLN C N   1 
ATOM   4672 C  CA  . GLN C  1 188 ? 3.383   40.001 -2.705  1.00 14.40 ? 211  GLN C CA  1 
ATOM   4673 C  C   . GLN C  1 188 ? 3.576   38.630 -3.364  1.00 16.74 ? 211  GLN C C   1 
ATOM   4674 O  O   . GLN C  1 188 ? 2.685   38.146 -4.074  1.00 16.12 ? 211  GLN C O   1 
ATOM   4675 C  CB  . GLN C  1 188 ? 3.809   41.142 -3.629  1.00 16.71 ? 211  GLN C CB  1 
ATOM   4676 C  CG  . GLN C  1 188 ? 3.388   42.553 -3.109  1.00 15.59 ? 211  GLN C CG  1 
ATOM   4677 C  CD  . GLN C  1 188 ? 1.888   42.814 -3.268  1.00 21.51 ? 211  GLN C CD  1 
ATOM   4678 O  OE1 . GLN C  1 188 ? 1.127   41.935 -3.682  1.00 21.82 ? 211  GLN C OE1 1 
ATOM   4679 N  NE2 . GLN C  1 188 ? 1.461   44.032 -2.945  1.00 22.40 ? 211  GLN C NE2 1 
ATOM   4680 N  N   . GLY C  1 189 ? 4.717   37.997 -3.115  1.00 19.37 ? 212  GLY C N   1 
ATOM   4681 C  CA  . GLY C  1 189 ? 5.021   36.760 -3.811  1.00 13.39 ? 212  GLY C CA  1 
ATOM   4682 C  C   . GLY C  1 189 ? 5.565   35.680 -2.901  1.00 16.39 ? 212  GLY C C   1 
ATOM   4683 O  O   . GLY C  1 189 ? 5.987   35.960 -1.779  1.00 13.16 ? 212  GLY C O   1 
ATOM   4684 N  N   . ILE C  1 190 ? 5.544   34.439 -3.400  1.00 15.49 ? 213  ILE C N   1 
ATOM   4685 C  CA  . ILE C  1 190 ? 6.102   33.278 -2.695  1.00 13.14 ? 213  ILE C CA  1 
ATOM   4686 C  C   . ILE C  1 190 ? 6.992   32.590 -3.707  1.00 9.67  ? 213  ILE C C   1 
ATOM   4687 O  O   . ILE C  1 190 ? 6.565   32.391 -4.854  1.00 13.82 ? 213  ILE C O   1 
ATOM   4688 C  CB  . ILE C  1 190 ? 5.016   32.264 -2.306  1.00 13.95 ? 213  ILE C CB  1 
ATOM   4689 C  CG1 . ILE C  1 190 ? 3.976   32.881 -1.354  1.00 13.61 ? 213  ILE C CG1 1 
ATOM   4690 C  CG2 . ILE C  1 190 ? 5.659   30.984 -1.658  1.00 16.24 ? 213  ILE C CG2 1 
ATOM   4691 C  CD1 . ILE C  1 190 ? 2.644   32.115 -1.312  1.00 13.82 ? 213  ILE C CD1 1 
ATOM   4692 N  N   . VAL C  1 191 ? 8.234   32.273 -3.335  1.00 11.20 ? 214  VAL C N   1 
ATOM   4693 C  CA  . VAL C  1 191 ? 9.158   31.632 -4.279  1.00 11.62 ? 214  VAL C CA  1 
ATOM   4694 C  C   . VAL C  1 191 ? 8.559   30.308 -4.736  1.00 9.65  ? 214  VAL C C   1 
ATOM   4695 O  O   . VAL C  1 191 ? 8.219   29.469 -3.906  1.00 11.91 ? 214  VAL C O   1 
ATOM   4696 C  CB  . VAL C  1 191 ? 10.517  31.315 -3.619  1.00 13.52 ? 214  VAL C CB  1 
ATOM   4697 C  CG1 . VAL C  1 191 ? 11.476  30.721 -4.651  1.00 13.24 ? 214  VAL C CG1 1 
ATOM   4698 C  CG2 . VAL C  1 191 ? 11.119  32.572 -2.950  1.00 15.99 ? 214  VAL C CG2 1 
ATOM   4699 N  N   . SER C  1 192 ? 8.393   30.121 -6.047  1.00 13.51 ? 215  SER C N   1 
ATOM   4700 C  CA  . SER C  1 192 ? 7.688   28.938 -6.522  1.00 11.40 ? 215  SER C CA  1 
ATOM   4701 C  C   . SER C  1 192 ? 8.514   28.144 -7.521  1.00 13.38 ? 215  SER C C   1 
ATOM   4702 O  O   . SER C  1 192 ? 9.031   27.071 -7.197  1.00 13.82 ? 215  SER C O   1 
ATOM   4703 C  CB  . SER C  1 192 ? 6.337   29.344 -7.111  1.00 14.01 ? 215  SER C CB  1 
ATOM   4704 O  OG  . SER C  1 192 ? 5.562   28.226 -7.507  1.00 13.83 ? 215  SER C OG  1 
ATOM   4705 N  N   . TRP C  1 193 ? 8.679   28.670 -8.731  1.00 10.07 ? 216  TRP C N   1 
ATOM   4706 C  CA  . TRP C  1 193 ? 9.384   27.913 -9.758  1.00 10.94 ? 216  TRP C CA  1 
ATOM   4707 C  C   . TRP C  1 193 ? 10.084  28.774 -10.796 1.00 10.74 ? 216  TRP C C   1 
ATOM   4708 O  O   . TRP C  1 193 ? 10.061  29.999 -10.725 1.00 13.04 ? 216  TRP C O   1 
ATOM   4709 C  CB  . TRP C  1 193 ? 8.420   26.947 -10.454 1.00 12.90 ? 216  TRP C CB  1 
ATOM   4710 C  CG  . TRP C  1 193 ? 7.286   27.605 -11.262 1.00 10.37 ? 216  TRP C CG  1 
ATOM   4711 C  CD1 . TRP C  1 193 ? 6.091   28.075 -10.779 1.00 10.08 ? 216  TRP C CD1 1 
ATOM   4712 C  CD2 . TRP C  1 193 ? 7.234   27.782 -12.690 1.00 10.44 ? 216  TRP C CD2 1 
ATOM   4713 N  NE1 . TRP C  1 193 ? 5.315   28.550 -11.819 1.00 11.46 ? 216  TRP C NE1 1 
ATOM   4714 C  CE2 . TRP C  1 193 ? 5.995   28.387 -12.996 1.00 9.32  ? 216  TRP C CE2 1 
ATOM   4715 C  CE3 . TRP C  1 193 ? 8.129   27.520 -13.729 1.00 11.92 ? 216  TRP C CE3 1 
ATOM   4716 C  CZ2 . TRP C  1 193 ? 5.607   28.720 -14.319 1.00 12.29 ? 216  TRP C CZ2 1 
ATOM   4717 C  CZ3 . TRP C  1 193 ? 7.740   27.847 -15.058 1.00 14.00 ? 216  TRP C CZ3 1 
ATOM   4718 C  CH2 . TRP C  1 193 ? 6.487   28.436 -15.324 1.00 12.01 ? 216  TRP C CH2 1 
ATOM   4719 N  N   . GLY C  1 194 ? 10.726  28.112 -11.751 1.00 12.16 ? 217  GLY C N   1 
ATOM   4720 C  CA  . GLY C  1 194 ? 11.402  28.773 -12.863 1.00 9.17  ? 217  GLY C CA  1 
ATOM   4721 C  C   . GLY C  1 194 ? 12.134  27.728 -13.667 1.00 17.65 ? 217  GLY C C   1 
ATOM   4722 O  O   . GLY C  1 194 ? 12.186  26.556 -13.272 1.00 18.93 ? 217  GLY C O   1 
ATOM   4723 N  N   . SER C  1 195 ? 12.681  28.129 -14.806 1.00 15.77 ? 218  SER C N   1 
ATOM   4724 C  CA  A SER C  1 195 ? 13.512  27.230 -15.593 0.20 19.08 ? 218  SER C CA  1 
ATOM   4725 C  CA  B SER C  1 195 ? 13.512  27.233 -15.588 0.80 19.10 ? 218  SER C CA  1 
ATOM   4726 C  C   . SER C  1 195 ? 14.968  27.473 -15.227 1.00 21.05 ? 218  SER C C   1 
ATOM   4727 O  O   . SER C  1 195 ? 15.558  28.491 -15.623 1.00 19.79 ? 218  SER C O   1 
ATOM   4728 C  CB  A SER C  1 195 ? 13.290  27.444 -17.090 0.20 19.62 ? 218  SER C CB  1 
ATOM   4729 C  CB  B SER C  1 195 ? 13.282  27.446 -17.085 0.80 19.64 ? 218  SER C CB  1 
ATOM   4730 O  OG  A SER C  1 195 ? 13.980  26.459 -17.838 0.20 20.95 ? 218  SER C OG  1 
ATOM   4731 O  OG  B SER C  1 195 ? 14.041  26.501 -17.813 0.80 20.97 ? 218  SER C OG  1 
ATOM   4732 N  N   . GLY C  1 196 ? 15.536  26.553 -14.450 1.00 18.68 ? 219  GLY C N   1 
ATOM   4733 C  CA  . GLY C  1 196 ? 16.872  26.723 -13.900 1.00 17.16 ? 219  GLY C CA  1 
ATOM   4734 C  C   . GLY C  1 196 ? 16.889  27.940 -12.981 1.00 23.26 ? 219  GLY C C   1 
ATOM   4735 O  O   . GLY C  1 196 ? 15.841  28.343 -12.484 1.00 20.77 ? 219  GLY C O   1 
ATOM   4736 N  N   . CYS C  1 197 ? 18.062  28.537 -12.775 1.00 17.09 ? 220  CYS C N   1 
ATOM   4737 C  CA  . CYS C  1 197 ? 18.171  29.736 -11.950 1.00 17.90 ? 220  CYS C CA  1 
ATOM   4738 C  C   . CYS C  1 197 ? 19.020  30.785 -12.651 1.00 14.51 ? 220  CYS C C   1 
ATOM   4739 O  O   . CYS C  1 197 ? 20.087  30.457 -13.172 1.00 23.91 ? 220  CYS C O   1 
ATOM   4740 C  CB  . CYS C  1 197 ? 18.861  29.431 -10.616 1.00 26.50 ? 220  CYS C CB  1 
ATOM   4741 S  SG  . CYS C  1 197 ? 18.125  28.124 -9.605  1.00 29.52 ? 220  CYS C SG  1 
ATOM   4742 N  N   . ALA C  1 198 ? 18.582  32.036 -12.577 1.00 18.40 ? 221  ALA C N   1 
ATOM   4743 C  CA  . ALA C  1 198 ? 19.320  33.198 -13.111 1.00 21.40 ? 221  ALA C CA  1 
ATOM   4744 C  C   . ALA C  1 198 ? 19.725  33.065 -14.583 1.00 27.58 ? 221  ALA C C   1 
ATOM   4745 O  O   . ALA C  1 198 ? 20.730  33.643 -15.011 1.00 22.87 ? 221  ALA C O   1 
ATOM   4746 C  CB  . ALA C  1 198 ? 20.542  33.526 -12.245 1.00 18.37 ? 221  ALA C CB  1 
ATOM   4747 N  N   . GLN C  1 199 ? 18.948  32.315 -15.354 1.00 19.21 ? 222  GLN C N   1 
ATOM   4748 C  CA  . GLN C  1 199 ? 19.230  32.162 -16.779 1.00 17.98 ? 222  GLN C CA  1 
ATOM   4749 C  C   . GLN C  1 199 ? 18.538  33.284 -17.530 1.00 19.72 ? 222  GLN C C   1 
ATOM   4750 O  O   . GLN C  1 199 ? 17.516  33.821 -17.078 1.00 16.38 ? 222  GLN C O   1 
ATOM   4751 C  CB  . GLN C  1 199 ? 18.778  30.787 -17.270 1.00 19.84 ? 222  GLN C CB  1 
ATOM   4752 C  CG  . GLN C  1 199 ? 19.304  29.660 -16.407 1.00 21.47 ? 222  GLN C CG  1 
ATOM   4753 C  CD  . GLN C  1 199 ? 20.600  29.047 -16.929 1.00 28.96 ? 222  GLN C CD  1 
ATOM   4754 O  OE1 . GLN C  1 199 ? 21.376  29.691 -17.647 1.00 35.53 ? 222  GLN C OE1 1 
ATOM   4755 N  NE2 . GLN C  1 199 ? 20.833  27.784 -16.576 1.00 38.57 ? 222  GLN C NE2 1 
ATOM   4756 N  N   . LYS C  1 200 ? 19.096  33.663 -18.673 1.00 24.41 ? 223  LYS C N   1 
ATOM   4757 C  CA  . LYS C  1 200 ? 18.498  34.764 -19.406 1.00 23.79 ? 223  LYS C CA  1 
ATOM   4758 C  C   . LYS C  1 200 ? 17.127  34.333 -19.921 1.00 19.11 ? 223  LYS C C   1 
ATOM   4759 O  O   . LYS C  1 200 ? 16.926  33.164 -20.270 1.00 20.85 ? 223  LYS C O   1 
ATOM   4760 C  CB  . LYS C  1 200 ? 19.422  35.239 -20.528 1.00 26.77 ? 223  LYS C CB  1 
ATOM   4761 C  CG  . LYS C  1 200 ? 19.892  34.151 -21.433 1.00 28.58 ? 223  LYS C CG  1 
ATOM   4762 C  CD  . LYS C  1 200 ? 21.313  34.423 -21.928 1.00 37.66 ? 223  LYS C CD  1 
ATOM   4763 C  CE  . LYS C  1 200 ? 21.575  33.656 -23.210 1.00 23.98 ? 223  LYS C CE  1 
ATOM   4764 N  NZ  . LYS C  1 200 ? 22.949  33.093 -23.283 1.00 39.11 ? 223  LYS C NZ  1 
ATOM   4765 N  N   . ASN C  1 201 ? 16.195  35.281 -19.911 1.00 18.10 ? 224  ASN C N   1 
ATOM   4766 C  CA  . ASN C  1 201 ? 14.817  35.100 -20.375 1.00 24.61 ? 224  ASN C CA  1 
ATOM   4767 C  C   . ASN C  1 201 ? 14.021  34.113 -19.559 1.00 21.75 ? 224  ASN C C   1 
ATOM   4768 O  O   . ASN C  1 201 ? 12.945  33.685 -19.984 1.00 19.71 ? 224  ASN C O   1 
ATOM   4769 C  CB  . ASN C  1 201 ? 14.745  34.680 -21.848 1.00 23.08 ? 224  ASN C CB  1 
ATOM   4770 C  CG  . ASN C  1 201 ? 15.596  35.529 -22.723 1.00 35.41 ? 224  ASN C CG  1 
ATOM   4771 O  OD1 . ASN C  1 201 ? 15.402  36.748 -22.801 1.00 31.45 ? 224  ASN C OD1 1 
ATOM   4772 N  ND2 . ASN C  1 201 ? 16.560  34.901 -23.393 1.00 36.76 ? 224  ASN C ND2 1 
ATOM   4773 N  N   . LYS C  1 202 ? 14.556  33.755 -18.398 1.00 24.59 ? 225  LYS C N   1 
ATOM   4774 C  CA  . LYS C  1 202 ? 13.910  32.796 -17.511 1.00 17.78 ? 225  LYS C CA  1 
ATOM   4775 C  C   . LYS C  1 202 ? 13.881  33.321 -16.088 1.00 19.74 ? 225  LYS C C   1 
ATOM   4776 O  O   . LYS C  1 202 ? 14.581  32.797 -15.224 1.00 16.57 ? 225  LYS C O   1 
ATOM   4777 C  CB  . LYS C  1 202 ? 14.643  31.458 -17.569 1.00 13.52 ? 225  LYS C CB  1 
ATOM   4778 C  CG  . LYS C  1 202 ? 14.537  30.769 -18.934 1.00 18.29 ? 225  LYS C CG  1 
ATOM   4779 C  CD  . LYS C  1 202 ? 13.082  30.469 -19.267 1.00 20.08 ? 225  LYS C CD  1 
ATOM   4780 C  CE  . LYS C  1 202 ? 12.939  29.718 -20.598 1.00 26.61 ? 225  LYS C CE  1 
ATOM   4781 N  NZ  . LYS C  1 202 ? 11.488  29.372 -20.852 1.00 26.41 ? 225  LYS C NZ  1 
ATOM   4782 N  N   . PRO C  1 203 ? 13.072  34.366 -15.837 1.00 18.63 ? 226  PRO C N   1 
ATOM   4783 C  CA  . PRO C  1 203 ? 12.999  34.905 -14.479 1.00 23.63 ? 226  PRO C CA  1 
ATOM   4784 C  C   . PRO C  1 203 ? 12.278  33.943 -13.540 1.00 21.22 ? 226  PRO C C   1 
ATOM   4785 O  O   . PRO C  1 203 ? 11.613  32.998 -13.984 1.00 17.97 ? 226  PRO C O   1 
ATOM   4786 C  CB  . PRO C  1 203 ? 12.125  36.142 -14.660 1.00 21.27 ? 226  PRO C CB  1 
ATOM   4787 C  CG  . PRO C  1 203 ? 11.260  35.804 -15.858 1.00 16.21 ? 226  PRO C CG  1 
ATOM   4788 C  CD  . PRO C  1 203 ? 12.235  35.143 -16.767 1.00 16.30 ? 226  PRO C CD  1 
ATOM   4789 N  N   . GLY C  1 204 ? 12.391  34.197 -12.246 1.00 16.01 ? 227  GLY C N   1 
ATOM   4790 C  CA  . GLY C  1 204 ? 11.596  33.462 -11.284 1.00 16.16 ? 227  GLY C CA  1 
ATOM   4791 C  C   . GLY C  1 204 ? 10.115  33.714 -11.467 1.00 16.96 ? 227  GLY C C   1 
ATOM   4792 O  O   . GLY C  1 204 ? 9.695   34.818 -11.833 1.00 18.17 ? 227  GLY C O   1 
ATOM   4793 N  N   . VAL C  1 205 ? 9.320   32.675 -11.214 1.00 10.68 ? 228  VAL C N   1 
ATOM   4794 C  CA  . VAL C  1 205 ? 7.872   32.768 -11.188 1.00 10.67 ? 228  VAL C CA  1 
ATOM   4795 C  C   . VAL C  1 205 ? 7.415   32.596 -9.766  1.00 13.86 ? 228  VAL C C   1 
ATOM   4796 O  O   . VAL C  1 205 ? 7.868   31.694 -9.064  1.00 14.53 ? 228  VAL C O   1 
ATOM   4797 C  CB  . VAL C  1 205 ? 7.233   31.690 -12.082 1.00 11.05 ? 228  VAL C CB  1 
ATOM   4798 C  CG1 . VAL C  1 205 ? 5.683   31.808 -12.072 1.00 12.44 ? 228  VAL C CG1 1 
ATOM   4799 C  CG2 . VAL C  1 205 ? 7.794   31.800 -13.480 1.00 13.86 ? 228  VAL C CG2 1 
ATOM   4800 N  N   . TYR C  1 206 ? 6.496   33.449 -9.331  1.00 13.08 ? 229  TYR C N   1 
ATOM   4801 C  CA  . TYR C  1 206 ? 6.138   33.545 -7.930  1.00 13.97 ? 229  TYR C CA  1 
ATOM   4802 C  C   . TYR C  1 206 ? 4.634   33.498 -7.755  1.00 14.16 ? 229  TYR C C   1 
ATOM   4803 O  O   . TYR C  1 206 ? 3.888   34.046 -8.563  1.00 15.89 ? 229  TYR C O   1 
ATOM   4804 C  CB  . TYR C  1 206 ? 6.692   34.871 -7.341  1.00 11.85 ? 229  TYR C CB  1 
ATOM   4805 C  CG  . TYR C  1 206 ? 8.199   34.942 -7.420  1.00 14.59 ? 229  TYR C CG  1 
ATOM   4806 C  CD1 . TYR C  1 206 ? 8.833   35.445 -8.547  1.00 11.06 ? 229  TYR C CD1 1 
ATOM   4807 C  CD2 . TYR C  1 206 ? 8.990   34.443 -6.390  1.00 12.78 ? 229  TYR C CD2 1 
ATOM   4808 C  CE1 . TYR C  1 206 ? 10.237  35.479 -8.635  1.00 14.45 ? 229  TYR C CE1 1 
ATOM   4809 C  CE2 . TYR C  1 206 ? 10.380  34.493 -6.454  1.00 12.02 ? 229  TYR C CE2 1 
ATOM   4810 C  CZ  . TYR C  1 206 ? 10.997  34.989 -7.585  1.00 11.18 ? 229  TYR C CZ  1 
ATOM   4811 O  OH  . TYR C  1 206 ? 12.375  35.028 -7.682  1.00 13.74 ? 229  TYR C OH  1 
ATOM   4812 N  N   . THR C  1 207 ? 4.182   32.867 -6.683  1.00 11.44 ? 230  THR C N   1 
ATOM   4813 C  CA  . THR C  1 207 ? 2.759   32.842 -6.363  1.00 9.04  ? 230  THR C CA  1 
ATOM   4814 C  C   . THR C  1 207 ? 2.293   34.261 -6.049  1.00 16.32 ? 230  THR C C   1 
ATOM   4815 O  O   . THR C  1 207 ? 2.877   34.929 -5.212  1.00 17.23 ? 230  THR C O   1 
ATOM   4816 C  CB  . THR C  1 207 ? 2.513   31.949 -5.173  1.00 13.67 ? 230  THR C CB  1 
ATOM   4817 O  OG1 . THR C  1 207 ? 3.190   30.702 -5.400  1.00 13.02 ? 230  THR C OG1 1 
ATOM   4818 C  CG2 . THR C  1 207 ? 1.036   31.697 -4.985  1.00 14.17 ? 230  THR C CG2 1 
ATOM   4819 N  N   . LYS C  1 208 ? 1.257   34.714 -6.742  1.00 13.37 ? 231  LYS C N   1 
ATOM   4820 C  CA  . LYS C  1 208 ? 0.719   36.077 -6.554  1.00 13.90 ? 231  LYS C CA  1 
ATOM   4821 C  C   . LYS C  1 208 ? -0.148  36.187 -5.280  1.00 18.78 ? 231  LYS C C   1 
ATOM   4822 O  O   . LYS C  1 208 ? -1.348  35.950 -5.337  1.00 20.01 ? 231  LYS C O   1 
ATOM   4823 C  CB  . LYS C  1 208 ? -0.102  36.450 -7.803  1.00 18.57 ? 231  LYS C CB  1 
ATOM   4824 C  CG  . LYS C  1 208 ? -0.561  37.908 -7.896  1.00 19.95 ? 231  LYS C CG  1 
ATOM   4825 C  CD  . LYS C  1 208 ? -0.850  38.265 -9.357  1.00 23.24 ? 231  LYS C CD  1 
ATOM   4826 C  CE  . LYS C  1 208 ? -1.942  39.300 -9.467  1.00 34.20 ? 231  LYS C CE  1 
ATOM   4827 N  NZ  . LYS C  1 208 ? -1.680  40.220 -10.618 1.00 40.28 ? 231  LYS C NZ  1 
ATOM   4828 N  N   . VAL C  1 209 ? 0.455   36.516 -4.126  1.00 17.05 ? 232  VAL C N   1 
ATOM   4829 C  CA  . VAL C  1 209 ? -0.252  36.490 -2.831  1.00 19.97 ? 232  VAL C CA  1 
ATOM   4830 C  C   . VAL C  1 209 ? -1.535  37.341 -2.764  1.00 18.49 ? 232  VAL C C   1 
ATOM   4831 O  O   . VAL C  1 209 ? -2.523  36.943 -2.155  1.00 18.32 ? 232  VAL C O   1 
ATOM   4832 C  CB  . VAL C  1 209 ? 0.678   36.872 -1.629  1.00 18.60 ? 232  VAL C CB  1 
ATOM   4833 C  CG1 . VAL C  1 209 ? -0.112  36.972 -0.321  1.00 18.28 ? 232  VAL C CG1 1 
ATOM   4834 C  CG2 . VAL C  1 209 ? 1.819   35.860 -1.482  1.00 20.36 ? 232  VAL C CG2 1 
ATOM   4835 N  N   . CYS C  1 210 ? -1.515  38.492 -3.416  1.00 20.76 ? 233  CYS C N   1 
ATOM   4836 C  CA  . CYS C  1 210 ? -2.671  39.390 -3.395  1.00 24.90 ? 233  CYS C CA  1 
ATOM   4837 C  C   . CYS C  1 210 ? -4.002  38.726 -3.805  1.00 28.28 ? 233  CYS C C   1 
ATOM   4838 O  O   . CYS C  1 210 ? -5.065  39.184 -3.400  1.00 26.12 ? 233  CYS C O   1 
ATOM   4839 C  CB  . CYS C  1 210 ? -2.391  40.632 -4.242  1.00 20.55 ? 233  CYS C CB  1 
ATOM   4840 S  SG  . CYS C  1 210 ? -2.220  40.312 -6.015  1.00 23.63 ? 233  CYS C SG  1 
ATOM   4841 N  N   . ASN C  1 211 ? -3.952  37.648 -4.593  1.00 23.52 ? 234  ASN C N   1 
ATOM   4842 C  CA  . ASN C  1 211 ? -5.183  36.903 -4.908  1.00 18.12 ? 234  ASN C CA  1 
ATOM   4843 C  C   . ASN C  1 211 ? -5.668  35.963 -3.825  1.00 24.57 ? 234  ASN C C   1 
ATOM   4844 O  O   . ASN C  1 211 ? -6.721  35.326 -3.969  1.00 22.39 ? 234  ASN C O   1 
ATOM   4845 C  CB  . ASN C  1 211 ? -5.040  36.120 -6.225  1.00 21.85 ? 234  ASN C CB  1 
ATOM   4846 C  CG  . ASN C  1 211 ? -4.712  37.007 -7.397  1.00 30.18 ? 234  ASN C CG  1 
ATOM   4847 O  OD1 . ASN C  1 211 ? -4.935  38.223 -7.358  1.00 22.38 ? 234  ASN C OD1 1 
ATOM   4848 N  ND2 . ASN C  1 211 ? -4.173  36.410 -8.453  1.00 23.56 ? 234  ASN C ND2 1 
ATOM   4849 N  N   . TYR C  1 212 ? -4.919  35.860 -2.732  1.00 18.44 ? 235  TYR C N   1 
ATOM   4850 C  CA  . TYR C  1 212 ? -5.240  34.862 -1.731  1.00 20.87 ? 235  TYR C CA  1 
ATOM   4851 C  C   . TYR C  1 212 ? -5.525  35.473 -0.365  1.00 18.21 ? 235  TYR C C   1 
ATOM   4852 O  O   . TYR C  1 212 ? -5.805  34.742 0.582   1.00 24.54 ? 235  TYR C O   1 
ATOM   4853 C  CB  . TYR C  1 212 ? -4.118  33.826 -1.630  1.00 21.10 ? 235  TYR C CB  1 
ATOM   4854 C  CG  . TYR C  1 212 ? -3.938  33.059 -2.922  1.00 19.65 ? 235  TYR C CG  1 
ATOM   4855 C  CD1 . TYR C  1 212 ? -4.693  31.915 -3.173  1.00 19.42 ? 235  TYR C CD1 1 
ATOM   4856 C  CD2 . TYR C  1 212 ? -3.031  33.484 -3.882  1.00 20.46 ? 235  TYR C CD2 1 
ATOM   4857 C  CE1 . TYR C  1 212 ? -4.537  31.197 -4.343  1.00 14.86 ? 235  TYR C CE1 1 
ATOM   4858 C  CE2 . TYR C  1 212 ? -2.873  32.787 -5.068  1.00 20.02 ? 235  TYR C CE2 1 
ATOM   4859 C  CZ  . TYR C  1 212 ? -3.632  31.654 -5.292  1.00 18.17 ? 235  TYR C CZ  1 
ATOM   4860 O  OH  . TYR C  1 212 ? -3.470  30.966 -6.463  1.00 17.00 ? 235  TYR C OH  1 
ATOM   4861 N  N   . VAL C  1 213 ? -5.480  36.805 -0.280  1.00 22.23 ? 236  VAL C N   1 
ATOM   4862 C  CA  . VAL C  1 213 ? -5.724  37.497 0.999   1.00 25.16 ? 236  VAL C CA  1 
ATOM   4863 C  C   . VAL C  1 213 ? -7.025  37.033 1.645   1.00 23.28 ? 236  VAL C C   1 
ATOM   4864 O  O   . VAL C  1 213 ? -7.055  36.676 2.822   1.00 30.81 ? 236  VAL C O   1 
ATOM   4865 C  CB  . VAL C  1 213 ? -5.726  39.019 0.835   1.00 26.21 ? 236  VAL C CB  1 
ATOM   4866 C  CG1 . VAL C  1 213 ? -5.945  39.696 2.189   1.00 28.85 ? 236  VAL C CG1 1 
ATOM   4867 C  CG2 . VAL C  1 213 ? -4.415  39.473 0.231   1.00 30.80 ? 236  VAL C CG2 1 
ATOM   4868 N  N   . SER C  1 214 ? -8.096  36.972 0.864   1.00 28.76 ? 237  SER C N   1 
ATOM   4869 C  CA  . SER C  1 214 ? -9.364  36.454 1.384   1.00 24.70 ? 237  SER C CA  1 
ATOM   4870 C  C   . SER C  1 214 ? -9.296  35.002 1.841   1.00 23.71 ? 237  SER C C   1 
ATOM   4871 O  O   . SER C  1 214 ? -9.879  34.636 2.869   1.00 29.23 ? 237  SER C O   1 
ATOM   4872 C  CB  . SER C  1 214 ? -10.489 36.619 0.357   1.00 33.14 ? 237  SER C CB  1 
ATOM   4873 O  OG  . SER C  1 214 ? -11.040 37.925 0.421   1.00 36.63 ? 237  SER C OG  1 
ATOM   4874 N  N   . TRP C  1 215 ? -8.604  34.157 1.083   1.00 24.38 ? 238  TRP C N   1 
ATOM   4875 C  CA  . TRP C  1 215 ? -8.500  32.757 1.478   1.00 22.41 ? 238  TRP C CA  1 
ATOM   4876 C  C   . TRP C  1 215 ? -7.699  32.601 2.774   1.00 19.29 ? 238  TRP C C   1 
ATOM   4877 O  O   . TRP C  1 215 ? -8.030  31.783 3.641   1.00 25.72 ? 238  TRP C O   1 
ATOM   4878 C  CB  . TRP C  1 215 ? -7.878  31.907 0.367   1.00 21.25 ? 238  TRP C CB  1 
ATOM   4879 C  CG  . TRP C  1 215 ? -7.605  30.508 0.806   1.00 23.13 ? 238  TRP C CG  1 
ATOM   4880 C  CD1 . TRP C  1 215 ? -8.520  29.517 1.018   1.00 24.45 ? 238  TRP C CD1 1 
ATOM   4881 C  CD2 . TRP C  1 215 ? -6.324  29.942 1.122   1.00 19.92 ? 238  TRP C CD2 1 
ATOM   4882 N  NE1 . TRP C  1 215 ? -7.887  28.371 1.438   1.00 22.92 ? 238  TRP C NE1 1 
ATOM   4883 C  CE2 . TRP C  1 215 ? -6.539  28.610 1.509   1.00 20.47 ? 238  TRP C CE2 1 
ATOM   4884 C  CE3 . TRP C  1 215 ? -5.018  30.440 1.116   1.00 24.08 ? 238  TRP C CE3 1 
ATOM   4885 C  CZ2 . TRP C  1 215 ? -5.494  27.762 1.874   1.00 17.35 ? 238  TRP C CZ2 1 
ATOM   4886 C  CZ3 . TRP C  1 215 ? -3.986  29.592 1.474   1.00 18.53 ? 238  TRP C CZ3 1 
ATOM   4887 C  CH2 . TRP C  1 215 ? -4.233  28.273 1.851   1.00 21.73 ? 238  TRP C CH2 1 
ATOM   4888 N  N   . ILE C  1 216 ? -6.651  33.401 2.891   1.00 25.71 ? 239  ILE C N   1 
ATOM   4889 C  CA  . ILE C  1 216 ? -5.769  33.338 4.044   1.00 23.41 ? 239  ILE C CA  1 
ATOM   4890 C  C   . ILE C  1 216 ? -6.527  33.740 5.302   1.00 28.01 ? 239  ILE C C   1 
ATOM   4891 O  O   . ILE C  1 216 ? -6.488  33.041 6.318   1.00 31.76 ? 239  ILE C O   1 
ATOM   4892 C  CB  . ILE C  1 216 ? -4.557  34.254 3.839   1.00 25.07 ? 239  ILE C CB  1 
ATOM   4893 C  CG1 . ILE C  1 216 ? -3.612  33.627 2.808   1.00 20.11 ? 239  ILE C CG1 1 
ATOM   4894 C  CG2 . ILE C  1 216 ? -3.825  34.485 5.165   1.00 22.53 ? 239  ILE C CG2 1 
ATOM   4895 C  CD1 . ILE C  1 216 ? -2.689  34.635 2.121   1.00 18.66 ? 239  ILE C CD1 1 
ATOM   4896 N  N   . LYS C  1 217 ? -7.243  34.855 5.210   1.00 31.06 ? 240  LYS C N   1 
ATOM   4897 C  CA  . LYS C  1 217 ? -7.932  35.413 6.368   1.00 36.63 ? 240  LYS C CA  1 
ATOM   4898 C  C   . LYS C  1 217 ? -9.035  34.497 6.884   1.00 33.22 ? 240  LYS C C   1 
ATOM   4899 O  O   . LYS C  1 217 ? -9.224  34.364 8.095   1.00 33.94 ? 240  LYS C O   1 
ATOM   4900 C  CB  . LYS C  1 217 ? -8.464  36.811 6.053   1.00 27.58 ? 240  LYS C CB  1 
ATOM   4901 C  CG  . LYS C  1 217 ? -7.354  37.814 5.837   1.00 30.69 ? 240  LYS C CG  1 
ATOM   4902 C  CD  . LYS C  1 217 ? -7.809  39.236 6.081   1.00 47.51 ? 240  LYS C CD  1 
ATOM   4903 C  CE  . LYS C  1 217 ? -6.614  40.173 6.147   1.00 47.83 ? 240  LYS C CE  1 
ATOM   4904 N  NZ  . LYS C  1 217 ? -5.628  39.715 7.178   1.00 50.95 ? 240  LYS C NZ  1 
ATOM   4905 N  N   . GLN C  1 218 ? -9.747  33.846 5.973   1.00 30.25 ? 241  GLN C N   1 
ATOM   4906 C  CA  . GLN C  1 218 ? -10.793 32.919 6.381   1.00 36.79 ? 241  GLN C CA  1 
ATOM   4907 C  C   . GLN C  1 218 ? -10.223 31.593 6.862   1.00 37.21 ? 241  GLN C C   1 
ATOM   4908 O  O   . GLN C  1 218 ? -10.809 30.941 7.723   1.00 37.42 ? 241  GLN C O   1 
ATOM   4909 C  CB  . GLN C  1 218 ? -11.806 32.686 5.253   1.00 37.80 ? 241  GLN C CB  1 
ATOM   4910 C  CG  . GLN C  1 218 ? -13.080 31.970 5.722   1.00 56.82 ? 241  GLN C CG  1 
ATOM   4911 C  CD  . GLN C  1 218 ? -13.677 32.580 6.995   1.00 56.86 ? 241  GLN C CD  1 
ATOM   4912 O  OE1 . GLN C  1 218 ? -13.526 32.031 8.093   1.00 45.09 ? 241  GLN C OE1 1 
ATOM   4913 N  NE2 . GLN C  1 218 ? -14.359 33.715 6.849   1.00 54.48 ? 241  GLN C NE2 1 
ATOM   4914 N  N   . THR C  1 219 ? -9.080  31.184 6.316   1.00 29.20 ? 242  THR C N   1 
ATOM   4915 C  CA  . THR C  1 219 ? -8.524  29.906 6.712   1.00 29.90 ? 242  THR C CA  1 
ATOM   4916 C  C   . THR C  1 219 ? -8.024  29.997 8.142   1.00 27.94 ? 242  THR C C   1 
ATOM   4917 O  O   . THR C  1 219 ? -8.214  29.081 8.947   1.00 31.84 ? 242  THR C O   1 
ATOM   4918 C  CB  . THR C  1 219 ? -7.393  29.455 5.778   1.00 30.05 ? 242  THR C CB  1 
ATOM   4919 O  OG1 . THR C  1 219 ? -7.927  29.224 4.466   1.00 33.05 ? 242  THR C OG1 1 
ATOM   4920 C  CG2 . THR C  1 219 ? -6.766  28.172 6.298   1.00 27.44 ? 242  THR C CG2 1 
ATOM   4921 N  N   . ILE C  1 220 ? -7.396  31.119 8.453   1.00 27.25 ? 243  ILE C N   1 
ATOM   4922 C  CA  . ILE C  1 220 ? -6.954  31.386 9.810   1.00 33.84 ? 243  ILE C CA  1 
ATOM   4923 C  C   . ILE C  1 220 ? -8.176  31.375 10.723  1.00 38.99 ? 243  ILE C C   1 
ATOM   4924 O  O   . ILE C  1 220 ? -8.234  30.624 11.705  1.00 40.92 ? 243  ILE C O   1 
ATOM   4925 C  CB  . ILE C  1 220 ? -6.254  32.756 9.907   1.00 37.06 ? 243  ILE C CB  1 
ATOM   4926 C  CG1 . ILE C  1 220 ? -4.927  32.749 9.140   1.00 34.25 ? 243  ILE C CG1 1 
ATOM   4927 C  CG2 . ILE C  1 220 ? -6.001  33.133 11.363  1.00 42.99 ? 243  ILE C CG2 1 
ATOM   4928 C  CD1 . ILE C  1 220 ? -4.248  34.111 9.107   1.00 33.03 ? 243  ILE C CD1 1 
ATOM   4929 N  N   . ALA C  1 221 ? -9.171  32.181 10.358  1.00 34.99 ? 244  ALA C N   1 
ATOM   4930 C  CA  . ALA C  1 221 ? -10.380 32.354 11.169  1.00 40.28 ? 244  ALA C CA  1 
ATOM   4931 C  C   . ALA C  1 221 ? -11.148 31.059 11.465  1.00 40.68 ? 244  ALA C C   1 
ATOM   4932 O  O   . ALA C  1 221 ? -11.959 31.011 12.390  1.00 40.84 ? 244  ALA C O   1 
ATOM   4933 C  CB  . ALA C  1 221 ? -11.304 33.397 10.535  1.00 34.49 ? 244  ALA C CB  1 
ATOM   4934 N  N   . SER C  1 222 ? -10.886 30.010 10.697  1.00 35.26 ? 245  SER C N   1 
ATOM   4935 C  CA  . SER C  1 222 ? -11.585 28.743 10.899  1.00 40.65 ? 245  SER C CA  1 
ATOM   4936 C  C   . SER C  1 222 ? -10.670 27.649 11.433  1.00 34.93 ? 245  SER C C   1 
ATOM   4937 O  O   . SER C  1 222 ? -11.074 26.489 11.520  1.00 41.76 ? 245  SER C O   1 
ATOM   4938 C  CB  . SER C  1 222 ? -12.242 28.279 9.596   1.00 40.87 ? 245  SER C CB  1 
ATOM   4939 O  OG  . SER C  1 222 ? -11.938 29.164 8.533   1.00 40.71 ? 245  SER C OG  1 
ATOM   4940 N  N   . ASN C  1 223 ? -9.439  28.014 11.786  1.00 38.81 ? 246  ASN C N   1 
ATOM   4941 C  CA  . ASN C  1 223 ? -8.456  27.022 12.221  1.00 40.65 ? 246  ASN C CA  1 
ATOM   4942 C  C   . ASN C  1 223 ? -7.620  27.468 13.417  1.00 41.60 ? 246  ASN C C   1 
ATOM   4943 O  O   . ASN C  1 223 ? -6.823  26.685 13.938  1.00 42.83 ? 246  ASN C O   1 
ATOM   4944 C  CB  . ASN C  1 223 ? -7.528  26.630 11.064  1.00 36.38 ? 246  ASN C CB  1 
ATOM   4945 C  CG  . ASN C  1 223 ? -8.269  25.988 9.909   1.00 31.08 ? 246  ASN C CG  1 
ATOM   4946 O  OD1 . ASN C  1 223 ? -8.475  24.775 9.888   1.00 34.87 ? 246  ASN C OD1 1 
ATOM   4947 N  ND2 . ASN C  1 223 ? -8.663  26.806 8.929   1.00 33.53 ? 246  ASN C ND2 1 
ATOM   4948 O  OXT . ASN C  1 223 ? -7.710  28.608 13.882  1.00 47.28 ? 246  ASN C OXT 1 
ATOM   4949 N  N   . CYS D  2 4   ? -4.700  23.432 41.681  1.00 25.81 ? 4    CYS D N   1 
ATOM   4950 C  CA  . CYS D  2 4   ? -4.267  22.672 40.498  1.00 20.89 ? 4    CYS D CA  1 
ATOM   4951 C  C   . CYS D  2 4   ? -3.382  23.506 39.581  1.00 18.42 ? 4    CYS D C   1 
ATOM   4952 O  O   . CYS D  2 4   ? -3.525  24.727 39.492  1.00 21.77 ? 4    CYS D O   1 
ATOM   4953 C  CB  . CYS D  2 4   ? -5.468  22.132 39.713  1.00 18.35 ? 4    CYS D CB  1 
ATOM   4954 S  SG  . CYS D  2 4   ? -6.495  23.370 38.848  1.00 22.21 ? 4    CYS D SG  1 
ATOM   4955 N  N   . SER D  2 5   ? -2.477  22.836 38.871  1.00 13.59 ? 5    SER D N   1 
ATOM   4956 C  CA  . SER D  2 5   ? -1.515  23.536 38.032  1.00 13.98 ? 5    SER D CA  1 
ATOM   4957 C  C   . SER D  2 5   ? -2.036  23.724 36.603  1.00 12.92 ? 5    SER D C   1 
ATOM   4958 O  O   . SER D  2 5   ? -2.603  22.805 36.002  1.00 13.35 ? 5    SER D O   1 
ATOM   4959 C  CB  . SER D  2 5   ? -0.175  22.784 38.012  1.00 13.19 ? 5    SER D CB  1 
ATOM   4960 O  OG  . SER D  2 5   ? 0.346   22.534 39.300  1.00 16.92 ? 5    SER D OG  1 
ATOM   4961 N  N   . PRO D  2 6   ? -1.836  24.925 36.047  1.00 15.38 ? 6    PRO D N   1 
ATOM   4962 C  CA  . PRO D  2 6   ? -2.251  25.306 34.699  1.00 18.71 ? 6    PRO D CA  1 
ATOM   4963 C  C   . PRO D  2 6   ? -1.516  24.536 33.620  1.00 18.91 ? 6    PRO D C   1 
ATOM   4964 O  O   . PRO D  2 6   ? -0.485  23.943 33.907  1.00 14.53 ? 6    PRO D O   1 
ATOM   4965 C  CB  . PRO D  2 6   ? -1.849  26.787 34.622  1.00 24.47 ? 6    PRO D CB  1 
ATOM   4966 C  CG  . PRO D  2 6   ? -0.784  26.940 35.651  1.00 25.20 ? 6    PRO D CG  1 
ATOM   4967 C  CD  . PRO D  2 6   ? -1.180  26.035 36.763  1.00 16.71 ? 6    PRO D CD  1 
ATOM   4968 N  N   . SER D  2 7   ? -2.033  24.574 32.392  1.00 16.89 ? 7    SER D N   1 
ATOM   4969 C  CA  . SER D  2 7   ? -1.382  23.927 31.252  1.00 17.32 ? 7    SER D CA  1 
ATOM   4970 C  C   . SER D  2 7   ? 0.042   24.437 31.061  1.00 17.02 ? 7    SER D C   1 
ATOM   4971 O  O   . SER D  2 7   ? 0.300   25.645 31.120  1.00 16.25 ? 7    SER D O   1 
ATOM   4972 C  CB  . SER D  2 7   ? -2.208  24.127 29.986  1.00 21.34 ? 7    SER D CB  1 
ATOM   4973 O  OG  . SER D  2 7   ? -3.481  23.537 30.197  1.00 29.00 ? 7    SER D OG  1 
ATOM   4974 N  N   . GLY D  2 8   ? 0.971   23.507 30.878  1.00 17.41 ? 8    GLY D N   1 
ATOM   4975 C  CA  . GLY D  2 8   ? 2.364   23.878 30.673  1.00 16.85 ? 8    GLY D CA  1 
ATOM   4976 C  C   . GLY D  2 8   ? 3.185   23.883 31.943  1.00 17.11 ? 8    GLY D C   1 
ATOM   4977 O  O   . GLY D  2 8   ? 4.418   23.935 31.882  1.00 15.36 ? 8    GLY D O   1 
ATOM   4978 N  N   . ALA D  2 9   ? 2.525   23.786 33.095  1.00 11.88 ? 9    ALA D N   1 
ATOM   4979 C  CA  . ALA D  2 9   ? 3.251   23.801 34.361  1.00 11.68 ? 9    ALA D CA  1 
ATOM   4980 C  C   . ALA D  2 9   ? 4.019   22.497 34.503  1.00 10.84 ? 9    ALA D C   1 
ATOM   4981 O  O   . ALA D  2 9   ? 3.595   21.461 33.998  1.00 10.31 ? 9    ALA D O   1 
ATOM   4982 C  CB  . ALA D  2 9   ? 2.285   23.955 35.555  1.00 10.93 ? 9    ALA D CB  1 
ATOM   4983 N  N   . ILE D  2 10  ? 5.114   22.541 35.251  1.00 9.92  ? 10   ILE D N   1 
ATOM   4984 C  CA  . ILE D  2 10  ? 5.802   21.325 35.640  1.00 11.37 ? 10   ILE D CA  1 
ATOM   4985 C  C   . ILE D  2 10  ? 4.897   20.468 36.528  1.00 10.38 ? 10   ILE D C   1 
ATOM   4986 O  O   . ILE D  2 10  ? 4.166   20.989 37.388  1.00 12.15 ? 10   ILE D O   1 
ATOM   4987 C  CB  . ILE D  2 10  ? 7.027   21.669 36.501  1.00 7.54  ? 10   ILE D CB  1 
ATOM   4988 C  CG1 . ILE D  2 10  ? 8.008   22.527 35.698  1.00 9.55  ? 10   ILE D CG1 1 
ATOM   4989 C  CG2 . ILE D  2 10  ? 7.707   20.391 37.007  1.00 15.02 ? 10   ILE D CG2 1 
ATOM   4990 C  CD1 . ILE D  2 10  ? 9.105   23.170 36.597  1.00 10.81 ? 10   ILE D CD1 1 
ATOM   4991 N  N   . CYS D  2 11  ? 4.965   19.163 36.345  1.00 9.63  ? 11   CYS D N   1 
ATOM   4992 C  CA  . CYS D  2 11  ? 4.288   18.244 37.233  1.00 10.38 ? 11   CYS D CA  1 
ATOM   4993 C  C   . CYS D  2 11  ? 5.088   16.963 37.364  1.00 9.56  ? 11   CYS D C   1 
ATOM   4994 O  O   . CYS D  2 11  ? 6.205   16.873 36.847  1.00 8.35  ? 11   CYS D O   1 
ATOM   4995 C  CB  . CYS D  2 11  ? 2.857   17.958 36.746  1.00 8.27  ? 11   CYS D CB  1 
ATOM   4996 S  SG  . CYS D  2 11  ? 2.757   17.286 35.071  1.00 11.36 ? 11   CYS D SG  1 
ATOM   4997 N  N   . SER D  2 12  ? 4.503   15.984 38.037  1.00 8.60  ? 12   SER D N   1 
ATOM   4998 C  CA  . SER D  2 12  ? 5.210   14.753 38.402  1.00 9.45  ? 12   SER D CA  1 
ATOM   4999 C  C   . SER D  2 12  ? 4.644   13.525 37.755  1.00 9.89  ? 12   SER D C   1 
ATOM   5000 O  O   . SER D  2 12  ? 3.456   13.255 37.879  1.00 9.56  ? 12   SER D O   1 
ATOM   5001 C  CB  . SER D  2 12  ? 5.154   14.523 39.901  1.00 13.21 ? 12   SER D CB  1 
ATOM   5002 O  OG  . SER D  2 12  ? 5.829   13.313 40.259  1.00 12.49 ? 12   SER D OG  1 
ATOM   5003 N  N   . GLY D  2 13  ? 5.509   12.727 37.150  1.00 9.47  ? 13   GLY D N   1 
ATOM   5004 C  CA  . GLY D  2 13  ? 5.096   11.426 36.662  1.00 13.22 ? 13   GLY D CA  1 
ATOM   5005 C  C   . GLY D  2 13  ? 4.621   10.472 37.757  1.00 15.22 ? 13   GLY D C   1 
ATOM   5006 O  O   . GLY D  2 13  ? 4.015   9.440  37.437  1.00 15.56 ? 13   GLY D O   1 
ATOM   5007 N  N   . PHE D  2 14  ? 4.898   10.790 39.025  1.00 10.46 ? 14   PHE D N   1 
ATOM   5008 C  CA  . PHE D  2 14  ? 4.489   9.943  40.147  1.00 11.45 ? 14   PHE D CA  1 
ATOM   5009 C  C   . PHE D  2 14  ? 3.135   10.335 40.720  1.00 15.19 ? 14   PHE D C   1 
ATOM   5010 O  O   . PHE D  2 14  ? 2.581   9.607  41.545  1.00 15.60 ? 14   PHE D O   1 
ATOM   5011 C  CB  . PHE D  2 14  ? 5.501   10.002 41.306  1.00 11.08 ? 14   PHE D CB  1 
ATOM   5012 C  CG  . PHE D  2 14  ? 6.854   9.418  40.984  1.00 15.04 ? 14   PHE D CG  1 
ATOM   5013 C  CD1 . PHE D  2 14  ? 7.864   10.217 40.467  1.00 19.66 ? 14   PHE D CD1 1 
ATOM   5014 C  CD2 . PHE D  2 14  ? 7.130   8.082  41.240  1.00 16.35 ? 14   PHE D CD2 1 
ATOM   5015 C  CE1 . PHE D  2 14  ? 9.120   9.678  40.180  1.00 16.02 ? 14   PHE D CE1 1 
ATOM   5016 C  CE2 . PHE D  2 14  ? 8.365   7.536  40.950  1.00 19.80 ? 14   PHE D CE2 1 
ATOM   5017 C  CZ  . PHE D  2 14  ? 9.374   8.336  40.419  1.00 17.30 ? 14   PHE D CZ  1 
ATOM   5018 N  N   . GLY D  2 15  ? 2.636   11.502 40.341  1.00 14.37 ? 15   GLY D N   1 
ATOM   5019 C  CA  . GLY D  2 15  ? 1.475   12.066 41.013  1.00 14.30 ? 15   GLY D CA  1 
ATOM   5020 C  C   . GLY D  2 15  ? 0.178   11.773 40.283  1.00 12.27 ? 15   GLY D C   1 
ATOM   5021 O  O   . GLY D  2 15  ? 0.176   11.276 39.165  1.00 14.00 ? 15   GLY D O   1 
ATOM   5022 N  N   . PRO D  2 16  ? -0.945  12.088 40.923  1.00 15.64 ? 16   PRO D N   1 
ATOM   5023 C  CA  . PRO D  2 16  ? -2.240  11.791 40.297  1.00 18.87 ? 16   PRO D CA  1 
ATOM   5024 C  C   . PRO D  2 16  ? -2.613  12.798 39.211  1.00 20.58 ? 16   PRO D C   1 
ATOM   5025 O  O   . PRO D  2 16  ? -2.066  13.897 39.201  1.00 19.37 ? 16   PRO D O   1 
ATOM   5026 C  CB  . PRO D  2 16  ? -3.218  11.901 41.472  1.00 20.28 ? 16   PRO D CB  1 
ATOM   5027 C  CG  . PRO D  2 16  ? -2.575  12.863 42.413  1.00 24.79 ? 16   PRO D CG  1 
ATOM   5028 C  CD  . PRO D  2 16  ? -1.079  12.652 42.275  1.00 23.32 ? 16   PRO D CD  1 
ATOM   5029 N  N   . PRO D  2 17  ? -3.541  12.426 38.303  1.00 18.83 ? 17   PRO D N   1 
ATOM   5030 C  CA  . PRO D  2 17  ? -3.995  13.348 37.247  1.00 17.26 ? 17   PRO D CA  1 
ATOM   5031 C  C   . PRO D  2 17  ? -4.436  14.710 37.798  1.00 12.72 ? 17   PRO D C   1 
ATOM   5032 O  O   . PRO D  2 17  ? -4.220  15.735 37.110  1.00 16.80 ? 17   PRO D O   1 
ATOM   5033 C  CB  . PRO D  2 17  ? -5.178  12.595 36.600  1.00 18.71 ? 17   PRO D CB  1 
ATOM   5034 C  CG  . PRO D  2 17  ? -4.827  11.115 36.810  1.00 24.88 ? 17   PRO D CG  1 
ATOM   5035 C  CD  . PRO D  2 17  ? -4.107  11.069 38.164  1.00 18.30 ? 17   PRO D CD  1 
ATOM   5036 N  N   . GLU D  2 18  ? -4.995  14.745 39.012  1.00 19.25 ? 18   GLU D N   1 
ATOM   5037 C  CA  . GLU D  2 18  ? -5.505  16.008 39.565  1.00 21.17 ? 18   GLU D CA  1 
ATOM   5038 C  C   . GLU D  2 18  ? -4.424  17.017 39.963  1.00 17.96 ? 18   GLU D C   1 
ATOM   5039 O  O   . GLU D  2 18  ? -4.756  18.117 40.395  1.00 15.17 ? 18   GLU D O   1 
ATOM   5040 C  CB  . GLU D  2 18  ? -6.481  15.805 40.738  1.00 25.52 ? 18   GLU D CB  1 
ATOM   5041 C  CG  . GLU D  2 18  ? -7.444  14.632 40.580  1.00 36.06 ? 18   GLU D CG  1 
ATOM   5042 C  CD  . GLU D  2 18  ? -6.811  13.311 41.004  1.00 32.73 ? 18   GLU D CD  1 
ATOM   5043 O  OE1 . GLU D  2 18  ? -6.614  13.100 42.226  1.00 51.72 ? 18   GLU D OE1 1 
ATOM   5044 O  OE2 . GLU D  2 18  ? -6.490  12.495 40.115  1.00 27.12 ? 18   GLU D OE2 1 
ATOM   5045 N  N   . GLN D  2 19  ? -3.142  16.668 39.805  1.00 15.21 ? 19   GLN D N   1 
ATOM   5046 C  CA  . GLN D  2 19  ? -2.089  17.689 39.873  1.00 12.63 ? 19   GLN D CA  1 
ATOM   5047 C  C   . GLN D  2 19  ? -2.366  18.850 38.951  1.00 13.77 ? 19   GLN D C   1 
ATOM   5048 O  O   . GLN D  2 19  ? -1.978  19.999 39.225  1.00 14.51 ? 19   GLN D O   1 
ATOM   5049 C  CB  . GLN D  2 19  ? -0.752  17.129 39.371  1.00 14.80 ? 19   GLN D CB  1 
ATOM   5050 C  CG  . GLN D  2 19  ? -0.001  16.209 40.274  1.00 26.06 ? 19   GLN D CG  1 
ATOM   5051 C  CD  . GLN D  2 19  ? 1.172   15.611 39.506  1.00 17.03 ? 19   GLN D CD  1 
ATOM   5052 O  OE1 . GLN D  2 19  ? 2.291   16.121 39.573  1.00 22.08 ? 19   GLN D OE1 1 
ATOM   5053 N  NE2 . GLN D  2 19  ? 0.902   14.564 38.723  1.00 17.87 ? 19   GLN D NE2 1 
ATOM   5054 N  N   . CYS D  2 20  ? -2.961  18.526 37.802  1.00 13.66 ? 20   CYS D N   1 
ATOM   5055 C  CA  . CYS D  2 20  ? -3.107  19.457 36.704  1.00 12.81 ? 20   CYS D CA  1 
ATOM   5056 C  C   . CYS D  2 20  ? -4.576  19.812 36.542  1.00 11.17 ? 20   CYS D C   1 
ATOM   5057 O  O   . CYS D  2 20  ? -5.434  18.921 36.618  1.00 15.20 ? 20   CYS D O   1 
ATOM   5058 C  CB  . CYS D  2 20  ? -2.624  18.813 35.401  1.00 12.28 ? 20   CYS D CB  1 
ATOM   5059 S  SG  . CYS D  2 20  ? -0.836  18.400 35.375  1.00 14.15 ? 20   CYS D SG  1 
ATOM   5060 N  N   . CYS D  2 21  ? -4.852  21.090 36.292  1.00 14.71 ? 21   CYS D N   1 
ATOM   5061 C  CA  . CYS D  2 21  ? -6.226  21.516 36.047  1.00 15.06 ? 21   CYS D CA  1 
ATOM   5062 C  C   . CYS D  2 21  ? -6.854  20.676 34.934  1.00 16.59 ? 21   CYS D C   1 
ATOM   5063 O  O   . CYS D  2 21  ? -8.027  20.287 35.032  1.00 13.45 ? 21   CYS D O   1 
ATOM   5064 C  CB  . CYS D  2 21  ? -6.283  23.009 35.706  1.00 14.36 ? 21   CYS D CB  1 
ATOM   5065 S  SG  . CYS D  2 21  ? -5.739  24.042 37.058  1.00 21.61 ? 21   CYS D SG  1 
ATOM   5066 N  N   . SER D  2 22  ? -6.044  20.344 33.922  1.00 13.47 ? 22   SER D N   1 
ATOM   5067 C  CA  . SER D  2 22  ? -6.483  19.610 32.733  1.00 13.02 ? 22   SER D CA  1 
ATOM   5068 C  C   . SER D  2 22  ? -6.666  18.115 32.961  1.00 12.97 ? 22   SER D C   1 
ATOM   5069 O  O   . SER D  2 22  ? -7.240  17.418 32.128  1.00 17.53 ? 22   SER D O   1 
ATOM   5070 C  CB  . SER D  2 22  ? -5.459  19.774 31.621  1.00 15.13 ? 22   SER D CB  1 
ATOM   5071 O  OG  . SER D  2 22  ? -4.301  19.040 31.969  1.00 16.91 ? 22   SER D OG  1 
ATOM   5072 N  N   . GLY D  2 23  ? -6.147  17.614 34.073  1.00 13.31 ? 23   GLY D N   1 
ATOM   5073 C  CA  . GLY D  2 23  ? -6.324  16.224 34.424  1.00 12.22 ? 23   GLY D CA  1 
ATOM   5074 C  C   . GLY D  2 23  ? -5.367  15.306 33.692  1.00 19.02 ? 23   GLY D C   1 
ATOM   5075 O  O   . GLY D  2 23  ? -5.539  14.081 33.727  1.00 16.83 ? 23   GLY D O   1 
ATOM   5076 N  N   . ALA D  2 24  ? -4.363  15.887 33.030  1.00 12.99 ? 24   ALA D N   1 
ATOM   5077 C  CA  . ALA D  2 24  ? -3.326  15.083 32.380  1.00 13.37 ? 24   ALA D CA  1 
ATOM   5078 C  C   . ALA D  2 24  ? -1.936  15.656 32.608  1.00 9.82  ? 24   ALA D C   1 
ATOM   5079 O  O   . ALA D  2 24  ? -1.654  16.797 32.241  1.00 15.66 ? 24   ALA D O   1 
ATOM   5080 C  CB  . ALA D  2 24  ? -3.583  14.969 30.904  1.00 14.68 ? 24   ALA D CB  1 
ATOM   5081 N  N   . CYS D  2 25  ? -1.085  14.840 33.208  1.00 14.66 ? 25   CYS D N   1 
ATOM   5082 C  CA  . CYS D  2 25  ? 0.316   15.185 33.395  1.00 15.20 ? 25   CYS D CA  1 
ATOM   5083 C  C   . CYS D  2 25  ? 1.097   14.267 32.474  1.00 11.08 ? 25   CYS D C   1 
ATOM   5084 O  O   . CYS D  2 25  ? 1.086   13.047 32.658  1.00 15.67 ? 25   CYS D O   1 
ATOM   5085 C  CB  . CYS D  2 25  ? 0.703   14.944 34.851  1.00 10.67 ? 25   CYS D CB  1 
ATOM   5086 S  SG  . CYS D  2 25  ? 2.457   15.271 35.240  1.00 14.70 ? 25   CYS D SG  1 
ATOM   5087 N  N   . VAL D  2 26  ? 1.780   14.847 31.497  1.00 9.68  ? 26   VAL D N   1 
ATOM   5088 C  CA  . VAL D  2 26  ? 2.346   14.064 30.397  1.00 13.94 ? 26   VAL D CA  1 
ATOM   5089 C  C   . VAL D  2 26  ? 3.817   14.353 30.202  1.00 11.37 ? 26   VAL D C   1 
ATOM   5090 O  O   . VAL D  2 26  ? 4.289   15.418 30.580  1.00 10.54 ? 26   VAL D O   1 
ATOM   5091 C  CB  . VAL D  2 26  ? 1.623   14.389 29.095  1.00 11.76 ? 26   VAL D CB  1 
ATOM   5092 C  CG1 . VAL D  2 26  ? 0.170   13.931 29.176  1.00 12.65 ? 26   VAL D CG1 1 
ATOM   5093 C  CG2 . VAL D  2 26  ? 1.693   15.883 28.798  1.00 13.55 ? 26   VAL D CG2 1 
ATOM   5094 N  N   . PRO D  2 27  ? 4.559   13.407 29.623  1.00 12.85 ? 27   PRO D N   1 
ATOM   5095 C  CA  . PRO D  2 27  ? 5.969   13.742 29.375  1.00 11.11 ? 27   PRO D CA  1 
ATOM   5096 C  C   . PRO D  2 27  ? 6.081   14.845 28.346  1.00 12.37 ? 27   PRO D C   1 
ATOM   5097 O  O   . PRO D  2 27  ? 5.370   14.843 27.321  1.00 14.87 ? 27   PRO D O   1 
ATOM   5098 C  CB  . PRO D  2 27  ? 6.554   12.441 28.803  1.00 15.56 ? 27   PRO D CB  1 
ATOM   5099 C  CG  . PRO D  2 27  ? 5.599   11.364 29.223  1.00 18.87 ? 27   PRO D CG  1 
ATOM   5100 C  CD  . PRO D  2 27  ? 4.248   11.998 29.348  1.00 15.04 ? 27   PRO D CD  1 
ATOM   5101 N  N   . HIS D  2 28  ? 6.934   15.823 28.632  1.00 8.57  ? 28   HIS D N   1 
ATOM   5102 C  CA  . HIS D  2 28  ? 7.283   16.828 27.652  1.00 10.81 ? 28   HIS D CA  1 
ATOM   5103 C  C   . HIS D  2 28  ? 8.011   16.147 26.498  1.00 15.30 ? 28   HIS D C   1 
ATOM   5104 O  O   . HIS D  2 28  ? 8.760   15.174 26.709  1.00 10.51 ? 28   HIS D O   1 
ATOM   5105 C  CB  . HIS D  2 28  ? 8.140   17.927 28.285  1.00 10.72 ? 28   HIS D CB  1 
ATOM   5106 C  CG  . HIS D  2 28  ? 8.219   19.175 27.467  1.00 11.59 ? 28   HIS D CG  1 
ATOM   5107 N  ND1 . HIS D  2 28  ? 9.149   19.359 26.458  1.00 12.52 ? 28   HIS D ND1 1 
ATOM   5108 C  CD2 . HIS D  2 28  ? 7.484   20.315 27.513  1.00 13.29 ? 28   HIS D CD2 1 
ATOM   5109 C  CE1 . HIS D  2 28  ? 8.978   20.554 25.921  1.00 17.16 ? 28   HIS D CE1 1 
ATOM   5110 N  NE2 . HIS D  2 28  ? 7.968   21.152 26.536  1.00 15.48 ? 28   HIS D NE2 1 
ATOM   5111 N  N   . PRO D  2 29  ? 7.774   16.622 25.258  1.00 14.49 ? 29   PRO D N   1 
ATOM   5112 C  CA  . PRO D  2 29  ? 8.412   15.976 24.108  1.00 13.55 ? 29   PRO D CA  1 
ATOM   5113 C  C   . PRO D  2 29  ? 9.922   16.249 24.006  1.00 13.43 ? 29   PRO D C   1 
ATOM   5114 O  O   . PRO D  2 29  ? 10.634  15.490 23.323  1.00 13.47 ? 29   PRO D O   1 
ATOM   5115 C  CB  . PRO D  2 29  ? 7.677   16.586 22.908  1.00 18.08 ? 29   PRO D CB  1 
ATOM   5116 C  CG  . PRO D  2 29  ? 7.220   17.927 23.397  1.00 19.60 ? 29   PRO D CG  1 
ATOM   5117 C  CD  . PRO D  2 29  ? 6.843   17.692 24.845  1.00 14.14 ? 29   PRO D CD  1 
ATOM   5118 N  N   . ILE D  2 30  ? 10.395  17.296 24.687  1.00 12.06 ? 30   ILE D N   1 
ATOM   5119 C  CA  . ILE D  2 30  ? 11.775  17.751 24.545  1.00 8.54  ? 30   ILE D CA  1 
ATOM   5120 C  C   . ILE D  2 30  ? 12.529  17.846 25.866  1.00 11.22 ? 30   ILE D C   1 
ATOM   5121 O  O   . ILE D  2 30  ? 13.610  17.254 26.030  1.00 10.37 ? 30   ILE D O   1 
ATOM   5122 C  CB  . ILE D  2 30  ? 11.830  19.108 23.846  1.00 9.62  ? 30   ILE D CB  1 
ATOM   5123 C  CG1 . ILE D  2 30  ? 11.275  18.976 22.431  1.00 15.43 ? 30   ILE D CG1 1 
ATOM   5124 C  CG2 . ILE D  2 30  ? 13.264  19.601 23.776  1.00 10.84 ? 30   ILE D CG2 1 
ATOM   5125 C  CD1 . ILE D  2 30  ? 12.114  18.055 21.546  1.00 21.17 ? 30   ILE D CD1 1 
ATOM   5126 N  N   . LEU D  2 31  ? 11.984  18.625 26.790  1.00 9.71  ? 31   LEU D N   1 
ATOM   5127 C  CA  . LEU D  2 31  ? 12.544  18.726 28.127  1.00 7.36  ? 31   LEU D CA  1 
ATOM   5128 C  C   . LEU D  2 31  ? 12.313  17.433 28.888  1.00 8.12  ? 31   LEU D C   1 
ATOM   5129 O  O   . LEU D  2 31  ? 11.286  16.801 28.740  1.00 9.54  ? 31   LEU D O   1 
ATOM   5130 C  CB  . LEU D  2 31  ? 11.856  19.844 28.892  1.00 8.95  ? 31   LEU D CB  1 
ATOM   5131 C  CG  . LEU D  2 31  ? 11.992  21.216 28.238  1.00 9.64  ? 31   LEU D CG  1 
ATOM   5132 C  CD1 . LEU D  2 31  ? 11.098  22.260 28.946  1.00 12.44 ? 31   LEU D CD1 1 
ATOM   5133 C  CD2 . LEU D  2 31  ? 13.447  21.684 28.227  1.00 10.17 ? 31   LEU D CD2 1 
ATOM   5134 N  N   . ARG D  2 32  ? 13.226  17.078 29.787  1.00 8.21  ? 32   ARG D N   1 
ATOM   5135 C  CA  . ARG D  2 32  ? 13.085  15.803 30.455  1.00 6.53  ? 32   ARG D CA  1 
ATOM   5136 C  C   . ARG D  2 32  ? 12.305  15.903 31.767  1.00 9.36  ? 32   ARG D C   1 
ATOM   5137 O  O   . ARG D  2 32  ? 12.704  15.381 32.819  1.00 8.11  ? 32   ARG D O   1 
ATOM   5138 C  CB  . ARG D  2 32  ? 14.459  15.133 30.535  1.00 9.18  ? 32   ARG D CB  1 
ATOM   5139 C  CG  . ARG D  2 32  ? 14.838  14.889 29.094  1.00 14.16 ? 32   ARG D CG  1 
ATOM   5140 C  CD  . ARG D  2 32  ? 16.096  14.154 28.839  1.00 13.90 ? 32   ARG D CD  1 
ATOM   5141 N  NE  . ARG D  2 32  ? 15.993  13.674 27.461  1.00 12.95 ? 32   ARG D NE  1 
ATOM   5142 C  CZ  . ARG D  2 32  ? 16.899  12.916 26.874  1.00 13.32 ? 32   ARG D CZ  1 
ATOM   5143 N  NH1 . ARG D  2 32  ? 17.989  12.563 27.536  1.00 13.84 ? 32   ARG D NH1 1 
ATOM   5144 N  NH2 . ARG D  2 32  ? 16.709  12.521 25.622  1.00 12.82 ? 32   ARG D NH2 1 
ATOM   5145 N  N   . ILE D  2 33  ? 11.160  16.587 31.667  1.00 9.00  ? 33   ILE D N   1 
ATOM   5146 C  CA  . ILE D  2 33  ? 10.239  16.722 32.777  1.00 7.13  ? 33   ILE D CA  1 
ATOM   5147 C  C   . ILE D  2 33  ? 8.865   16.306 32.281  1.00 10.34 ? 33   ILE D C   1 
ATOM   5148 O  O   . ILE D  2 33  ? 8.659   16.179 31.080  1.00 8.77  ? 33   ILE D O   1 
ATOM   5149 C  CB  . ILE D  2 33  ? 10.084  18.199 33.207  1.00 9.58  ? 33   ILE D CB  1 
ATOM   5150 C  CG1 . ILE D  2 33  ? 9.871   19.097 32.001  1.00 8.96  ? 33   ILE D CG1 1 
ATOM   5151 C  CG2 . ILE D  2 33  ? 11.280  18.673 34.028  1.00 12.73 ? 33   ILE D CG2 1 
ATOM   5152 C  CD1 . ILE D  2 33  ? 9.347   20.450 32.396  1.00 12.11 ? 33   ILE D CD1 1 
ATOM   5153 N  N   . PHE D  2 34  ? 7.940   16.128 33.214  1.00 8.00  ? 34   PHE D N   1 
ATOM   5154 C  CA  . PHE D  2 34  ? 6.523   16.026 32.901  1.00 8.55  ? 34   PHE D CA  1 
ATOM   5155 C  C   . PHE D  2 34  ? 5.900   17.434 32.996  1.00 9.05  ? 34   PHE D C   1 
ATOM   5156 O  O   . PHE D  2 34  ? 6.373   18.289 33.758  1.00 10.41 ? 34   PHE D O   1 
ATOM   5157 C  CB  . PHE D  2 34  ? 5.827   15.112 33.902  1.00 7.71  ? 34   PHE D CB  1 
ATOM   5158 C  CG  . PHE D  2 34  ? 6.043   13.645 33.652  1.00 10.00 ? 34   PHE D CG  1 
ATOM   5159 C  CD1 . PHE D  2 34  ? 7.281   13.062 33.916  1.00 11.30 ? 34   PHE D CD1 1 
ATOM   5160 C  CD2 . PHE D  2 34  ? 5.009   12.849 33.184  1.00 12.56 ? 34   PHE D CD2 1 
ATOM   5161 C  CE1 . PHE D  2 34  ? 7.484   11.693 33.695  1.00 15.78 ? 34   PHE D CE1 1 
ATOM   5162 C  CE2 . PHE D  2 34  ? 5.214   11.474 32.959  1.00 15.38 ? 34   PHE D CE2 1 
ATOM   5163 C  CZ  . PHE D  2 34  ? 6.458   10.911 33.218  1.00 14.59 ? 34   PHE D CZ  1 
ATOM   5164 N  N   . VAL D  2 35  ? 4.875   17.682 32.178  1.00 9.39  ? 35   VAL D N   1 
ATOM   5165 C  CA  . VAL D  2 35  ? 4.142   18.955 32.222  1.00 10.53 ? 35   VAL D CA  1 
ATOM   5166 C  C   . VAL D  2 35  ? 2.655   18.703 32.152  1.00 8.28  ? 35   VAL D C   1 
ATOM   5167 O  O   . VAL D  2 35  ? 2.221   17.638 31.687  1.00 9.20  ? 35   VAL D O   1 
ATOM   5168 C  CB  . VAL D  2 35  ? 4.501   19.911 31.069  1.00 8.30  ? 35   VAL D CB  1 
ATOM   5169 C  CG1 . VAL D  2 35  ? 5.894   20.509 31.271  1.00 10.79 ? 35   VAL D CG1 1 
ATOM   5170 C  CG2 . VAL D  2 35  ? 4.357   19.200 29.696  1.00 10.87 ? 35   VAL D CG2 1 
ATOM   5171 N  N   . CYS D  2 36  ? 1.880   19.684 32.602  1.00 8.96  ? 36   CYS D N   1 
ATOM   5172 C  CA  . CYS D  2 36  ? 0.427   19.584 32.494  1.00 10.60 ? 36   CYS D CA  1 
ATOM   5173 C  C   . CYS D  2 36  ? 0.005   19.840 31.065  1.00 11.57 ? 36   CYS D C   1 
ATOM   5174 O  O   . CYS D  2 36  ? 0.405   20.824 30.442  1.00 13.66 ? 36   CYS D O   1 
ATOM   5175 C  CB  . CYS D  2 36  ? -0.257  20.602 33.431  1.00 10.09 ? 36   CYS D CB  1 
ATOM   5176 S  SG  . CYS D  2 36  ? -0.004  20.245 35.183  1.00 11.89 ? 36   CYS D SG  1 
ATOM   5177 N  N   . GLN D  2 37  ? -0.820  18.943 30.556  1.00 14.64 ? 37   GLN D N   1 
ATOM   5178 C  CA  . GLN D  2 37  ? -1.459  19.122 29.256  1.00 20.12 ? 37   GLN D CA  1 
ATOM   5179 C  C   . GLN D  2 37  ? -2.271  20.420 29.247  1.00 24.24 ? 37   GLN D C   1 
ATOM   5180 O  O   . GLN D  2 37  ? -2.808  20.841 30.295  1.00 17.54 ? 37   GLN D O   1 
ATOM   5181 C  CB  . GLN D  2 37  ? -2.349  17.914 28.997  1.00 22.06 ? 37   GLN D CB  1 
ATOM   5182 C  CG  . GLN D  2 37  ? -3.035  17.860 27.663  1.00 27.26 ? 37   GLN D CG  1 
ATOM   5183 C  CD  . GLN D  2 37  ? -3.896  16.615 27.562  1.00 23.77 ? 37   GLN D CD  1 
ATOM   5184 O  OE1 . GLN D  2 37  ? -3.391  15.511 27.341  1.00 29.75 ? 37   GLN D OE1 1 
ATOM   5185 N  NE2 . GLN D  2 37  ? -5.203  16.783 27.757  1.00 38.49 ? 37   GLN D NE2 1 
ATOM   5186 O  OXT . GLN D  2 37  ? -2.382  21.095 28.213  1.00 21.13 ? 37   GLN D OXT 1 
ATOM   5187 N  N   . CYS E  2 4   ? -20.393 64.611 31.268  1.00 32.45 ? 4    CYS E N   1 
ATOM   5188 C  CA  . CYS E  2 4   ? -19.486 64.771 32.400  1.00 31.51 ? 4    CYS E CA  1 
ATOM   5189 C  C   . CYS E  2 4   ? -19.578 63.555 33.326  1.00 25.22 ? 4    CYS E C   1 
ATOM   5190 O  O   . CYS E  2 4   ? -20.643 62.942 33.468  1.00 28.83 ? 4    CYS E O   1 
ATOM   5191 C  CB  . CYS E  2 4   ? -19.793 66.077 33.158  1.00 26.22 ? 4    CYS E CB  1 
ATOM   5192 S  SG  . CYS E  2 4   ? -21.387 66.095 34.042  1.00 29.01 ? 4    CYS E SG  1 
ATOM   5193 N  N   . SER E  2 5   ? -18.466 63.183 33.954  1.00 24.94 ? 5    SER E N   1 
ATOM   5194 C  CA  . SER E  2 5   ? -18.484 62.011 34.833  1.00 27.45 ? 5    SER E CA  1 
ATOM   5195 C  C   . SER E  2 5   ? -18.928 62.391 36.235  1.00 24.29 ? 5    SER E C   1 
ATOM   5196 O  O   . SER E  2 5   ? -18.644 63.494 36.694  1.00 27.31 ? 5    SER E O   1 
ATOM   5197 C  CB  . SER E  2 5   ? -17.104 61.339 34.886  1.00 23.91 ? 5    SER E CB  1 
ATOM   5198 O  OG  . SER E  2 5   ? -16.744 60.836 33.610  1.00 25.15 ? 5    SER E OG  1 
ATOM   5199 N  N   . PRO E  2 6   ? -19.605 61.467 36.927  1.00 26.81 ? 6    PRO E N   1 
ATOM   5200 C  CA  . PRO E  2 6   ? -20.096 61.753 38.279  1.00 21.22 ? 6    PRO E CA  1 
ATOM   5201 C  C   . PRO E  2 6   ? -19.015 61.629 39.348  1.00 29.74 ? 6    PRO E C   1 
ATOM   5202 O  O   . PRO E  2 6   ? -17.912 61.125 39.074  1.00 21.96 ? 6    PRO E O   1 
ATOM   5203 C  CB  . PRO E  2 6   ? -21.169 60.679 38.485  1.00 31.73 ? 6    PRO E CB  1 
ATOM   5204 C  CG  . PRO E  2 6   ? -20.720 59.545 37.621  1.00 30.65 ? 6    PRO E CG  1 
ATOM   5205 C  CD  . PRO E  2 6   ? -20.083 60.164 36.424  1.00 26.72 ? 6    PRO E CD  1 
ATOM   5206 N  N   . SER E  2 7   ? -19.327 62.090 40.557  1.00 26.59 ? 7    SER E N   1 
ATOM   5207 C  CA  . SER E  2 7   ? -18.386 61.991 41.672  1.00 26.35 ? 7    SER E CA  1 
ATOM   5208 C  C   . SER E  2 7   ? -18.025 60.544 41.957  1.00 24.88 ? 7    SER E C   1 
ATOM   5209 O  O   . SER E  2 7   ? -18.873 59.662 41.897  1.00 24.56 ? 7    SER E O   1 
ATOM   5210 C  CB  . SER E  2 7   ? -18.950 62.660 42.927  1.00 38.27 ? 7    SER E CB  1 
ATOM   5211 O  OG  . SER E  2 7   ? -18.942 64.071 42.780  1.00 41.26 ? 7    SER E OG  1 
ATOM   5212 N  N   . GLY E  2 8   ? -16.747 60.304 42.228  1.00 24.39 ? 8    GLY E N   1 
ATOM   5213 C  CA  . GLY E  2 8   ? -16.274 58.962 42.517  1.00 24.85 ? 8    GLY E CA  1 
ATOM   5214 C  C   . GLY E  2 8   ? -15.880 58.140 41.297  1.00 23.20 ? 8    GLY E C   1 
ATOM   5215 O  O   . GLY E  2 8   ? -15.132 57.164 41.435  1.00 23.89 ? 8    GLY E O   1 
ATOM   5216 N  N   . ALA E  2 9   ? -16.396 58.513 40.122  1.00 18.61 ? 9    ALA E N   1 
ATOM   5217 C  CA  . ALA E  2 9   ? -16.065 57.847 38.856  1.00 19.77 ? 9    ALA E CA  1 
ATOM   5218 C  C   . ALA E  2 9   ? -14.615 58.076 38.430  1.00 21.17 ? 9    ALA E C   1 
ATOM   5219 O  O   . ALA E  2 9   ? -14.044 59.143 38.652  1.00 16.04 ? 9    ALA E O   1 
ATOM   5220 C  CB  . ALA E  2 9   ? -17.013 58.290 37.746  1.00 21.33 ? 9    ALA E CB  1 
ATOM   5221 N  N   A ILE E  2 10  ? -14.030 57.064 37.795  0.78 17.12 ? 10   ILE E N   1 
ATOM   5222 N  N   B ILE E  2 10  ? -14.025 57.069 37.799  0.22 17.13 ? 10   ILE E N   1 
ATOM   5223 C  CA  A ILE E  2 10  ? -12.636 57.136 37.363  0.78 14.39 ? 10   ILE E CA  1 
ATOM   5224 C  CA  B ILE E  2 10  ? -12.642 57.174 37.355  0.22 14.51 ? 10   ILE E CA  1 
ATOM   5225 C  C   A ILE E  2 10  ? -12.411 58.246 36.316  0.78 15.81 ? 10   ILE E C   1 
ATOM   5226 C  C   B ILE E  2 10  ? -12.441 58.297 36.346  0.22 15.79 ? 10   ILE E C   1 
ATOM   5227 O  O   A ILE E  2 10  ? -13.241 58.481 35.431  0.78 15.12 ? 10   ILE E O   1 
ATOM   5228 O  O   B ILE E  2 10  ? -13.302 58.569 35.507  0.22 15.28 ? 10   ILE E O   1 
ATOM   5229 C  CB  A ILE E  2 10  ? -12.143 55.718 36.871  0.78 15.67 ? 10   ILE E CB  1 
ATOM   5230 C  CB  B ILE E  2 10  ? -12.143 55.854 36.749  0.22 15.78 ? 10   ILE E CB  1 
ATOM   5231 C  CG1 A ILE E  2 10  ? -10.621 55.674 36.681  0.78 13.05 ? 10   ILE E CG1 1 
ATOM   5232 C  CG1 B ILE E  2 10  ? -13.060 55.399 35.624  0.22 18.49 ? 10   ILE E CG1 1 
ATOM   5233 C  CG2 A ILE E  2 10  ? -12.872 55.291 35.635  0.78 18.74 ? 10   ILE E CG2 1 
ATOM   5234 C  CG2 B ILE E  2 10  ? -12.104 54.783 37.798  0.22 15.05 ? 10   ILE E CG2 1 
ATOM   5235 C  CD1 A ILE E  2 10  ? -10.083 54.225 36.579  0.78 10.20 ? 10   ILE E CD1 1 
ATOM   5236 C  CD1 B ILE E  2 10  ? -12.750 54.011 35.154  0.22 17.36 ? 10   ILE E CD1 1 
ATOM   5237 N  N   . CYS E  2 11  ? -11.293 58.952 36.442  1.00 12.05 ? 11   CYS E N   1 
ATOM   5238 C  CA  . CYS E  2 11  ? -10.954 60.020 35.526  1.00 18.06 ? 11   CYS E CA  1 
ATOM   5239 C  C   . CYS E  2 11  ? -9.450  60.043 35.345  1.00 15.88 ? 11   CYS E C   1 
ATOM   5240 O  O   . CYS E  2 11  ? -8.742  59.209 35.920  1.00 12.54 ? 11   CYS E O   1 
ATOM   5241 C  CB  . CYS E  2 11  ? -11.486 61.367 36.048  1.00 15.80 ? 11   CYS E CB  1 
ATOM   5242 S  SG  . CYS E  2 11  ? -10.840 61.853 37.656  1.00 18.25 ? 11   CYS E SG  1 
ATOM   5243 N  N   . SER E  2 12  ? -8.952  60.974 34.538  1.00 15.37 ? 12   SER E N   1 
ATOM   5244 C  CA  . SER E  2 12  ? -7.526  61.012 34.211  1.00 12.41 ? 12   SER E CA  1 
ATOM   5245 C  C   . SER E  2 12  ? -6.827  62.191 34.874  1.00 20.78 ? 12   SER E C   1 
ATOM   5246 O  O   . SER E  2 12  ? -7.296  63.325 34.773  1.00 17.40 ? 12   SER E O   1 
ATOM   5247 C  CB  . SER E  2 12  ? -7.327  61.103 32.696  1.00 16.69 ? 12   SER E CB  1 
ATOM   5248 O  OG  . SER E  2 12  ? -5.943  61.242 32.387  1.00 16.44 ? 12   SER E OG  1 
ATOM   5249 N  N   . GLY E  2 13  ? -5.694  61.943 35.524  1.00 20.96 ? 13   GLY E N   1 
ATOM   5250 C  CA  . GLY E  2 13  ? -4.932  63.037 36.115  1.00 26.77 ? 13   GLY E CA  1 
ATOM   5251 C  C   . GLY E  2 13  ? -4.347  63.978 35.061  1.00 26.72 ? 13   GLY E C   1 
ATOM   5252 O  O   . GLY E  2 13  ? -4.169  65.170 35.312  1.00 36.55 ? 13   GLY E O   1 
ATOM   5253 N  N   . PHE E  2 14  ? -4.058  63.434 33.880  1.00 25.20 ? 14   PHE E N   1 
ATOM   5254 C  CA  . PHE E  2 14  ? -3.540  64.195 32.736  1.00 17.62 ? 14   PHE E CA  1 
ATOM   5255 C  C   . PHE E  2 14  ? -4.615  65.099 32.101  1.00 22.17 ? 14   PHE E C   1 
ATOM   5256 O  O   . PHE E  2 14  ? -4.298  65.988 31.294  1.00 22.46 ? 14   PHE E O   1 
ATOM   5257 C  CB  . PHE E  2 14  ? -3.059  63.232 31.635  1.00 21.12 ? 14   PHE E CB  1 
ATOM   5258 C  CG  . PHE E  2 14  ? -1.811  62.439 31.985  1.00 22.38 ? 14   PHE E CG  1 
ATOM   5259 C  CD1 . PHE E  2 14  ? -0.541  62.966 31.738  1.00 34.08 ? 14   PHE E CD1 1 
ATOM   5260 C  CD2 . PHE E  2 14  ? -1.910  61.160 32.501  1.00 20.16 ? 14   PHE E CD2 1 
ATOM   5261 C  CE1 . PHE E  2 14  ? 0.609   62.239 32.039  1.00 33.13 ? 14   PHE E CE1 1 
ATOM   5262 C  CE2 . PHE E  2 14  ? -0.768  60.425 32.814  1.00 29.16 ? 14   PHE E CE2 1 
ATOM   5263 C  CZ  . PHE E  2 14  ? 0.497   60.971 32.590  1.00 27.22 ? 14   PHE E CZ  1 
ATOM   5264 N  N   . GLY E  2 15  ? -5.879  64.856 32.435  1.00 18.15 ? 15   GLY E N   1 
ATOM   5265 C  CA  . GLY E  2 15  ? -6.988  65.492 31.737  1.00 19.49 ? 15   GLY E CA  1 
ATOM   5266 C  C   . GLY E  2 15  ? -7.472  66.787 32.368  1.00 23.28 ? 15   GLY E C   1 
ATOM   5267 O  O   . GLY E  2 15  ? -7.045  67.146 33.459  1.00 20.73 ? 15   GLY E O   1 
ATOM   5268 N  N   . PRO E  2 16  ? -8.390  67.481 31.686  1.00 29.18 ? 16   PRO E N   1 
ATOM   5269 C  CA  . PRO E  2 16  ? -8.949  68.746 32.177  1.00 36.79 ? 16   PRO E CA  1 
ATOM   5270 C  C   . PRO E  2 16  ? -10.023 68.527 33.247  1.00 28.16 ? 16   PRO E C   1 
ATOM   5271 O  O   . PRO E  2 16  ? -10.695 67.497 33.239  1.00 26.42 ? 16   PRO E O   1 
ATOM   5272 C  CB  . PRO E  2 16  ? -9.598  69.326 30.921  1.00 33.84 ? 16   PRO E CB  1 
ATOM   5273 C  CG  . PRO E  2 16  ? -10.084 68.115 30.196  1.00 36.80 ? 16   PRO E CG  1 
ATOM   5274 C  CD  . PRO E  2 16  ? -9.005  67.072 30.411  1.00 29.26 ? 16   PRO E CD  1 
ATOM   5275 N  N   . PRO E  2 17  ? -10.203 69.503 34.155  1.00 38.03 ? 17   PRO E N   1 
ATOM   5276 C  CA  . PRO E  2 17  ? -11.235 69.426 35.200  1.00 31.52 ? 17   PRO E CA  1 
ATOM   5277 C  C   . PRO E  2 17  ? -12.609 69.013 34.678  1.00 25.30 ? 17   PRO E C   1 
ATOM   5278 O  O   . PRO E  2 17  ? -13.311 68.282 35.384  1.00 24.44 ? 17   PRO E O   1 
ATOM   5279 C  CB  . PRO E  2 17  ? -11.304 70.864 35.719  1.00 34.65 ? 17   PRO E CB  1 
ATOM   5280 C  CG  . PRO E  2 17  ? -9.910  71.382 35.529  1.00 39.70 ? 17   PRO E CG  1 
ATOM   5281 C  CD  . PRO E  2 17  ? -9.381  70.724 34.272  1.00 23.51 ? 17   PRO E CD  1 
ATOM   5282 N  N   . GLU E  2 18  ? -12.976 69.449 33.470  1.00 25.36 ? 18   GLU E N   1 
ATOM   5283 C  CA  . GLU E  2 18  ? -14.330 69.217 32.945  1.00 26.56 ? 18   GLU E CA  1 
ATOM   5284 C  C   . GLU E  2 18  ? -14.701 67.755 32.630  1.00 24.68 ? 18   GLU E C   1 
ATOM   5285 O  O   . GLU E  2 18  ? -15.862 67.465 32.333  1.00 23.59 ? 18   GLU E O   1 
ATOM   5286 C  CB  . GLU E  2 18  ? -14.638 70.134 31.743  1.00 35.42 ? 18   GLU E CB  1 
ATOM   5287 C  CG  . GLU E  2 18  ? -13.548 70.218 30.673  1.00 30.24 ? 18   GLU E CG  1 
ATOM   5288 C  CD  . GLU E  2 18  ? -12.521 71.317 30.945  1.00 41.15 ? 18   GLU E CD  1 
ATOM   5289 O  OE1 . GLU E  2 18  ? -12.171 71.546 32.129  1.00 39.40 ? 18   GLU E OE1 1 
ATOM   5290 O  OE2 . GLU E  2 18  ? -12.063 71.958 29.968  1.00 48.99 ? 18   GLU E OE2 1 
ATOM   5291 N  N   . GLN E  2 19  ? -13.734 66.831 32.723  1.00 25.85 ? 19   GLN E N   1 
ATOM   5292 C  CA  . GLN E  2 19  ? -14.055 65.402 32.616  1.00 20.97 ? 19   GLN E CA  1 
ATOM   5293 C  C   . GLN E  2 19  ? -15.136 65.088 33.611  1.00 19.61 ? 19   GLN E C   1 
ATOM   5294 O  O   . GLN E  2 19  ? -16.012 64.251 33.369  1.00 23.08 ? 19   GLN E O   1 
ATOM   5295 C  CB  . GLN E  2 19  ? -12.877 64.509 33.024  1.00 22.75 ? 19   GLN E CB  1 
ATOM   5296 C  CG  . GLN E  2 19  ? -11.557 64.726 32.343  1.00 31.52 ? 19   GLN E CG  1 
ATOM   5297 C  CD  . GLN E  2 19  ? -10.490 63.843 32.964  1.00 23.68 ? 19   GLN E CD  1 
ATOM   5298 O  OE1 . GLN E  2 19  ? -10.474 62.627 32.740  1.00 19.53 ? 19   GLN E OE1 1 
ATOM   5299 N  NE2 . GLN E  2 19  ? -9.614  64.439 33.775  1.00 26.00 ? 19   GLN E NE2 1 
ATOM   5300 N  N   . CYS E  2 20  ? -15.037 65.758 34.761  1.00 23.28 ? 20   CYS E N   1 
ATOM   5301 C  CA  . CYS E  2 20  ? -15.914 65.514 35.890  1.00 20.04 ? 20   CYS E CA  1 
ATOM   5302 C  C   . CYS E  2 20  ? -16.943 66.609 35.961  1.00 18.58 ? 20   CYS E C   1 
ATOM   5303 O  O   . CYS E  2 20  ? -16.625 67.768 35.719  1.00 21.56 ? 20   CYS E O   1 
ATOM   5304 C  CB  . CYS E  2 20  ? -15.122 65.566 37.197  1.00 17.78 ? 20   CYS E CB  1 
ATOM   5305 S  SG  . CYS E  2 20  ? -13.767 64.354 37.276  1.00 19.86 ? 20   CYS E SG  1 
ATOM   5306 N  N   . CYS E  2 21  ? -18.157 66.230 36.327  1.00 21.28 ? 21   CYS E N   1 
ATOM   5307 C  CA  . CYS E  2 21  ? -19.228 67.191 36.548  1.00 24.50 ? 21   CYS E CA  1 
ATOM   5308 C  C   . CYS E  2 21  ? -18.784 68.212 37.561  1.00 25.80 ? 21   CYS E C   1 
ATOM   5309 O  O   . CYS E  2 21  ? -19.008 69.418 37.397  1.00 20.49 ? 21   CYS E O   1 
ATOM   5310 C  CB  . CYS E  2 21  ? -20.468 66.470 37.061  1.00 23.27 ? 21   CYS E CB  1 
ATOM   5311 S  SG  . CYS E  2 21  ? -21.128 65.263 35.879  1.00 27.99 ? 21   CYS E SG  1 
ATOM   5312 N  N   . SER E  2 22  ? -18.123 67.720 38.602  1.00 23.65 ? 22   SER E N   1 
ATOM   5313 C  CA  . SER E  2 22  ? -17.748 68.540 39.746  1.00 21.09 ? 22   SER E CA  1 
ATOM   5314 C  C   . SER E  2 22  ? -16.606 69.480 39.407  1.00 24.94 ? 22   SER E C   1 
ATOM   5315 O  O   . SER E  2 22  ? -16.311 70.409 40.158  1.00 35.46 ? 22   SER E O   1 
ATOM   5316 C  CB  . SER E  2 22  ? -17.330 67.642 40.900  1.00 22.77 ? 22   SER E CB  1 
ATOM   5317 O  OG  . SER E  2 22  ? -16.200 66.874 40.510  1.00 24.85 ? 22   SER E OG  1 
ATOM   5318 N  N   . GLY E  2 23  ? -15.955 69.228 38.280  1.00 19.30 ? 23   GLY E N   1 
ATOM   5319 C  CA  . GLY E  2 23  ? -14.831 70.043 37.856  1.00 20.43 ? 23   GLY E CA  1 
ATOM   5320 C  C   . GLY E  2 23  ? -13.553 69.768 38.639  1.00 22.03 ? 23   GLY E C   1 
ATOM   5321 O  O   . GLY E  2 23  ? -12.644 70.586 38.627  1.00 24.38 ? 23   GLY E O   1 
ATOM   5322 N  N   . ALA E  2 24  ? -13.469 68.616 39.302  1.00 22.42 ? 24   ALA E N   1 
ATOM   5323 C  CA  . ALA E  2 24  ? -12.242 68.240 40.013  1.00 21.92 ? 24   ALA E CA  1 
ATOM   5324 C  C   . ALA E  2 24  ? -11.947 66.737 39.902  1.00 17.87 ? 24   ALA E C   1 
ATOM   5325 O  O   . ALA E  2 24  ? -12.729 65.915 40.378  1.00 18.54 ? 24   ALA E O   1 
ATOM   5326 C  CB  . ALA E  2 24  ? -12.328 68.647 41.466  1.00 30.40 ? 24   ALA E CB  1 
ATOM   5327 N  N   . CYS E  2 25  ? -10.832 66.403 39.256  1.00 19.46 ? 25   CYS E N   1 
ATOM   5328 C  CA  . CYS E  2 25  ? -10.348 65.015 39.144  1.00 19.81 ? 25   CYS E CA  1 
ATOM   5329 C  C   . CYS E  2 25  ? -9.152  64.907 40.094  1.00 18.10 ? 25   CYS E C   1 
ATOM   5330 O  O   . CYS E  2 25  ? -8.169  65.639 39.947  1.00 21.79 ? 25   CYS E O   1 
ATOM   5331 C  CB  . CYS E  2 25  ? -9.934  64.708 37.699  1.00 20.57 ? 25   CYS E CB  1 
ATOM   5332 S  SG  . CYS E  2 25  ? -9.212  63.024 37.414  1.00 20.30 ? 25   CYS E SG  1 
ATOM   5333 N  N   . VAL E  2 26  ? -9.260  64.032 41.093  1.00 14.16 ? 26   VAL E N   1 
ATOM   5334 C  CA  . VAL E  2 26  ? -8.303  64.006 42.188  1.00 17.64 ? 26   VAL E CA  1 
ATOM   5335 C  C   . VAL E  2 26  ? -7.794  62.589 42.466  1.00 15.91 ? 26   VAL E C   1 
ATOM   5336 O  O   . VAL E  2 26  ? -8.488  61.613 42.184  1.00 18.20 ? 26   VAL E O   1 
ATOM   5337 C  CB  . VAL E  2 26  ? -8.918  64.606 43.472  1.00 19.78 ? 26   VAL E CB  1 
ATOM   5338 C  CG1 . VAL E  2 26  ? -9.398  66.049 43.219  1.00 24.60 ? 26   VAL E CG1 1 
ATOM   5339 C  CG2 . VAL E  2 26  ? -10.070 63.747 44.003  1.00 16.04 ? 26   VAL E CG2 1 
ATOM   5340 N  N   . PRO E  2 27  ? -6.574  62.477 43.017  1.00 16.77 ? 27   PRO E N   1 
ATOM   5341 C  CA  . PRO E  2 27  ? -6.037  61.141 43.332  1.00 18.96 ? 27   PRO E CA  1 
ATOM   5342 C  C   . PRO E  2 27  ? -6.866  60.422 44.386  1.00 13.45 ? 27   PRO E C   1 
ATOM   5343 O  O   . PRO E  2 27  ? -7.189  61.003 45.433  1.00 15.34 ? 27   PRO E O   1 
ATOM   5344 C  CB  . PRO E  2 27  ? -4.638  61.432 43.890  1.00 21.18 ? 27   PRO E CB  1 
ATOM   5345 C  CG  . PRO E  2 27  ? -4.655  62.927 44.256  1.00 23.09 ? 27   PRO E CG  1 
ATOM   5346 C  CD  . PRO E  2 27  ? -5.625  63.566 43.318  1.00 19.48 ? 27   PRO E CD  1 
ATOM   5347 N  N   . HIS E  2 28  ? -7.227  59.157 44.119  1.00 14.14 ? 28   HIS E N   1 
ATOM   5348 C  CA  . HIS E  2 28  ? -7.900  58.356 45.118  1.00 13.24 ? 28   HIS E CA  1 
ATOM   5349 C  C   . HIS E  2 28  ? -6.935  58.096 46.277  1.00 11.42 ? 28   HIS E C   1 
ATOM   5350 O  O   . HIS E  2 28  ? -5.735  57.888 46.062  1.00 13.91 ? 28   HIS E O   1 
ATOM   5351 C  CB  . HIS E  2 28  ? -8.367  57.020 44.515  1.00 11.57 ? 28   HIS E CB  1 
ATOM   5352 C  CG  . HIS E  2 28  ? -9.423  56.336 45.323  1.00 11.82 ? 28   HIS E CG  1 
ATOM   5353 N  ND1 . HIS E  2 28  ? -9.131  55.490 46.371  1.00 10.05 ? 28   HIS E ND1 1 
ATOM   5354 C  CD2 . HIS E  2 28  ? -10.776 56.393 45.250  1.00 14.44 ? 28   HIS E CD2 1 
ATOM   5355 C  CE1 . HIS E  2 28  ? -10.255 55.043 46.899  1.00 18.97 ? 28   HIS E CE1 1 
ATOM   5356 N  NE2 . HIS E  2 28  ? -11.272 55.576 46.239  1.00 20.93 ? 28   HIS E NE2 1 
ATOM   5357 N  N   . PRO E  2 29  ? -7.435  58.105 47.520  1.00 16.32 ? 29   PRO E N   1 
ATOM   5358 C  CA  . PRO E  2 29  ? -6.493  57.867 48.622  1.00 17.09 ? 29   PRO E CA  1 
ATOM   5359 C  C   . PRO E  2 29  ? -6.003  56.416 48.724  1.00 14.60 ? 29   PRO E C   1 
ATOM   5360 O  O   . PRO E  2 29  ? -4.951  56.199 49.334  1.00 17.37 ? 29   PRO E O   1 
ATOM   5361 C  CB  . PRO E  2 29  ? -7.305  58.255 49.864  1.00 18.56 ? 29   PRO E CB  1 
ATOM   5362 C  CG  . PRO E  2 29  ? -8.728  58.007 49.459  1.00 22.55 ? 29   PRO E CG  1 
ATOM   5363 C  CD  . PRO E  2 29  ? -8.803  58.385 47.998  1.00 22.69 ? 29   PRO E CD  1 
ATOM   5364 N  N   . ILE E  2 30  ? -6.707  55.459 48.107  1.00 14.89 ? 30   ILE E N   1 
ATOM   5365 C  CA  . ILE E  2 30  ? -6.365  54.035 48.250  1.00 12.12 ? 30   ILE E CA  1 
ATOM   5366 C  C   . ILE E  2 30  ? -6.073  53.333 46.911  1.00 11.25 ? 30   ILE E C   1 
ATOM   5367 O  O   . ILE E  2 30  ? -5.003  52.750 46.725  1.00 12.21 ? 30   ILE E O   1 
ATOM   5368 C  CB  . ILE E  2 30  ? -7.495  53.275 48.985  1.00 12.50 ? 30   ILE E CB  1 
ATOM   5369 C  CG1 . ILE E  2 30  ? -7.713  53.849 50.393  1.00 21.23 ? 30   ILE E CG1 1 
ATOM   5370 C  CG2 . ILE E  2 30  ? -7.237  51.769 49.010  1.00 15.09 ? 30   ILE E CG2 1 
ATOM   5371 C  CD1 . ILE E  2 30  ? -6.482  53.836 51.219  1.00 24.20 ? 30   ILE E CD1 1 
ATOM   5372 N  N   . LEU E  2 31  ? -7.051  53.347 46.011  1.00 9.67  ? 31   LEU E N   1 
ATOM   5373 C  CA  . LEU E  2 31  ? -6.885  52.868 44.644  1.00 8.40  ? 31   LEU E CA  1 
ATOM   5374 C  C   . LEU E  2 31  ? -5.862  53.700 43.892  1.00 10.19 ? 31   LEU E C   1 
ATOM   5375 O  O   . LEU E  2 31  ? -5.819  54.920 44.044  1.00 10.80 ? 31   LEU E O   1 
ATOM   5376 C  CB  . LEU E  2 31  ? -8.212  52.939 43.873  1.00 9.88  ? 31   LEU E CB  1 
ATOM   5377 C  CG  . LEU E  2 31  ? -9.344  52.107 44.472  1.00 14.24 ? 31   LEU E CG  1 
ATOM   5378 C  CD1 . LEU E  2 31  ? -10.665 52.343 43.728  1.00 13.91 ? 31   LEU E CD1 1 
ATOM   5379 C  CD2 . LEU E  2 31  ? -8.975  50.623 44.456  1.00 14.30 ? 31   LEU E CD2 1 
ATOM   5380 N  N   . ARG E  2 32  ? -5.072  53.070 43.025  1.00 8.68  ? 32   ARG E N   1 
ATOM   5381 C  CA  . ARG E  2 32  ? -4.033  53.807 42.338  1.00 8.25  ? 32   ARG E CA  1 
ATOM   5382 C  C   . ARG E  2 32  ? -4.544  54.439 41.012  1.00 11.39 ? 32   ARG E C   1 
ATOM   5383 O  O   . ARG E  2 32  ? -3.907  54.390 39.955  1.00 10.21 ? 32   ARG E O   1 
ATOM   5384 C  CB  . ARG E  2 32  ? -2.777  52.920 42.191  1.00 10.82 ? 32   ARG E CB  1 
ATOM   5385 C  CG  . ARG E  2 32  ? -1.799  53.106 43.366  1.00 17.14 ? 32   ARG E CG  1 
ATOM   5386 C  CD  . ARG E  2 32  ? -1.515  51.871 44.201  1.00 18.85 ? 32   ARG E CD  1 
ATOM   5387 N  NE  . ARG E  2 32  ? -0.985  52.275 45.509  1.00 16.69 ? 32   ARG E NE  1 
ATOM   5388 C  CZ  . ARG E  2 32  ? 0.228   51.966 45.974  1.00 14.77 ? 32   ARG E CZ  1 
ATOM   5389 N  NH1 . ARG E  2 32  ? 1.051   51.185 45.279  1.00 14.51 ? 32   ARG E NH1 1 
ATOM   5390 N  NH2 . ARG E  2 32  ? 0.593   52.399 47.179  1.00 20.32 ? 32   ARG E NH2 1 
ATOM   5391 N  N   . ILE E  2 33  ? -5.723  55.052 41.109  1.00 8.02  ? 33   ILE E N   1 
ATOM   5392 C  CA  . ILE E  2 33  ? -6.346  55.790 40.014  1.00 8.33  ? 33   ILE E CA  1 
ATOM   5393 C  C   . ILE E  2 33  ? -6.716  57.171 40.516  1.00 9.19  ? 33   ILE E C   1 
ATOM   5394 O  O   . ILE E  2 33  ? -6.637  57.428 41.716  1.00 10.32 ? 33   ILE E O   1 
ATOM   5395 C  CB  . ILE E  2 33  ? -7.665  55.144 39.588  1.00 8.15  ? 33   ILE E CB  1 
ATOM   5396 C  CG1 . ILE E  2 33  ? -8.572  54.957 40.802  1.00 11.14 ? 33   ILE E CG1 1 
ATOM   5397 C  CG2 . ILE E  2 33  ? -7.400  53.817 38.911  1.00 11.59 ? 33   ILE E CG2 1 
ATOM   5398 C  CD1 . ILE E  2 33  ? -9.989  54.514 40.463  1.00 11.30 ? 33   ILE E CD1 1 
ATOM   5399 N  N   . PHE E  2 34  ? -7.120  58.046 39.593  1.00 9.92  ? 34   PHE E N   1 
ATOM   5400 C  CA  . PHE E  2 34  ? -7.756  59.316 39.951  1.00 12.72 ? 34   PHE E CA  1 
ATOM   5401 C  C   . PHE E  2 34  ? -9.257  59.120 39.819  1.00 15.51 ? 34   PHE E C   1 
ATOM   5402 O  O   . PHE E  2 34  ? -9.720  58.296 39.016  1.00 12.14 ? 34   PHE E O   1 
ATOM   5403 C  CB  . PHE E  2 34  ? -7.325  60.425 39.001  1.00 12.53 ? 34   PHE E CB  1 
ATOM   5404 C  CG  . PHE E  2 34  ? -5.917  60.901 39.212  1.00 16.24 ? 34   PHE E CG  1 
ATOM   5405 C  CD1 . PHE E  2 34  ? -4.833  60.094 38.892  1.00 18.15 ? 34   PHE E CD1 1 
ATOM   5406 C  CD2 . PHE E  2 34  ? -5.678  62.161 39.722  1.00 17.38 ? 34   PHE E CD2 1 
ATOM   5407 C  CE1 . PHE E  2 34  ? -3.526  60.548 39.073  1.00 20.14 ? 34   PHE E CE1 1 
ATOM   5408 C  CE2 . PHE E  2 34  ? -4.375  62.624 39.898  1.00 22.79 ? 34   PHE E CE2 1 
ATOM   5409 C  CZ  . PHE E  2 34  ? -3.304  61.809 39.575  1.00 26.22 ? 34   PHE E CZ  1 
ATOM   5410 N  N   . VAL E  2 35  ? -10.020 59.909 40.571  1.00 13.40 ? 35   VAL E N   1 
ATOM   5411 C  CA  . VAL E  2 35  ? -11.474 59.847 40.520  1.00 13.69 ? 35   VAL E CA  1 
ATOM   5412 C  C   . VAL E  2 35  ? -12.047 61.249 40.612  1.00 15.07 ? 35   VAL E C   1 
ATOM   5413 O  O   . VAL E  2 35  ? -11.376 62.169 41.055  1.00 14.49 ? 35   VAL E O   1 
ATOM   5414 C  CB  . VAL E  2 35  ? -12.058 59.039 41.676  1.00 15.94 ? 35   VAL E CB  1 
ATOM   5415 C  CG1 . VAL E  2 35  ? -11.703 57.558 41.525  1.00 12.80 ? 35   VAL E CG1 1 
ATOM   5416 C  CG2 . VAL E  2 35  ? -11.567 59.605 43.022  1.00 11.26 ? 35   VAL E CG2 1 
ATOM   5417 N  N   . CYS E  2 36  ? -13.279 61.403 40.147  1.00 17.17 ? 36   CYS E N   1 
ATOM   5418 C  CA  . CYS E  2 36  ? -13.952 62.699 40.199  1.00 13.52 ? 36   CYS E CA  1 
ATOM   5419 C  C   . CYS E  2 36  ? -14.324 63.031 41.640  1.00 18.69 ? 36   CYS E C   1 
ATOM   5420 O  O   . CYS E  2 36  ? -14.847 62.180 42.357  1.00 19.13 ? 36   CYS E O   1 
ATOM   5421 C  CB  . CYS E  2 36  ? -15.209 62.658 39.334  1.00 15.30 ? 36   CYS E CB  1 
ATOM   5422 S  SG  . CYS E  2 36  ? -14.825 62.660 37.586  1.00 20.31 ? 36   CYS E SG  1 
ATOM   5423 N  N   . GLN E  2 37  ? -14.061 64.276 42.044  1.00 21.40 ? 37   GLN E N   1 
ATOM   5424 C  CA  . GLN E  2 37  ? -14.498 64.775 43.342  1.00 26.74 ? 37   GLN E CA  1 
ATOM   5425 C  C   . GLN E  2 37  ? -16.025 64.746 43.419  1.00 33.36 ? 37   GLN E C   1 
ATOM   5426 O  O   . GLN E  2 37  ? -16.720 64.970 42.413  1.00 29.57 ? 37   GLN E O   1 
ATOM   5427 C  CB  . GLN E  2 37  ? -13.982 66.195 43.558  1.00 29.88 ? 37   GLN E CB  1 
ATOM   5428 C  CG  . GLN E  2 37  ? -13.903 66.657 45.017  1.00 32.01 ? 37   GLN E CG  1 
ATOM   5429 C  CD  . GLN E  2 37  ? -13.177 67.991 45.139  1.00 42.28 ? 37   GLN E CD  1 
ATOM   5430 O  OE1 . GLN E  2 37  ? -11.962 68.039 45.375  1.00 37.81 ? 37   GLN E OE1 1 
ATOM   5431 N  NE2 . GLN E  2 37  ? -13.916 69.082 44.957  1.00 49.33 ? 37   GLN E NE2 1 
ATOM   5432 O  OXT . GLN E  2 37  ? -16.586 64.486 44.490  1.00 32.13 ? 37   GLN E OXT 1 
ATOM   5433 N  N   . CYS F  2 4   ? 15.246  6.332  4.938   1.00 40.65 ? 4    CYS F N   1 
ATOM   5434 C  CA  . CYS F  2 4   ? 15.653  7.075  3.736   1.00 35.24 ? 4    CYS F CA  1 
ATOM   5435 C  C   . CYS F  2 4   ? 14.480  7.368  2.802   1.00 35.64 ? 4    CYS F C   1 
ATOM   5436 O  O   . CYS F  2 4   ? 13.497  6.619  2.755   1.00 37.80 ? 4    CYS F O   1 
ATOM   5437 C  CB  . CYS F  2 4   ? 16.766  6.343  2.975   1.00 27.20 ? 4    CYS F CB  1 
ATOM   5438 S  SG  . CYS F  2 4   ? 16.215  4.900  1.974   1.00 39.18 ? 4    CYS F SG  1 
ATOM   5439 N  N   . SER F  2 5   ? 14.608  8.455  2.043   1.00 28.94 ? 5    SER F N   1 
ATOM   5440 C  CA  . SER F  2 5   ? 13.511  8.992  1.244   1.00 28.55 ? 5    SER F CA  1 
ATOM   5441 C  C   . SER F  2 5   ? 13.460  8.478  -0.191  1.00 25.18 ? 5    SER F C   1 
ATOM   5442 O  O   . SER F  2 5   ? 14.493  8.324  -0.841  1.00 26.85 ? 5    SER F O   1 
ATOM   5443 C  CB  . SER F  2 5   ? 13.588  10.523 1.232   1.00 30.00 ? 5    SER F CB  1 
ATOM   5444 O  OG  . SER F  2 5   ? 13.241  11.048 2.500   1.00 25.75 ? 5    SER F OG  1 
ATOM   5445 N  N   . PRO F  2 6   ? 12.239  8.241  -0.698  1.00 21.99 ? 6    PRO F N   1 
ATOM   5446 C  CA  . PRO F  2 6   ? 12.009  7.785  -2.069  1.00 29.83 ? 6    PRO F CA  1 
ATOM   5447 C  C   . PRO F  2 6   ? 12.507  8.796  -3.102  1.00 36.44 ? 6    PRO F C   1 
ATOM   5448 O  O   . PRO F  2 6   ? 12.803  9.951  -2.767  1.00 28.54 ? 6    PRO F O   1 
ATOM   5449 C  CB  . PRO F  2 6   ? 10.480  7.691  -2.155  1.00 29.83 ? 6    PRO F CB  1 
ATOM   5450 C  CG  . PRO F  2 6   ? 10.006  7.652  -0.740  1.00 37.05 ? 6    PRO F CG  1 
ATOM   5451 C  CD  . PRO F  2 6   ? 10.980  8.460  0.031   1.00 28.18 ? 6    PRO F CD  1 
ATOM   5452 N  N   . SER F  2 7   ? 12.595  8.365  -4.355  1.00 27.53 ? 7    SER F N   1 
ATOM   5453 C  CA  . SER F  2 7   ? 12.990  9.259  -5.432  1.00 32.09 ? 7    SER F CA  1 
ATOM   5454 C  C   . SER F  2 7   ? 11.887  10.302 -5.588  1.00 22.74 ? 7    SER F C   1 
ATOM   5455 O  O   . SER F  2 7   ? 10.707  9.984  -5.413  1.00 30.49 ? 7    SER F O   1 
ATOM   5456 C  CB  . SER F  2 7   ? 13.186  8.461  -6.726  1.00 38.10 ? 7    SER F CB  1 
ATOM   5457 O  OG  . SER F  2 7   ? 13.728  9.263  -7.760  1.00 42.69 ? 7    SER F OG  1 
ATOM   5458 N  N   . GLY F  2 8   ? 12.269  11.555 -5.844  1.00 31.79 ? 8    GLY F N   1 
ATOM   5459 C  CA  . GLY F  2 8   ? 11.303  12.640 -5.998  1.00 25.94 ? 8    GLY F CA  1 
ATOM   5460 C  C   . GLY F  2 8   ? 10.840  13.345 -4.720  1.00 24.82 ? 8    GLY F C   1 
ATOM   5461 O  O   . GLY F  2 8   ? 10.242  14.423 -4.780  1.00 20.96 ? 8    GLY F O   1 
ATOM   5462 N  N   . ALA F  2 9   ? 11.106  12.742 -3.568  1.00 19.52 ? 9    ALA F N   1 
ATOM   5463 C  CA  . ALA F  2 9   ? 10.729  13.320 -2.278  1.00 16.62 ? 9    ALA F CA  1 
ATOM   5464 C  C   . ALA F  2 9   ? 11.561  14.562 -1.979  1.00 13.79 ? 9    ALA F C   1 
ATOM   5465 O  O   . ALA F  2 9   ? 12.729  14.637 -2.369  1.00 14.49 ? 9    ALA F O   1 
ATOM   5466 C  CB  . ALA F  2 9   ? 10.939  12.293 -1.167  1.00 23.46 ? 9    ALA F CB  1 
ATOM   5467 N  N   . ILE F  2 10  ? 10.970  15.504 -1.236  1.00 15.30 ? 10   ILE F N   1 
ATOM   5468 C  CA  . ILE F  2 10  ? 11.679  16.682 -0.758  1.00 14.08 ? 10   ILE F CA  1 
ATOM   5469 C  C   . ILE F  2 10  ? 12.923  16.272 0.032   1.00 15.97 ? 10   ILE F C   1 
ATOM   5470 O  O   . ILE F  2 10  ? 12.883  15.349 0.853   1.00 15.65 ? 10   ILE F O   1 
ATOM   5471 C  CB  . ILE F  2 10  ? 10.759  17.562 0.135   1.00 15.47 ? 10   ILE F CB  1 
ATOM   5472 C  CG1 . ILE F  2 10  ? 9.628   18.168 -0.711  1.00 14.77 ? 10   ILE F CG1 1 
ATOM   5473 C  CG2 . ILE F  2 10  ? 11.574  18.661 0.829   1.00 19.37 ? 10   ILE F CG2 1 
ATOM   5474 C  CD1 . ILE F  2 10  ? 8.496   18.790 0.125   1.00 16.77 ? 10   ILE F CD1 1 
ATOM   5475 N  N   . CYS F  2 11  ? 14.044  16.933 -0.225  1.00 10.63 ? 11   CYS F N   1 
ATOM   5476 C  CA  . CYS F  2 11  ? 15.202  16.773 0.651   1.00 14.96 ? 11   CYS F CA  1 
ATOM   5477 C  C   . CYS F  2 11  ? 15.878  18.112 0.860   1.00 14.49 ? 11   CYS F C   1 
ATOM   5478 O  O   . CYS F  2 11  ? 15.377  19.147 0.365   1.00 13.43 ? 11   CYS F O   1 
ATOM   5479 C  CB  . CYS F  2 11  ? 16.193  15.749 0.087   1.00 15.92 ? 11   CYS F CB  1 
ATOM   5480 S  SG  . CYS F  2 11  ? 16.742  16.130 -1.576  1.00 16.98 ? 11   CYS F SG  1 
ATOM   5481 N  N   . SER F  2 12  ? 16.996  18.098 1.595   1.00 12.68 ? 12   SER F N   1 
ATOM   5482 C  CA  . SER F  2 12  ? 17.739  19.312 1.927   1.00 10.92 ? 12   SER F CA  1 
ATOM   5483 C  C   . SER F  2 12  ? 19.119  19.404 1.304   1.00 16.10 ? 12   SER F C   1 
ATOM   5484 O  O   . SER F  2 12  ? 19.928  18.483 1.441   1.00 17.72 ? 12   SER F O   1 
ATOM   5485 C  CB  . SER F  2 12  ? 17.906  19.438 3.446   1.00 13.01 ? 12   SER F CB  1 
ATOM   5486 O  OG  . SER F  2 12  ? 18.728  20.557 3.765   1.00 12.49 ? 12   SER F OG  1 
ATOM   5487 N  N   . GLY F  2 13  ? 19.394  20.547 0.671   1.00 15.99 ? 13   GLY F N   1 
ATOM   5488 C  CA  . GLY F  2 13  ? 20.716  20.850 0.154   1.00 22.98 ? 13   GLY F CA  1 
ATOM   5489 C  C   . GLY F  2 13  ? 21.750  20.876 1.264   1.00 26.69 ? 13   GLY F C   1 
ATOM   5490 O  O   . GLY F  2 13  ? 22.938  20.662 1.035   1.00 24.22 ? 13   GLY F O   1 
ATOM   5491 N  N   . PHE F  2 14  ? 21.306  21.130 2.488   1.00 20.99 ? 14   PHE F N   1 
ATOM   5492 C  CA  . PHE F  2 14  ? 22.250  21.157 3.591   1.00 18.80 ? 14   PHE F CA  1 
ATOM   5493 C  C   . PHE F  2 14  ? 22.515  19.757 4.141   1.00 17.21 ? 14   PHE F C   1 
ATOM   5494 O  O   . PHE F  2 14  ? 23.526  19.535 4.799   1.00 25.54 ? 14   PHE F O   1 
ATOM   5495 C  CB  . PHE F  2 14  ? 21.751  22.090 4.691   1.00 13.83 ? 14   PHE F CB  1 
ATOM   5496 C  CG  . PHE F  2 14  ? 21.741  23.535 4.284   1.00 16.48 ? 14   PHE F CG  1 
ATOM   5497 C  CD1 . PHE F  2 14  ? 22.893  24.295 4.361   1.00 23.32 ? 14   PHE F CD1 1 
ATOM   5498 C  CD2 . PHE F  2 14  ? 20.588  24.116 3.792   1.00 16.36 ? 14   PHE F CD2 1 
ATOM   5499 C  CE1 . PHE F  2 14  ? 22.894  25.635 3.979   1.00 27.88 ? 14   PHE F CE1 1 
ATOM   5500 C  CE2 . PHE F  2 14  ? 20.577  25.446 3.400   1.00 18.83 ? 14   PHE F CE2 1 
ATOM   5501 C  CZ  . PHE F  2 14  ? 21.733  26.210 3.494   1.00 22.79 ? 14   PHE F CZ  1 
ATOM   5502 N  N   . GLY F  2 15  ? 21.605  18.827 3.864   1.00 13.39 ? 15   GLY F N   1 
ATOM   5503 C  CA  . GLY F  2 15  ? 21.623  17.507 4.489   1.00 14.19 ? 15   GLY F CA  1 
ATOM   5504 C  C   . GLY F  2 15  ? 22.625  16.536 3.888   1.00 18.52 ? 15   GLY F C   1 
ATOM   5505 O  O   . GLY F  2 15  ? 23.230  16.810 2.848   1.00 22.71 ? 15   GLY F O   1 
ATOM   5506 N  N   . PRO F  2 16  ? 22.819  15.396 4.553   1.00 21.73 ? 16   PRO F N   1 
ATOM   5507 C  CA  . PRO F  2 16  ? 23.752  14.388 4.026   1.00 25.30 ? 16   PRO F CA  1 
ATOM   5508 C  C   . PRO F  2 16  ? 23.134  13.530 2.929   1.00 18.51 ? 16   PRO F C   1 
ATOM   5509 O  O   . PRO F  2 16  ? 21.906  13.346 2.908   1.00 20.09 ? 16   PRO F O   1 
ATOM   5510 C  CB  . PRO F  2 16  ? 24.046  13.519 5.252   1.00 24.37 ? 16   PRO F CB  1 
ATOM   5511 C  CG  . PRO F  2 16  ? 22.780  13.585 6.054   1.00 23.07 ? 16   PRO F CG  1 
ATOM   5512 C  CD  . PRO F  2 16  ? 22.309  15.030 5.889   1.00 23.39 ? 16   PRO F CD  1 
ATOM   5513 N  N   . PRO F  2 17  ? 23.983  12.960 2.053   1.00 25.23 ? 17   PRO F N   1 
ATOM   5514 C  CA  . PRO F  2 17  ? 23.564  12.078 0.954   1.00 23.40 ? 17   PRO F CA  1 
ATOM   5515 C  C   . PRO F  2 17  ? 22.576  10.979 1.354   1.00 22.61 ? 17   PRO F C   1 
ATOM   5516 O  O   . PRO F  2 17  ? 21.655  10.681 0.580   1.00 22.29 ? 17   PRO F O   1 
ATOM   5517 C  CB  . PRO F  2 17  ? 24.883  11.442 0.509   1.00 28.60 ? 17   PRO F CB  1 
ATOM   5518 C  CG  . PRO F  2 17  ? 25.929  12.433 0.852   1.00 27.30 ? 17   PRO F CG  1 
ATOM   5519 C  CD  . PRO F  2 17  ? 25.445  13.161 2.084   1.00 24.05 ? 17   PRO F CD  1 
ATOM   5520 N  N   A GLU F  2 18  ? 22.739  10.408 2.542   0.34 19.93 ? 18   GLU F N   1 
ATOM   5521 N  N   B GLU F  2 18  ? 22.749  10.369 2.534   0.66 19.79 ? 18   GLU F N   1 
ATOM   5522 C  CA  A GLU F  2 18  ? 21.907  9.282  2.946   0.34 20.93 ? 18   GLU F CA  1 
ATOM   5523 C  CA  B GLU F  2 18  ? 21.872  9.256  2.931   0.66 20.88 ? 18   GLU F CA  1 
ATOM   5524 C  C   A GLU F  2 18  ? 20.434  9.630  3.180   0.34 21.65 ? 18   GLU F C   1 
ATOM   5525 C  C   B GLU F  2 18  ? 20.415  9.631  3.197   0.66 21.62 ? 18   GLU F C   1 
ATOM   5526 O  O   A GLU F  2 18  ? 19.619  8.735  3.398   0.34 23.54 ? 18   GLU F O   1 
ATOM   5527 O  O   B GLU F  2 18  ? 19.589  8.758  3.453   0.66 23.60 ? 18   GLU F O   1 
ATOM   5528 C  CB  A GLU F  2 18  ? 22.500  8.595  4.176   0.34 24.70 ? 18   GLU F CB  1 
ATOM   5529 C  CB  B GLU F  2 18  ? 22.427  8.437  4.115   0.66 24.70 ? 18   GLU F CB  1 
ATOM   5530 C  CG  A GLU F  2 18  ? 24.012  8.700  4.242   0.34 23.34 ? 18   GLU F CG  1 
ATOM   5531 C  CG  B GLU F  2 18  ? 22.673  9.212  5.401   0.66 22.83 ? 18   GLU F CG  1 
ATOM   5532 C  CD  A GLU F  2 18  ? 24.474  9.883  5.071   0.34 26.61 ? 18   GLU F CD  1 
ATOM   5533 C  CD  B GLU F  2 18  ? 24.039  9.864  5.414   0.66 26.67 ? 18   GLU F CD  1 
ATOM   5534 O  OE1 A GLU F  2 18  ? 23.976  10.030 6.207   0.34 28.50 ? 18   GLU F OE1 1 
ATOM   5535 O  OE1 B GLU F  2 18  ? 24.558  10.168 4.317   0.66 26.95 ? 18   GLU F OE1 1 
ATOM   5536 O  OE2 A GLU F  2 18  ? 25.336  10.656 4.591   0.34 22.70 ? 18   GLU F OE2 1 
ATOM   5537 O  OE2 B GLU F  2 18  ? 24.610  10.058 6.510   0.66 29.91 ? 18   GLU F OE2 1 
ATOM   5538 N  N   . GLN F  2 19  ? 20.081  10.914 3.114   1.00 21.27 ? 19   GLN F N   1 
ATOM   5539 C  CA  . GLN F  2 19  ? 18.684  11.309 3.298   1.00 19.21 ? 19   GLN F CA  1 
ATOM   5540 C  C   . GLN F  2 19  ? 17.819  10.704 2.184   1.00 19.07 ? 19   GLN F C   1 
ATOM   5541 O  O   . GLN F  2 19  ? 16.631  10.423 2.380   1.00 19.58 ? 19   GLN F O   1 
ATOM   5542 C  CB  . GLN F  2 19  ? 18.531  12.832 3.379   1.00 22.16 ? 19   GLN F CB  1 
ATOM   5543 C  CG  . GLN F  2 19  ? 19.038  13.593 2.176   1.00 19.74 ? 19   GLN F CG  1 
ATOM   5544 C  CD  . GLN F  2 19  ? 19.046  15.111 2.398   1.00 21.41 ? 19   GLN F CD  1 
ATOM   5545 O  OE1 . GLN F  2 19  ? 18.104  15.677 2.964   1.00 24.19 ? 19   GLN F OE1 1 
ATOM   5546 N  NE2 . GLN F  2 19  ? 20.118  15.759 1.977   1.00 20.22 ? 19   GLN F NE2 1 
ATOM   5547 N  N   . CYS F  2 20  ? 18.444  10.472 1.034   1.00 19.98 ? 20   CYS F N   1 
ATOM   5548 C  CA  . CYS F  2 20  ? 17.797  9.869  -0.128  1.00 20.76 ? 20   CYS F CA  1 
ATOM   5549 C  C   . CYS F  2 20  ? 18.318  8.454  -0.317  1.00 22.87 ? 20   CYS F C   1 
ATOM   5550 O  O   . CYS F  2 20  ? 19.537  8.248  -0.311  1.00 21.30 ? 20   CYS F O   1 
ATOM   5551 C  CB  . CYS F  2 20  ? 18.143  10.651 -1.392  1.00 21.88 ? 20   CYS F CB  1 
ATOM   5552 S  SG  . CYS F  2 20  ? 17.609  12.407 -1.370  1.00 18.70 ? 20   CYS F SG  1 
ATOM   5553 N  N   . CYS F  2 21  ? 17.409  7.498  -0.490  1.00 24.61 ? 21   CYS F N   1 
ATOM   5554 C  CA  . CYS F  2 21  ? 17.810  6.130  -0.862  1.00 23.97 ? 21   CYS F CA  1 
ATOM   5555 C  C   . CYS F  2 21  ? 18.794  6.131  -2.039  1.00 28.36 ? 21   CYS F C   1 
ATOM   5556 O  O   . CYS F  2 21  ? 19.804  5.419  -2.027  1.00 29.12 ? 21   CYS F O   1 
ATOM   5557 C  CB  . CYS F  2 21  ? 16.583  5.285  -1.199  1.00 33.71 ? 21   CYS F CB  1 
ATOM   5558 S  SG  . CYS F  2 21  ? 15.364  5.187  0.134   1.00 39.96 ? 21   CYS F SG  1 
ATOM   5559 N  N   . SER F  2 22  ? 18.509  6.953  -3.049  1.00 23.21 ? 22   SER F N   1 
ATOM   5560 C  CA  . SER F  2 22  ? 19.377  7.076  -4.219  1.00 27.05 ? 22   SER F CA  1 
ATOM   5561 C  C   . SER F  2 22  ? 20.754  7.668  -3.923  1.00 16.95 ? 22   SER F C   1 
ATOM   5562 O  O   . SER F  2 22  ? 21.638  7.655  -4.774  1.00 25.08 ? 22   SER F O   1 
ATOM   5563 C  CB  . SER F  2 22  ? 18.695  7.921  -5.301  1.00 24.12 ? 22   SER F CB  1 
ATOM   5564 O  OG  . SER F  2 22  ? 18.620  9.286  -4.896  1.00 26.01 ? 22   SER F OG  1 
ATOM   5565 N  N   . GLY F  2 23  ? 20.942  8.231  -2.732  1.00 23.34 ? 23   GLY F N   1 
ATOM   5566 C  CA  . GLY F  2 23  ? 22.225  8.824  -2.399  1.00 15.81 ? 23   GLY F CA  1 
ATOM   5567 C  C   . GLY F  2 23  ? 22.499  10.214 -2.945  1.00 22.72 ? 23   GLY F C   1 
ATOM   5568 O  O   . GLY F  2 23  ? 23.581  10.786 -2.747  1.00 24.57 ? 23   GLY F O   1 
ATOM   5569 N  N   . ALA F  2 24  ? 21.520  10.776 -3.641  1.00 24.67 ? 24   ALA F N   1 
ATOM   5570 C  CA  . ALA F  2 24  ? 21.733  12.033 -4.340  1.00 26.86 ? 24   ALA F CA  1 
ATOM   5571 C  C   . ALA F  2 24  ? 20.560  12.953 -4.107  1.00 20.03 ? 24   ALA F C   1 
ATOM   5572 O  O   . ALA F  2 24  ? 19.420  12.638 -4.444  1.00 24.72 ? 24   ALA F O   1 
ATOM   5573 C  CB  . ALA F  2 24  ? 21.901  11.793 -5.832  1.00 26.62 ? 24   ALA F CB  1 
ATOM   5574 N  N   A CYS F  2 25  ? 20.812  14.068 -3.429  0.83 24.96 ? 25   CYS F N   1 
ATOM   5575 N  N   B CYS F  2 25  ? 20.869  14.130 -3.612  0.17 24.57 ? 25   CYS F N   1 
ATOM   5576 C  CA  A CYS F  2 25  ? 19.771  15.077 -3.217  0.83 22.04 ? 25   CYS F CA  1 
ATOM   5577 C  CA  B CYS F  2 25  ? 19.830  15.065 -3.298  0.17 22.07 ? 25   CYS F CA  1 
ATOM   5578 C  C   A CYS F  2 25  ? 20.116  16.246 -4.142  0.83 22.03 ? 25   CYS F C   1 
ATOM   5579 C  C   B CYS F  2 25  ? 20.075  16.329 -4.101  0.17 22.00 ? 25   CYS F C   1 
ATOM   5580 O  O   A CYS F  2 25  ? 21.146  16.897 -3.963  0.83 22.93 ? 25   CYS F O   1 
ATOM   5581 O  O   B CYS F  2 25  ? 20.969  17.120 -3.806  0.17 22.76 ? 25   CYS F O   1 
ATOM   5582 C  CB  A CYS F  2 25  ? 19.726  15.513 -1.744  0.83 21.51 ? 25   CYS F CB  1 
ATOM   5583 C  CB  B CYS F  2 25  ? 19.797  15.231 -1.793  0.17 21.45 ? 25   CYS F CB  1 
ATOM   5584 S  SG  A CYS F  2 25  ? 18.587  16.916 -1.388  0.83 16.91 ? 25   CYS F SG  1 
ATOM   5585 S  SG  B CYS F  2 25  ? 19.181  13.674 -1.085  0.17 25.28 ? 25   CYS F SG  1 
ATOM   5586 N  N   . VAL F  2 26  ? 19.284  16.472 -5.159  1.00 21.32 ? 26   VAL F N   1 
ATOM   5587 C  CA  . VAL F  2 26  ? 19.618  17.392 -6.241  1.00 20.51 ? 26   VAL F CA  1 
ATOM   5588 C  C   . VAL F  2 26  ? 18.579  18.497 -6.397  1.00 15.35 ? 26   VAL F C   1 
ATOM   5589 O  O   . VAL F  2 26  ? 17.434  18.313 -5.997  1.00 18.59 ? 26   VAL F O   1 
ATOM   5590 C  CB  . VAL F  2 26  ? 19.710  16.643 -7.585  1.00 18.70 ? 26   VAL F CB  1 
ATOM   5591 C  CG1 . VAL F  2 26  ? 20.821  15.596 -7.537  1.00 26.77 ? 26   VAL F CG1 1 
ATOM   5592 C  CG2 . VAL F  2 26  ? 18.382  15.984 -7.930  1.00 19.36 ? 26   VAL F CG2 1 
ATOM   5593 N  N   . PRO F  2 27  ? 18.986  19.643 -6.965  1.00 22.69 ? 27   PRO F N   1 
ATOM   5594 C  CA  . PRO F  2 27  ? 18.041  20.718 -7.277  1.00 18.85 ? 27   PRO F CA  1 
ATOM   5595 C  C   . PRO F  2 27  ? 16.957  20.210 -8.222  1.00 18.71 ? 27   PRO F C   1 
ATOM   5596 O  O   . PRO F  2 27  ? 17.288  19.577 -9.241  1.00 21.43 ? 27   PRO F O   1 
ATOM   5597 C  CB  . PRO F  2 27  ? 18.912  21.738 -8.012  1.00 24.58 ? 27   PRO F CB  1 
ATOM   5598 C  CG  . PRO F  2 27  ? 20.276  21.511 -7.481  1.00 29.27 ? 27   PRO F CG  1 
ATOM   5599 C  CD  . PRO F  2 27  ? 20.369  20.022 -7.306  1.00 25.06 ? 27   PRO F CD  1 
ATOM   5600 N  N   . HIS F  2 28  ? 15.689  20.456 -7.898  1.00 16.60 ? 28   HIS F N   1 
ATOM   5601 C  CA  . HIS F  2 28  ? 14.626  20.214 -8.852  1.00 10.83 ? 28   HIS F CA  1 
ATOM   5602 C  C   . HIS F  2 28  ? 14.891  21.148 -10.042 1.00 13.65 ? 28   HIS F C   1 
ATOM   5603 O  O   . HIS F  2 28  ? 15.387  22.266 -9.870  1.00 20.13 ? 28   HIS F O   1 
ATOM   5604 C  CB  . HIS F  2 28  ? 13.263  20.520 -8.221  1.00 19.42 ? 28   HIS F CB  1 
ATOM   5605 C  CG  . HIS F  2 28  ? 12.109  19.879 -8.923  1.00 16.03 ? 28   HIS F CG  1 
ATOM   5606 N  ND1 . HIS F  2 28  ? 11.487  20.459 -10.006 1.00 17.10 ? 28   HIS F ND1 1 
ATOM   5607 C  CD2 . HIS F  2 28  ? 11.465  18.708 -8.705  1.00 14.79 ? 28   HIS F CD2 1 
ATOM   5608 C  CE1 . HIS F  2 28  ? 10.515  19.674 -10.428 1.00 19.37 ? 28   HIS F CE1 1 
ATOM   5609 N  NE2 . HIS F  2 28  ? 10.472  18.607 -9.651  1.00 20.47 ? 28   HIS F NE2 1 
ATOM   5610 N  N   . PRO F  2 29  ? 14.580  20.685 -11.256 1.00 19.66 ? 29   PRO F N   1 
ATOM   5611 C  CA  . PRO F  2 29  ? 14.821  21.514 -12.442 1.00 25.06 ? 29   PRO F CA  1 
ATOM   5612 C  C   . PRO F  2 29  ? 13.849  22.684 -12.548 1.00 24.94 ? 29   PRO F C   1 
ATOM   5613 O  O   . PRO F  2 29  ? 14.178  23.673 -13.214 1.00 27.61 ? 29   PRO F O   1 
ATOM   5614 C  CB  . PRO F  2 29  ? 14.569  20.538 -13.590 1.00 18.83 ? 29   PRO F CB  1 
ATOM   5615 C  CG  . PRO F  2 29  ? 13.544  19.588 -13.034 1.00 25.51 ? 29   PRO F CG  1 
ATOM   5616 C  CD  . PRO F  2 29  ? 14.000  19.376 -11.608 1.00 22.56 ? 29   PRO F CD  1 
ATOM   5617 N  N   . ILE F  2 30  ? 12.688  22.573 -11.898 1.00 15.99 ? 30   ILE F N   1 
ATOM   5618 C  CA  . ILE F  2 30  ? 11.618  23.562 -12.041 1.00 13.90 ? 30   ILE F CA  1 
ATOM   5619 C  C   . ILE F  2 30  ? 11.240  24.219 -10.704 1.00 11.53 ? 30   ILE F C   1 
ATOM   5620 O  O   . ILE F  2 30  ? 11.349  25.445 -10.556 1.00 12.63 ? 30   ILE F O   1 
ATOM   5621 C  CB  . ILE F  2 30  ? 10.383  22.938 -12.714 1.00 17.67 ? 30   ILE F CB  1 
ATOM   5622 C  CG1 . ILE F  2 30  ? 10.704  22.558 -14.166 1.00 23.06 ? 30   ILE F CG1 1 
ATOM   5623 C  CG2 . ILE F  2 30  ? 9.229   23.888 -12.719 1.00 17.29 ? 30   ILE F CG2 1 
ATOM   5624 C  CD1 . ILE F  2 30  ? 11.077  23.742 -15.013 1.00 22.86 ? 30   ILE F CD1 1 
ATOM   5625 N  N   . LEU F  2 31  ? 10.809  23.406 -9.738  1.00 14.47 ? 31   LEU F N   1 
ATOM   5626 C  CA  . LEU F  2 31  ? 10.490  23.883 -8.388  1.00 11.83 ? 31   LEU F CA  1 
ATOM   5627 C  C   . LEU F  2 31  ? 11.772  24.310 -7.702  1.00 12.11 ? 31   LEU F C   1 
ATOM   5628 O  O   . LEU F  2 31  ? 12.842  23.741 -7.949  1.00 12.48 ? 31   LEU F O   1 
ATOM   5629 C  CB  . LEU F  2 31  ? 9.826   22.768 -7.590  1.00 11.00 ? 31   LEU F CB  1 
ATOM   5630 C  CG  . LEU F  2 31  ? 8.521   22.250 -8.174  1.00 13.06 ? 31   LEU F CG  1 
ATOM   5631 C  CD1 . LEU F  2 31  ? 8.096   20.983 -7.425  1.00 15.45 ? 31   LEU F CD1 1 
ATOM   5632 C  CD2 . LEU F  2 31  ? 7.439   23.310 -8.059  1.00 15.25 ? 31   LEU F CD2 1 
ATOM   5633 N  N   . ARG F  2 32  ? 11.690  25.308 -6.822  1.00 12.43 ? 32   ARG F N   1 
ATOM   5634 C  CA  . ARG F  2 32  ? 12.913  25.801 -6.204  1.00 11.53 ? 32   ARG F CA  1 
ATOM   5635 C  C   . ARG F  2 32  ? 13.215  25.085 -4.885  1.00 14.13 ? 32   ARG F C   1 
ATOM   5636 O  O   . ARG F  2 32  ? 13.530  25.711 -3.868  1.00 11.45 ? 32   ARG F O   1 
ATOM   5637 C  CB  . ARG F  2 32  ? 12.836  27.333 -6.081  1.00 14.95 ? 32   ARG F CB  1 
ATOM   5638 C  CG  . ARG F  2 32  ? 12.546  27.908 -7.476  1.00 20.70 ? 32   ARG F CG  1 
ATOM   5639 C  CD  . ARG F  2 32  ? 13.355  29.122 -7.794  1.00 22.78 ? 32   ARG F CD  1 
ATOM   5640 N  NE  . ARG F  2 32  ? 13.642  29.235 -9.232  1.00 20.03 ? 32   ARG F NE  1 
ATOM   5641 C  CZ  . ARG F  2 32  ? 13.672  30.397 -9.879  1.00 22.86 ? 32   ARG F CZ  1 
ATOM   5642 N  NH1 . ARG F  2 32  ? 13.402  31.519 -9.232  1.00 20.72 ? 32   ARG F NH1 1 
ATOM   5643 N  NH2 . ARG F  2 32  ? 13.962  30.439 -11.168 1.00 22.07 ? 32   ARG F NH2 1 
ATOM   5644 N  N   . ILE F  2 33  ? 13.097  23.754 -4.927  1.00 8.54  ? 33   ILE F N   1 
ATOM   5645 C  CA  . ILE F  2 33  ? 13.442  22.893 -3.795  1.00 11.83 ? 33   ILE F CA  1 
ATOM   5646 C  C   . ILE F  2 33  ? 14.417  21.867 -4.287  1.00 12.45 ? 33   ILE F C   1 
ATOM   5647 O  O   . ILE F  2 33  ? 14.554  21.661 -5.496  1.00 12.23 ? 33   ILE F O   1 
ATOM   5648 C  CB  . ILE F  2 33  ? 12.268  22.022 -3.290  1.00 12.33 ? 33   ILE F CB  1 
ATOM   5649 C  CG1 . ILE F  2 33  ? 11.595  21.300 -4.461  1.00 12.96 ? 33   ILE F CG1 1 
ATOM   5650 C  CG2 . ILE F  2 33  ? 11.292  22.802 -2.481  1.00 21.11 ? 33   ILE F CG2 1 
ATOM   5651 C  CD1 . ILE F  2 33  ? 10.457  20.367 -4.039  1.00 22.96 ? 33   ILE F CD1 1 
ATOM   5652 N  N   . PHE F  2 34  ? 15.069  21.203 -3.337  1.00 13.05 ? 34   PHE F N   1 
ATOM   5653 C  CA  . PHE F  2 34  ? 15.870  20.024 -3.639  1.00 16.18 ? 34   PHE F CA  1 
ATOM   5654 C  C   . PHE F  2 34  ? 14.970  18.810 -3.514  1.00 12.06 ? 34   PHE F C   1 
ATOM   5655 O  O   . PHE F  2 34  ? 14.083  18.765 -2.658  1.00 13.10 ? 34   PHE F O   1 
ATOM   5656 C  CB  . PHE F  2 34  ? 17.030  19.883 -2.657  1.00 12.55 ? 34   PHE F CB  1 
ATOM   5657 C  CG  . PHE F  2 34  ? 18.190  20.804 -2.926  1.00 17.63 ? 34   PHE F CG  1 
ATOM   5658 C  CD1 . PHE F  2 34  ? 18.105  22.159 -2.630  1.00 16.00 ? 34   PHE F CD1 1 
ATOM   5659 C  CD2 . PHE F  2 34  ? 19.375  20.302 -3.444  1.00 23.00 ? 34   PHE F CD2 1 
ATOM   5660 C  CE1 . PHE F  2 34  ? 19.182  23.013 -2.868  1.00 20.95 ? 34   PHE F CE1 1 
ATOM   5661 C  CE2 . PHE F  2 34  ? 20.453  21.148 -3.691  1.00 25.89 ? 34   PHE F CE2 1 
ATOM   5662 C  CZ  . PHE F  2 34  ? 20.354  22.504 -3.400  1.00 24.52 ? 34   PHE F CZ  1 
ATOM   5663 N  N   . VAL F  2 35  ? 15.207  17.815 -4.368  1.00 13.81 ? 35   VAL F N   1 
ATOM   5664 C  CA  . VAL F  2 35  ? 14.504  16.538 -4.276  1.00 13.56 ? 35   VAL F CA  1 
ATOM   5665 C  C   . VAL F  2 35  ? 15.474  15.368 -4.411  1.00 13.88 ? 35   VAL F C   1 
ATOM   5666 O  O   . VAL F  2 35  ? 16.620  15.533 -4.856  1.00 16.61 ? 35   VAL F O   1 
ATOM   5667 C  CB  . VAL F  2 35  ? 13.401  16.426 -5.336  1.00 12.43 ? 35   VAL F CB  1 
ATOM   5668 C  CG1 . VAL F  2 35  ? 12.296  17.446 -5.036  1.00 13.03 ? 35   VAL F CG1 1 
ATOM   5669 C  CG2 . VAL F  2 35  ? 13.998  16.622 -6.761  1.00 12.61 ? 35   VAL F CG2 1 
ATOM   5670 N  N   . CYS F  2 36  ? 15.035  14.197 -3.974  1.00 14.00 ? 36   CYS F N   1 
ATOM   5671 C  CA  . CYS F  2 36  ? 15.880  13.017 -4.091  1.00 17.38 ? 36   CYS F CA  1 
ATOM   5672 C  C   . CYS F  2 36  ? 15.939  12.566 -5.546  1.00 18.22 ? 36   CYS F C   1 
ATOM   5673 O  O   . CYS F  2 36  ? 14.905  12.412 -6.191  1.00 21.16 ? 36   CYS F O   1 
ATOM   5674 C  CB  . CYS F  2 36  ? 15.346  11.884 -3.223  1.00 20.74 ? 36   CYS F CB  1 
ATOM   5675 S  SG  . CYS F  2 36  ? 15.591  12.171 -1.464  1.00 20.58 ? 36   CYS F SG  1 
ATOM   5676 N  N   . GLN F  2 37  ? 17.160  12.374 -6.032  1.00 16.99 ? 37   GLN F N   1 
ATOM   5677 C  CA  . GLN F  2 37  ? 17.412  11.787 -7.349  1.00 30.60 ? 37   GLN F CA  1 
ATOM   5678 C  C   . GLN F  2 37  ? 17.122  10.286 -7.357  1.00 35.48 ? 37   GLN F C   1 
ATOM   5679 O  O   . GLN F  2 37  ? 16.415  9.766  -6.487  1.00 28.65 ? 37   GLN F O   1 
ATOM   5680 C  CB  . GLN F  2 37  ? 18.869  12.031 -7.735  1.00 28.87 ? 37   GLN F CB  1 
ATOM   5681 C  CG  . GLN F  2 37  ? 19.339  11.341 -9.010  1.00 34.49 ? 37   GLN F CG  1 
ATOM   5682 C  CD  . GLN F  2 37  ? 20.852  11.200 -9.044  1.00 36.54 ? 37   GLN F CD  1 
ATOM   5683 O  OE1 . GLN F  2 37  ? 21.585  12.187 -9.147  1.00 34.06 ? 37   GLN F OE1 1 
ATOM   5684 N  NE2 . GLN F  2 37  ? 21.329  9.966  -8.937  1.00 45.79 ? 37   GLN F NE2 1 
HETATM 5685 C  C1  A GOL G  3 .   ? 11.441  27.124 45.022  0.44 18.29 ? 1247 GOL A C1  1 
HETATM 5686 C  C1  B GOL G  3 .   ? 11.164  27.218 46.415  0.40 16.22 ? 1247 GOL A C1  1 
HETATM 5687 O  O1  A GOL G  3 .   ? 11.751  28.131 44.075  0.44 10.63 ? 1247 GOL A O1  1 
HETATM 5688 O  O1  B GOL G  3 .   ? 11.706  26.964 45.133  0.40 18.64 ? 1247 GOL A O1  1 
HETATM 5689 C  C2  A GOL G  3 .   ? 11.450  27.647 46.459  0.44 17.09 ? 1247 GOL A C2  1 
HETATM 5690 C  C2  B GOL G  3 .   ? 11.744  28.445 47.124  0.40 19.33 ? 1247 GOL A C2  1 
HETATM 5691 O  O2  A GOL G  3 .   ? 10.750  26.746 47.289  0.44 19.23 ? 1247 GOL A O2  1 
HETATM 5692 O  O2  B GOL G  3 .   ? 12.780  29.066 46.386  0.40 19.91 ? 1247 GOL A O2  1 
HETATM 5693 C  C3  A GOL G  3 .   ? 10.801  29.026 46.544  0.44 19.47 ? 1247 GOL A C3  1 
HETATM 5694 C  C3  B GOL G  3 .   ? 10.646  29.452 47.459  0.40 20.04 ? 1247 GOL A C3  1 
HETATM 5695 O  O3  A GOL G  3 .   ? 9.588   28.965 47.269  0.44 25.06 ? 1247 GOL A O3  1 
HETATM 5696 O  O3  B GOL G  3 .   ? 9.348   28.889 47.333  0.40 24.13 ? 1247 GOL A O3  1 
HETATM 5697 C  C1  . GOL H  3 .   ? 32.399  8.123  35.788  1.00 23.45 ? 1248 GOL A C1  1 
HETATM 5698 O  O1  . GOL H  3 .   ? 33.512  8.787  35.237  1.00 24.89 ? 1248 GOL A O1  1 
HETATM 5699 C  C2  . GOL H  3 .   ? 31.986  8.728  37.119  1.00 27.21 ? 1248 GOL A C2  1 
HETATM 5700 O  O2  . GOL H  3 .   ? 31.115  7.819  37.753  1.00 36.20 ? 1248 GOL A O2  1 
HETATM 5701 C  C3  . GOL H  3 .   ? 33.217  8.874  37.996  1.00 23.86 ? 1248 GOL A C3  1 
HETATM 5702 O  O3  . GOL H  3 .   ? 32.931  9.757  39.049  1.00 29.68 ? 1248 GOL A O3  1 
HETATM 5703 C  C1  . GOL I  3 .   ? 31.100  4.873  22.517  1.00 36.85 ? 1249 GOL A C1  1 
HETATM 5704 O  O1  . GOL I  3 .   ? 30.954  6.287  22.367  1.00 39.17 ? 1249 GOL A O1  1 
HETATM 5705 C  C2  . GOL I  3 .   ? 30.393  4.302  23.755  1.00 29.33 ? 1249 GOL A C2  1 
HETATM 5706 O  O2  . GOL I  3 .   ? 29.440  3.340  23.386  1.00 37.81 ? 1249 GOL A O2  1 
HETATM 5707 C  C3  . GOL I  3 .   ? 31.360  3.748  24.811  1.00 32.17 ? 1249 GOL A C3  1 
HETATM 5708 O  O3  . GOL I  3 .   ? 30.713  3.404  26.027  1.00 34.62 ? 1249 GOL A O3  1 
HETATM 5709 C  C1  . GOL J  3 .   ? 29.365  31.123 29.586  1.00 36.75 ? 1250 GOL A C1  1 
HETATM 5710 O  O1  . GOL J  3 .   ? 29.237  30.415 28.364  1.00 42.10 ? 1250 GOL A O1  1 
HETATM 5711 C  C2  . GOL J  3 .   ? 28.001  31.256 30.262  1.00 28.01 ? 1250 GOL A C2  1 
HETATM 5712 O  O2  . GOL J  3 .   ? 27.086  31.545 29.216  1.00 29.43 ? 1250 GOL A O2  1 
HETATM 5713 C  C3  . GOL J  3 .   ? 28.006  32.398 31.297  1.00 34.91 ? 1250 GOL A C3  1 
HETATM 5714 O  O3  . GOL J  3 .   ? 28.107  31.981 32.666  1.00 32.34 ? 1250 GOL A O3  1 
HETATM 5715 CL CL  . CL  K  4 .   ? 10.492  11.358 47.940  1.00 22.29 ? 1251 CL  A CL  1 
HETATM 5716 CL CL  . CL  L  4 .   ? 21.538  32.914 24.644  1.00 31.28 ? 1252 CL  A CL  1 
HETATM 5717 N  N1  . IMD M  5 .   ? 7.550   11.709 44.990  1.00 12.53 ? 1253 IMD A N1  1 
HETATM 5718 C  C2  . IMD M  5 .   ? 7.585   10.480 44.436  1.00 15.56 ? 1253 IMD A C2  1 
HETATM 5719 N  N3  . IMD M  5 .   ? 7.117   9.589  45.344  1.00 15.95 ? 1253 IMD A N3  1 
HETATM 5720 C  C4  . IMD M  5 .   ? 6.803   10.264 46.465  1.00 13.53 ? 1253 IMD A C4  1 
HETATM 5721 C  C5  . IMD M  5 .   ? 7.077   11.610 46.251  1.00 16.05 ? 1253 IMD A C5  1 
HETATM 5722 N  N1  . IMD N  5 .   ? 14.435  23.815 21.741  1.00 27.42 ? 1254 IMD A N1  1 
HETATM 5723 C  C2  . IMD N  5 .   ? 15.538  24.536 21.449  1.00 24.61 ? 1254 IMD A C2  1 
HETATM 5724 N  N3  . IMD N  5 .   ? 16.549  23.680 21.132  1.00 25.73 ? 1254 IMD A N3  1 
HETATM 5725 C  C4  . IMD N  5 .   ? 16.079  22.417 21.235  1.00 24.34 ? 1254 IMD A C4  1 
HETATM 5726 C  C5  . IMD N  5 .   ? 14.738  22.504 21.605  1.00 29.53 ? 1254 IMD A C5  1 
HETATM 5727 CA CA  . CA  O  6 .   ? 12.752  7.199  50.458  1.00 10.41 ? 1255 CA  A CA  1 
HETATM 5728 C  C1  A GOL P  3 .   ? -5.949  51.050 53.498  0.45 26.48 ? 1247 GOL B C1  1 
HETATM 5729 C  C1  B GOL P  3 .   ? -5.878  51.191 53.417  0.50 26.46 ? 1247 GOL B C1  1 
HETATM 5730 O  O1  A GOL P  3 .   ? -4.990  50.407 54.304  0.45 26.78 ? 1247 GOL B O1  1 
HETATM 5731 O  O1  B GOL P  3 .   ? -5.118  50.405 54.305  0.50 26.72 ? 1247 GOL B O1  1 
HETATM 5732 C  C2  A GOL P  3 .   ? -7.157  51.400 54.360  0.45 27.50 ? 1247 GOL B C2  1 
HETATM 5733 C  C2  B GOL P  3 .   ? -6.967  51.916 54.203  0.50 28.61 ? 1247 GOL B C2  1 
HETATM 5734 O  O2  A GOL P  3 .   ? -8.298  51.475 53.534  0.45 25.30 ? 1247 GOL B O2  1 
HETATM 5735 O  O2  B GOL P  3 .   ? -7.662  50.990 55.006  0.50 20.21 ? 1247 GOL B O2  1 
HETATM 5736 C  C3  A GOL P  3 .   ? -6.913  52.718 55.087  0.45 30.66 ? 1247 GOL B C3  1 
HETATM 5737 C  C3  B GOL P  3 .   ? -6.338  52.983 55.092  0.50 31.77 ? 1247 GOL B C3  1 
HETATM 5738 O  O3  A GOL P  3 .   ? -5.996  53.494 54.349  0.45 34.20 ? 1247 GOL B O3  1 
HETATM 5739 O  O3  B GOL P  3 .   ? -5.521  53.829 54.312  0.50 35.05 ? 1247 GOL B O3  1 
HETATM 5740 N  N1  . IMD Q  5 .   ? -15.172 48.889 27.227  1.00 32.91 ? 1248 IMD B N1  1 
HETATM 5741 C  C2  . IMD Q  5 .   ? -15.047 49.497 26.018  1.00 30.35 ? 1248 IMD B C2  1 
HETATM 5742 N  N3  . IMD Q  5 .   ? -16.229 49.399 25.357  1.00 39.64 ? 1248 IMD B N3  1 
HETATM 5743 C  C4  . IMD Q  5 .   ? -17.102 48.729 26.141  1.00 38.16 ? 1248 IMD B C4  1 
HETATM 5744 C  C5  . IMD Q  5 .   ? -16.436 48.397 27.317  1.00 32.21 ? 1248 IMD B C5  1 
HETATM 5745 N  N1  . IMD R  5 .   ? -1.681  62.321 27.434  1.00 22.77 ? 1249 IMD B N1  1 
HETATM 5746 C  C2  . IMD R  5 .   ? -2.175  61.471 28.374  1.00 22.91 ? 1249 IMD B C2  1 
HETATM 5747 N  N3  . IMD R  5 .   ? -3.031  60.616 27.779  1.00 18.94 ? 1249 IMD B N3  1 
HETATM 5748 C  C4  . IMD R  5 .   ? -3.080  60.932 26.457  1.00 24.83 ? 1249 IMD B C4  1 
HETATM 5749 C  C5  . IMD R  5 .   ? -2.226  62.009 26.237  1.00 24.28 ? 1249 IMD B C5  1 
HETATM 5750 N  N1  . IMD S  5 .   ? -10.866 48.522 51.041  1.00 27.68 ? 1250 IMD B N1  1 
HETATM 5751 C  C2  . IMD S  5 .   ? -10.411 47.249 51.145  1.00 29.90 ? 1250 IMD B C2  1 
HETATM 5752 N  N3  . IMD S  5 .   ? -9.060  47.267 51.296  1.00 21.33 ? 1250 IMD B N3  1 
HETATM 5753 C  C4  . IMD S  5 .   ? -8.662  48.561 51.294  1.00 27.66 ? 1250 IMD B C4  1 
HETATM 5754 C  C5  . IMD S  5 .   ? -9.800  49.352 51.144  1.00 25.04 ? 1250 IMD B C5  1 
HETATM 5755 N  N1  . IMD T  5 .   ? -12.965 50.628 47.983  1.00 38.53 ? 1251 IMD B N1  1 
HETATM 5756 C  C2  . IMD T  5 .   ? -12.445 50.366 49.202  1.00 31.39 ? 1251 IMD B C2  1 
HETATM 5757 N  N3  . IMD T  5 .   ? -11.491 51.290 49.478  1.00 37.86 ? 1251 IMD B N3  1 
HETATM 5758 C  C4  . IMD T  5 .   ? -11.411 52.144 48.432  1.00 28.96 ? 1251 IMD B C4  1 
HETATM 5759 C  C5  . IMD T  5 .   ? -12.339 51.723 47.487  1.00 38.70 ? 1251 IMD B C5  1 
HETATM 5760 CA CA  . CA  U  6 .   ? 3.116   58.400 22.176  1.00 12.80 ? 1252 CA  B CA  1 
HETATM 5761 CA CA  . CA  V  6 .   ? 9.199   42.385 54.784  1.00 46.79 ? 1253 CA  B CA  1 
HETATM 5762 O  O1  . MES W  7 .   ? -12.965 24.493 33.738  1.00 14.73 ? 1254 MES B O1  1 
HETATM 5763 C  C2  . MES W  7 .   ? -12.627 25.720 33.086  1.00 19.68 ? 1254 MES B C2  1 
HETATM 5764 C  C3  . MES W  7 .   ? -11.918 26.704 34.018  1.00 16.07 ? 1254 MES B C3  1 
HETATM 5765 N  N4  . MES W  7 .   ? -12.570 26.844 35.317  1.00 19.38 ? 1254 MES B N4  1 
HETATM 5766 C  C5  . MES W  7 .   ? -12.887 25.574 35.997  1.00 15.36 ? 1254 MES B C5  1 
HETATM 5767 C  C6  . MES W  7 .   ? -13.641 24.706 34.983  1.00 13.87 ? 1254 MES B C6  1 
HETATM 5768 C  C7  . MES W  7 .   ? -11.907 27.889 36.116  1.00 20.68 ? 1254 MES B C7  1 
HETATM 5769 C  C8  . MES W  7 .   ? -12.898 28.595 37.035  1.00 28.72 ? 1254 MES B C8  1 
HETATM 5770 S  S   . MES W  7 .   ? -12.100 29.644 38.063  1.00 27.57 ? 1254 MES B S   1 
HETATM 5771 O  O1S . MES W  7 .   ? -12.637 29.492 39.437  1.00 30.71 ? 1254 MES B O1S 1 
HETATM 5772 O  O2S . MES W  7 .   ? -12.329 31.054 37.655  1.00 25.60 ? 1254 MES B O2S 1 
HETATM 5773 O  O3S . MES W  7 .   ? -10.639 29.370 38.078  1.00 27.95 ? 1254 MES B O3S 1 
HETATM 5774 C  C1  . GOL X  3 .   ? 4.383   23.317 -14.501 1.00 28.03 ? 1247 GOL C C1  1 
HETATM 5775 O  O1  . GOL X  3 .   ? 5.678   22.797 -14.691 1.00 27.54 ? 1247 GOL C O1  1 
HETATM 5776 C  C2  . GOL X  3 .   ? 4.447   24.827 -14.717 1.00 23.87 ? 1247 GOL C C2  1 
HETATM 5777 O  O2  . GOL X  3 .   ? 5.757   25.035 -15.194 1.00 27.14 ? 1247 GOL C O2  1 
HETATM 5778 C  C3  . GOL X  3 .   ? 3.474   25.260 -15.820 1.00 30.53 ? 1247 GOL C C3  1 
HETATM 5779 O  O3  . GOL X  3 .   ? 2.300   25.972 -15.427 1.00 19.92 ? 1247 GOL C O3  1 
HETATM 5780 N  N1  . IMD Y  5 .   ? 19.422  23.100 8.264   1.00 13.25 ? 1248 IMD C N1  1 
HETATM 5781 C  C2  . IMD Y  5 .   ? 20.649  23.349 7.763   1.00 16.90 ? 1248 IMD C C2  1 
HETATM 5782 N  N3  . IMD Y  5 .   ? 21.515  23.341 8.800   1.00 17.87 ? 1248 IMD C N3  1 
HETATM 5783 C  C4  . IMD Y  5 .   ? 20.847  23.103 9.950   1.00 18.18 ? 1248 IMD C C4  1 
HETATM 5784 C  C5  . IMD Y  5 .   ? 19.514  22.945 9.612   1.00 17.90 ? 1248 IMD C C5  1 
HETATM 5785 CA CA  . CA  Z  6 .   ? 20.907  29.717 13.877  1.00 14.96 ? 1249 CA  C CA  1 
HETATM 5786 O  O   . HOH AA 8 .   ? 14.976  6.267  36.340  1.00 15.04 ? 2001 HOH A O   1 
HETATM 5787 O  O   . HOH AA 8 .   ? 16.754  2.086  33.612  1.00 17.07 ? 2002 HOH A O   1 
HETATM 5788 O  O   . HOH AA 8 .   ? 14.782  0.494  31.108  1.00 18.82 ? 2003 HOH A O   1 
HETATM 5789 O  O   . HOH AA 8 .   ? 20.955  -1.341 28.591  1.00 27.31 ? 2004 HOH A O   1 
HETATM 5790 O  O   . HOH AA 8 .   ? 22.753  -0.120 31.928  1.00 27.31 ? 2005 HOH A O   1 
HETATM 5791 O  O   . HOH AA 8 .   ? 18.017  -1.665 31.493  1.00 27.80 ? 2006 HOH A O   1 
HETATM 5792 O  O   . HOH AA 8 .   ? 17.312  -1.626 35.433  1.00 26.39 ? 2007 HOH A O   1 
HETATM 5793 O  O   . HOH AA 8 .   ? 19.460  -3.274 37.525  1.00 23.46 ? 2008 HOH A O   1 
HETATM 5794 O  O   . HOH AA 8 .   ? 16.505  -3.667 41.028  1.00 32.58 ? 2009 HOH A O   1 
HETATM 5795 O  O   . HOH AA 8 .   ? 19.254  2.305  43.429  1.00 13.13 ? 2010 HOH A O   1 
HETATM 5796 O  O   . HOH AA 8 .   ? 20.450  -1.127 47.490  1.00 22.39 ? 2011 HOH A O   1 
HETATM 5797 O  O   . HOH AA 8 .   ? 18.470  0.187  45.189  1.00 15.64 ? 2012 HOH A O   1 
HETATM 5798 O  O   . HOH AA 8 .   ? 24.150  0.392  49.235  1.00 27.53 ? 2013 HOH A O   1 
HETATM 5799 O  O   . HOH AA 8 .   ? 22.229  7.295  45.757  1.00 13.86 ? 2014 HOH A O   1 
HETATM 5800 O  O   . HOH AA 8 .   ? 20.089  5.999  46.202  1.00 12.44 ? 2015 HOH A O   1 
HETATM 5801 O  O   . HOH AA 8 .   ? 27.706  6.538  49.022  1.00 29.74 ? 2016 HOH A O   1 
HETATM 5802 O  O   . HOH AA 8 .   ? 18.548  4.469  52.157  1.00 14.74 ? 2017 HOH A O   1 
HETATM 5803 O  O   . HOH AA 8 .   ? 22.005  9.017  48.694  1.00 12.66 ? 2018 HOH A O   1 
HETATM 5804 O  O   . HOH AA 8 .   ? 15.275  -0.064 33.917  1.00 21.87 ? 2019 HOH A O   1 
HETATM 5805 O  O   . HOH AA 8 .   ? 20.504  9.789  46.463  1.00 12.44 ? 2020 HOH A O   1 
HETATM 5806 O  O   . HOH AA 8 .   ? 21.511  12.835 48.439  1.00 10.30 ? 2021 HOH A O   1 
HETATM 5807 O  O   . HOH AA 8 .   ? 17.098  -1.958 45.178  1.00 25.68 ? 2022 HOH A O   1 
HETATM 5808 O  O   . HOH AA 8 .   ? 24.665  -1.257 46.981  1.00 25.52 ? 2023 HOH A O   1 
HETATM 5809 O  O   . HOH AA 8 .   ? 25.467  10.724 38.684  1.00 9.62  ? 2024 HOH A O   1 
HETATM 5810 O  O   . HOH AA 8 .   ? 29.614  9.118  40.960  1.00 22.06 ? 2025 HOH A O   1 
HETATM 5811 O  O   . HOH AA 8 .   ? 18.070  1.918  51.729  1.00 22.43 ? 2026 HOH A O   1 
HETATM 5812 O  O   . HOH AA 8 .   ? 18.110  12.089 47.354  1.00 8.41  ? 2027 HOH A O   1 
HETATM 5813 O  O   . HOH AA 8 .   ? 17.949  13.020 37.727  1.00 6.05  ? 2028 HOH A O   1 
HETATM 5814 O  O   . HOH AA 8 .   ? 10.550  13.439 45.869  1.00 10.47 ? 2029 HOH A O   1 
HETATM 5815 O  O   . HOH AA 8 .   ? 7.113   18.955 49.280  1.00 24.32 ? 2030 HOH A O   1 
HETATM 5816 O  O   . HOH AA 8 .   ? 1.478   19.004 43.491  1.00 32.90 ? 2031 HOH A O   1 
HETATM 5817 O  O   . HOH AA 8 .   ? 5.483   17.753 41.544  1.00 23.45 ? 2032 HOH A O   1 
HETATM 5818 O  O   . HOH AA 8 .   ? 30.288  20.931 55.084  1.00 30.00 ? 2033 HOH A O   1 
HETATM 5819 O  O   . HOH AA 8 .   ? -1.295  12.133 46.367  1.00 21.71 ? 2034 HOH A O   1 
HETATM 5820 O  O   . HOH AA 8 .   ? 8.412   13.198 37.320  1.00 12.36 ? 2035 HOH A O   1 
HETATM 5821 O  O   . HOH AA 8 .   ? 15.417  12.270 38.698  1.00 8.17  ? 2036 HOH A O   1 
HETATM 5822 O  O   . HOH AA 8 .   ? 13.079  31.726 35.088  1.00 30.15 ? 2037 HOH A O   1 
HETATM 5823 O  O   . HOH AA 8 .   ? 8.664   15.824 36.072  1.00 9.54  ? 2038 HOH A O   1 
HETATM 5824 O  O   . HOH AA 8 .   ? 22.649  18.458 38.393  1.00 10.54 ? 2039 HOH A O   1 
HETATM 5825 O  O   . HOH AA 8 .   ? 31.266  20.963 44.883  1.00 17.40 ? 2040 HOH A O   1 
HETATM 5826 O  O   . HOH AA 8 .   ? 27.874  25.006 52.906  1.00 22.44 ? 2041 HOH A O   1 
HETATM 5827 O  O   . HOH AA 8 .   ? 27.572  27.133 51.161  1.00 33.25 ? 2042 HOH A O   1 
HETATM 5828 O  O   . HOH AA 8 .   ? 30.992  25.339 47.673  1.00 35.66 ? 2043 HOH A O   1 
HETATM 5829 O  O   . HOH AA 8 .   ? 29.790  21.722 52.434  1.00 17.50 ? 2044 HOH A O   1 
HETATM 5830 O  O   . HOH AA 8 .   ? 27.561  22.740 56.554  1.00 22.28 ? 2045 HOH A O   1 
HETATM 5831 O  O   . HOH AA 8 .   ? 21.471  27.459 54.590  1.00 22.75 ? 2046 HOH A O   1 
HETATM 5832 O  O   . HOH AA 8 .   ? 25.931  30.786 50.443  1.00 21.23 ? 2047 HOH A O   1 
HETATM 5833 O  O   . HOH AA 8 .   ? 17.574  35.468 41.240  1.00 32.25 ? 2048 HOH A O   1 
HETATM 5834 O  O   . HOH AA 8 .   ? 20.896  36.501 38.855  1.00 18.36 ? 2049 HOH A O   1 
HETATM 5835 O  O   . HOH AA 8 .   ? 12.977  28.828 34.342  1.00 20.22 ? 2050 HOH A O   1 
HETATM 5836 O  O   . HOH AA 8 .   ? 10.346  26.840 34.874  1.00 19.48 ? 2051 HOH A O   1 
HETATM 5837 O  O   . HOH AA 8 .   ? 10.135  25.420 32.643  1.00 25.99 ? 2052 HOH A O   1 
HETATM 5838 O  O   . HOH AA 8 .   ? 7.518   27.427 37.087  1.00 20.98 ? 2053 HOH A O   1 
HETATM 5839 O  O   . HOH AA 8 .   ? 9.697   30.963 41.951  1.00 35.69 ? 2054 HOH A O   1 
HETATM 5840 O  O   . HOH AA 8 .   ? 9.347   34.231 39.977  1.00 26.85 ? 2055 HOH A O   1 
HETATM 5841 O  O   . HOH AA 8 .   ? 13.250  33.067 43.083  1.00 34.14 ? 2056 HOH A O   1 
HETATM 5842 O  O   . HOH AA 8 .   ? 4.144   23.320 38.620  1.00 15.89 ? 2057 HOH A O   1 
HETATM 5843 O  O   . HOH AA 8 .   ? 5.463   19.729 40.287  1.00 28.48 ? 2058 HOH A O   1 
HETATM 5844 O  O   . HOH AA 8 .   ? 4.591   28.336 45.949  1.00 38.40 ? 2059 HOH A O   1 
HETATM 5845 O  O   . HOH AA 8 .   ? 24.670  20.925 60.076  1.00 34.80 ? 2060 HOH A O   1 
HETATM 5846 O  O   . HOH AA 8 .   ? 7.299   21.575 48.947  1.00 26.76 ? 2061 HOH A O   1 
HETATM 5847 O  O   . HOH AA 8 .   ? 31.086  10.699 48.372  1.00 26.79 ? 2062 HOH A O   1 
HETATM 5848 O  O   . HOH AA 8 .   ? 10.685  26.003 49.295  1.00 20.23 ? 2063 HOH A O   1 
HETATM 5849 O  O   . HOH AA 8 .   ? 10.601  21.156 54.304  1.00 22.88 ? 2064 HOH A O   1 
HETATM 5850 O  O   . HOH AA 8 .   ? 34.175  24.407 44.131  1.00 33.19 ? 2065 HOH A O   1 
HETATM 5851 O  O   . HOH AA 8 .   ? 39.226  25.451 39.446  1.00 25.95 ? 2066 HOH A O   1 
HETATM 5852 O  O   . HOH AA 8 .   ? 16.792  6.632  52.364  1.00 10.05 ? 2067 HOH A O   1 
HETATM 5853 O  O   . HOH AA 8 .   ? 10.983  9.069  50.792  1.00 13.87 ? 2068 HOH A O   1 
HETATM 5854 O  O   . HOH AA 8 .   ? 15.102  6.019  50.398  1.00 9.15  ? 2069 HOH A O   1 
HETATM 5855 O  O   . HOH AA 8 .   ? 15.974  0.549  48.098  1.00 26.98 ? 2070 HOH A O   1 
HETATM 5856 O  O   . HOH AA 8 .   ? 8.554   0.329  45.818  1.00 31.34 ? 2071 HOH A O   1 
HETATM 5857 O  O   . HOH AA 8 .   ? 4.619   6.857  49.887  1.00 24.65 ? 2072 HOH A O   1 
HETATM 5858 O  O   . HOH AA 8 .   ? 7.270   2.097  44.733  1.00 31.23 ? 2073 HOH A O   1 
HETATM 5859 O  O   . HOH AA 8 .   ? 7.404   4.410  53.720  1.00 18.96 ? 2074 HOH A O   1 
HETATM 5860 O  O   . HOH AA 8 .   ? 9.085   2.701  55.456  1.00 25.36 ? 2075 HOH A O   1 
HETATM 5861 O  O   . HOH AA 8 .   ? 12.456  3.909  57.912  1.00 22.90 ? 2076 HOH A O   1 
HETATM 5862 O  O   . HOH AA 8 .   ? 14.510  -0.554 52.007  1.00 31.69 ? 2077 HOH A O   1 
HETATM 5863 O  O   . HOH AA 8 .   ? 17.806  10.415 57.855  1.00 15.16 ? 2078 HOH A O   1 
HETATM 5864 O  O   . HOH AA 8 .   ? 20.968  11.438 55.997  1.00 17.24 ? 2079 HOH A O   1 
HETATM 5865 O  O   . HOH AA 8 .   ? 21.174  5.405  59.103  1.00 35.33 ? 2080 HOH A O   1 
HETATM 5866 O  O   . HOH AA 8 .   ? 20.953  2.482  55.945  1.00 33.77 ? 2081 HOH A O   1 
HETATM 5867 O  O   . HOH AA 8 .   ? 18.865  17.882 57.722  1.00 21.05 ? 2082 HOH A O   1 
HETATM 5868 O  O   . HOH AA 8 .   ? 14.589  15.828 57.110  1.00 14.21 ? 2083 HOH A O   1 
HETATM 5869 O  O   . HOH AA 8 .   ? 11.773  20.058 56.531  1.00 24.32 ? 2084 HOH A O   1 
HETATM 5870 O  O   . HOH AA 8 .   ? 13.237  23.048 55.571  1.00 15.75 ? 2085 HOH A O   1 
HETATM 5871 O  O   . HOH AA 8 .   ? 8.844   22.899 51.337  1.00 27.35 ? 2086 HOH A O   1 
HETATM 5872 O  O   . HOH AA 8 .   ? 12.137  28.141 52.810  1.00 25.73 ? 2087 HOH A O   1 
HETATM 5873 O  O   . HOH AA 8 .   ? 18.448  31.249 52.979  1.00 30.68 ? 2088 HOH A O   1 
HETATM 5874 O  O   . HOH AA 8 .   ? 21.169  37.081 51.324  1.00 48.41 ? 2089 HOH A O   1 
HETATM 5875 O  O   . HOH AA 8 .   ? 14.854  32.862 45.166  1.00 29.30 ? 2090 HOH A O   1 
HETATM 5876 O  O   . HOH AA 8 .   ? 15.663  32.938 39.450  1.00 16.45 ? 2091 HOH A O   1 
HETATM 5877 O  O   . HOH AA 8 .   ? 18.509  35.077 37.944  1.00 17.02 ? 2092 HOH A O   1 
HETATM 5878 O  O   . HOH AA 8 .   ? 17.026  34.064 33.857  1.00 17.10 ? 2093 HOH A O   1 
HETATM 5879 O  O   . HOH AA 8 .   ? 16.694  34.698 31.162  1.00 20.67 ? 2094 HOH A O   1 
HETATM 5880 O  O   . HOH AA 8 .   ? 24.537  36.843 31.764  1.00 31.76 ? 2095 HOH A O   1 
HETATM 5881 O  O   . HOH AA 8 .   ? 14.350  33.064 28.384  1.00 25.91 ? 2096 HOH A O   1 
HETATM 5882 O  O   . HOH AA 8 .   ? 11.711  27.019 30.749  1.00 21.18 ? 2097 HOH A O   1 
HETATM 5883 O  O   . HOH AA 8 .   ? 15.707  33.049 21.039  1.00 15.50 ? 2098 HOH A O   1 
HETATM 5884 O  O   . HOH AA 8 .   ? 10.463  29.971 25.383  1.00 24.45 ? 2099 HOH A O   1 
HETATM 5885 O  O   . HOH AA 8 .   ? 12.172  27.609 20.641  1.00 16.43 ? 2100 HOH A O   1 
HETATM 5886 O  O   . HOH AA 8 .   ? 8.463   30.540 20.997  1.00 22.44 ? 2101 HOH A O   1 
HETATM 5887 O  O   . HOH AA 8 .   ? 9.798   28.336 21.856  1.00 28.96 ? 2102 HOH A O   1 
HETATM 5888 O  O   . HOH AA 8 .   ? 8.919   32.412 23.264  1.00 31.77 ? 2103 HOH A O   1 
HETATM 5889 O  O   . HOH AA 8 .   ? 18.661  24.848 20.757  1.00 12.64 ? 2104 HOH A O   1 
HETATM 5890 O  O   . HOH AA 8 .   ? 21.117  30.780 22.687  1.00 18.54 ? 2105 HOH A O   1 
HETATM 5891 O  O   . HOH AA 8 .   ? 22.785  25.131 28.122  1.00 12.08 ? 2106 HOH A O   1 
HETATM 5892 O  O   . HOH AA 8 .   ? 20.974  22.807 27.786  1.00 17.25 ? 2107 HOH A O   1 
HETATM 5893 O  O   . HOH AA 8 .   ? 24.859  33.228 26.963  1.00 25.59 ? 2108 HOH A O   1 
HETATM 5894 O  O   . HOH AA 8 .   ? 25.216  37.137 37.243  1.00 35.40 ? 2109 HOH A O   1 
HETATM 5895 O  O   . HOH AA 8 .   ? 28.771  35.136 35.781  1.00 20.88 ? 2110 HOH A O   1 
HETATM 5896 O  O   . HOH AA 8 .   ? 17.865  29.994 55.642  1.00 31.58 ? 2111 HOH A O   1 
HETATM 5897 O  O   . HOH AA 8 .   ? 15.299  23.561 57.391  1.00 26.92 ? 2112 HOH A O   1 
HETATM 5898 O  O   . HOH AA 8 .   ? 19.235  20.807 58.035  1.00 23.74 ? 2113 HOH A O   1 
HETATM 5899 O  O   . HOH AA 8 .   ? 22.239  25.802 58.469  1.00 26.96 ? 2114 HOH A O   1 
HETATM 5900 O  O   . HOH AA 8 .   ? 26.210  20.554 57.733  1.00 20.71 ? 2115 HOH A O   1 
HETATM 5901 O  O   . HOH AA 8 .   ? 27.515  18.168 57.891  1.00 22.84 ? 2116 HOH A O   1 
HETATM 5902 O  O   . HOH AA 8 .   ? 29.853  13.369 52.981  1.00 19.18 ? 2117 HOH A O   1 
HETATM 5903 O  O   . HOH AA 8 .   ? 31.294  11.514 52.429  1.00 27.68 ? 2118 HOH A O   1 
HETATM 5904 O  O   . HOH AA 8 .   ? 24.333  12.742 59.296  1.00 25.66 ? 2119 HOH A O   1 
HETATM 5905 O  O   . HOH AA 8 .   ? 28.369  8.121  57.361  1.00 38.21 ? 2120 HOH A O   1 
HETATM 5906 O  O   . HOH AA 8 .   ? 30.158  9.135  50.430  1.00 25.35 ? 2121 HOH A O   1 
HETATM 5907 O  O   . HOH AA 8 .   ? 28.769  5.824  57.204  1.00 43.18 ? 2122 HOH A O   1 
HETATM 5908 O  O   . HOH AA 8 .   ? 24.698  5.290  56.689  1.00 34.88 ? 2123 HOH A O   1 
HETATM 5909 O  O   . HOH AA 8 .   ? 31.907  14.862 49.054  1.00 15.58 ? 2124 HOH A O   1 
HETATM 5910 O  O   . HOH AA 8 .   ? 30.407  15.494 51.380  1.00 14.92 ? 2125 HOH A O   1 
HETATM 5911 O  O   . HOH AA 8 .   ? 30.210  12.412 46.443  1.00 19.36 ? 2126 HOH A O   1 
HETATM 5912 O  O   . HOH AA 8 .   ? 32.239  18.184 47.028  1.00 26.02 ? 2127 HOH A O   1 
HETATM 5913 O  O   . HOH AA 8 .   ? 31.028  19.518 50.792  1.00 22.62 ? 2128 HOH A O   1 
HETATM 5914 O  O   . HOH AA 8 .   ? 33.673  14.680 43.784  1.00 21.17 ? 2129 HOH A O   1 
HETATM 5915 O  O   . HOH AA 8 .   ? 33.616  21.818 44.112  1.00 18.69 ? 2130 HOH A O   1 
HETATM 5916 O  O   . HOH AA 8 .   ? 36.732  24.510 39.672  1.00 23.46 ? 2131 HOH A O   1 
HETATM 5917 O  O   . HOH AA 8 .   ? 37.446  18.563 35.878  1.00 18.81 ? 2132 HOH A O   1 
HETATM 5918 O  O   . HOH AA 8 .   ? 40.471  24.588 32.999  1.00 23.04 ? 2133 HOH A O   1 
HETATM 5919 O  O   . HOH AA 8 .   ? 39.989  17.673 35.532  1.00 26.89 ? 2134 HOH A O   1 
HETATM 5920 O  O   . HOH AA 8 .   ? 38.615  23.412 29.848  1.00 25.49 ? 2135 HOH A O   1 
HETATM 5921 O  O   . HOH AA 8 .   ? 32.571  19.070 29.649  1.00 22.45 ? 2136 HOH A O   1 
HETATM 5922 O  O   . HOH AA 8 .   ? 32.818  18.689 27.168  1.00 25.92 ? 2137 HOH A O   1 
HETATM 5923 O  O   . HOH AA 8 .   ? 36.796  16.469 23.031  1.00 30.70 ? 2138 HOH A O   1 
HETATM 5924 O  O   . HOH AA 8 .   ? 32.338  9.452  22.125  1.00 19.34 ? 2139 HOH A O   1 
HETATM 5925 O  O   . HOH AA 8 .   ? 36.520  8.087  30.721  1.00 26.96 ? 2140 HOH A O   1 
HETATM 5926 O  O   . HOH AA 8 .   ? 29.455  1.460  29.949  1.00 30.86 ? 2141 HOH A O   1 
HETATM 5927 O  O   . HOH AA 8 .   ? 31.337  2.245  32.725  1.00 23.47 ? 2142 HOH A O   1 
HETATM 5928 O  O   . HOH AA 8 .   ? 9.826   10.801 37.068  1.00 14.61 ? 2143 HOH A O   1 
HETATM 5929 O  O   . HOH AA 8 .   ? 7.701   5.543  30.576  1.00 26.70 ? 2144 HOH A O   1 
HETATM 5930 O  O   . HOH AA 8 .   ? 5.458   6.981  33.076  1.00 26.58 ? 2145 HOH A O   1 
HETATM 5931 O  O   . HOH AA 8 .   ? 8.024   8.879  35.796  1.00 19.97 ? 2146 HOH A O   1 
HETATM 5932 O  O   . HOH AA 8 .   ? 5.034   8.326  30.930  1.00 24.32 ? 2147 HOH A O   1 
HETATM 5933 O  O   . HOH AA 8 .   ? 8.817   9.740  28.676  1.00 32.12 ? 2148 HOH A O   1 
HETATM 5934 O  O   . HOH AA 8 .   ? 12.717  -0.531 34.916  1.00 39.20 ? 2149 HOH A O   1 
HETATM 5935 O  O   . HOH AA 8 .   ? 12.046  1.560  26.351  1.00 32.84 ? 2150 HOH A O   1 
HETATM 5936 O  O   . HOH AA 8 .   ? 10.709  8.975  23.597  1.00 28.90 ? 2151 HOH A O   1 
HETATM 5937 O  O   . HOH AA 8 .   ? 5.677   4.564  40.858  1.00 36.34 ? 2152 HOH A O   1 
HETATM 5938 O  O   . HOH AA 8 .   ? 13.084  2.647  39.658  1.00 28.65 ? 2153 HOH A O   1 
HETATM 5939 O  O   . HOH AA 8 .   ? 12.729  -1.586 42.034  1.00 35.38 ? 2154 HOH A O   1 
HETATM 5940 O  O   . HOH AA 8 .   ? 24.962  1.559  31.897  1.00 12.88 ? 2155 HOH A O   1 
HETATM 5941 O  O   . HOH AA 8 .   ? 33.900  5.526  34.765  1.00 33.53 ? 2156 HOH A O   1 
HETATM 5942 O  O   . HOH AA 8 .   ? 28.850  16.745 22.522  1.00 14.29 ? 2157 HOH A O   1 
HETATM 5943 O  O   . HOH AA 8 .   ? 32.006  10.741 19.750  1.00 24.94 ? 2158 HOH A O   1 
HETATM 5944 O  O   . HOH AA 8 .   ? 34.197  17.753 17.689  1.00 32.15 ? 2159 HOH A O   1 
HETATM 5945 O  O   . HOH AA 8 .   ? 34.401  17.224 20.726  1.00 30.29 ? 2160 HOH A O   1 
HETATM 5946 O  O   . HOH AA 8 .   ? 28.767  23.092 21.075  1.00 27.07 ? 2161 HOH A O   1 
HETATM 5947 O  O   . HOH AA 8 .   ? 28.627  18.006 12.532  1.00 24.72 ? 2162 HOH A O   1 
HETATM 5948 O  O   . HOH AA 8 .   ? 31.173  13.180 13.991  1.00 28.06 ? 2163 HOH A O   1 
HETATM 5949 O  O   . HOH AA 8 .   ? 25.585  11.591 15.352  1.00 23.24 ? 2164 HOH A O   1 
HETATM 5950 O  O   . HOH AA 8 .   ? 25.203  20.021 11.339  1.00 39.13 ? 2165 HOH A O   1 
HETATM 5951 O  O   . HOH AA 8 .   ? 28.994  25.046 19.626  1.00 29.76 ? 2166 HOH A O   1 
HETATM 5952 O  O   . HOH AA 8 .   ? 22.999  15.065 10.212  1.00 19.70 ? 2167 HOH A O   1 
HETATM 5953 O  O   . HOH AA 8 .   ? 19.605  12.433 14.162  1.00 29.37 ? 2168 HOH A O   1 
HETATM 5954 O  O   . HOH AA 8 .   ? 23.842  21.766 16.172  1.00 21.00 ? 2169 HOH A O   1 
HETATM 5955 O  O   . HOH AA 8 .   ? 17.521  19.846 13.483  1.00 22.20 ? 2170 HOH A O   1 
HETATM 5956 O  O   . HOH AA 8 .   ? 24.569  22.421 13.746  1.00 19.58 ? 2171 HOH A O   1 
HETATM 5957 O  O   . HOH AA 8 .   ? 19.930  27.374 14.266  1.00 12.88 ? 2172 HOH A O   1 
HETATM 5958 O  O   . HOH AA 8 .   ? 17.135  18.401 15.549  1.00 26.36 ? 2173 HOH A O   1 
HETATM 5959 O  O   . HOH AA 8 .   ? 15.255  18.462 18.535  1.00 27.18 ? 2174 HOH A O   1 
HETATM 5960 O  O   . HOH AA 8 .   ? 25.621  26.097 17.281  1.00 19.89 ? 2175 HOH A O   1 
HETATM 5961 O  O   . HOH AA 8 .   ? 32.159  24.716 25.290  1.00 31.30 ? 2176 HOH A O   1 
HETATM 5962 O  O   . HOH AA 8 .   ? 21.982  10.146 27.492  1.00 14.85 ? 2177 HOH A O   1 
HETATM 5963 O  O   . HOH AA 8 .   ? 28.186  6.005  22.305  1.00 20.89 ? 2178 HOH A O   1 
HETATM 5964 O  O   . HOH AA 8 .   ? 21.573  8.267  24.607  1.00 13.72 ? 2179 HOH A O   1 
HETATM 5965 O  O   . HOH AA 8 .   ? 19.805  5.598  23.330  1.00 19.26 ? 2180 HOH A O   1 
HETATM 5966 O  O   . HOH AA 8 .   ? 20.357  8.051  20.588  1.00 25.89 ? 2181 HOH A O   1 
HETATM 5967 O  O   . HOH AA 8 .   ? 26.654  5.106  20.338  1.00 22.90 ? 2182 HOH A O   1 
HETATM 5968 O  O   . HOH AA 8 .   ? 16.268  -0.131 26.598  1.00 24.36 ? 2183 HOH A O   1 
HETATM 5969 O  O   . HOH AA 8 .   ? 16.102  10.319 22.200  1.00 16.19 ? 2184 HOH A O   1 
HETATM 5970 O  O   . HOH AA 8 .   ? 19.167  8.471  23.250  1.00 15.88 ? 2185 HOH A O   1 
HETATM 5971 O  O   . HOH AA 8 .   ? 19.401  15.270 28.717  1.00 11.24 ? 2186 HOH A O   1 
HETATM 5972 O  O   . HOH AA 8 .   ? 8.919   12.395 25.532  1.00 25.93 ? 2187 HOH A O   1 
HETATM 5973 O  O   . HOH AA 8 .   ? 13.552  14.373 25.808  1.00 13.03 ? 2188 HOH A O   1 
HETATM 5974 O  O   . HOH AA 8 .   ? 35.650  15.149 34.440  1.00 21.00 ? 2189 HOH A O   1 
HETATM 5975 O  O   . HOH AA 8 .   ? 31.036  20.360 31.712  1.00 12.68 ? 2190 HOH A O   1 
HETATM 5976 O  O   . HOH AA 8 .   ? 14.914  8.122  15.805  1.00 30.27 ? 2191 HOH A O   1 
HETATM 5977 O  O   . HOH AA 8 .   ? 25.153  6.721  13.225  1.00 36.71 ? 2192 HOH A O   1 
HETATM 5978 O  O   . HOH AA 8 .   ? 23.459  4.237  14.734  1.00 34.98 ? 2193 HOH A O   1 
HETATM 5979 O  O   . HOH AA 8 .   ? 15.270  16.534 16.867  1.00 30.71 ? 2194 HOH A O   1 
HETATM 5980 O  O   . HOH AA 8 .   ? 31.576  19.025 24.696  1.00 28.74 ? 2195 HOH A O   1 
HETATM 5981 O  O   . HOH AA 8 .   ? 35.059  22.035 25.537  1.00 30.19 ? 2196 HOH A O   1 
HETATM 5982 O  O   . HOH AA 8 .   ? 34.077  27.856 34.510  1.00 24.86 ? 2197 HOH A O   1 
HETATM 5983 O  O   . HOH AA 8 .   ? 32.235  30.055 30.325  1.00 30.08 ? 2198 HOH A O   1 
HETATM 5984 O  O   . HOH AA 8 .   ? 30.680  30.936 34.700  1.00 15.34 ? 2199 HOH A O   1 
HETATM 5985 O  O   . HOH AA 8 .   ? 33.627  25.566 26.631  1.00 37.34 ? 2200 HOH A O   1 
HETATM 5986 O  O   . HOH AA 8 .   ? 33.365  33.592 40.492  1.00 14.82 ? 2201 HOH A O   1 
HETATM 5987 O  O   . HOH AA 8 .   ? 35.061  30.757 34.168  1.00 23.68 ? 2202 HOH A O   1 
HETATM 5988 O  O   . HOH AA 8 .   ? 23.326  35.568 38.708  1.00 13.28 ? 2203 HOH A O   1 
HETATM 5989 O  O   . HOH AA 8 .   ? 31.647  30.563 46.405  1.00 21.37 ? 2204 HOH A O   1 
HETATM 5990 O  O   . HOH AA 8 .   ? 36.454  24.336 42.213  1.00 34.21 ? 2205 HOH A O   1 
HETATM 5991 O  O   . HOH AA 8 .   ? 24.585  35.146 40.953  1.00 18.37 ? 2206 HOH A O   1 
HETATM 5992 O  O   . HOH AA 8 .   ? 27.921  36.180 38.545  1.00 28.07 ? 2207 HOH A O   1 
HETATM 5993 O  O   . HOH AA 8 .   ? 26.482  35.995 50.871  1.00 31.98 ? 2208 HOH A O   1 
HETATM 5994 O  O   . HOH AA 8 .   ? 22.876  36.060 42.940  1.00 24.75 ? 2209 HOH A O   1 
HETATM 5995 O  O   . HOH AA 8 .   ? 11.067  30.849 44.047  1.00 25.31 ? 2210 HOH A O   1 
HETATM 5996 O  O   . HOH AA 8 .   ? 31.850  10.173 41.656  1.00 26.66 ? 2211 HOH A O   1 
HETATM 5997 O  O   . HOH BA 8 .   ? 5.126   56.772 36.709  1.00 15.68 ? 2001 HOH B O   1 
HETATM 5998 O  O   . HOH BA 8 .   ? 9.751   57.504 39.484  1.00 22.62 ? 2002 HOH B O   1 
HETATM 5999 O  O   . HOH BA 8 .   ? 9.987   59.907 42.205  1.00 21.87 ? 2003 HOH B O   1 
HETATM 6000 O  O   . HOH BA 8 .   ? 14.463  52.993 41.187  1.00 24.03 ? 2004 HOH B O   1 
HETATM 6001 O  O   . HOH BA 8 .   ? 13.569  58.279 41.318  1.00 30.03 ? 2005 HOH B O   1 
HETATM 6002 O  O   . HOH BA 8 .   ? 15.590  57.867 35.475  1.00 22.45 ? 2006 HOH B O   1 
HETATM 6003 O  O   . HOH BA 8 .   ? 10.625  55.301 29.315  1.00 13.01 ? 2007 HOH B O   1 
HETATM 6004 O  O   . HOH BA 8 .   ? 14.517  52.310 23.628  1.00 23.97 ? 2008 HOH B O   1 
HETATM 6005 O  O   . HOH BA 8 .   ? 11.865  57.164 27.684  1.00 18.50 ? 2009 HOH B O   1 
HETATM 6006 O  O   . HOH BA 8 .   ? 7.804   52.854 26.464  1.00 14.63 ? 2010 HOH B O   1 
HETATM 6007 O  O   . HOH BA 8 .   ? 7.625   50.136 26.982  1.00 14.97 ? 2011 HOH B O   1 
HETATM 6008 O  O   . HOH BA 8 .   ? 11.044  46.403 23.135  1.00 34.42 ? 2012 HOH B O   1 
HETATM 6009 O  O   . HOH BA 8 .   ? 8.265   54.819 20.559  1.00 17.51 ? 2013 HOH B O   1 
HETATM 6010 O  O   . HOH BA 8 .   ? 6.224   49.524 24.024  1.00 14.00 ? 2014 HOH B O   1 
HETATM 6011 O  O   . HOH BA 8 .   ? 10.716  60.110 39.033  1.00 30.03 ? 2015 HOH B O   1 
HETATM 6012 O  O   . HOH BA 8 .   ? 4.868   50.469 26.269  1.00 15.08 ? 2016 HOH B O   1 
HETATM 6013 O  O   . HOH BA 8 .   ? 2.593   48.076 24.280  1.00 10.90 ? 2017 HOH B O   1 
HETATM 6014 O  O   . HOH BA 8 .   ? 9.909   43.109 31.700  1.00 19.41 ? 2018 HOH B O   1 
HETATM 6015 O  O   . HOH BA 8 .   ? 6.567   45.726 34.134  1.00 10.21 ? 2019 HOH B O   1 
HETATM 6016 O  O   . HOH BA 8 .   ? 1.603   51.322 25.409  1.00 9.70  ? 2020 HOH B O   1 
HETATM 6017 O  O   . HOH BA 8 .   ? 0.763   50.946 35.041  1.00 10.65 ? 2021 HOH B O   1 
HETATM 6018 O  O   . HOH BA 8 .   ? -3.169  57.245 26.848  1.00 13.92 ? 2022 HOH B O   1 
HETATM 6019 O  O   . HOH BA 8 .   ? -2.069  59.462 35.589  1.00 26.48 ? 2023 HOH B O   1 
HETATM 6020 O  O   . HOH BA 8 .   ? -9.624  59.167 31.260  1.00 31.19 ? 2024 HOH B O   1 
HETATM 6021 O  O   . HOH BA 8 .   ? -4.725  59.195 35.478  1.00 19.31 ? 2025 HOH B O   1 
HETATM 6022 O  O   . HOH BA 8 .   ? 0.130   53.542 34.122  1.00 10.80 ? 2026 HOH B O   1 
HETATM 6023 O  O   . HOH BA 8 .   ? -15.610 50.275 38.108  1.00 29.10 ? 2027 HOH B O   1 
HETATM 6024 O  O   . HOH BA 8 .   ? -6.756  57.482 36.727  1.00 13.12 ? 2028 HOH B O   1 
HETATM 6025 O  O   . HOH BA 8 .   ? -1.675  44.145 34.216  1.00 11.42 ? 2029 HOH B O   1 
HETATM 6026 O  O   . HOH BA 8 .   ? 0.471   35.572 27.656  1.00 17.21 ? 2030 HOH B O   1 
HETATM 6027 O  O   . HOH BA 8 .   ? -7.148  35.189 21.617  1.00 27.28 ? 2031 HOH B O   1 
HETATM 6028 O  O   . HOH BA 8 .   ? 12.383  54.558 19.424  1.00 40.71 ? 2032 HOH B O   1 
HETATM 6029 O  O   . HOH BA 8 .   ? -0.719  36.208 20.115  1.00 25.99 ? 2033 HOH B O   1 
HETATM 6030 O  O   . HOH BA 8 .   ? -4.763  36.159 19.662  1.00 32.86 ? 2034 HOH B O   1 
HETATM 6031 O  O   . HOH BA 8 .   ? -3.127  37.904 15.763  1.00 24.45 ? 2035 HOH B O   1 
HETATM 6032 O  O   . HOH BA 8 .   ? -10.792 35.262 22.125  1.00 26.38 ? 2036 HOH B O   1 
HETATM 6033 O  O   . HOH BA 8 .   ? -18.982 40.385 32.238  1.00 33.62 ? 2037 HOH B O   1 
HETATM 6034 O  O   . HOH BA 8 .   ? -18.613 45.252 34.692  1.00 30.34 ? 2038 HOH B O   1 
HETATM 6035 O  O   . HOH BA 8 .   ? -20.120 39.772 36.631  1.00 28.98 ? 2039 HOH B O   1 
HETATM 6036 O  O   . HOH BA 8 .   ? -15.481 47.651 38.241  1.00 20.01 ? 2040 HOH B O   1 
HETATM 6037 O  O   . HOH BA 8 .   ? -13.947 51.774 37.384  1.00 17.96 ? 2041 HOH B O   1 
HETATM 6038 O  O   . HOH BA 8 .   ? -13.497 51.739 40.324  1.00 29.56 ? 2042 HOH B O   1 
HETATM 6039 O  O   . HOH BA 8 .   ? -20.546 50.825 32.043  1.00 35.94 ? 2043 HOH B O   1 
HETATM 6040 O  O   . HOH BA 8 .   ? -16.602 53.082 35.149  1.00 27.71 ? 2044 HOH B O   1 
HETATM 6041 O  O   . HOH BA 8 .   ? -16.281 59.384 30.565  1.00 34.60 ? 2045 HOH B O   1 
HETATM 6042 O  O   . HOH BA 8 .   ? -17.308 55.553 30.416  1.00 30.05 ? 2046 HOH B O   1 
HETATM 6043 O  O   . HOH BA 8 .   ? -15.591 57.191 34.327  1.00 26.98 ? 2047 HOH B O   1 
HETATM 6044 O  O   . HOH BA 8 .   ? -18.231 53.211 32.512  1.00 32.16 ? 2048 HOH B O   1 
HETATM 6045 O  O   . HOH BA 8 .   ? -19.118 54.814 26.825  1.00 29.77 ? 2049 HOH B O   1 
HETATM 6046 O  O   . HOH BA 8 .   ? -14.137 50.815 23.231  1.00 30.42 ? 2050 HOH B O   1 
HETATM 6047 O  O   . HOH BA 8 .   ? -10.027 53.416 18.344  1.00 28.22 ? 2051 HOH B O   1 
HETATM 6048 O  O   . HOH BA 8 .   ? -8.795  57.525 18.056  1.00 23.71 ? 2052 HOH B O   1 
HETATM 6049 O  O   . HOH BA 8 .   ? -1.376  58.416 24.678  1.00 12.10 ? 2053 HOH B O   1 
HETATM 6050 O  O   . HOH BA 8 .   ? 7.615   31.833 37.407  1.00 22.84 ? 2054 HOH B O   1 
HETATM 6051 O  O   . HOH BA 8 .   ? 9.168   30.691 35.756  1.00 32.05 ? 2055 HOH B O   1 
HETATM 6052 O  O   . HOH BA 8 .   ? 12.324  42.712 50.960  1.00 26.10 ? 2056 HOH B O   1 
HETATM 6053 O  O   . HOH BA 8 .   ? 14.464  41.502 49.414  1.00 31.57 ? 2057 HOH B O   1 
HETATM 6054 O  O   . HOH BA 8 .   ? 5.674   55.150 20.333  1.00 15.25 ? 2058 HOH B O   1 
HETATM 6055 O  O   . HOH BA 8 .   ? 0.581   58.926 21.970  1.00 13.72 ? 2059 HOH B O   1 
HETATM 6056 O  O   . HOH BA 8 .   ? 5.396   56.978 22.249  1.00 15.06 ? 2060 HOH B O   1 
HETATM 6057 O  O   . HOH BA 8 .   ? 10.323  58.840 24.307  1.00 22.27 ? 2061 HOH B O   1 
HETATM 6058 O  O   . HOH BA 8 .   ? -0.868  65.535 22.756  1.00 18.62 ? 2062 HOH B O   1 
HETATM 6059 O  O   . HOH BA 8 .   ? 2.739   64.509 18.663  1.00 20.94 ? 2063 HOH B O   1 
HETATM 6060 O  O   . HOH BA 8 .   ? 5.696   60.664 14.675  1.00 28.65 ? 2064 HOH B O   1 
HETATM 6061 O  O   . HOH BA 8 .   ? 10.315  56.514 20.911  1.00 27.72 ? 2065 HOH B O   1 
HETATM 6062 O  O   . HOH BA 8 .   ? 16.959  49.525 39.327  1.00 30.37 ? 2066 HOH B O   1 
HETATM 6063 O  O   . HOH BA 8 .   ? 3.005   52.285 14.927  1.00 18.98 ? 2067 HOH B O   1 
HETATM 6064 O  O   . HOH BA 8 .   ? 3.405   49.342 16.729  1.00 15.39 ? 2068 HOH B O   1 
HETATM 6065 O  O   . HOH BA 8 .   ? 11.527  54.171 16.787  1.00 33.95 ? 2069 HOH B O   1 
HETATM 6066 O  O   . HOH BA 8 .   ? 10.849  38.049 54.561  1.00 29.23 ? 2070 HOH B O   1 
HETATM 6067 O  O   . HOH BA 8 .   ? -3.208  47.764 15.034  1.00 22.31 ? 2071 HOH B O   1 
HETATM 6068 O  O   . HOH BA 8 .   ? -9.270  52.457 16.497  1.00 38.57 ? 2072 HOH B O   1 
HETATM 6069 O  O   . HOH BA 8 .   ? -10.210 50.319 17.084  1.00 18.12 ? 2073 HOH B O   1 
HETATM 6070 O  O   . HOH BA 8 .   ? -12.639 54.134 21.704  1.00 35.67 ? 2074 HOH B O   1 
HETATM 6071 O  O   . HOH BA 8 .   ? 14.528  45.996 50.357  1.00 23.83 ? 2075 HOH B O   1 
HETATM 6072 O  O   . HOH BA 8 .   ? -14.766 41.721 19.884  1.00 30.30 ? 2076 HOH B O   1 
HETATM 6073 O  O   . HOH BA 8 .   ? -16.245 39.995 20.198  1.00 34.02 ? 2077 HOH B O   1 
HETATM 6074 O  O   . HOH BA 8 .   ? -18.194 44.356 27.793  1.00 28.02 ? 2078 HOH B O   1 
HETATM 6075 O  O   . HOH BA 8 .   ? -17.752 43.167 33.071  1.00 29.57 ? 2079 HOH B O   1 
HETATM 6076 O  O   . HOH BA 8 .   ? -17.803 39.116 34.482  1.00 24.90 ? 2080 HOH B O   1 
HETATM 6077 O  O   . HOH BA 8 .   ? -18.063 41.586 38.618  1.00 27.08 ? 2081 HOH B O   1 
HETATM 6078 O  O   . HOH BA 8 .   ? -11.021 32.969 39.337  1.00 14.62 ? 2082 HOH B O   1 
HETATM 6079 O  O   . HOH BA 8 .   ? -20.600 38.670 38.766  1.00 22.97 ? 2083 HOH B O   1 
HETATM 6080 O  O   . HOH BA 8 .   ? -18.861 40.607 41.644  1.00 30.19 ? 2084 HOH B O   1 
HETATM 6081 O  O   . HOH BA 8 .   ? -18.613 44.437 44.810  1.00 30.69 ? 2085 HOH B O   1 
HETATM 6082 O  O   . HOH BA 8 .   ? -14.333 49.619 41.714  1.00 21.51 ? 2086 HOH B O   1 
HETATM 6083 O  O   . HOH BA 8 .   ? -17.927 49.668 46.764  1.00 28.73 ? 2087 HOH B O   1 
HETATM 6084 O  O   . HOH BA 8 .   ? -20.832 43.981 50.460  1.00 30.55 ? 2088 HOH B O   1 
HETATM 6085 O  O   . HOH BA 8 .   ? -9.423  44.505 51.829  1.00 16.57 ? 2089 HOH B O   1 
HETATM 6086 O  O   . HOH BA 8 .   ? -13.416 39.726 49.772  1.00 14.11 ? 2090 HOH B O   1 
HETATM 6087 O  O   . HOH BA 8 .   ? -7.185  40.642 44.480  1.00 15.73 ? 2091 HOH B O   1 
HETATM 6088 O  O   . HOH BA 8 .   ? -6.527  43.826 45.149  1.00 18.38 ? 2092 HOH B O   1 
HETATM 6089 O  O   . HOH BA 8 .   ? -13.266 35.050 45.715  1.00 21.05 ? 2093 HOH B O   1 
HETATM 6090 O  O   . HOH BA 8 .   ? -14.778 38.390 47.618  1.00 25.21 ? 2094 HOH B O   1 
HETATM 6091 O  O   . HOH BA 8 .   ? -11.111 34.716 48.035  1.00 25.76 ? 2095 HOH B O   1 
HETATM 6092 O  O   . HOH BA 8 .   ? -5.248  46.202 14.757  1.00 21.68 ? 2096 HOH B O   1 
HETATM 6093 O  O   . HOH BA 8 .   ? -8.258  41.540 13.858  1.00 25.65 ? 2097 HOH B O   1 
HETATM 6094 O  O   . HOH BA 8 .   ? -1.863  40.125 15.105  1.00 29.97 ? 2098 HOH B O   1 
HETATM 6095 O  O   . HOH BA 8 .   ? 2.091   42.299 10.453  1.00 34.69 ? 2099 HOH B O   1 
HETATM 6096 O  O   . HOH BA 8 .   ? 3.867   45.582 13.328  1.00 24.40 ? 2100 HOH B O   1 
HETATM 6097 O  O   . HOH BA 8 .   ? 2.354   40.827 14.171  1.00 26.84 ? 2101 HOH B O   1 
HETATM 6098 O  O   . HOH BA 8 .   ? 0.867   39.264 15.251  1.00 27.37 ? 2102 HOH B O   1 
HETATM 6099 O  O   . HOH BA 8 .   ? 6.278   41.841 13.930  1.00 20.49 ? 2103 HOH B O   1 
HETATM 6100 O  O   . HOH BA 8 .   ? 5.614   40.851 19.953  1.00 23.47 ? 2104 HOH B O   1 
HETATM 6101 O  O   . HOH BA 8 .   ? 7.849   47.836 15.224  1.00 41.80 ? 2105 HOH B O   1 
HETATM 6102 O  O   . HOH BA 8 .   ? 8.558   42.205 15.401  1.00 21.96 ? 2106 HOH B O   1 
HETATM 6103 O  O   . HOH BA 8 .   ? 9.497   44.520 14.811  1.00 32.16 ? 2107 HOH B O   1 
HETATM 6104 O  O   . HOH BA 8 .   ? 12.737  47.770 20.224  1.00 39.02 ? 2108 HOH B O   1 
HETATM 6105 O  O   . HOH BA 8 .   ? 4.601   38.865 21.424  1.00 17.19 ? 2109 HOH B O   1 
HETATM 6106 O  O   . HOH BA 8 .   ? 6.177   38.079 23.641  1.00 19.13 ? 2110 HOH B O   1 
HETATM 6107 O  O   . HOH BA 8 .   ? 3.851   35.798 25.908  1.00 27.77 ? 2111 HOH B O   1 
HETATM 6108 O  O   . HOH BA 8 .   ? 7.201   40.821 26.344  1.00 22.86 ? 2112 HOH B O   1 
HETATM 6109 O  O   . HOH BA 8 .   ? 3.741   36.606 20.951  1.00 31.16 ? 2113 HOH B O   1 
HETATM 6110 O  O   . HOH BA 8 .   ? 1.277   36.363 21.744  1.00 25.53 ? 2114 HOH B O   1 
HETATM 6111 O  O   . HOH BA 8 .   ? 7.043   36.666 28.652  1.00 21.10 ? 2115 HOH B O   1 
HETATM 6112 O  O   . HOH BA 8 .   ? 0.945   32.868 28.514  1.00 28.92 ? 2116 HOH B O   1 
HETATM 6113 O  O   . HOH BA 8 .   ? 4.304   30.648 31.304  1.00 22.11 ? 2117 HOH B O   1 
HETATM 6114 O  O   . HOH BA 8 .   ? -0.359  29.773 38.079  1.00 26.24 ? 2118 HOH B O   1 
HETATM 6115 O  O   . HOH BA 8 .   ? 5.758   30.569 36.194  1.00 17.84 ? 2119 HOH B O   1 
HETATM 6116 O  O   . HOH BA 8 .   ? 2.146   25.158 39.240  1.00 18.32 ? 2120 HOH B O   1 
HETATM 6117 O  O   . HOH BA 8 .   ? 5.563   25.276 36.686  1.00 9.97  ? 2121 HOH B O   1 
HETATM 6118 O  O   . HOH BA 8 .   ? 7.542   30.881 40.243  1.00 26.82 ? 2122 HOH B O   1 
HETATM 6119 O  O   . HOH BA 8 .   ? 2.202   28.006 42.434  1.00 20.71 ? 2123 HOH B O   1 
HETATM 6120 O  O   . HOH BA 8 .   ? 3.751   25.985 41.718  1.00 24.07 ? 2124 HOH B O   1 
HETATM 6121 O  O   . HOH BA 8 .   ? -2.426  29.349 42.192  1.00 25.42 ? 2125 HOH B O   1 
HETATM 6122 O  O   . HOH BA 8 .   ? 2.839   35.103 42.756  1.00 17.83 ? 2126 HOH B O   1 
HETATM 6123 O  O   . HOH BA 8 .   ? 4.350   31.249 46.599  1.00 28.46 ? 2127 HOH B O   1 
HETATM 6124 O  O   . HOH BA 8 .   ? 3.157   35.133 45.720  1.00 21.10 ? 2128 HOH B O   1 
HETATM 6125 O  O   . HOH BA 8 .   ? 7.072   32.561 49.140  1.00 29.69 ? 2129 HOH B O   1 
HETATM 6126 O  O   . HOH BA 8 .   ? 10.949  40.116 50.570  1.00 15.74 ? 2130 HOH B O   1 
HETATM 6127 O  O   . HOH BA 8 .   ? 14.572  37.793 42.171  1.00 33.31 ? 2131 HOH B O   1 
HETATM 6128 O  O   . HOH BA 8 .   ? 12.241  40.304 37.103  1.00 29.77 ? 2132 HOH B O   1 
HETATM 6129 O  O   . HOH BA 8 .   ? -1.088  60.524 44.563  1.00 29.09 ? 2133 HOH B O   1 
HETATM 6130 O  O   . HOH BA 8 .   ? -1.012  61.476 42.187  1.00 34.08 ? 2134 HOH B O   1 
HETATM 6131 O  O   . HOH BA 8 .   ? 0.887   59.189 49.418  1.00 31.49 ? 2135 HOH B O   1 
HETATM 6132 O  O   . HOH BA 8 .   ? 6.325   65.478 32.789  1.00 38.37 ? 2136 HOH B O   1 
HETATM 6133 O  O   . HOH BA 8 .   ? 14.276  50.453 40.804  1.00 15.85 ? 2137 HOH B O   1 
HETATM 6134 O  O   . HOH BA 8 .   ? 14.877  49.573 43.194  1.00 27.81 ? 2138 HOH B O   1 
HETATM 6135 O  O   . HOH BA 8 .   ? 4.654   36.091 49.320  1.00 30.98 ? 2139 HOH B O   1 
HETATM 6136 O  O   . HOH BA 8 .   ? 2.933   39.603 50.211  1.00 14.75 ? 2140 HOH B O   1 
HETATM 6137 O  O   . HOH BA 8 .   ? 9.637   40.093 53.070  1.00 24.39 ? 2141 HOH B O   1 
HETATM 6138 O  O   . HOH BA 8 .   ? 9.048   38.663 57.174  1.00 33.41 ? 2142 HOH B O   1 
HETATM 6139 O  O   . HOH BA 8 .   ? 4.765   34.914 55.490  1.00 25.16 ? 2143 HOH B O   1 
HETATM 6140 O  O   . HOH BA 8 .   ? 5.114   34.517 52.054  1.00 20.97 ? 2144 HOH B O   1 
HETATM 6141 O  O   . HOH BA 8 .   ? 1.950   35.835 47.809  1.00 28.13 ? 2145 HOH B O   1 
HETATM 6142 O  O   . HOH BA 8 .   ? 1.547   39.014 60.232  1.00 25.98 ? 2146 HOH B O   1 
HETATM 6143 O  O   . HOH BA 8 .   ? 6.581   39.152 59.270  1.00 37.22 ? 2147 HOH B O   1 
HETATM 6144 O  O   . HOH BA 8 .   ? 5.018   44.923 57.842  1.00 25.62 ? 2148 HOH B O   1 
HETATM 6145 O  O   . HOH BA 8 .   ? 7.162   43.586 58.635  1.00 28.66 ? 2149 HOH B O   1 
HETATM 6146 O  O   . HOH BA 8 .   ? -1.926  41.896 61.383  1.00 35.36 ? 2150 HOH B O   1 
HETATM 6147 O  O   . HOH BA 8 .   ? -4.511  41.345 56.413  1.00 16.28 ? 2151 HOH B O   1 
HETATM 6148 O  O   . HOH BA 8 .   ? -5.738  48.000 59.083  1.00 23.54 ? 2152 HOH B O   1 
HETATM 6149 O  O   . HOH BA 8 .   ? -4.425  49.292 57.236  1.00 26.65 ? 2153 HOH B O   1 
HETATM 6150 O  O   . HOH BA 8 .   ? 5.275   48.742 45.464  1.00 13.90 ? 2154 HOH B O   1 
HETATM 6151 O  O   . HOH BA 8 .   ? 11.898  45.559 50.452  1.00 18.90 ? 2155 HOH B O   1 
HETATM 6152 O  O   . HOH BA 8 .   ? 6.782   50.063 48.504  1.00 16.68 ? 2156 HOH B O   1 
HETATM 6153 O  O   . HOH BA 8 .   ? 8.583   52.373 49.497  1.00 26.46 ? 2157 HOH B O   1 
HETATM 6154 O  O   . HOH BA 8 .   ? 6.228   50.738 52.373  1.00 23.64 ? 2158 HOH B O   1 
HETATM 6155 O  O   . HOH BA 8 .   ? 11.152  46.172 52.894  1.00 19.73 ? 2159 HOH B O   1 
HETATM 6156 O  O   . HOH BA 8 .   ? 17.053  50.492 53.341  1.00 35.29 ? 2160 HOH B O   1 
HETATM 6157 O  O   . HOH BA 8 .   ? 11.741  58.500 46.520  1.00 32.62 ? 2161 HOH B O   1 
HETATM 6158 O  O   . HOH BA 8 .   ? 16.179  50.007 48.008  1.00 33.14 ? 2162 HOH B O   1 
HETATM 6159 O  O   . HOH BA 8 .   ? 5.254   52.148 49.729  1.00 20.17 ? 2163 HOH B O   1 
HETATM 6160 O  O   . HOH BA 8 .   ? 2.375   53.867 50.691  1.00 18.64 ? 2164 HOH B O   1 
HETATM 6161 O  O   . HOH BA 8 .   ? -0.332  48.578 44.108  1.00 11.94 ? 2165 HOH B O   1 
HETATM 6162 O  O   . HOH BA 8 .   ? -2.603  54.107 47.057  1.00 18.83 ? 2166 HOH B O   1 
HETATM 6163 O  O   . HOH BA 8 .   ? 7.656   34.336 38.154  1.00 18.81 ? 2167 HOH B O   1 
HETATM 6164 O  O   . HOH BA 8 .   ? 11.675  39.874 34.801  1.00 25.35 ? 2168 HOH B O   1 
HETATM 6165 O  O   . HOH BA 8 .   ? 10.737  32.276 34.155  1.00 26.58 ? 2169 HOH B O   1 
HETATM 6166 O  O   . HOH BA 8 .   ? 13.816  33.197 37.647  1.00 31.96 ? 2170 HOH B O   1 
HETATM 6167 O  O   . HOH BA 8 .   ? 8.274   29.258 29.601  1.00 34.77 ? 2171 HOH B O   1 
HETATM 6168 O  O   . HOH BA 8 .   ? 0.908   35.831 40.840  1.00 9.78  ? 2172 HOH B O   1 
HETATM 6169 O  O   . HOH BA 8 .   ? 6.502   57.681 55.060  1.00 29.10 ? 2173 HOH B O   1 
HETATM 6170 O  O   . HOH BA 8 .   ? -2.475  51.227 59.753  1.00 28.73 ? 2174 HOH B O   1 
HETATM 6171 O  O   . HOH BA 8 .   ? 1.714   31.190 46.506  1.00 28.04 ? 2175 HOH B O   1 
HETATM 6172 O  O   . HOH BA 8 .   ? -5.334  29.490 38.097  1.00 19.34 ? 2176 HOH B O   1 
HETATM 6173 O  O   . HOH BA 8 .   ? -8.380  30.877 37.863  1.00 14.60 ? 2177 HOH B O   1 
HETATM 6174 O  O   . HOH BA 8 .   ? -7.035  30.237 42.403  1.00 34.93 ? 2178 HOH B O   1 
HETATM 6175 O  O   . HOH BA 8 .   ? -9.208  27.180 32.122  1.00 18.12 ? 2179 HOH B O   1 
HETATM 6176 O  O   . HOH BA 8 .   ? -8.999  25.239 36.949  1.00 22.12 ? 2180 HOH B O   1 
HETATM 6177 O  O   . HOH BA 8 .   ? -5.881  25.928 33.984  1.00 24.94 ? 2181 HOH B O   1 
HETATM 6178 O  O   . HOH BA 8 .   ? -15.333 33.664 32.311  1.00 28.94 ? 2182 HOH B O   1 
HETATM 6179 O  O   . HOH BA 8 .   ? -16.319 35.081 34.141  1.00 20.03 ? 2183 HOH B O   1 
HETATM 6180 O  O   . HOH BA 8 .   ? -7.980  29.993 26.160  1.00 19.24 ? 2184 HOH B O   1 
HETATM 6181 O  O   . HOH BA 8 .   ? -4.293  26.300 32.054  1.00 26.32 ? 2185 HOH B O   1 
HETATM 6182 O  O   . HOH BA 8 .   ? 13.412  42.699 53.507  1.00 28.21 ? 2186 HOH B O   1 
HETATM 6183 O  O   . HOH BA 8 .   ? 11.290  44.420 54.487  1.00 36.13 ? 2187 HOH B O   1 
HETATM 6184 O  O   . HOH BA 8 .   ? -13.779 32.166 40.605  1.00 25.70 ? 2188 HOH B O   1 
HETATM 6185 O  O   . HOH CA 8 .   ? 20.647  31.847 -0.791  1.00 15.21 ? 2001 HOH C O   1 
HETATM 6186 O  O   . HOH CA 8 .   ? 23.510  35.377 -3.599  1.00 21.67 ? 2002 HOH C O   1 
HETATM 6187 O  O   . HOH CA 8 .   ? 25.696  34.341 -6.530  1.00 23.17 ? 2003 HOH C O   1 
HETATM 6188 O  O   . HOH CA 8 .   ? 22.322  41.902 -5.396  1.00 32.41 ? 2004 HOH C O   1 
HETATM 6189 O  O   . HOH CA 8 .   ? 26.586  38.397 -5.693  1.00 28.96 ? 2005 HOH C O   1 
HETATM 6190 O  O   . HOH CA 8 .   ? 19.087  44.820 2.543   1.00 33.82 ? 2006 HOH C O   1 
HETATM 6191 O  O   . HOH CA 8 .   ? 27.290  39.727 0.081   1.00 24.57 ? 2007 HOH C O   1 
HETATM 6192 O  O   . HOH CA 8 .   ? 22.630  37.169 6.467   1.00 15.51 ? 2008 HOH C O   1 
HETATM 6193 O  O   . HOH CA 8 .   ? 19.566  43.620 4.609   1.00 29.70 ? 2009 HOH C O   1 
HETATM 6194 O  O   . HOH CA 8 .   ? 25.372  39.913 9.980   1.00 36.92 ? 2010 HOH C O   1 
HETATM 6195 O  O   . HOH CA 8 .   ? 22.179  42.596 12.031  1.00 20.60 ? 2011 HOH C O   1 
HETATM 6196 O  O   . HOH CA 8 .   ? 16.723  37.913 8.633   1.00 16.34 ? 2012 HOH C O   1 
HETATM 6197 O  O   . HOH CA 8 .   ? 19.070  36.436 9.130   1.00 16.23 ? 2013 HOH C O   1 
HETATM 6198 O  O   . HOH CA 8 .   ? 20.752  36.083 15.149  1.00 16.57 ? 2014 HOH C O   1 
HETATM 6199 O  O   . HOH CA 8 .   ? 15.483  37.019 11.838  1.00 17.57 ? 2015 HOH C O   1 
HETATM 6200 O  O   . HOH CA 8 .   ? 13.637  43.837 6.269   1.00 27.15 ? 2016 HOH C O   1 
HETATM 6201 O  O   . HOH CA 8 .   ? 16.828  45.167 3.260   1.00 36.48 ? 2017 HOH C O   1 
HETATM 6202 O  O   . HOH CA 8 .   ? 22.032  45.958 2.809   1.00 31.07 ? 2018 HOH C O   1 
HETATM 6203 O  O   . HOH CA 8 .   ? 15.407  35.260 9.481   1.00 16.70 ? 2019 HOH C O   1 
HETATM 6204 O  O   . HOH CA 8 .   ? 12.041  34.935 11.536  1.00 18.56 ? 2020 HOH C O   1 
HETATM 6205 O  O   . HOH CA 8 .   ? 12.127  39.133 1.720   1.00 16.69 ? 2021 HOH C O   1 
HETATM 6206 O  O   . HOH CA 8 .   ? 14.153  32.295 10.470  1.00 11.33 ? 2022 HOH C O   1 
HETATM 6207 O  O   . HOH CA 8 .   ? 13.458  31.419 0.972   1.00 12.40 ? 2023 HOH C O   1 
HETATM 6208 O  O   . HOH CA 8 .   ? 16.369  24.920 9.349   1.00 12.17 ? 2024 HOH C O   1 
HETATM 6209 O  O   . HOH CA 8 .   ? 13.285  19.204 13.417  1.00 30.27 ? 2025 HOH C O   1 
HETATM 6210 O  O   . HOH CA 8 .   ? 14.950  18.485 5.201   1.00 23.65 ? 2026 HOH C O   1 
HETATM 6211 O  O   . HOH CA 8 .   ? 13.615  17.164 3.804   1.00 30.46 ? 2027 HOH C O   1 
HETATM 6212 O  O   . HOH CA 8 .   ? 17.680  22.828 0.764   1.00 16.91 ? 2028 HOH C O   1 
HETATM 6213 O  O   . HOH CA 8 .   ? 15.133  29.564 1.968   1.00 8.88  ? 2029 HOH C O   1 
HETATM 6214 O  O   . HOH CA 8 .   ? 14.919  21.784 -0.394  1.00 12.87 ? 2030 HOH C O   1 
HETATM 6215 O  O   . HOH CA 8 .   ? 1.836   18.345 9.933   1.00 27.88 ? 2031 HOH C O   1 
HETATM 6216 O  O   . HOH CA 8 .   ? 6.448   33.196 1.853   1.00 15.16 ? 2032 HOH C O   1 
HETATM 6217 O  O   . HOH CA 8 .   ? 0.565   39.878 7.879   1.00 25.54 ? 2033 HOH C O   1 
HETATM 6218 O  O   . HOH CA 8 .   ? -4.053  33.914 14.622  1.00 31.78 ? 2034 HOH C O   1 
HETATM 6219 O  O   . HOH CA 8 .   ? -1.170  36.759 16.239  1.00 32.66 ? 2035 HOH C O   1 
HETATM 6220 O  O   . HOH CA 8 .   ? -4.934  30.708 17.611  1.00 35.80 ? 2036 HOH C O   1 
HETATM 6221 O  O   . HOH CA 8 .   ? -5.961  31.102 14.842  1.00 43.93 ? 2037 HOH C O   1 
HETATM 6222 O  O   . HOH CA 8 .   ? -2.621  18.344 1.835   1.00 34.96 ? 2038 HOH C O   1 
HETATM 6223 O  O   . HOH CA 8 .   ? -8.930  23.795 2.750   1.00 32.94 ? 2039 HOH C O   1 
HETATM 6224 O  O   . HOH CA 8 .   ? -8.511  30.870 -5.926  1.00 39.00 ? 2040 HOH C O   1 
HETATM 6225 O  O   . HOH CA 8 .   ? 2.459   19.462 -2.040  1.00 26.71 ? 2041 HOH C O   1 
HETATM 6226 O  O   . HOH CA 8 .   ? 4.969   18.393 -1.223  1.00 20.00 ? 2042 HOH C O   1 
HETATM 6227 O  O   . HOH CA 8 .   ? 6.903   18.499 -4.193  1.00 38.50 ? 2043 HOH C O   1 
HETATM 6228 O  O   . HOH CA 8 .   ? 5.090   15.533 1.469   1.00 31.87 ? 2044 HOH C O   1 
HETATM 6229 O  O   . HOH CA 8 .   ? 0.362   17.042 7.850   1.00 25.64 ? 2045 HOH C O   1 
HETATM 6230 O  O   . HOH CA 8 .   ? 3.781   19.764 8.663   1.00 21.81 ? 2046 HOH C O   1 
HETATM 6231 O  O   . HOH CA 8 .   ? 10.596  14.195 2.069   1.00 31.26 ? 2047 HOH C O   1 
HETATM 6232 O  O   . HOH CA 8 .   ? 5.145   19.430 12.968  1.00 22.17 ? 2048 HOH C O   1 
HETATM 6233 O  O   . HOH CA 8 .   ? 18.279  25.835 11.446  1.00 12.97 ? 2049 HOH C O   1 
HETATM 6234 O  O   . HOH CA 8 .   ? 19.685  33.728 15.600  1.00 13.66 ? 2050 HOH C O   1 
HETATM 6235 O  O   . HOH CA 8 .   ? 20.997  32.335 13.634  1.00 14.81 ? 2051 HOH C O   1 
HETATM 6236 O  O   . HOH CA 8 .   ? 24.824  37.351 8.103   1.00 19.61 ? 2052 HOH C O   1 
HETATM 6237 O  O   . HOH CA 8 .   ? 25.484  35.560 11.572  1.00 23.75 ? 2053 HOH C O   1 
HETATM 6238 O  O   . HOH CA 8 .   ? 28.516  28.286 9.326   1.00 29.29 ? 2054 HOH C O   1 
HETATM 6239 O  O   . HOH CA 8 .   ? 23.988  30.628 21.420  1.00 27.89 ? 2055 HOH C O   1 
HETATM 6240 O  O   . HOH CA 8 .   ? 23.486  36.854 15.090  1.00 26.18 ? 2056 HOH C O   1 
HETATM 6241 O  O   . HOH CA 8 .   ? 13.785  35.139 19.163  1.00 18.36 ? 2057 HOH C O   1 
HETATM 6242 O  O   . HOH CA 8 .   ? 8.663   26.277 21.066  1.00 32.79 ? 2058 HOH C O   1 
HETATM 6243 O  O   . HOH CA 8 .   ? 6.779   23.244 19.149  1.00 23.03 ? 2059 HOH C O   1 
HETATM 6244 O  O   . HOH CA 8 .   ? -2.967  18.710 8.260   1.00 42.71 ? 2060 HOH C O   1 
HETATM 6245 O  O   . HOH CA 8 .   ? -2.993  20.150 3.826   1.00 33.71 ? 2061 HOH C O   1 
HETATM 6246 O  O   . HOH CA 8 .   ? -6.926  22.044 2.065   1.00 28.35 ? 2062 HOH C O   1 
HETATM 6247 O  O   . HOH CA 8 .   ? -5.036  20.637 -2.526  1.00 33.13 ? 2063 HOH C O   1 
HETATM 6248 O  O   . HOH CA 8 .   ? -8.393  31.412 -3.289  1.00 30.67 ? 2064 HOH C O   1 
HETATM 6249 O  O   . HOH CA 8 .   ? -5.767  20.872 -5.065  1.00 34.21 ? 2065 HOH C O   1 
HETATM 6250 O  O   . HOH CA 8 .   ? -2.929  18.732 -7.718  1.00 28.35 ? 2066 HOH C O   1 
HETATM 6251 O  O   . HOH CA 8 .   ? 3.597   19.251 -5.251  1.00 22.02 ? 2067 HOH C O   1 
HETATM 6252 O  O   . HOH CA 8 .   ? -5.964  24.690 -11.467 1.00 21.13 ? 2068 HOH C O   1 
HETATM 6253 O  O   . HOH CA 8 .   ? 2.115   16.294 -10.253 1.00 25.50 ? 2069 HOH C O   1 
HETATM 6254 O  O   . HOH CA 8 .   ? 5.099   19.791 -12.314 1.00 32.81 ? 2070 HOH C O   1 
HETATM 6255 O  O   . HOH CA 8 .   ? 3.494   19.222 -15.512 1.00 17.47 ? 2071 HOH C O   1 
HETATM 6256 O  O   . HOH CA 8 .   ? 3.423   16.758 -14.154 1.00 27.65 ? 2072 HOH C O   1 
HETATM 6257 O  O   . HOH CA 8 .   ? -2.456  14.313 -12.411 1.00 34.58 ? 2073 HOH C O   1 
HETATM 6258 O  O   . HOH CA 8 .   ? -4.046  25.312 -13.560 1.00 16.03 ? 2074 HOH C O   1 
HETATM 6259 O  O   . HOH CA 8 .   ? 3.001   28.989 -8.961  1.00 22.88 ? 2075 HOH C O   1 
HETATM 6260 O  O   . HOH CA 8 .   ? 0.104   30.109 -8.253  1.00 20.11 ? 2076 HOH C O   1 
HETATM 6261 O  O   . HOH CA 8 .   ? -7.324  29.912 -11.426 1.00 32.42 ? 2077 HOH C O   1 
HETATM 6262 O  O   . HOH CA 8 .   ? 3.237   17.065 22.178  1.00 41.83 ? 2078 HOH C O   1 
HETATM 6263 O  O   . HOH CA 8 .   ? 5.726   24.973 21.066  1.00 28.28 ? 2079 HOH C O   1 
HETATM 6264 O  O   . HOH CA 8 .   ? 6.152   29.748 21.301  1.00 23.38 ? 2080 HOH C O   1 
HETATM 6265 O  O   . HOH CA 8 .   ? 11.179  37.768 22.423  1.00 20.44 ? 2081 HOH C O   1 
HETATM 6266 O  O   . HOH CA 8 .   ? 13.181  43.194 20.736  1.00 31.20 ? 2082 HOH C O   1 
HETATM 6267 O  O   . HOH CA 8 .   ? 16.061  40.547 20.065  1.00 38.80 ? 2083 HOH C O   1 
HETATM 6268 O  O   . HOH CA 8 .   ? 22.562  41.680 14.860  1.00 37.95 ? 2084 HOH C O   1 
HETATM 6269 O  O   . HOH CA 8 .   ? 18.995  43.139 14.651  1.00 34.22 ? 2085 HOH C O   1 
HETATM 6270 O  O   . HOH CA 8 .   ? 8.865   42.796 9.462   1.00 26.43 ? 2086 HOH C O   1 
HETATM 6271 O  O   . HOH CA 8 .   ? 5.809   43.587 11.948  1.00 26.75 ? 2087 HOH C O   1 
HETATM 6272 O  O   . HOH CA 8 .   ? 3.371   44.625 9.616   1.00 31.38 ? 2088 HOH C O   1 
HETATM 6273 O  O   . HOH CA 8 .   ? -1.365  41.686 7.355   1.00 28.43 ? 2089 HOH C O   1 
HETATM 6274 O  O   . HOH CA 8 .   ? -1.541  45.856 4.128   1.00 36.58 ? 2090 HOH C O   1 
HETATM 6275 O  O   . HOH CA 8 .   ? -0.032  47.247 -4.120  1.00 33.96 ? 2091 HOH C O   1 
HETATM 6276 O  O   . HOH CA 8 .   ? -5.079  44.669 -6.587  1.00 28.92 ? 2092 HOH C O   1 
HETATM 6277 O  O   . HOH CA 8 .   ? 1.350   41.568 -6.986  1.00 27.34 ? 2093 HOH C O   1 
HETATM 6278 O  O   . HOH CA 8 .   ? 0.846   41.607 -9.566  1.00 31.15 ? 2094 HOH C O   1 
HETATM 6279 O  O   . HOH CA 8 .   ? 3.536   48.332 -7.286  1.00 32.50 ? 2095 HOH C O   1 
HETATM 6280 O  O   . HOH CA 8 .   ? 15.463  47.170 -11.419 1.00 34.97 ? 2096 HOH C O   1 
HETATM 6281 O  O   . HOH CA 8 .   ? 19.197  25.271 0.235   1.00 22.81 ? 2097 HOH C O   1 
HETATM 6282 O  O   . HOH CA 8 .   ? 20.241  24.988 -8.319  1.00 24.55 ? 2098 HOH C O   1 
HETATM 6283 O  O   . HOH CA 8 .   ? 20.512  27.208 -13.917 1.00 29.23 ? 2099 HOH C O   1 
HETATM 6284 O  O   . HOH CA 8 .   ? 26.732  25.047 3.731   1.00 32.53 ? 2100 HOH C O   1 
HETATM 6285 O  O   . HOH CA 8 .   ? 20.278  42.887 -4.882  1.00 21.59 ? 2101 HOH C O   1 
HETATM 6286 O  O   . HOH CA 8 .   ? 19.439  43.917 -7.527  1.00 28.68 ? 2102 HOH C O   1 
HETATM 6287 O  O   . HOH CA 8 .   ? 4.897   39.109 -14.172 1.00 21.01 ? 2103 HOH C O   1 
HETATM 6288 O  O   . HOH CA 8 .   ? 2.752   42.072 -13.410 1.00 32.88 ? 2104 HOH C O   1 
HETATM 6289 O  O   . HOH CA 8 .   ? 1.653   43.465 -19.539 1.00 33.24 ? 2105 HOH C O   1 
HETATM 6290 O  O   . HOH CA 8 .   ? 1.705   44.037 -16.106 1.00 34.76 ? 2106 HOH C O   1 
HETATM 6291 O  O   . HOH CA 8 .   ? 1.841   38.354 -13.898 1.00 34.26 ? 2107 HOH C O   1 
HETATM 6292 O  O   . HOH CA 8 .   ? 3.895   38.099 -24.481 1.00 31.91 ? 2108 HOH C O   1 
HETATM 6293 O  O   . HOH CA 8 .   ? 10.141  38.065 -21.922 1.00 24.94 ? 2109 HOH C O   1 
HETATM 6294 O  O   . HOH CA 8 .   ? 2.044   31.915 -20.125 1.00 23.78 ? 2110 HOH C O   1 
HETATM 6295 O  O   . HOH CA 8 .   ? 6.974   27.936 -21.177 1.00 29.82 ? 2111 HOH C O   1 
HETATM 6296 O  O   . HOH CA 8 .   ? -5.498  31.514 -14.711 1.00 29.01 ? 2112 HOH C O   1 
HETATM 6297 O  O   . HOH CA 8 .   ? -7.120  34.496 -9.933  1.00 32.95 ? 2113 HOH C O   1 
HETATM 6298 O  O   . HOH CA 8 .   ? 13.755  36.181 -9.358  1.00 20.12 ? 2114 HOH C O   1 
HETATM 6299 O  O   . HOH CA 8 .   ? 14.292  43.557 -14.763 1.00 23.39 ? 2115 HOH C O   1 
HETATM 6300 O  O   . HOH CA 8 .   ? 15.806  36.662 -12.712 1.00 19.10 ? 2116 HOH C O   1 
HETATM 6301 O  O   . HOH CA 8 .   ? 15.113  42.605 -17.167 1.00 27.26 ? 2117 HOH C O   1 
HETATM 6302 O  O   . HOH CA 8 .   ? 21.533  43.475 -14.206 1.00 32.11 ? 2118 HOH C O   1 
HETATM 6303 O  O   . HOH CA 8 .   ? 21.974  40.751 -13.531 1.00 23.15 ? 2119 HOH C O   1 
HETATM 6304 O  O   . HOH CA 8 .   ? 21.397  44.619 -11.959 1.00 39.94 ? 2120 HOH C O   1 
HETATM 6305 O  O   . HOH CA 8 .   ? 16.501  30.887 -14.701 1.00 19.64 ? 2121 HOH C O   1 
HETATM 6306 O  O   . HOH CA 8 .   ? 16.688  34.801 -14.269 1.00 22.02 ? 2122 HOH C O   1 
HETATM 6307 O  O   . HOH CA 8 .   ? 10.563  31.569 -8.017  1.00 17.95 ? 2123 HOH C O   1 
HETATM 6308 O  O   . HOH CA 8 .   ? 13.951  26.742 -10.964 1.00 16.51 ? 2124 HOH C O   1 
HETATM 6309 O  O   . HOH CA 8 .   ? 0.840   39.723 -5.005  1.00 17.09 ? 2125 HOH C O   1 
HETATM 6310 O  O   . HOH CA 8 .   ? 21.765  32.665 -19.252 1.00 31.72 ? 2126 HOH C O   1 
HETATM 6311 O  O   . HOH CA 8 .   ? 15.413  39.274 -22.420 1.00 45.75 ? 2127 HOH C O   1 
HETATM 6312 O  O   . HOH CA 8 .   ? -8.714  34.482 -1.652  1.00 23.31 ? 2128 HOH C O   1 
HETATM 6313 O  O   . HOH CA 8 .   ? -9.327  26.327 2.290   1.00 26.93 ? 2129 HOH C O   1 
HETATM 6314 O  O   . HOH DA 8 .   ? -7.921  23.521 42.262  1.00 37.60 ? 2001 HOH D O   1 
HETATM 6315 O  O   . HOH DA 8 .   ? -1.283  27.257 40.344  1.00 33.18 ? 2002 HOH D O   1 
HETATM 6316 O  O   . HOH DA 8 .   ? -3.498  21.816 33.546  1.00 15.59 ? 2003 HOH D O   1 
HETATM 6317 O  O   . HOH DA 8 .   ? -0.708  20.607 41.739  1.00 28.05 ? 2004 HOH D O   1 
HETATM 6318 O  O   . HOH DA 8 .   ? 2.065   20.509 39.190  1.00 23.79 ? 2005 HOH D O   1 
HETATM 6319 O  O   . HOH DA 8 .   ? -1.178  27.985 31.180  1.00 24.58 ? 2006 HOH D O   1 
HETATM 6320 O  O   . HOH DA 8 .   ? 5.581   23.471 29.234  1.00 27.81 ? 2007 HOH D O   1 
HETATM 6321 O  O   . HOH DA 8 .   ? 1.077   8.279  38.646  1.00 29.03 ? 2008 HOH D O   1 
HETATM 6322 O  O   . HOH DA 8 .   ? 3.355   7.207  42.688  1.00 30.09 ? 2009 HOH D O   1 
HETATM 6323 O  O   . HOH DA 8 .   ? -0.204  9.128  42.376  1.00 30.51 ? 2010 HOH D O   1 
HETATM 6324 O  O   . HOH DA 8 .   ? -0.364  11.718 36.611  1.00 29.45 ? 2011 HOH D O   1 
HETATM 6325 O  O   . HOH DA 8 .   ? 3.000   18.258 40.911  1.00 27.14 ? 2012 HOH D O   1 
HETATM 6326 O  O   . HOH DA 8 .   ? -7.942  12.793 34.402  1.00 26.20 ? 2013 HOH D O   1 
HETATM 6327 O  O   . HOH DA 8 .   ? -4.826  11.464 32.567  1.00 31.28 ? 2014 HOH D O   1 
HETATM 6328 O  O   . HOH DA 8 .   ? -1.872  12.430 34.448  1.00 23.43 ? 2015 HOH D O   1 
HETATM 6329 O  O   . HOH DA 8 .   ? 4.136   22.439 27.586  1.00 29.61 ? 2016 HOH D O   1 
HETATM 6330 O  O   . HOH DA 8 .   ? 7.279   24.114 26.081  1.00 26.51 ? 2017 HOH D O   1 
HETATM 6331 O  O   . HOH DA 8 .   ? 1.738   21.301 27.971  1.00 25.20 ? 2018 HOH D O   1 
HETATM 6332 O  O   . HOH DA 8 .   ? -0.622  16.260 25.662  1.00 37.44 ? 2019 HOH D O   1 
HETATM 6333 O  O   . HOH EA 8 .   ? -19.307 62.917 29.937  1.00 36.67 ? 2001 HOH E O   1 
HETATM 6334 O  O   . HOH EA 8 .   ? -20.919 62.782 28.272  1.00 42.51 ? 2002 HOH E O   1 
HETATM 6335 O  O   . HOH EA 8 .   ? -22.041 66.960 30.553  1.00 33.54 ? 2003 HOH E O   1 
HETATM 6336 O  O   . HOH EA 8 .   ? -17.071 62.387 31.075  1.00 34.93 ? 2004 HOH E O   1 
HETATM 6337 O  O   . HOH EA 8 .   ? -18.080 64.801 39.000  1.00 22.62 ? 2005 HOH E O   1 
HETATM 6338 O  O   . HOH EA 8 .   ? -13.930 60.223 33.348  1.00 25.36 ? 2006 HOH E O   1 
HETATM 6339 O  O   . HOH EA 8 .   ? -14.690 61.079 45.085  1.00 30.58 ? 2007 HOH E O   1 
HETATM 6340 O  O   . HOH EA 8 .   ? -14.298 54.016 40.508  1.00 29.87 ? 2008 HOH E O   1 
HETATM 6341 O  O   . HOH EA 8 .   ? -14.617 56.214 43.800  1.00 28.53 ? 2009 HOH E O   1 
HETATM 6342 O  O   . HOH EA 8 .   ? -15.173 54.175 38.274  1.00 28.02 ? 2010 HOH E O   1 
HETATM 6343 O  O   . HOH EA 8 .   ? -5.383  68.565 31.055  1.00 36.26 ? 2011 HOH E O   1 
HETATM 6344 O  O   . HOH EA 8 .   ? -7.774  66.924 36.019  1.00 32.53 ? 2012 HOH E O   1 
HETATM 6345 O  O   . HOH EA 8 .   ? -12.145 61.017 31.896  1.00 28.42 ? 2013 HOH E O   1 
HETATM 6346 O  O   . HOH EA 8 .   ? -18.493 72.316 38.190  1.00 31.09 ? 2014 HOH E O   1 
HETATM 6347 O  O   . HOH EA 8 .   ? -9.274  68.313 38.152  1.00 31.40 ? 2015 HOH E O   1 
HETATM 6348 O  O   . HOH EA 8 .   ? -13.847 58.498 45.828  1.00 28.23 ? 2016 HOH E O   1 
HETATM 6349 O  O   . HOH EA 8 .   ? -10.529 69.932 44.588  1.00 39.81 ? 2017 HOH E O   1 
HETATM 6350 O  O   . HOH FA 8 .   ? 16.050  8.243  -3.196  1.00 26.14 ? 2001 HOH F O   1 
HETATM 6351 O  O   . HOH FA 8 .   ? 15.052  10.971 5.232   1.00 39.19 ? 2002 HOH F O   1 
HETATM 6352 O  O   . HOH FA 8 .   ? 14.543  13.518 2.235   1.00 27.50 ? 2003 HOH F O   1 
HETATM 6353 O  O   . HOH FA 8 .   ? 14.635  5.654  -4.768  1.00 34.79 ? 2004 HOH F O   1 
HETATM 6354 O  O   . HOH FA 8 .   ? 12.219  5.463  -5.001  1.00 36.13 ? 2005 HOH F O   1 
HETATM 6355 O  O   . HOH FA 8 .   ? 8.209   14.773 -0.196  1.00 28.68 ? 2006 HOH F O   1 
HETATM 6356 O  O   . HOH FA 8 .   ? 25.214  17.525 6.061   1.00 30.89 ? 2007 HOH F O   1 
HETATM 6357 O  O   . HOH FA 8 .   ? 25.256  21.591 5.642   1.00 37.32 ? 2008 HOH F O   1 
HETATM 6358 O  O   . HOH FA 8 .   ? 22.921  16.280 0.115   1.00 25.49 ? 2009 HOH F O   1 
HETATM 6359 O  O   . HOH FA 8 .   ? 15.231  15.093 4.119   1.00 28.33 ? 2010 HOH F O   1 
HETATM 6360 O  O   . HOH FA 8 .   ? 20.134  3.099  -3.806  1.00 30.56 ? 2011 HOH F O   1 
HETATM 6361 O  O   . HOH FA 8 .   ? 23.689  8.532  -5.728  1.00 29.42 ? 2012 HOH F O   1 
HETATM 6362 O  O   . HOH FA 8 .   ? 26.084  10.675 -4.071  1.00 31.90 ? 2013 HOH F O   1 
HETATM 6363 O  O   . HOH FA 8 .   ? 23.429  14.427 -1.985  1.00 34.71 ? 2014 HOH F O   1 
HETATM 6364 O  O   . HOH FA 8 .   ? 18.892  18.725 -10.951 1.00 34.63 ? 2015 HOH F O   1 
HETATM 6365 O  O   . HOH FA 8 .   ? 23.314  8.638  -8.531  1.00 38.39 ? 2016 HOH F O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   24  24  ILE ILE A . n 
A 1 2   VAL 2   25  25  VAL VAL A . n 
A 1 3   GLY 3   26  26  GLY GLY A . n 
A 1 4   GLY 4   27  27  GLY GLY A . n 
A 1 5   TYR 5   28  28  TYR TYR A . n 
A 1 6   THR 6   29  29  THR THR A . n 
A 1 7   CYS 7   30  30  CYS CYS A . n 
A 1 8   GLY 8   31  31  GLY GLY A . n 
A 1 9   ALA 9   32  32  ALA ALA A . n 
A 1 10  ASN 10  33  33  ASN ASN A . n 
A 1 11  THR 11  34  34  THR THR A . n 
A 1 12  VAL 12  35  35  VAL VAL A . n 
A 1 13  PRO 13  36  36  PRO PRO A . n 
A 1 14  TYR 14  37  37  TYR TYR A . n 
A 1 15  GLN 15  38  38  GLN GLN A . n 
A 1 16  VAL 16  39  39  VAL VAL A . n 
A 1 17  SER 17  40  40  SER SER A . n 
A 1 18  LEU 18  41  41  LEU LEU A . n 
A 1 19  ASN 19  42  42  ASN ASN A . n 
A 1 20  SER 20  43  43  SER SER A . n 
A 1 21  GLY 21  44  44  GLY GLY A . n 
A 1 22  TYR 22  45  45  TYR TYR A . n 
A 1 23  HIS 23  46  46  HIS HIS A . n 
A 1 24  PHE 24  47  47  PHE PHE A . n 
A 1 25  CYS 25  48  48  CYS CYS A . n 
A 1 26  GLY 26  49  49  GLY GLY A . n 
A 1 27  GLY 27  50  50  GLY GLY A . n 
A 1 28  SER 28  51  51  SER SER A . n 
A 1 29  LEU 29  52  52  LEU LEU A . n 
A 1 30  ILE 30  53  53  ILE ILE A . n 
A 1 31  ASN 31  54  54  ASN ASN A . n 
A 1 32  SER 32  55  55  SER SER A . n 
A 1 33  GLN 33  56  56  GLN GLN A . n 
A 1 34  TRP 34  57  57  TRP TRP A . n 
A 1 35  VAL 35  58  58  VAL VAL A . n 
A 1 36  VAL 36  59  59  VAL VAL A . n 
A 1 37  SER 37  60  60  SER SER A . n 
A 1 38  ALA 38  61  61  ALA ALA A . n 
A 1 39  ALA 39  62  62  ALA ALA A . n 
A 1 40  HIS 40  63  63  HIS HIS A . n 
A 1 41  CYS 41  64  64  CYS CYS A . n 
A 1 42  TYR 42  65  65  TYR TYR A . n 
A 1 43  LYS 43  66  66  LYS LYS A . n 
A 1 44  SER 44  67  67  SER SER A . n 
A 1 45  GLY 45  68  68  GLY GLY A . n 
A 1 46  ILE 46  69  69  ILE ILE A . n 
A 1 47  GLN 47  70  70  GLN GLN A . n 
A 1 48  VAL 48  71  71  VAL VAL A . n 
A 1 49  ARG 49  72  72  ARG ARG A . n 
A 1 50  LEU 50  73  73  LEU LEU A . n 
A 1 51  GLY 51  74  74  GLY GLY A . n 
A 1 52  GLU 52  75  75  GLU GLU A . n 
A 1 53  ASP 53  76  76  ASP ASP A . n 
A 1 54  ASN 54  77  77  ASN ASN A . n 
A 1 55  ILE 55  78  78  ILE ILE A . n 
A 1 56  ASN 56  79  79  ASN ASN A . n 
A 1 57  VAL 57  80  80  VAL VAL A . n 
A 1 58  VAL 58  81  81  VAL VAL A . n 
A 1 59  GLU 59  82  82  GLU GLU A . n 
A 1 60  GLY 60  83  83  GLY GLY A . n 
A 1 61  ASN 61  84  84  ASN ASN A . n 
A 1 62  GLU 62  85  85  GLU GLU A . n 
A 1 63  GLN 63  86  86  GLN GLN A . n 
A 1 64  PHE 64  87  87  PHE PHE A . n 
A 1 65  ILE 65  88  88  ILE ILE A . n 
A 1 66  SER 66  89  89  SER SER A . n 
A 1 67  ALA 67  90  90  ALA ALA A . n 
A 1 68  SER 68  91  91  SER SER A . n 
A 1 69  LYS 69  92  92  LYS LYS A . n 
A 1 70  SER 70  93  93  SER SER A . n 
A 1 71  ILE 71  94  94  ILE ILE A . n 
A 1 72  VAL 72  95  95  VAL VAL A . n 
A 1 73  HIS 73  96  96  HIS HIS A . n 
A 1 74  PRO 74  97  97  PRO PRO A . n 
A 1 75  SER 75  98  98  SER SER A . n 
A 1 76  TYR 76  99  99  TYR TYR A . n 
A 1 77  ASN 77  100 100 ASN ASN A . n 
A 1 78  SER 78  101 101 SER SER A . n 
A 1 79  ASN 79  102 102 ASN ASN A . n 
A 1 80  THR 80  103 103 THR THR A . n 
A 1 81  LEU 81  104 104 LEU LEU A . n 
A 1 82  ASN 82  105 105 ASN ASN A . n 
A 1 83  ASN 83  106 106 ASN ASN A . n 
A 1 84  ASP 84  107 107 ASP ASP A . n 
A 1 85  ILE 85  108 108 ILE ILE A . n 
A 1 86  MET 86  109 109 MET MET A . n 
A 1 87  LEU 87  110 110 LEU LEU A . n 
A 1 88  ILE 88  111 111 ILE ILE A . n 
A 1 89  LYS 89  112 112 LYS LYS A . n 
A 1 90  LEU 90  113 113 LEU LEU A . n 
A 1 91  LYS 91  114 114 LYS LYS A . n 
A 1 92  SER 92  115 115 SER SER A . n 
A 1 93  ALA 93  116 116 ALA ALA A . n 
A 1 94  ALA 94  117 117 ALA ALA A . n 
A 1 95  SER 95  118 118 SER SER A . n 
A 1 96  LEU 96  119 119 LEU LEU A . n 
A 1 97  ASN 97  120 120 ASN ASN A . n 
A 1 98  SER 98  121 121 SER SER A . n 
A 1 99  ARG 99  122 122 ARG ARG A . n 
A 1 100 VAL 100 123 123 VAL VAL A . n 
A 1 101 ALA 101 124 124 ALA ALA A . n 
A 1 102 SER 102 125 125 SER SER A . n 
A 1 103 ILE 103 126 126 ILE ILE A . n 
A 1 104 SER 104 127 127 SER SER A . n 
A 1 105 LEU 105 128 128 LEU LEU A . n 
A 1 106 PRO 106 129 129 PRO PRO A . n 
A 1 107 THR 107 130 130 THR THR A . n 
A 1 108 SER 108 131 131 SER SER A . n 
A 1 109 CYS 109 132 132 CYS CYS A . n 
A 1 110 ALA 110 133 133 ALA ALA A . n 
A 1 111 SER 111 134 134 SER SER A . n 
A 1 112 ALA 112 135 135 ALA ALA A . n 
A 1 113 GLY 113 136 136 GLY GLY A . n 
A 1 114 THR 114 137 137 THR THR A . n 
A 1 115 GLN 115 138 138 GLN GLN A . n 
A 1 116 CYS 116 139 139 CYS CYS A . n 
A 1 117 LEU 117 140 140 LEU LEU A . n 
A 1 118 ILE 118 141 141 ILE ILE A . n 
A 1 119 SER 119 142 142 SER SER A . n 
A 1 120 GLY 120 143 143 GLY GLY A . n 
A 1 121 TRP 121 144 144 TRP TRP A . n 
A 1 122 GLY 122 145 145 GLY GLY A . n 
A 1 123 ASN 123 146 146 ASN ASN A . n 
A 1 124 THR 124 147 147 THR THR A . n 
A 1 125 LYS 125 148 148 LYS LYS A . n 
A 1 126 SER 126 149 149 SER SER A . n 
A 1 127 SER 127 150 150 SER SER A . n 
A 1 128 GLY 128 151 151 GLY GLY A . n 
A 1 129 THR 129 152 152 THR THR A . n 
A 1 130 SER 130 153 153 SER SER A . n 
A 1 131 TYR 131 154 154 TYR TYR A . n 
A 1 132 PRO 132 155 155 PRO PRO A . n 
A 1 133 ASP 133 156 156 ASP ASP A . n 
A 1 134 VAL 134 157 157 VAL VAL A . n 
A 1 135 LEU 135 158 158 LEU LEU A . n 
A 1 136 LYS 136 159 159 LYS LYS A . n 
A 1 137 CYS 137 160 160 CYS CYS A . n 
A 1 138 LEU 138 161 161 LEU LEU A . n 
A 1 139 LYS 139 162 162 LYS LYS A . n 
A 1 140 ALA 140 163 163 ALA ALA A . n 
A 1 141 PRO 141 164 164 PRO PRO A . n 
A 1 142 ILE 142 165 165 ILE ILE A . n 
A 1 143 LEU 143 166 166 LEU LEU A . n 
A 1 144 SER 144 167 167 SER SER A . n 
A 1 145 ASP 145 168 168 ASP ASP A . n 
A 1 146 SER 146 169 169 SER SER A . n 
A 1 147 SER 147 170 170 SER SER A . n 
A 1 148 CYS 148 171 171 CYS CYS A . n 
A 1 149 LYS 149 172 172 LYS LYS A . n 
A 1 150 SER 150 173 173 SER SER A . n 
A 1 151 ALA 151 174 174 ALA ALA A . n 
A 1 152 TYR 152 175 175 TYR TYR A . n 
A 1 153 PRO 153 176 176 PRO PRO A . n 
A 1 154 GLY 154 177 177 GLY GLY A . n 
A 1 155 GLN 155 178 178 GLN GLN A . n 
A 1 156 ILE 156 179 179 ILE ILE A . n 
A 1 157 THR 157 180 180 THR THR A . n 
A 1 158 SER 158 181 181 SER SER A . n 
A 1 159 ASN 159 182 182 ASN ASN A . n 
A 1 160 MET 160 183 183 MET MET A . n 
A 1 161 PHE 161 184 184 PHE PHE A . n 
A 1 162 CYS 162 185 185 CYS CYS A . n 
A 1 163 ALA 163 186 186 ALA ALA A . n 
A 1 164 GLY 164 187 187 GLY GLY A . n 
A 1 165 TYR 165 188 188 TYR TYR A . n 
A 1 166 LEU 166 189 189 LEU LEU A . n 
A 1 167 GLU 167 190 190 GLU GLU A . n 
A 1 168 GLY 168 191 191 GLY GLY A . n 
A 1 169 GLY 169 192 192 GLY GLY A . n 
A 1 170 LYS 170 193 193 LYS LYS A . n 
A 1 171 ASP 171 194 194 ASP ASP A . n 
A 1 172 SER 172 195 195 SER SER A . n 
A 1 173 CYS 173 196 196 CYS CYS A . n 
A 1 174 GLN 174 197 197 GLN GLN A . n 
A 1 175 GLY 175 198 198 GLY GLY A . n 
A 1 176 ASP 176 199 199 ASP ASP A . n 
A 1 177 SER 177 200 200 SER SER A . n 
A 1 178 GLY 178 201 201 GLY GLY A . n 
A 1 179 GLY 179 202 202 GLY GLY A . n 
A 1 180 PRO 180 203 203 PRO PRO A . n 
A 1 181 VAL 181 204 204 VAL VAL A . n 
A 1 182 VAL 182 205 205 VAL VAL A . n 
A 1 183 CYS 183 206 206 CYS CYS A . n 
A 1 184 SER 184 207 207 SER SER A . n 
A 1 185 GLY 185 208 208 GLY GLY A . n 
A 1 186 LYS 186 209 209 LYS LYS A . n 
A 1 187 LEU 187 210 210 LEU LEU A . n 
A 1 188 GLN 188 211 211 GLN GLN A . n 
A 1 189 GLY 189 212 212 GLY GLY A . n 
A 1 190 ILE 190 213 213 ILE ILE A . n 
A 1 191 VAL 191 214 214 VAL VAL A . n 
A 1 192 SER 192 215 215 SER SER A . n 
A 1 193 TRP 193 216 216 TRP TRP A . n 
A 1 194 GLY 194 217 217 GLY GLY A . n 
A 1 195 SER 195 218 218 SER SER A . n 
A 1 196 GLY 196 219 219 GLY GLY A . n 
A 1 197 CYS 197 220 220 CYS CYS A . n 
A 1 198 ALA 198 221 221 ALA ALA A . n 
A 1 199 GLN 199 222 222 GLN GLN A . n 
A 1 200 LYS 200 223 223 LYS LYS A . n 
A 1 201 ASN 201 224 224 ASN ASN A . n 
A 1 202 LYS 202 225 225 LYS LYS A . n 
A 1 203 PRO 203 226 226 PRO PRO A . n 
A 1 204 GLY 204 227 227 GLY GLY A . n 
A 1 205 VAL 205 228 228 VAL VAL A . n 
A 1 206 TYR 206 229 229 TYR TYR A . n 
A 1 207 THR 207 230 230 THR THR A . n 
A 1 208 LYS 208 231 231 LYS LYS A . n 
A 1 209 VAL 209 232 232 VAL VAL A . n 
A 1 210 CYS 210 233 233 CYS CYS A . n 
A 1 211 ASN 211 234 234 ASN ASN A . n 
A 1 212 TYR 212 235 235 TYR TYR A . n 
A 1 213 VAL 213 236 236 VAL VAL A . n 
A 1 214 SER 214 237 237 SER SER A . n 
A 1 215 TRP 215 238 238 TRP TRP A . n 
A 1 216 ILE 216 239 239 ILE ILE A . n 
A 1 217 LYS 217 240 240 LYS LYS A . n 
A 1 218 GLN 218 241 241 GLN GLN A . n 
A 1 219 THR 219 242 242 THR THR A . n 
A 1 220 ILE 220 243 243 ILE ILE A . n 
A 1 221 ALA 221 244 244 ALA ALA A . n 
A 1 222 SER 222 245 245 SER SER A . n 
A 1 223 ASN 223 246 246 ASN ASN A . n 
B 1 1   ILE 1   24  24  ILE ILE B . n 
B 1 2   VAL 2   25  25  VAL VAL B . n 
B 1 3   GLY 3   26  26  GLY GLY B . n 
B 1 4   GLY 4   27  27  GLY GLY B . n 
B 1 5   TYR 5   28  28  TYR TYR B . n 
B 1 6   THR 6   29  29  THR THR B . n 
B 1 7   CYS 7   30  30  CYS CYS B . n 
B 1 8   GLY 8   31  31  GLY GLY B . n 
B 1 9   ALA 9   32  32  ALA ALA B . n 
B 1 10  ASN 10  33  33  ASN ASN B . n 
B 1 11  THR 11  34  34  THR THR B . n 
B 1 12  VAL 12  35  35  VAL VAL B . n 
B 1 13  PRO 13  36  36  PRO PRO B . n 
B 1 14  TYR 14  37  37  TYR TYR B . n 
B 1 15  GLN 15  38  38  GLN GLN B . n 
B 1 16  VAL 16  39  39  VAL VAL B . n 
B 1 17  SER 17  40  40  SER SER B . n 
B 1 18  LEU 18  41  41  LEU LEU B . n 
B 1 19  ASN 19  42  42  ASN ASN B . n 
B 1 20  SER 20  43  43  SER SER B . n 
B 1 21  GLY 21  44  44  GLY GLY B . n 
B 1 22  TYR 22  45  45  TYR TYR B . n 
B 1 23  HIS 23  46  46  HIS HIS B . n 
B 1 24  PHE 24  47  47  PHE PHE B . n 
B 1 25  CYS 25  48  48  CYS CYS B . n 
B 1 26  GLY 26  49  49  GLY GLY B . n 
B 1 27  GLY 27  50  50  GLY GLY B . n 
B 1 28  SER 28  51  51  SER SER B . n 
B 1 29  LEU 29  52  52  LEU LEU B . n 
B 1 30  ILE 30  53  53  ILE ILE B . n 
B 1 31  ASN 31  54  54  ASN ASN B . n 
B 1 32  SER 32  55  55  SER SER B . n 
B 1 33  GLN 33  56  56  GLN GLN B . n 
B 1 34  TRP 34  57  57  TRP TRP B . n 
B 1 35  VAL 35  58  58  VAL VAL B . n 
B 1 36  VAL 36  59  59  VAL VAL B . n 
B 1 37  SER 37  60  60  SER SER B . n 
B 1 38  ALA 38  61  61  ALA ALA B . n 
B 1 39  ALA 39  62  62  ALA ALA B . n 
B 1 40  HIS 40  63  63  HIS HIS B . n 
B 1 41  CYS 41  64  64  CYS CYS B . n 
B 1 42  TYR 42  65  65  TYR TYR B . n 
B 1 43  LYS 43  66  66  LYS LYS B . n 
B 1 44  SER 44  67  67  SER SER B . n 
B 1 45  GLY 45  68  68  GLY GLY B . n 
B 1 46  ILE 46  69  69  ILE ILE B . n 
B 1 47  GLN 47  70  70  GLN GLN B . n 
B 1 48  VAL 48  71  71  VAL VAL B . n 
B 1 49  ARG 49  72  72  ARG ARG B . n 
B 1 50  LEU 50  73  73  LEU LEU B . n 
B 1 51  GLY 51  74  74  GLY GLY B . n 
B 1 52  GLU 52  75  75  GLU GLU B . n 
B 1 53  ASP 53  76  76  ASP ASP B . n 
B 1 54  ASN 54  77  77  ASN ASN B . n 
B 1 55  ILE 55  78  78  ILE ILE B . n 
B 1 56  ASN 56  79  79  ASN ASN B . n 
B 1 57  VAL 57  80  80  VAL VAL B . n 
B 1 58  VAL 58  81  81  VAL VAL B . n 
B 1 59  GLU 59  82  82  GLU GLU B . n 
B 1 60  GLY 60  83  83  GLY GLY B . n 
B 1 61  ASN 61  84  84  ASN ASN B . n 
B 1 62  GLU 62  85  85  GLU GLU B . n 
B 1 63  GLN 63  86  86  GLN GLN B . n 
B 1 64  PHE 64  87  87  PHE PHE B . n 
B 1 65  ILE 65  88  88  ILE ILE B . n 
B 1 66  SER 66  89  89  SER SER B . n 
B 1 67  ALA 67  90  90  ALA ALA B . n 
B 1 68  SER 68  91  91  SER SER B . n 
B 1 69  LYS 69  92  92  LYS LYS B . n 
B 1 70  SER 70  93  93  SER SER B . n 
B 1 71  ILE 71  94  94  ILE ILE B . n 
B 1 72  VAL 72  95  95  VAL VAL B . n 
B 1 73  HIS 73  96  96  HIS HIS B . n 
B 1 74  PRO 74  97  97  PRO PRO B . n 
B 1 75  SER 75  98  98  SER SER B . n 
B 1 76  TYR 76  99  99  TYR TYR B . n 
B 1 77  ASN 77  100 100 ASN ASN B . n 
B 1 78  SER 78  101 101 SER SER B . n 
B 1 79  ASN 79  102 102 ASN ASN B . n 
B 1 80  THR 80  103 103 THR THR B . n 
B 1 81  LEU 81  104 104 LEU LEU B . n 
B 1 82  ASN 82  105 105 ASN ASN B . n 
B 1 83  ASN 83  106 106 ASN ASN B . n 
B 1 84  ASP 84  107 107 ASP ASP B . n 
B 1 85  ILE 85  108 108 ILE ILE B . n 
B 1 86  MET 86  109 109 MET MET B . n 
B 1 87  LEU 87  110 110 LEU LEU B . n 
B 1 88  ILE 88  111 111 ILE ILE B . n 
B 1 89  LYS 89  112 112 LYS LYS B . n 
B 1 90  LEU 90  113 113 LEU LEU B . n 
B 1 91  LYS 91  114 114 LYS LYS B . n 
B 1 92  SER 92  115 115 SER SER B . n 
B 1 93  ALA 93  116 116 ALA ALA B . n 
B 1 94  ALA 94  117 117 ALA ALA B . n 
B 1 95  SER 95  118 118 SER SER B . n 
B 1 96  LEU 96  119 119 LEU LEU B . n 
B 1 97  ASN 97  120 120 ASN ASN B . n 
B 1 98  SER 98  121 121 SER SER B . n 
B 1 99  ARG 99  122 122 ARG ARG B . n 
B 1 100 VAL 100 123 123 VAL VAL B . n 
B 1 101 ALA 101 124 124 ALA ALA B . n 
B 1 102 SER 102 125 125 SER SER B . n 
B 1 103 ILE 103 126 126 ILE ILE B . n 
B 1 104 SER 104 127 127 SER SER B . n 
B 1 105 LEU 105 128 128 LEU LEU B . n 
B 1 106 PRO 106 129 129 PRO PRO B . n 
B 1 107 THR 107 130 130 THR THR B . n 
B 1 108 SER 108 131 131 SER SER B . n 
B 1 109 CYS 109 132 132 CYS CYS B . n 
B 1 110 ALA 110 133 133 ALA ALA B . n 
B 1 111 SER 111 134 134 SER SER B . n 
B 1 112 ALA 112 135 135 ALA ALA B . n 
B 1 113 GLY 113 136 136 GLY GLY B . n 
B 1 114 THR 114 137 137 THR THR B . n 
B 1 115 GLN 115 138 138 GLN GLN B . n 
B 1 116 CYS 116 139 139 CYS CYS B . n 
B 1 117 LEU 117 140 140 LEU LEU B . n 
B 1 118 ILE 118 141 141 ILE ILE B . n 
B 1 119 SER 119 142 142 SER SER B . n 
B 1 120 GLY 120 143 143 GLY GLY B . n 
B 1 121 TRP 121 144 144 TRP TRP B . n 
B 1 122 GLY 122 145 145 GLY GLY B . n 
B 1 123 ASN 123 146 146 ASN ASN B . n 
B 1 124 THR 124 147 147 THR THR B . n 
B 1 125 LYS 125 148 148 LYS LYS B . n 
B 1 126 SER 126 149 149 SER SER B . n 
B 1 127 SER 127 150 150 SER SER B . n 
B 1 128 GLY 128 151 151 GLY GLY B . n 
B 1 129 THR 129 152 152 THR THR B . n 
B 1 130 SER 130 153 153 SER SER B . n 
B 1 131 TYR 131 154 154 TYR TYR B . n 
B 1 132 PRO 132 155 155 PRO PRO B . n 
B 1 133 ASP 133 156 156 ASP ASP B . n 
B 1 134 VAL 134 157 157 VAL VAL B . n 
B 1 135 LEU 135 158 158 LEU LEU B . n 
B 1 136 LYS 136 159 159 LYS LYS B . n 
B 1 137 CYS 137 160 160 CYS CYS B . n 
B 1 138 LEU 138 161 161 LEU LEU B . n 
B 1 139 LYS 139 162 162 LYS LYS B . n 
B 1 140 ALA 140 163 163 ALA ALA B . n 
B 1 141 PRO 141 164 164 PRO PRO B . n 
B 1 142 ILE 142 165 165 ILE ILE B . n 
B 1 143 LEU 143 166 166 LEU LEU B . n 
B 1 144 SER 144 167 167 SER SER B . n 
B 1 145 ASP 145 168 168 ASP ASP B . n 
B 1 146 SER 146 169 169 SER SER B . n 
B 1 147 SER 147 170 170 SER SER B . n 
B 1 148 CYS 148 171 171 CYS CYS B . n 
B 1 149 LYS 149 172 172 LYS LYS B . n 
B 1 150 SER 150 173 173 SER SER B . n 
B 1 151 ALA 151 174 174 ALA ALA B . n 
B 1 152 TYR 152 175 175 TYR TYR B . n 
B 1 153 PRO 153 176 176 PRO PRO B . n 
B 1 154 GLY 154 177 177 GLY GLY B . n 
B 1 155 GLN 155 178 178 GLN GLN B . n 
B 1 156 ILE 156 179 179 ILE ILE B . n 
B 1 157 THR 157 180 180 THR THR B . n 
B 1 158 SER 158 181 181 SER SER B . n 
B 1 159 ASN 159 182 182 ASN ASN B . n 
B 1 160 MET 160 183 183 MET MET B . n 
B 1 161 PHE 161 184 184 PHE PHE B . n 
B 1 162 CYS 162 185 185 CYS CYS B . n 
B 1 163 ALA 163 186 186 ALA ALA B . n 
B 1 164 GLY 164 187 187 GLY GLY B . n 
B 1 165 TYR 165 188 188 TYR TYR B . n 
B 1 166 LEU 166 189 189 LEU LEU B . n 
B 1 167 GLU 167 190 190 GLU GLU B . n 
B 1 168 GLY 168 191 191 GLY GLY B . n 
B 1 169 GLY 169 192 192 GLY GLY B . n 
B 1 170 LYS 170 193 193 LYS LYS B . n 
B 1 171 ASP 171 194 194 ASP ASP B . n 
B 1 172 SER 172 195 195 SER SER B . n 
B 1 173 CYS 173 196 196 CYS CYS B . n 
B 1 174 GLN 174 197 197 GLN GLN B . n 
B 1 175 GLY 175 198 198 GLY GLY B . n 
B 1 176 ASP 176 199 199 ASP ASP B . n 
B 1 177 SER 177 200 200 SER SER B . n 
B 1 178 GLY 178 201 201 GLY GLY B . n 
B 1 179 GLY 179 202 202 GLY GLY B . n 
B 1 180 PRO 180 203 203 PRO PRO B . n 
B 1 181 VAL 181 204 204 VAL VAL B . n 
B 1 182 VAL 182 205 205 VAL VAL B . n 
B 1 183 CYS 183 206 206 CYS CYS B . n 
B 1 184 SER 184 207 207 SER SER B . n 
B 1 185 GLY 185 208 208 GLY GLY B . n 
B 1 186 LYS 186 209 209 LYS LYS B . n 
B 1 187 LEU 187 210 210 LEU LEU B . n 
B 1 188 GLN 188 211 211 GLN GLN B . n 
B 1 189 GLY 189 212 212 GLY GLY B . n 
B 1 190 ILE 190 213 213 ILE ILE B . n 
B 1 191 VAL 191 214 214 VAL VAL B . n 
B 1 192 SER 192 215 215 SER SER B . n 
B 1 193 TRP 193 216 216 TRP TRP B . n 
B 1 194 GLY 194 217 217 GLY GLY B . n 
B 1 195 SER 195 218 218 SER SER B . n 
B 1 196 GLY 196 219 219 GLY GLY B . n 
B 1 197 CYS 197 220 220 CYS CYS B . n 
B 1 198 ALA 198 221 221 ALA ALA B . n 
B 1 199 GLN 199 222 222 GLN GLN B . n 
B 1 200 LYS 200 223 223 LYS LYS B . n 
B 1 201 ASN 201 224 224 ASN ASN B . n 
B 1 202 LYS 202 225 225 LYS LYS B . n 
B 1 203 PRO 203 226 226 PRO PRO B . n 
B 1 204 GLY 204 227 227 GLY GLY B . n 
B 1 205 VAL 205 228 228 VAL VAL B . n 
B 1 206 TYR 206 229 229 TYR TYR B . n 
B 1 207 THR 207 230 230 THR THR B . n 
B 1 208 LYS 208 231 231 LYS LYS B . n 
B 1 209 VAL 209 232 232 VAL VAL B . n 
B 1 210 CYS 210 233 233 CYS CYS B . n 
B 1 211 ASN 211 234 234 ASN ASN B . n 
B 1 212 TYR 212 235 235 TYR TYR B . n 
B 1 213 VAL 213 236 236 VAL VAL B . n 
B 1 214 SER 214 237 237 SER SER B . n 
B 1 215 TRP 215 238 238 TRP TRP B . n 
B 1 216 ILE 216 239 239 ILE ILE B . n 
B 1 217 LYS 217 240 240 LYS LYS B . n 
B 1 218 GLN 218 241 241 GLN GLN B . n 
B 1 219 THR 219 242 242 THR THR B . n 
B 1 220 ILE 220 243 243 ILE ILE B . n 
B 1 221 ALA 221 244 244 ALA ALA B . n 
B 1 222 SER 222 245 245 SER SER B . n 
B 1 223 ASN 223 246 246 ASN ASN B . n 
C 1 1   ILE 1   24  24  ILE ILE C . n 
C 1 2   VAL 2   25  25  VAL VAL C . n 
C 1 3   GLY 3   26  26  GLY GLY C . n 
C 1 4   GLY 4   27  27  GLY GLY C . n 
C 1 5   TYR 5   28  28  TYR TYR C . n 
C 1 6   THR 6   29  29  THR THR C . n 
C 1 7   CYS 7   30  30  CYS CYS C . n 
C 1 8   GLY 8   31  31  GLY GLY C . n 
C 1 9   ALA 9   32  32  ALA ALA C . n 
C 1 10  ASN 10  33  33  ASN ASN C . n 
C 1 11  THR 11  34  34  THR THR C . n 
C 1 12  VAL 12  35  35  VAL VAL C . n 
C 1 13  PRO 13  36  36  PRO PRO C . n 
C 1 14  TYR 14  37  37  TYR TYR C . n 
C 1 15  GLN 15  38  38  GLN GLN C . n 
C 1 16  VAL 16  39  39  VAL VAL C . n 
C 1 17  SER 17  40  40  SER SER C . n 
C 1 18  LEU 18  41  41  LEU LEU C . n 
C 1 19  ASN 19  42  42  ASN ASN C . n 
C 1 20  SER 20  43  43  SER SER C . n 
C 1 21  GLY 21  44  44  GLY GLY C . n 
C 1 22  TYR 22  45  45  TYR TYR C . n 
C 1 23  HIS 23  46  46  HIS HIS C . n 
C 1 24  PHE 24  47  47  PHE PHE C . n 
C 1 25  CYS 25  48  48  CYS CYS C . n 
C 1 26  GLY 26  49  49  GLY GLY C . n 
C 1 27  GLY 27  50  50  GLY GLY C . n 
C 1 28  SER 28  51  51  SER SER C . n 
C 1 29  LEU 29  52  52  LEU LEU C . n 
C 1 30  ILE 30  53  53  ILE ILE C . n 
C 1 31  ASN 31  54  54  ASN ASN C . n 
C 1 32  SER 32  55  55  SER SER C . n 
C 1 33  GLN 33  56  56  GLN GLN C . n 
C 1 34  TRP 34  57  57  TRP TRP C . n 
C 1 35  VAL 35  58  58  VAL VAL C . n 
C 1 36  VAL 36  59  59  VAL VAL C . n 
C 1 37  SER 37  60  60  SER SER C . n 
C 1 38  ALA 38  61  61  ALA ALA C . n 
C 1 39  ALA 39  62  62  ALA ALA C . n 
C 1 40  HIS 40  63  63  HIS HIS C . n 
C 1 41  CYS 41  64  64  CYS CYS C . n 
C 1 42  TYR 42  65  65  TYR TYR C . n 
C 1 43  LYS 43  66  66  LYS LYS C . n 
C 1 44  SER 44  67  67  SER SER C . n 
C 1 45  GLY 45  68  68  GLY GLY C . n 
C 1 46  ILE 46  69  69  ILE ILE C . n 
C 1 47  GLN 47  70  70  GLN GLN C . n 
C 1 48  VAL 48  71  71  VAL VAL C . n 
C 1 49  ARG 49  72  72  ARG ARG C . n 
C 1 50  LEU 50  73  73  LEU LEU C . n 
C 1 51  GLY 51  74  74  GLY GLY C . n 
C 1 52  GLU 52  75  75  GLU GLU C . n 
C 1 53  ASP 53  76  76  ASP ASP C . n 
C 1 54  ASN 54  77  77  ASN ASN C . n 
C 1 55  ILE 55  78  78  ILE ILE C . n 
C 1 56  ASN 56  79  79  ASN ASN C . n 
C 1 57  VAL 57  80  80  VAL VAL C . n 
C 1 58  VAL 58  81  81  VAL VAL C . n 
C 1 59  GLU 59  82  82  GLU GLU C . n 
C 1 60  GLY 60  83  83  GLY GLY C . n 
C 1 61  ASN 61  84  84  ASN ASN C . n 
C 1 62  GLU 62  85  85  GLU GLU C . n 
C 1 63  GLN 63  86  86  GLN GLN C . n 
C 1 64  PHE 64  87  87  PHE PHE C . n 
C 1 65  ILE 65  88  88  ILE ILE C . n 
C 1 66  SER 66  89  89  SER SER C . n 
C 1 67  ALA 67  90  90  ALA ALA C . n 
C 1 68  SER 68  91  91  SER SER C . n 
C 1 69  LYS 69  92  92  LYS LYS C . n 
C 1 70  SER 70  93  93  SER SER C . n 
C 1 71  ILE 71  94  94  ILE ILE C . n 
C 1 72  VAL 72  95  95  VAL VAL C . n 
C 1 73  HIS 73  96  96  HIS HIS C . n 
C 1 74  PRO 74  97  97  PRO PRO C . n 
C 1 75  SER 75  98  98  SER SER C . n 
C 1 76  TYR 76  99  99  TYR TYR C . n 
C 1 77  ASN 77  100 100 ASN ASN C . n 
C 1 78  SER 78  101 101 SER SER C . n 
C 1 79  ASN 79  102 102 ASN ASN C . n 
C 1 80  THR 80  103 103 THR THR C . n 
C 1 81  LEU 81  104 104 LEU LEU C . n 
C 1 82  ASN 82  105 105 ASN ASN C . n 
C 1 83  ASN 83  106 106 ASN ASN C . n 
C 1 84  ASP 84  107 107 ASP ASP C . n 
C 1 85  ILE 85  108 108 ILE ILE C . n 
C 1 86  MET 86  109 109 MET MET C . n 
C 1 87  LEU 87  110 110 LEU LEU C . n 
C 1 88  ILE 88  111 111 ILE ILE C . n 
C 1 89  LYS 89  112 112 LYS LYS C . n 
C 1 90  LEU 90  113 113 LEU LEU C . n 
C 1 91  LYS 91  114 114 LYS LYS C . n 
C 1 92  SER 92  115 115 SER SER C . n 
C 1 93  ALA 93  116 116 ALA ALA C . n 
C 1 94  ALA 94  117 117 ALA ALA C . n 
C 1 95  SER 95  118 118 SER SER C . n 
C 1 96  LEU 96  119 119 LEU LEU C . n 
C 1 97  ASN 97  120 120 ASN ASN C . n 
C 1 98  SER 98  121 121 SER SER C . n 
C 1 99  ARG 99  122 122 ARG ARG C . n 
C 1 100 VAL 100 123 123 VAL VAL C . n 
C 1 101 ALA 101 124 124 ALA ALA C . n 
C 1 102 SER 102 125 125 SER SER C . n 
C 1 103 ILE 103 126 126 ILE ILE C . n 
C 1 104 SER 104 127 127 SER SER C . n 
C 1 105 LEU 105 128 128 LEU LEU C . n 
C 1 106 PRO 106 129 129 PRO PRO C . n 
C 1 107 THR 107 130 130 THR THR C . n 
C 1 108 SER 108 131 131 SER SER C . n 
C 1 109 CYS 109 132 132 CYS CYS C . n 
C 1 110 ALA 110 133 133 ALA ALA C . n 
C 1 111 SER 111 134 134 SER SER C . n 
C 1 112 ALA 112 135 135 ALA ALA C . n 
C 1 113 GLY 113 136 136 GLY GLY C . n 
C 1 114 THR 114 137 137 THR THR C . n 
C 1 115 GLN 115 138 138 GLN GLN C . n 
C 1 116 CYS 116 139 139 CYS CYS C . n 
C 1 117 LEU 117 140 140 LEU LEU C . n 
C 1 118 ILE 118 141 141 ILE ILE C . n 
C 1 119 SER 119 142 142 SER SER C . n 
C 1 120 GLY 120 143 143 GLY GLY C . n 
C 1 121 TRP 121 144 144 TRP TRP C . n 
C 1 122 GLY 122 145 145 GLY GLY C . n 
C 1 123 ASN 123 146 146 ASN ASN C . n 
C 1 124 THR 124 147 147 THR THR C . n 
C 1 125 LYS 125 148 148 LYS LYS C . n 
C 1 126 SER 126 149 149 SER SER C . n 
C 1 127 SER 127 150 150 SER SER C . n 
C 1 128 GLY 128 151 151 GLY GLY C . n 
C 1 129 THR 129 152 152 THR THR C . n 
C 1 130 SER 130 153 153 SER SER C . n 
C 1 131 TYR 131 154 154 TYR TYR C . n 
C 1 132 PRO 132 155 155 PRO PRO C . n 
C 1 133 ASP 133 156 156 ASP ASP C . n 
C 1 134 VAL 134 157 157 VAL VAL C . n 
C 1 135 LEU 135 158 158 LEU LEU C . n 
C 1 136 LYS 136 159 159 LYS LYS C . n 
C 1 137 CYS 137 160 160 CYS CYS C . n 
C 1 138 LEU 138 161 161 LEU LEU C . n 
C 1 139 LYS 139 162 162 LYS LYS C . n 
C 1 140 ALA 140 163 163 ALA ALA C . n 
C 1 141 PRO 141 164 164 PRO PRO C . n 
C 1 142 ILE 142 165 165 ILE ILE C . n 
C 1 143 LEU 143 166 166 LEU LEU C . n 
C 1 144 SER 144 167 167 SER SER C . n 
C 1 145 ASP 145 168 168 ASP ASP C . n 
C 1 146 SER 146 169 169 SER SER C . n 
C 1 147 SER 147 170 170 SER SER C . n 
C 1 148 CYS 148 171 171 CYS CYS C . n 
C 1 149 LYS 149 172 172 LYS LYS C . n 
C 1 150 SER 150 173 173 SER SER C . n 
C 1 151 ALA 151 174 174 ALA ALA C . n 
C 1 152 TYR 152 175 175 TYR TYR C . n 
C 1 153 PRO 153 176 176 PRO PRO C . n 
C 1 154 GLY 154 177 177 GLY GLY C . n 
C 1 155 GLN 155 178 178 GLN GLN C . n 
C 1 156 ILE 156 179 179 ILE ILE C . n 
C 1 157 THR 157 180 180 THR THR C . n 
C 1 158 SER 158 181 181 SER SER C . n 
C 1 159 ASN 159 182 182 ASN ASN C . n 
C 1 160 MET 160 183 183 MET MET C . n 
C 1 161 PHE 161 184 184 PHE PHE C . n 
C 1 162 CYS 162 185 185 CYS CYS C . n 
C 1 163 ALA 163 186 186 ALA ALA C . n 
C 1 164 GLY 164 187 187 GLY GLY C . n 
C 1 165 TYR 165 188 188 TYR TYR C . n 
C 1 166 LEU 166 189 189 LEU LEU C . n 
C 1 167 GLU 167 190 190 GLU GLU C . n 
C 1 168 GLY 168 191 191 GLY GLY C . n 
C 1 169 GLY 169 192 192 GLY GLY C . n 
C 1 170 LYS 170 193 193 LYS LYS C . n 
C 1 171 ASP 171 194 194 ASP ASP C . n 
C 1 172 SER 172 195 195 SER SER C . n 
C 1 173 CYS 173 196 196 CYS CYS C . n 
C 1 174 GLN 174 197 197 GLN GLN C . n 
C 1 175 GLY 175 198 198 GLY GLY C . n 
C 1 176 ASP 176 199 199 ASP ASP C . n 
C 1 177 SER 177 200 200 SER SER C . n 
C 1 178 GLY 178 201 201 GLY GLY C . n 
C 1 179 GLY 179 202 202 GLY GLY C . n 
C 1 180 PRO 180 203 203 PRO PRO C . n 
C 1 181 VAL 181 204 204 VAL VAL C . n 
C 1 182 VAL 182 205 205 VAL VAL C . n 
C 1 183 CYS 183 206 206 CYS CYS C . n 
C 1 184 SER 184 207 207 SER SER C . n 
C 1 185 GLY 185 208 208 GLY GLY C . n 
C 1 186 LYS 186 209 209 LYS LYS C . n 
C 1 187 LEU 187 210 210 LEU LEU C . n 
C 1 188 GLN 188 211 211 GLN GLN C . n 
C 1 189 GLY 189 212 212 GLY GLY C . n 
C 1 190 ILE 190 213 213 ILE ILE C . n 
C 1 191 VAL 191 214 214 VAL VAL C . n 
C 1 192 SER 192 215 215 SER SER C . n 
C 1 193 TRP 193 216 216 TRP TRP C . n 
C 1 194 GLY 194 217 217 GLY GLY C . n 
C 1 195 SER 195 218 218 SER SER C . n 
C 1 196 GLY 196 219 219 GLY GLY C . n 
C 1 197 CYS 197 220 220 CYS CYS C . n 
C 1 198 ALA 198 221 221 ALA ALA C . n 
C 1 199 GLN 199 222 222 GLN GLN C . n 
C 1 200 LYS 200 223 223 LYS LYS C . n 
C 1 201 ASN 201 224 224 ASN ASN C . n 
C 1 202 LYS 202 225 225 LYS LYS C . n 
C 1 203 PRO 203 226 226 PRO PRO C . n 
C 1 204 GLY 204 227 227 GLY GLY C . n 
C 1 205 VAL 205 228 228 VAL VAL C . n 
C 1 206 TYR 206 229 229 TYR TYR C . n 
C 1 207 THR 207 230 230 THR THR C . n 
C 1 208 LYS 208 231 231 LYS LYS C . n 
C 1 209 VAL 209 232 232 VAL VAL C . n 
C 1 210 CYS 210 233 233 CYS CYS C . n 
C 1 211 ASN 211 234 234 ASN ASN C . n 
C 1 212 TYR 212 235 235 TYR TYR C . n 
C 1 213 VAL 213 236 236 VAL VAL C . n 
C 1 214 SER 214 237 237 SER SER C . n 
C 1 215 TRP 215 238 238 TRP TRP C . n 
C 1 216 ILE 216 239 239 ILE ILE C . n 
C 1 217 LYS 217 240 240 LYS LYS C . n 
C 1 218 GLN 218 241 241 GLN GLN C . n 
C 1 219 THR 219 242 242 THR THR C . n 
C 1 220 ILE 220 243 243 ILE ILE C . n 
C 1 221 ALA 221 244 244 ALA ALA C . n 
C 1 222 SER 222 245 245 SER SER C . n 
C 1 223 ASN 223 246 246 ASN ASN C . n 
D 2 1   GLU 1   1   ?   ?   ?   D . n 
D 2 2   ASP 2   2   ?   ?   ?   D . n 
D 2 3   LYS 3   3   ?   ?   ?   D . n 
D 2 4   CYS 4   4   4   CYS CYS D . n 
D 2 5   SER 5   5   5   SER SER D . n 
D 2 6   PRO 6   6   6   PRO PRO D . n 
D 2 7   SER 7   7   7   SER SER D . n 
D 2 8   GLY 8   8   8   GLY GLY D . n 
D 2 9   ALA 9   9   9   ALA ALA D . n 
D 2 10  ILE 10  10  10  ILE ILE D . n 
D 2 11  CYS 11  11  11  CYS CYS D . n 
D 2 12  SER 12  12  12  SER SER D . n 
D 2 13  GLY 13  13  13  GLY GLY D . n 
D 2 14  PHE 14  14  14  PHE PHE D . n 
D 2 15  GLY 15  15  15  GLY GLY D . n 
D 2 16  PRO 16  16  16  PRO PRO D . n 
D 2 17  PRO 17  17  17  PRO PRO D . n 
D 2 18  GLU 18  18  18  GLU GLU D . n 
D 2 19  GLN 19  19  19  GLN GLN D . n 
D 2 20  CYS 20  20  20  CYS CYS D . n 
D 2 21  CYS 21  21  21  CYS CYS D . n 
D 2 22  SER 22  22  22  SER SER D . n 
D 2 23  GLY 23  23  23  GLY GLY D . n 
D 2 24  ALA 24  24  24  ALA ALA D . n 
D 2 25  CYS 25  25  25  CYS CYS D . n 
D 2 26  VAL 26  26  26  VAL VAL D . n 
D 2 27  PRO 27  27  27  PRO PRO D . n 
D 2 28  HIS 28  28  28  HIS HIS D . n 
D 2 29  PRO 29  29  29  PRO PRO D . n 
D 2 30  ILE 30  30  30  ILE ILE D . n 
D 2 31  LEU 31  31  31  LEU LEU D . n 
D 2 32  ARG 32  32  32  ARG ARG D . n 
D 2 33  ILE 33  33  33  ILE ILE D . n 
D 2 34  PHE 34  34  34  PHE PHE D . n 
D 2 35  VAL 35  35  35  VAL VAL D . n 
D 2 36  CYS 36  36  36  CYS CYS D . n 
D 2 37  GLN 37  37  37  GLN GLN D . n 
E 2 1   GLU 1   1   ?   ?   ?   E . n 
E 2 2   ASP 2   2   ?   ?   ?   E . n 
E 2 3   LYS 3   3   ?   ?   ?   E . n 
E 2 4   CYS 4   4   4   CYS CYS E . n 
E 2 5   SER 5   5   5   SER SER E . n 
E 2 6   PRO 6   6   6   PRO PRO E . n 
E 2 7   SER 7   7   7   SER SER E . n 
E 2 8   GLY 8   8   8   GLY GLY E . n 
E 2 9   ALA 9   9   9   ALA ALA E . n 
E 2 10  ILE 10  10  10  ILE ILE E . n 
E 2 11  CYS 11  11  11  CYS CYS E . n 
E 2 12  SER 12  12  12  SER SER E . n 
E 2 13  GLY 13  13  13  GLY GLY E . n 
E 2 14  PHE 14  14  14  PHE PHE E . n 
E 2 15  GLY 15  15  15  GLY GLY E . n 
E 2 16  PRO 16  16  16  PRO PRO E . n 
E 2 17  PRO 17  17  17  PRO PRO E . n 
E 2 18  GLU 18  18  18  GLU GLU E . n 
E 2 19  GLN 19  19  19  GLN GLN E . n 
E 2 20  CYS 20  20  20  CYS CYS E . n 
E 2 21  CYS 21  21  21  CYS CYS E . n 
E 2 22  SER 22  22  22  SER SER E . n 
E 2 23  GLY 23  23  23  GLY GLY E . n 
E 2 24  ALA 24  24  24  ALA ALA E . n 
E 2 25  CYS 25  25  25  CYS CYS E . n 
E 2 26  VAL 26  26  26  VAL VAL E . n 
E 2 27  PRO 27  27  27  PRO PRO E . n 
E 2 28  HIS 28  28  28  HIS HIS E . n 
E 2 29  PRO 29  29  29  PRO PRO E . n 
E 2 30  ILE 30  30  30  ILE ILE E . n 
E 2 31  LEU 31  31  31  LEU LEU E . n 
E 2 32  ARG 32  32  32  ARG ARG E . n 
E 2 33  ILE 33  33  33  ILE ILE E . n 
E 2 34  PHE 34  34  34  PHE PHE E . n 
E 2 35  VAL 35  35  35  VAL VAL E . n 
E 2 36  CYS 36  36  36  CYS CYS E . n 
E 2 37  GLN 37  37  37  GLN GLN E . n 
F 2 1   GLU 1   1   ?   ?   ?   F . n 
F 2 2   ASP 2   2   ?   ?   ?   F . n 
F 2 3   LYS 3   3   ?   ?   ?   F . n 
F 2 4   CYS 4   4   4   CYS CYS F . n 
F 2 5   SER 5   5   5   SER SER F . n 
F 2 6   PRO 6   6   6   PRO PRO F . n 
F 2 7   SER 7   7   7   SER SER F . n 
F 2 8   GLY 8   8   8   GLY GLY F . n 
F 2 9   ALA 9   9   9   ALA ALA F . n 
F 2 10  ILE 10  10  10  ILE ILE F . n 
F 2 11  CYS 11  11  11  CYS CYS F . n 
F 2 12  SER 12  12  12  SER SER F . n 
F 2 13  GLY 13  13  13  GLY GLY F . n 
F 2 14  PHE 14  14  14  PHE PHE F . n 
F 2 15  GLY 15  15  15  GLY GLY F . n 
F 2 16  PRO 16  16  16  PRO PRO F . n 
F 2 17  PRO 17  17  17  PRO PRO F . n 
F 2 18  GLU 18  18  18  GLU GLU F . n 
F 2 19  GLN 19  19  19  GLN GLN F . n 
F 2 20  CYS 20  20  20  CYS CYS F . n 
F 2 21  CYS 21  21  21  CYS CYS F . n 
F 2 22  SER 22  22  22  SER SER F . n 
F 2 23  GLY 23  23  23  GLY GLY F . n 
F 2 24  ALA 24  24  24  ALA ALA F . n 
F 2 25  CYS 25  25  25  CYS CYS F . n 
F 2 26  VAL 26  26  26  VAL VAL F . n 
F 2 27  PRO 27  27  27  PRO PRO F . n 
F 2 28  HIS 28  28  28  HIS HIS F . n 
F 2 29  PRO 29  29  29  PRO PRO F . n 
F 2 30  ILE 30  30  30  ILE ILE F . n 
F 2 31  LEU 31  31  31  LEU LEU F . n 
F 2 32  ARG 32  32  32  ARG ARG F . n 
F 2 33  ILE 33  33  33  ILE ILE F . n 
F 2 34  PHE 34  34  34  PHE PHE F . n 
F 2 35  VAL 35  35  35  VAL VAL F . n 
F 2 36  CYS 36  36  36  CYS CYS F . n 
F 2 37  GLN 37  37  37  GLN GLN F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  3 GOL 1   1247 1247 GOL GOL A . 
H  3 GOL 1   1248 1248 GOL GOL A . 
I  3 GOL 1   1249 1249 GOL GOL A . 
J  3 GOL 1   1250 1250 GOL GOL A . 
K  4 CL  1   1251 1251 CL  CL  A . 
L  4 CL  1   1252 1252 CL  CL  A . 
M  5 IMD 1   1253 1253 IMD IMD A . 
N  5 IMD 1   1254 1254 IMD IMD A . 
O  6 CA  1   1255 1255 CA  CA  A . 
P  3 GOL 1   1247 1247 GOL GOL B . 
Q  5 IMD 1   1248 1248 IMD IMD B . 
R  5 IMD 1   1249 1249 IMD IMD B . 
S  5 IMD 1   1250 1250 IMD IMD B . 
T  5 IMD 1   1251 1251 IMD IMD B . 
U  6 CA  1   1252 1252 CA  CA  B . 
V  6 CA  1   1253 1253 CA  CA  B . 
W  7 MES 1   1254 1254 MES MES B . 
X  3 GOL 1   1247 1247 GOL GOL C . 
Y  5 IMD 1   1248 1248 IMD IMD C . 
Z  6 CA  1   1249 1249 CA  CA  C . 
AA 8 HOH 1   2001 2001 HOH HOH A . 
AA 8 HOH 2   2002 2002 HOH HOH A . 
AA 8 HOH 3   2003 2003 HOH HOH A . 
AA 8 HOH 4   2004 2004 HOH HOH A . 
AA 8 HOH 5   2005 2005 HOH HOH A . 
AA 8 HOH 6   2006 2006 HOH HOH A . 
AA 8 HOH 7   2007 2007 HOH HOH A . 
AA 8 HOH 8   2008 2008 HOH HOH A . 
AA 8 HOH 9   2009 2009 HOH HOH A . 
AA 8 HOH 10  2010 2010 HOH HOH A . 
AA 8 HOH 11  2011 2011 HOH HOH A . 
AA 8 HOH 12  2012 2012 HOH HOH A . 
AA 8 HOH 13  2013 2013 HOH HOH A . 
AA 8 HOH 14  2014 2014 HOH HOH A . 
AA 8 HOH 15  2015 2015 HOH HOH A . 
AA 8 HOH 16  2016 2016 HOH HOH A . 
AA 8 HOH 17  2017 2017 HOH HOH A . 
AA 8 HOH 18  2018 2018 HOH HOH A . 
AA 8 HOH 19  2019 2019 HOH HOH A . 
AA 8 HOH 20  2020 2020 HOH HOH A . 
AA 8 HOH 21  2021 2021 HOH HOH A . 
AA 8 HOH 22  2022 2022 HOH HOH A . 
AA 8 HOH 23  2023 2023 HOH HOH A . 
AA 8 HOH 24  2024 2024 HOH HOH A . 
AA 8 HOH 25  2025 2025 HOH HOH A . 
AA 8 HOH 26  2026 2026 HOH HOH A . 
AA 8 HOH 27  2027 2027 HOH HOH A . 
AA 8 HOH 28  2028 2028 HOH HOH A . 
AA 8 HOH 29  2029 2029 HOH HOH A . 
AA 8 HOH 30  2030 2030 HOH HOH A . 
AA 8 HOH 31  2031 2031 HOH HOH A . 
AA 8 HOH 32  2032 2032 HOH HOH A . 
AA 8 HOH 33  2033 2033 HOH HOH A . 
AA 8 HOH 34  2034 2034 HOH HOH A . 
AA 8 HOH 35  2035 2035 HOH HOH A . 
AA 8 HOH 36  2036 2036 HOH HOH A . 
AA 8 HOH 37  2037 2037 HOH HOH A . 
AA 8 HOH 38  2038 2038 HOH HOH A . 
AA 8 HOH 39  2039 2039 HOH HOH A . 
AA 8 HOH 40  2040 2040 HOH HOH A . 
AA 8 HOH 41  2041 2041 HOH HOH A . 
AA 8 HOH 42  2042 2042 HOH HOH A . 
AA 8 HOH 43  2043 2043 HOH HOH A . 
AA 8 HOH 44  2044 2044 HOH HOH A . 
AA 8 HOH 45  2045 2045 HOH HOH A . 
AA 8 HOH 46  2046 2046 HOH HOH A . 
AA 8 HOH 47  2047 2047 HOH HOH A . 
AA 8 HOH 48  2048 2048 HOH HOH A . 
AA 8 HOH 49  2049 2049 HOH HOH A . 
AA 8 HOH 50  2050 2050 HOH HOH A . 
AA 8 HOH 51  2051 2051 HOH HOH A . 
AA 8 HOH 52  2052 2052 HOH HOH A . 
AA 8 HOH 53  2053 2053 HOH HOH A . 
AA 8 HOH 54  2054 2054 HOH HOH A . 
AA 8 HOH 55  2055 2055 HOH HOH A . 
AA 8 HOH 56  2056 2056 HOH HOH A . 
AA 8 HOH 57  2057 2057 HOH HOH A . 
AA 8 HOH 58  2058 2058 HOH HOH A . 
AA 8 HOH 59  2059 2059 HOH HOH A . 
AA 8 HOH 60  2060 2060 HOH HOH A . 
AA 8 HOH 61  2061 2061 HOH HOH A . 
AA 8 HOH 62  2062 2062 HOH HOH A . 
AA 8 HOH 63  2063 2063 HOH HOH A . 
AA 8 HOH 64  2064 2064 HOH HOH A . 
AA 8 HOH 65  2065 2065 HOH HOH A . 
AA 8 HOH 66  2066 2066 HOH HOH A . 
AA 8 HOH 67  2067 2067 HOH HOH A . 
AA 8 HOH 68  2068 2068 HOH HOH A . 
AA 8 HOH 69  2069 2069 HOH HOH A . 
AA 8 HOH 70  2070 2070 HOH HOH A . 
AA 8 HOH 71  2071 2071 HOH HOH A . 
AA 8 HOH 72  2072 2072 HOH HOH A . 
AA 8 HOH 73  2073 2073 HOH HOH A . 
AA 8 HOH 74  2074 2074 HOH HOH A . 
AA 8 HOH 75  2075 2075 HOH HOH A . 
AA 8 HOH 76  2076 2076 HOH HOH A . 
AA 8 HOH 77  2077 2077 HOH HOH A . 
AA 8 HOH 78  2078 2078 HOH HOH A . 
AA 8 HOH 79  2079 2079 HOH HOH A . 
AA 8 HOH 80  2080 2080 HOH HOH A . 
AA 8 HOH 81  2081 2081 HOH HOH A . 
AA 8 HOH 82  2082 2082 HOH HOH A . 
AA 8 HOH 83  2083 2083 HOH HOH A . 
AA 8 HOH 84  2084 2084 HOH HOH A . 
AA 8 HOH 85  2085 2085 HOH HOH A . 
AA 8 HOH 86  2086 2086 HOH HOH A . 
AA 8 HOH 87  2087 2087 HOH HOH A . 
AA 8 HOH 88  2088 2088 HOH HOH A . 
AA 8 HOH 89  2089 2089 HOH HOH A . 
AA 8 HOH 90  2090 2090 HOH HOH A . 
AA 8 HOH 91  2091 2091 HOH HOH A . 
AA 8 HOH 92  2092 2092 HOH HOH A . 
AA 8 HOH 93  2093 2093 HOH HOH A . 
AA 8 HOH 94  2094 2094 HOH HOH A . 
AA 8 HOH 95  2095 2095 HOH HOH A . 
AA 8 HOH 96  2096 2096 HOH HOH A . 
AA 8 HOH 97  2097 2097 HOH HOH A . 
AA 8 HOH 98  2098 2098 HOH HOH A . 
AA 8 HOH 99  2099 2099 HOH HOH A . 
AA 8 HOH 100 2100 2100 HOH HOH A . 
AA 8 HOH 101 2101 2101 HOH HOH A . 
AA 8 HOH 102 2102 2102 HOH HOH A . 
AA 8 HOH 103 2103 2103 HOH HOH A . 
AA 8 HOH 104 2104 2104 HOH HOH A . 
AA 8 HOH 105 2105 2105 HOH HOH A . 
AA 8 HOH 106 2106 2106 HOH HOH A . 
AA 8 HOH 107 2107 2107 HOH HOH A . 
AA 8 HOH 108 2108 2108 HOH HOH A . 
AA 8 HOH 109 2109 2109 HOH HOH A . 
AA 8 HOH 110 2110 2110 HOH HOH A . 
AA 8 HOH 111 2111 2111 HOH HOH A . 
AA 8 HOH 112 2112 2112 HOH HOH A . 
AA 8 HOH 113 2113 2113 HOH HOH A . 
AA 8 HOH 114 2114 2114 HOH HOH A . 
AA 8 HOH 115 2115 2115 HOH HOH A . 
AA 8 HOH 116 2116 2116 HOH HOH A . 
AA 8 HOH 117 2117 2117 HOH HOH A . 
AA 8 HOH 118 2118 2118 HOH HOH A . 
AA 8 HOH 119 2119 2119 HOH HOH A . 
AA 8 HOH 120 2120 2120 HOH HOH A . 
AA 8 HOH 121 2121 2121 HOH HOH A . 
AA 8 HOH 122 2122 2122 HOH HOH A . 
AA 8 HOH 123 2123 2123 HOH HOH A . 
AA 8 HOH 124 2124 2124 HOH HOH A . 
AA 8 HOH 125 2125 2125 HOH HOH A . 
AA 8 HOH 126 2126 2126 HOH HOH A . 
AA 8 HOH 127 2127 2127 HOH HOH A . 
AA 8 HOH 128 2128 2128 HOH HOH A . 
AA 8 HOH 129 2129 2129 HOH HOH A . 
AA 8 HOH 130 2130 2130 HOH HOH A . 
AA 8 HOH 131 2131 2131 HOH HOH A . 
AA 8 HOH 132 2132 2132 HOH HOH A . 
AA 8 HOH 133 2133 2133 HOH HOH A . 
AA 8 HOH 134 2134 2134 HOH HOH A . 
AA 8 HOH 135 2135 2135 HOH HOH A . 
AA 8 HOH 136 2136 2136 HOH HOH A . 
AA 8 HOH 137 2137 2137 HOH HOH A . 
AA 8 HOH 138 2138 2138 HOH HOH A . 
AA 8 HOH 139 2139 2139 HOH HOH A . 
AA 8 HOH 140 2140 2140 HOH HOH A . 
AA 8 HOH 141 2141 2141 HOH HOH A . 
AA 8 HOH 142 2142 2142 HOH HOH A . 
AA 8 HOH 143 2143 2143 HOH HOH A . 
AA 8 HOH 144 2144 2144 HOH HOH A . 
AA 8 HOH 145 2145 2145 HOH HOH A . 
AA 8 HOH 146 2146 2146 HOH HOH A . 
AA 8 HOH 147 2147 2147 HOH HOH A . 
AA 8 HOH 148 2148 2148 HOH HOH A . 
AA 8 HOH 149 2149 2149 HOH HOH A . 
AA 8 HOH 150 2150 2150 HOH HOH A . 
AA 8 HOH 151 2151 2151 HOH HOH A . 
AA 8 HOH 152 2152 2152 HOH HOH A . 
AA 8 HOH 153 2153 2153 HOH HOH A . 
AA 8 HOH 154 2154 2154 HOH HOH A . 
AA 8 HOH 155 2155 2155 HOH HOH A . 
AA 8 HOH 156 2156 2156 HOH HOH A . 
AA 8 HOH 157 2157 2157 HOH HOH A . 
AA 8 HOH 158 2158 2158 HOH HOH A . 
AA 8 HOH 159 2159 2159 HOH HOH A . 
AA 8 HOH 160 2160 2160 HOH HOH A . 
AA 8 HOH 161 2161 2161 HOH HOH A . 
AA 8 HOH 162 2162 2162 HOH HOH A . 
AA 8 HOH 163 2163 2163 HOH HOH A . 
AA 8 HOH 164 2164 2164 HOH HOH A . 
AA 8 HOH 165 2165 2165 HOH HOH A . 
AA 8 HOH 166 2166 2166 HOH HOH A . 
AA 8 HOH 167 2167 2167 HOH HOH A . 
AA 8 HOH 168 2168 2168 HOH HOH A . 
AA 8 HOH 169 2169 2169 HOH HOH A . 
AA 8 HOH 170 2170 2170 HOH HOH A . 
AA 8 HOH 171 2171 2171 HOH HOH A . 
AA 8 HOH 172 2172 2172 HOH HOH A . 
AA 8 HOH 173 2173 2173 HOH HOH A . 
AA 8 HOH 174 2174 2174 HOH HOH A . 
AA 8 HOH 175 2175 2175 HOH HOH A . 
AA 8 HOH 176 2176 2176 HOH HOH A . 
AA 8 HOH 177 2177 2177 HOH HOH A . 
AA 8 HOH 178 2178 2178 HOH HOH A . 
AA 8 HOH 179 2179 2179 HOH HOH A . 
AA 8 HOH 180 2180 2180 HOH HOH A . 
AA 8 HOH 181 2181 2181 HOH HOH A . 
AA 8 HOH 182 2182 2182 HOH HOH A . 
AA 8 HOH 183 2183 2183 HOH HOH A . 
AA 8 HOH 184 2184 2184 HOH HOH A . 
AA 8 HOH 185 2185 2185 HOH HOH A . 
AA 8 HOH 186 2186 2186 HOH HOH A . 
AA 8 HOH 187 2187 2187 HOH HOH A . 
AA 8 HOH 188 2188 2188 HOH HOH A . 
AA 8 HOH 189 2189 2189 HOH HOH A . 
AA 8 HOH 190 2190 2190 HOH HOH A . 
AA 8 HOH 191 2191 2191 HOH HOH A . 
AA 8 HOH 192 2192 2192 HOH HOH A . 
AA 8 HOH 193 2193 2193 HOH HOH A . 
AA 8 HOH 194 2194 2194 HOH HOH A . 
AA 8 HOH 195 2195 2195 HOH HOH A . 
AA 8 HOH 196 2196 2196 HOH HOH A . 
AA 8 HOH 197 2197 2197 HOH HOH A . 
AA 8 HOH 198 2198 2198 HOH HOH A . 
AA 8 HOH 199 2199 2199 HOH HOH A . 
AA 8 HOH 200 2200 2200 HOH HOH A . 
AA 8 HOH 201 2201 2201 HOH HOH A . 
AA 8 HOH 202 2202 2202 HOH HOH A . 
AA 8 HOH 203 2203 2203 HOH HOH A . 
AA 8 HOH 204 2204 2204 HOH HOH A . 
AA 8 HOH 205 2205 2205 HOH HOH A . 
AA 8 HOH 206 2206 2206 HOH HOH A . 
AA 8 HOH 207 2207 2207 HOH HOH A . 
AA 8 HOH 208 2208 2208 HOH HOH A . 
AA 8 HOH 209 2209 2209 HOH HOH A . 
AA 8 HOH 210 2210 2210 HOH HOH A . 
AA 8 HOH 211 2211 2211 HOH HOH A . 
BA 8 HOH 1   2001 2001 HOH HOH B . 
BA 8 HOH 2   2002 2002 HOH HOH B . 
BA 8 HOH 3   2003 2003 HOH HOH B . 
BA 8 HOH 4   2004 2004 HOH HOH B . 
BA 8 HOH 5   2005 2005 HOH HOH B . 
BA 8 HOH 6   2006 2006 HOH HOH B . 
BA 8 HOH 7   2007 2007 HOH HOH B . 
BA 8 HOH 8   2008 2008 HOH HOH B . 
BA 8 HOH 9   2009 2009 HOH HOH B . 
BA 8 HOH 10  2010 2010 HOH HOH B . 
BA 8 HOH 11  2011 2011 HOH HOH B . 
BA 8 HOH 12  2012 2012 HOH HOH B . 
BA 8 HOH 13  2013 2013 HOH HOH B . 
BA 8 HOH 14  2014 2014 HOH HOH B . 
BA 8 HOH 15  2015 2015 HOH HOH B . 
BA 8 HOH 16  2016 2016 HOH HOH B . 
BA 8 HOH 17  2017 2017 HOH HOH B . 
BA 8 HOH 18  2018 2018 HOH HOH B . 
BA 8 HOH 19  2019 2019 HOH HOH B . 
BA 8 HOH 20  2020 2020 HOH HOH B . 
BA 8 HOH 21  2021 2021 HOH HOH B . 
BA 8 HOH 22  2022 2022 HOH HOH B . 
BA 8 HOH 23  2023 2023 HOH HOH B . 
BA 8 HOH 24  2024 2024 HOH HOH B . 
BA 8 HOH 25  2025 2025 HOH HOH B . 
BA 8 HOH 26  2026 2026 HOH HOH B . 
BA 8 HOH 27  2027 2027 HOH HOH B . 
BA 8 HOH 28  2028 2028 HOH HOH B . 
BA 8 HOH 29  2029 2029 HOH HOH B . 
BA 8 HOH 30  2030 2030 HOH HOH B . 
BA 8 HOH 31  2031 2031 HOH HOH B . 
BA 8 HOH 32  2032 2032 HOH HOH B . 
BA 8 HOH 33  2033 2033 HOH HOH B . 
BA 8 HOH 34  2034 2034 HOH HOH B . 
BA 8 HOH 35  2035 2035 HOH HOH B . 
BA 8 HOH 36  2036 2036 HOH HOH B . 
BA 8 HOH 37  2037 2037 HOH HOH B . 
BA 8 HOH 38  2038 2038 HOH HOH B . 
BA 8 HOH 39  2039 2039 HOH HOH B . 
BA 8 HOH 40  2040 2040 HOH HOH B . 
BA 8 HOH 41  2041 2041 HOH HOH B . 
BA 8 HOH 42  2042 2042 HOH HOH B . 
BA 8 HOH 43  2043 2043 HOH HOH B . 
BA 8 HOH 44  2044 2044 HOH HOH B . 
BA 8 HOH 45  2045 2045 HOH HOH B . 
BA 8 HOH 46  2046 2046 HOH HOH B . 
BA 8 HOH 47  2047 2047 HOH HOH B . 
BA 8 HOH 48  2048 2048 HOH HOH B . 
BA 8 HOH 49  2049 2049 HOH HOH B . 
BA 8 HOH 50  2050 2050 HOH HOH B . 
BA 8 HOH 51  2051 2051 HOH HOH B . 
BA 8 HOH 52  2052 2052 HOH HOH B . 
BA 8 HOH 53  2053 2053 HOH HOH B . 
BA 8 HOH 54  2054 2054 HOH HOH B . 
BA 8 HOH 55  2055 2055 HOH HOH B . 
BA 8 HOH 56  2056 2056 HOH HOH B . 
BA 8 HOH 57  2057 2057 HOH HOH B . 
BA 8 HOH 58  2058 2058 HOH HOH B . 
BA 8 HOH 59  2059 2059 HOH HOH B . 
BA 8 HOH 60  2060 2060 HOH HOH B . 
BA 8 HOH 61  2061 2061 HOH HOH B . 
BA 8 HOH 62  2062 2062 HOH HOH B . 
BA 8 HOH 63  2063 2063 HOH HOH B . 
BA 8 HOH 64  2064 2064 HOH HOH B . 
BA 8 HOH 65  2065 2065 HOH HOH B . 
BA 8 HOH 66  2066 2066 HOH HOH B . 
BA 8 HOH 67  2067 2067 HOH HOH B . 
BA 8 HOH 68  2068 2068 HOH HOH B . 
BA 8 HOH 69  2069 2069 HOH HOH B . 
BA 8 HOH 70  2070 2070 HOH HOH B . 
BA 8 HOH 71  2071 2071 HOH HOH B . 
BA 8 HOH 72  2072 2072 HOH HOH B . 
BA 8 HOH 73  2073 2073 HOH HOH B . 
BA 8 HOH 74  2074 2074 HOH HOH B . 
BA 8 HOH 75  2075 2075 HOH HOH B . 
BA 8 HOH 76  2076 2076 HOH HOH B . 
BA 8 HOH 77  2077 2077 HOH HOH B . 
BA 8 HOH 78  2078 2078 HOH HOH B . 
BA 8 HOH 79  2079 2079 HOH HOH B . 
BA 8 HOH 80  2080 2080 HOH HOH B . 
BA 8 HOH 81  2081 2081 HOH HOH B . 
BA 8 HOH 82  2082 2082 HOH HOH B . 
BA 8 HOH 83  2083 2083 HOH HOH B . 
BA 8 HOH 84  2084 2084 HOH HOH B . 
BA 8 HOH 85  2085 2085 HOH HOH B . 
BA 8 HOH 86  2086 2086 HOH HOH B . 
BA 8 HOH 87  2087 2087 HOH HOH B . 
BA 8 HOH 88  2088 2088 HOH HOH B . 
BA 8 HOH 89  2089 2089 HOH HOH B . 
BA 8 HOH 90  2090 2090 HOH HOH B . 
BA 8 HOH 91  2091 2091 HOH HOH B . 
BA 8 HOH 92  2092 2092 HOH HOH B . 
BA 8 HOH 93  2093 2093 HOH HOH B . 
BA 8 HOH 94  2094 2094 HOH HOH B . 
BA 8 HOH 95  2095 2095 HOH HOH B . 
BA 8 HOH 96  2096 2096 HOH HOH B . 
BA 8 HOH 97  2097 2097 HOH HOH B . 
BA 8 HOH 98  2098 2098 HOH HOH B . 
BA 8 HOH 99  2099 2099 HOH HOH B . 
BA 8 HOH 100 2100 2100 HOH HOH B . 
BA 8 HOH 101 2101 2101 HOH HOH B . 
BA 8 HOH 102 2102 2102 HOH HOH B . 
BA 8 HOH 103 2103 2103 HOH HOH B . 
BA 8 HOH 104 2104 2104 HOH HOH B . 
BA 8 HOH 105 2105 2105 HOH HOH B . 
BA 8 HOH 106 2106 2106 HOH HOH B . 
BA 8 HOH 107 2107 2107 HOH HOH B . 
BA 8 HOH 108 2108 2108 HOH HOH B . 
BA 8 HOH 109 2109 2109 HOH HOH B . 
BA 8 HOH 110 2110 2110 HOH HOH B . 
BA 8 HOH 111 2111 2111 HOH HOH B . 
BA 8 HOH 112 2112 2112 HOH HOH B . 
BA 8 HOH 113 2113 2113 HOH HOH B . 
BA 8 HOH 114 2114 2114 HOH HOH B . 
BA 8 HOH 115 2115 2115 HOH HOH B . 
BA 8 HOH 116 2116 2116 HOH HOH B . 
BA 8 HOH 117 2117 2117 HOH HOH B . 
BA 8 HOH 118 2118 2118 HOH HOH B . 
BA 8 HOH 119 2119 2119 HOH HOH B . 
BA 8 HOH 120 2120 2120 HOH HOH B . 
BA 8 HOH 121 2121 2121 HOH HOH B . 
BA 8 HOH 122 2122 2122 HOH HOH B . 
BA 8 HOH 123 2123 2123 HOH HOH B . 
BA 8 HOH 124 2124 2124 HOH HOH B . 
BA 8 HOH 125 2125 2125 HOH HOH B . 
BA 8 HOH 126 2126 2126 HOH HOH B . 
BA 8 HOH 127 2127 2127 HOH HOH B . 
BA 8 HOH 128 2128 2128 HOH HOH B . 
BA 8 HOH 129 2129 2129 HOH HOH B . 
BA 8 HOH 130 2130 2130 HOH HOH B . 
BA 8 HOH 131 2131 2131 HOH HOH B . 
BA 8 HOH 132 2132 2132 HOH HOH B . 
BA 8 HOH 133 2133 2133 HOH HOH B . 
BA 8 HOH 134 2134 2134 HOH HOH B . 
BA 8 HOH 135 2135 2135 HOH HOH B . 
BA 8 HOH 136 2136 2136 HOH HOH B . 
BA 8 HOH 137 2137 2137 HOH HOH B . 
BA 8 HOH 138 2138 2138 HOH HOH B . 
BA 8 HOH 139 2139 2139 HOH HOH B . 
BA 8 HOH 140 2140 2140 HOH HOH B . 
BA 8 HOH 141 2141 2141 HOH HOH B . 
BA 8 HOH 142 2142 2142 HOH HOH B . 
BA 8 HOH 143 2143 2143 HOH HOH B . 
BA 8 HOH 144 2144 2144 HOH HOH B . 
BA 8 HOH 145 2145 2145 HOH HOH B . 
BA 8 HOH 146 2146 2146 HOH HOH B . 
BA 8 HOH 147 2147 2147 HOH HOH B . 
BA 8 HOH 148 2148 2148 HOH HOH B . 
BA 8 HOH 149 2149 2149 HOH HOH B . 
BA 8 HOH 150 2150 2150 HOH HOH B . 
BA 8 HOH 151 2151 2151 HOH HOH B . 
BA 8 HOH 152 2152 2152 HOH HOH B . 
BA 8 HOH 153 2153 2153 HOH HOH B . 
BA 8 HOH 154 2154 2154 HOH HOH B . 
BA 8 HOH 155 2155 2155 HOH HOH B . 
BA 8 HOH 156 2156 2156 HOH HOH B . 
BA 8 HOH 157 2157 2157 HOH HOH B . 
BA 8 HOH 158 2158 2158 HOH HOH B . 
BA 8 HOH 159 2159 2159 HOH HOH B . 
BA 8 HOH 160 2160 2160 HOH HOH B . 
BA 8 HOH 161 2161 2161 HOH HOH B . 
BA 8 HOH 162 2162 2162 HOH HOH B . 
BA 8 HOH 163 2163 2163 HOH HOH B . 
BA 8 HOH 164 2164 2164 HOH HOH B . 
BA 8 HOH 165 2165 2165 HOH HOH B . 
BA 8 HOH 166 2166 2166 HOH HOH B . 
BA 8 HOH 167 2167 2167 HOH HOH B . 
BA 8 HOH 168 2168 2168 HOH HOH B . 
BA 8 HOH 169 2169 2169 HOH HOH B . 
BA 8 HOH 170 2170 2170 HOH HOH B . 
BA 8 HOH 171 2171 2171 HOH HOH B . 
BA 8 HOH 172 2172 2172 HOH HOH B . 
BA 8 HOH 173 2173 2173 HOH HOH B . 
BA 8 HOH 174 2174 2174 HOH HOH B . 
BA 8 HOH 175 2175 2175 HOH HOH B . 
BA 8 HOH 176 2176 2176 HOH HOH B . 
BA 8 HOH 177 2177 2177 HOH HOH B . 
BA 8 HOH 178 2178 2178 HOH HOH B . 
BA 8 HOH 179 2179 2179 HOH HOH B . 
BA 8 HOH 180 2180 2180 HOH HOH B . 
BA 8 HOH 181 2181 2181 HOH HOH B . 
BA 8 HOH 182 2182 2182 HOH HOH B . 
BA 8 HOH 183 2183 2183 HOH HOH B . 
BA 8 HOH 184 2184 2184 HOH HOH B . 
BA 8 HOH 185 2185 2185 HOH HOH B . 
BA 8 HOH 186 2186 2186 HOH HOH B . 
BA 8 HOH 187 2187 2187 HOH HOH B . 
BA 8 HOH 188 2188 2188 HOH HOH B . 
CA 8 HOH 1   2001 2001 HOH HOH C . 
CA 8 HOH 2   2002 2002 HOH HOH C . 
CA 8 HOH 3   2003 2003 HOH HOH C . 
CA 8 HOH 4   2004 2004 HOH HOH C . 
CA 8 HOH 5   2005 2005 HOH HOH C . 
CA 8 HOH 6   2006 2006 HOH HOH C . 
CA 8 HOH 7   2007 2007 HOH HOH C . 
CA 8 HOH 8   2008 2008 HOH HOH C . 
CA 8 HOH 9   2009 2009 HOH HOH C . 
CA 8 HOH 10  2010 2010 HOH HOH C . 
CA 8 HOH 11  2011 2011 HOH HOH C . 
CA 8 HOH 12  2012 2012 HOH HOH C . 
CA 8 HOH 13  2013 2013 HOH HOH C . 
CA 8 HOH 14  2014 2014 HOH HOH C . 
CA 8 HOH 15  2015 2015 HOH HOH C . 
CA 8 HOH 16  2016 2016 HOH HOH C . 
CA 8 HOH 17  2017 2017 HOH HOH C . 
CA 8 HOH 18  2018 2018 HOH HOH C . 
CA 8 HOH 19  2019 2019 HOH HOH C . 
CA 8 HOH 20  2020 2020 HOH HOH C . 
CA 8 HOH 21  2021 2021 HOH HOH C . 
CA 8 HOH 22  2022 2022 HOH HOH C . 
CA 8 HOH 23  2023 2023 HOH HOH C . 
CA 8 HOH 24  2024 2024 HOH HOH C . 
CA 8 HOH 25  2025 2025 HOH HOH C . 
CA 8 HOH 26  2026 2026 HOH HOH C . 
CA 8 HOH 27  2027 2027 HOH HOH C . 
CA 8 HOH 28  2028 2028 HOH HOH C . 
CA 8 HOH 29  2029 2029 HOH HOH C . 
CA 8 HOH 30  2030 2030 HOH HOH C . 
CA 8 HOH 31  2031 2031 HOH HOH C . 
CA 8 HOH 32  2032 2032 HOH HOH C . 
CA 8 HOH 33  2033 2033 HOH HOH C . 
CA 8 HOH 34  2034 2034 HOH HOH C . 
CA 8 HOH 35  2035 2035 HOH HOH C . 
CA 8 HOH 36  2036 2036 HOH HOH C . 
CA 8 HOH 37  2037 2037 HOH HOH C . 
CA 8 HOH 38  2038 2038 HOH HOH C . 
CA 8 HOH 39  2039 2039 HOH HOH C . 
CA 8 HOH 40  2040 2040 HOH HOH C . 
CA 8 HOH 41  2041 2041 HOH HOH C . 
CA 8 HOH 42  2042 2042 HOH HOH C . 
CA 8 HOH 43  2043 2043 HOH HOH C . 
CA 8 HOH 44  2044 2044 HOH HOH C . 
CA 8 HOH 45  2045 2045 HOH HOH C . 
CA 8 HOH 46  2046 2046 HOH HOH C . 
CA 8 HOH 47  2047 2047 HOH HOH C . 
CA 8 HOH 48  2048 2048 HOH HOH C . 
CA 8 HOH 49  2049 2049 HOH HOH C . 
CA 8 HOH 50  2050 2050 HOH HOH C . 
CA 8 HOH 51  2051 2051 HOH HOH C . 
CA 8 HOH 52  2052 2052 HOH HOH C . 
CA 8 HOH 53  2053 2053 HOH HOH C . 
CA 8 HOH 54  2054 2054 HOH HOH C . 
CA 8 HOH 55  2055 2055 HOH HOH C . 
CA 8 HOH 56  2056 2056 HOH HOH C . 
CA 8 HOH 57  2057 2057 HOH HOH C . 
CA 8 HOH 58  2058 2058 HOH HOH C . 
CA 8 HOH 59  2059 2059 HOH HOH C . 
CA 8 HOH 60  2060 2060 HOH HOH C . 
CA 8 HOH 61  2061 2061 HOH HOH C . 
CA 8 HOH 62  2062 2062 HOH HOH C . 
CA 8 HOH 63  2063 2063 HOH HOH C . 
CA 8 HOH 64  2064 2064 HOH HOH C . 
CA 8 HOH 65  2065 2065 HOH HOH C . 
CA 8 HOH 66  2066 2066 HOH HOH C . 
CA 8 HOH 67  2067 2067 HOH HOH C . 
CA 8 HOH 68  2068 2068 HOH HOH C . 
CA 8 HOH 69  2069 2069 HOH HOH C . 
CA 8 HOH 70  2070 2070 HOH HOH C . 
CA 8 HOH 71  2071 2071 HOH HOH C . 
CA 8 HOH 72  2072 2072 HOH HOH C . 
CA 8 HOH 73  2073 2073 HOH HOH C . 
CA 8 HOH 74  2074 2074 HOH HOH C . 
CA 8 HOH 75  2075 2075 HOH HOH C . 
CA 8 HOH 76  2076 2076 HOH HOH C . 
CA 8 HOH 77  2077 2077 HOH HOH C . 
CA 8 HOH 78  2078 2078 HOH HOH C . 
CA 8 HOH 79  2079 2079 HOH HOH C . 
CA 8 HOH 80  2080 2080 HOH HOH C . 
CA 8 HOH 81  2081 2081 HOH HOH C . 
CA 8 HOH 82  2082 2082 HOH HOH C . 
CA 8 HOH 83  2083 2083 HOH HOH C . 
CA 8 HOH 84  2084 2084 HOH HOH C . 
CA 8 HOH 85  2085 2085 HOH HOH C . 
CA 8 HOH 86  2086 2086 HOH HOH C . 
CA 8 HOH 87  2087 2087 HOH HOH C . 
CA 8 HOH 88  2088 2088 HOH HOH C . 
CA 8 HOH 89  2089 2089 HOH HOH C . 
CA 8 HOH 90  2090 2090 HOH HOH C . 
CA 8 HOH 91  2091 2091 HOH HOH C . 
CA 8 HOH 92  2092 2092 HOH HOH C . 
CA 8 HOH 93  2093 2093 HOH HOH C . 
CA 8 HOH 94  2094 2094 HOH HOH C . 
CA 8 HOH 95  2095 2095 HOH HOH C . 
CA 8 HOH 96  2096 2096 HOH HOH C . 
CA 8 HOH 97  2097 2097 HOH HOH C . 
CA 8 HOH 98  2098 2098 HOH HOH C . 
CA 8 HOH 99  2099 2099 HOH HOH C . 
CA 8 HOH 100 2100 2100 HOH HOH C . 
CA 8 HOH 101 2101 2101 HOH HOH C . 
CA 8 HOH 102 2102 2102 HOH HOH C . 
CA 8 HOH 103 2103 2103 HOH HOH C . 
CA 8 HOH 104 2104 2104 HOH HOH C . 
CA 8 HOH 105 2105 2105 HOH HOH C . 
CA 8 HOH 106 2106 2106 HOH HOH C . 
CA 8 HOH 107 2107 2107 HOH HOH C . 
CA 8 HOH 108 2108 2108 HOH HOH C . 
CA 8 HOH 109 2109 2109 HOH HOH C . 
CA 8 HOH 110 2110 2110 HOH HOH C . 
CA 8 HOH 111 2111 2111 HOH HOH C . 
CA 8 HOH 112 2112 2112 HOH HOH C . 
CA 8 HOH 113 2113 2113 HOH HOH C . 
CA 8 HOH 114 2114 2114 HOH HOH C . 
CA 8 HOH 115 2115 2115 HOH HOH C . 
CA 8 HOH 116 2116 2116 HOH HOH C . 
CA 8 HOH 117 2117 2117 HOH HOH C . 
CA 8 HOH 118 2118 2118 HOH HOH C . 
CA 8 HOH 119 2119 2119 HOH HOH C . 
CA 8 HOH 120 2120 2120 HOH HOH C . 
CA 8 HOH 121 2121 2121 HOH HOH C . 
CA 8 HOH 122 2122 2122 HOH HOH C . 
CA 8 HOH 123 2123 2123 HOH HOH C . 
CA 8 HOH 124 2124 2124 HOH HOH C . 
CA 8 HOH 125 2125 2125 HOH HOH C . 
CA 8 HOH 126 2126 2126 HOH HOH C . 
CA 8 HOH 127 2127 2127 HOH HOH C . 
CA 8 HOH 128 2128 2128 HOH HOH C . 
CA 8 HOH 129 2129 2129 HOH HOH C . 
DA 8 HOH 1   2001 2001 HOH HOH D . 
DA 8 HOH 2   2002 2002 HOH HOH D . 
DA 8 HOH 3   2003 2003 HOH HOH D . 
DA 8 HOH 4   2004 2004 HOH HOH D . 
DA 8 HOH 5   2005 2005 HOH HOH D . 
DA 8 HOH 6   2006 2006 HOH HOH D . 
DA 8 HOH 7   2007 2007 HOH HOH D . 
DA 8 HOH 8   2008 2008 HOH HOH D . 
DA 8 HOH 9   2009 2009 HOH HOH D . 
DA 8 HOH 10  2010 2010 HOH HOH D . 
DA 8 HOH 11  2011 2011 HOH HOH D . 
DA 8 HOH 12  2012 2012 HOH HOH D . 
DA 8 HOH 13  2013 2013 HOH HOH D . 
DA 8 HOH 14  2014 2014 HOH HOH D . 
DA 8 HOH 15  2015 2015 HOH HOH D . 
DA 8 HOH 16  2016 2016 HOH HOH D . 
DA 8 HOH 17  2017 2017 HOH HOH D . 
DA 8 HOH 18  2018 2018 HOH HOH D . 
DA 8 HOH 19  2019 2019 HOH HOH D . 
EA 8 HOH 1   2001 2001 HOH HOH E . 
EA 8 HOH 2   2002 2002 HOH HOH E . 
EA 8 HOH 3   2003 2003 HOH HOH E . 
EA 8 HOH 4   2004 2004 HOH HOH E . 
EA 8 HOH 5   2005 2005 HOH HOH E . 
EA 8 HOH 6   2006 2006 HOH HOH E . 
EA 8 HOH 7   2007 2007 HOH HOH E . 
EA 8 HOH 8   2008 2008 HOH HOH E . 
EA 8 HOH 9   2009 2009 HOH HOH E . 
EA 8 HOH 10  2010 2010 HOH HOH E . 
EA 8 HOH 11  2011 2011 HOH HOH E . 
EA 8 HOH 12  2012 2012 HOH HOH E . 
EA 8 HOH 13  2013 2013 HOH HOH E . 
EA 8 HOH 14  2014 2014 HOH HOH E . 
EA 8 HOH 15  2015 2015 HOH HOH E . 
EA 8 HOH 16  2016 2016 HOH HOH E . 
EA 8 HOH 17  2017 2017 HOH HOH E . 
FA 8 HOH 1   2001 2001 HOH HOH F . 
FA 8 HOH 2   2002 2002 HOH HOH F . 
FA 8 HOH 3   2003 2003 HOH HOH F . 
FA 8 HOH 4   2004 2004 HOH HOH F . 
FA 8 HOH 5   2005 2005 HOH HOH F . 
FA 8 HOH 6   2006 2006 HOH HOH F . 
FA 8 HOH 7   2007 2007 HOH HOH F . 
FA 8 HOH 8   2008 2008 HOH HOH F . 
FA 8 HOH 9   2009 2009 HOH HOH F . 
FA 8 HOH 10  2010 2010 HOH HOH F . 
FA 8 HOH 11  2011 2011 HOH HOH F . 
FA 8 HOH 12  2012 2012 HOH HOH F . 
FA 8 HOH 13  2013 2013 HOH HOH F . 
FA 8 HOH 14  2014 2014 HOH HOH F . 
FA 8 HOH 15  2015 2015 HOH HOH F . 
FA 8 HOH 16  2016 2016 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,G,H,I,J,K,L,M,N,O,AA,DA 
2 1 B,E,P,Q,R,S,T,U,V,W,BA,EA   
3 1 C,F,X,Y,Z,CA,FA             
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3110  ? 
1 MORE         -37.1 ? 
1 'SSA (A^2)'  10250 ? 
2 'ABSA (A^2)' 3130  ? 
2 MORE         -20.7 ? 
2 'SSA (A^2)'  10020 ? 
3 'ABSA (A^2)' 2470  ? 
3 MORE         -22.6 ? 
3 'SSA (A^2)'  10010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A  GLU 52  ? A GLU 75   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? A  ASN 54 ? A ASN 77   ? 1_555 91.8  ? 
2  OE1 ? A  GLU 52  ? A GLU 75   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? A  VAL 57 ? A VAL 80   ? 1_555 166.4 ? 
3  O   ? A  ASN 54  ? A ASN 77   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? A  VAL 57 ? A VAL 80   ? 1_555 78.2  ? 
4  OE1 ? A  GLU 52  ? A GLU 75   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 OE2 ? A  GLU 62 ? A GLU 85   ? 1_555 104.1 ? 
5  O   ? A  ASN 54  ? A ASN 77   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 OE2 ? A  GLU 62 ? A GLU 85   ? 1_555 153.9 ? 
6  O   ? A  VAL 57  ? A VAL 80   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 OE2 ? A  GLU 62 ? A GLU 85   ? 1_555 88.5  ? 
7  OE1 ? A  GLU 52  ? A GLU 75   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2068 ? 1_555 78.9  ? 
8  O   ? A  ASN 54  ? A ASN 77   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2068 ? 1_555 109.5 ? 
9  O   ? A  VAL 57  ? A VAL 80   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2068 ? 1_555 95.6  ? 
10 OE2 ? A  GLU 62  ? A GLU 85   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2068 ? 1_555 93.9  ? 
11 OE1 ? A  GLU 52  ? A GLU 75   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2069 ? 1_555 87.0  ? 
12 O   ? A  ASN 54  ? A ASN 77   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2069 ? 1_555 86.0  ? 
13 O   ? A  VAL 57  ? A VAL 80   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2069 ? 1_555 101.3 ? 
14 OE2 ? A  GLU 62  ? A GLU 85   ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2069 ? 1_555 74.6  ? 
15 O   ? AA HOH .   ? A HOH 2068 ? 1_555 CA ? O CA . ? A CA 1255 ? 1_555 O   ? AA HOH .  ? A HOH 2069 ? 1_555 159.2 ? 
16 OE2 ? B  GLU 62  ? B GLU 85   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 OE1 ? B  GLU 52 ? B GLU 75   ? 1_555 106.4 ? 
17 OE2 ? B  GLU 62  ? B GLU 85   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2059 ? 1_555 96.5  ? 
18 OE1 ? B  GLU 52  ? B GLU 75   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2059 ? 1_555 78.2  ? 
19 OE2 ? B  GLU 62  ? B GLU 85   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  ASN 54 ? B ASN 77   ? 1_555 152.7 ? 
20 OE1 ? B  GLU 52  ? B GLU 75   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  ASN 54 ? B ASN 77   ? 1_555 88.6  ? 
21 O   ? BA HOH .   ? B HOH 2059 ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  ASN 54 ? B ASN 77   ? 1_555 109.1 ? 
22 OE2 ? B  GLU 62  ? B GLU 85   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  VAL 57 ? B VAL 80   ? 1_555 89.9  ? 
23 OE1 ? B  GLU 52  ? B GLU 75   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  VAL 57 ? B VAL 80   ? 1_555 162.8 ? 
24 O   ? BA HOH .   ? B HOH 2059 ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  VAL 57 ? B VAL 80   ? 1_555 94.8  ? 
25 O   ? B  ASN 54  ? B ASN 77   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? B  VAL 57 ? B VAL 80   ? 1_555 78.7  ? 
26 OE2 ? B  GLU 62  ? B GLU 85   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2060 ? 1_555 74.9  ? 
27 OE1 ? B  GLU 52  ? B GLU 75   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2060 ? 1_555 86.4  ? 
28 O   ? BA HOH .   ? B HOH 2059 ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2060 ? 1_555 159.6 ? 
29 O   ? B  ASN 54  ? B ASN 77   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2060 ? 1_555 83.6  ? 
30 O   ? B  VAL 57  ? B VAL 80   ? 1_555 CA ? U CA . ? B CA 1252 ? 1_555 O   ? BA HOH .  ? B HOH 2060 ? 1_555 103.6 ? 
31 OG  ? B  SER 147 ? B SER 170  ? 1_555 CA ? V CA . ? B CA 1253 ? 1_555 O   ? BA HOH .  ? B HOH 2187 ? 1_555 122.5 ? 
32 OG  ? B  SER 147 ? B SER 170  ? 1_555 CA ? V CA . ? B CA 1253 ? 1_555 O   ? BA HOH .  ? B HOH 2141 ? 1_555 121.5 ? 
33 O   ? BA HOH .   ? B HOH 2187 ? 1_555 CA ? V CA . ? B CA 1253 ? 1_555 O   ? BA HOH .  ? B HOH 2141 ? 1_555 112.4 ? 
34 OE1 ? C  GLU 52  ? C GLU 75   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? C  ASN 54 ? C ASN 77   ? 1_555 90.9  ? 
35 OE1 ? C  GLU 52  ? C GLU 75   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? CA HOH .  ? C HOH 2051 ? 1_555 87.2  ? 
36 O   ? C  ASN 54  ? C ASN 77   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? CA HOH .  ? C HOH 2051 ? 1_555 85.7  ? 
37 OE1 ? C  GLU 52  ? C GLU 75   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 OE2 ? C  GLU 62 ? C GLU 85   ? 1_555 105.3 ? 
38 O   ? C  ASN 54  ? C ASN 77   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 OE2 ? C  GLU 62 ? C GLU 85   ? 1_555 155.4 ? 
39 O   ? CA HOH .   ? C HOH 2051 ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 OE2 ? C  GLU 62 ? C GLU 85   ? 1_555 77.0  ? 
40 OE1 ? C  GLU 52  ? C GLU 75   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? C  VAL 57 ? C VAL 80   ? 1_555 165.1 ? 
41 O   ? C  ASN 54  ? C ASN 77   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? C  VAL 57 ? C VAL 80   ? 1_555 79.3  ? 
42 O   ? CA HOH .   ? C HOH 2051 ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? C  VAL 57 ? C VAL 80   ? 1_555 103.0 ? 
43 OE2 ? C  GLU 62  ? C GLU 85   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? C  VAL 57 ? C VAL 80   ? 1_555 87.7  ? 
44 OE1 ? C  GLU 52  ? C GLU 75   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? AA HOH .  ? A HOH 2172 ? 1_555 77.2  ? 
45 O   ? C  ASN 54  ? C ASN 77   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? AA HOH .  ? A HOH 2172 ? 1_555 108.0 ? 
46 O   ? CA HOH .   ? C HOH 2051 ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? AA HOH .  ? A HOH 2172 ? 1_555 159.2 ? 
47 OE2 ? C  GLU 62  ? C GLU 85   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? AA HOH .  ? A HOH 2172 ? 1_555 93.8  ? 
48 O   ? C  VAL 57  ? C VAL 80   ? 1_555 CA ? Z CA . ? C CA 1249 ? 1_555 O   ? AA HOH .  ? A HOH 2172 ? 1_555 95.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-01-09 
2 'Structure model' 1 1 2013-01-16 
3 'Structure model' 1 2 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 3 'Structure model' 'Experimental preparation' 
4 3 'Structure model' Other                      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow   
2 3 'Structure model' pdbx_database_proc   
3 3 'Structure model' pdbx_database_status 
4 3 'Structure model' struct_biol          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                  
2 3 'Structure model' '_exptl_crystal_grow.temp'                    
3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 ? ? ? ? 
XDS    'data reduction' .                 ? 2 ? ? ? ? 
XSCALE 'data scaling'   .                 ? 3 ? ? ? ? 
PHASER phasing          .                 ? 4 ? ? ? ? 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
DETERMINATION METHOD: DSSP
THE SHEETS PRESENTED AS "AB" IN EACH CHAIN ON SHEET RECORDS
BELOW IS ACTUALLY AN  6-STRANDED BARREL THIS IS REPRESENTED BY
A  7-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.

THE SHEETS PRESENTED AS "BB" IN EACH CHAIN ON SHEET RECORDS
BELOW IS ACTUALLY AN  6-STRANDED BARREL THIS IS REPRESENTED BY
A  7-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.

THE SHEETS PRESENTED AS "CB" IN EACH CHAIN ON SHEET RECORDS
BELOW IS ACTUALLY AN  6-STRANDED BARREL THIS IS REPRESENTED BY
A  7-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O2 A GOL 1247 ? A O A HOH 2063 ? ? 2.14 
2 1 O  A HOH 2176 ? ? O A HOH 2200 ? ? 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 76  ? ? -118.40 -75.33  
2  1 ASN A 120 ? ? -160.22 -169.50 
3  1 ASP A 156 ? ? -137.52 -61.15  
4  1 SER A 215 ? ? -127.33 -72.66  
5  1 ASP B 76  ? ? -115.35 -80.59  
6  1 SER B 215 ? ? -130.91 -71.21  
7  1 ASP C 76  ? ? -124.01 -77.23  
8  1 SER C 215 ? ? -125.30 -71.82  
9  1 ILE D 30  ? ? -125.67 -56.91  
10 1 ARG D 32  ? ? -91.82  48.37   
11 1 ILE E 30  ? ? -122.29 -58.80  
12 1 ARG E 32  ? ? -88.74  45.41   
13 1 ILE F 30  ? ? -120.58 -59.53  
14 1 ARG F 32  ? ? -91.88  46.28   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2186 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.68 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D GLU 1 ? D GLU 1 
2 1 Y 1 D ASP 2 ? D ASP 2 
3 1 Y 1 D LYS 3 ? D LYS 3 
4 1 Y 1 E GLU 1 ? E GLU 1 
5 1 Y 1 E ASP 2 ? E ASP 2 
6 1 Y 1 E LYS 3 ? E LYS 3 
7 1 Y 1 F GLU 1 ? F GLU 1 
8 1 Y 1 F ASP 2 ? F ASP 2 
9 1 Y 1 F LYS 3 ? F LYS 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL                               GOL 
4 'CHLORIDE ION'                         CL  
5 IMIDAZOLE                              IMD 
6 'CALCIUM ION'                          CA  
7 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 
8 water                                  HOH 
#