data_4AR3
# 
_entry.id   4AR3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4AR3         
PDBE  EBI-52056    
WWPDB D_1290052056 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1BQ8 unspecified 'RUBREDOXIN (METHIONINE MUTANT) FROM PYROCOCCUS FURIOSUS' 
PDB 1BQ9 unspecified 'RUBREDOXIN (FORMYL METHIONINE MUTANT) FROM PYROCOCCUS FURIOSUS' 
PDB 1BRF unspecified 'RUBREDOXIN (WILD TYPE) FROM PYROCOCCUS FURIOSUS' 
PDB 1CAA unspecified 'RUBREDOXIN (OXIDIZED)' 
PDB 1CAD unspecified 'RUBREDOXIN (REDUCED)' 
PDB 1IU5 unspecified 'X-RAY CRYSTAL STRUCTURE OF THE RUBREDOXIN MUTANT FROMPYROCOCCUS FURIOSUS' 
PDB 1IU6 unspecified 'NEUTRON CRYSTAL STRUCTURE OF THE RUBREDOXIN MUTANT FROMPYROCOCCUS FURIOSUS' 
PDB 1QCV unspecified 'RUBREDOXIN VARIANT (PFRD-XC4) FOLDS WITHOUT IRON' 
PDB 1RWD unspecified 'BACKBONE NMR STRUCTURE OF A MUTANT P. FURIOSUS RUBREDOXINUSING RESIDUAL DIPOLAR COUPLINGS' 
PDB 1VCX unspecified 'NEUTRON CRYSTAL STRUCTURE OF THE WILD TYPE RUBREDOXIN FROMPYROCOCCUS FURIOSUS AT 1.5A RESOLUTION' 
PDB 1ZRP unspecified 'RUBREDOXIN (ZN-SUBSTITUTED) (NMR, 40 STRUCTURES)' 
PDB 4AR6 unspecified 
;X-RAY CRYSTALLOGRAPHIC STRUCTURE OF THE REDUCED FORM PERDEUTERATED PYROCOCCUS FURIOSUS RUBREDOXIN AT 295 K ( IN QUARTZ CAPILLARY) TO 0.92 ANGSTROMS RESOLUTION.
;
PDB 4AR4 unspecified 
'NEUTRON CRYSTALLOGRAPHIC STRUCTURE OF THE REDUCED FORM PERDEUTERATED PYROCOCCUS FURIOSUS RUBREDOXIN TO 1.38 ANGSTROMS RESOLUTION.' 
PDB 4AR5 unspecified 
;X-RAY CRYSTALLOGRAPHIC STRUCTURE OF THE OXIDISED FORM PERDEUTERATED PYROCOCCUS FURIOSUS RUBREDOXIN IN D2O AT 295K (IN QUARTZ CAPILLARY) TO 1.00 ANGSTROM RESOLUTION.
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4AR3 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-20 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cuypers, M.G.'  1 
'Mason, S.A.'    2 
'Blakeley, M.P.' 3 
'Mitchell, E.P.' 4 
'Haertlein, M.'  5 
'Forsyth, V.T.'  6 
# 
_citation.id                        primary 
_citation.title                     
;Near-Atomic Resolution Neutron Crystallography on Perdeuterated Pyrococcus Furiosus Rubredoxin: Implication of Hydronium Ions and Protonation State Equilibria in Redox Changes.
;
_citation.journal_abbrev            Angew.Chem.Int.Ed.Engl. 
_citation.journal_volume            52 
_citation.page_first                1022 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   GE 
_citation.journal_id_ISSN           1433-7851 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23225503 
_citation.pdbx_database_id_DOI      10.1002/ANIE.201207071 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Cuypers, M.G.'  1 ? 
primary 'Mason, S.A.'    2 ? 
primary 'Blakeley, M.P.' 3 ? 
primary 'Mitchell, E.P.' 4 ? 
primary 'Haertlein, M.'  5 ? 
primary 'Forsyth, V.T.'  6 ? 
# 
_cell.entry_id           4AR3 
_cell.length_a           34.360 
_cell.length_b           35.316 
_cell.length_c           43.993 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4AR3 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man RUBREDOXIN           6031.728 1   ? ? ? 'OXIDISED, FE (III) STATE, HYDRONIUM IONS, CARBOXYLIC DEUTERONS' 
2 non-polymer syn 'FE (III) ION'       55.845   1   ? ? ? ?                                                                
3 non-polymer syn 'deuterium(1+)'      2.014    4   ? ? ? ?                                                                
4 non-polymer syn trideuteriooxidanium 22.042   4   ? ? ? ?                                                                
5 water       nat water                18.015   149 ? ? ? ?                                                                
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        RD 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_seq_one_letter_code_can   MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  LYS n 
1 4  TRP n 
1 5  VAL n 
1 6  CYS n 
1 7  LYS n 
1 8  ILE n 
1 9  CYS n 
1 10 GLY n 
1 11 TYR n 
1 12 ILE n 
1 13 TYR n 
1 14 ASP n 
1 15 GLU n 
1 16 ASP n 
1 17 ALA n 
1 18 GLY n 
1 19 ASP n 
1 20 PRO n 
1 21 ASP n 
1 22 ASN n 
1 23 GLY n 
1 24 ILE n 
1 25 SER n 
1 26 PRO n 
1 27 GLY n 
1 28 THR n 
1 29 LYS n 
1 30 PHE n 
1 31 GLU n 
1 32 GLU n 
1 33 LEU n 
1 34 PRO n 
1 35 ASP n 
1 36 ASP n 
1 37 TRP n 
1 38 VAL n 
1 39 CYS n 
1 40 PRO n 
1 41 ILE n 
1 42 CYS n 
1 43 GLY n 
1 44 ALA n 
1 45 PRO n 
1 46 LYS n 
1 47 SER n 
1 48 GLU n 
1 49 PHE n 
1 50 GLU n 
1 51 LYS n 
1 52 LEU n 
1 53 GLU n 
1 54 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'PYROCOCCUS FURIOSUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET28A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUBR_PYRFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P24297 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4AR3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 54 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24297 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  54 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       0 
_struct_ref_seq.pdbx_auth_seq_align_end       53 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ?                       'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE           ?                       'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ?                       'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ?                       'C3 H7 N O2 S'   121.158 
D3O non-polymer         . trideuteriooxidanium 'perdeuterated oxonium' 'O 1'            22.042  
D8U non-polymer         . 'deuterium(1+)'      ?                       'D 1'            2.014   
DOD non-polymer         . 'DEUTERATED WATER'   ?                       'D2 O'           20.028  
FE  non-polymer         . 'FE (III) ION'       ?                       'Fe 3'           55.845  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ?                       'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ?                       'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE           ?                       'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ?                       'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ?                       'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ?                       'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ?                       'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ?                       'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ?                       'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ?                       'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ?                       'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ?                       'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ?                       'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4AR3 
_exptl.method            'NEUTRON DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.46 
_exptl_crystal.density_percent_sol   15.08 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               '5ATM 3HE, CURVED 120X30 DEGREES' 
_diffrn_detector.type                   'INSTITUT LAUE LANGEVIN DETECTOR GROUP' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                'BORON CARBIDE BEAM DEFINING APERTURES' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    'PYROLYTIC GRAPHITE (002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             neutron 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.46 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'NUCLEAR REACTOR' 
_diffrn_source.type                        'ILL BEAMLINE D19' 
_diffrn_source.pdbx_synchrotron_site       ILL 
_diffrn_source.pdbx_synchrotron_beamline   D19 
_diffrn_source.pdbx_wavelength             1.46 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4AR3 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             18.67 
_reflns.d_resolution_high            1.27 
_reflns.number_obs                   10521 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.1 
_reflns.B_iso_Wilson_estimate        8.36 
_reflns.pdbx_redundancy              3.1 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              0.095 
# 
_refine.pdbx_refine_id                           'NEUTRON DIFFRACTION' 
_refine.entry_id                                 4AR3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22729 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.705 
_refine.ls_d_res_high                            1.05 
_refine.ls_percent_reflns_obs                    88.73 
_refine.ls_R_factor_obs                          0.2010 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1990 
_refine.ls_R_factor_R_free                       0.2374 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1159 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.4276 
_refine.aniso_B[2][2]                            0.1858 
_refine.aniso_B[3][3]                            0.2418 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.600 
_refine.solvent_model_param_bsol                 80.058 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.60 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.20 
_refine.pdbx_overall_phase_error                 26.39 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'NEUTRON DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        421 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             149 
_refine_hist.number_atoms_total               575 
_refine_hist.d_res_high                       1.05 
_refine_hist.d_res_low                        15.705 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.023  ? ? 1022 'NEUTRON DIFFRACTION' ? 
f_angle_d          1.976  ? ? 1702 'NEUTRON DIFFRACTION' ? 
f_dihedral_angle_d 13.321 ? ? 245  'NEUTRON DIFFRACTION' ? 
f_chiral_restr     0.122  ? ? 63   'NEUTRON DIFFRACTION' ? 
f_plane_restr      0.011  ? ? 143  'NEUTRON DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'NEUTRON DIFFRACTION' . 1.0501 1.0978  2331 0.3924 79.00 0.3989 . . 136 . . . . 
'NEUTRON DIFFRACTION' . 1.0978 1.1557  2551 0.3437 85.00 0.3784 . . 135 . . . . 
'NEUTRON DIFFRACTION' . 1.1557 1.2281  2603 0.3133 87.00 0.3441 . . 146 . . . . 
'NEUTRON DIFFRACTION' . 1.2281 1.3229  2619 0.2715 87.00 0.3159 . . 135 . . . . 
'NEUTRON DIFFRACTION' . 1.3229 1.4559  2677 0.2279 89.00 0.2595 . . 155 . . . . 
'NEUTRON DIFFRACTION' . 1.4559 1.6664  2735 0.1855 91.00 0.2327 . . 153 . . . . 
'NEUTRON DIFFRACTION' . 1.6664 2.0987  2897 0.1377 94.00 0.1970 . . 154 . . . . 
'NEUTRON DIFFRACTION' . 2.0987 15.7072 3157 0.1577 98.00 0.1785 . . 145 . . . . 
# 
_struct.entry_id                  4AR3 
_struct.title                     
'Near-atomic resolution neutron crystallography on the oxidised form perdeuterated Pyrococcus furiosus rubredoxin.' 
_struct.pdbx_descriptor           RUBREDOXIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4AR3 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'ELECTRON TRANSPORT, PERDEUTERATED, MONOCHROMATIC NEUTRON CRYSTALLOGRAPHY' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 20 ? GLY A 23 ? PRO A 19 GLY A 22 5 ? 4 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 33 ? LYS A 28 LEU A 32 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 6  SG ? ? A FE 1054 A CYS 5  1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 9  SG ? ? A FE 1054 A CYS 8  1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 39 SG ? ? A FE 1054 A CYS 38 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc4 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 42 SG ? ? A FE 1054 A CYS 41 1_555 ? ? ? ? ? ? ? 2.152 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 12 ? ASP A 14 ? ILE A 11 ASP A 13 
AA 2 LYS A 3  ? CYS A 6  ? LYS A 2  CYS A 5  
AA 3 PHE A 49 ? LYS A 51 ? PHE A 48 LYS A 50 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 13 ? N TYR A 12 O TRP A 4  ? O TRP A 3  
AA 2 3 N VAL A 5  ? N VAL A 4  O GLU A 50 ? O GLU A 49 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FE A 1054'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE D3O A 1059' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE D3O A 1060' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE D3O A 1061' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE D3O A 1062' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 6  ? CYS A 5    . ? 1_555 ? 
2  AC1 4 CYS A 9  ? CYS A 8    . ? 1_555 ? 
3  AC1 4 CYS A 39 ? CYS A 38   . ? 1_555 ? 
4  AC1 4 CYS A 42 ? CYS A 41   . ? 1_555 ? 
5  AC2 4 ALA A 2  ? ALA A 1    . ? 1_555 ? 
6  AC2 4 LYS A 3  ? LYS A 2    . ? 1_555 ? 
7  AC2 4 LEU A 52 ? LEU A 51   . ? 1_555 ? 
8  AC2 4 DOD K .  ? DOD A 2102 . ? 1_555 ? 
9  AC3 2 SER A 25 ? SER A 24   . ? 1_555 ? 
10 AC3 2 PRO A 26 ? PRO A 25   . ? 1_555 ? 
11 AC4 2 DOD K .  ? DOD A 2005 . ? 1_555 ? 
12 AC4 2 DOD K .  ? DOD A 2024 . ? 1_555 ? 
13 AC5 3 ALA A 17 ? ALA A 16   . ? 1_555 ? 
14 AC5 3 PRO A 20 ? PRO A 19   . ? 1_555 ? 
15 AC5 3 DOD K .  ? DOD A 2052 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4AR3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4AR3 
_atom_sites.fract_transf_matrix[1][1]   0.029104 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022731 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
D  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . MET A 1 1  ? 24.432 31.161 5.607   1.00   21.93 ? 0    MET A N    1 
ATOM   2    C  CA   . MET A 1 1  ? 23.129 30.956 4.875   1.00   18.94 ? 0    MET A CA   1 
ATOM   3    C  C    . MET A 1 1  ? 22.864 32.235 4.065   1.00   15.92 ? 0    MET A C    1 
ATOM   4    O  O    . MET A 1 1  ? 23.693 33.143 4.025   1.00   22.69 ? 0    MET A O    1 
ATOM   5    C  CB   . MET A 1 1  ? 22.013 30.604 5.877   1.00   19.06 ? 0    MET A CB   1 
ATOM   6    C  CG   . MET A 1 1  ? 22.323 29.327 6.655   1.00   26.90 ? 0    MET A CG   1 
ATOM   7    S  SD   . MET A 1 1  ? 20.948 28.705 7.661   1.00   21.44 ? 0    MET A SD   1 
ATOM   8    C  CE   . MET A 1 1  ? 19.690 28.296 6.445   1.00   28.81 ? 0    MET A CE   1 
ATOM   9    D  D1   . MET A 1 1  ? 25.112 31.515 5.018   1.00   36.52 ? 0    MET A D1   1 
ATOM   10   D  D2   . MET A 1 1  ? 24.307 31.772 6.359   1.00   25.03 ? 0    MET A D2   1 
ATOM   11   D  D3   . MET A 1 1  ? 24.720 30.305 5.942   1.00   39.03 ? 0    MET A D3   1 
ATOM   12   D  DA   . MET A 1 1  ? 23.188 30.196 4.194   1.00   20.58 ? 0    MET A DA   1 
ATOM   13   D  DB2  . MET A 1 1  ? 21.892 31.322 6.567   1.00   20.62 ? 0    MET A DB2  1 
ATOM   14   D  DB3  . MET A 1 1  ? 21.188 30.471 5.362   1.00   18.91 ? 0    MET A DB3  1 
ATOM   15   D  DG2  . MET A 1 1  ? 22.599 28.654 6.018   1.00   20.46 ? 0    MET A DG2  1 
ATOM   16   D  DG3  . MET A 1 1  ? 23.050 29.517 7.283   1.00   23.02 ? 0    MET A DG3  1 
ATOM   17   D  DE1  . MET A 1 1  ? 19.557 29.055 5.873   1.00   29.10 ? 0    MET A DE1  1 
ATOM   18   D  DE2  . MET A 1 1  ? 19.960 27.532 5.917   1.00   28.79 ? 0    MET A DE2  1 
ATOM   19   D  DE3  . MET A 1 1  ? 18.866 28.084 6.914   1.00   25.72 ? 0    MET A DE3  1 
ATOM   20   N  N    . ALA A 1 2  ? 21.710 32.302 3.423   1.00   15.50 ? 1    ALA A N    1 
ATOM   21   C  CA   . ALA A 1 2  ? 21.470 33.370 2.449   1.00   13.45 ? 1    ALA A CA   1 
ATOM   22   C  C    . ALA A 1 2  ? 20.864 34.611 3.080   1.00   11.56 ? 1    ALA A C    1 
ATOM   23   O  O    . ALA A 1 2  ? 20.353 34.577 4.202   1.00   11.50 ? 1    ALA A O    1 
ATOM   24   C  CB   . ALA A 1 2  ? 20.562 32.849 1.322   1.00   23.26 ? 1    ALA A CB   1 
ATOM   25   D  D    . ALA A 1 2  ? 21.025 31.749 3.563   1.00   15.33 ? 1    ALA A D    1 
ATOM   26   D  DA   . ALA A 1 2  ? 22.342 33.692 2.040   1.00   18.39 ? 1    ALA A DA   1 
ATOM   27   D  DB1  . ALA A 1 2  ? 19.709 32.583 1.691   1.00   20.07 ? 1    ALA A DB1  1 
ATOM   28   D  DB2  . ALA A 1 2  ? 20.449 33.549 0.655   1.00   20.85 ? 1    ALA A DB2  1 
ATOM   29   D  DB3  . ALA A 1 2  ? 20.962 32.080 0.918   1.00   28.59 ? 1    ALA A DB3  1 
ATOM   30   N  N    . LYS A 1 3  ? 20.996 35.694 2.350   1.00   12.65 ? 2    LYS A N    1 
ATOM   31   C  CA   . LYS A 1 3  ? 20.392 36.935 2.699   1.00   10.76 ? 2    LYS A CA   1 
ATOM   32   C  C    . LYS A 1 3  ? 19.461 37.363 1.558   1.00   9.72  ? 2    LYS A C    1 
ATOM   33   O  O    . LYS A 1 3  ? 19.790 37.186 0.391   1.00   11.46 ? 2    LYS A O    1 
ATOM   34   C  CB   . LYS A 1 3  ? 21.477 37.979 2.961   1.00   15.11 ? 2    LYS A CB   1 
ATOM   35   C  CG   . LYS A 1 3  ? 22.316 37.648 4.233   1.00   18.63 ? 2    LYS A CG   1 
ATOM   36   C  CD   . LYS A 1 3  ? 23.359 38.688 4.415   1.00   36.82 ? 2    LYS A CD   1 
ATOM   37   C  CE   . LYS A 1 3  ? 24.181 38.510 5.730   1.00   45.48 ? 2    LYS A CE   1 
ATOM   38   N  NZ   . LYS A 1 3  ? 24.702 37.110 5.754   1.00   53.11 ? 2    LYS A NZ   1 
ATOM   39   D  D    . LYS A 1 3  ? 21.413 35.678 1.570   1.00   17.16 ? 2    LYS A D    1 
ATOM   40   D  DA   . LYS A 1 3  ? 19.868 36.805 3.568   1.00   11.83 ? 2    LYS A DA   1 
ATOM   41   D  DB2  . LYS A 1 3  ? 22.098 37.983 2.165   1.00   15.57 ? 2    LYS A DB2  1 
ATOM   42   D  DB3  . LYS A 1 3  ? 21.071 38.865 3.091   1.00   16.68 ? 2    LYS A DB3  1 
ATOM   43   D  DG2  . LYS A 1 3  ? 21.769 37.658 5.013   1.00   19.11 ? 2    LYS A DG2  1 
ATOM   44   D  DG3  . LYS A 1 3  ? 22.740 36.764 4.137   1.00   25.96 ? 2    LYS A DG3  1 
ATOM   45   D  DD2  . LYS A 1 3  ? 23.934 38.614 3.628   1.00   30.10 ? 2    LYS A DD2  1 
ATOM   46   D  DD3  . LYS A 1 3  ? 22.911 39.538 4.449   1.00   24.48 ? 2    LYS A DD3  1 
ATOM   47   D  DE2  . LYS A 1 3  ? 24.934 39.141 5.768   1.00   41.49 ? 2    LYS A DE2  1 
ATOM   48   D  DE3  . LYS A 1 3  ? 23.612 38.648 6.512   1.00   27.64 ? 2    LYS A DE3  1 
ATOM   49   D  DZ1  . LYS A 1 3  ? 24.990 36.876 4.938   1.00   36.38 ? 2    LYS A DZ1  1 
ATOM   50   D  DZ2  . LYS A 1 3  ? 25.374 37.040 6.333   1.00   73.37 ? 2    LYS A DZ2  1 
ATOM   51   D  DZ3  . LYS A 1 3  ? 24.051 36.554 6.004   1.00   46.62 ? 2    LYS A DZ3  1 
ATOM   52   N  N    . TRP A 1 4  ? 18.337 37.967 1.923   1.00   9.00  ? 3    TRP A N    1 
ATOM   53   C  CA   . TRP A 1 4  ? 17.299 38.421 1.021   1.00   8.95  ? 3    TRP A CA   1 
ATOM   54   C  C    . TRP A 1 4  ? 16.942 39.848 1.379   1.00   9.41  ? 3    TRP A C    1 
ATOM   55   O  O    . TRP A 1 4  ? 16.758 40.177 2.565   1.00   15.72 ? 3    TRP A O    1 
ATOM   56   C  CB   . TRP A 1 4  ? 16.050 37.547 1.191   1.00   11.15 ? 3    TRP A CB   1 
ATOM   57   C  CG   . TRP A 1 4  ? 16.222 36.106 0.841   1.00   10.53 ? 3    TRP A CG   1 
ATOM   58   C  CD1  . TRP A 1 4  ? 16.948 35.154 1.514   1.00   12.09 ? 3    TRP A CD1  1 
ATOM   59   C  CD2  . TRP A 1 4  ? 15.608 35.449 -0.255  1.00   10.01 ? 3    TRP A CD2  1 
ATOM   60   N  NE1  . TRP A 1 4  ? 16.853 33.954 0.876   1.00   14.67 ? 3    TRP A NE1  1 
ATOM   61   C  CE2  . TRP A 1 4  ? 16.018 34.081 -0.203  1.00   11.99 ? 3    TRP A CE2  1 
ATOM   62   C  CE3  . TRP A 1 4  ? 14.729 35.881 -1.277  1.00   13.05 ? 3    TRP A CE3  1 
ATOM   63   C  CZ2  . TRP A 1 4  ? 15.564 33.138 -1.138  1.00   16.40 ? 3    TRP A CZ2  1 
ATOM   64   C  CZ3  . TRP A 1 4  ? 14.275 34.935 -2.209  1.00   15.80 ? 3    TRP A CZ3  1 
ATOM   65   C  CH2  . TRP A 1 4  ? 14.717 33.572 -2.127  1.00   15.29 ? 3    TRP A CH2  1 
ATOM   66   D  D    . TRP A 1 4  ? 18.156 38.129 2.751   1.00   27.05 ? 3    TRP A D    1 
ATOM   67   D  DA   . TRP A 1 4  ? 17.676 38.340 0.051   1.00   9.88  ? 3    TRP A DA   1 
ATOM   68   D  DB2  . TRP A 1 4  ? 15.757 37.602 2.164   1.00   12.19 ? 3    TRP A DB2  1 
ATOM   69   D  DB3  . TRP A 1 4  ? 15.305 37.920 0.586   1.00   11.24 ? 3    TRP A DB3  1 
ATOM   70   D  DD1  . TRP A 1 4  ? 17.488 35.273 2.291   1.00   15.68 ? 3    TRP A DD1  1 
ATOM   71   D  DE1  . TRP A 1 4  ? 17.231 33.207 1.197   1.00   16.31 ? 3    TRP A DE1  1 
ATOM   72   D  DE3  . TRP A 1 4  ? 14.439 36.794 -1.329  1.00   15.16 ? 3    TRP A DE3  1 
ATOM   73   D  DZ2  . TRP A 1 4  ? 15.854 32.238 -1.069  1.00   18.33 ? 3    TRP A DZ2  1 
ATOM   74   D  DZ3  . TRP A 1 4  ? 13.679 35.250 -2.897  1.00   16.37 ? 3    TRP A DZ3  1 
ATOM   75   D  DH2  . TRP A 1 4  ? 14.411 32.951 -2.783  1.00   21.68 ? 3    TRP A DH2  1 
ATOM   76   N  N    . VAL A 1 5  ? 16.807 40.710 0.400   1.00   8.49  ? 4    VAL A N    1 
ATOM   77   C  CA   . VAL A 1 5  ? 16.500 42.115 0.634   1.00   8.10  ? 4    VAL A CA   1 
ATOM   78   C  C    . VAL A 1 5  ? 15.034 42.369 0.295   1.00   7.04  ? 4    VAL A C    1 
ATOM   79   O  O    . VAL A 1 5  ? 14.474 41.902 -0.705  1.00   8.39  ? 4    VAL A O    1 
ATOM   80   C  CB   . VAL A 1 5  ? 17.437 43.065 -0.192  1.00   11.05 ? 4    VAL A CB   1 
ATOM   81   C  CG1  . VAL A 1 5  ? 17.162 42.955 -1.718  1.00   13.17 ? 4    VAL A CG1  1 
ATOM   82   C  CG2  . VAL A 1 5  ? 17.286 44.538 0.280   1.00   10.92 ? 4    VAL A CG2  1 
ATOM   83   D  D    . VAL A 1 5  ? 16.873 40.434 -0.447  1.00   15.94 ? 4    VAL A D    1 
ATOM   84   D  DA   . VAL A 1 5  ? 16.616 42.281 1.626   1.00   9.53  ? 4    VAL A DA   1 
ATOM   85   D  DB   . VAL A 1 5  ? 18.379 42.759 0.036   1.00   12.12 ? 4    VAL A DB   1 
ATOM   86   D  DG11 . VAL A 1 5  ? 16.249 43.271 -1.937  1.00   13.93 ? 4    VAL A DG11 1 
ATOM   87   D  DG12 . VAL A 1 5  ? 17.824 43.546 -2.183  1.00   16.64 ? 4    VAL A DG12 1 
ATOM   88   D  DG13 . VAL A 1 5  ? 17.263 42.004 -1.997  1.00   12.82 ? 4    VAL A DG13 1 
ATOM   89   D  DG21 . VAL A 1 5  ? 17.366 44.632 1.246   1.00   13.99 ? 4    VAL A DG21 1 
ATOM   90   D  DG22 . VAL A 1 5  ? 17.959 45.127 -0.191  1.00   14.52 ? 4    VAL A DG22 1 
ATOM   91   D  DG23 . VAL A 1 5  ? 16.357 44.861 0.057   1.00   11.50 ? 4    VAL A DG23 1 
ATOM   92   N  N    . CYS A 1 6  ? 14.409 43.168 1.124   1.00   7.14  ? 5    CYS A N    1 
ATOM   93   C  CA   . CYS A 1 6  ? 13.079 43.717 0.890   1.00   6.64  ? 5    CYS A CA   1 
ATOM   94   C  C    . CYS A 1 6  ? 13.257 44.859 -0.112  1.00   7.32  ? 5    CYS A C    1 
ATOM   95   O  O    . CYS A 1 6  ? 13.911 45.870 0.191   1.00   7.09  ? 5    CYS A O    1 
ATOM   96   C  CB   . CYS A 1 6  ? 12.469 44.244 2.176   1.00   8.26  ? 5    CYS A CB   1 
ATOM   97   S  SG   . CYS A 1 6  ? 10.835 44.945 1.882   1.00   7.47  ? 5    CYS A SG   1 
ATOM   98   D  D    . CYS A 1 6  ? 14.780 43.436 1.885   1.00   14.10 ? 5    CYS A D    1 
ATOM   99   D  DA   . CYS A 1 6  ? 12.437 42.966 0.471   1.00   7.61  ? 5    CYS A DA   1 
ATOM   100  D  DB2  . CYS A 1 6  ? 12.384 43.512 2.854   1.00   9.38  ? 5    CYS A DB2  1 
ATOM   101  D  DB3  . CYS A 1 6  ? 13.049 44.965 2.552   1.00   10.08 ? 5    CYS A DB3  1 
ATOM   102  N  N    . LYS A 1 7  ? 12.721 44.678 -1.299  1.00   8.56  ? 6    LYS A N    1 
ATOM   103  C  CA   . LYS A 1 7  ? 12.890 45.700 -2.356  1.00   9.32  ? 6    LYS A CA   1 
ATOM   104  C  C    . LYS A 1 7  ? 12.209 47.037 -2.040  1.00   10.79 ? 6    LYS A C    1 
ATOM   105  O  O    . LYS A 1 7  ? 12.514 48.055 -2.640  1.00   16.87 ? 6    LYS A O    1 
ATOM   106  C  CB   . LYS A 1 7  ? 12.461 45.178 -3.725  1.00   15.30 ? 6    LYS A CB   1 
ATOM   107  C  CG   . LYS A 1 7  ? 13.453 44.130 -4.258  1.00   18.58 ? 6    LYS A CG   1 
ATOM   108  C  CD   . LYS A 1 7  ? 13.195 43.681 -5.714  1.00   43.00 ? 6    LYS A CD   1 
ATOM   109  C  CE   . LYS A 1 7  ? 11.855 42.933 -5.846  1.00   51.18 ? 6    LYS A CE   1 
ATOM   110  N  NZ   . LYS A 1 7  ? 11.633 42.350 -7.229  1.00   68.34 ? 6    LYS A NZ   1 
ATOM   111  D  D    . LYS A 1 7  ? 12.232 43.897 -1.497  1.00   9.53  ? 6    LYS A D    1 
ATOM   112  D  DA   . LYS A 1 7  ? 13.880 45.915 -2.426  1.00   12.22 ? 6    LYS A DA   1 
ATOM   113  D  DB2  . LYS A 1 7  ? 11.557 44.751 -3.662  1.00   14.49 ? 6    LYS A DB2  1 
ATOM   114  D  DB3  . LYS A 1 7  ? 12.401 45.968 -4.319  1.00   18.88 ? 6    LYS A DB3  1 
ATOM   115  D  DG2  . LYS A 1 7  ? 14.376 44.469 -4.214  1.00   24.99 ? 6    LYS A DG2  1 
ATOM   116  D  DG3  . LYS A 1 7  ? 13.357 43.329 -3.677  1.00   23.89 ? 6    LYS A DG3  1 
ATOM   117  D  DD2  . LYS A 1 7  ? 13.193 44.455 -6.310  1.00   46.77 ? 6    LYS A DD2  1 
ATOM   118  D  DD3  . LYS A 1 7  ? 13.913 43.076 -5.982  1.00   51.21 ? 6    LYS A DD3  1 
ATOM   119  D  DE2  . LYS A 1 7  ? 11.851 42.201 -5.205  1.00   45.80 ? 6    LYS A DE2  1 
ATOM   120  D  DE3  . LYS A 1 7  ? 11.115 43.539 -5.653  1.00   44.58 ? 6    LYS A DE3  1 
ATOM   121  D  DZ1  . LYS A 1 7  ? 11.785 42.970 -7.855  1.00   49.95 ? 6    LYS A DZ1  1 
ATOM   122  D  DZ2  . LYS A 1 7  ? 12.202 41.668 -7.368  1.00   44.47 ? 6    LYS A DZ2  1 
ATOM   123  D  DZ3  . LYS A 1 7  ? 10.782 42.060 -7.301  1.00   45.02 ? 6    LYS A DZ3  1 
ATOM   124  N  N    . ILE A 1 8  ? 11.262 47.024 -1.105  1.00   10.67 ? 7    ILE A N    1 
ATOM   125  C  CA   . ILE A 1 8  ? 10.531 48.246 -0.750  1.00   10.28 ? 7    ILE A CA   1 
ATOM   126  C  C    . ILE A 1 8  ? 11.323 49.094 0.229   1.00   9.20  ? 7    ILE A C    1 
ATOM   127  O  O    . ILE A 1 8  ? 11.499 50.275 0.001   1.00   15.28 ? 7    ILE A O    1 
ATOM   128  C  CB   . ILE A 1 8  ? 9.130  47.897 -0.142  1.00   12.55 ? 7    ILE A CB   1 
ATOM   129  C  CG1  . ILE A 1 8  ? 8.242  46.963 -1.008  1.00   23.49 ? 7    ILE A CG1  1 
ATOM   130  C  CG2  . ILE A 1 8  ? 8.411  49.195 0.337   1.00   21.62 ? 7    ILE A CG2  1 
ATOM   131  C  CD1  . ILE A 1 8  ? 7.793  47.583 -2.214  1.00   36.41 ? 7    ILE A CD1  1 
ATOM   132  D  D    A ILE A 1 8  ? 11.021 46.327 -0.663  0.0000 10.03 ? 7    ILE A D    1 
ATOM   133  D  D    B ILE A 1 8  ? 11.069 46.233 -0.649  1.00   9.72  ? 7    ILE A D    1 
ATOM   134  D  DA   . ILE A 1 8  ? 10.480 48.845 -1.593  1.00   12.15 ? 7    ILE A DA   1 
ATOM   135  D  DB   . ILE A 1 8  ? 9.308  47.385 0.688   1.00   13.09 ? 7    ILE A DB   1 
ATOM   136  D  DG12 . ILE A 1 8  ? 8.677  46.126 -1.243  1.00   17.51 ? 7    ILE A DG12 1 
ATOM   137  D  DG13 . ILE A 1 8  ? 7.412  46.741 -0.499  1.00   22.20 ? 7    ILE A DG13 1 
ATOM   138  D  DG21 . ILE A 1 8  ? 8.354  49.811 -0.380  1.00   16.00 ? 7    ILE A DG21 1 
ATOM   139  D  DG22 . ILE A 1 8  ? 7.523  48.972 0.618   1.00   19.24 ? 7    ILE A DG22 1 
ATOM   140  D  DG23 . ILE A 1 8  ? 8.916  49.555 1.092   1.00   17.91 ? 7    ILE A DG23 1 
ATOM   141  D  DD11 . ILE A 1 8  ? 8.551  47.854 -2.741  1.00   21.16 ? 7    ILE A DD11 1 
ATOM   142  D  DD12 . ILE A 1 8  ? 7.241  46.939 -2.663  1.00   23.68 ? 7    ILE A DD12 1 
ATOM   143  D  DD13 . ILE A 1 8  ? 7.277  48.348 -1.947  1.00   37.39 ? 7    ILE A DD13 1 
ATOM   144  N  N    . CYS A 1 9  ? 11.831 48.499 1.320   1.00   9.77  ? 8    CYS A N    1 
ATOM   145  C  CA   . CYS A 1 9  ? 12.415 49.314 2.402   1.00   10.38 ? 8    CYS A CA   1 
ATOM   146  C  C    . CYS A 1 9  ? 13.918 49.103 2.687   1.00   9.35  ? 8    CYS A C    1 
ATOM   147  O  O    . CYS A 1 9  ? 14.491 49.862 3.470   1.00   10.81 ? 8    CYS A O    1 
ATOM   148  C  CB   . CYS A 1 9  ? 11.619 49.113 3.688   1.00   11.09 ? 8    CYS A CB   1 
ATOM   149  S  SG   . CYS A 1 9  ? 11.908 47.539 4.586   1.00   7.99  ? 8    CYS A SG   1 
ATOM   150  D  D    . CYS A 1 9  ? 11.689 47.579 1.462   1.00   11.47 ? 8    CYS A D    1 
ATOM   151  D  DA   . CYS A 1 9  ? 12.292 50.299 2.153   1.00   12.77 ? 8    CYS A DA   1 
ATOM   152  D  DB2  . CYS A 1 9  ? 11.852 49.803 4.356   1.00   11.98 ? 8    CYS A DB2  1 
ATOM   153  D  DB3  . CYS A 1 9  ? 10.627 49.179 3.480   1.00   12.17 ? 8    CYS A DB3  1 
ATOM   154  N  N    . GLY A 1 10 ? 14.488 48.039 2.151   1.00   7.88  ? 9    GLY A N    1 
ATOM   155  C  CA   . GLY A 1 10 ? 15.912 47.768 2.355   1.00   10.53 ? 9    GLY A CA   1 
ATOM   156  C  C    . GLY A 1 10 ? 16.262 46.862 3.545   1.00   8.70  ? 9    GLY A C    1 
ATOM   157  O  O    . GLY A 1 10 ? 17.439 46.639 3.802   1.00   10.76 ? 9    GLY A O    1 
ATOM   158  D  D    . GLY A 1 10 ? 14.081 47.461 1.557   1.00   11.03 ? 9    GLY A D    1 
ATOM   159  D  DA2  . GLY A 1 10 ? 16.272 47.341 1.546   1.00   11.18 ? 9    GLY A DA2  1 
ATOM   160  D  DA3  . GLY A 1 10 ? 16.383 48.624 2.495   1.00   12.49 ? 9    GLY A DA3  1 
ATOM   161  N  N    . TYR A 1 11 ? 15.255 46.425 4.315   1.00   9.17  ? 10   TYR A N    1 
ATOM   162  C  CA   . TYR A 1 11 ? 15.477 45.399 5.346   1.00   7.80  ? 10   TYR A CA   1 
ATOM   163  C  C    . TYR A 1 11 ? 16.077 44.129 4.690   1.00   7.00  ? 10   TYR A C    1 
ATOM   164  O  O    . TYR A 1 11 ? 15.683 43.720 3.604   1.00   7.32  ? 10   TYR A O    1 
ATOM   165  C  CB   . TYR A 1 11 ? 14.120 45.030 5.955   1.00   8.15  ? 10   TYR A CB   1 
ATOM   166  C  CG   . TYR A 1 11 ? 14.192 43.837 6.897   1.00   7.75  ? 10   TYR A CG   1 
ATOM   167  C  CD1  . TYR A 1 11 ? 14.722 43.953 8.184   1.00   10.02 ? 10   TYR A CD1  1 
ATOM   168  C  CD2  . TYR A 1 11 ? 13.765 42.554 6.474   1.00   9.35  ? 10   TYR A CD2  1 
ATOM   169  C  CE1  . TYR A 1 11 ? 14.793 42.823 9.022   1.00   9.26  ? 10   TYR A CE1  1 
ATOM   170  C  CE2  . TYR A 1 11 ? 13.846 41.448 7.314   1.00   10.52 ? 10   TYR A CE2  1 
ATOM   171  C  CZ   . TYR A 1 11 ? 14.341 41.592 8.589   1.00   10.41 ? 10   TYR A CZ   1 
ATOM   172  O  OH   . TYR A 1 11 ? 14.390 40.429 9.370   1.00   15.95 ? 10   TYR A OH   1 
ATOM   173  D  D    . TYR A 1 11 ? 14.459 46.678 4.225   1.00   19.96 ? 10   TYR A D    1 
ATOM   174  D  DA   . TYR A 1 11 ? 16.124 45.756 6.073   1.00   8.60  ? 10   TYR A DA   1 
ATOM   175  D  DB2  . TYR A 1 11 ? 13.797 45.831 6.461   1.00   10.00 ? 10   TYR A DB2  1 
ATOM   176  D  DB3  . TYR A 1 11 ? 13.430 44.871 5.193   1.00   10.17 ? 10   TYR A DB3  1 
ATOM   177  D  DD1  . TYR A 1 11 ? 15.025 44.812 8.522   1.00   12.69 ? 10   TYR A DD1  1 
ATOM   178  D  DD2  . TYR A 1 11 ? 13.410 42.473 5.556   1.00   12.36 ? 10   TYR A DD2  1 
ATOM   179  D  DE1  . TYR A 1 11 ? 15.150 42.922 9.920   1.00   13.29 ? 10   TYR A DE1  1 
ATOM   180  D  DE2  . TYR A 1 11 ? 13.543 40.549 6.978   1.00   11.13 ? 10   TYR A DE2  1 
ATOM   181  D  DH   . TYR A 1 11 ? 14.482 40.607 10.183  1.00   14.01 ? 10   TYR A DH   1 
ATOM   182  N  N    A ILE A 1 12 ? 17.035 43.540 5.394   0.59   8.11  ? 11   ILE A N    1 
ATOM   183  N  N    B ILE A 1 12 ? 17.043 43.515 5.352   0.41   7.97  ? 11   ILE A N    1 
ATOM   184  C  CA   A ILE A 1 12 ? 17.703 42.316 4.985   0.59   6.77  ? 11   ILE A CA   1 
ATOM   185  C  CA   B ILE A 1 12 ? 17.561 42.261 4.864   0.41   7.44  ? 11   ILE A CA   1 
ATOM   186  C  C    A ILE A 1 12 ? 17.148 41.156 5.874   0.59   8.15  ? 11   ILE A C    1 
ATOM   187  C  C    B ILE A 1 12 ? 17.147 41.161 5.834   0.41   8.20  ? 11   ILE A C    1 
ATOM   188  O  O    A ILE A 1 12 ? 17.340 41.147 7.086   0.59   7.59  ? 11   ILE A O    1 
ATOM   189  O  O    B ILE A 1 12 ? 17.424 41.185 7.025   0.41   7.81  ? 11   ILE A O    1 
ATOM   190  C  CB   A ILE A 1 12 ? 19.255 42.467 5.185   0.59   12.30 ? 11   ILE A CB   1 
ATOM   191  C  CB   B ILE A 1 12 ? 19.097 42.303 4.698   0.41   11.67 ? 11   ILE A CB   1 
ATOM   192  C  CG1  A ILE A 1 12 ? 19.813 43.684 4.413   0.59   13.92 ? 11   ILE A CG1  1 
ATOM   193  C  CG1  B ILE A 1 12 ? 19.488 43.256 3.564   0.41   8.78  ? 11   ILE A CG1  1 
ATOM   194  C  CG2  A ILE A 1 12 ? 19.968 41.131 4.879   0.59   10.21 ? 11   ILE A CG2  1 
ATOM   195  C  CG2  B ILE A 1 12 ? 19.649 40.884 4.369   0.41   11.31 ? 11   ILE A CG2  1 
ATOM   196  C  CD1  A ILE A 1 12 ? 19.818 43.586 2.933   0.59   20.34 ? 11   ILE A CD1  1 
ATOM   197  C  CD1  B ILE A 1 12 ? 20.924 43.745 3.657   0.41   18.04 ? 11   ILE A CD1  1 
ATOM   198  D  D    A ILE A 1 12 ? 17.294 43.914 6.167   0.59   8.76  ? 11   ILE A D    1 
ATOM   199  D  D    B ILE A 1 12 ? 17.390 43.833 6.093   0.41   9.96  ? 11   ILE A D    1 
ATOM   200  D  DA   A ILE A 1 12 ? 17.559 42.113 4.009   0.59   10.36 ? 11   ILE A DA   1 
ATOM   201  D  DA   B ILE A 1 12 ? 17.155 42.061 3.957   0.41   6.40  ? 11   ILE A DA   1 
ATOM   202  D  DB   A ILE A 1 12 ? 19.471 42.655 6.116   0.59   11.04 ? 11   ILE A DB   1 
ATOM   203  D  DB   B ILE A 1 12 ? 19.530 42.634 5.503   0.41   10.78 ? 11   ILE A DB   1 
ATOM   204  D  DG12 A ILE A 1 12 ? 19.298 44.474 4.635   0.59   13.31 ? 11   ILE A DG12 1 
ATOM   205  D  DG12 B ILE A 1 12 ? 19.413 42.744 2.726   0.41   13.36 ? 11   ILE A DG12 1 
ATOM   206  D  DG13 A ILE A 1 12 ? 20.748 43.826 4.698   0.59   20.05 ? 11   ILE A DG13 1 
ATOM   207  D  DG13 B ILE A 1 12 ? 18.880 44.023 3.525   0.41   10.33 ? 11   ILE A DG13 1 
ATOM   208  D  DG21 A ILE A 1 12 ? 19.622 40.738 4.072   0.59   13.02 ? 11   ILE A DG21 1 
ATOM   209  D  DG21 B ILE A 1 12 ? 19.223 40.539 3.577   0.41   13.68 ? 11   ILE A DG21 1 
ATOM   210  D  DG22 A ILE A 1 12 ? 20.923 41.281 4.798   0.59   15.00 ? 11   ILE A DG22 1 
ATOM   211  D  DG22 B ILE A 1 12 ? 20.602 40.959 4.189   0.41   14.22 ? 11   ILE A DG22 1 
ATOM   212  D  DG23 A ILE A 1 12 ? 19.819 40.503 5.612   0.59   14.24 ? 11   ILE A DG23 1 
ATOM   213  D  DG23 B ILE A 1 12 ? 19.461 40.282 5.116   0.41   7.50  ? 11   ILE A DG23 1 
ATOM   214  D  DD11 A ILE A 1 12 ? 18.967 43.232 2.644   0.59   12.48 ? 11   ILE A DD11 1 
ATOM   215  D  DD11 B ILE A 1 12 ? 21.142 43.976 4.568   0.41   16.13 ? 11   ILE A DD11 1 
ATOM   216  D  DD12 A ILE A 1 12 ? 19.967 44.475 2.573   0.59   19.93 ? 11   ILE A DD12 1 
ATOM   217  D  DD12 B ILE A 1 12 ? 21.479 43.020 3.377   0.41   17.47 ? 11   ILE A DD12 1 
ATOM   218  D  DD13 A ILE A 1 12 ? 20.556 43.015 2.679   0.59   19.40 ? 11   ILE A DD13 1 
ATOM   219  D  DD13 B ILE A 1 12 ? 21.032 44.514 3.077   0.41   17.20 ? 11   ILE A DD13 1 
ATOM   220  N  N    . TYR A 1 13 ? 16.512 40.178 5.270   1.00   8.04  ? 12   TYR A N    1 
ATOM   221  C  CA   . TYR A 1 13 ? 16.227 38.959 5.980   1.00   7.83  ? 12   TYR A CA   1 
ATOM   222  C  C    . TYR A 1 13 ? 17.467 38.079 5.892   1.00   8.53  ? 12   TYR A C    1 
ATOM   223  O  O    . TYR A 1 13 ? 17.819 37.653 4.822   1.00   9.53  ? 12   TYR A O    1 
ATOM   224  C  CB   . TYR A 1 13 ? 15.012 38.206 5.344   1.00   9.16  ? 12   TYR A CB   1 
ATOM   225  C  CG   . TYR A 1 13 ? 14.809 36.889 6.102   1.00   8.28  ? 12   TYR A CG   1 
ATOM   226  C  CD1  . TYR A 1 13 ? 14.281 36.909 7.407   1.00   9.66  ? 12   TYR A CD1  1 
ATOM   227  C  CD2  . TYR A 1 13 ? 15.198 35.654 5.590   1.00   9.57  ? 12   TYR A CD2  1 
ATOM   228  C  CE1  . TYR A 1 13 ? 14.122 35.744 8.144   1.00   8.46  ? 12   TYR A CE1  1 
ATOM   229  C  CE2  . TYR A 1 13 ? 15.092 34.457 6.362   1.00   8.09  ? 12   TYR A CE2  1 
ATOM   230  C  CZ   . TYR A 1 13 ? 14.543 34.519 7.619   1.00   8.32  ? 12   TYR A CZ   1 
ATOM   231  O  OH   . TYR A 1 13 ? 14.425 33.380 8.374   1.00   10.28 ? 12   TYR A OH   1 
ATOM   232  D  D    . TYR A 1 13 ? 16.366 40.149 4.398   1.00   12.42 ? 12   TYR A D    1 
ATOM   233  D  DA   . TYR A 1 13 ? 16.003 39.166 6.970   1.00   9.11  ? 12   TYR A DA   1 
ATOM   234  D  DB2  . TYR A 1 13 ? 14.213 38.818 5.449   1.00   12.89 ? 12   TYR A DB2  1 
ATOM   235  D  DB3  . TYR A 1 13 ? 15.187 38.034 4.355   1.00   9.56  ? 12   TYR A DB3  1 
ATOM   236  D  DD1  . TYR A 1 13 ? 13.988 37.754 7.813   1.00   12.86 ? 12   TYR A DD1  1 
ATOM   237  D  DD2  . TYR A 1 13 ? 15.598 35.636 4.679   1.00   12.26 ? 12   TYR A DD2  1 
ATOM   238  D  DE1  . TYR A 1 13 ? 13.757 35.764 9.080   1.00   11.20 ? 12   TYR A DE1  1 
ATOM   239  D  DE2  . TYR A 1 13 ? 15.343 33.614 5.971   1.00   12.77 ? 12   TYR A DE2  1 
ATOM   240  D  DH   . TYR A 1 13 ? 14.789 32.708 7.965   1.00   10.82 ? 12   TYR A DH   1 
ATOM   241  N  N    . ASP A 1 14 ? 18.095 37.839 7.018   1.00   7.91  ? 13   ASP A N    1 
ATOM   242  C  CA   . ASP A 1 14 ? 19.287 37.044 7.109   1.00   7.40  ? 13   ASP A CA   1 
ATOM   243  C  C    . ASP A 1 14 ? 18.913 35.694 7.678   1.00   8.50  ? 13   ASP A C    1 
ATOM   244  O  O    . ASP A 1 14 ? 18.447 35.588 8.841   1.00   8.23  ? 13   ASP A O    1 
ATOM   245  C  CB   . ASP A 1 14 ? 20.257 37.750 8.067   1.00   11.53 ? 13   ASP A CB   1 
ATOM   246  C  CG   . ASP A 1 14 ? 21.583 37.034 8.208   1.00   14.84 ? 13   ASP A CG   1 
ATOM   247  O  OD1  . ASP A 1 14 ? 21.788 35.934 7.667   1.00   12.45 ? 13   ASP A OD1  1 
ATOM   248  O  OD2  . ASP A 1 14 ? 22.463 37.620 8.888   1.00   20.81 ? 13   ASP A OD2  1 
ATOM   249  D  D    . ASP A 1 14 ? 17.731 38.110 7.836   1.00   9.52  ? 13   ASP A D    1 
ATOM   250  D  DA   . ASP A 1 14 ? 19.672 36.898 6.145   1.00   9.00  ? 13   ASP A DA   1 
ATOM   251  D  DB2  . ASP A 1 14 ? 20.477 38.684 7.716   1.00   15.41 ? 13   ASP A DB2  1 
ATOM   252  D  DB3  . ASP A 1 14 ? 19.842 37.864 8.960   1.00   13.08 ? 13   ASP A DB3  1 
ATOM   253  N  N    . GLU A 1 15 ? 19.011 34.665 6.878   1.00   9.00  ? 14   GLU A N    1 
ATOM   254  C  CA   . GLU A 1 15 ? 18.633 33.302 7.306   1.00   10.84 ? 14   GLU A CA   1 
ATOM   255  C  C    . GLU A 1 15 ? 19.348 32.868 8.562   1.00   9.81  ? 14   GLU A C    1 
ATOM   256  O  O    . GLU A 1 15 ? 18.767 32.167 9.386   1.00   11.70 ? 14   GLU A O    1 
ATOM   257  C  CB   . GLU A 1 15 ? 18.864 32.283 6.164   1.00   12.44 ? 14   GLU A CB   1 
ATOM   258  C  CG   . GLU A 1 15 ? 17.901 32.478 5.003   1.00   10.93 ? 14   GLU A CG   1 
ATOM   259  C  CD   . GLU A 1 15 ? 18.160 31.581 3.842   1.00   11.98 ? 14   GLU A CD   1 
ATOM   260  O  OE1  . GLU A 1 15 ? 19.211 30.915 3.782   1.00   15.44 ? 14   GLU A OE1  1 
ATOM   261  O  OE2  . GLU A 1 15 ? 17.298 31.582 2.955   1.00   12.81 ? 14   GLU A OE2  1 
ATOM   262  D  D    . GLU A 1 15 ? 19.372 34.738 6.048   1.00   11.21 ? 14   GLU A D    1 
ATOM   263  D  DA   . GLU A 1 15 ? 17.656 33.302 7.616   1.00   12.31 ? 14   GLU A DA   1 
ATOM   264  D  DB2  . GLU A 1 15 ? 19.840 32.370 5.845   1.00   11.96 ? 14   GLU A DB2  1 
ATOM   265  D  DB3  . GLU A 1 15 ? 18.669 31.372 6.488   1.00   13.79 ? 14   GLU A DB3  1 
ATOM   266  D  DG2  . GLU A 1 15 ? 16.948 32.373 5.352   1.00   10.82 ? 14   GLU A DG2  1 
ATOM   267  D  DG3  . GLU A 1 15 ? 17.966 33.401 4.641   1.00   13.31 ? 14   GLU A DG3  1 
ATOM   268  N  N    . ASP A 1 16 ? 20.576 33.345 8.746   1.00   11.14 ? 15   ASP A N    1 
ATOM   269  C  CA   . ASP A 1 16 ? 21.332 33.017 9.961   1.00   11.50 ? 15   ASP A CA   1 
ATOM   270  C  C    . ASP A 1 16 ? 20.689 33.621 11.230  1.00   12.36 ? 15   ASP A C    1 
ATOM   271  O  O    . ASP A 1 16 ? 20.752 33.003 12.304  1.00   18.03 ? 15   ASP A O    1 
ATOM   272  C  CB   . ASP A 1 16 ? 22.799 33.437 9.876   1.00   13.86 ? 15   ASP A CB   1 
ATOM   273  C  CG   . ASP A 1 16 ? 23.627 32.573 8.936   1.00   17.17 ? 15   ASP A CG   1 
ATOM   274  O  OD1  . ASP A 1 16 ? 23.376 31.357 8.870   1.00   25.04 ? 15   ASP A OD1  1 
ATOM   275  O  OD2  . ASP A 1 16 ? 24.527 33.125 8.277   1.00   36.42 ? 15   ASP A OD2  1 
ATOM   276  D  D    . ASP A 1 16 ? 21.001 33.886 8.170   1.00   13.42 ? 15   ASP A D    1 
ATOM   277  D  DA   . ASP A 1 16 ? 21.301 32.002 10.045  1.00   14.37 ? 15   ASP A DA   1 
ATOM   278  D  DB2  . ASP A 1 16 ? 22.913 34.380 9.600   1.00   17.26 ? 15   ASP A DB2  1 
ATOM   279  D  DB3  . ASP A 1 16 ? 23.150 33.319 10.797  1.00   20.21 ? 15   ASP A DB3  1 
ATOM   280  N  N    . ALA A 1 17 ? 20.051 34.789 11.117  1.00   11.42 ? 16   ALA A N    1 
ATOM   281  C  CA   . ALA A 1 17 ? 19.432 35.497 12.233  1.00   11.95 ? 16   ALA A CA   1 
ATOM   282  C  C    . ALA A 1 17 ? 17.945 35.127 12.452  1.00   10.55 ? 16   ALA A C    1 
ATOM   283  O  O    . ALA A 1 17 ? 17.435 35.295 13.556  1.00   10.35 ? 16   ALA A O    1 
ATOM   284  C  CB   . ALA A 1 17 ? 19.540 37.010 12.001  1.00   16.49 ? 16   ALA A CB   1 
ATOM   285  D  D    . ALA A 1 17 ? 19.958 35.159 10.300  1.00   15.58 ? 16   ALA A D    1 
ATOM   286  D  DA   . ALA A 1 17 ? 19.908 35.277 13.110  1.00   13.72 ? 16   ALA A DA   1 
ATOM   287  D  DB1  . ALA A 1 17 ? 19.034 37.248 11.211  1.00   16.65 ? 16   ALA A DB1  1 
ATOM   288  D  DB2  . ALA A 1 17 ? 19.141 37.436 12.751  1.00   18.52 ? 16   ALA A DB2  1 
ATOM   289  D  DB3  . ALA A 1 17 ? 20.486 37.283 11.853  1.00   17.89 ? 16   ALA A DB3  1 
ATOM   290  N  N    . GLY A 1 18 ? 17.253 34.674 11.402  1.00   10.26 ? 17   GLY A N    1 
ATOM   291  C  CA   . GLY A 1 18 ? 15.813 34.477 11.443  1.00   9.81  ? 17   GLY A CA   1 
ATOM   292  C  C    . GLY A 1 18 ? 15.140 35.803 11.795  1.00   9.45  ? 17   GLY A C    1 
ATOM   293  O  O    . GLY A 1 18 ? 15.623 36.893 11.432  1.00   10.82 ? 17   GLY A O    1 
ATOM   294  D  D    . GLY A 1 18 ? 17.669 34.620 10.587  1.00   13.59 ? 17   GLY A D    1 
ATOM   295  D  DA2  . GLY A 1 18 ? 15.494 34.147 10.537  1.00   10.68 ? 17   GLY A DA2  1 
ATOM   296  D  DA3  . GLY A 1 18 ? 15.588 33.834 12.194  1.00   14.30 ? 17   GLY A DA3  1 
ATOM   297  N  N    . ASP A 1 19 ? 14.029 35.691 12.482  1.00   10.16 ? 18   ASP A N    1 
ATOM   298  C  CA   . ASP A 1 19 ? 13.163 36.857 12.854  1.00   9.68  ? 18   ASP A CA   1 
ATOM   299  C  C    . ASP A 1 19 ? 12.438 36.396 14.130  1.00   11.15 ? 18   ASP A C    1 
ATOM   300  O  O    . ASP A 1 19 ? 11.239 36.191 14.125  1.00   9.78  ? 18   ASP A O    1 
ATOM   301  C  CB   . ASP A 1 19 ? 12.229 37.209 11.677  1.00   10.93 ? 18   ASP A CB   1 
ATOM   302  C  CG   . ASP A 1 19 ? 11.325 38.430 11.920  1.00   11.97 ? 18   ASP A CG   1 
ATOM   303  O  OD1  . ASP A 1 19 ? 11.678 39.248 12.794  1.00   14.27 ? 18   ASP A OD1  1 
ATOM   304  O  OD2  . ASP A 1 19 ? 10.299 38.526 11.220  1.00   12.86 ? 18   ASP A OD2  1 
ATOM   305  D  D    . ASP A 1 19 ? 13.773 34.860 12.777  1.00   12.63 ? 18   ASP A D    1 
ATOM   306  D  DA   . ASP A 1 19 ? 13.799 37.630 13.052  1.00   11.45 ? 18   ASP A DA   1 
ATOM   307  D  DB2  . ASP A 1 19 ? 12.860 37.415 10.905  1.00   12.18 ? 18   ASP A DB2  1 
ATOM   308  D  DB3  . ASP A 1 19 ? 11.635 36.442 11.443  1.00   11.87 ? 18   ASP A DB3  1 
ATOM   309  N  N    A PRO A 1 20 ? 13.192 36.236 15.210  0.61   11.54 ? 19   PRO A N    1 
ATOM   310  N  N    B PRO A 1 20 ? 13.216 36.246 15.227  0.39   11.63 ? 19   PRO A N    1 
ATOM   311  C  CA   A PRO A 1 20 ? 12.601 35.530 16.358  0.61   12.31 ? 19   PRO A CA   1 
ATOM   312  C  CA   B PRO A 1 20 ? 12.658 35.598 16.422  0.39   12.12 ? 19   PRO A CA   1 
ATOM   313  C  C    A PRO A 1 20 ? 11.456 36.315 17.029  0.61   15.42 ? 19   PRO A C    1 
ATOM   314  C  C    B PRO A 1 20 ? 11.442 36.320 16.998  0.39   15.44 ? 19   PRO A C    1 
ATOM   315  O  O    A PRO A 1 20 ? 10.562 35.679 17.594  0.61   14.02 ? 19   PRO A O    1 
ATOM   316  O  O    B PRO A 1 20 ? 10.506 35.669 17.475  0.39   13.99 ? 19   PRO A O    1 
ATOM   317  C  CB   A PRO A 1 20 ? 13.797 35.334 17.302  0.61   14.62 ? 19   PRO A CB   1 
ATOM   318  C  CB   B PRO A 1 20 ? 13.822 35.629 17.421  0.39   14.10 ? 19   PRO A CB   1 
ATOM   319  C  CG   A PRO A 1 20 ? 14.820 36.368 16.835  0.61   14.29 ? 19   PRO A CG   1 
ATOM   320  C  CG   B PRO A 1 20 ? 15.021 35.543 16.539  0.39   13.44 ? 19   PRO A CG   1 
ATOM   321  C  CD   A PRO A 1 20 ? 14.647 36.420 15.356  0.61   13.91 ? 19   PRO A CD   1 
ATOM   322  C  CD   B PRO A 1 20 ? 14.660 36.511 15.415  0.39   13.85 ? 19   PRO A CD   1 
ATOM   323  D  DA   A PRO A 1 20 ? 12.208 34.649 16.055  0.61   11.01 ? 19   PRO A DA   1 
ATOM   324  D  DA   B PRO A 1 20 ? 12.434 34.660 16.200  0.39   13.92 ? 19   PRO A DA   1 
ATOM   325  D  DB2  A PRO A 1 20 ? 13.462 35.484 18.215  0.61   16.01 ? 19   PRO A DB2  1 
ATOM   326  D  DB2  B PRO A 1 20 ? 13.811 36.468 17.938  0.39   16.70 ? 19   PRO A DB2  1 
ATOM   327  D  DB3  A PRO A 1 20 ? 14.167 34.436 17.164  0.61   14.19 ? 19   PRO A DB3  1 
ATOM   328  D  DB3  B PRO A 1 20 ? 13.718 34.851 18.001  0.39   17.29 ? 19   PRO A DB3  1 
ATOM   329  D  DG2  A PRO A 1 20 ? 14.627 37.243 17.232  0.61   19.44 ? 19   PRO A DG2  1 
ATOM   330  D  DG2  B PRO A 1 20 ? 15.831 35.786 17.016  0.39   16.85 ? 19   PRO A DG2  1 
ATOM   331  D  DG3  A PRO A 1 20 ? 15.719 36.063 17.061  0.61   20.52 ? 19   PRO A DG3  1 
ATOM   332  D  DG3  B PRO A 1 20 ? 15.082 34.633 16.206  0.39   14.26 ? 19   PRO A DG3  1 
ATOM   333  D  DD2  A PRO A 1 20 ? 14.952 37.280 14.993  0.61   15.73 ? 19   PRO A DD2  1 
ATOM   334  D  DD2  B PRO A 1 20 ? 14.771 37.424 15.721  0.39   16.80 ? 19   PRO A DD2  1 
ATOM   335  D  DD3  A PRO A 1 20 ? 15.119 35.674 14.921  0.61   13.18 ? 19   PRO A DD3  1 
ATOM   336  D  DD3  B PRO A 1 20 ? 15.216 36.331 14.625  0.39   13.75 ? 19   PRO A DD3  1 
ATOM   337  N  N    . ASP A 1 21 ? 11.450 37.650 16.937  1.00   15.14 ? 20   ASP A N    1 
ATOM   338  C  CA   . ASP A 1 21 ? 10.373 38.419 17.514  1.00   20.15 ? 20   ASP A CA   1 
ATOM   339  C  C    . ASP A 1 21 ? 9.058  38.164 16.798  1.00   16.17 ? 20   ASP A C    1 
ATOM   340  O  O    . ASP A 1 21 ? 7.988  38.404 17.353  1.00   22.97 ? 20   ASP A O    1 
ATOM   341  C  CB   . ASP A 1 21 ? 10.711 39.916 17.549  1.00   25.03 ? 20   ASP A CB   1 
ATOM   342  C  CG   . ASP A 1 21 ? 11.893 40.226 18.464  1.00   30.58 ? 20   ASP A CG   1 
ATOM   343  O  OD1  . ASP A 1 21 ? 12.190 39.412 19.378  1.00   31.10 ? 20   ASP A OD1  1 
ATOM   344  O  OD2  . ASP A 1 21 ? 12.531 41.285 18.263  1.00   33.23 ? 20   ASP A OD2  1 
ATOM   345  D  D    . ASP A 1 21 ? 12.084 38.136 16.555  1.00   15.60 ? 20   ASP A D    1 
ATOM   346  D  DA   . ASP A 1 21 ? 10.259 38.100 18.441  1.00   21.24 ? 20   ASP A DA   1 
ATOM   347  D  DB2  . ASP A 1 21 ? 10.940 40.252 16.663  1.00   19.11 ? 20   ASP A DB2  1 
ATOM   348  D  DB3  . ASP A 1 21 ? 9.926  40.379 17.875  1.00   28.58 ? 20   ASP A DB3  1 
ATOM   349  N  N    . ASN A 1 22 ? 9.128  37.653 15.563  1.00   14.65 ? 21   ASN A N    1 
ATOM   350  C  CA   . ASN A 1 22 ? 7.922  37.357 14.807  1.00   15.79 ? 21   ASN A CA   1 
ATOM   351  C  C    . ASN A 1 22 ? 7.724  35.871 14.537  1.00   11.38 ? 21   ASN A C    1 
ATOM   352  O  O    . ASN A 1 22 ? 7.050  35.468 13.596  1.00   19.02 ? 21   ASN A O    1 
ATOM   353  C  CB   . ASN A 1 22 ? 7.908  38.151 13.479  1.00   16.55 ? 21   ASN A CB   1 
ATOM   354  C  CG   . ASN A 1 22 ? 7.851  39.655 13.723  1.00   16.55 ? 21   ASN A CG   1 
ATOM   355  O  OD1  . ASN A 1 22 ? 6.794  40.184 14.091  1.00   30.80 ? 21   ASN A OD1  1 
ATOM   356  N  ND2  . ASN A 1 22 ? 8.979  40.351 13.555  1.00   23.80 ? 21   ASN A ND2  1 
ATOM   357  D  D    . ASN A 1 22 ? 9.931  37.459 15.187  1.00   15.80 ? 21   ASN A D    1 
ATOM   358  D  DA   . ASN A 1 22 ? 7.149  37.690 15.360  1.00   19.12 ? 21   ASN A DA   1 
ATOM   359  D  DB2  . ASN A 1 22 ? 8.713  37.903 12.936  1.00   18.73 ? 21   ASN A DB2  1 
ATOM   360  D  DB3  . ASN A 1 22 ? 7.091  37.868 12.963  1.00   16.31 ? 21   ASN A DB3  1 
ATOM   361  D  DD21 . ASN A 1 22 ? 9.668  39.997 13.155  1.00   21.89 ? 21   ASN A DD21 1 
ATOM   362  D  DD22 . ASN A 1 22 ? 9.043  41.173 13.855  1.00   26.23 ? 21   ASN A DD22 1 
ATOM   363  N  N    . GLY A 1 23 ? 8.292  35.021 15.414  1.00   12.63 ? 22   GLY A N    1 
ATOM   364  C  CA   . GLY A 1 23 ? 8.065  33.588 15.398  1.00   13.93 ? 22   GLY A CA   1 
ATOM   365  C  C    . GLY A 1 23 ? 9.001  32.750 14.538  1.00   11.13 ? 22   GLY A C    1 
ATOM   366  O  O    . GLY A 1 23 ? 8.701  31.624 14.286  1.00   10.49 ? 22   GLY A O    1 
ATOM   367  D  D    . GLY A 1 23 ? 8.826  35.365 16.052  1.00   13.39 ? 22   GLY A D    1 
ATOM   368  D  DA2  . GLY A 1 23 ? 8.163  33.232 16.291  1.00   13.89 ? 22   GLY A DA2  1 
ATOM   369  D  DA3  . GLY A 1 23 ? 7.115  33.403 15.091  1.00   15.39 ? 22   GLY A DA3  1 
ATOM   370  N  N    . ILE A 1 24 ? 10.137 33.294 14.101  1.00   10.01 ? 23   ILE A N    1 
ATOM   371  C  CA   . ILE A 1 24 ? 11.022 32.630 13.185  1.00   9.47  ? 23   ILE A CA   1 
ATOM   372  C  C    . ILE A 1 24 ? 12.432 32.426 13.812  1.00   8.39  ? 23   ILE A C    1 
ATOM   373  O  O    . ILE A 1 24 ? 13.160 33.365 14.082  1.00   9.96  ? 23   ILE A O    1 
ATOM   374  C  CB   . ILE A 1 24 ? 11.179 33.439 11.863  1.00   10.70 ? 23   ILE A CB   1 
ATOM   375  C  CG1  . ILE A 1 24 ? 9.812  33.818 11.206  1.00   10.93 ? 23   ILE A CG1  1 
ATOM   376  C  CG2  . ILE A 1 24 ? 12.114 32.684 10.916  1.00   10.57 ? 23   ILE A CG2  1 
ATOM   377  C  CD1  . ILE A 1 24 ? 8.955  32.591 10.815  1.00   17.35 ? 23   ILE A CD1  1 
ATOM   378  D  D    . ILE A 1 24 ? 10.364 34.134 14.331  1.00   11.63 ? 23   ILE A D    1 
ATOM   379  D  DA   . ILE A 1 24 ? 10.629 31.704 12.974  1.00   10.59 ? 23   ILE A DA   1 
ATOM   380  D  DB   . ILE A 1 24 ? 11.617 34.296 12.150  1.00   12.23 ? 23   ILE A DB   1 
ATOM   381  D  DG12 . ILE A 1 24 ? 9.330  34.447 11.819  1.00   14.98 ? 23   ILE A DG12 1 
ATOM   382  D  DG13 . ILE A 1 24 ? 10.023 34.400 10.381  1.00   12.89 ? 23   ILE A DG13 1 
ATOM   383  D  DG21 . ILE A 1 24 ? 11.742 31.835 10.658  1.00   13.07 ? 23   ILE A DG21 1 
ATOM   384  D  DG22 . ILE A 1 24 ? 12.235 33.295 10.102  1.00   13.16 ? 23   ILE A DG22 1 
ATOM   385  D  DG23 . ILE A 1 24 ? 12.966 32.518 11.356  1.00   11.69 ? 23   ILE A DG23 1 
ATOM   386  D  DD11 . ILE A 1 24 ? 8.714  32.073 11.600  1.00   20.50 ? 23   ILE A DD11 1 
ATOM   387  D  DD12 . ILE A 1 24 ? 8.169  32.944 10.381  1.00   19.90 ? 23   ILE A DD12 1 
ATOM   388  D  DD13 . ILE A 1 24 ? 9.405  31.984 10.222  1.00   16.82 ? 23   ILE A DD13 1 
ATOM   389  N  N    . SER A 1 25 ? 12.769 31.186 14.143  1.00   10.13 ? 24   SER A N    1 
ATOM   390  C  CA   . SER A 1 25 ? 14.067 30.889 14.749  1.00   9.64  ? 24   SER A CA   1 
ATOM   391  C  C    . SER A 1 25 ? 15.209 31.090 13.778  1.00   7.75  ? 24   SER A C    1 
ATOM   392  O  O    . SER A 1 25 ? 15.079 30.979 12.566  1.00   8.46  ? 24   SER A O    1 
ATOM   393  C  CB   . SER A 1 25 ? 14.060 29.492 15.307  1.00   9.21  ? 24   SER A CB   1 
ATOM   394  O  OG   . SER A 1 25 ? 13.762 28.520 14.335  1.00   11.67 ? 24   SER A OG   1 
ATOM   395  D  D    . SER A 1 25 ? 12.237 30.518 13.960  1.00   11.20 ? 24   SER A D    1 
ATOM   396  D  DA   . SER A 1 25 ? 14.186 31.487 15.523  1.00   9.70  ? 24   SER A DA   1 
ATOM   397  D  DB2  . SER A 1 25 ? 14.909 29.255 15.781  1.00   11.51 ? 24   SER A DB2  1 
ATOM   398  D  DB3  . SER A 1 25 ? 13.325 29.439 15.997  1.00   12.71 ? 24   SER A DB3  1 
ATOM   399  D  DG   . SER A 1 25 ? 14.455 28.071 14.160  0.63   12.56 ? 24   SER A DG   1 
ATOM   400  N  N    . PRO A 1 26 ? 16.404 31.358 14.307  1.00   9.65  ? 25   PRO A N    1 
ATOM   401  C  CA   . PRO A 1 26 ? 17.608 31.462 13.472  1.00   10.78 ? 25   PRO A CA   1 
ATOM   402  C  C    . PRO A 1 26 ? 17.793 30.168 12.673  1.00   11.46 ? 25   PRO A C    1 
ATOM   403  O  O    . PRO A 1 26 ? 17.611 29.069 13.211  1.00   12.05 ? 25   PRO A O    1 
ATOM   404  C  CB   . PRO A 1 26 ? 18.751 31.619 14.529  1.00   14.91 ? 25   PRO A CB   1 
ATOM   405  C  CG   . PRO A 1 26 ? 18.074 32.348 15.699  1.00   21.02 ? 25   PRO A CG   1 
ATOM   406  C  CD   . PRO A 1 26 ? 16.699 31.655 15.739  1.00   14.45 ? 25   PRO A CD   1 
ATOM   407  D  DA   . PRO A 1 26 ? 17.509 32.257 12.829  1.00   10.94 ? 25   PRO A DA   1 
ATOM   408  D  DB2  . PRO A 1 26 ? 19.000 30.705 14.815  1.00   15.91 ? 25   PRO A DB2  1 
ATOM   409  D  DB3  . PRO A 1 26 ? 19.509 32.060 14.107  1.00   17.25 ? 25   PRO A DB3  1 
ATOM   410  D  DG2  . PRO A 1 26 ? 18.552 32.225 16.536  1.00   16.58 ? 25   PRO A DG2  1 
ATOM   411  D  DG3  . PRO A 1 26 ? 17.965 33.297 15.527  1.00   16.06 ? 25   PRO A DG3  1 
ATOM   412  D  DD2  . PRO A 1 26 ? 16.703 30.834 16.226  1.00   14.24 ? 25   PRO A DD2  1 
ATOM   413  D  DD3  . PRO A 1 26 ? 16.068 32.225 16.197  1.00   16.36 ? 25   PRO A DD3  1 
ATOM   414  N  N    . GLY A 1 27 ? 18.248 30.303 11.428  1.00   10.91 ? 26   GLY A N    1 
ATOM   415  C  CA   . GLY A 1 27 ? 18.497 29.191 10.568  1.00   13.00 ? 26   GLY A CA   1 
ATOM   416  C  C    . GLY A 1 27 ? 17.290 28.800 9.727   1.00   12.76 ? 26   GLY A C    1 
ATOM   417  O  O    . GLY A 1 27 ? 17.274 27.772 9.052   1.00   14.77 ? 26   GLY A O    1 
ATOM   418  D  D    . GLY A 1 27 ? 18.447 31.093 11.076  1.00   13.86 ? 26   GLY A D    1 
ATOM   419  D  DA2  . GLY A 1 27 ? 19.257 29.487 9.972   1.00   14.56 ? 26   GLY A DA2  1 
ATOM   420  D  DA3  . GLY A 1 27 ? 18.750 28.410 11.148  1.00   12.56 ? 26   GLY A DA3  1 
ATOM   421  N  N    . THR A 1 28 ? 16.249 29.623 9.704   1.00   12.71 ? 27   THR A N    1 
ATOM   422  C  CA   . THR A 1 28 ? 15.085 29.341 8.892   1.00   11.14 ? 27   THR A CA   1 
ATOM   423  C  C    . THR A 1 28 ? 15.287 29.931 7.491   1.00   10.11 ? 27   THR A C    1 
ATOM   424  O  O    . THR A 1 28 ? 15.520 31.147 7.323   1.00   10.16 ? 27   THR A O    1 
ATOM   425  C  CB   . THR A 1 28 ? 13.843 29.933 9.556   1.00   10.58 ? 27   THR A CB   1 
ATOM   426  O  OG1  . THR A 1 28 ? 13.714 29.402 10.893  1.00   12.51 ? 27   THR A OG1  1 
ATOM   427  C  CG2  . THR A 1 28 ? 12.597 29.595 8.731   1.00   13.46 ? 27   THR A CG2  1 
ATOM   428  D  D    . THR A 1 28 ? 16.233 30.330 10.207  1.00   18.38 ? 27   THR A D    1 
ATOM   429  D  DA   . THR A 1 28 ? 14.960 28.306 8.841   1.00   12.10 ? 27   THR A DA   1 
ATOM   430  D  DB   . THR A 1 28 ? 14.026 30.932 9.624   1.00   12.62 ? 27   THR A DB   1 
ATOM   431  D  DG1  . THR A 1 28 ? 14.114 29.872 11.474  1.00   15.15 ? 27   THR A DG1  1 
ATOM   432  D  DG21 . THR A 1 28 ? 12.501 28.631 8.655   1.00   13.79 ? 27   THR A DG21 1 
ATOM   433  D  DG22 . THR A 1 28 ? 11.804 29.978 9.181   1.00   14.15 ? 27   THR A DG22 1 
ATOM   434  D  DG23 . THR A 1 28 ? 12.703 29.963 7.832   1.00   14.71 ? 27   THR A DG23 1 
ATOM   435  N  N    . LYS A 1 29 ? 15.263 29.082 6.480   1.00   11.34 ? 28   LYS A N    1 
ATOM   436  C  CA   . LYS A 1 29 ? 15.438 29.512 5.096   1.00   11.88 ? 28   LYS A CA   1 
ATOM   437  C  C    . LYS A 1 29 ? 14.252 30.313 4.669   1.00   10.12 ? 28   LYS A C    1 
ATOM   438  O  O    . LYS A 1 29 ? 13.178 30.154 5.176   1.00   9.75  ? 28   LYS A O    1 
ATOM   439  C  CB   . LYS A 1 29 ? 15.573 28.307 4.147   1.00   15.14 ? 28   LYS A CB   1 
ATOM   440  C  CG   . LYS A 1 29 ? 16.879 27.515 4.400   1.00   19.27 ? 28   LYS A CG   1 
ATOM   441  C  CD   . LYS A 1 29 ? 17.034 26.327 3.401   1.00   31.95 ? 28   LYS A CD   1 
ATOM   442  C  CE   . LYS A 1 29 ? 18.485 25.711 3.510   1.00   49.79 ? 28   LYS A CE   1 
ATOM   443  N  NZ   . LYS A 1 29 ? 18.778 24.539 2.602   1.00   84.51 ? 28   LYS A NZ   1 
ATOM   444  D  D    . LYS A 1 29 ? 15.061 28.209 6.605   1.00   13.02 ? 28   LYS A D    1 
ATOM   445  D  DA   . LYS A 1 29 ? 16.248 30.085 5.009   1.00   11.87 ? 28   LYS A DA   1 
ATOM   446  D  DB2  . LYS A 1 29 ? 14.767 27.736 4.244   1.00   16.42 ? 28   LYS A DB2  1 
ATOM   447  D  DB3  . LYS A 1 29 ? 15.586 28.624 3.210   1.00   17.90 ? 28   LYS A DB3  1 
ATOM   448  D  DG2  . LYS A 1 29 ? 17.651 28.113 4.309   1.00   21.36 ? 28   LYS A DG2  1 
ATOM   449  D  DG3  . LYS A 1 29 ? 16.856 27.168 5.322   1.00   24.35 ? 28   LYS A DG3  1 
ATOM   450  D  DD2  . LYS A 1 29 ? 16.362 25.657 3.630   1.00   42.10 ? 28   LYS A DD2  1 
ATOM   451  D  DD3  . LYS A 1 29 ? 16.866 26.623 2.481   1.00   34.29 ? 28   LYS A DD3  1 
ATOM   452  D  DE2  . LYS A 1 29 ? 19.143 26.400 3.300   1.00   44.53 ? 28   LYS A DE2  1 
ATOM   453  D  DE3  . LYS A 1 29 ? 18.632 25.406 4.425   1.00   54.31 ? 28   LYS A DE3  1 
ATOM   454  D  DZ1  . LYS A 1 29 ? 18.406 24.658 1.798   1.00   72.85 ? 28   LYS A DZ1  1 
ATOM   455  D  DZ2  . LYS A 1 29 ? 19.661 24.453 2.495   1.00   72.63 ? 28   LYS A DZ2  1 
ATOM   456  D  DZ3  . LYS A 1 29 ? 18.464 23.787 2.968   1.00   81.30 ? 28   LYS A DZ3  1 
ATOM   457  N  N    . PHE A 1 30 ? 14.493 31.258 3.780   1.00   10.96 ? 29   PHE A N    1 
ATOM   458  C  CA   . PHE A 1 30 ? 13.402 32.169 3.277   1.00   10.21 ? 29   PHE A CA   1 
ATOM   459  C  C    . PHE A 1 30 ? 12.219 31.331 2.721   1.00   12.03 ? 29   PHE A C    1 
ATOM   460  O  O    . PHE A 1 30 ? 11.060 31.631 2.962   1.00   10.11 ? 29   PHE A O    1 
ATOM   461  C  CB   . PHE A 1 30 ? 13.969 33.110 2.194   1.00   11.45 ? 29   PHE A CB   1 
ATOM   462  C  CG   . PHE A 1 30 ? 12.979 34.170 1.761   1.00   12.12 ? 29   PHE A CG   1 
ATOM   463  C  CD1  . PHE A 1 30 ? 12.803 35.342 2.496   1.00   12.60 ? 29   PHE A CD1  1 
ATOM   464  C  CD2  . PHE A 1 30 ? 12.201 34.006 0.636   1.00   12.79 ? 29   PHE A CD2  1 
ATOM   465  C  CE1  . PHE A 1 30 ? 11.829 36.314 2.112   1.00   15.71 ? 29   PHE A CE1  1 
ATOM   466  C  CE2  . PHE A 1 30 ? 11.252 34.983 0.270   1.00   16.09 ? 29   PHE A CE2  1 
ATOM   467  C  CZ   . PHE A 1 30 ? 11.074 36.096 1.032   1.00   16.37 ? 29   PHE A CZ   1 
ATOM   468  D  D    . PHE A 1 30 ? 15.330 31.455 3.469   1.00   13.08 ? 29   PHE A D    1 
ATOM   469  D  DA   . PHE A 1 30 ? 13.004 32.727 4.059   1.00   10.33 ? 29   PHE A DA   1 
ATOM   470  D  DB2  . PHE A 1 30 ? 14.765 33.560 2.618   1.00   13.78 ? 29   PHE A DB2  1 
ATOM   471  D  DB3  . PHE A 1 30 ? 14.255 32.518 1.444   1.00   13.28 ? 29   PHE A DB3  1 
ATOM   472  D  DD1  . PHE A 1 30 ? 13.322 35.498 3.273   1.00   16.71 ? 29   PHE A DD1  1 
ATOM   473  D  DD2  . PHE A 1 30 ? 12.297 33.226 0.142   1.00   16.32 ? 29   PHE A DD2  1 
ATOM   474  D  DE1  . PHE A 1 30 ? 11.714 37.077 2.639   1.00   21.02 ? 29   PHE A DE1  1 
ATOM   475  D  DE2  . PHE A 1 30 ? 10.740 34.811 -0.500  1.00   24.32 ? 29   PHE A DE2  1 
ATOM   476  D  DZ   . PHE A 1 30 ? 10.442 36.762 0.762   1.00   20.95 ? 29   PHE A DZ   1 
ATOM   477  N  N    . GLU A 1 31 ? 12.509 30.261 1.985   1.00   13.60 ? 30   GLU A N    1 
ATOM   478  C  CA   . GLU A 1 31 ? 11.474 29.424 1.409   1.00   17.03 ? 30   GLU A CA   1 
ATOM   479  C  C    . GLU A 1 31 ? 10.613 28.746 2.455   1.00   16.25 ? 30   GLU A C    1 
ATOM   480  O  O    . GLU A 1 31 ? 9.474  28.354 2.164   1.00   21.50 ? 30   GLU A O    1 
ATOM   481  C  CB   . GLU A 1 31 ? 12.084 28.397 0.424   1.00   17.86 ? 30   GLU A CB   1 
ATOM   482  C  CG   . GLU A 1 31 ? 12.806 29.041 -0.791  1.00   38.07 ? 30   GLU A CG   1 
ATOM   483  C  CD   . GLU A 1 31 ? 14.275 29.433 -0.575  1.00   21.92 ? 30   GLU A CD   1 
ATOM   484  O  OE1  . GLU A 1 31 ? 14.817 29.343 0.550   1.00   26.25 ? 30   GLU A OE1  1 
ATOM   485  O  OE2  . GLU A 1 31 ? 14.883 29.854 -1.588  1.00   25.25 ? 30   GLU A OE2  1 
ATOM   486  D  D    . GLU A 1 31 ? 13.347 30.036 1.700   1.00   15.92 ? 30   GLU A D    1 
ATOM   487  D  DA   . GLU A 1 31 ? 10.876 30.033 0.878   1.00   17.47 ? 30   GLU A DA   1 
ATOM   488  D  DB2  . GLU A 1 31 ? 12.657 27.728 0.895   1.00   21.34 ? 30   GLU A DB2  1 
ATOM   489  D  DB3  . GLU A 1 31 ? 11.315 27.925 0.058   1.00   30.94 ? 30   GLU A DB3  1 
ATOM   490  D  DG2  . GLU A 1 31 ? 12.783 28.424 -1.543  1.00   45.95 ? 30   GLU A DG2  1 
ATOM   491  D  DG3  . GLU A 1 31 ? 12.341 29.867 -1.025  1.00   31.17 ? 30   GLU A DG3  1 
ATOM   492  N  N    . GLU A 1 32 ? 11.145 28.581 3.664   1.00   15.04 ? 31   GLU A N    1 
ATOM   493  C  CA   . GLU A 1 32 ? 10.447 27.941 4.787   1.00   19.06 ? 31   GLU A CA   1 
ATOM   494  C  C    . GLU A 1 32 ? 9.636  28.903 5.617   1.00   14.29 ? 31   GLU A C    1 
ATOM   495  O  O    . GLU A 1 32 ? 8.913  28.469 6.519   1.00   19.47 ? 31   GLU A O    1 
ATOM   496  C  CB   . GLU A 1 32 ? 11.450 27.219 5.739   1.00   20.36 ? 31   GLU A CB   1 
ATOM   497  C  CG   . GLU A 1 32 ? 12.195 26.034 5.159   1.00   34.41 ? 31   GLU A CG   1 
ATOM   498  C  CD   . GLU A 1 32 ? 13.121 25.394 6.195   1.00   28.35 ? 31   GLU A CD   1 
ATOM   499  O  OE1  . GLU A 1 32 ? 14.128 26.024 6.613   1.00   24.24 ? 31   GLU A OE1  1 
ATOM   500  O  OE2  . GLU A 1 32 ? 12.829 24.252 6.617   1.00   62.95 ? 31   GLU A OE2  1 
ATOM   501  D  D    . GLU A 1 32 ? 11.964 28.932 3.875   1.00   13.90 ? 31   GLU A D    1 
ATOM   502  D  DA   . GLU A 1 32 ? 9.779  27.292 4.446   1.00   22.95 ? 31   GLU A DA   1 
ATOM   503  D  DB2  . GLU A 1 32 ? 12.133 27.819 6.068   1.00   18.70 ? 31   GLU A DB2  1 
ATOM   504  D  DB3  . GLU A 1 32 ? 10.988 26.932 6.552   1.00   19.20 ? 31   GLU A DB3  1 
ATOM   505  D  DG2  . GLU A 1 32 ? 11.565 25.358 4.849   1.00   39.61 ? 31   GLU A DG2  1 
ATOM   506  D  DG3  . GLU A 1 32 ? 12.721 26.353 4.412   1.00   26.15 ? 31   GLU A DG3  1 
ATOM   507  N  N    . LEU A 1 33 ? 9.709  30.216 5.339   1.00   12.40 ? 32   LEU A N    1 
ATOM   508  C  CA   . LEU A 1 33 ? 8.902  31.151 6.097   1.00   12.71 ? 32   LEU A CA   1 
ATOM   509  C  C    . LEU A 1 33 ? 7.431  30.884 5.762   1.00   12.64 ? 32   LEU A C    1 
ATOM   510  O  O    . LEU A 1 33 ? 7.129  30.532 4.639   1.00   15.66 ? 32   LEU A O    1 
ATOM   511  C  CB   . LEU A 1 33 ? 9.244  32.596 5.700   1.00   12.52 ? 32   LEU A CB   1 
ATOM   512  C  CG   . LEU A 1 33 ? 10.664 33.081 6.094   1.00   10.22 ? 32   LEU A CG   1 
ATOM   513  C  CD1  . LEU A 1 33 ? 11.019 34.400 5.399   1.00   13.49 ? 32   LEU A CD1  1 
ATOM   514  C  CD2  . LEU A 1 33 ? 10.782 33.177 7.626   1.00   15.79 ? 32   LEU A CD2  1 
ATOM   515  D  D    . LEU A 1 33 ? 10.191 30.559 4.672   1.00   13.32 ? 32   LEU A D    1 
ATOM   516  D  DA   . LEU A 1 33 ? 9.050  30.984 7.100   1.00   13.65 ? 32   LEU A DA   1 
ATOM   517  D  DB2  . LEU A 1 33 ? 9.181  32.662 4.706   1.00   14.63 ? 32   LEU A DB2  1 
ATOM   518  D  DB3  . LEU A 1 33 ? 8.557  33.201 6.102   1.00   13.06 ? 32   LEU A DB3  1 
ATOM   519  D  DG   . LEU A 1 33 ? 11.323 32.408 5.769   1.00   11.70 ? 32   LEU A DG   1 
ATOM   520  D  DD11 . LEU A 1 33 ? 10.355 35.067 5.653   1.00   13.31 ? 32   LEU A DD11 1 
ATOM   521  D  DD12 . LEU A 1 33 ? 11.936 34.672 5.661   1.00   13.77 ? 32   LEU A DD12 1 
ATOM   522  D  DD13 . LEU A 1 33 ? 10.975 34.296 4.432   1.00   13.92 ? 32   LEU A DD13 1 
ATOM   523  D  DD21 . LEU A 1 33 ? 10.551 32.308 7.994   1.00   16.39 ? 32   LEU A DD21 1 
ATOM   524  D  DD22 . LEU A 1 33 ? 11.694 33.416 7.874   1.00   17.73 ? 32   LEU A DD22 1 
ATOM   525  D  DD23 . LEU A 1 33 ? 10.154 33.847 7.952   1.00   14.99 ? 32   LEU A DD23 1 
ATOM   526  N  N    . PRO A 1 34 ? 6.544  31.076 6.735   1.00   14.83 ? 33   PRO A N    1 
ATOM   527  C  CA   . PRO A 1 34 ? 5.090  30.941 6.452   1.00   14.81 ? 33   PRO A CA   1 
ATOM   528  C  C    . PRO A 1 34 ? 4.633  31.824 5.297   1.00   14.55 ? 33   PRO A C    1 
ATOM   529  O  O    . PRO A 1 34 ? 5.218  32.887 5.073   1.00   14.35 ? 33   PRO A O    1 
ATOM   530  C  CB   . PRO A 1 34 ? 4.455  31.396 7.773   1.00   32.38 ? 33   PRO A CB   1 
ATOM   531  C  CG   . PRO A 1 34 ? 5.523  31.157 8.808   1.00   30.62 ? 33   PRO A CG   1 
ATOM   532  C  CD   . PRO A 1 34 ? 6.798  31.456 8.128   1.00   15.82 ? 33   PRO A CD   1 
ATOM   533  D  DA   . PRO A 1 34 ? 4.913  29.992 6.239   1.00   20.49 ? 33   PRO A DA   1 
ATOM   534  D  DB2  . PRO A 1 34 ? 4.256  32.354 7.756   1.00   36.32 ? 33   PRO A DB2  1 
ATOM   535  D  DB3  . PRO A 1 34 ? 3.655  30.876 7.944   1.00   28.51 ? 33   PRO A DB3  1 
ATOM   536  D  DG2  . PRO A 1 34 ? 5.430  31.765 9.562   1.00   21.05 ? 33   PRO A DG2  1 
ATOM   537  D  DG3  . PRO A 1 34 ? 5.495  30.226 9.092   1.00   31.73 ? 33   PRO A DG3  1 
ATOM   538  D  DD2  . PRO A 1 34 ? 7.031  32.399 8.182   1.00   16.91 ? 33   PRO A DD2  1 
ATOM   539  D  DD3  . PRO A 1 34 ? 7.509  30.853 8.438   1.00   16.58 ? 33   PRO A DD3  1 
ATOM   540  N  N    . ASP A 1 35 ? 3.587  31.409 4.564   1.00   21.10 ? 34   ASP A N    1 
ATOM   541  C  CA   . ASP A 1 35 ? 3.126  32.160 3.389   1.00   20.42 ? 34   ASP A CA   1 
ATOM   542  C  C    . ASP A 1 35 ? 2.702  33.573 3.754   1.00   18.81 ? 34   ASP A C    1 
ATOM   543  O  O    . ASP A 1 35 ? 2.791  34.470 2.912   1.00   24.74 ? 34   ASP A O    1 
ATOM   544  C  CB   . ASP A 1 35 ? 1.957  31.460 2.666   1.00   31.48 ? 34   ASP A CB   1 
ATOM   545  C  CG   . ASP A 1 35 ? 2.390  30.235 1.887   1.00   34.60 ? 34   ASP A CG   1 
ATOM   546  O  OD1  . ASP A 1 35 ? 3.615  29.971 1.797   1.00   34.68 ? 34   ASP A OD1  1 
ATOM   547  O  OD2  . ASP A 1 35 ? 1.491  29.549 1.340   1.00   30.69 ? 34   ASP A OD2  1 
ATOM   548  D  D    . ASP A 1 35 ? 3.143  30.701 4.770   1.00   26.77 ? 34   ASP A D    1 
ATOM   549  D  DA   . ASP A 1 35 ? 3.863  32.258 2.741   1.00   23.47 ? 34   ASP A DA   1 
ATOM   550  D  DB2  . ASP A 1 35 ? 1.276  31.206 3.345   1.00   20.00 ? 34   ASP A DB2  1 
ATOM   551  D  DB3  . ASP A 1 35 ? 1.604  32.079 1.997   1.00   31.99 ? 34   ASP A DB3  1 
ATOM   552  N  N    . ASP A 1 36 ? 2.245  33.766 4.991   1.00   19.01 ? 35   ASP A N    1 
ATOM   553  C  CA   . ASP A 1 36 ? 1.812  35.094 5.462   1.00   23.15 ? 35   ASP A CA   1 
ATOM   554  C  C    . ASP A 1 36 ? 2.813  35.847 6.395   1.00   18.35 ? 35   ASP A C    1 
ATOM   555  O  O    . ASP A 1 36 ? 2.452  36.759 7.134   1.00   18.18 ? 35   ASP A O    1 
ATOM   556  C  CB   . ASP A 1 36 ? 0.535  34.951 6.270   1.00   41.57 ? 35   ASP A CB   1 
ATOM   557  C  CG   . ASP A 1 36 ? 0.775  34.269 7.597   1.00   27.94 ? 35   ASP A CG   1 
ATOM   558  O  OD1  . ASP A 1 36 ? 1.498  33.248 7.619   1.00   37.24 ? 35   ASP A OD1  1 
ATOM   559  O  OD2  . ASP A 1 36 ? 0.277  34.773 8.625   1.00   38.72 ? 35   ASP A OD2  1 
ATOM   560  D  D    . ASP A 1 36 ? 2.197  33.183 5.642   1.00   19.20 ? 35   ASP A D    1 
ATOM   561  D  DA   . ASP A 1 36 ? 1.627  35.619 4.626   1.00   22.50 ? 35   ASP A DA   1 
ATOM   562  D  DB2  . ASP A 1 36 ? 0.200  35.835 6.477   1.00   32.80 ? 35   ASP A DB2  1 
ATOM   563  D  DB3  . ASP A 1 36 ? -0.118 34.452 5.755   1.00   54.25 ? 35   ASP A DB3  1 
ATOM   564  N  N    . TRP A 1 37 ? 4.058  35.409 6.393   1.00   17.01 ? 36   TRP A N    1 
ATOM   565  C  CA   . TRP A 1 37 ? 5.142  36.221 6.955   1.00   12.09 ? 36   TRP A CA   1 
ATOM   566  C  C    . TRP A 1 37 ? 5.341  37.440 6.033   1.00   8.90  ? 36   TRP A C    1 
ATOM   567  O  O    . TRP A 1 37 ? 5.287  37.334 4.810   1.00   13.46 ? 36   TRP A O    1 
ATOM   568  C  CB   . TRP A 1 37 ? 6.418  35.378 7.041   1.00   13.57 ? 36   TRP A CB   1 
ATOM   569  C  CG   . TRP A 1 37 ? 7.621  36.110 7.607   1.00   12.81 ? 36   TRP A CG   1 
ATOM   570  C  CD1  . TRP A 1 37 ? 8.019  36.152 8.912   1.00   13.39 ? 36   TRP A CD1  1 
ATOM   571  C  CD2  . TRP A 1 37 ? 8.541  36.962 6.884   1.00   11.85 ? 36   TRP A CD2  1 
ATOM   572  N  NE1  . TRP A 1 37 ? 9.159  36.881 9.031   1.00   13.11 ? 36   TRP A NE1  1 
ATOM   573  C  CE2  . TRP A 1 37 ? 9.487  37.431 7.818   1.00   10.02 ? 36   TRP A CE2  1 
ATOM   574  C  CE3  . TRP A 1 37 ? 8.672  37.340 5.548   1.00   10.56 ? 36   TRP A CE3  1 
ATOM   575  C  CZ2  . TRP A 1 37 ? 10.575 38.249 7.443   1.00   11.56 ? 36   TRP A CZ2  1 
ATOM   576  C  CZ3  . TRP A 1 37 ? 9.733  38.167 5.184   1.00   11.82 ? 36   TRP A CZ3  1 
ATOM   577  C  CH2  . TRP A 1 37 ? 10.664 38.607 6.114   1.00   13.11 ? 36   TRP A CH2  1 
ATOM   578  D  D    . TRP A 1 37 ? 4.272  34.666 5.982   1.00   18.71 ? 36   TRP A D    1 
ATOM   579  D  DA   . TRP A 1 37 ? 4.910  36.530 7.868   1.00   12.29 ? 36   TRP A DA   1 
ATOM   580  D  DB2  . TRP A 1 37 ? 6.241  34.582 7.579   1.00   19.07 ? 36   TRP A DB2  1 
ATOM   581  D  DB3  . TRP A 1 37 ? 6.644  35.051 6.168   1.00   13.13 ? 36   TRP A DB3  1 
ATOM   582  D  DD1  . TRP A 1 37 ? 7.592  35.686 9.636   1.00   17.11 ? 36   TRP A DD1  1 
ATOM   583  D  DE1  . TRP A 1 37 ? 9.545  37.068 9.790   1.00   14.70 ? 36   TRP A DE1  1 
ATOM   584  D  DE3  . TRP A 1 37 ? 8.029  37.016 4.872   1.00   12.21 ? 36   TRP A DE3  1 
ATOM   585  D  DZ2  . TRP A 1 37 ? 11.196 38.565 8.078   1.00   17.01 ? 36   TRP A DZ2  1 
ATOM   586  D  DZ3  . TRP A 1 37 ? 9.818  38.414 4.260   1.00   15.03 ? 36   TRP A DZ3  1 
ATOM   587  D  DH2  . TRP A 1 37 ? 11.380 39.176 5.840   1.00   16.03 ? 36   TRP A DH2  1 
ATOM   588  N  N    . VAL A 1 38 ? 5.596  38.577 6.653   1.00   9.39  ? 37   VAL A N    1 
ATOM   589  C  CA   . VAL A 1 38 ? 5.834  39.808 5.901   1.00   9.04  ? 37   VAL A CA   1 
ATOM   590  C  C    . VAL A 1 38 ? 7.076  40.522 6.419   1.00   8.35  ? 37   VAL A C    1 
ATOM   591  O  O    . VAL A 1 38 ? 7.534  40.267 7.506   1.00   9.16  ? 37   VAL A O    1 
ATOM   592  C  CB   . VAL A 1 38 ? 4.642  40.778 5.988   1.00   11.58 ? 37   VAL A CB   1 
ATOM   593  C  CG1  . VAL A 1 38 ? 3.389  40.156 5.280   1.00   14.09 ? 37   VAL A CG1  1 
ATOM   594  C  CG2  . VAL A 1 38 ? 4.351  41.234 7.427   1.00   14.56 ? 37   VAL A CG2  1 
ATOM   595  D  D    . VAL A 1 38 ? 5.650  38.649 7.546   1.00   11.83 ? 37   VAL A D    1 
ATOM   596  D  DA   . VAL A 1 38 ? 6.003  39.559 4.935   1.00   10.26 ? 37   VAL A DA   1 
ATOM   597  D  DB   . VAL A 1 38 ? 4.850  41.620 5.447   1.00   13.03 ? 37   VAL A DB   1 
ATOM   598  D  DG11 . VAL A 1 38 ? 3.121  39.333 5.706   1.00   14.50 ? 37   VAL A DG11 1 
ATOM   599  D  DG12 . VAL A 1 38 ? 2.684  40.816 5.341   1.00   18.59 ? 37   VAL A DG12 1 
ATOM   600  D  DG13 . VAL A 1 38 ? 3.588  39.952 4.375   1.00   14.42 ? 37   VAL A DG13 1 
ATOM   601  D  DG21 . VAL A 1 38 ? 5.102  41.703 7.829   1.00   16.96 ? 37   VAL A DG21 1 
ATOM   602  D  DG22 . VAL A 1 38 ? 3.569  41.833 7.390   1.00   18.52 ? 37   VAL A DG22 1 
ATOM   603  D  DG23 . VAL A 1 38 ? 4.156  40.454 7.972   1.00   14.78 ? 37   VAL A DG23 1 
ATOM   604  N  N    . CYS A 1 39 ? 7.581  41.461 5.655   1.00   8.01  ? 38   CYS A N    1 
ATOM   605  C  CA   . CYS A 1 39 ? 8.714  42.251 6.069   1.00   7.41  ? 38   CYS A CA   1 
ATOM   606  C  C    . CYS A 1 39 ? 8.360  42.874 7.430   1.00   8.31  ? 38   CYS A C    1 
ATOM   607  O  O    . CYS A 1 39 ? 7.354  43.545 7.556   1.00   8.50  ? 38   CYS A O    1 
ATOM   608  C  CB   . CYS A 1 39 ? 8.952  43.361 5.037   1.00   8.01  ? 38   CYS A CB   1 
ATOM   609  S  SG   . CYS A 1 39 ? 10.402 44.409 5.407   1.00   8.65  ? 38   CYS A SG   1 
ATOM   610  D  D    . CYS A 1 39 ? 7.247  41.660 4.867   1.00   14.65 ? 38   CYS A D    1 
ATOM   611  D  DA   . CYS A 1 39 ? 9.564  41.625 6.154   1.00   8.66  ? 38   CYS A DA   1 
ATOM   612  D  DB2  . CYS A 1 39 ? 9.145  42.976 4.103   1.00   8.73  ? 38   CYS A DB2  1 
ATOM   613  D  DB3  . CYS A 1 39 ? 8.106  43.941 4.984   1.00   10.51 ? 38   CYS A DB3  1 
ATOM   614  N  N    . PRO A 1 40 ? 9.255  42.749 8.438   1.00   8.54  ? 39   PRO A N    1 
ATOM   615  C  CA   . PRO A 1 40 ? 8.901  43.256 9.783   1.00   11.52 ? 39   PRO A CA   1 
ATOM   616  C  C    . PRO A 1 40 ? 8.973  44.770 9.869   1.00   11.03 ? 39   PRO A C    1 
ATOM   617  O  O    . PRO A 1 40 ? 8.474  45.344 10.847  1.00   13.41 ? 39   PRO A O    1 
ATOM   618  C  CB   . PRO A 1 40 ? 9.936  42.582 10.700  1.00   15.50 ? 39   PRO A CB   1 
ATOM   619  C  CG   . PRO A 1 40 ? 11.084 42.257 9.835   1.00   15.92 ? 39   PRO A CG   1 
ATOM   620  C  CD   . PRO A 1 40 ? 10.484 41.924 8.474   1.00   10.25 ? 39   PRO A CD   1 
ATOM   621  D  DA   . PRO A 1 40 ? 7.937  42.996 10.057  1.00   12.44 ? 39   PRO A DA   1 
ATOM   622  D  DB2  . PRO A 1 40 ? 10.141 43.189 11.461  1.00   17.76 ? 39   PRO A DB2  1 
ATOM   623  D  DB3  . PRO A 1 40 ? 9.593  41.734 11.053  1.00   19.02 ? 39   PRO A DB3  1 
ATOM   624  D  DG2  . PRO A 1 40 ? 11.637 43.068 9.739   1.00   15.19 ? 39   PRO A DG2  1 
ATOM   625  D  DG3  . PRO A 1 40 ? 11.593 41.465 10.159  1.00   17.24 ? 39   PRO A DG3  1 
ATOM   626  D  DD2  . PRO A 1 40 ? 11.097 42.183 7.682   1.00   11.47 ? 39   PRO A DD2  1 
ATOM   627  D  DD3  . PRO A 1 40 ? 10.279 40.950 8.388   1.00   13.60 ? 39   PRO A DD3  1 
ATOM   628  N  N    . ILE A 1 41 ? 9.572  45.445 8.905   1.00   9.73  ? 40   ILE A N    1 
ATOM   629  C  CA   . ILE A 1 41 ? 9.674  46.888 8.887   1.00   10.41 ? 40   ILE A CA   1 
ATOM   630  C  C    . ILE A 1 41 ? 8.506  47.507 8.117   1.00   9.20  ? 40   ILE A C    1 
ATOM   631  O  O    . ILE A 1 41 ? 7.862  48.395 8.615   1.00   12.94 ? 40   ILE A O    1 
ATOM   632  C  CB   . ILE A 1 41 ? 11.077 47.308 8.240   1.00   10.71 ? 40   ILE A CB   1 
ATOM   633  C  CG1  . ILE A 1 41 ? 12.244 46.639 9.021   1.00   13.22 ? 40   ILE A CG1  1 
ATOM   634  C  CG2  . ILE A 1 41 ? 11.213 48.827 8.124   1.00   18.05 ? 40   ILE A CG2  1 
ATOM   635  C  CD1  . ILE A 1 41 ? 12.205 46.913 10.498  1.00   21.98 ? 40   ILE A CD1  1 
ATOM   636  D  D    . ILE A 1 41 ? 9.920  45.039 8.223   1.00   16.01 ? 40   ILE A D    1 
ATOM   637  D  DA   . ILE A 1 41 ? 9.594  47.233 9.852   1.00   12.33 ? 40   ILE A DA   1 
ATOM   638  D  DB   . ILE A 1 41 ? 11.102 46.977 7.309   1.00   11.50 ? 40   ILE A DB   1 
ATOM   639  D  DG12 . ILE A 1 41 ? 12.279 45.648 8.882   1.00   13.83 ? 40   ILE A DG12 1 
ATOM   640  D  DG13 . ILE A 1 41 ? 13.100 46.974 8.649   1.00   19.66 ? 40   ILE A DG13 1 
ATOM   641  D  DG21 . ILE A 1 41 ? 11.090 49.238 8.981   1.00   18.75 ? 40   ILE A DG21 1 
ATOM   642  D  DG22 . ILE A 1 41 ? 12.085 49.012 7.755   1.00   18.11 ? 40   ILE A DG22 1 
ATOM   643  D  DG23 . ILE A 1 41 ? 10.521 49.139 7.530   1.00   20.08 ? 40   ILE A DG23 1 
ATOM   644  D  DD11 . ILE A 1 41 ? 12.180 47.866 10.634  1.00   26.11 ? 40   ILE A DD11 1 
ATOM   645  D  DD12 . ILE A 1 41 ? 11.434 46.535 10.933  1.00   20.62 ? 40   ILE A DD12 1 
ATOM   646  D  DD13 . ILE A 1 41 ? 12.988 46.505 10.867  1.00   20.64 ? 40   ILE A DD13 1 
ATOM   647  N  N    . CYS A 1 42 ? 8.287  47.085 6.862   1.00   9.37  ? 41   CYS A N    1 
ATOM   648  C  CA   . CYS A 1 42 ? 7.327  47.803 6.014   1.00   9.92  ? 41   CYS A CA   1 
ATOM   649  C  C    . CYS A 1 42 ? 6.054  47.046 5.724   1.00   8.38  ? 41   CYS A C    1 
ATOM   650  O  O    . CYS A 1 42 ? 5.136  47.653 5.175   1.00   9.70  ? 41   CYS A O    1 
ATOM   651  C  CB   . CYS A 1 42 ? 7.961  48.238 4.719   1.00   10.40 ? 41   CYS A CB   1 
ATOM   652  S  SG   . CYS A 1 42 ? 8.366  46.862 3.632   1.00   8.39  ? 41   CYS A SG   1 
ATOM   653  D  D    . CYS A 1 42 ? 8.824  46.430 6.468   1.00   9.44  ? 41   CYS A D    1 
ATOM   654  D  DA   . CYS A 1 42 ? 7.053  48.653 6.482   1.00   10.04 ? 41   CYS A DA   1 
ATOM   655  D  DB2  . CYS A 1 42 ? 7.384  48.896 4.225   1.00   11.41 ? 41   CYS A DB2  1 
ATOM   656  D  DB3  . CYS A 1 42 ? 8.829  48.678 4.946   1.00   14.53 ? 41   CYS A DB3  1 
ATOM   657  N  N    . GLY A 1 43 ? 5.993  45.781 6.083   1.00   9.31  ? 42   GLY A N    1 
ATOM   658  C  CA   . GLY A 1 43 ? 4.829  44.942 5.832   1.00   9.10  ? 42   GLY A CA   1 
ATOM   659  C  C    . GLY A 1 43 ? 4.704  44.289 4.456   1.00   7.94  ? 42   GLY A C    1 
ATOM   660  O  O    . GLY A 1 43 ? 3.663  43.739 4.134   1.00   8.48  ? 42   GLY A O    1 
ATOM   661  D  D    . GLY A 1 43 ? 6.618  45.345 6.579   1.00   10.76 ? 42   GLY A D    1 
ATOM   662  D  DA2  . GLY A 1 43 ? 4.851  44.179 6.484   1.00   10.79 ? 42   GLY A DA2  1 
ATOM   663  D  DA3  . GLY A 1 43 ? 3.997  45.489 5.944   1.00   13.95 ? 42   GLY A DA3  1 
ATOM   664  N  N    . ALA A 1 44 ? 5.717  44.405 3.602   1.00   8.75  ? 43   ALA A N    1 
ATOM   665  C  CA   . ALA A 1 44 ? 5.685  43.862 2.263   1.00   8.08  ? 43   ALA A CA   1 
ATOM   666  C  C    . ALA A 1 44 ? 5.591  42.352 2.309   1.00   8.55  ? 43   ALA A C    1 
ATOM   667  O  O    . ALA A 1 44 ? 6.235  41.704 3.123   1.00   9.25  ? 43   ALA A O    1 
ATOM   668  C  CB   . ALA A 1 44 ? 6.960  44.247 1.449   1.00   13.41 ? 43   ALA A CB   1 
ATOM   669  D  D    . ALA A 1 44 ? 6.476  44.794 3.815   1.00   16.82 ? 43   ALA A D    1 
ATOM   670  D  DA   . ALA A 1 44 ? 4.840  44.263 1.796   1.00   10.09 ? 43   ALA A DA   1 
ATOM   671  D  DB1  . ALA A 1 44 ? 7.746  43.865 1.902   1.00   10.84 ? 43   ALA A DB1  1 
ATOM   672  D  DB2  . ALA A 1 44 ? 6.890  43.913 0.495   1.00   12.26 ? 43   ALA A DB2  1 
ATOM   673  D  DB3  . ALA A 1 44 ? 7.048  45.230 1.431   1.00   11.57 ? 43   ALA A DB3  1 
ATOM   674  N  N    A PRO A 1 45 ? 4.812  41.762 1.397   0.68   7.73  ? 44   PRO A N    1 
ATOM   675  N  N    B PRO A 1 45 ? 4.784  41.769 1.378   0.32   8.01  ? 44   PRO A N    1 
ATOM   676  C  CA   A PRO A 1 45 ? 4.786  40.303 1.257   0.68   8.11  ? 44   PRO A CA   1 
ATOM   677  C  CA   B PRO A 1 45 ? 4.760  40.313 1.215   0.32   8.24  ? 44   PRO A CA   1 
ATOM   678  C  C    A PRO A 1 45 ? 6.078  39.710 0.722   0.68   8.11  ? 44   PRO A C    1 
ATOM   679  C  C    B PRO A 1 45 ? 6.126  39.776 0.837   0.32   7.78  ? 44   PRO A C    1 
ATOM   680  O  O    A PRO A 1 45 ? 6.893  40.416 0.095   0.68   6.80  ? 44   PRO A O    1 
ATOM   681  O  O    B PRO A 1 45 ? 7.043  40.536 0.526   0.32   8.52  ? 44   PRO A O    1 
ATOM   682  C  CB   A PRO A 1 45 ? 3.575  40.073 0.377   0.68   11.28 ? 44   PRO A CB   1 
ATOM   683  C  CB   B PRO A 1 45 ? 3.718  40.084 0.101   0.32   11.47 ? 44   PRO A CB   1 
ATOM   684  C  CG   A PRO A 1 45 ? 3.519  41.315 -0.467  0.68   13.29 ? 44   PRO A CG   1 
ATOM   685  C  CG   B PRO A 1 45 ? 2.790  41.296 0.237   0.32   12.09 ? 44   PRO A CG   1 
ATOM   686  C  CD   A PRO A 1 45 ? 3.887  42.447 0.461   0.68   9.18  ? 44   PRO A CD   1 
ATOM   687  C  CD   B PRO A 1 45 ? 3.834  42.406 0.436   0.32   9.31  ? 44   PRO A CD   1 
ATOM   688  D  DA   A PRO A 1 45 ? 4.580  39.923 2.150   0.68   11.36 ? 44   PRO A DA   1 
ATOM   689  D  DA   B PRO A 1 45 ? 4.420  39.914 2.046   0.32   10.53 ? 44   PRO A DA   1 
ATOM   690  D  DB2  A PRO A 1 45 ? 3.665  39.257 -0.166  0.68   12.49 ? 44   PRO A DB2  1 
ATOM   691  D  DB2  B PRO A 1 45 ? 4.159  40.102 -0.773  0.32   8.84  ? 44   PRO A DB2  1 
ATOM   692  D  DB3  A PRO A 1 45 ? 2.831  40.023 1.012   0.68   15.14 ? 44   PRO A DB3  1 
ATOM   693  D  DB3  B PRO A 1 45 ? 3.287  39.200 0.285   0.32   10.07 ? 44   PRO A DB3  1 
ATOM   694  D  DG2  A PRO A 1 45 ? 4.191  41.207 -1.186  0.68   15.24 ? 44   PRO A DG2  1 
ATOM   695  D  DG2  B PRO A 1 45 ? 2.250  41.437 -0.562  0.32   13.87 ? 44   PRO A DG2  1 
ATOM   696  D  DG3  A PRO A 1 45 ? 2.628  41.503 -0.862  0.68   15.26 ? 44   PRO A DG3  1 
ATOM   697  D  DG3  B PRO A 1 45 ? 2.216  41.184 1.005   0.32   9.59  ? 44   PRO A DG3  1 
ATOM   698  D  DD2  A PRO A 1 45 ? 4.360  43.124 -0.082  0.68   10.48 ? 44   PRO A DD2  1 
ATOM   699  D  DD2  B PRO A 1 45 ? 4.295  42.567 -0.410  0.32   12.99 ? 44   PRO A DD2  1 
ATOM   700  D  DD3  A PRO A 1 45 ? 3.159  42.808 1.002   0.68   12.12 ? 44   PRO A DD3  1 
ATOM   701  D  DD3  B PRO A 1 45 ? 3.466  43.229 0.779   0.32   7.60  ? 44   PRO A DD3  1 
ATOM   702  N  N    A LYS A 1 46 ? 6.188  38.397 0.884   0.68   9.04  ? 45   LYS A N    1 
ATOM   703  N  N    B LYS A 1 46 ? 6.246  38.464 0.853   0.32   8.94  ? 45   LYS A N    1 
ATOM   704  C  CA   A LYS A 1 46 ? 7.369  37.653 0.426   0.68   7.52  ? 45   LYS A CA   1 
ATOM   705  C  CA   B LYS A 1 46 ? 7.474  37.806 0.448   0.32   10.07 ? 45   LYS A CA   1 
ATOM   706  C  C    A LYS A 1 46 ? 7.726  37.887 -1.032  0.68   8.44  ? 45   LYS A C    1 
ATOM   707  C  C    B LYS A 1 46 ? 7.757  37.957 -1.040  0.32   8.88  ? 45   LYS A C    1 
ATOM   708  O  O    A LYS A 1 46 ? 8.919  37.913 -1.375  0.68   9.28  ? 45   LYS A O    1 
ATOM   709  O  O    B LYS A 1 46 ? 8.924  37.928 -1.441  0.32   9.43  ? 45   LYS A O    1 
ATOM   710  C  CB   A LYS A 1 46 ? 7.230  36.151 0.699   0.68   10.79 ? 45   LYS A CB   1 
ATOM   711  C  CB   B LYS A 1 46 ? 7.384  36.330 0.831   0.32   8.92  ? 45   LYS A CB   1 
ATOM   712  C  CG   A LYS A 1 46 ? 7.304  35.752 2.218   0.68   12.26 ? 45   LYS A CG   1 
ATOM   713  C  CG   B LYS A 1 46 ? 7.531  36.104 2.326   0.32   12.03 ? 45   LYS A CG   1 
ATOM   714  C  CD   A LYS A 1 46 ? 7.169  34.216 2.425   0.68   14.51 ? 45   LYS A CD   1 
ATOM   715  C  CD   B LYS A 1 46 ? 7.542  34.636 2.700   0.32   16.54 ? 45   LYS A CD   1 
ATOM   716  C  CE   A LYS A 1 46 ? 8.368  33.450 1.880   0.68   16.45 ? 45   LYS A CE   1 
ATOM   717  C  CE   B LYS A 1 46 ? 6.319  33.815 2.216   0.32   17.04 ? 45   LYS A CE   1 
ATOM   718  N  NZ   A LYS A 1 46 ? 8.340  31.945 2.081   0.68   20.85 ? 45   LYS A NZ   1 
ATOM   719  N  NZ   B LYS A 1 46 ? 6.325  32.425 2.751   0.32   19.55 ? 45   LYS A NZ   1 
ATOM   720  D  D    A LYS A 1 46 ? 5.519  37.909 1.302   0.68   9.98  ? 45   LYS A D    1 
ATOM   721  D  D    B LYS A 1 46 ? 5.609  37.927 1.132   0.32   12.48 ? 45   LYS A D    1 
ATOM   722  D  DA   A LYS A 1 46 ? 8.140  38.013 0.985   0.68   12.47 ? 45   LYS A DA   1 
ATOM   723  D  DA   B LYS A 1 46 ? 8.251  38.243 0.946   0.32   5.17  ? 45   LYS A DA   1 
ATOM   724  D  DB2  A LYS A 1 46 ? 6.368  35.856 0.305   0.68   11.58 ? 45   LYS A DB2  1 
ATOM   725  D  DB2  B LYS A 1 46 ? 6.507  35.992 0.562   0.32   13.95 ? 45   LYS A DB2  1 
ATOM   726  D  DB3  A LYS A 1 46 ? 7.972  35.702 0.209   0.68   11.00 ? 45   LYS A DB3  1 
ATOM   727  D  DB3  B LYS A 1 46 ? 8.088  35.833 0.362   0.32   11.07 ? 45   LYS A DB3  1 
ATOM   728  D  DG2  A LYS A 1 46 ? 8.150  36.069 2.589   0.68   15.31 ? 45   LYS A DG2  1 
ATOM   729  D  DG2  B LYS A 1 46 ? 8.411  36.427 2.585   0.32   11.66 ? 45   LYS A DG2  1 
ATOM   730  D  DG3  A LYS A 1 46 ? 6.563  36.185 2.713   0.68   16.21 ? 45   LYS A DG3  1 
ATOM   731  D  DG3  B LYS A 1 46 ? 6.837  36.589 2.818   0.32   12.87 ? 45   LYS A DG3  1 
ATOM   732  D  DD2  A LYS A 1 46 ? 7.089  34.024 3.376   0.68   21.28 ? 45   LYS A DD2  1 
ATOM   733  D  DD2  B LYS A 1 46 ? 8.330  34.240 2.300   0.32   16.30 ? 45   LYS A DD2  1 
ATOM   734  D  DD3  A LYS A 1 46 ? 6.373  33.886 1.974   0.68   17.29 ? 45   LYS A DD3  1 
ATOM   735  D  DD3  B LYS A 1 46 ? 7.599  34.601 3.678   0.32   10.71 ? 45   LYS A DD3  1 
ATOM   736  D  DE2  A LYS A 1 46 ? 8.418  33.638 0.927   0.68   20.82 ? 45   LYS A DE2  1 
ATOM   737  D  DE2  B LYS A 1 46 ? 5.508  34.228 2.539   0.32   16.31 ? 45   LYS A DE2  1 
ATOM   738  D  DE3  A LYS A 1 46 ? 9.167  33.784 2.318   0.68   21.16 ? 45   LYS A DE3  1 
ATOM   739  D  DE3  B LYS A 1 46 ? 6.316  33.740 1.243   0.32   13.97 ? 45   LYS A DE3  1 
ATOM   740  D  DZ1  A LYS A 1 46 ? 7.973  31.718 2.887   0.68   15.68 ? 45   LYS A DZ1  1 
ATOM   741  D  DZ1  B LYS A 1 46 ? 6.360  32.461 3.643   0.32   15.54 ? 45   LYS A DZ1  1 
ATOM   742  D  DZ2  A LYS A 1 46 ? 7.873  31.555 1.446   0.68   16.24 ? 45   LYS A DZ2  1 
ATOM   743  D  DZ2  B LYS A 1 46 ? 5.582  31.998 2.514   0.32   13.89 ? 45   LYS A DZ2  1 
ATOM   744  D  DZ3  A LYS A 1 46 ? 9.173  31.637 2.014   0.68   18.92 ? 45   LYS A DZ3  1 
ATOM   745  D  DZ3  B LYS A 1 46 ? 7.018  31.968 2.433   0.32   14.55 ? 45   LYS A DZ3  1 
ATOM   746  N  N    . SER A 1 47 ? 6.719  38.179 -1.844  1.00   7.84  ? 46   SER A N    1 
ATOM   747  C  CA   . SER A 1 47 ? 6.932  38.434 -3.262  1.00   7.81  ? 46   SER A CA   1 
ATOM   748  C  C    . SER A 1 47 ? 7.932  39.579 -3.539  1.00   7.96  ? 46   SER A C    1 
ATOM   749  O  O    . SER A 1 47 ? 8.521  39.631 -4.621  1.00   9.10  ? 46   SER A O    1 
ATOM   750  C  CB   . SER A 1 47 ? 5.596  38.745 -3.970  1.00   9.96  ? 46   SER A CB   1 
ATOM   751  O  OG   . SER A 1 47 ? 4.988  39.914 -3.427  1.00   10.77 ? 46   SER A OG   1 
ATOM   752  D  D    . SER A 1 47 ? 5.860  38.160 -1.543  1.00   10.15 ? 46   SER A D    1 
ATOM   753  D  DA   . SER A 1 47 ? 7.335  37.596 -3.686  1.00   11.16 ? 46   SER A DA   1 
ATOM   754  D  DB2  . SER A 1 47 ? 5.757  38.830 -4.962  1.00   12.66 ? 46   SER A DB2  1 
ATOM   755  D  DB3  . SER A 1 47 ? 5.011  37.979 -3.784  1.00   10.89 ? 46   SER A DB3  1 
ATOM   756  D  DG   . SER A 1 47 ? 5.312  40.638 -3.803  1.00   12.89 ? 46   SER A DG   1 
ATOM   757  N  N    . GLU A 1 48 ? 8.057  40.481 -2.585  1.00   8.18  ? 47   GLU A N    1 
ATOM   758  C  CA   . GLU A 1 48 ? 8.837  41.688 -2.776  1.00   8.74  ? 47   GLU A CA   1 
ATOM   759  C  C    . GLU A 1 48 ? 10.293 41.572 -2.289  1.00   7.38  ? 47   GLU A C    1 
ATOM   760  O  O    . GLU A 1 48 ? 10.950 42.592 -2.203  1.00   10.67 ? 47   GLU A O    1 
ATOM   761  C  CB   . GLU A 1 48 ? 8.136  42.919 -2.168  1.00   9.97  ? 47   GLU A CB   1 
ATOM   762  C  CG   . GLU A 1 48 ? 6.671  43.094 -2.612  1.00   12.94 ? 47   GLU A CG   1 
ATOM   763  C  CD   . GLU A 1 48 ? 6.540  42.990 -4.121  1.00   11.26 ? 47   GLU A CD   1 
ATOM   764  O  OE1  . GLU A 1 48 ? 6.990  43.947 -4.769  1.00   13.63 ? 47   GLU A OE1  1 
ATOM   765  O  OE2  . GLU A 1 48 ? 6.084  41.984 -4.685  1.00   11.37 ? 47   GLU A OE2  1 
ATOM   766  D  D    . GLU A 1 48 ? 7.629  40.386 -1.773  1.00   8.80  ? 47   GLU A D    1 
ATOM   767  D  DA   . GLU A 1 48 ? 8.934  41.880 -3.792  1.00   10.95 ? 47   GLU A DA   1 
ATOM   768  D  DB2  . GLU A 1 48 ? 8.160  42.839 -1.194  1.00   11.08 ? 47   GLU A DB2  1 
ATOM   769  D  DB3  . GLU A 1 48 ? 8.637  43.748 -2.389  1.00   13.02 ? 47   GLU A DB3  1 
ATOM   770  D  DG2  . GLU A 1 48 ? 6.145  42.392 -2.143  1.00   10.79 ? 47   GLU A DG2  1 
ATOM   771  D  DG3  . GLU A 1 48 ? 6.377  43.997 -2.335  1.00   13.37 ? 47   GLU A DG3  1 
ATOM   772  N  N    . PHE A 1 49 ? 10.726 40.365 -2.026  1.00   8.00  ? 48   PHE A N    1 
ATOM   773  C  CA   . PHE A 1 49 ? 12.114 40.097 -1.612  1.00   7.22  ? 48   PHE A CA   1 
ATOM   774  C  C    . PHE A 1 49 ? 12.895 39.489 -2.762  1.00   9.10  ? 48   PHE A C    1 
ATOM   775  O  O    . PHE A 1 49 ? 12.366 38.700 -3.538  1.00   10.59 ? 48   PHE A O    1 
ATOM   776  C  CB   . PHE A 1 49 ? 12.158 39.131 -0.432  1.00   10.40 ? 48   PHE A CB   1 
ATOM   777  C  CG   . PHE A 1 49 ? 11.826 39.777 0.901   1.00   8.94  ? 48   PHE A CG   1 
ATOM   778  C  CD1  . PHE A 1 49 ? 10.520 40.160 1.215   1.00   10.19 ? 48   PHE A CD1  1 
ATOM   779  C  CD2  . PHE A 1 49 ? 12.827 40.040 1.805   1.00   9.68  ? 48   PHE A CD2  1 
ATOM   780  C  CE1  . PHE A 1 49 ? 10.227 40.762 2.446   1.00   8.53  ? 48   PHE A CE1  1 
ATOM   781  C  CE2  . PHE A 1 49 ? 12.527 40.654 3.064   1.00   9.74  ? 48   PHE A CE2  1 
ATOM   782  C  CZ   . PHE A 1 49 ? 11.236 41.031 3.354   1.00   9.54  ? 48   PHE A CZ   1 
ATOM   783  D  D    . PHE A 1 49 ? 10.231 39.674 -2.071  1.00   27.43 ? 48   PHE A D    1 
ATOM   784  D  DA   . PHE A 1 49 ? 12.535 40.995 -1.383  1.00   7.85  ? 48   PHE A DA   1 
ATOM   785  D  DB2  . PHE A 1 49 ? 11.514 38.358 -0.599  1.00   11.19 ? 48   PHE A DB2  1 
ATOM   786  D  DB3  . PHE A 1 49 ? 13.114 38.788 -0.361  1.00   11.03 ? 48   PHE A DB3  1 
ATOM   787  D  DD1  . PHE A 1 49 ? 9.804  40.026 0.571   1.00   11.74 ? 48   PHE A DD1  1 
ATOM   788  D  DD2  . PHE A 1 49 ? 13.747 39.782 1.561   1.00   10.18 ? 48   PHE A DD2  1 
ATOM   789  D  DE1  . PHE A 1 49 ? 9.299  41.007 2.636   1.00   12.24 ? 48   PHE A DE1  1 
ATOM   790  D  DE2  . PHE A 1 49 ? 13.257 40.822 3.683   1.00   12.88 ? 48   PHE A DE2  1 
ATOM   791  D  DZ   . PHE A 1 49 ? 11.057 41.416 4.227   1.00   14.45 ? 48   PHE A DZ   1 
ATOM   792  N  N    . GLU A 1 50 ? 14.164 39.800 -2.804  1.00   9.67  ? 49   GLU A N    1 
ATOM   793  C  CA   . GLU A 1 50 ? 15.081 39.264 -3.771  1.00   10.43 ? 49   GLU A CA   1 
ATOM   794  C  C    . GLU A 1 50 ? 16.271 38.655 -3.031  1.00   9.32  ? 49   GLU A C    1 
ATOM   795  O  O    . GLU A 1 50 ? 16.833 39.248 -2.128  1.00   10.44 ? 49   GLU A O    1 
ATOM   796  C  CB   . GLU A 1 50 ? 15.509 40.369 -4.728  1.00   15.66 ? 49   GLU A CB   1 
ATOM   797  C  CG   . GLU A 1 50 ? 16.275 39.878 -5.903  1.00   24.96 ? 49   GLU A CG   1 
ATOM   798  C  CD   . GLU A 1 50 ? 16.678 41.021 -6.846  1.00   46.50 ? 49   GLU A CD   1 
ATOM   799  O  OE1  . GLU A 1 50 ? 16.631 42.199 -6.419  1.00   33.76 ? 49   GLU A OE1  1 
ATOM   800  O  OE2  . GLU A 1 50 ? 17.042 40.736 -8.012  1.00   40.65 ? 49   GLU A OE2  1 
ATOM   801  D  D    . GLU A 1 50 ? 14.478 40.403 -2.282  1.00   24.26 ? 49   GLU A D    1 
ATOM   802  D  DA   . GLU A 1 50 ? 14.585 38.544 -4.271  1.00   12.52 ? 49   GLU A DA   1 
ATOM   803  D  DB2  . GLU A 1 50 ? 14.697 40.749 -5.118  1.00   32.51 ? 49   GLU A DB2  1 
ATOM   804  D  DB3  . GLU A 1 50 ? 15.993 41.081 -4.273  1.00   14.65 ? 49   GLU A DB3  1 
ATOM   805  D  DG2  . GLU A 1 50 ? 17.066 39.401 -5.613  1.00   26.11 ? 49   GLU A DG2  1 
ATOM   806  D  DG3  . GLU A 1 50 ? 15.689 39.264 -6.384  1.00   38.90 ? 49   GLU A DG3  1 
ATOM   807  N  N    . LYS A 1 51 ? 16.727 37.506 -3.482  1.00   10.07 ? 50   LYS A N    1 
ATOM   808  C  CA   . LYS A 1 51 ? 17.884 36.874 -2.868  1.00   10.04 ? 50   LYS A CA   1 
ATOM   809  C  C    . LYS A 1 51 ? 19.182 37.571 -3.299  1.00   8.49  ? 50   LYS A C    1 
ATOM   810  O  O    . LYS A 1 51 ? 19.378 37.849 -4.499  1.00   10.21 ? 50   LYS A O    1 
ATOM   811  C  CB   . LYS A 1 51 ? 17.942 35.399 -3.265  1.00   14.00 ? 50   LYS A CB   1 
ATOM   812  C  CG   . LYS A 1 51 ? 18.962 34.596 -2.483  1.00   15.94 ? 50   LYS A CG   1 
ATOM   813  C  CD   . LYS A 1 51 ? 18.896 33.135 -2.979  1.00   20.36 ? 50   LYS A CD   1 
ATOM   814  C  CE   . LYS A 1 51 ? 19.460 32.230 -1.987  1.00   22.72 ? 50   LYS A CE   1 
ATOM   815  N  NZ   . LYS A 1 51 ? 19.391 30.803 -2.461  1.00   33.66 ? 50   LYS A NZ   1 
ATOM   816  D  D    . LYS A 1 51 ? 16.327 37.099 -4.191  1.00   14.08 ? 50   LYS A D    1 
ATOM   817  D  DA   . LYS A 1 51 ? 17.784 36.880 -1.857  1.00   9.08  ? 50   LYS A DA   1 
ATOM   818  D  DB2  . LYS A 1 51 ? 17.012 34.989 -3.148  1.00   13.65 ? 50   LYS A DB2  1 
ATOM   819  D  DB3  . LYS A 1 51 ? 18.188 35.356 -4.233  1.00   14.60 ? 50   LYS A DB3  1 
ATOM   820  D  DG2  . LYS A 1 51 ? 19.863 34.986 -2.628  1.00   18.90 ? 50   LYS A DG2  1 
ATOM   821  D  DG3  . LYS A 1 51 ? 18.767 34.635 -1.515  1.00   15.87 ? 50   LYS A DG3  1 
ATOM   822  D  DD2  . LYS A 1 51 ? 17.965 32.854 -3.065  1.00   24.73 ? 50   LYS A DD2  1 
ATOM   823  D  DD3  . LYS A 1 51 ? 19.350 33.036 -3.854  1.00   22.29 ? 50   LYS A DD3  1 
ATOM   824  D  DE2  . LYS A 1 51 ? 20.392 32.508 -1.849  1.00   24.96 ? 50   LYS A DE2  1 
ATOM   825  D  DE3  . LYS A 1 51 ? 18.940 32.303 -1.163  1.00   26.24 ? 50   LYS A DE3  1 
ATOM   826  D  DZ1  . LYS A 1 51 ? 19.777 30.761 -3.263  1.00   21.36 ? 50   LYS A DZ1  1 
ATOM   827  D  DZ2  . LYS A 1 51 ? 19.817 30.282 -1.865  1.00   35.10 ? 50   LYS A DZ2  1 
ATOM   828  D  DZ3  . LYS A 1 51 ? 18.549 30.516 -2.550  1.00   25.16 ? 50   LYS A DZ3  1 
ATOM   829  N  N    . LEU A 1 52 ? 20.062 37.832 -2.342  1.00   9.27  ? 51   LEU A N    1 
ATOM   830  C  CA   . LEU A 1 52 ? 21.352 38.488 -2.624  1.00   10.54 ? 51   LEU A CA   1 
ATOM   831  C  C    . LEU A 1 52 ? 22.404 37.480 -2.975  1.00   13.68 ? 51   LEU A C    1 
ATOM   832  O  O    . LEU A 1 52 ? 23.169 37.008 -2.140  1.00   23.63 ? 51   LEU A O    1 
ATOM   833  C  CB   . LEU A 1 52 ? 21.781 39.333 -1.414  1.00   11.15 ? 51   LEU A CB   1 
ATOM   834  C  CG   . LEU A 1 52 ? 20.775 40.457 -1.057  1.00   13.30 ? 51   LEU A CG   1 
ATOM   835  C  CD1  . LEU A 1 52 ? 21.279 41.273 0.192   1.00   15.03 ? 51   LEU A CD1  1 
ATOM   836  C  CD2  . LEU A 1 52 ? 20.509 41.415 -2.278  1.00   16.20 ? 51   LEU A CD2  1 
ATOM   837  D  D    . LEU A 1 52 ? 19.919 37.579 -1.479  1.00   10.17 ? 51   LEU A D    1 
ATOM   838  D  DA   . LEU A 1 52 ? 21.222 39.068 -3.453  1.00   10.90 ? 51   LEU A DA   1 
ATOM   839  D  DB2  . LEU A 1 52 ? 21.891 38.733 -0.621  1.00   11.90 ? 51   LEU A DB2  1 
ATOM   840  D  DB3  . LEU A 1 52 ? 22.666 39.804 -1.639  1.00   13.55 ? 51   LEU A DB3  1 
ATOM   841  D  DG   . LEU A 1 52 ? 19.890 40.004 -0.850  1.00   14.86 ? 51   LEU A DG   1 
ATOM   842  D  DD11 . LEU A 1 52 ? 22.137 41.680 -0.021  1.00   17.30 ? 51   LEU A DD11 1 
ATOM   843  D  DD12 . LEU A 1 52 ? 20.620 41.991 0.387   1.00   15.71 ? 51   LEU A DD12 1 
ATOM   844  D  DD13 . LEU A 1 52 ? 21.400 40.690 0.942   1.00   16.74 ? 51   LEU A DD13 1 
ATOM   845  D  DD21 . LEU A 1 52 ? 21.382 41.712 -2.570  1.00   15.88 ? 51   LEU A DD21 1 
ATOM   846  D  DD22 . LEU A 1 52 ? 20.067 40.946 -3.002  1.00   16.70 ? 51   LEU A DD22 1 
ATOM   847  D  DD23 . LEU A 1 52 ? 19.962 42.186 -2.022  1.00   15.97 ? 51   LEU A DD23 1 
ATOM   848  N  N    . GLU A 1 53 ? 22.502 37.288 -4.281  1.00   16.39 ? 52   GLU A N    1 
ATOM   849  C  CA   . GLU A 1 53 ? 23.413 36.349 -4.918  1.00   28.00 ? 52   GLU A CA   1 
ATOM   850  C  C    . GLU A 1 53 ? 23.278 36.703 -6.406  1.00   33.23 ? 52   GLU A C    1 
ATOM   851  O  O    . GLU A 1 53 ? 22.249 37.268 -6.818  1.00   28.95 ? 52   GLU A O    1 
ATOM   852  C  CB   . GLU A 1 53 ? 22.956 34.923 -4.683  1.00   37.54 ? 52   GLU A CB   1 
ATOM   853  C  CG   . GLU A 1 53 ? 21.866 34.505 -5.679  1.00   44.98 ? 52   GLU A CG   1 
ATOM   854  C  CD   . GLU A 1 53 ? 21.588 33.020 -5.632  1.00   54.74 ? 52   GLU A CD   1 
ATOM   855  O  OE1  . GLU A 1 53 ? 22.288 32.323 -4.861  1.00   31.70 ? 52   GLU A OE1  1 
ATOM   856  O  OE2  . GLU A 1 53 ? 20.688 32.560 -6.373  1.00   44.06 ? 52   GLU A OE2  1 
ATOM   857  D  D    . GLU A 1 53 ? 22.048 37.733 -4.869  0.38   15.48 ? 52   GLU A D    1 
ATOM   858  D  DA   . GLU A 1 53 ? 24.341 36.450 -4.604  1.00   31.79 ? 52   GLU A DA   1 
ATOM   859  D  DB2  . GLU A 1 53 ? 23.721 34.325 -4.793  1.00   58.12 ? 52   GLU A DB2  1 
ATOM   860  D  DB3  . GLU A 1 53 ? 22.613 34.848 -3.768  1.00   42.82 ? 52   GLU A DB3  1 
ATOM   861  D  DG2  . GLU A 1 53 ? 21.048 35.003 -5.499  1.00   25.22 ? 52   GLU A DG2  1 
ATOM   862  D  DG3  . GLU A 1 53 ? 22.159 34.701 -6.588  1.00   47.24 ? 52   GLU A DG3  1 
ATOM   863  N  N    . ASP A 1 54 ? 24.301 36.407 -7.204  1.00   34.59 ? 53   ASP A N    1 
ATOM   864  C  CA   . ASP A 1 54 ? 24.184 36.590 -8.662  1.00   43.60 ? 53   ASP A CA   1 
ATOM   865  C  C    . ASP A 1 54 ? 23.087 35.695 -9.279  1.00   51.55 ? 53   ASP A C    1 
ATOM   866  O  O    . ASP A 1 54 ? 22.835 34.559 -8.857  1.00   40.00 ? 53   ASP A O    1 
ATOM   867  C  CB   . ASP A 1 54 ? 25.536 36.377 -9.395  1.00   46.57 ? 53   ASP A CB   1 
ATOM   868  C  CG   . ASP A 1 54 ? 25.355 36.067 -10.869 1.00   51.02 ? 53   ASP A CG   1 
ATOM   869  O  OD1  . ASP A 1 54 ? 25.137 37.011 -11.660 1.00   51.17 ? 53   ASP A OD1  1 
ATOM   870  O  OD2  . ASP A 1 54 ? 25.430 34.876 -11.232 1.00   35.67 ? 53   ASP A OD2  1 
ATOM   871  O  OXT  . ASP A 1 54 ? 22.415 36.096 -10.234 1.00   54.73 ? 53   ASP A OXT  1 
ATOM   872  D  D    . ASP A 1 54 ? 25.070 36.135 -6.914  1.00   39.49 ? 53   ASP A D    1 
ATOM   873  D  DA   . ASP A 1 54 ? 23.913 37.523 -8.818  1.00   46.44 ? 53   ASP A DA   1 
ATOM   874  D  DB2  . ASP A 1 54 ? 26.053 37.197 -9.350  1.00   57.27 ? 53   ASP A DB2  1 
ATOM   875  D  DB3  . ASP A 1 54 ? 26.050 35.649 -9.003  1.00   50.71 ? 53   ASP A DB3  1 
HETATM 876  FE FE   . FE  B 2 .  ? 10.321 45.987 3.837   1.00   7.87  ? 1054 FE  A FE   1 
HETATM 877  D  D    . D8U C 3 .  ? 22.351 35.984 -2.026  0.62   17.10 ? 1055 D8U A D    1 
HETATM 878  D  D    . D8U D 3 .  ? 15.793 25.908 7.820   1.00   29.92 ? 1056 D8U A D    1 
HETATM 879  D  D    . D8U E 3 .  ? 8.532  44.175 -5.432  1.00   29.12 ? 1057 D8U A D    1 
HETATM 880  D  D    . D8U F 3 .  ? 24.835 34.706 8.760   1.00   30.32 ? 1058 D8U A D    1 
HETATM 881  O  O    . D3O G 4 .  ? 22.979 35.682 0.165   1.00   32.82 ? 1059 D3O A O    1 
HETATM 882  D  D1   . D3O G 4 .  ? 22.953 34.866 -0.225  1.00   26.12 ? 1059 D3O A D1   1 
HETATM 883  D  D2   . D3O G 4 .  ? 23.719 35.788 0.678   1.00   24.03 ? 1059 D3O A D2   1 
HETATM 884  D  D3   . D3O G 4 .  ? 22.943 36.320 -0.466  1.00   25.79 ? 1059 D3O A D3   1 
HETATM 885  O  O    . D3O H 4 .  ? 16.036 27.079 14.111  1.00   14.19 ? 1060 D3O A O    1 
HETATM 886  D  D1   . D3O H 4 .  ? 16.609 27.655 13.693  1.00   11.18 ? 1060 D3O A D1   1 
HETATM 887  D  D2   . D3O H 4 .  ? 15.953 26.348 13.608  1.00   16.03 ? 1060 D3O A D2   1 
HETATM 888  D  D3   . D3O H 4 .  ? 15.224 27.442 14.219  0.37   11.73 ? 1060 D3O A D3   1 
HETATM 889  O  O    . D3O I 4 .  ? 1.534  37.717 -2.061  1.00   23.24 ? 1061 D3O A O    1 
HETATM 890  D  D1   . D3O I 4 .  ? 1.162  37.139 -2.628  1.00   23.74 ? 1061 D3O A D1   1 
HETATM 891  D  D2   . D3O I 4 .  ? 1.069  37.756 -1.284  1.00   24.32 ? 1061 D3O A D2   1 
HETATM 892  D  D3   . D3O I 4 .  ? 1.578  38.522 -2.452  1.00   18.28 ? 1061 D3O A D3   1 
HETATM 893  O  O    . D3O J 4 .  ? 18.415 36.383 15.732  1.00   31.90 ? 1062 D3O A O    1 
HETATM 894  D  D1   . D3O J 4 .  ? 19.259 36.107 15.867  1.00   29.93 ? 1062 D3O A D1   1 
HETATM 895  D  D2   . D3O J 4 .  ? 18.015 35.821 15.166  1.00   25.47 ? 1062 D3O A D2   1 
HETATM 896  D  D3   . D3O J 4 .  ? 18.407 37.212 15.392  0.32   21.20 ? 1062 D3O A D3   1 
HETATM 897  O  O    . DOD K 5 .  ? 17.191 30.439 0.577   0.74   20.32 ? 2001 DOD A O    1 
HETATM 898  D  D1   . DOD K 5 .  ? 16.341 29.941 0.507   0.91   24.25 ? 2001 DOD A D1   1 
HETATM 899  D  D2   . DOD K 5 .  ? 17.353 30.612 1.527   1.00   20.04 ? 2001 DOD A D2   1 
HETATM 900  O  O    . DOD K 5 .  ? 3.991  37.018 2.391   1.00   13.55 ? 2002 DOD A O    1 
HETATM 901  D  D1   . DOD K 5 .  ? 3.233  36.441 2.539   0.79   24.22 ? 2002 DOD A D1   1 
HETATM 902  D  D2   . DOD K 5 .  ? 4.330  37.255 3.305   1.00   14.76 ? 2002 DOD A D2   1 
HETATM 903  O  O    . DOD K 5 .  ? 6.951  41.286 -7.289  1.00   21.26 ? 2003 DOD A O    1 
HETATM 904  D  D1   . DOD K 5 .  ? 7.570  40.549 -7.102  0.60   16.33 ? 2003 DOD A D1   1 
HETATM 905  D  D2   . DOD K 5 .  ? 6.561  41.520 -6.425  1.00   15.86 ? 2003 DOD A D2   1 
HETATM 906  O  O    . DOD K 5 .  ? 2.136  39.712 -3.353  1.00   14.11 ? 2005 DOD A O    1 
HETATM 907  D  D1   . DOD K 5 .  ? 1.739  40.582 -3.545  1.00   11.48 ? 2005 DOD A D1   1 
HETATM 908  D  D2   . DOD K 5 .  ? 3.101  39.836 -3.427  1.00   13.27 ? 2005 DOD A D2   1 
HETATM 909  O  O    . DOD K 5 .  ? 7.857  39.705 10.305  0.68   11.35 ? 2006 DOD A O    1 
HETATM 910  D  D1   . DOD K 5 .  ? 7.843  39.812 9.343   0.93   13.97 ? 2006 DOD A D1   1 
HETATM 911  D  D2   . DOD K 5 .  ? 8.683  39.205 10.563  0.64   9.22  ? 2006 DOD A D2   1 
HETATM 912  O  O    . DOD K 5 .  ? 5.186  44.275 9.596   1.00   23.87 ? 2007 DOD A O    1 
HETATM 913  D  D2   . DOD K 5 .  ? 5.976  44.078 9.044   0.98   18.55 ? 2007 DOD A D2   1 
HETATM 914  O  O    . DOD K 5 .  ? 13.426 39.649 15.273  1.00   15.88 ? 2009 DOD A O    1 
HETATM 915  D  D1   . DOD K 5 .  ? 12.717 39.449 14.606  1.00   22.13 ? 2009 DOD A D1   1 
HETATM 916  O  O    . DOD K 5 .  ? 11.104 28.980 12.098  1.00   19.86 ? 2010 DOD A O    1 
HETATM 917  D  D1   . DOD K 5 .  ? 12.005 28.838 11.743  0.79   15.63 ? 2010 DOD A D1   1 
HETATM 918  D  D2   . DOD K 5 .  ? 10.486 28.739 11.382  1.00   32.77 ? 2010 DOD A D2   1 
HETATM 919  O  O    . DOD K 5 .  ? 15.888 35.970 -6.227  1.00   22.42 ? 2011 DOD A O    1 
HETATM 920  D  D1   . DOD K 5 .  ? 15.617 36.754 -6.773  1.00   29.06 ? 2011 DOD A D1   1 
HETATM 921  D  D2   . DOD K 5 .  ? 15.187 35.864 -5.545  1.00   18.89 ? 2011 DOD A D2   1 
HETATM 922  O  O    . DOD K 5 .  ? 14.202 40.556 12.057  0.83   19.32 ? 2012 DOD A O    1 
HETATM 923  D  D1   . DOD K 5 .  ? 14.457 41.482 12.290  1.00   22.64 ? 2012 DOD A D1   1 
HETATM 924  D  D2   . DOD K 5 .  ? 13.225 40.464 12.150  0.59   15.87 ? 2012 DOD A D2   1 
HETATM 925  O  O    . DOD K 5 .  ? 1.321  38.639 3.141   0.85   18.00 ? 2013 DOD A O    1 
HETATM 926  D  D1   . DOD K 5 .  ? 2.058  38.168 2.693   0.67   29.96 ? 2013 DOD A D1   1 
HETATM 927  D  D2   . DOD K 5 .  ? 0.628  37.963 3.324   0.61   23.96 ? 2013 DOD A D2   1 
HETATM 928  O  O    . DOD K 5 .  ? 16.758 38.747 9.535   1.00   12.66 ? 2014 DOD A O    1 
HETATM 929  D  D1   . DOD K 5 .  ? 16.416 37.957 9.968   0.91   12.19 ? 2014 DOD A D1   1 
HETATM 930  D  D2   . DOD K 5 .  ? 15.944 39.290 9.356   1.00   13.36 ? 2014 DOD A D2   1 
HETATM 931  O  O    . DOD K 5 .  ? 0.354  38.487 5.639   0.75   23.50 ? 2015 DOD A O    1 
HETATM 932  D  D2   . DOD K 5 .  ? 0.541  38.315 6.587   0.36   22.25 ? 2015 DOD A D2   1 
HETATM 933  O  O    . DOD K 5 .  ? 23.655 37.197 12.097  0.38   31.58 ? 2016 DOD A O    1 
HETATM 934  D  D1   . DOD K 5 .  ? 23.403 37.294 11.151  1.00   27.00 ? 2016 DOD A D1   1 
HETATM 935  D  D2   . DOD K 5 .  ? 22.835 37.009 12.609  0.42   14.58 ? 2016 DOD A D2   1 
HETATM 936  O  O    . DOD K 5 .  ? 23.592 34.957 6.507   0.77   30.48 ? 2017 DOD A O    1 
HETATM 937  D  D1   . DOD K 5 .  ? 23.893 34.917 5.572   0.96   25.12 ? 2017 DOD A D1   1 
HETATM 938  D  D2   . DOD K 5 .  ? 22.617 34.826 6.496   0.73   24.30 ? 2017 DOD A D2   1 
HETATM 939  O  O    . DOD K 5 .  ? 15.868 47.708 -1.027  0.87   19.89 ? 2018 DOD A O    1 
HETATM 940  D  D1   . DOD K 5 .  ? 15.314 46.981 -0.691  0.31   9.45  ? 2018 DOD A D1   1 
HETATM 941  D  D2   . DOD K 5 .  ? 15.237 48.414 -1.289  0.34   13.10 ? 2018 DOD A D2   1 
HETATM 942  O  O    . DOD K 5 .  ? 16.478 39.114 13.279  1.00   22.10 ? 2021 DOD A O    1 
HETATM 943  D  D1   . DOD K 5 .  ? 16.137 40.010 13.059  1.00   36.48 ? 2021 DOD A D1   1 
HETATM 944  D  D2   . DOD K 5 .  ? 16.118 38.532 12.574  0.57   13.32 ? 2021 DOD A D2   1 
HETATM 945  O  O    . DOD K 5 .  ? 6.626  34.157 18.658  1.00   18.52 ? 2022 DOD A O    1 
HETATM 946  D  D1   . DOD K 5 .  ? 7.416  34.002 19.221  1.00   20.34 ? 2022 DOD A D1   1 
HETATM 947  D  D2   . DOD K 5 .  ? 6.073  33.335 18.673  0.53   13.82 ? 2022 DOD A D2   1 
HETATM 948  O  O    . DOD K 5 .  ? 10.621 39.790 -5.994  1.00   26.41 ? 2023 DOD A O    1 
HETATM 949  D  D1   . DOD K 5 .  ? 11.372 39.683 -5.372  0.93   22.50 ? 2023 DOD A D1   1 
HETATM 950  D  D2   . DOD K 5 .  ? 9.973  40.374 -5.542  0.50   13.88 ? 2023 DOD A D2   1 
HETATM 951  O  O    . DOD K 5 .  ? 4.085  36.414 -1.201  1.00   14.75 ? 2024 DOD A O    1 
HETATM 952  D  D1   . DOD K 5 .  ? 3.598  35.570 -1.097  0.0000 16.57 ? 2024 DOD A D1   1 
HETATM 953  D  D2   . DOD K 5 .  ? 3.417  37.102 -1.436  1.00   17.02 ? 2024 DOD A D2   1 
HETATM 954  O  O    . DOD K 5 .  ? 5.427  38.278 9.779   0.49   13.82 ? 2026 DOD A O    1 
HETATM 955  D  D1   . DOD K 5 .  ? 6.349  38.623 9.899   0.66   20.79 ? 2026 DOD A D1   1 
HETATM 956  D  D2   . DOD K 5 .  ? 5.200  37.735 10.566  0.87   26.01 ? 2026 DOD A D2   1 
HETATM 957  O  O    . DOD K 5 .  ? 6.147  41.165 11.615  0.79   25.84 ? 2027 DOD A O    1 
HETATM 958  D  D1   . DOD K 5 .  ? 5.689  42.017 11.414  1.00   22.99 ? 2027 DOD A D1   1 
HETATM 959  D  D2   . DOD K 5 .  ? 6.724  40.949 10.841  0.53   14.98 ? 2027 DOD A D2   1 
HETATM 960  O  O    . DOD K 5 .  ? 21.234 39.979 10.837  0.68   29.74 ? 2028 DOD A O    1 
HETATM 961  D  D1   . DOD K 5 .  ? 21.813 39.294 10.420  1.00   32.83 ? 2028 DOD A D1   1 
HETATM 962  D  D2   . DOD K 5 .  ? 21.400 39.966 11.810  1.00   38.53 ? 2028 DOD A D2   1 
HETATM 963  O  O    . DOD K 5 .  ? 8.243  29.072 11.524  1.00   28.91 ? 2029 DOD A O    1 
HETATM 964  D  D2   . DOD K 5 .  ? 7.781  29.203 12.384  1.00   35.69 ? 2029 DOD A D2   1 
HETATM 965  O  O    . DOD K 5 .  ? 6.324  35.713 11.924  0.37   21.68 ? 2030 DOD A O    1 
HETATM 966  D  D1   . DOD K 5 .  ? 5.456  35.789 11.472  1.00   33.46 ? 2030 DOD A D1   1 
HETATM 967  D  D2   . DOD K 5 .  ? 6.487  34.757 12.105  0.38   16.25 ? 2030 DOD A D2   1 
HETATM 968  O  O    . DOD K 5 .  ? -0.672 31.561 -0.014  1.00   28.86 ? 2031 DOD A O    1 
HETATM 969  O  O    . DOD K 5 .  ? 9.160  43.269 -7.191  1.00   26.50 ? 2032 DOD A O    1 
HETATM 970  O  O    . DOD K 5 .  ? 11.598 26.642 14.536  1.00   22.97 ? 2033 DOD A O    1 
HETATM 971  D  D1   . DOD K 5 .  ? 11.269 26.734 15.459  0.90   22.74 ? 2033 DOD A D1   1 
HETATM 972  D  D2   . DOD K 5 .  ? 12.429 27.158 14.501  1.00   25.81 ? 2033 DOD A D2   1 
HETATM 973  O  O    . DOD K 5 .  ? 14.149 42.355 15.992  1.00   38.14 ? 2034 DOD A O    1 
HETATM 974  D  D2   . DOD K 5 .  ? 13.259 42.631 16.306  1.00   31.96 ? 2034 DOD A D2   1 
HETATM 975  O  O    . DOD K 5 .  ? 12.533 36.302 -6.033  0.70   18.55 ? 2035 DOD A O    1 
HETATM 976  D  D2   . DOD K 5 .  ? 12.294 36.172 -5.088  0.92   30.75 ? 2035 DOD A D2   1 
HETATM 977  O  O    . DOD K 5 .  ? 1.192  43.612 5.094   0.76   22.94 ? 2037 DOD A O    1 
HETATM 978  D  D1   . DOD K 5 .  ? 1.063  43.990 5.993   1.00   26.01 ? 2037 DOD A D1   1 
HETATM 979  D  D2   . DOD K 5 .  ? 2.160  43.639 4.922   0.55   13.97 ? 2037 DOD A D2   1 
HETATM 980  O  O    . DOD K 5 .  ? 1.935  28.876 4.863   0.56   25.77 ? 2038 DOD A O    1 
HETATM 981  D  D1   . DOD K 5 .  ? 2.197  28.740 5.804   0.75   21.06 ? 2038 DOD A D1   1 
HETATM 982  D  D2   . DOD K 5 .  ? 2.552  28.344 4.316   0.77   25.03 ? 2038 DOD A D2   1 
HETATM 983  O  O    A DOD K 5 .  ? 15.727 43.216 -8.846  0.61   22.51 ? 2039 DOD A O    1 
HETATM 984  O  O    B DOD K 5 .  ? 16.524 42.525 -9.323  0.39   12.94 ? 2039 DOD A O    1 
HETATM 985  O  O    . DOD K 5 .  ? 26.806 36.712 -5.620  0.99   28.98 ? 2040 DOD A O    1 
HETATM 986  D  D1   . DOD K 5 .  ? 27.467 36.470 -4.926  0.43   21.38 ? 2040 DOD A D1   1 
HETATM 987  D  D2   . DOD K 5 .  ? 27.294 36.719 -6.474  0.76   33.31 ? 2040 DOD A D2   1 
HETATM 988  O  O    . DOD K 5 .  ? 23.403 32.200 -0.936  1.00   44.23 ? 2041 DOD A O    1 
HETATM 989  D  D1   . DOD K 5 .  ? 23.301 32.835 -1.680  1.00   26.28 ? 2041 DOD A D1   1 
HETATM 990  D  D2   . DOD K 5 .  ? 23.047 31.327 -1.231  1.00   33.62 ? 2041 DOD A D2   1 
HETATM 991  O  O    . DOD K 5 .  ? 21.967 34.084 14.085  0.71   15.36 ? 2042 DOD A O    1 
HETATM 992  D  D1   . DOD K 5 .  ? 22.692 34.679 13.786  1.00   34.09 ? 2042 DOD A D1   1 
HETATM 993  D  D2   . DOD K 5 .  ? 21.794 34.321 15.028  0.95   20.82 ? 2042 DOD A D2   1 
HETATM 994  O  O    . DOD K 5 .  ? 8.102  39.579 20.630  0.64   30.41 ? 2043 DOD A O    1 
HETATM 995  D  D1   . DOD K 5 .  ? 8.236  38.690 21.035  1.00   34.33 ? 2043 DOD A D1   1 
HETATM 996  D  D2   . DOD K 5 .  ? 7.316  39.517 20.037  0.68   30.32 ? 2043 DOD A D2   1 
HETATM 997  O  O    . DOD K 5 .  ? 13.938 26.688 11.280  1.00   28.11 ? 2044 DOD A O    1 
HETATM 998  D  D1   . DOD K 5 .  ? 13.794 27.643 11.079  0.34   10.98 ? 2044 DOD A D1   1 
HETATM 999  D  D2   . DOD K 5 .  ? 13.445 26.197 10.584  1.00   30.52 ? 2044 DOD A D2   1 
HETATM 1000 O  O    . DOD K 5 .  ? -1.931 36.932 3.466   1.00   26.82 ? 2046 DOD A O    1 
HETATM 1001 O  O    . DOD K 5 .  ? -6.109 40.182 22.419  1.00   26.43 ? 2047 DOD A O    1 
HETATM 1002 D  D2   . DOD K 5 .  ? -6.874 39.649 22.746  1.00   31.53 ? 2047 DOD A D2   1 
HETATM 1003 O  O    . DOD K 5 .  ? 19.527 39.964 15.062  0.75   26.88 ? 2048 DOD A O    1 
HETATM 1004 D  D1   . DOD K 5 .  ? 19.996 39.187 15.448  0.33   18.22 ? 2048 DOD A D1   1 
HETATM 1005 D  D2   . DOD K 5 .  ? 18.643 39.645 14.767  1.00   34.21 ? 2048 DOD A D2   1 
HETATM 1006 O  O    . DOD K 5 .  ? 14.103 46.309 19.571  1.00   33.77 ? 2049 DOD A O    1 
HETATM 1007 D  D1   . DOD K 5 .  ? 14.276 47.190 19.176  0.95   29.62 ? 2049 DOD A D1   1 
HETATM 1008 D  D2   . DOD K 5 .  ? 14.620 46.282 20.404  1.00   36.82 ? 2049 DOD A D2   1 
HETATM 1009 O  O    . DOD K 5 .  ? 21.130 42.093 8.542   1.00   32.97 ? 2050 DOD A O    1 
HETATM 1010 D  D1   . DOD K 5 .  ? 21.585 42.170 7.675   1.00   28.44 ? 2050 DOD A D1   1 
HETATM 1011 D  D2   . DOD K 5 .  ? 21.496 42.807 9.111   1.00   34.88 ? 2050 DOD A D2   1 
HETATM 1012 O  O    . DOD K 5 .  ? 18.818 40.341 10.893  0.74   25.67 ? 2051 DOD A O    1 
HETATM 1013 D  D1   . DOD K 5 .  ? 18.223 39.785 10.327  0.93   26.28 ? 2051 DOD A D1   1 
HETATM 1014 D  D2   . DOD K 5 .  ? 18.248 40.884 11.495  1.00   30.69 ? 2051 DOD A D2   1 
HETATM 1015 O  O    . DOD K 5 .  ? 18.073 34.770 18.144  0.54   14.66 ? 2052 DOD A O    1 
HETATM 1016 D  D1   . DOD K 5 .  ? 18.506 33.984 18.556  0.85   28.15 ? 2052 DOD A D1   1 
HETATM 1017 D  D2   . DOD K 5 .  ? 17.816 35.366 18.883  0.70   25.46 ? 2052 DOD A D2   1 
HETATM 1018 O  O    . DOD K 5 .  ? 3.573  34.208 0.409   1.00   23.52 ? 2053 DOD A O    1 
HETATM 1019 O  O    . DOD K 5 .  ? 25.074 29.801 9.100   0.78   19.24 ? 2054 DOD A O    1 
HETATM 1020 D  D1   . DOD K 5 .  ? 25.345 29.055 9.687   0.42   15.45 ? 2054 DOD A D1   1 
HETATM 1021 O  O    . DOD K 5 .  ? 12.030 39.181 21.880  1.00   25.01 ? 2055 DOD A O    1 
HETATM 1022 D  D2   . DOD K 5 .  ? 11.376 39.439 22.571  1.00   33.74 ? 2055 DOD A D2   1 
HETATM 1023 O  O    . DOD K 5 .  ? 11.811 36.499 20.418  1.00   27.32 ? 2056 DOD A O    1 
HETATM 1024 O  O    . DOD K 5 .  ? 17.264 49.900 -0.434  1.00   32.80 ? 2057 DOD A O    1 
HETATM 1025 D  D1   . DOD K 5 .  ? 17.858 50.044 -1.208  0.64   25.92 ? 2057 DOD A D1   1 
HETATM 1026 D  D2   . DOD K 5 .  ? 16.825 49.035 -0.577  0.54   23.48 ? 2057 DOD A D2   1 
HETATM 1027 O  O    . DOD K 5 .  ? 4.660  34.742 10.207  0.63   22.30 ? 2058 DOD A O    1 
HETATM 1028 D  D1   . DOD K 5 .  ? 4.771  33.850 10.611  0.76   22.76 ? 2058 DOD A D1   1 
HETATM 1029 D  D2   . DOD K 5 .  ? 3.860  34.696 9.632   0.60   21.72 ? 2058 DOD A D2   1 
HETATM 1030 O  O    . DOD K 5 .  ? -0.137 35.490 2.197   1.00   29.78 ? 2059 DOD A O    1 
HETATM 1031 O  O    . DOD K 5 .  ? 18.877 25.726 9.032   1.00   29.74 ? 2060 DOD A O    1 
HETATM 1032 O  O    . DOD K 5 .  ? 18.793 37.159 -7.357  1.00   44.15 ? 2062 DOD A O    1 
HETATM 1033 D  D1   . DOD K 5 .  ? 19.089 37.409 -6.453  1.00   27.73 ? 2062 DOD A D1   1 
HETATM 1034 O  O    . DOD K 5 .  ? 4.272  47.805 8.422   0.78   33.47 ? 2064 DOD A O    1 
HETATM 1035 D  D1   . DOD K 5 .  ? 5.124  48.156 8.768   0.97   27.91 ? 2064 DOD A D1   1 
HETATM 1036 D  D2   . DOD K 5 .  ? 4.218  46.865 8.703   0.59   25.77 ? 2064 DOD A D2   1 
HETATM 1037 O  O    . DOD K 5 .  ? 2.166  44.109 8.501   1.00   22.49 ? 2065 DOD A O    1 
HETATM 1038 O  O    . DOD K 5 .  ? 26.572 31.495 10.662  0.52   27.00 ? 2067 DOD A O    1 
HETATM 1039 D  D1   . DOD K 5 .  ? 26.397 31.175 11.576  0.45   17.16 ? 2067 DOD A D1   1 
HETATM 1040 O  O    . DOD K 5 .  ? 14.034 40.726 -11.068 1.00   24.03 ? 2068 DOD A O    1 
HETATM 1041 O  O    . DOD K 5 .  ? 14.506 52.009 0.059   1.00   32.39 ? 2069 DOD A O    1 
HETATM 1042 D  D2   . DOD K 5 .  ? 13.858 52.160 0.783   1.00   39.98 ? 2069 DOD A D2   1 
HETATM 1043 O  O    . DOD K 5 .  ? 9.449  46.561 -5.453  0.57   28.06 ? 2070 DOD A O    1 
HETATM 1044 D  D1   . DOD K 5 .  ? 9.925  47.420 -5.505  0.62   27.59 ? 2070 DOD A D1   1 
HETATM 1045 D  D2   . DOD K 5 .  ? 9.422  46.188 -6.360  0.74   26.47 ? 2070 DOD A D2   1 
HETATM 1046 O  O    . DOD K 5 .  ? 13.765 30.625 -4.087  0.48   15.43 ? 2071 DOD A O    1 
HETATM 1047 D  D1   . DOD K 5 .  ? 14.202 30.568 -3.208  0.27   11.54 ? 2071 DOD A D1   1 
HETATM 1048 O  O    . DOD K 5 .  ? 7.212  43.578 13.195  1.00   30.58 ? 2072 DOD A O    1 
HETATM 1049 O  O    . DOD K 5 .  ? 27.713 37.871 3.881   0.91   33.60 ? 2073 DOD A O    1 
HETATM 1050 D  D2   . DOD K 5 .  ? 27.809 38.606 4.531   1.00   30.17 ? 2073 DOD A D2   1 
HETATM 1051 O  O    . DOD K 5 .  ? 13.559 51.856 5.161   0.57   15.68 ? 2074 DOD A O    1 
HETATM 1052 D  D1   . DOD K 5 .  ? 14.058 51.258 4.557   0.31   10.17 ? 2074 DOD A D1   1 
HETATM 1053 D  D2   . DOD K 5 .  ? 13.384 52.679 4.650   0.76   31.30 ? 2074 DOD A D2   1 
HETATM 1054 O  O    A DOD K 5 .  ? 18.007 37.471 -11.453 0.39   20.65 ? 2075 DOD A O    1 
HETATM 1055 O  O    B DOD K 5 .  ? 18.114 38.046 -10.387 0.61   29.12 ? 2075 DOD A O    1 
HETATM 1056 O  O    . DOD K 5 .  ? 28.421 45.060 -14.190 1.00   45.48 ? 2076 DOD A O    1 
HETATM 1057 D  D1   . DOD K 5 .  ? 27.689 44.402 -14.177 1.00   36.93 ? 2076 DOD A D1   1 
HETATM 1058 D  D2   . DOD K 5 .  ? 28.275 45.634 -14.975 1.00   39.77 ? 2076 DOD A D2   1 
HETATM 1059 O  O    . DOD K 5 .  ? 16.866 29.916 -3.244  0.43   23.61 ? 2077 DOD A O    1 
HETATM 1060 D  D1   . DOD K 5 .  ? 16.274 29.587 -2.526  0.57   17.69 ? 2077 DOD A D1   1 
HETATM 1061 D  D2   . DOD K 5 .  ? 16.317 30.444 -3.870  0.53   15.12 ? 2077 DOD A D2   1 
HETATM 1062 O  O    . DOD K 5 .  ? 14.552 25.357 -2.486  0.48   12.85 ? 2078 DOD A O    1 
HETATM 1063 O  O    . DOD K 5 .  ? 2.510  40.473 10.219  0.95   26.54 ? 2079 DOD A O    1 
HETATM 1064 O  O    . DOD K 5 .  ? 0.326  41.397 3.583   0.38   22.97 ? 2080 DOD A O    1 
HETATM 1065 D  D1   . DOD K 5 .  ? 1.146  41.782 3.192   0.91   27.88 ? 2080 DOD A D1   1 
HETATM 1066 D  D2   . DOD K 5 .  ? -0.148 42.121 4.057   0.64   21.87 ? 2080 DOD A D2   1 
HETATM 1067 O  O    . DOD K 5 .  ? 3.000  27.964 8.631   1.00   24.82 ? 2081 DOD A O    1 
HETATM 1068 O  O    A DOD K 5 .  ? -2.633 38.126 0.513   0.60   18.80 ? 2082 DOD A O    1 
HETATM 1069 O  O    B DOD K 5 .  ? -3.015 37.930 1.918   0.40   16.98 ? 2082 DOD A O    1 
HETATM 1070 O  O    . DOD K 5 .  ? 8.638  28.658 9.744   1.00   30.49 ? 2083 DOD A O    1 
HETATM 1071 D  D1   . DOD K 5 .  ? 9.259  28.254 9.098   1.00   39.47 ? 2083 DOD A D1   1 
HETATM 1072 O  O    . DOD K 5 .  ? 26.070 36.665 -3.220  0.97   37.03 ? 2084 DOD A O    1 
HETATM 1073 D  D1   . DOD K 5 .  ? 25.891 36.922 -4.150  0.81   25.48 ? 2084 DOD A D1   1 
HETATM 1074 D  D2   . DOD K 5 .  ? 25.321 36.095 -2.939  0.58   27.61 ? 2084 DOD A D2   1 
HETATM 1075 O  O    . DOD K 5 .  ? 16.932 25.082 9.897   1.00   28.60 ? 2085 DOD A O    1 
HETATM 1076 O  O    . DOD K 5 .  ? 15.036 33.864 -6.077  1.00   29.19 ? 2086 DOD A O    1 
HETATM 1077 O  O    . DOD K 5 .  ? 1.098  33.108 -1.708  1.00   29.58 ? 2088 DOD A O    1 
HETATM 1078 O  O    . DOD K 5 .  ? -8.124 31.090 2.996   1.00   28.59 ? 2089 DOD A O    1 
HETATM 1079 O  O    . DOD K 5 .  ? 18.830 42.283 8.919   1.00   20.42 ? 2090 DOD A O    1 
HETATM 1080 D  D1   . DOD K 5 .  ? 18.258 41.777 8.292   0.58   13.80 ? 2090 DOD A D1   1 
HETATM 1081 D  D2   . DOD K 5 .  ? 18.356 42.264 9.787   0.79   24.80 ? 2090 DOD A D2   1 
HETATM 1082 O  O    . DOD K 5 .  ? -6.668 36.833 1.707   1.00   30.28 ? 2091 DOD A O    1 
HETATM 1083 O  O    . DOD K 5 .  ? 11.615 25.648 -2.561  0.76   22.30 ? 2093 DOD A O    1 
HETATM 1084 O  O    . DOD K 5 .  ? -1.520 32.118 3.355   1.00   37.45 ? 2094 DOD A O    1 
HETATM 1085 O  O    . DOD K 5 .  ? 22.404 29.081 1.689   1.00   29.94 ? 2095 DOD A O    1 
HETATM 1086 O  O    . DOD K 5 .  ? -1.994 42.593 5.979   0.57   24.73 ? 2096 DOD A O    1 
HETATM 1087 D  D1   . DOD K 5 .  ? -1.045 42.712 6.191   0.48   21.71 ? 2096 DOD A D1   1 
HETATM 1088 D  D2   . DOD K 5 .  ? -2.435 42.348 6.820   0.51   32.40 ? 2096 DOD A D2   1 
HETATM 1089 O  O    . DOD K 5 .  ? 11.840 25.567 8.999   1.00   27.21 ? 2097 DOD A O    1 
HETATM 1090 O  O    . DOD K 5 .  ? 10.174 26.884 10.948  1.00   28.89 ? 2098 DOD A O    1 
HETATM 1091 O  O    . DOD K 5 .  ? 6.869  29.079 2.947   1.00   30.59 ? 2099 DOD A O    1 
HETATM 1092 D  D1   . DOD K 5 .  ? 5.927  29.013 3.215   1.00   36.60 ? 2099 DOD A D1   1 
HETATM 1093 O  O    . DOD K 5 .  ? 12.583 31.501 -8.004  0.57   21.24 ? 2100 DOD A O    1 
HETATM 1094 D  D2   . DOD K 5 .  ? 12.980 32.298 -8.424  0.86   36.78 ? 2100 DOD A D2   1 
HETATM 1095 O  O    . DOD K 5 .  ? 28.174 32.154 9.402   1.00   33.16 ? 2101 DOD A O    1 
HETATM 1096 O  O    . DOD K 5 .  ? 25.420 34.614 1.061   0.49   33.26 ? 2102 DOD A O    1 
HETATM 1097 D  D1   . DOD K 5 .  ? 25.354 35.110 1.909   1.00   43.35 ? 2102 DOD A D1   1 
HETATM 1098 D  D2   . DOD K 5 .  ? 25.392 33.651 1.271   1.00   37.06 ? 2102 DOD A D2   1 
HETATM 1099 O  O    . DOD K 5 .  ? 6.855  30.874 12.461  0.35   20.81 ? 2103 DOD A O    1 
HETATM 1100 D  D1   . DOD K 5 .  ? 7.531  31.049 13.149  0.27   11.33 ? 2103 DOD A D1   1 
HETATM 1101 D  D2   . DOD K 5 .  ? 5.990  30.866 12.927  0.66   21.82 ? 2103 DOD A D2   1 
HETATM 1102 O  O    . DOD K 5 .  ? 5.740  33.172 12.313  1.00   25.38 ? 2104 DOD A O    1 
HETATM 1103 O  O    . DOD K 5 .  ? 6.558  46.790 -6.004  1.00   36.22 ? 2105 DOD A O    1 
HETATM 1104 D  D1   . DOD K 5 .  ? 6.800  46.252 -5.214  1.00   28.61 ? 2105 DOD A D1   1 
HETATM 1105 O  O    . DOD K 5 .  ? 14.552 41.624 -8.501  1.00   37.26 ? 2106 DOD A O    1 
HETATM 1106 O  O    . DOD K 5 .  ? 27.469 35.713 -2.274  1.00   26.42 ? 2107 DOD A O    1 
HETATM 1107 O  O    . DOD K 5 .  ? 8.903  36.948 20.247  1.00   25.85 ? 2108 DOD A O    1 
HETATM 1108 O  O    . DOD K 5 .  ? 16.398 39.605 16.231  1.00   34.36 ? 2109 DOD A O    1 
HETATM 1109 O  O    . DOD K 5 .  ? 26.576 32.845 7.301   1.00   27.94 ? 2110 DOD A O    1 
HETATM 1110 O  O    A DOD K 5 .  ? 14.355 37.734 -10.951 0.69   20.35 ? 2111 DOD A O    1 
HETATM 1111 O  O    B DOD K 5 .  ? 13.553 38.894 -10.173 0.31   13.99 ? 2111 DOD A O    1 
HETATM 1112 O  O    . DOD K 5 .  ? 13.795 47.060 -8.138  1.00   32.32 ? 2112 DOD A O    1 
HETATM 1113 O  O    . DOD K 5 .  ? 27.139 45.062 -17.233 1.00   33.52 ? 2113 DOD A O    1 
HETATM 1114 O  O    . DOD K 5 .  ? 9.927  25.429 -1.376  0.44   15.39 ? 2114 DOD A O    1 
HETATM 1115 O  O    . DOD K 5 .  ? 7.860  25.493 2.682   1.00   31.25 ? 2115 DOD A O    1 
HETATM 1116 O  O    . DOD K 5 .  ? 21.591 29.517 -0.346  0.90   28.30 ? 2116 DOD A O    1 
HETATM 1117 O  O    . DOD K 5 .  ? 15.371 32.873 -8.800  0.79   35.57 ? 2117 DOD A O    1 
HETATM 1118 O  O    . DOD K 5 .  ? 2.322  33.110 9.385   1.00   23.53 ? 2119 DOD A O    1 
HETATM 1119 O  O    . DOD K 5 .  ? 1.230  30.582 9.526   1.00   39.58 ? 2120 DOD A O    1 
HETATM 1120 O  O    . DOD K 5 .  ? -0.756 33.491 0.676   1.00   40.61 ? 2122 DOD A O    1 
HETATM 1121 O  O    . DOD K 5 .  ? 12.707 44.043 13.019  1.00   29.98 ? 2123 DOD A O    1 
HETATM 1122 O  O    . DOD K 5 .  ? 12.513 38.353 -5.741  0.99   25.71 ? 2124 DOD A O    1 
HETATM 1123 O  O    . DOD K 5 .  ? 11.391 34.233 -4.207  0.77   32.58 ? 2125 DOD A O    1 
HETATM 1124 D  D1   . DOD K 5 .  ? 11.057 35.103 -3.877  0.89   25.43 ? 2125 DOD A D1   1 
HETATM 1125 D  D2   . DOD K 5 .  ? 11.992 34.402 -4.977  0.83   31.76 ? 2125 DOD A D2   1 
HETATM 1126 O  O    . DOD K 5 .  ? 25.441 27.865 6.118   0.99   28.46 ? 2126 DOD A O    1 
HETATM 1127 O  O    . DOD K 5 .  ? 26.836 24.688 5.366   1.00   33.82 ? 2127 DOD A O    1 
HETATM 1128 O  O    A DOD K 5 .  ? 13.103 20.133 6.788   0.46   21.60 ? 2128 DOD A O    1 
HETATM 1129 O  O    B DOD K 5 .  ? 12.369 19.923 8.396   0.33   13.51 ? 2128 DOD A O    1 
HETATM 1130 O  O    C DOD K 5 .  ? 11.398 21.405 8.981   0.21   8.81  ? 2128 DOD A O    1 
HETATM 1131 O  O    . DOD K 5 .  ? 16.689 33.826 -7.613  1.00   30.98 ? 2130 DOD A O    1 
HETATM 1132 O  O    . DOD K 5 .  ? 19.001 34.659 -7.224  1.00   37.73 ? 2131 DOD A O    1 
HETATM 1133 O  O    . DOD K 5 .  ? 13.585 34.511 -9.113  1.00   24.66 ? 2132 DOD A O    1 
HETATM 1134 O  O    . DOD K 5 .  ? 16.239 31.023 -9.866  0.26   11.42 ? 2133 DOD A O    1 
HETATM 1135 O  O    . DOD K 5 .  ? 21.028 30.908 -4.106  0.59   25.15 ? 2136 DOD A O    1 
HETATM 1136 O  O    . DOD K 5 .  ? 11.342 45.398 18.690  1.00   25.02 ? 2138 DOD A O    1 
HETATM 1137 O  O    . DOD K 5 .  ? 10.425 41.459 20.593  1.00   29.13 ? 2139 DOD A O    1 
HETATM 1138 O  O    . DOD K 5 .  ? 23.522 35.850 21.320  1.00   32.78 ? 2140 DOD A O    1 
HETATM 1139 O  O    . DOD K 5 .  ? 22.082 37.485 22.619  0.95   28.38 ? 2141 DOD A O    1 
HETATM 1140 O  O    . DOD K 5 .  ? 7.795  44.552 -9.013  1.00   38.56 ? 2143 DOD A O    1 
HETATM 1141 O  O    . DOD K 5 .  ? 16.086 38.361 -8.364  1.00   25.29 ? 2145 DOD A O    1 
HETATM 1142 O  O    . DOD K 5 .  ? 14.073 44.660 -8.405  1.00   31.01 ? 2146 DOD A O    1 
HETATM 1143 O  O    . DOD K 5 .  ? 12.340 47.841 -6.671  1.00   34.76 ? 2147 DOD A O    1 
HETATM 1144 O  O    . DOD K 5 .  ? 17.052 44.424 -19.014 0.40   12.27 ? 2148 DOD A O    1 
HETATM 1145 O  O    . DOD K 5 .  ? 16.347 46.437 -16.673 0.28   7.41  ? 2149 DOD A O    1 
HETATM 1146 O  O    . DOD K 5 .  ? 17.583 46.930 -13.108 0.94   34.14 ? 2152 DOD A O    1 
HETATM 1147 O  O    . DOD K 5 .  ? 3.918  50.652 10.268  1.00   35.76 ? 2153 DOD A O    1 
HETATM 1148 O  O    . DOD K 5 .  ? 3.957  42.078 13.048  0.47   18.37 ? 2154 DOD A O    1 
HETATM 1149 O  O    . DOD K 5 .  ? 2.029  42.160 14.482  0.23   12.05 ? 2155 DOD A O    1 
HETATM 1150 O  O    . DOD K 5 .  ? 0.628  26.140 8.915   1.00   33.24 ? 2157 DOD A O    1 
HETATM 1151 O  O    . DOD K 5 .  ? 0.022  28.160 10.652  1.00   30.58 ? 2158 DOD A O    1 
HETATM 1152 O  O    . DOD K 5 .  ? 13.307 38.462 -7.798  1.00   34.91 ? 2159 DOD A O    1 
HETATM 1153 O  O    . DOD K 5 .  ? 9.048  23.687 13.473  1.00   32.49 ? 2160 DOD A O    1 
HETATM 1154 O  O    . DOD K 5 .  ? -1.244 34.000 3.891   1.00   33.26 ? 2161 DOD A O    1 
HETATM 1155 O  O    . DOD K 5 .  ? 24.395 36.623 9.231   1.00   34.25 ? 2162 DOD A O    1 
HETATM 1156 O  O    . DOD K 5 .  ? 16.846 42.098 15.433  1.00   32.84 ? 2163 DOD A O    1 
HETATM 1157 O  O    A DOD K 5 .  ? 14.168 25.235 1.216   0.71   22.63 ? 2164 DOD A O    1 
HETATM 1158 O  O    B DOD K 5 .  ? 13.639 24.269 1.789   0.29   8.20  ? 2164 DOD A O    1 
HETATM 1159 O  O    . DOD K 5 .  ? 8.839  25.025 0.238   1.00   33.68 ? 2165 DOD A O    1 
HETATM 1160 O  O    . DOD K 5 .  ? 0.498  42.126 7.075   1.00   27.69 ? 2166 DOD A O    1 
HETATM 1161 O  O    . DOD K 5 .  ? 13.086 53.165 2.388   1.00   37.33 ? 2167 DOD A O    1 
HETATM 1162 O  O    . DOD K 5 .  ? 20.606 28.630 -6.557  1.00   26.71 ? 2169 DOD A O    1 
HETATM 1163 O  O    . DOD K 5 .  ? 2.367  47.654 6.446   0.68   27.95 ? 2170 DOD A O    1 
HETATM 1164 D  D1   . DOD K 5 .  ? 1.633  47.016 6.287   0.40   14.85 ? 2170 DOD A D1   1 
HETATM 1165 D  D2   . DOD K 5 .  ? 2.451  48.195 5.632   0.74   24.93 ? 2170 DOD A D2   1 
HETATM 1166 O  O    . DOD K 5 .  ? -3.026 34.051 6.643   0.76   35.27 ? 2174 DOD A O    1 
HETATM 1167 O  O    . DOD K 5 .  ? -6.107 37.800 6.548   1.00   34.91 ? 2175 DOD A O    1 
HETATM 1168 O  O    . DOD K 5 .  ? 25.643 35.007 -1.493  0.85   39.21 ? 2176 DOD A O    1 
HETATM 1169 D  D1   . DOD K 5 .  ? 24.820 35.463 -1.209  0.67   24.06 ? 2176 DOD A D1   1 
HETATM 1170 D  D2   . DOD K 5 .  ? 26.371 35.384 -0.946  0.54   25.10 ? 2176 DOD A D2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  ALA 2  1  1  ALA ALA A . n 
A 1 3  LYS 3  2  2  LYS LYS A . n 
A 1 4  TRP 4  3  3  TRP TRP A . n 
A 1 5  VAL 5  4  4  VAL VAL A . n 
A 1 6  CYS 6  5  5  CYS CYS A . n 
A 1 7  LYS 7  6  6  LYS LYS A . n 
A 1 8  ILE 8  7  7  ILE ILE A . n 
A 1 9  CYS 9  8  8  CYS CYS A . n 
A 1 10 GLY 10 9  9  GLY GLY A . n 
A 1 11 TYR 11 10 10 TYR TYR A . n 
A 1 12 ILE 12 11 11 ILE ILE A . n 
A 1 13 TYR 13 12 12 TYR TYR A . n 
A 1 14 ASP 14 13 13 ASP ASP A . n 
A 1 15 GLU 15 14 14 GLU GLU A . n 
A 1 16 ASP 16 15 15 ASP ASP A . n 
A 1 17 ALA 17 16 16 ALA ALA A . n 
A 1 18 GLY 18 17 17 GLY GLY A . n 
A 1 19 ASP 19 18 18 ASP ASP A . n 
A 1 20 PRO 20 19 19 PRO PRO A . n 
A 1 21 ASP 21 20 20 ASP ASP A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 GLY 23 22 22 GLY GLY A . n 
A 1 24 ILE 24 23 23 ILE ILE A . n 
A 1 25 SER 25 24 24 SER SER A . n 
A 1 26 PRO 26 25 25 PRO PRO A . n 
A 1 27 GLY 27 26 26 GLY GLY A . n 
A 1 28 THR 28 27 27 THR THR A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 PHE 30 29 29 PHE PHE A . n 
A 1 31 GLU 31 30 30 GLU GLU A . n 
A 1 32 GLU 32 31 31 GLU GLU A . n 
A 1 33 LEU 33 32 32 LEU LEU A . n 
A 1 34 PRO 34 33 33 PRO PRO A . n 
A 1 35 ASP 35 34 34 ASP ASP A . n 
A 1 36 ASP 36 35 35 ASP ASP A . n 
A 1 37 TRP 37 36 36 TRP TRP A . n 
A 1 38 VAL 38 37 37 VAL VAL A . n 
A 1 39 CYS 39 38 38 CYS CYS A . n 
A 1 40 PRO 40 39 39 PRO PRO A . n 
A 1 41 ILE 41 40 40 ILE ILE A . n 
A 1 42 CYS 42 41 41 CYS CYS A . n 
A 1 43 GLY 43 42 42 GLY GLY A . n 
A 1 44 ALA 44 43 43 ALA ALA A . n 
A 1 45 PRO 45 44 44 PRO PRO A . n 
A 1 46 LYS 46 45 45 LYS LYS A . n 
A 1 47 SER 47 46 46 SER SER A . n 
A 1 48 GLU 48 47 47 GLU GLU A . n 
A 1 49 PHE 49 48 48 PHE PHE A . n 
A 1 50 GLU 50 49 49 GLU GLU A . n 
A 1 51 LYS 51 50 50 LYS LYS A . n 
A 1 52 LEU 52 51 51 LEU LEU A . n 
A 1 53 GLU 53 52 52 GLU GLU A . n 
A 1 54 ASP 54 53 53 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1   1054 1054 FE  FE  A . 
C 3 D8U 1   1055 1055 D8U D8U A . 
D 3 D8U 1   1056 1056 D8U D8U A . 
E 3 D8U 1   1057 1057 D8U D8U A . 
F 3 D8U 1   1058 1058 D8U D8U A . 
G 4 D3O 1   1059 1059 D3O D3O A . 
H 4 D3O 1   1060 1060 D3O D3O A . 
I 4 D3O 1   1061 1061 D3O D3O A . 
J 4 D3O 1   1062 1062 D3O D3O A . 
K 5 DOD 1   2001 2001 DOD DOD A . 
K 5 DOD 2   2002 2002 DOD DOD A . 
K 5 DOD 3   2003 2003 DOD DOD A . 
K 5 DOD 4   2005 2005 DOD DOD A . 
K 5 DOD 5   2006 2006 DOD DOD A . 
K 5 DOD 6   2007 2007 DOD DOD A . 
K 5 DOD 7   2009 2009 DOD DOD A . 
K 5 DOD 8   2010 2010 DOD DOD A . 
K 5 DOD 9   2011 2011 DOD DOD A . 
K 5 DOD 10  2012 2012 DOD DOD A . 
K 5 DOD 11  2013 2013 DOD DOD A . 
K 5 DOD 12  2014 2014 DOD DOD A . 
K 5 DOD 13  2015 2015 DOD DOD A . 
K 5 DOD 14  2016 2016 DOD DOD A . 
K 5 DOD 15  2017 2017 DOD DOD A . 
K 5 DOD 16  2018 2018 DOD DOD A . 
K 5 DOD 17  2021 2021 DOD DOD A . 
K 5 DOD 18  2022 2022 DOD DOD A . 
K 5 DOD 19  2023 2023 DOD DOD A . 
K 5 DOD 20  2024 2024 DOD DOD A . 
K 5 DOD 21  2026 2026 DOD DOD A . 
K 5 DOD 22  2027 2027 DOD DOD A . 
K 5 DOD 23  2028 2028 DOD DOD A . 
K 5 DOD 24  2029 2029 DOD DOD A . 
K 5 DOD 25  2030 2030 DOD DOD A . 
K 5 DOD 26  2031 2031 DOD DOD A . 
K 5 DOD 27  2032 2032 DOD DOD A . 
K 5 DOD 28  2033 2033 DOD DOD A . 
K 5 DOD 29  2034 2034 DOD DOD A . 
K 5 DOD 30  2035 2035 DOD DOD A . 
K 5 DOD 31  2037 2037 DOD DOD A . 
K 5 DOD 32  2038 2038 DOD DOD A . 
K 5 DOD 33  2039 2039 DOD DOD A . 
K 5 DOD 34  2040 2040 DOD DOD A . 
K 5 DOD 35  2041 2041 DOD DOD A . 
K 5 DOD 36  2042 2042 DOD DOD A . 
K 5 DOD 37  2043 2043 DOD DOD A . 
K 5 DOD 38  2044 2044 DOD DOD A . 
K 5 DOD 39  2046 2046 DOD DOD A . 
K 5 DOD 40  2047 2047 DOD DOD A . 
K 5 DOD 41  2048 2048 DOD DOD A . 
K 5 DOD 42  2049 2049 DOD DOD A . 
K 5 DOD 43  2050 2050 DOD DOD A . 
K 5 DOD 44  2051 2051 DOD DOD A . 
K 5 DOD 45  2052 2052 DOD DOD A . 
K 5 DOD 46  2053 2053 DOD DOD A . 
K 5 DOD 47  2054 2054 DOD DOD A . 
K 5 DOD 48  2055 2055 DOD DOD A . 
K 5 DOD 49  2056 2056 DOD DOD A . 
K 5 DOD 50  2057 2057 DOD DOD A . 
K 5 DOD 51  2058 2058 DOD DOD A . 
K 5 DOD 52  2059 2059 DOD DOD A . 
K 5 DOD 53  2060 2060 DOD DOD A . 
K 5 DOD 54  2062 2062 DOD DOD A . 
K 5 DOD 55  2064 2064 DOD DOD A . 
K 5 DOD 56  2065 2065 DOD DOD A . 
K 5 DOD 57  2067 2067 DOD DOD A . 
K 5 DOD 58  2068 2068 DOD DOD A . 
K 5 DOD 59  2069 2069 DOD DOD A . 
K 5 DOD 60  2070 2070 DOD DOD A . 
K 5 DOD 61  2071 2071 DOD DOD A . 
K 5 DOD 62  2072 2072 DOD DOD A . 
K 5 DOD 63  2073 2073 DOD DOD A . 
K 5 DOD 64  2074 2074 DOD DOD A . 
K 5 DOD 65  2075 2075 DOD DOD A . 
K 5 DOD 66  2076 2076 DOD DOD A . 
K 5 DOD 67  2077 2077 DOD DOD A . 
K 5 DOD 68  2078 2078 DOD DOD A . 
K 5 DOD 69  2079 2079 DOD DOD A . 
K 5 DOD 70  2080 2080 DOD DOD A . 
K 5 DOD 71  2081 2081 DOD DOD A . 
K 5 DOD 72  2082 2082 DOD DOD A . 
K 5 DOD 73  2083 2083 DOD DOD A . 
K 5 DOD 74  2084 2084 DOD DOD A . 
K 5 DOD 75  2085 2085 DOD DOD A . 
K 5 DOD 76  2086 2086 DOD DOD A . 
K 5 DOD 77  2088 2088 DOD DOD A . 
K 5 DOD 78  2089 2089 DOD DOD A . 
K 5 DOD 79  2090 2090 DOD DOD A . 
K 5 DOD 80  2091 2091 DOD DOD A . 
K 5 DOD 81  2093 2093 DOD DOD A . 
K 5 DOD 82  2094 2094 DOD DOD A . 
K 5 DOD 83  2095 2095 DOD DOD A . 
K 5 DOD 84  2096 2096 DOD DOD A . 
K 5 DOD 85  2097 2097 DOD DOD A . 
K 5 DOD 86  2098 2098 DOD DOD A . 
K 5 DOD 87  2099 2099 DOD DOD A . 
K 5 DOD 88  2100 2100 DOD DOD A . 
K 5 DOD 89  2101 2101 DOD DOD A . 
K 5 DOD 90  2102 2102 DOD DOD A . 
K 5 DOD 91  2103 2103 DOD DOD A . 
K 5 DOD 92  2104 2104 DOD DOD A . 
K 5 DOD 93  2105 2105 DOD DOD A . 
K 5 DOD 94  2106 2106 DOD DOD A . 
K 5 DOD 95  2107 2107 DOD DOD A . 
K 5 DOD 96  2108 2108 DOD DOD A . 
K 5 DOD 97  2109 2109 DOD DOD A . 
K 5 DOD 98  2110 2110 DOD DOD A . 
K 5 DOD 99  2111 2111 DOD DOD A . 
K 5 DOD 100 2112 2112 DOD DOD A . 
K 5 DOD 101 2113 2113 DOD DOD A . 
K 5 DOD 102 2114 2114 DOD DOD A . 
K 5 DOD 103 2115 2115 DOD DOD A . 
K 5 DOD 104 2116 2116 DOD DOD A . 
K 5 DOD 105 2117 2117 DOD DOD A . 
K 5 DOD 106 2119 2119 DOD DOD A . 
K 5 DOD 107 2120 2120 DOD DOD A . 
K 5 DOD 108 2122 2122 DOD DOD A . 
K 5 DOD 109 2123 2123 DOD DOD A . 
K 5 DOD 110 2124 2124 DOD DOD A . 
K 5 DOD 111 2125 2125 DOD DOD A . 
K 5 DOD 112 2126 2126 DOD DOD A . 
K 5 DOD 113 2127 2127 DOD DOD A . 
K 5 DOD 114 2128 2128 DOD DOD A . 
K 5 DOD 115 2130 2130 DOD DOD A . 
K 5 DOD 116 2131 2131 DOD DOD A . 
K 5 DOD 117 2132 2132 DOD DOD A . 
K 5 DOD 118 2133 2133 DOD DOD A . 
K 5 DOD 119 2136 2136 DOD DOD A . 
K 5 DOD 120 2138 2138 DOD DOD A . 
K 5 DOD 121 2139 2139 DOD DOD A . 
K 5 DOD 122 2140 2140 DOD DOD A . 
K 5 DOD 123 2141 2141 DOD DOD A . 
K 5 DOD 124 2143 2143 DOD DOD A . 
K 5 DOD 125 2145 2145 DOD DOD A . 
K 5 DOD 126 2146 2146 DOD DOD A . 
K 5 DOD 127 2147 2147 DOD DOD A . 
K 5 DOD 128 2148 2148 DOD DOD A . 
K 5 DOD 129 2149 2149 DOD DOD A . 
K 5 DOD 130 2152 2152 DOD DOD A . 
K 5 DOD 131 2153 2153 DOD DOD A . 
K 5 DOD 132 2154 2154 DOD DOD A . 
K 5 DOD 133 2155 2155 DOD DOD A . 
K 5 DOD 134 2157 2157 DOD DOD A . 
K 5 DOD 135 2158 2158 DOD DOD A . 
K 5 DOD 136 2159 2159 DOD DOD A . 
K 5 DOD 137 2160 2160 DOD DOD A . 
K 5 DOD 138 2161 2161 DOD DOD A . 
K 5 DOD 139 2162 2162 DOD DOD A . 
K 5 DOD 140 2163 2163 DOD DOD A . 
K 5 DOD 141 2164 2164 DOD DOD A . 
K 5 DOD 142 2165 2165 DOD DOD A . 
K 5 DOD 143 2166 2166 DOD DOD A . 
K 5 DOD 144 2167 2167 DOD DOD A . 
K 5 DOD 145 2169 2169 DOD DOD A . 
K 5 DOD 146 2170 2170 DOD DOD A . 
K 5 DOD 147 2174 2174 DOD DOD A . 
K 5 DOD 148 2175 2175 DOD DOD A . 
K 5 DOD 149 2176 2176 DOD DOD A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 6  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 1054 ? 1_555 SG ? A CYS 9  ? A CYS 8  ? 1_555 115.2 ? 
2 SG ? A CYS 6  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 1054 ? 1_555 SG ? A CYS 39 ? A CYS 38 ? 1_555 105.8 ? 
3 SG ? A CYS 9  ? A CYS 8  ? 1_555 FE ? B FE . ? A FE 1054 ? 1_555 SG ? A CYS 39 ? A CYS 38 ? 1_555 102.7 ? 
4 SG ? A CYS 6  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 1054 ? 1_555 SG ? A CYS 42 ? A CYS 41 ? 1_555 108.0 ? 
5 SG ? A CYS 9  ? A CYS 8  ? 1_555 FE ? B FE . ? A FE 1054 ? 1_555 SG ? A CYS 42 ? A CYS 41 ? 1_555 112.1 ? 
6 SG ? A CYS 39 ? A CYS 38 ? 1_555 FE ? B FE . ? A FE 1054 ? 1_555 SG ? A CYS 42 ? A CYS 41 ? 1_555 112.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-01-16 
2 'Structure model' 1 1 2013-03-06 
3 'Structure model' 1 2 2013-08-14 
4 'Structure model' 1 3 2017-03-22 
5 'Structure model' 1 4 2019-08-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Atomic model'        
3 4 'Structure model' 'Data collection'     
4 5 'Structure model' 'Data collection'     
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            reflns 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_reflns.pdbx_Rrim_I_all'       
2 5 'Structure model' '_reflns.pdbx_Rsym_value'       
3 5 'Structure model' '_reflns.pdbx_netI_over_sigmaI' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX  refinement       '(PHENIX.REFINE)' ? 1 
RETREAT 'data reduction' .                 ? 2 
RETREAT 'data scaling'   .                 ? 3 
# 
_pdbx_entry_details.entry_id             4AR3 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'M IN POSITION 0' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A LEU 51   ? ? D A D8U 1055 ? ? 1.32 
2 1 D3  A D3O 1061 ? ? O A DOD 2005 ? ? 1.59 
3 1 O   A DOD 2029 ? ? O A DOD 2083 ? ? 1.87 
4 1 OD1 A ASP 35   ? ? O A DOD 2119 ? ? 1.95 
5 1 O   A DOD 2094 ? ? O A DOD 2161 ? ? 1.98 
6 1 O   A DOD 2031 ? ? O A DOD 2122 ? ? 2.05 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A DOD 2107 ? ? 1_555 O A DOD 2140 ? ? 2_674 1.93 
2 1 OXT A ASP 53   ? ? 1_555 O A DOD 2153 ? ? 4_575 2.03 
3 1 O   A DOD 2076 ? ? 1_555 O A DOD 2123 ? ? 4_575 2.04 
4 1 O   A DOD 2047 ? ? 1_555 O A DOD 2095 ? ? 2_575 2.06 
5 1 O   A DOD 2095 ? ? 1_555 O A DOD 2138 ? ? 3_645 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 18 ? ? -153.70 67.77 
2 1 ASP A 18 ? ? -153.70 68.24 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A DOD 2047 ? 15.08 .    
2  1 O ? A DOD 2076 ? 9.05  .    
3  1 O ? A DOD 2089 ? 9.88  .    
4  1 O ? A DOD 2091 ? .     9.07 
5  1 O ? A DOD 2096 ? 6.06  .    
6  1 O ? A DOD 2100 ? 7.01  .    
7  1 O ? A DOD 2113 ? 9.99  .    
8  1 O ? A DOD 2117 ? 5.85  .    
9  1 O ? A DOD 2127 ? 6.91  .    
10 1 O ? A DOD 2132 ? 7.08  .    
11 1 O ? A DOD 2133 ? 5.86  .    
12 1 O ? A DOD 2140 ? .     7.59 
13 1 O ? A DOD 2141 ? .     7.88 
14 1 O ? A DOD 2148 ? 11.60 .    
15 1 O ? A DOD 2149 ? 10.39 .    
16 1 O ? A DOD 2152 ? 8.04  .    
17 1 O ? A DOD 2157 ? 7.28  .    
18 1 O ? A DOD 2158 ? 6.10  .    
19 1 O ? A DOD 2160 ? 6.81  .    
20 1 O ? A DOD 2175 ? 7.36  .    
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION'       FE  
3 'deuterium(1+)'      D8U 
4 trideuteriooxidanium D3O 
5 water                DOD 
#