data_4ARA
# 
_entry.id   4ARA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ARA         
PDBE  EBI-52170    
WWPDB D_1290052170 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE' 
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM' 
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- DECIDIUM COMPLEX' 
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN' 
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX' 
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- GALLAMINE COMPLEX' 
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- PROPIDIUM COMPLEX' 
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- TZ2PA6SYN COMPLEX' 
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE- TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2C0Q unspecified 'NON-AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN' 
PDB 2H9Y unspecified 
'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 2HA0 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH 4-KETOAMYLTRIMETHYLAMMONIUM' 
PDB 2HA2 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH SUCCINYLCHOLINE' 
PDB 2HA3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEXEDWITH CHOLINE' 
PDB 2HA4 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH ACETYLCHOLINE' 
PDB 2HA5 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF ACETYLCHOLINESTERASECOMPLEXED WITH ACETYLTHIOCHOLINE' 
PDB 2HA6 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH SUCCINYLCHOLINE' 
PDB 2HA7 unspecified 'CRYSTAL STRUCTURE OF MUTANT S203A OF MOUSEACETYLCHOLINESTERASE COMPLEXED WITH BUTYRYLTHIOCHOLINE' 
PDB 2JEY unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH HLO-7' 
PDB 2JEZ unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND HLO-7' 
PDB 2JF0 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH TABUN AND ORTHO-7' 
PDB 2JGE unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED METHAMIDOPHOS' 
PDB 2JGF unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED FENAMIPHOS' 
PDB 2JGG unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED SARIN' 
PDB 2JGH unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED VX' 
PDB 2JGI unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY NON-AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2JGJ unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED METHAMIDOPHOS' 
PDB 2JGK unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED FENAMIPHOS' 
PDB 2JGL unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED VX AND SARIN' 
PDB 2JGM unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY AGED DIISOPROPYL FLUOROPHOSPHATE (DFP)' 
PDB 2WHP unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN AND IN COMPLEX WITH HI-6' 
PDB 2WHQ unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE, PHOSPHONYLATED BY SARIN (AGED) IN COMPLEX WITH HI-6' 
PDB 2WHR unspecified 'CRYSTAL STRUCTURE OF ACETYLCHOLINESTERASE IN COMPLEX WITH K027' 
PDB 2WLS unspecified 'CRYSTAL STRUCTURE OF MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH AMTS13' 
PDB 2WU3 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND HI-6' 
PDB 2WU4 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN COMPLEX WITH FENAMIPHOS AND ORTHO-7' 
PDB 2XUD unspecified 'CRYSTAL STRUCTURE OF THE Y337A MUTANT OF MOUSE ACETYLCHOLINESTERASE' 
PDB 2XUF unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 1 MTH)' 
PDB 2XUG unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 1 WK)' 
PDB 2XUH unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 ANTI COMPLEX ( 10 MTH)' 
PDB 2XUI unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 WK)' 
PDB 2XUJ unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX (1 MTH)' 
PDB 2XUK unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A-TZ2PA6 SYN COMPLEX ( 10 MTH)' 
PDB 2XUO unspecified 'CRYSTAL STRUCTURE OF MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI INHIBITOR' 
PDB 2XUP unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 SYN INHIBITOR' 
PDB 2XUQ unspecified 'CRYSTAL STRUCTURE OF THE MACHE-Y337A MUTANT IN COMPLEX WITH SOAKED TZ2PA6 ANTI-SYN INHIBITORS' 
PDB 4A16 unspecified 'STRUCTURE OF MOUSE ACETYLCHOLINESTERASE COMPLEX WITH HUPRINE DERIVATIVE' 
PDB 4A23 unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH RACEMIC C5685' 
PDB 4ARB unspecified 'MUS MUSCULUS ACETYLCHOLINESTERASE IN COMPLEX WITH (S)- C5685 AT 2.25 A RESOLUTION.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ARA 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-04-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berg, L.'             1 
'Niemiec, M.S.'        2 
'Qian, W.'             3 
'Andersson, C.D.'      4 
'WittungStafshede, P.' 5 
'Ekstrom, F.'          6 
'Linusson, A.'         7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Similar But Different: Thermodynamic and Structural Characterization of a Pair of Enantiomers Binding to Acetylcholinesterase.' 
Angew.Chem.Int.Ed.Engl. 51 12716 ? 2012 ? GE 1433-7851 9999 ? 23161758 10.1002/ANIE.201205113       
1       
;Targeting Acetylcholinesterase: Identification of Chemical Leads by High Throughput Screening, Structure Determination and Molecular Modeling.
;
'Plos One'              6  26039 ? 2011 ? US 1932-6203 ?    ? 22140425 10.1371/JOURNAL.PONE.0026039 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Berg, L.'              1  ? 
primary 'Niemiec, M.S.'         2  ? 
primary 'Qian, W.'              3  ? 
primary 'Andersson, C.D.'       4  ? 
primary 'Wittung-Stafshede, P.' 5  ? 
primary 'Ekstrom, F.'           6  ? 
primary 'Linusson, A.'          7  ? 
1       'Berg, L.'              8  ? 
1       'Andersson, C.D.'       9  ? 
1       'Artursson, E.'         10 ? 
1       'Hornberg, A.'          11 ? 
1       'Tunemalm, A.'          12 ? 
1       'Linusson, A.'          13 ? 
1       'Ekstrom, F.'           14 ? 
# 
_cell.entry_id           4ARA 
_cell.length_a           78.764 
_cell.length_b           112.012 
_cell.length_c           227.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4ARA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                                   60233.984 2   3.1.1.7 ? 
'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer syn '4-(DIMETHYLAMINO)-N-{[(2R)-1-ETHYLPYRROLIDIN-2-YL]METHYL}-2-METHOXY-5-NITROBENZAMIDE' 350.413   2   ?       ? ? 
? 
3 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                                                                106.120   9   ?       ? ? 
? 
4 non-polymer syn 1,2-ETHANEDIOL                                                                         62.068    8   ?       ? ? 
? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                               221.208   3   ?       ? ? 
? 
6 non-polymer syn 'PENTAETHYLENE GLYCOL'                                                                 238.278   1   ?       ? ? 
? 
7 non-polymer syn 'CHLORIDE ION'                                                                         35.453    1   ?       ? ? 
? 
8 water       nat water                                                                                  18.015    628 ?       ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ARA A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 4ARA B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ARA ALA A 544 ? UNP P21836 ? ? 'expression tag' 544 1  
1 4ARA THR A 545 ? UNP P21836 ? ? 'expression tag' 545 2  
1 4ARA GLU A 546 ? UNP P21836 ? ? 'expression tag' 546 3  
1 4ARA ALA A 547 ? UNP P21836 ? ? 'expression tag' 547 4  
1 4ARA PRO A 548 ? UNP P21836 ? ? 'expression tag' 548 5  
2 4ARA ALA B 544 ? UNP P21836 ? ? 'expression tag' 544 6  
2 4ARA THR B 545 ? UNP P21836 ? ? 'expression tag' 545 7  
2 4ARA GLU B 546 ? UNP P21836 ? ? 'expression tag' 546 8  
2 4ARA ALA B 547 ? UNP P21836 ? ? 'expression tag' 547 9  
2 4ARA PRO B 548 ? UNP P21836 ? ? 'expression tag' 548 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer                  . 'PENTAETHYLENE GLYCOL'                                                                 PEG400 
'C10 H22 O6'     238.278 
ALA 'L-peptide linking'          y ALANINE                                                                                ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                               ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                             ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                        ? 
'C4 H7 N O4'     133.103 
C56 non-polymer                  . '4-(DIMETHYLAMINO)-N-{[(2R)-1-ETHYLPYRROLIDIN-2-YL]METHYL}-2-METHOXY-5-NITROBENZAMIDE' ? 
'C17 H26 N4 O4'  350.413 
CL  non-polymer                  . 'CHLORIDE ION'                                                                         ? 
'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                                                               ? 
'C3 H7 N O2 S'   121.158 
EDO non-polymer                  . 1,2-ETHANEDIOL                                                                         
'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking'          y GLUTAMINE                                                                              ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                        ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                              ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                  ? 'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                             ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                 ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                             ? 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                               ? 
'C8 H15 N O6'    221.208 
PEG non-polymer                  . 'DI(HYDROXYETHYL)ETHER'                                                                ? 
'C4 H10 O3'      106.120 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                          ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                 ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                              ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                             ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                               ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                 ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4ARA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.6 
_exptl_crystal.density_percent_sol   65 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES, 30 % (V/V) POLYETHELENEGLYCOLEMONOMETHYLETHER, PH 7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2012-02-14 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'RH-COATED SI MIRROR, BENT FOR VERTICAL COLLIMATION' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-5' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-5 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4ARA 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             28.98 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   70472 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.00 
_reflns.B_iso_Wilson_estimate        39.74 
_reflns.pdbx_redundancy              5.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.56 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.00 
_reflns_shell.pdbx_redundancy        5.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4ARA 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     70252 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.855 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_R_factor_obs                          0.1834 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1826 
_refine.ls_R_factor_R_free                       0.2220 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1416 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            10.8219 
_refine.aniso_B[2][2]                            12.8430 
_refine.aniso_B[3][3]                            -23.6649 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 60.440 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.73 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 22.96 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8294 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         204 
_refine_hist.number_atoms_solvent             628 
_refine_hist.number_atoms_total               9126 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        28.855 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.004  ? ? 8837  'X-RAY DIFFRACTION' ? 
f_angle_d          0.898  ? ? 12028 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.764 ? ? 3242  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.062  ? ? 1284  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1569  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.5000 2.5893  6772 0.2516 100.00 0.3072 . . 154 . . 
'X-RAY DIFFRACTION' . 2.5893 2.6929  6773 0.2283 100.00 0.2913 . . 154 . . 
'X-RAY DIFFRACTION' . 2.6929 2.8154  6819 0.2188 100.00 0.2521 . . 134 . . 
'X-RAY DIFFRACTION' . 2.8154 2.9637  6822 0.2017 100.00 0.2763 . . 136 . . 
'X-RAY DIFFRACTION' . 2.9637 3.1492  6812 0.2038 100.00 0.2251 . . 152 . . 
'X-RAY DIFFRACTION' . 3.1492 3.3920  6883 0.2051 100.00 0.2611 . . 130 . . 
'X-RAY DIFFRACTION' . 3.3920 3.7327  6867 0.1836 100.00 0.2211 . . 141 . . 
'X-RAY DIFFRACTION' . 3.7327 4.2713  6914 0.1496 100.00 0.1868 . . 140 . . 
'X-RAY DIFFRACTION' . 4.2713 5.3757  6985 0.1405 100.00 0.1623 . . 132 . . 
'X-RAY DIFFRACTION' . 5.3757 28.8570 7189 0.1885 99.00  0.2164 . . 143 . . 
# 
_struct.entry_id                  4ARA 
_struct.title                     'Mus musculus Acetylcholinesterase in complex with (R)-C5685 at 2.5 A resolution.' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ARA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, ENATIOMERS, INHIBITOR, CHEMICAL LEAD' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 5 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 6 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 5 ? 
W  N N 4 ? 
X  N N 3 ? 
Y  N N 7 ? 
Z  N N 4 ? 
AA N N 8 ? 
BA N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLU A 142 ? GLY A 135 GLU A 142 1 ? 8  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 10 LEU A 216 ? ARG A 219 ? LEU A 216 ARG A 219 5 ? 4  
HELX_P HELX_P11 11 SER A 240 ? GLY A 256 ? SER A 240 GLY A 256 1 ? 17 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 274 ? ASN A 265 ARG A 274 1 ? 10 
HELX_P HELX_P13 13 PRO A 277 ? HIS A 284 ? PRO A 277 HIS A 284 1 ? 8  
HELX_P HELX_P14 14 GLU A 285 ? LEU A 289 ? GLU A 285 LEU A 289 5 ? 5  
HELX_P HELX_P15 15 THR A 311 ? THR A 318 ? THR A 311 THR A 318 1 ? 8  
HELX_P HELX_P16 16 GLY A 335 ? GLY A 342 ? GLY A 335 GLY A 342 5 ? 8  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLU B 142 ? GLY B 135 GLU B 142 1 ? 8  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 36 SER B 215 ? LEU B 221 ? SER B 215 LEU B 221 5 ? 7  
HELX_P HELX_P37 37 SER B 240 ? GLY B 256 ? SER B 240 GLY B 256 1 ? 17 
HELX_P HELX_P38 38 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P39 39 PRO B 277 ? ASP B 283 ? PRO B 277 ASP B 283 1 ? 7  
HELX_P HELX_P40 40 HIS B 284 ? LEU B 289 ? HIS B 284 LEU B 289 5 ? 6  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? GLY B 342 ? GLY B 335 GLY B 342 5 ? 8  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P53 53 PHE B 535 ? SER B 541 ? PHE B 535 SER B 541 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1 covale one ? A ASN 350 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 350 A NAG 1549 1_555 ? ? ? ? ? ? ? 1.468 ? N-Glycosylation 
covale2 covale one ? A ASN 464 ND2 ? ? ? 1_555 M NAG .   C1 ? ? A ASN 464 A NAG 1553 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
covale3 covale one ? B ASN 350 ND2 ? ? ? 1_555 V NAG .   C1 ? ? B ASN 350 B NAG 1552 1_555 ? ? ? ? ? ? ? 1.467 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -0.99 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 1.55  
3 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 11.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
_database_PDB_matrix.entry_id          4ARA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ARA 
_atom_sites.fract_transf_matrix[1][1]   0.012696 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008928 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004399 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A  1 1   ? 31.918  14.164  55.838  1.00 87.02  ? 1    GLU A N   1 
ATOM   2    C  CA  . GLU A  1 1   ? 30.517  14.443  55.545  1.00 82.14  ? 1    GLU A CA  1 
ATOM   3    C  C   . GLU A  1 1   ? 29.726  14.662  56.832  1.00 78.38  ? 1    GLU A C   1 
ATOM   4    O  O   . GLU A  1 1   ? 30.291  14.635  57.927  1.00 84.54  ? 1    GLU A O   1 
ATOM   5    C  CB  . GLU A  1 1   ? 29.907  13.293  54.737  1.00 73.75  ? 1    GLU A CB  1 
ATOM   6    C  CG  . GLU A  1 1   ? 29.788  11.990  55.511  1.00 67.14  ? 1    GLU A CG  1 
ATOM   7    C  CD  . GLU A  1 1   ? 29.337  10.830  54.648  1.00 57.81  ? 1    GLU A CD  1 
ATOM   8    O  OE1 . GLU A  1 1   ? 30.125  10.390  53.784  1.00 56.09  ? 1    GLU A OE1 1 
ATOM   9    O  OE2 . GLU A  1 1   ? 28.201  10.348  54.846  1.00 49.83  ? 1    GLU A OE2 1 
ATOM   10   N  N   . GLY A  1 2   ? 28.420  14.887  56.702  1.00 69.75  ? 2    GLY A N   1 
ATOM   11   C  CA  . GLY A  1 2   ? 27.561  15.012  57.867  1.00 65.24  ? 2    GLY A CA  1 
ATOM   12   C  C   . GLY A  1 2   ? 26.515  16.108  57.797  1.00 64.49  ? 2    GLY A C   1 
ATOM   13   O  O   . GLY A  1 2   ? 25.392  15.923  58.267  1.00 61.96  ? 2    GLY A O   1 
ATOM   14   N  N   . ARG A  1 3   ? 26.880  17.249  57.218  1.00 71.22  ? 3    ARG A N   1 
ATOM   15   C  CA  . ARG A  1 3   ? 25.977  18.396  57.157  1.00 72.37  ? 3    ARG A CA  1 
ATOM   16   C  C   . ARG A  1 3   ? 25.442  18.649  55.746  1.00 71.99  ? 3    ARG A C   1 
ATOM   17   O  O   . ARG A  1 3   ? 24.841  19.692  55.482  1.00 76.16  ? 3    ARG A O   1 
ATOM   18   C  CB  . ARG A  1 3   ? 26.677  19.653  57.688  1.00 64.53  ? 3    ARG A CB  1 
ATOM   19   N  N   . GLU A  1 4   ? 25.648  17.688  54.849  1.00 63.70  ? 4    GLU A N   1 
ATOM   20   C  CA  . GLU A  1 4   ? 25.262  17.841  53.446  1.00 68.71  ? 4    GLU A CA  1 
ATOM   21   C  C   . GLU A  1 4   ? 24.202  16.823  53.025  1.00 63.55  ? 4    GLU A C   1 
ATOM   22   O  O   . GLU A  1 4   ? 23.862  15.926  53.795  1.00 65.21  ? 4    GLU A O   1 
ATOM   23   C  CB  . GLU A  1 4   ? 26.498  17.737  52.547  1.00 77.21  ? 4    GLU A CB  1 
ATOM   24   C  CG  . GLU A  1 4   ? 27.367  16.521  52.841  1.00 83.98  ? 4    GLU A CG  1 
ATOM   25   C  CD  . GLU A  1 4   ? 28.789  16.682  52.342  1.00 90.67  ? 4    GLU A CD  1 
ATOM   26   O  OE1 . GLU A  1 4   ? 29.023  17.542  51.468  1.00 87.07  ? 4    GLU A OE1 1 
ATOM   27   O  OE2 . GLU A  1 4   ? 29.672  15.944  52.826  1.00 94.75  ? 4    GLU A OE2 1 
ATOM   28   N  N   . ASP A  1 5   ? 23.684  16.975  51.805  1.00 53.73  ? 5    ASP A N   1 
ATOM   29   C  CA  . ASP A  1 5   ? 22.648  16.088  51.270  1.00 50.37  ? 5    ASP A CA  1 
ATOM   30   C  C   . ASP A  1 5   ? 23.154  14.651  51.133  1.00 56.13  ? 5    ASP A C   1 
ATOM   31   O  O   . ASP A  1 5   ? 24.028  14.370  50.312  1.00 56.16  ? 5    ASP A O   1 
ATOM   32   C  CB  . ASP A  1 5   ? 22.152  16.609  49.917  1.00 48.49  ? 5    ASP A CB  1 
ATOM   33   C  CG  . ASP A  1 5   ? 20.873  15.927  49.449  1.00 52.70  ? 5    ASP A CG  1 
ATOM   34   O  OD1 . ASP A  1 5   ? 20.570  14.805  49.906  1.00 50.85  ? 5    ASP A OD1 1 
ATOM   35   O  OD2 . ASP A  1 5   ? 20.167  16.517  48.603  1.00 57.97  ? 5    ASP A OD2 1 
ATOM   36   N  N   . PRO A  1 6   ? 22.587  13.736  51.935  1.00 55.25  ? 6    PRO A N   1 
ATOM   37   C  CA  . PRO A  1 6   ? 23.001  12.329  51.986  1.00 55.50  ? 6    PRO A CA  1 
ATOM   38   C  C   . PRO A  1 6   ? 22.649  11.558  50.714  1.00 52.58  ? 6    PRO A C   1 
ATOM   39   O  O   . PRO A  1 6   ? 23.175  10.467  50.489  1.00 52.43  ? 6    PRO A O   1 
ATOM   40   C  CB  . PRO A  1 6   ? 22.205  11.775  53.176  1.00 53.15  ? 6    PRO A CB  1 
ATOM   41   C  CG  . PRO A  1 6   ? 21.005  12.663  53.278  1.00 49.35  ? 6    PRO A CG  1 
ATOM   42   C  CD  . PRO A  1 6   ? 21.486  14.025  52.874  1.00 49.95  ? 6    PRO A CD  1 
ATOM   43   N  N   . GLN A  1 7   ? 21.771  12.124  49.894  1.00 47.71  ? 7    GLN A N   1 
ATOM   44   C  CA  . GLN A  1 7   ? 21.309  11.448  48.687  1.00 54.91  ? 7    GLN A CA  1 
ATOM   45   C  C   . GLN A  1 7   ? 22.190  11.771  47.479  1.00 50.10  ? 7    GLN A C   1 
ATOM   46   O  O   . GLN A  1 7   ? 21.915  11.324  46.366  1.00 53.67  ? 7    GLN A O   1 
ATOM   47   C  CB  . GLN A  1 7   ? 19.851  11.828  48.400  1.00 63.02  ? 7    GLN A CB  1 
ATOM   48   C  CG  . GLN A  1 7   ? 18.994  12.017  49.652  1.00 73.17  ? 7    GLN A CG  1 
ATOM   49   C  CD  . GLN A  1 7   ? 17.810  11.065  49.724  1.00 78.10  ? 7    GLN A CD  1 
ATOM   50   O  OE1 . GLN A  1 7   ? 17.972  9.845   49.684  1.00 83.29  ? 7    GLN A OE1 1 
ATOM   51   N  NE2 . GLN A  1 7   ? 16.611  11.624  49.841  1.00 72.78  ? 7    GLN A NE2 1 
ATOM   52   N  N   . LEU A  1 8   ? 23.254  12.537  47.710  1.00 47.65  ? 8    LEU A N   1 
ATOM   53   C  CA  . LEU A  1 8   ? 24.153  12.970  46.640  1.00 44.89  ? 8    LEU A CA  1 
ATOM   54   C  C   . LEU A  1 8   ? 25.563  12.408  46.823  1.00 46.08  ? 8    LEU A C   1 
ATOM   55   O  O   . LEU A  1 8   ? 26.497  12.800  46.116  1.00 45.51  ? 8    LEU A O   1 
ATOM   56   C  CB  . LEU A  1 8   ? 24.199  14.501  46.575  1.00 38.41  ? 8    LEU A CB  1 
ATOM   57   C  CG  . LEU A  1 8   ? 22.872  15.202  46.274  1.00 38.56  ? 8    LEU A CG  1 
ATOM   58   C  CD1 . LEU A  1 8   ? 23.021  16.709  46.342  1.00 37.08  ? 8    LEU A CD1 1 
ATOM   59   C  CD2 . LEU A  1 8   ? 22.347  14.787  44.913  1.00 35.60  ? 8    LEU A CD2 1 
ATOM   60   N  N   . LEU A  1 9   ? 25.708  11.483  47.768  1.00 41.86  ? 9    LEU A N   1 
ATOM   61   C  CA  . LEU A  1 9   ? 27.004  10.873  48.055  1.00 41.02  ? 9    LEU A CA  1 
ATOM   62   C  C   . LEU A  1 9   ? 27.060  9.435   47.543  1.00 39.33  ? 9    LEU A C   1 
ATOM   63   O  O   . LEU A  1 9   ? 26.265  8.587   47.952  1.00 41.44  ? 9    LEU A O   1 
ATOM   64   C  CB  . LEU A  1 9   ? 27.290  10.917  49.557  1.00 47.08  ? 9    LEU A CB  1 
ATOM   65   C  CG  . LEU A  1 9   ? 27.247  12.322  50.161  1.00 56.88  ? 9    LEU A CG  1 
ATOM   66   C  CD1 . LEU A  1 9   ? 27.288  12.285  51.686  1.00 56.74  ? 9    LEU A CD1 1 
ATOM   67   C  CD2 . LEU A  1 9   ? 28.392  13.153  49.618  1.00 57.61  ? 9    LEU A CD2 1 
ATOM   68   N  N   . VAL A  1 10  ? 28.003  9.175   46.640  1.00 33.63  ? 10   VAL A N   1 
ATOM   69   C  CA  . VAL A  1 10  ? 28.121  7.882   45.971  1.00 31.76  ? 10   VAL A CA  1 
ATOM   70   C  C   . VAL A  1 10  ? 29.592  7.487   45.873  1.00 42.64  ? 10   VAL A C   1 
ATOM   71   O  O   . VAL A  1 10  ? 30.453  8.343   45.657  1.00 49.13  ? 10   VAL A O   1 
ATOM   72   C  CB  . VAL A  1 10  ? 27.520  7.942   44.539  1.00 48.49  ? 10   VAL A CB  1 
ATOM   73   C  CG1 . VAL A  1 10  ? 27.773  6.649   43.772  1.00 47.13  ? 10   VAL A CG1 1 
ATOM   74   C  CG2 . VAL A  1 10  ? 26.035  8.226   44.595  1.00 44.69  ? 10   VAL A CG2 1 
ATOM   75   N  N   . ARG A  1 11  ? 29.882  6.199   46.043  1.00 39.60  ? 11   ARG A N   1 
ATOM   76   C  CA  . ARG A  1 11  ? 31.231  5.689   45.811  1.00 34.91  ? 11   ARG A CA  1 
ATOM   77   C  C   . ARG A  1 11  ? 31.330  4.933   44.484  1.00 40.95  ? 11   ARG A C   1 
ATOM   78   O  O   . ARG A  1 11  ? 30.464  4.118   44.160  1.00 41.79  ? 11   ARG A O   1 
ATOM   79   C  CB  . ARG A  1 11  ? 31.665  4.779   46.962  1.00 28.03  ? 11   ARG A CB  1 
ATOM   80   C  CG  . ARG A  1 11  ? 32.948  4.006   46.695  1.00 32.56  ? 11   ARG A CG  1 
ATOM   81   C  CD  . ARG A  1 11  ? 33.450  3.315   47.956  1.00 44.02  ? 11   ARG A CD  1 
ATOM   82   N  NE  . ARG A  1 11  ? 33.867  4.276   48.974  1.00 43.74  ? 11   ARG A NE  1 
ATOM   83   C  CZ  . ARG A  1 11  ? 35.121  4.683   49.142  1.00 46.98  ? 11   ARG A CZ  1 
ATOM   84   N  NH1 . ARG A  1 11  ? 36.082  4.210   48.361  1.00 49.53  ? 11   ARG A NH1 1 
ATOM   85   N  NH2 . ARG A  1 11  ? 35.417  5.561   50.094  1.00 40.32  ? 11   ARG A NH2 1 
ATOM   86   N  N   . VAL A  1 12  ? 32.376  5.221   43.714  1.00 35.57  ? 12   VAL A N   1 
ATOM   87   C  CA  . VAL A  1 12  ? 32.709  4.427   42.534  1.00 36.42  ? 12   VAL A CA  1 
ATOM   88   C  C   . VAL A  1 12  ? 34.099  3.817   42.707  1.00 40.25  ? 12   VAL A C   1 
ATOM   89   O  O   . VAL A  1 12  ? 34.787  4.117   43.684  1.00 46.57  ? 12   VAL A O   1 
ATOM   90   C  CB  . VAL A  1 12  ? 32.645  5.254   41.230  1.00 36.03  ? 12   VAL A CB  1 
ATOM   91   C  CG1 . VAL A  1 12  ? 31.233  5.735   40.979  1.00 32.61  ? 12   VAL A CG1 1 
ATOM   92   C  CG2 . VAL A  1 12  ? 33.601  6.435   41.292  1.00 42.26  ? 12   VAL A CG2 1 
ATOM   93   N  N   . ARG A  1 13  ? 34.498  2.969   41.760  1.00 36.16  ? 13   ARG A N   1 
ATOM   94   C  CA  . ARG A  1 13  ? 35.773  2.245   41.821  1.00 37.63  ? 13   ARG A CA  1 
ATOM   95   C  C   . ARG A  1 13  ? 36.960  3.148   42.155  1.00 33.39  ? 13   ARG A C   1 
ATOM   96   O  O   . ARG A  1 13  ? 37.877  2.743   42.867  1.00 31.35  ? 13   ARG A O   1 
ATOM   97   C  CB  . ARG A  1 13  ? 36.012  1.506   40.496  1.00 36.00  ? 13   ARG A CB  1 
ATOM   98   C  CG  . ARG A  1 13  ? 37.352  0.781   40.370  1.00 36.07  ? 13   ARG A CG  1 
ATOM   99   C  CD  . ARG A  1 13  ? 37.574  -0.223  41.489  1.00 38.86  ? 13   ARG A CD  1 
ATOM   100  N  NE  . ARG A  1 13  ? 38.781  0.114   42.238  1.00 45.82  ? 13   ARG A NE  1 
ATOM   101  C  CZ  . ARG A  1 13  ? 39.883  -0.625  42.253  1.00 46.29  ? 13   ARG A CZ  1 
ATOM   102  N  NH1 . ARG A  1 13  ? 39.928  -1.764  41.582  1.00 44.78  ? 13   ARG A NH1 1 
ATOM   103  N  NH2 . ARG A  1 13  ? 40.936  -0.233  42.953  1.00 48.07  ? 13   ARG A NH2 1 
ATOM   104  N  N   . GLY A  1 14  ? 36.928  4.383   41.667  1.00 36.13  ? 14   GLY A N   1 
ATOM   105  C  CA  . GLY A  1 14  ? 38.023  5.307   41.898  1.00 37.21  ? 14   GLY A CA  1 
ATOM   106  C  C   . GLY A  1 14  ? 37.945  6.110   43.186  1.00 44.09  ? 14   GLY A C   1 
ATOM   107  O  O   . GLY A  1 14  ? 38.931  6.728   43.590  1.00 44.98  ? 14   GLY A O   1 
ATOM   108  N  N   . GLY A  1 15  ? 36.782  6.123   43.832  1.00 39.24  ? 15   GLY A N   1 
ATOM   109  C  CA  . GLY A  1 15  ? 36.639  6.853   45.081  1.00 42.17  ? 15   GLY A CA  1 
ATOM   110  C  C   . GLY A  1 15  ? 35.250  7.412   45.330  1.00 45.14  ? 15   GLY A C   1 
ATOM   111  O  O   . GLY A  1 15  ? 34.275  6.930   44.753  1.00 43.25  ? 15   GLY A O   1 
ATOM   112  N  N   . GLN A  1 16  ? 35.161  8.430   46.186  1.00 46.32  ? 16   GLN A N   1 
ATOM   113  C  CA  . GLN A  1 16  ? 33.876  9.026   46.563  1.00 42.87  ? 16   GLN A CA  1 
ATOM   114  C  C   . GLN A  1 16  ? 33.515  10.280  45.769  1.00 37.32  ? 16   GLN A C   1 
ATOM   115  O  O   . GLN A  1 16  ? 34.368  11.132  45.501  1.00 47.62  ? 16   GLN A O   1 
ATOM   116  C  CB  . GLN A  1 16  ? 33.854  9.351   48.061  1.00 41.53  ? 16   GLN A CB  1 
ATOM   117  C  CG  . GLN A  1 16  ? 33.451  8.182   48.944  1.00 41.49  ? 16   GLN A CG  1 
ATOM   118  C  CD  . GLN A  1 16  ? 33.697  8.453   50.413  1.00 53.26  ? 16   GLN A CD  1 
ATOM   119  O  OE1 . GLN A  1 16  ? 34.833  8.683   50.829  1.00 60.07  ? 16   GLN A OE1 1 
ATOM   120  N  NE2 . GLN A  1 16  ? 32.632  8.431   51.208  1.00 47.11  ? 16   GLN A NE2 1 
ATOM   121  N  N   . LEU A  1 17  ? 32.237  10.391  45.414  1.00 31.93  ? 17   LEU A N   1 
ATOM   122  C  CA  . LEU A  1 17  ? 31.743  11.517  44.629  1.00 43.11  ? 17   LEU A CA  1 
ATOM   123  C  C   . LEU A  1 17  ? 30.670  12.277  45.398  1.00 41.82  ? 17   LEU A C   1 
ATOM   124  O  O   . LEU A  1 17  ? 29.850  11.671  46.091  1.00 43.32  ? 17   LEU A O   1 
ATOM   125  C  CB  . LEU A  1 17  ? 31.149  11.023  43.306  1.00 44.29  ? 17   LEU A CB  1 
ATOM   126  C  CG  . LEU A  1 17  ? 32.035  10.190  42.379  1.00 45.02  ? 17   LEU A CG  1 
ATOM   127  C  CD1 . LEU A  1 17  ? 31.199  9.479   41.326  1.00 46.77  ? 17   LEU A CD1 1 
ATOM   128  C  CD2 . LEU A  1 17  ? 33.079  11.066  41.716  1.00 47.29  ? 17   LEU A CD2 1 
ATOM   129  N  N   . ARG A  1 18  ? 30.680  13.602  45.286  1.00 46.71  ? 18   ARG A N   1 
ATOM   130  C  CA  . ARG A  1 18  ? 29.544  14.396  45.736  1.00 47.58  ? 18   ARG A CA  1 
ATOM   131  C  C   . ARG A  1 18  ? 28.901  15.059  44.527  1.00 46.06  ? 18   ARG A C   1 
ATOM   132  O  O   . ARG A  1 18  ? 29.526  15.879  43.851  1.00 39.70  ? 18   ARG A O   1 
ATOM   133  C  CB  . ARG A  1 18  ? 29.953  15.450  46.767  1.00 44.43  ? 18   ARG A CB  1 
ATOM   134  C  CG  . ARG A  1 18  ? 28.785  16.314  47.235  1.00 45.72  ? 18   ARG A CG  1 
ATOM   135  C  CD  . ARG A  1 18  ? 29.193  17.291  48.324  1.00 55.34  ? 18   ARG A CD  1 
ATOM   136  N  NE  . ARG A  1 18  ? 30.399  18.031  47.961  1.00 61.76  ? 18   ARG A NE  1 
ATOM   137  C  CZ  . ARG A  1 18  ? 31.582  17.862  48.543  1.00 64.23  ? 18   ARG A CZ  1 
ATOM   138  N  NH1 . ARG A  1 18  ? 31.719  16.986  49.531  1.00 57.82  ? 18   ARG A NH1 1 
ATOM   139  N  NH2 . ARG A  1 18  ? 32.628  18.570  48.144  1.00 65.93  ? 18   ARG A NH2 1 
ATOM   140  N  N   . GLY A  1 19  ? 27.656  14.685  44.251  1.00 41.86  ? 19   GLY A N   1 
ATOM   141  C  CA  . GLY A  1 19  ? 26.920  15.245  43.134  1.00 36.66  ? 19   GLY A CA  1 
ATOM   142  C  C   . GLY A  1 19  ? 26.096  16.453  43.527  1.00 46.64  ? 19   GLY A C   1 
ATOM   143  O  O   . GLY A  1 19  ? 26.268  17.012  44.615  1.00 48.57  ? 19   GLY A O   1 
ATOM   144  N  N   . ILE A  1 20  ? 25.193  16.850  42.636  1.00 44.75  ? 20   ILE A N   1 
ATOM   145  C  CA  . ILE A  1 20  ? 24.382  18.042  42.843  1.00 35.93  ? 20   ILE A CA  1 
ATOM   146  C  C   . ILE A  1 20  ? 22.908  17.793  42.521  1.00 38.82  ? 20   ILE A C   1 
ATOM   147  O  O   . ILE A  1 20  ? 22.578  17.069  41.578  1.00 50.03  ? 20   ILE A O   1 
ATOM   148  C  CB  . ILE A  1 20  ? 24.934  19.236  42.019  1.00 39.92  ? 20   ILE A CB  1 
ATOM   149  C  CG1 . ILE A  1 20  ? 24.159  20.518  42.324  1.00 36.80  ? 20   ILE A CG1 1 
ATOM   150  C  CG2 . ILE A  1 20  ? 24.916  18.929  40.521  1.00 36.56  ? 20   ILE A CG2 1 
ATOM   151  C  CD1 . ILE A  1 20  ? 24.751  21.757  41.674  1.00 37.54  ? 20   ILE A CD1 1 
ATOM   152  N  N   . ARG A  1 21  ? 22.029  18.382  43.325  1.00 41.41  ? 21   ARG A N   1 
ATOM   153  C  CA  . ARG A  1 21  ? 20.591  18.294  43.113  1.00 44.41  ? 21   ARG A CA  1 
ATOM   154  C  C   . ARG A  1 21  ? 20.161  19.376  42.126  1.00 45.70  ? 21   ARG A C   1 
ATOM   155  O  O   . ARG A  1 21  ? 20.235  20.567  42.432  1.00 54.24  ? 21   ARG A O   1 
ATOM   156  C  CB  . ARG A  1 21  ? 19.867  18.484  44.448  1.00 45.10  ? 21   ARG A CB  1 
ATOM   157  C  CG  . ARG A  1 21  ? 18.396  18.094  44.449  1.00 54.03  ? 21   ARG A CG  1 
ATOM   158  C  CD  . ARG A  1 21  ? 17.721  18.558  45.735  1.00 57.68  ? 21   ARG A CD  1 
ATOM   159  N  NE  . ARG A  1 21  ? 16.740  19.611  45.480  1.00 68.60  ? 21   ARG A NE  1 
ATOM   160  C  CZ  . ARG A  1 21  ? 15.455  19.532  45.814  1.00 75.95  ? 21   ARG A CZ  1 
ATOM   161  N  NH1 . ARG A  1 21  ? 14.993  18.454  46.432  1.00 76.72  ? 21   ARG A NH1 1 
ATOM   162  N  NH2 . ARG A  1 21  ? 14.632  20.534  45.537  1.00 74.78  ? 21   ARG A NH2 1 
ATOM   163  N  N   . LEU A  1 22  ? 19.720  18.960  40.943  1.00 41.96  ? 22   LEU A N   1 
ATOM   164  C  CA  . LEU A  1 22  ? 19.335  19.899  39.891  1.00 45.49  ? 22   LEU A CA  1 
ATOM   165  C  C   . LEU A  1 22  ? 17.823  20.006  39.734  1.00 44.48  ? 22   LEU A C   1 
ATOM   166  O  O   . LEU A  1 22  ? 17.107  19.015  39.877  1.00 48.54  ? 22   LEU A O   1 
ATOM   167  C  CB  . LEU A  1 22  ? 19.954  19.491  38.550  1.00 39.57  ? 22   LEU A CB  1 
ATOM   168  C  CG  . LEU A  1 22  ? 21.467  19.656  38.402  1.00 39.77  ? 22   LEU A CG  1 
ATOM   169  C  CD1 . LEU A  1 22  ? 21.897  19.434  36.965  1.00 32.65  ? 22   LEU A CD1 1 
ATOM   170  C  CD2 . LEU A  1 22  ? 21.885  21.030  38.869  1.00 38.28  ? 22   LEU A CD2 1 
ATOM   171  N  N   . LYS A  1 23  ? 17.342  21.207  39.425  1.00 39.38  ? 23   LYS A N   1 
ATOM   172  C  CA  . LYS A  1 23  ? 15.917  21.417  39.179  1.00 42.81  ? 23   LYS A CA  1 
ATOM   173  C  C   . LYS A  1 23  ? 15.523  21.175  37.722  1.00 45.87  ? 23   LYS A C   1 
ATOM   174  O  O   . LYS A  1 23  ? 16.015  21.845  36.812  1.00 47.69  ? 23   LYS A O   1 
ATOM   175  C  CB  . LYS A  1 23  ? 15.505  22.833  39.590  1.00 41.64  ? 23   LYS A CB  1 
ATOM   176  N  N   . ALA A  1 24  ? 14.643  20.203  37.509  1.00 44.41  ? 24   ALA A N   1 
ATOM   177  C  CA  . ALA A  1 24  ? 13.967  20.035  36.226  1.00 46.66  ? 24   ALA A CA  1 
ATOM   178  C  C   . ALA A  1 24  ? 12.573  20.627  36.406  1.00 52.89  ? 24   ALA A C   1 
ATOM   179  O  O   . ALA A  1 24  ? 12.160  20.866  37.541  1.00 56.68  ? 24   ALA A O   1 
ATOM   180  C  CB  . ALA A  1 24  ? 13.893  18.563  35.852  1.00 40.23  ? 24   ALA A CB  1 
ATOM   181  N  N   . PRO A  1 25  ? 11.848  20.882  35.301  1.00 56.64  ? 25   PRO A N   1 
ATOM   182  C  CA  . PRO A  1 25  ? 10.529  21.510  35.452  1.00 50.82  ? 25   PRO A CA  1 
ATOM   183  C  C   . PRO A  1 25  ? 9.560   20.733  36.345  1.00 49.25  ? 25   PRO A C   1 
ATOM   184  O  O   . PRO A  1 25  ? 8.784   21.356  37.074  1.00 46.56  ? 25   PRO A O   1 
ATOM   185  C  CB  . PRO A  1 25  ? 9.999   21.552  34.016  1.00 52.71  ? 25   PRO A CB  1 
ATOM   186  C  CG  . PRO A  1 25  ? 11.225  21.619  33.171  1.00 55.75  ? 25   PRO A CG  1 
ATOM   187  C  CD  . PRO A  1 25  ? 12.249  20.779  33.884  1.00 53.85  ? 25   PRO A CD  1 
ATOM   188  N  N   . GLY A  1 26  ? 9.609   19.404  36.302  1.00 46.73  ? 26   GLY A N   1 
ATOM   189  C  CA  . GLY A  1 26  ? 8.673   18.594  37.066  1.00 49.78  ? 26   GLY A CA  1 
ATOM   190  C  C   . GLY A  1 26  ? 9.226   17.956  38.329  1.00 60.75  ? 26   GLY A C   1 
ATOM   191  O  O   . GLY A  1 26  ? 8.600   17.054  38.893  1.00 62.05  ? 26   GLY A O   1 
ATOM   192  N  N   . GLY A  1 27  ? 10.390  18.423  38.779  1.00 56.80  ? 27   GLY A N   1 
ATOM   193  C  CA  . GLY A  1 27  ? 11.013  17.900  39.984  1.00 54.62  ? 27   GLY A CA  1 
ATOM   194  C  C   . GLY A  1 27  ? 12.528  17.944  39.927  1.00 56.00  ? 27   GLY A C   1 
ATOM   195  O  O   . GLY A  1 27  ? 13.094  18.394  38.933  1.00 55.48  ? 27   GLY A O   1 
ATOM   196  N  N   . PRO A  1 28  ? 13.195  17.478  40.996  1.00 53.37  ? 28   PRO A N   1 
ATOM   197  C  CA  . PRO A  1 28  ? 14.662  17.470  41.055  1.00 48.38  ? 28   PRO A CA  1 
ATOM   198  C  C   . PRO A  1 28  ? 15.289  16.206  40.464  1.00 46.20  ? 28   PRO A C   1 
ATOM   199  O  O   . PRO A  1 28  ? 14.668  15.140  40.488  1.00 42.62  ? 28   PRO A O   1 
ATOM   200  C  CB  . PRO A  1 28  ? 14.940  17.532  42.557  1.00 44.09  ? 28   PRO A CB  1 
ATOM   201  C  CG  . PRO A  1 28  ? 13.778  16.803  43.174  1.00 41.79  ? 28   PRO A CG  1 
ATOM   202  C  CD  . PRO A  1 28  ? 12.586  17.071  42.277  1.00 44.16  ? 28   PRO A CD  1 
ATOM   203  N  N   . VAL A  1 29  ? 16.503  16.336  39.930  1.00 37.96  ? 29   VAL A N   1 
ATOM   204  C  CA  . VAL A  1 29  ? 17.276  15.184  39.473  1.00 38.79  ? 29   VAL A CA  1 
ATOM   205  C  C   . VAL A  1 29  ? 18.659  15.197  40.104  1.00 33.29  ? 29   VAL A C   1 
ATOM   206  O  O   . VAL A  1 29  ? 19.127  16.241  40.558  1.00 38.25  ? 29   VAL A O   1 
ATOM   207  C  CB  . VAL A  1 29  ? 17.431  15.139  37.927  1.00 37.47  ? 29   VAL A CB  1 
ATOM   208  C  CG1 . VAL A  1 29  ? 16.120  14.787  37.268  1.00 33.43  ? 29   VAL A CG1 1 
ATOM   209  C  CG2 . VAL A  1 29  ? 17.968  16.459  37.388  1.00 32.22  ? 29   VAL A CG2 1 
ATOM   210  N  N   . SER A  1 30  ? 19.311  14.037  40.130  1.00 33.04  ? 30   SER A N   1 
ATOM   211  C  CA  . SER A  1 30  ? 20.676  13.948  40.637  1.00 37.49  ? 30   SER A CA  1 
ATOM   212  C  C   . SER A  1 30  ? 21.672  14.057  39.486  1.00 43.67  ? 30   SER A C   1 
ATOM   213  O  O   . SER A  1 30  ? 21.534  13.372  38.470  1.00 39.64  ? 30   SER A O   1 
ATOM   214  C  CB  . SER A  1 30  ? 20.892  12.633  41.388  1.00 43.59  ? 30   SER A CB  1 
ATOM   215  O  OG  . SER A  1 30  ? 19.957  12.470  42.440  1.00 60.81  ? 30   SER A OG  1 
ATOM   216  N  N   . ALA A  1 31  ? 22.675  14.917  39.641  1.00 44.66  ? 31   ALA A N   1 
ATOM   217  C  CA  . ALA A  1 31  ? 23.709  15.059  38.621  1.00 44.44  ? 31   ALA A CA  1 
ATOM   218  C  C   . ALA A  1 31  ? 25.095  14.816  39.194  1.00 46.21  ? 31   ALA A C   1 
ATOM   219  O  O   . ALA A  1 31  ? 25.448  15.359  40.243  1.00 46.93  ? 31   ALA A O   1 
ATOM   220  C  CB  . ALA A  1 31  ? 23.640  16.432  37.973  1.00 44.27  ? 31   ALA A CB  1 
ATOM   221  N  N   . PHE A  1 32  ? 25.876  14.001  38.492  1.00 43.60  ? 32   PHE A N   1 
ATOM   222  C  CA  . PHE A  1 32  ? 27.266  13.764  38.848  1.00 39.14  ? 32   PHE A CA  1 
ATOM   223  C  C   . PHE A  1 32  ? 28.133  14.131  37.645  1.00 42.30  ? 32   PHE A C   1 
ATOM   224  O  O   . PHE A  1 32  ? 28.271  13.352  36.699  1.00 41.07  ? 32   PHE A O   1 
ATOM   225  C  CB  . PHE A  1 32  ? 27.463  12.307  39.274  1.00 37.75  ? 32   PHE A CB  1 
ATOM   226  C  CG  . PHE A  1 32  ? 26.686  11.927  40.514  1.00 41.85  ? 32   PHE A CG  1 
ATOM   227  C  CD1 . PHE A  1 32  ? 25.374  11.474  40.422  1.00 38.96  ? 32   PHE A CD1 1 
ATOM   228  C  CD2 . PHE A  1 32  ? 27.268  12.031  41.772  1.00 41.63  ? 32   PHE A CD2 1 
ATOM   229  C  CE1 . PHE A  1 32  ? 24.657  11.130  41.562  1.00 40.14  ? 32   PHE A CE1 1 
ATOM   230  C  CE2 . PHE A  1 32  ? 26.558  11.691  42.918  1.00 42.97  ? 32   PHE A CE2 1 
ATOM   231  C  CZ  . PHE A  1 32  ? 25.251  11.240  42.813  1.00 42.29  ? 32   PHE A CZ  1 
ATOM   232  N  N   . LEU A  1 33  ? 28.702  15.334  37.686  1.00 40.10  ? 33   LEU A N   1 
ATOM   233  C  CA  . LEU A  1 33  ? 29.392  15.907  36.534  1.00 40.62  ? 33   LEU A CA  1 
ATOM   234  C  C   . LEU A  1 33  ? 30.908  15.951  36.726  1.00 41.56  ? 33   LEU A C   1 
ATOM   235  O  O   . LEU A  1 33  ? 31.396  16.193  37.831  1.00 41.60  ? 33   LEU A O   1 
ATOM   236  C  CB  . LEU A  1 33  ? 28.849  17.311  36.250  1.00 39.57  ? 33   LEU A CB  1 
ATOM   237  C  CG  . LEU A  1 33  ? 27.320  17.439  36.243  1.00 35.12  ? 33   LEU A CG  1 
ATOM   238  C  CD1 . LEU A  1 33  ? 26.879  18.886  36.084  1.00 37.67  ? 33   LEU A CD1 1 
ATOM   239  C  CD2 . LEU A  1 33  ? 26.695  16.576  35.156  1.00 28.78  ? 33   LEU A CD2 1 
ATOM   240  N  N   . GLY A  1 34  ? 31.652  15.705  35.651  1.00 36.23  ? 34   GLY A N   1 
ATOM   241  C  CA  . GLY A  1 34  ? 33.104  15.736  35.710  1.00 30.69  ? 34   GLY A CA  1 
ATOM   242  C  C   . GLY A  1 34  ? 33.744  14.590  36.476  1.00 36.80  ? 34   GLY A C   1 
ATOM   243  O  O   . GLY A  1 34  ? 34.684  14.798  37.248  1.00 41.01  ? 34   GLY A O   1 
ATOM   244  N  N   . ILE A  1 35  ? 33.235  13.379  36.266  1.00 39.25  ? 35   ILE A N   1 
ATOM   245  C  CA  . ILE A  1 35  ? 33.848  12.182  36.829  1.00 37.64  ? 35   ILE A CA  1 
ATOM   246  C  C   . ILE A  1 35  ? 34.966  11.688  35.913  1.00 46.11  ? 35   ILE A C   1 
ATOM   247  O  O   . ILE A  1 35  ? 34.710  11.292  34.776  1.00 49.26  ? 35   ILE A O   1 
ATOM   248  C  CB  . ILE A  1 35  ? 32.822  11.045  36.987  1.00 34.13  ? 35   ILE A CB  1 
ATOM   249  C  CG1 . ILE A  1 35  ? 31.591  11.526  37.763  1.00 35.19  ? 35   ILE A CG1 1 
ATOM   250  C  CG2 . ILE A  1 35  ? 33.463  9.834   37.661  1.00 28.97  ? 35   ILE A CG2 1 
ATOM   251  C  CD1 . ILE A  1 35  ? 30.478  10.496  37.836  1.00 29.40  ? 35   ILE A CD1 1 
ATOM   252  N  N   . PRO A  1 36  ? 36.213  11.702  36.410  1.00 48.44  ? 36   PRO A N   1 
ATOM   253  C  CA  . PRO A  1 36  ? 37.350  11.199  35.629  1.00 41.20  ? 36   PRO A CA  1 
ATOM   254  C  C   . PRO A  1 36  ? 37.261  9.689   35.433  1.00 42.06  ? 36   PRO A C   1 
ATOM   255  O  O   . PRO A  1 36  ? 37.038  8.964   36.405  1.00 52.15  ? 36   PRO A O   1 
ATOM   256  C  CB  . PRO A  1 36  ? 38.557  11.544  36.509  1.00 44.79  ? 36   PRO A CB  1 
ATOM   257  C  CG  . PRO A  1 36  ? 37.999  11.607  37.914  1.00 40.20  ? 36   PRO A CG  1 
ATOM   258  C  CD  . PRO A  1 36  ? 36.612  12.161  37.755  1.00 38.92  ? 36   PRO A CD  1 
ATOM   259  N  N   . PHE A  1 37  ? 37.420  9.227   34.195  1.00 42.12  ? 37   PHE A N   1 
ATOM   260  C  CA  . PHE A  1 37  ? 37.396  7.795   33.903  1.00 36.18  ? 37   PHE A CA  1 
ATOM   261  C  C   . PHE A  1 37  ? 38.730  7.320   33.328  1.00 37.53  ? 37   PHE A C   1 
ATOM   262  O  O   . PHE A  1 37  ? 38.937  6.122   33.105  1.00 44.54  ? 37   PHE A O   1 
ATOM   263  C  CB  . PHE A  1 37  ? 36.230  7.435   32.968  1.00 34.75  ? 37   PHE A CB  1 
ATOM   264  C  CG  . PHE A  1 37  ? 36.304  8.084   31.611  1.00 41.74  ? 37   PHE A CG  1 
ATOM   265  C  CD1 . PHE A  1 37  ? 37.003  7.481   30.567  1.00 39.70  ? 37   PHE A CD1 1 
ATOM   266  C  CD2 . PHE A  1 37  ? 35.658  9.288   31.374  1.00 40.99  ? 37   PHE A CD2 1 
ATOM   267  C  CE1 . PHE A  1 37  ? 37.068  8.080   29.318  1.00 36.74  ? 37   PHE A CE1 1 
ATOM   268  C  CE2 . PHE A  1 37  ? 35.712  9.889   30.130  1.00 39.14  ? 37   PHE A CE2 1 
ATOM   269  C  CZ  . PHE A  1 37  ? 36.419  9.287   29.099  1.00 32.32  ? 37   PHE A CZ  1 
ATOM   270  N  N   . ALA A  1 38  ? 39.635  8.270   33.107  1.00 36.69  ? 38   ALA A N   1 
ATOM   271  C  CA  . ALA A  1 38  ? 40.947  7.982   32.537  1.00 36.12  ? 38   ALA A CA  1 
ATOM   272  C  C   . ALA A  1 38  ? 42.019  8.888   33.127  1.00 38.35  ? 38   ALA A C   1 
ATOM   273  O  O   . ALA A  1 38  ? 41.725  9.983   33.616  1.00 36.23  ? 38   ALA A O   1 
ATOM   274  C  CB  . ALA A  1 38  ? 40.907  8.154   31.032  1.00 42.85  ? 38   ALA A CB  1 
ATOM   275  N  N   . GLU A  1 39  ? 43.266  8.434   33.072  1.00 34.08  ? 39   GLU A N   1 
ATOM   276  C  CA  . GLU A  1 39  ? 44.387  9.303   33.394  1.00 38.60  ? 39   GLU A CA  1 
ATOM   277  C  C   . GLU A  1 39  ? 44.469  10.364  32.311  1.00 44.92  ? 39   GLU A C   1 
ATOM   278  O  O   . GLU A  1 39  ? 44.251  10.062  31.137  1.00 47.72  ? 39   GLU A O   1 
ATOM   279  C  CB  . GLU A  1 39  ? 45.693  8.507   33.451  1.00 40.17  ? 39   GLU A CB  1 
ATOM   280  C  CG  . GLU A  1 39  ? 45.865  7.688   34.721  1.00 49.73  ? 39   GLU A CG  1 
ATOM   281  C  CD  . GLU A  1 39  ? 45.989  8.553   35.954  1.00 52.23  ? 39   GLU A CD  1 
ATOM   282  O  OE1 . GLU A  1 39  ? 46.981  9.306   36.053  1.00 58.14  ? 39   GLU A OE1 1 
ATOM   283  O  OE2 . GLU A  1 39  ? 45.093  8.487   36.823  1.00 48.63  ? 39   GLU A OE2 1 
ATOM   284  N  N   . PRO A  1 40  ? 44.759  11.616  32.702  1.00 44.40  ? 40   PRO A N   1 
ATOM   285  C  CA  . PRO A  1 40  ? 44.900  12.705  31.727  1.00 41.37  ? 40   PRO A CA  1 
ATOM   286  C  C   . PRO A  1 40  ? 45.895  12.367  30.618  1.00 44.10  ? 40   PRO A C   1 
ATOM   287  O  O   . PRO A  1 40  ? 47.073  12.148  30.903  1.00 47.50  ? 40   PRO A O   1 
ATOM   288  C  CB  . PRO A  1 40  ? 45.439  13.860  32.574  1.00 45.83  ? 40   PRO A CB  1 
ATOM   289  C  CG  . PRO A  1 40  ? 44.918  13.588  33.954  1.00 37.89  ? 40   PRO A CG  1 
ATOM   290  C  CD  . PRO A  1 40  ? 44.915  12.087  34.092  1.00 38.50  ? 40   PRO A CD  1 
ATOM   291  N  N   . PRO A  1 41  ? 45.423  12.332  29.363  1.00 47.89  ? 41   PRO A N   1 
ATOM   292  C  CA  . PRO A  1 41  ? 46.259  11.983  28.211  1.00 44.40  ? 41   PRO A CA  1 
ATOM   293  C  C   . PRO A  1 41  ? 47.118  13.162  27.771  1.00 44.54  ? 41   PRO A C   1 
ATOM   294  O  O   . PRO A  1 41  ? 46.996  13.631  26.637  1.00 44.67  ? 41   PRO A O   1 
ATOM   295  C  CB  . PRO A  1 41  ? 45.227  11.648  27.133  1.00 36.75  ? 41   PRO A CB  1 
ATOM   296  C  CG  . PRO A  1 41  ? 44.067  12.534  27.459  1.00 41.10  ? 41   PRO A CG  1 
ATOM   297  C  CD  . PRO A  1 41  ? 44.029  12.612  28.968  1.00 43.19  ? 41   PRO A CD  1 
ATOM   298  N  N   . VAL A  1 42  ? 47.986  13.621  28.669  1.00 37.99  ? 42   VAL A N   1 
ATOM   299  C  CA  . VAL A  1 42  ? 48.831  14.782  28.417  1.00 40.03  ? 42   VAL A CA  1 
ATOM   300  C  C   . VAL A  1 42  ? 50.300  14.380  28.342  1.00 45.68  ? 42   VAL A C   1 
ATOM   301  O  O   . VAL A  1 42  ? 50.661  13.256  28.695  1.00 47.15  ? 42   VAL A O   1 
ATOM   302  C  CB  . VAL A  1 42  ? 48.663  15.845  29.526  1.00 42.67  ? 42   VAL A CB  1 
ATOM   303  C  CG1 . VAL A  1 42  ? 47.218  16.288  29.624  1.00 42.19  ? 42   VAL A CG1 1 
ATOM   304  C  CG2 . VAL A  1 42  ? 49.129  15.299  30.869  1.00 33.08  ? 42   VAL A CG2 1 
ATOM   305  N  N   . GLY A  1 43  ? 51.142  15.305  27.889  1.00 45.57  ? 43   GLY A N   1 
ATOM   306  C  CA  . GLY A  1 43  ? 52.569  15.056  27.787  1.00 45.14  ? 43   GLY A CA  1 
ATOM   307  C  C   . GLY A  1 43  ? 52.907  13.867  26.910  1.00 51.27  ? 43   GLY A C   1 
ATOM   308  O  O   . GLY A  1 43  ? 52.523  13.827  25.740  1.00 53.22  ? 43   GLY A O   1 
ATOM   309  N  N   . SER A  1 44  ? 53.611  12.891  27.480  1.00 54.20  ? 44   SER A N   1 
ATOM   310  C  CA  . SER A  1 44  ? 54.028  11.699  26.740  1.00 56.56  ? 44   SER A CA  1 
ATOM   311  C  C   . SER A  1 44  ? 52.860  10.768  26.421  1.00 53.66  ? 44   SER A C   1 
ATOM   312  O  O   . SER A  1 44  ? 53.045  9.730   25.780  1.00 50.69  ? 44   SER A O   1 
ATOM   313  C  CB  . SER A  1 44  ? 55.098  10.932  27.518  1.00 55.01  ? 44   SER A CB  1 
ATOM   314  O  OG  . SER A  1 44  ? 54.576  10.432  28.736  1.00 59.45  ? 44   SER A OG  1 
ATOM   315  N  N   . ARG A  1 45  ? 51.662  11.137  26.867  1.00 49.44  ? 45   ARG A N   1 
ATOM   316  C  CA  . ARG A  1 45  ? 50.476  10.326  26.607  1.00 49.88  ? 45   ARG A CA  1 
ATOM   317  C  C   . ARG A  1 45  ? 49.594  10.861  25.482  1.00 43.52  ? 45   ARG A C   1 
ATOM   318  O  O   . ARG A  1 45  ? 48.564  10.262  25.161  1.00 35.55  ? 45   ARG A O   1 
ATOM   319  C  CB  . ARG A  1 45  ? 49.650  10.144  27.881  1.00 52.03  ? 45   ARG A CB  1 
ATOM   320  C  CG  . ARG A  1 45  ? 50.230  9.124   28.834  1.00 61.41  ? 45   ARG A CG  1 
ATOM   321  C  CD  . ARG A  1 45  ? 49.143  8.496   29.686  1.00 79.44  ? 45   ARG A CD  1 
ATOM   322  N  NE  . ARG A  1 45  ? 49.112  9.043   31.038  1.00 85.80  ? 45   ARG A NE  1 
ATOM   323  C  CZ  . ARG A  1 45  ? 49.699  8.472   32.084  1.00 94.35  ? 45   ARG A CZ  1 
ATOM   324  N  NH1 . ARG A  1 45  ? 50.362  7.332   31.934  1.00 95.27  ? 45   ARG A NH1 1 
ATOM   325  N  NH2 . ARG A  1 45  ? 49.620  9.035   33.282  1.00 99.25  ? 45   ARG A NH2 1 
ATOM   326  N  N   . ARG A  1 46  ? 49.987  11.985  24.889  1.00 46.57  ? 46   ARG A N   1 
ATOM   327  C  CA  . ARG A  1 46  ? 49.282  12.496  23.717  1.00 43.90  ? 46   ARG A CA  1 
ATOM   328  C  C   . ARG A  1 46  ? 49.384  11.438  22.624  1.00 42.40  ? 46   ARG A C   1 
ATOM   329  O  O   . ARG A  1 46  ? 50.415  10.774  22.504  1.00 44.09  ? 46   ARG A O   1 
ATOM   330  C  CB  . ARG A  1 46  ? 49.888  13.829  23.251  1.00 42.95  ? 46   ARG A CB  1 
ATOM   331  C  CG  . ARG A  1 46  ? 49.145  14.509  22.098  1.00 38.66  ? 46   ARG A CG  1 
ATOM   332  C  CD  . ARG A  1 46  ? 49.916  15.717  21.566  1.00 35.09  ? 46   ARG A CD  1 
ATOM   333  N  NE  . ARG A  1 46  ? 49.772  16.903  22.410  1.00 36.91  ? 46   ARG A NE  1 
ATOM   334  C  CZ  . ARG A  1 46  ? 50.399  18.055  22.185  1.00 38.47  ? 46   ARG A CZ  1 
ATOM   335  N  NH1 . ARG A  1 46  ? 51.216  18.174  21.147  1.00 39.27  ? 46   ARG A NH1 1 
ATOM   336  N  NH2 . ARG A  1 46  ? 50.215  19.086  22.995  1.00 29.57  ? 46   ARG A NH2 1 
ATOM   337  N  N   . PHE A  1 47  ? 48.296  11.258  21.874  1.00 38.42  ? 47   PHE A N   1 
ATOM   338  C  CA  . PHE A  1 47  ? 48.190  10.246  20.811  1.00 35.57  ? 47   PHE A CA  1 
ATOM   339  C  C   . PHE A  1 47  ? 48.088  8.806   21.335  1.00 40.81  ? 47   PHE A C   1 
ATOM   340  O  O   . PHE A  1 47  ? 47.804  7.885   20.567  1.00 45.91  ? 47   PHE A O   1 
ATOM   341  C  CB  . PHE A  1 47  ? 49.340  10.361  19.800  1.00 34.24  ? 47   PHE A CB  1 
ATOM   342  C  CG  . PHE A  1 47  ? 49.576  11.759  19.301  1.00 35.29  ? 47   PHE A CG  1 
ATOM   343  C  CD1 . PHE A  1 47  ? 48.536  12.510  18.765  1.00 36.16  ? 47   PHE A CD1 1 
ATOM   344  C  CD2 . PHE A  1 47  ? 50.842  12.326  19.375  1.00 34.19  ? 47   PHE A CD2 1 
ATOM   345  C  CE1 . PHE A  1 47  ? 48.756  13.800  18.305  1.00 37.80  ? 47   PHE A CE1 1 
ATOM   346  C  CE2 . PHE A  1 47  ? 51.073  13.613  18.918  1.00 33.23  ? 47   PHE A CE2 1 
ATOM   347  C  CZ  . PHE A  1 47  ? 50.028  14.352  18.381  1.00 36.50  ? 47   PHE A CZ  1 
ATOM   348  N  N   . MET A  1 48  ? 48.313  8.617   22.634  1.00 41.67  ? 48   MET A N   1 
ATOM   349  C  CA  . MET A  1 48  ? 48.308  7.282   23.234  1.00 39.59  ? 48   MET A CA  1 
ATOM   350  C  C   . MET A  1 48  ? 46.911  6.819   23.650  1.00 34.24  ? 48   MET A C   1 
ATOM   351  O  O   . MET A  1 48  ? 46.033  7.642   23.921  1.00 34.38  ? 48   MET A O   1 
ATOM   352  C  CB  . MET A  1 48  ? 49.245  7.234   24.451  1.00 38.03  ? 48   MET A CB  1 
ATOM   353  C  CG  . MET A  1 48  ? 50.704  7.452   24.116  1.00 48.10  ? 48   MET A CG  1 
ATOM   354  S  SD  . MET A  1 48  ? 51.281  6.302   22.855  1.00 63.02  ? 48   MET A SD  1 
ATOM   355  C  CE  . MET A  1 48  ? 51.126  4.751   23.735  1.00 54.48  ? 48   MET A CE  1 
ATOM   356  N  N   . PRO A  1 49  ? 46.697  5.491   23.681  1.00 37.88  ? 49   PRO A N   1 
ATOM   357  C  CA  . PRO A  1 49  ? 45.455  4.933   24.233  1.00 38.30  ? 49   PRO A CA  1 
ATOM   358  C  C   . PRO A  1 49  ? 45.291  5.354   25.687  1.00 36.85  ? 49   PRO A C   1 
ATOM   359  O  O   . PRO A  1 49  ? 46.294  5.539   26.376  1.00 33.50  ? 49   PRO A O   1 
ATOM   360  C  CB  . PRO A  1 49  ? 45.689  3.420   24.156  1.00 34.57  ? 49   PRO A CB  1 
ATOM   361  C  CG  . PRO A  1 49  ? 46.658  3.243   23.025  1.00 41.24  ? 49   PRO A CG  1 
ATOM   362  C  CD  . PRO A  1 49  ? 47.554  4.453   23.074  1.00 40.52  ? 49   PRO A CD  1 
ATOM   363  N  N   . PRO A  1 50  ? 44.042  5.502   26.154  1.00 37.17  ? 50   PRO A N   1 
ATOM   364  C  CA  . PRO A  1 50  ? 43.809  5.959   27.528  1.00 43.58  ? 50   PRO A CA  1 
ATOM   365  C  C   . PRO A  1 50  ? 44.092  4.882   28.573  1.00 49.47  ? 50   PRO A C   1 
ATOM   366  O  O   . PRO A  1 50  ? 43.765  3.714   28.355  1.00 50.29  ? 50   PRO A O   1 
ATOM   367  C  CB  . PRO A  1 50  ? 42.313  6.272   27.528  1.00 41.66  ? 50   PRO A CB  1 
ATOM   368  C  CG  . PRO A  1 50  ? 41.741  5.305   26.529  1.00 40.03  ? 50   PRO A CG  1 
ATOM   369  C  CD  . PRO A  1 50  ? 42.780  5.236   25.436  1.00 34.61  ? 50   PRO A CD  1 
ATOM   370  N  N   . GLU A  1 51  ? 44.693  5.275   29.692  1.00 51.90  ? 51   GLU A N   1 
ATOM   371  C  CA  . GLU A  1 51  ? 44.811  4.395   30.850  1.00 52.52  ? 51   GLU A CA  1 
ATOM   372  C  C   . GLU A  1 51  ? 43.713  4.776   31.839  1.00 48.80  ? 51   GLU A C   1 
ATOM   373  O  O   . GLU A  1 51  ? 43.471  5.964   32.060  1.00 47.50  ? 51   GLU A O   1 
ATOM   374  C  CB  . GLU A  1 51  ? 46.182  4.553   31.520  1.00 61.97  ? 51   GLU A CB  1 
ATOM   375  C  CG  . GLU A  1 51  ? 47.369  4.071   30.697  1.00 77.91  ? 51   GLU A CG  1 
ATOM   376  C  CD  . GLU A  1 51  ? 48.695  4.541   31.270  1.00 92.02  ? 51   GLU A CD  1 
ATOM   377  O  OE1 . GLU A  1 51  ? 48.721  5.630   31.881  1.00 96.59  ? 51   GLU A OE1 1 
ATOM   378  O  OE2 . GLU A  1 51  ? 49.708  3.827   31.113  1.00 96.30  ? 51   GLU A OE2 1 
ATOM   379  N  N   . PRO A  1 52  ? 43.039  3.774   32.431  1.00 50.08  ? 52   PRO A N   1 
ATOM   380  C  CA  . PRO A  1 52  ? 41.984  4.036   33.420  1.00 51.19  ? 52   PRO A CA  1 
ATOM   381  C  C   . PRO A  1 52  ? 42.443  4.931   34.574  1.00 42.25  ? 52   PRO A C   1 
ATOM   382  O  O   . PRO A  1 52  ? 43.600  4.856   34.993  1.00 34.29  ? 52   PRO A O   1 
ATOM   383  C  CB  . PRO A  1 52  ? 41.625  2.634   33.940  1.00 53.39  ? 52   PRO A CB  1 
ATOM   384  C  CG  . PRO A  1 52  ? 42.733  1.724   33.462  1.00 51.87  ? 52   PRO A CG  1 
ATOM   385  C  CD  . PRO A  1 52  ? 43.215  2.332   32.185  1.00 46.19  ? 52   PRO A CD  1 
ATOM   386  N  N   . LYS A  1 53  ? 41.534  5.768   35.069  1.00 36.02  ? 53   LYS A N   1 
ATOM   387  C  CA  . LYS A  1 53  ? 41.837  6.727   36.128  1.00 40.67  ? 53   LYS A CA  1 
ATOM   388  C  C   . LYS A  1 53  ? 42.279  6.043   37.416  1.00 51.61  ? 53   LYS A C   1 
ATOM   389  O  O   . LYS A  1 53  ? 41.624  5.114   37.890  1.00 52.37  ? 53   LYS A O   1 
ATOM   390  C  CB  . LYS A  1 53  ? 40.607  7.600   36.405  1.00 42.93  ? 53   LYS A CB  1 
ATOM   391  C  CG  . LYS A  1 53  ? 40.754  8.550   37.591  1.00 41.32  ? 53   LYS A CG  1 
ATOM   392  C  CD  . LYS A  1 53  ? 41.839  9.585   37.338  1.00 44.60  ? 53   LYS A CD  1 
ATOM   393  C  CE  . LYS A  1 53  ? 41.802  10.697  38.377  1.00 41.46  ? 53   LYS A CE  1 
ATOM   394  N  NZ  . LYS A  1 53  ? 42.836  11.735  38.101  1.00 43.49  ? 53   LYS A NZ  1 
ATOM   395  N  N   . ARG A  1 54  ? 43.396  6.499   37.976  1.00 48.65  ? 54   ARG A N   1 
ATOM   396  C  CA  . ARG A  1 54  ? 43.857  5.991   39.264  1.00 52.82  ? 54   ARG A CA  1 
ATOM   397  C  C   . ARG A  1 54  ? 43.002  6.574   40.385  1.00 50.23  ? 54   ARG A C   1 
ATOM   398  O  O   . ARG A  1 54  ? 42.694  7.768   40.370  1.00 51.78  ? 54   ARG A O   1 
ATOM   399  C  CB  . ARG A  1 54  ? 45.331  6.340   39.499  1.00 50.55  ? 54   ARG A CB  1 
ATOM   400  C  CG  . ARG A  1 54  ? 46.316  5.606   38.599  1.00 56.16  ? 54   ARG A CG  1 
ATOM   401  C  CD  . ARG A  1 54  ? 47.746  5.817   39.083  1.00 70.69  ? 54   ARG A CD  1 
ATOM   402  N  NE  . ARG A  1 54  ? 48.036  7.230   39.326  1.00 84.55  ? 54   ARG A NE  1 
ATOM   403  C  CZ  . ARG A  1 54  ? 48.825  7.980   38.561  1.00 91.04  ? 54   ARG A CZ  1 
ATOM   404  N  NH1 . ARG A  1 54  ? 49.422  7.452   37.499  1.00 92.60  ? 54   ARG A NH1 1 
ATOM   405  N  NH2 . ARG A  1 54  ? 49.023  9.257   38.862  1.00 86.63  ? 54   ARG A NH2 1 
ATOM   406  N  N   . PRO A  1 55  ? 42.617  5.728   41.357  1.00 41.12  ? 55   PRO A N   1 
ATOM   407  C  CA  . PRO A  1 55  ? 41.786  6.127   42.500  1.00 41.62  ? 55   PRO A CA  1 
ATOM   408  C  C   . PRO A  1 55  ? 42.294  7.394   43.183  1.00 44.06  ? 55   PRO A C   1 
ATOM   409  O  O   . PRO A  1 55  ? 43.507  7.596   43.287  1.00 39.80  ? 55   PRO A O   1 
ATOM   410  C  CB  . PRO A  1 55  ? 41.924  4.940   43.459  1.00 35.72  ? 55   PRO A CB  1 
ATOM   411  C  CG  . PRO A  1 55  ? 42.181  3.769   42.568  1.00 45.01  ? 55   PRO A CG  1 
ATOM   412  C  CD  . PRO A  1 55  ? 42.986  4.300   41.409  1.00 34.82  ? 55   PRO A CD  1 
ATOM   413  N  N   . TRP A  1 56  ? 41.371  8.237   43.635  1.00 42.44  ? 56   TRP A N   1 
ATOM   414  C  CA  . TRP A  1 56  ? 41.729  9.472   44.327  1.00 44.34  ? 56   TRP A CA  1 
ATOM   415  C  C   . TRP A  1 56  ? 41.431  9.358   45.819  1.00 53.96  ? 56   TRP A C   1 
ATOM   416  O  O   . TRP A  1 56  ? 40.816  8.386   46.257  1.00 50.75  ? 56   TRP A O   1 
ATOM   417  C  CB  . TRP A  1 56  ? 40.964  10.656  43.733  1.00 43.43  ? 56   TRP A CB  1 
ATOM   418  C  CG  . TRP A  1 56  ? 39.485  10.453  43.717  1.00 50.29  ? 56   TRP A CG  1 
ATOM   419  C  CD1 . TRP A  1 56  ? 38.591  10.821  44.681  1.00 48.56  ? 56   TRP A CD1 1 
ATOM   420  C  CD2 . TRP A  1 56  ? 38.723  9.829   42.678  1.00 51.95  ? 56   TRP A CD2 1 
ATOM   421  N  NE1 . TRP A  1 56  ? 37.318  10.464  44.303  1.00 54.22  ? 56   TRP A NE1 1 
ATOM   422  C  CE2 . TRP A  1 56  ? 37.373  9.853   43.077  1.00 52.13  ? 56   TRP A CE2 1 
ATOM   423  C  CE3 . TRP A  1 56  ? 39.052  9.253   41.448  1.00 52.57  ? 56   TRP A CE3 1 
ATOM   424  C  CZ2 . TRP A  1 56  ? 36.352  9.322   42.285  1.00 52.70  ? 56   TRP A CZ2 1 
ATOM   425  C  CZ3 . TRP A  1 56  ? 38.041  8.726   40.665  1.00 50.54  ? 56   TRP A CZ3 1 
ATOM   426  C  CH2 . TRP A  1 56  ? 36.707  8.764   41.086  1.00 51.20  ? 56   TRP A CH2 1 
ATOM   427  N  N   . SER A  1 57  ? 41.870  10.343  46.599  1.00 55.72  ? 57   SER A N   1 
ATOM   428  C  CA  . SER A  1 57  ? 41.557  10.372  48.029  1.00 59.35  ? 57   SER A CA  1 
ATOM   429  C  C   . SER A  1 57  ? 40.539  11.467  48.336  1.00 56.46  ? 57   SER A C   1 
ATOM   430  O  O   . SER A  1 57  ? 40.546  12.522  47.705  1.00 61.72  ? 57   SER A O   1 
ATOM   431  C  CB  . SER A  1 57  ? 42.826  10.563  48.868  1.00 61.74  ? 57   SER A CB  1 
ATOM   432  O  OG  . SER A  1 57  ? 43.519  11.744  48.502  1.00 66.57  ? 57   SER A OG  1 
ATOM   433  N  N   . GLY A  1 58  ? 39.654  11.209  49.294  1.00 52.44  ? 58   GLY A N   1 
ATOM   434  C  CA  . GLY A  1 58  ? 38.655  12.190  49.684  1.00 49.80  ? 58   GLY A CA  1 
ATOM   435  C  C   . GLY A  1 58  ? 37.402  12.145  48.831  1.00 47.99  ? 58   GLY A C   1 
ATOM   436  O  O   . GLY A  1 58  ? 37.163  11.172  48.113  1.00 40.29  ? 58   GLY A O   1 
ATOM   437  N  N   . VAL A  1 59  ? 36.595  13.200  48.912  1.00 49.57  ? 59   VAL A N   1 
ATOM   438  C  CA  . VAL A  1 59  ? 35.370  13.281  48.125  1.00 50.82  ? 59   VAL A CA  1 
ATOM   439  C  C   . VAL A  1 59  ? 35.565  14.194  46.917  1.00 50.57  ? 59   VAL A C   1 
ATOM   440  O  O   . VAL A  1 59  ? 35.756  15.403  47.064  1.00 52.53  ? 59   VAL A O   1 
ATOM   441  C  CB  . VAL A  1 59  ? 34.183  13.788  48.970  1.00 54.58  ? 59   VAL A CB  1 
ATOM   442  C  CG1 . VAL A  1 59  ? 32.878  13.554  48.235  1.00 53.96  ? 59   VAL A CG1 1 
ATOM   443  C  CG2 . VAL A  1 59  ? 34.150  13.084  50.312  1.00 44.41  ? 59   VAL A CG2 1 
ATOM   444  N  N   . LEU A  1 60  ? 35.529  13.607  45.725  1.00 48.98  ? 60   LEU A N   1 
ATOM   445  C  CA  . LEU A  1 60  ? 35.620  14.381  44.494  1.00 47.10  ? 60   LEU A CA  1 
ATOM   446  C  C   . LEU A  1 60  ? 34.336  15.183  44.301  1.00 44.61  ? 60   LEU A C   1 
ATOM   447  O  O   . LEU A  1 60  ? 33.241  14.616  44.297  1.00 46.93  ? 60   LEU A O   1 
ATOM   448  C  CB  . LEU A  1 60  ? 35.857  13.454  43.296  1.00 52.05  ? 60   LEU A CB  1 
ATOM   449  C  CG  . LEU A  1 60  ? 36.251  14.096  41.961  1.00 49.70  ? 60   LEU A CG  1 
ATOM   450  C  CD1 . LEU A  1 60  ? 37.407  13.350  41.321  1.00 49.39  ? 60   LEU A CD1 1 
ATOM   451  C  CD2 . LEU A  1 60  ? 35.071  14.129  41.014  1.00 44.52  ? 60   LEU A CD2 1 
ATOM   452  N  N   . ASP A  1 61  ? 34.460  16.500  44.167  1.00 38.26  ? 61   ASP A N   1 
ATOM   453  C  CA  . ASP A  1 61  ? 33.298  17.323  43.854  1.00 45.25  ? 61   ASP A CA  1 
ATOM   454  C  C   . ASP A  1 61  ? 32.857  17.042  42.422  1.00 39.86  ? 61   ASP A C   1 
ATOM   455  O  O   . ASP A  1 61  ? 33.632  17.213  41.482  1.00 40.76  ? 61   ASP A O   1 
ATOM   456  C  CB  . ASP A  1 61  ? 33.607  18.811  44.037  1.00 54.06  ? 61   ASP A CB  1 
ATOM   457  C  CG  . ASP A  1 61  ? 32.392  19.695  43.804  1.00 65.91  ? 61   ASP A CG  1 
ATOM   458  O  OD1 . ASP A  1 61  ? 31.576  19.849  44.740  1.00 68.72  ? 61   ASP A OD1 1 
ATOM   459  O  OD2 . ASP A  1 61  ? 32.253  20.238  42.686  1.00 69.38  ? 61   ASP A OD2 1 
ATOM   460  N  N   . ALA A  1 62  ? 31.617  16.592  42.261  1.00 39.34  ? 62   ALA A N   1 
ATOM   461  C  CA  . ALA A  1 62  ? 31.088  16.267  40.938  1.00 40.55  ? 62   ALA A CA  1 
ATOM   462  C  C   . ALA A  1 62  ? 29.874  17.125  40.608  1.00 40.74  ? 62   ALA A C   1 
ATOM   463  O  O   . ALA A  1 62  ? 28.825  16.606  40.219  1.00 35.64  ? 62   ALA A O   1 
ATOM   464  C  CB  . ALA A  1 62  ? 30.733  14.794  40.861  1.00 34.17  ? 62   ALA A CB  1 
ATOM   465  N  N   . THR A  1 63  ? 30.035  18.441  40.748  1.00 43.59  ? 63   THR A N   1 
ATOM   466  C  CA  . THR A  1 63  ? 28.926  19.387  40.625  1.00 41.70  ? 63   THR A CA  1 
ATOM   467  C  C   . THR A  1 63  ? 29.035  20.306  39.408  1.00 46.75  ? 63   THR A C   1 
ATOM   468  O  O   . THR A  1 63  ? 28.088  21.022  39.082  1.00 45.94  ? 63   THR A O   1 
ATOM   469  C  CB  . THR A  1 63  ? 28.805  20.259  41.889  1.00 40.21  ? 63   THR A CB  1 
ATOM   470  O  OG1 . THR A  1 63  ? 29.981  21.067  42.031  1.00 42.79  ? 63   THR A OG1 1 
ATOM   471  C  CG2 . THR A  1 63  ? 28.640  19.383  43.127  1.00 28.56  ? 63   THR A CG2 1 
ATOM   472  N  N   . THR A  1 64  ? 30.188  20.292  38.745  1.00 50.96  ? 64   THR A N   1 
ATOM   473  C  CA  . THR A  1 64  ? 30.393  21.105  37.547  1.00 47.05  ? 64   THR A CA  1 
ATOM   474  C  C   . THR A  1 64  ? 30.893  20.270  36.379  1.00 42.89  ? 64   THR A C   1 
ATOM   475  O  O   . THR A  1 64  ? 31.516  19.225  36.574  1.00 42.91  ? 64   THR A O   1 
ATOM   476  C  CB  . THR A  1 64  ? 31.407  22.241  37.787  1.00 49.28  ? 64   THR A CB  1 
ATOM   477  O  OG1 . THR A  1 64  ? 32.662  21.688  38.205  1.00 52.06  ? 64   THR A OG1 1 
ATOM   478  C  CG2 . THR A  1 64  ? 30.896  23.198  38.844  1.00 48.16  ? 64   THR A CG2 1 
ATOM   479  N  N   . PHE A  1 65  ? 30.620  20.731  35.164  1.00 45.08  ? 65   PHE A N   1 
ATOM   480  C  CA  . PHE A  1 65  ? 31.185  20.098  33.983  1.00 39.02  ? 65   PHE A CA  1 
ATOM   481  C  C   . PHE A  1 65  ? 32.692  20.320  33.972  1.00 40.53  ? 65   PHE A C   1 
ATOM   482  O  O   . PHE A  1 65  ? 33.175  21.364  34.416  1.00 42.48  ? 65   PHE A O   1 
ATOM   483  C  CB  . PHE A  1 65  ? 30.558  20.666  32.711  1.00 25.52  ? 65   PHE A CB  1 
ATOM   484  C  CG  . PHE A  1 65  ? 29.156  20.178  32.450  1.00 36.64  ? 65   PHE A CG  1 
ATOM   485  C  CD1 . PHE A  1 65  ? 28.906  18.829  32.212  1.00 35.01  ? 65   PHE A CD1 1 
ATOM   486  C  CD2 . PHE A  1 65  ? 28.091  21.073  32.409  1.00 37.24  ? 65   PHE A CD2 1 
ATOM   487  C  CE1 . PHE A  1 65  ? 27.615  18.378  31.959  1.00 38.53  ? 65   PHE A CE1 1 
ATOM   488  C  CE2 . PHE A  1 65  ? 26.800  20.633  32.158  1.00 35.11  ? 65   PHE A CE2 1 
ATOM   489  C  CZ  . PHE A  1 65  ? 26.559  19.282  31.934  1.00 40.44  ? 65   PHE A CZ  1 
ATOM   490  N  N   . GLN A  1 66  ? 33.436  19.337  33.478  1.00 34.13  ? 66   GLN A N   1 
ATOM   491  C  CA  . GLN A  1 66  ? 34.890  19.446  33.409  1.00 34.54  ? 66   GLN A CA  1 
ATOM   492  C  C   . GLN A  1 66  ? 35.353  20.014  32.073  1.00 40.98  ? 66   GLN A C   1 
ATOM   493  O  O   . GLN A  1 66  ? 34.532  20.369  31.225  1.00 38.14  ? 66   GLN A O   1 
ATOM   494  C  CB  . GLN A  1 66  ? 35.537  18.084  33.650  1.00 42.38  ? 66   GLN A CB  1 
ATOM   495  C  CG  . GLN A  1 66  ? 35.978  17.855  35.086  1.00 47.21  ? 66   GLN A CG  1 
ATOM   496  C  CD  . GLN A  1 66  ? 37.243  18.614  35.436  1.00 54.93  ? 66   GLN A CD  1 
ATOM   497  O  OE1 . GLN A  1 66  ? 37.819  19.307  34.596  1.00 53.52  ? 66   GLN A OE1 1 
ATOM   498  N  NE2 . GLN A  1 66  ? 37.686  18.481  36.681  1.00 56.13  ? 66   GLN A NE2 1 
ATOM   499  N  N   . ASN A  1 67  ? 36.668  20.097  31.893  1.00 42.43  ? 67   ASN A N   1 
ATOM   500  C  CA  . ASN A  1 67  ? 37.246  20.680  30.685  1.00 39.22  ? 67   ASN A CA  1 
ATOM   501  C  C   . ASN A  1 67  ? 36.756  20.031  29.393  1.00 39.82  ? 67   ASN A C   1 
ATOM   502  O  O   . ASN A  1 67  ? 36.490  18.828  29.346  1.00 36.90  ? 67   ASN A O   1 
ATOM   503  C  CB  . ASN A  1 67  ? 38.777  20.631  30.749  1.00 35.34  ? 67   ASN A CB  1 
ATOM   504  C  CG  . ASN A  1 67  ? 39.342  21.505  31.853  1.00 36.30  ? 67   ASN A CG  1 
ATOM   505  O  OD1 . ASN A  1 67  ? 38.774  22.545  32.185  1.00 41.58  ? 67   ASN A OD1 1 
ATOM   506  N  ND2 . ASN A  1 67  ? 40.464  21.087  32.426  1.00 39.97  ? 67   ASN A ND2 1 
ATOM   507  N  N   . VAL A  1 68  ? 36.626  20.848  28.352  1.00 34.75  ? 68   VAL A N   1 
ATOM   508  C  CA  . VAL A  1 68  ? 36.285  20.366  27.021  1.00 32.55  ? 68   VAL A CA  1 
ATOM   509  C  C   . VAL A  1 68  ? 37.567  19.954  26.310  1.00 32.19  ? 68   VAL A C   1 
ATOM   510  O  O   . VAL A  1 68  ? 38.585  20.640  26.422  1.00 35.10  ? 68   VAL A O   1 
ATOM   511  C  CB  . VAL A  1 68  ? 35.566  21.464  26.216  1.00 37.51  ? 68   VAL A CB  1 
ATOM   512  C  CG1 . VAL A  1 68  ? 35.470  21.095  24.746  1.00 30.17  ? 68   VAL A CG1 1 
ATOM   513  C  CG2 . VAL A  1 68  ? 34.188  21.714  26.797  1.00 31.11  ? 68   VAL A CG2 1 
ATOM   514  N  N   . CYS A  1 69  ? 37.532  18.829  25.600  1.00 33.47  ? 69   CYS A N   1 
ATOM   515  C  CA  . CYS A  1 69  ? 38.713  18.355  24.884  1.00 30.87  ? 69   CYS A CA  1 
ATOM   516  C  C   . CYS A  1 69  ? 39.184  19.382  23.864  1.00 35.12  ? 69   CYS A C   1 
ATOM   517  O  O   . CYS A  1 69  ? 38.368  20.041  23.215  1.00 33.05  ? 69   CYS A O   1 
ATOM   518  C  CB  . CYS A  1 69  ? 38.435  17.006  24.221  1.00 28.18  ? 69   CYS A CB  1 
ATOM   519  S  SG  . CYS A  1 69  ? 38.269  15.651  25.404  1.00 41.88  ? 69   CYS A SG  1 
ATOM   520  N  N   . TYR A  1 70  ? 40.501  19.533  23.746  1.00 28.44  ? 70   TYR A N   1 
ATOM   521  C  CA  . TYR A  1 70  ? 41.072  20.586  22.916  1.00 34.88  ? 70   TYR A CA  1 
ATOM   522  C  C   . TYR A  1 70  ? 40.618  20.461  21.468  1.00 37.39  ? 70   TYR A C   1 
ATOM   523  O  O   . TYR A  1 70  ? 40.742  19.399  20.856  1.00 36.97  ? 70   TYR A O   1 
ATOM   524  C  CB  . TYR A  1 70  ? 42.598  20.593  23.011  1.00 35.80  ? 70   TYR A CB  1 
ATOM   525  C  CG  . TYR A  1 70  ? 43.160  21.991  23.064  1.00 44.25  ? 70   TYR A CG  1 
ATOM   526  C  CD1 . TYR A  1 70  ? 43.198  22.785  21.926  1.00 43.34  ? 70   TYR A CD1 1 
ATOM   527  C  CD2 . TYR A  1 70  ? 43.636  22.526  24.255  1.00 40.43  ? 70   TYR A CD2 1 
ATOM   528  C  CE1 . TYR A  1 70  ? 43.701  24.067  21.967  1.00 47.15  ? 70   TYR A CE1 1 
ATOM   529  C  CE2 . TYR A  1 70  ? 44.141  23.809  24.307  1.00 40.09  ? 70   TYR A CE2 1 
ATOM   530  C  CZ  . TYR A  1 70  ? 44.171  24.573  23.160  1.00 52.81  ? 70   TYR A CZ  1 
ATOM   531  O  OH  . TYR A  1 70  ? 44.675  25.852  23.204  1.00 62.68  ? 70   TYR A OH  1 
ATOM   532  N  N   . GLN A  1 71  ? 40.081  21.550  20.926  1.00 35.12  ? 71   GLN A N   1 
ATOM   533  C  CA  . GLN A  1 71  ? 39.453  21.489  19.615  1.00 34.39  ? 71   GLN A CA  1 
ATOM   534  C  C   . GLN A  1 71  ? 39.361  22.834  18.900  1.00 37.60  ? 71   GLN A C   1 
ATOM   535  O  O   . GLN A  1 71  ? 39.617  23.890  19.479  1.00 37.54  ? 71   GLN A O   1 
ATOM   536  C  CB  . GLN A  1 71  ? 38.053  20.890  19.751  1.00 30.85  ? 71   GLN A CB  1 
ATOM   537  C  CG  . GLN A  1 71  ? 37.092  21.756  20.549  1.00 24.61  ? 71   GLN A CG  1 
ATOM   538  C  CD  . GLN A  1 71  ? 35.807  21.034  20.874  1.00 29.08  ? 71   GLN A CD  1 
ATOM   539  O  OE1 . GLN A  1 71  ? 34.744  21.356  20.341  1.00 32.14  ? 71   GLN A OE1 1 
ATOM   540  N  NE2 . GLN A  1 71  ? 35.896  20.044  21.751  1.00 30.18  ? 71   GLN A NE2 1 
ATOM   541  N  N   . TYR A  1 72  ? 38.986  22.765  17.627  1.00 44.46  ? 72   TYR A N   1 
ATOM   542  C  CA  . TYR A  1 72  ? 38.771  23.935  16.788  1.00 45.04  ? 72   TYR A CA  1 
ATOM   543  C  C   . TYR A  1 72  ? 37.501  24.670  17.209  1.00 42.81  ? 72   TYR A C   1 
ATOM   544  O  O   . TYR A  1 72  ? 36.485  24.041  17.515  1.00 42.91  ? 72   TYR A O   1 
ATOM   545  C  CB  . TYR A  1 72  ? 38.655  23.481  15.331  1.00 52.53  ? 72   TYR A CB  1 
ATOM   546  C  CG  . TYR A  1 72  ? 38.420  24.594  14.343  1.00 54.61  ? 72   TYR A CG  1 
ATOM   547  C  CD1 . TYR A  1 72  ? 39.477  25.352  13.863  1.00 52.40  ? 72   TYR A CD1 1 
ATOM   548  C  CD2 . TYR A  1 72  ? 37.141  24.883  13.884  1.00 55.85  ? 72   TYR A CD2 1 
ATOM   549  C  CE1 . TYR A  1 72  ? 39.269  26.372  12.957  1.00 53.75  ? 72   TYR A CE1 1 
ATOM   550  C  CE2 . TYR A  1 72  ? 36.923  25.902  12.980  1.00 56.63  ? 72   TYR A CE2 1 
ATOM   551  C  CZ  . TYR A  1 72  ? 37.991  26.643  12.519  1.00 58.99  ? 72   TYR A CZ  1 
ATOM   552  O  OH  . TYR A  1 72  ? 37.783  27.661  11.617  1.00 63.55  ? 72   TYR A OH  1 
ATOM   553  N  N   . VAL A  1 73  ? 37.560  25.999  17.233  1.00 44.36  ? 73   VAL A N   1 
ATOM   554  C  CA  . VAL A  1 73  ? 36.383  26.798  17.562  1.00 52.84  ? 73   VAL A CA  1 
ATOM   555  C  C   . VAL A  1 73  ? 35.827  27.525  16.336  1.00 55.01  ? 73   VAL A C   1 
ATOM   556  O  O   . VAL A  1 73  ? 36.534  28.295  15.682  1.00 52.09  ? 73   VAL A O   1 
ATOM   557  C  CB  . VAL A  1 73  ? 36.667  27.794  18.700  1.00 47.92  ? 73   VAL A CB  1 
ATOM   558  C  CG1 . VAL A  1 73  ? 35.435  28.634  18.981  1.00 47.22  ? 73   VAL A CG1 1 
ATOM   559  C  CG2 . VAL A  1 73  ? 37.086  27.046  19.950  1.00 38.43  ? 73   VAL A CG2 1 
ATOM   560  N  N   . ASP A  1 74  ? 34.559  27.259  16.032  1.00 58.99  ? 74   ASP A N   1 
ATOM   561  C  CA  . ASP A  1 74  ? 33.880  27.836  14.873  1.00 53.44  ? 74   ASP A CA  1 
ATOM   562  C  C   . ASP A  1 74  ? 33.803  29.362  14.972  1.00 55.16  ? 74   ASP A C   1 
ATOM   563  O  O   . ASP A  1 74  ? 33.239  29.907  15.921  1.00 50.42  ? 74   ASP A O   1 
ATOM   564  C  CB  . ASP A  1 74  ? 32.475  27.234  14.747  1.00 53.47  ? 74   ASP A CB  1 
ATOM   565  C  CG  . ASP A  1 74  ? 31.856  27.446  13.375  1.00 58.57  ? 74   ASP A CG  1 
ATOM   566  O  OD1 . ASP A  1 74  ? 32.125  28.484  12.731  1.00 58.67  ? 74   ASP A OD1 1 
ATOM   567  O  OD2 . ASP A  1 74  ? 31.079  26.566  12.945  1.00 59.43  ? 74   ASP A OD2 1 
ATOM   568  N  N   . THR A  1 75  ? 34.379  30.038  13.981  1.00 63.99  ? 75   THR A N   1 
ATOM   569  C  CA  . THR A  1 75  ? 34.406  31.497  13.944  1.00 68.23  ? 75   THR A CA  1 
ATOM   570  C  C   . THR A  1 75  ? 33.710  32.060  12.704  1.00 67.93  ? 75   THR A C   1 
ATOM   571  O  O   . THR A  1 75  ? 33.845  33.247  12.401  1.00 65.89  ? 75   THR A O   1 
ATOM   572  C  CB  . THR A  1 75  ? 35.854  32.037  13.986  1.00 69.53  ? 75   THR A CB  1 
ATOM   573  O  OG1 . THR A  1 75  ? 36.707  31.194  13.200  1.00 65.68  ? 75   THR A OG1 1 
ATOM   574  C  CG2 . THR A  1 75  ? 36.370  32.085  15.415  1.00 63.56  ? 75   THR A CG2 1 
ATOM   575  N  N   . LEU A  1 76  ? 32.964  31.216  11.993  1.00 63.63  ? 76   LEU A N   1 
ATOM   576  C  CA  . LEU A  1 76  ? 32.294  31.647  10.763  1.00 66.33  ? 76   LEU A CA  1 
ATOM   577  C  C   . LEU A  1 76  ? 31.272  32.753  11.020  1.00 70.55  ? 76   LEU A C   1 
ATOM   578  O  O   . LEU A  1 76  ? 31.170  33.707  10.246  1.00 75.56  ? 76   LEU A O   1 
ATOM   579  C  CB  . LEU A  1 76  ? 31.631  30.468  10.038  1.00 64.06  ? 76   LEU A CB  1 
ATOM   580  C  CG  . LEU A  1 76  ? 31.032  30.834  8.673   1.00 68.93  ? 76   LEU A CG  1 
ATOM   581  C  CD1 . LEU A  1 76  ? 32.104  31.444  7.791   1.00 68.70  ? 76   LEU A CD1 1 
ATOM   582  C  CD2 . LEU A  1 76  ? 30.385  29.645  7.974   1.00 61.79  ? 76   LEU A CD2 1 
ATOM   583  N  N   . TYR A  1 77  ? 30.522  32.622  12.110  1.00 66.48  ? 77   TYR A N   1 
ATOM   584  C  CA  . TYR A  1 77  ? 29.523  33.622  12.469  1.00 63.44  ? 77   TYR A CA  1 
ATOM   585  C  C   . TYR A  1 77  ? 29.607  34.010  13.950  1.00 69.08  ? 77   TYR A C   1 
ATOM   586  O  O   . TYR A  1 77  ? 28.831  33.519  14.772  1.00 66.31  ? 77   TYR A O   1 
ATOM   587  C  CB  . TYR A  1 77  ? 28.118  33.118  12.121  1.00 54.76  ? 77   TYR A CB  1 
ATOM   588  C  CG  . TYR A  1 77  ? 27.904  32.815  10.652  1.00 52.32  ? 77   TYR A CG  1 
ATOM   589  C  CD1 . TYR A  1 77  ? 27.974  33.822  9.699   1.00 51.78  ? 77   TYR A CD1 1 
ATOM   590  C  CD2 . TYR A  1 77  ? 27.609  31.527  10.221  1.00 54.55  ? 77   TYR A CD2 1 
ATOM   591  C  CE1 . TYR A  1 77  ? 27.770  33.554  8.359   1.00 56.36  ? 77   TYR A CE1 1 
ATOM   592  C  CE2 . TYR A  1 77  ? 27.401  31.249  8.879   1.00 56.98  ? 77   TYR A CE2 1 
ATOM   593  C  CZ  . TYR A  1 77  ? 27.483  32.269  7.952   1.00 62.53  ? 77   TYR A CZ  1 
ATOM   594  O  OH  . TYR A  1 77  ? 27.282  32.016  6.611   1.00 63.87  ? 77   TYR A OH  1 
ATOM   595  N  N   . PRO A  1 78  ? 30.556  34.898  14.292  1.00 75.43  ? 78   PRO A N   1 
ATOM   596  C  CA  . PRO A  1 78  ? 30.783  35.326  15.681  1.00 75.69  ? 78   PRO A CA  1 
ATOM   597  C  C   . PRO A  1 78  ? 29.574  36.015  16.318  1.00 73.15  ? 78   PRO A C   1 
ATOM   598  O  O   . PRO A  1 78  ? 29.142  37.067  15.843  1.00 69.90  ? 78   PRO A O   1 
ATOM   599  C  CB  . PRO A  1 78  ? 31.947  36.316  15.554  1.00 77.71  ? 78   PRO A CB  1 
ATOM   600  C  CG  . PRO A  1 78  ? 32.659  35.904  14.306  1.00 77.02  ? 78   PRO A CG  1 
ATOM   601  C  CD  . PRO A  1 78  ? 31.573  35.444  13.374  1.00 71.60  ? 78   PRO A CD  1 
ATOM   602  N  N   . GLY A  1 79  ? 29.048  35.425  17.390  1.00 71.27  ? 79   GLY A N   1 
ATOM   603  C  CA  . GLY A  1 79  ? 27.890  35.968  18.080  1.00 66.82  ? 79   GLY A CA  1 
ATOM   604  C  C   . GLY A  1 79  ? 26.585  35.263  17.747  1.00 60.83  ? 79   GLY A C   1 
ATOM   605  O  O   . GLY A  1 79  ? 25.590  35.415  18.460  1.00 52.86  ? 79   GLY A O   1 
ATOM   606  N  N   . PHE A  1 80  ? 26.600  34.489  16.664  1.00 55.32  ? 80   PHE A N   1 
ATOM   607  C  CA  . PHE A  1 80  ? 25.411  33.812  16.146  1.00 45.57  ? 80   PHE A CA  1 
ATOM   608  C  C   . PHE A  1 80  ? 25.101  32.528  16.907  1.00 42.84  ? 80   PHE A C   1 
ATOM   609  O  O   . PHE A  1 80  ? 25.930  31.617  16.966  1.00 37.98  ? 80   PHE A O   1 
ATOM   610  C  CB  . PHE A  1 80  ? 25.614  33.507  14.659  1.00 38.10  ? 80   PHE A CB  1 
ATOM   611  C  CG  . PHE A  1 80  ? 24.469  32.779  14.015  1.00 41.71  ? 80   PHE A CG  1 
ATOM   612  C  CD1 . PHE A  1 80  ? 23.186  33.313  14.033  1.00 43.88  ? 80   PHE A CD1 1 
ATOM   613  C  CD2 . PHE A  1 80  ? 24.683  31.574  13.357  1.00 46.44  ? 80   PHE A CD2 1 
ATOM   614  C  CE1 . PHE A  1 80  ? 22.130  32.647  13.425  1.00 45.51  ? 80   PHE A CE1 1 
ATOM   615  C  CE2 . PHE A  1 80  ? 23.636  30.902  12.744  1.00 43.79  ? 80   PHE A CE2 1 
ATOM   616  C  CZ  . PHE A  1 80  ? 22.355  31.439  12.779  1.00 47.40  ? 80   PHE A CZ  1 
ATOM   617  N  N   . GLU A  1 81  ? 23.901  32.459  17.476  1.00 42.32  ? 81   GLU A N   1 
ATOM   618  C  CA  . GLU A  1 81  ? 23.485  31.306  18.273  1.00 43.86  ? 81   GLU A CA  1 
ATOM   619  C  C   . GLU A  1 81  ? 23.579  29.979  17.520  1.00 43.29  ? 81   GLU A C   1 
ATOM   620  O  O   . GLU A  1 81  ? 23.918  28.955  18.109  1.00 39.39  ? 81   GLU A O   1 
ATOM   621  C  CB  . GLU A  1 81  ? 22.061  31.506  18.798  1.00 43.52  ? 81   GLU A CB  1 
ATOM   622  N  N   . GLY A  1 82  ? 23.288  30.001  16.221  1.00 36.93  ? 82   GLY A N   1 
ATOM   623  C  CA  . GLY A  1 82  ? 23.288  28.787  15.421  1.00 30.10  ? 82   GLY A CA  1 
ATOM   624  C  C   . GLY A  1 82  ? 24.621  28.060  15.377  1.00 33.81  ? 82   GLY A C   1 
ATOM   625  O  O   . GLY A  1 82  ? 24.663  26.844  15.167  1.00 30.05  ? 82   GLY A O   1 
ATOM   626  N  N   . THR A  1 83  ? 25.707  28.806  15.573  1.00 34.16  ? 83   THR A N   1 
ATOM   627  C  CA  . THR A  1 83  ? 27.050  28.229  15.615  1.00 40.13  ? 83   THR A CA  1 
ATOM   628  C  C   . THR A  1 83  ? 27.585  28.098  17.047  1.00 43.34  ? 83   THR A C   1 
ATOM   629  O  O   . THR A  1 83  ? 28.203  27.090  17.398  1.00 47.77  ? 83   THR A O   1 
ATOM   630  C  CB  . THR A  1 83  ? 28.047  29.039  14.749  1.00 39.39  ? 83   THR A CB  1 
ATOM   631  O  OG1 . THR A  1 83  ? 27.983  30.427  15.098  1.00 48.63  ? 83   THR A OG1 1 
ATOM   632  C  CG2 . THR A  1 83  ? 27.727  28.885  13.272  1.00 38.60  ? 83   THR A CG2 1 
ATOM   633  N  N   . GLU A  1 84  ? 27.338  29.113  17.870  1.00 36.52  ? 84   GLU A N   1 
ATOM   634  C  CA  . GLU A  1 84  ? 27.855  29.147  19.237  1.00 43.16  ? 84   GLU A CA  1 
ATOM   635  C  C   . GLU A  1 84  ? 27.352  27.995  20.112  1.00 42.23  ? 84   GLU A C   1 
ATOM   636  O  O   . GLU A  1 84  ? 28.078  27.512  20.981  1.00 41.06  ? 84   GLU A O   1 
ATOM   637  C  CB  . GLU A  1 84  ? 27.539  30.496  19.904  1.00 42.67  ? 84   GLU A CB  1 
ATOM   638  C  CG  . GLU A  1 84  ? 28.144  31.725  19.218  1.00 54.98  ? 84   GLU A CG  1 
ATOM   639  C  CD  . GLU A  1 84  ? 29.662  31.785  19.301  1.00 66.44  ? 84   GLU A CD  1 
ATOM   640  O  OE1 . GLU A  1 84  ? 30.268  30.984  20.044  1.00 66.30  ? 84   GLU A OE1 1 
ATOM   641  O  OE2 . GLU A  1 84  ? 30.254  32.647  18.616  1.00 71.31  ? 84   GLU A OE2 1 
ATOM   642  N  N   . MET A  1 85  ? 26.122  27.547  19.866  1.00 40.19  ? 85   MET A N   1 
ATOM   643  C  CA  . MET A  1 85  ? 25.499  26.473  20.650  1.00 33.83  ? 85   MET A CA  1 
ATOM   644  C  C   . MET A  1 85  ? 26.260  25.149  20.558  1.00 40.30  ? 85   MET A C   1 
ATOM   645  O  O   . MET A  1 85  ? 26.041  24.243  21.365  1.00 50.62  ? 85   MET A O   1 
ATOM   646  C  CB  . MET A  1 85  ? 24.040  26.261  20.209  1.00 34.42  ? 85   MET A CB  1 
ATOM   647  C  CG  . MET A  1 85  ? 23.887  25.845  18.744  1.00 41.88  ? 85   MET A CG  1 
ATOM   648  S  SD  . MET A  1 85  ? 22.382  24.910  18.371  1.00 52.00  ? 85   MET A SD  1 
ATOM   649  C  CE  . MET A  1 85  ? 21.132  26.173  18.549  1.00 41.38  ? 85   MET A CE  1 
ATOM   650  N  N   . TRP A  1 86  ? 27.142  25.041  19.568  1.00 33.84  ? 86   TRP A N   1 
ATOM   651  C  CA  . TRP A  1 86  ? 27.951  23.842  19.382  1.00 31.56  ? 86   TRP A CA  1 
ATOM   652  C  C   . TRP A  1 86  ? 29.388  24.064  19.854  1.00 31.11  ? 86   TRP A C   1 
ATOM   653  O  O   . TRP A  1 86  ? 30.155  23.111  20.003  1.00 31.81  ? 86   TRP A O   1 
ATOM   654  C  CB  . TRP A  1 86  ? 27.947  23.420  17.908  1.00 29.95  ? 86   TRP A CB  1 
ATOM   655  C  CG  . TRP A  1 86  ? 26.572  23.269  17.323  1.00 30.11  ? 86   TRP A CG  1 
ATOM   656  C  CD1 . TRP A  1 86  ? 25.945  24.123  16.461  1.00 37.84  ? 86   TRP A CD1 1 
ATOM   657  C  CD2 . TRP A  1 86  ? 25.653  22.196  17.563  1.00 33.86  ? 86   TRP A CD2 1 
ATOM   658  N  NE1 . TRP A  1 86  ? 24.692  23.645  16.151  1.00 40.32  ? 86   TRP A NE1 1 
ATOM   659  C  CE2 . TRP A  1 86  ? 24.490  22.464  16.817  1.00 37.41  ? 86   TRP A CE2 1 
ATOM   660  C  CE3 . TRP A  1 86  ? 25.703  21.035  18.339  1.00 32.92  ? 86   TRP A CE3 1 
ATOM   661  C  CZ2 . TRP A  1 86  ? 23.385  21.608  16.826  1.00 37.58  ? 86   TRP A CZ2 1 
ATOM   662  C  CZ3 . TRP A  1 86  ? 24.608  20.190  18.346  1.00 34.14  ? 86   TRP A CZ3 1 
ATOM   663  C  CH2 . TRP A  1 86  ? 23.465  20.479  17.597  1.00 34.69  ? 86   TRP A CH2 1 
ATOM   664  N  N   . ASN A  1 87  ? 29.750  25.325  20.077  1.00 28.33  ? 87   ASN A N   1 
ATOM   665  C  CA  . ASN A  1 87  ? 31.096  25.670  20.528  1.00 33.67  ? 87   ASN A CA  1 
ATOM   666  C  C   . ASN A  1 87  ? 31.340  25.284  21.995  1.00 41.28  ? 87   ASN A C   1 
ATOM   667  O  O   . ASN A  1 87  ? 30.389  25.183  22.773  1.00 40.06  ? 87   ASN A O   1 
ATOM   668  C  CB  . ASN A  1 87  ? 31.367  27.164  20.295  1.00 35.92  ? 87   ASN A CB  1 
ATOM   669  C  CG  . ASN A  1 87  ? 31.748  27.474  18.853  1.00 40.72  ? 87   ASN A CG  1 
ATOM   670  O  OD1 . ASN A  1 87  ? 32.224  26.605  18.118  1.00 39.91  ? 87   ASN A OD1 1 
ATOM   671  N  ND2 . ASN A  1 87  ? 31.551  28.721  18.448  1.00 43.43  ? 87   ASN A ND2 1 
ATOM   672  N  N   . PRO A  1 88  ? 32.615  25.055  22.372  1.00 43.13  ? 88   PRO A N   1 
ATOM   673  C  CA  . PRO A  1 88  ? 32.972  24.670  23.748  1.00 39.01  ? 88   PRO A CA  1 
ATOM   674  C  C   . PRO A  1 88  ? 32.436  25.643  24.798  1.00 39.05  ? 88   PRO A C   1 
ATOM   675  O  O   . PRO A  1 88  ? 32.610  26.853  24.652  1.00 36.12  ? 88   PRO A O   1 
ATOM   676  C  CB  . PRO A  1 88  ? 34.505  24.713  23.736  1.00 29.43  ? 88   PRO A CB  1 
ATOM   677  C  CG  . PRO A  1 88  ? 34.876  24.436  22.304  1.00 36.99  ? 88   PRO A CG  1 
ATOM   678  C  CD  . PRO A  1 88  ? 33.795  25.089  21.483  1.00 39.07  ? 88   PRO A CD  1 
ATOM   679  N  N   . ASN A  1 89  ? 31.802  25.117  25.843  1.00 39.95  ? 89   ASN A N   1 
ATOM   680  C  CA  . ASN A  1 89  ? 31.228  25.954  26.893  1.00 34.59  ? 89   ASN A CA  1 
ATOM   681  C  C   . ASN A  1 89  ? 32.007  25.842  28.199  1.00 40.36  ? 89   ASN A C   1 
ATOM   682  O  O   . ASN A  1 89  ? 31.591  26.364  29.233  1.00 51.32  ? 89   ASN A O   1 
ATOM   683  C  CB  . ASN A  1 89  ? 29.754  25.596  27.121  1.00 30.63  ? 89   ASN A CB  1 
ATOM   684  C  CG  . ASN A  1 89  ? 29.565  24.153  27.550  1.00 36.49  ? 89   ASN A CG  1 
ATOM   685  O  OD1 . ASN A  1 89  ? 30.391  23.294  27.243  1.00 37.42  ? 89   ASN A OD1 1 
ATOM   686  N  ND2 . ASN A  1 89  ? 28.476  23.879  28.265  1.00 38.05  ? 89   ASN A ND2 1 
ATOM   687  N  N   . ARG A  1 90  ? 33.128  25.131  28.145  1.00 41.50  ? 90   ARG A N   1 
ATOM   688  C  CA  . ARG A  1 90  ? 34.066  25.065  29.261  1.00 44.59  ? 90   ARG A CA  1 
ATOM   689  C  C   . ARG A  1 90  ? 35.475  25.260  28.717  1.00 44.42  ? 90   ARG A C   1 
ATOM   690  O  O   . ARG A  1 90  ? 35.674  25.330  27.503  1.00 46.18  ? 90   ARG A O   1 
ATOM   691  C  CB  . ARG A  1 90  ? 33.958  23.723  29.993  1.00 42.40  ? 90   ARG A CB  1 
ATOM   692  C  CG  . ARG A  1 90  ? 32.669  23.532  30.784  1.00 49.37  ? 90   ARG A CG  1 
ATOM   693  C  CD  . ARG A  1 90  ? 32.606  24.468  31.984  1.00 63.84  ? 90   ARG A CD  1 
ATOM   694  N  NE  . ARG A  1 90  ? 31.324  24.383  32.681  1.00 76.31  ? 90   ARG A NE  1 
ATOM   695  C  CZ  . ARG A  1 90  ? 30.318  25.237  32.504  1.00 83.06  ? 90   ARG A CZ  1 
ATOM   696  N  NH1 . ARG A  1 90  ? 30.444  26.251  31.658  1.00 85.76  ? 90   ARG A NH1 1 
ATOM   697  N  NH2 . ARG A  1 90  ? 29.187  25.079  33.176  1.00 79.81  ? 90   ARG A NH2 1 
ATOM   698  N  N   . GLU A  1 91  ? 36.450  25.349  29.613  1.00 40.41  ? 91   GLU A N   1 
ATOM   699  C  CA  . GLU A  1 91  ? 37.840  25.548  29.212  1.00 39.83  ? 91   GLU A CA  1 
ATOM   700  C  C   . GLU A  1 91  ? 38.367  24.397  28.358  1.00 41.71  ? 91   GLU A C   1 
ATOM   701  O  O   . GLU A  1 91  ? 38.028  23.233  28.586  1.00 36.12  ? 91   GLU A O   1 
ATOM   702  C  CB  . GLU A  1 91  ? 38.721  25.718  30.448  1.00 39.54  ? 91   GLU A CB  1 
ATOM   703  C  CG  . GLU A  1 91  ? 40.183  26.002  30.145  1.00 48.32  ? 91   GLU A CG  1 
ATOM   704  C  CD  . GLU A  1 91  ? 40.984  26.256  31.400  1.00 63.45  ? 91   GLU A CD  1 
ATOM   705  O  OE1 . GLU A  1 91  ? 40.392  26.722  32.399  1.00 63.50  ? 91   GLU A OE1 1 
ATOM   706  O  OE2 . GLU A  1 91  ? 42.205  25.989  31.402  1.00 66.96  ? 91   GLU A OE2 1 
ATOM   707  N  N   . LEU A  1 92  ? 39.192  24.733  27.370  1.00 39.18  ? 92   LEU A N   1 
ATOM   708  C  CA  . LEU A  1 92  ? 39.839  23.734  26.529  1.00 42.23  ? 92   LEU A CA  1 
ATOM   709  C  C   . LEU A  1 92  ? 41.092  23.179  27.206  1.00 44.78  ? 92   LEU A C   1 
ATOM   710  O  O   . LEU A  1 92  ? 41.891  23.932  27.768  1.00 40.14  ? 92   LEU A O   1 
ATOM   711  C  CB  . LEU A  1 92  ? 40.199  24.336  25.170  1.00 41.98  ? 92   LEU A CB  1 
ATOM   712  C  CG  . LEU A  1 92  ? 39.018  24.761  24.295  1.00 39.86  ? 92   LEU A CG  1 
ATOM   713  C  CD1 . LEU A  1 92  ? 39.487  25.433  23.019  1.00 37.91  ? 92   LEU A CD1 1 
ATOM   714  C  CD2 . LEU A  1 92  ? 38.180  23.550  23.966  1.00 42.95  ? 92   LEU A CD2 1 
ATOM   715  N  N   . SER A  1 93  ? 41.252  21.858  27.150  1.00 41.07  ? 93   SER A N   1 
ATOM   716  C  CA  . SER A  1 93  ? 42.406  21.182  27.741  1.00 41.55  ? 93   SER A CA  1 
ATOM   717  C  C   . SER A  1 93  ? 42.533  19.770  27.180  1.00 36.97  ? 93   SER A C   1 
ATOM   718  O  O   . SER A  1 93  ? 41.542  19.185  26.733  1.00 34.84  ? 93   SER A O   1 
ATOM   719  C  CB  . SER A  1 93  ? 42.269  21.131  29.268  1.00 32.64  ? 93   SER A CB  1 
ATOM   720  O  OG  . SER A  1 93  ? 43.356  20.437  29.859  1.00 34.67  ? 93   SER A OG  1 
ATOM   721  N  N   . GLU A  1 94  ? 43.749  19.227  27.191  1.00 37.64  ? 94   GLU A N   1 
ATOM   722  C  CA  . GLU A  1 94  ? 43.954  17.830  26.819  1.00 40.27  ? 94   GLU A CA  1 
ATOM   723  C  C   . GLU A  1 94  ? 43.576  16.939  27.996  1.00 42.33  ? 94   GLU A C   1 
ATOM   724  O  O   . GLU A  1 94  ? 43.350  15.737  27.831  1.00 42.76  ? 94   GLU A O   1 
ATOM   725  C  CB  . GLU A  1 94  ? 45.404  17.574  26.379  1.00 41.87  ? 94   GLU A CB  1 
ATOM   726  C  CG  . GLU A  1 94  ? 45.824  18.311  25.106  1.00 40.71  ? 94   GLU A CG  1 
ATOM   727  C  CD  . GLU A  1 94  ? 47.271  18.049  24.719  1.00 47.34  ? 94   GLU A CD  1 
ATOM   728  O  OE1 . GLU A  1 94  ? 47.582  16.925  24.266  1.00 42.34  ? 94   GLU A OE1 1 
ATOM   729  O  OE2 . GLU A  1 94  ? 48.101  18.971  24.861  1.00 50.57  ? 94   GLU A OE2 1 
ATOM   730  N  N   . ASP A  1 95  ? 43.515  17.546  29.181  1.00 36.21  ? 95   ASP A N   1 
ATOM   731  C  CA  . ASP A  1 95  ? 42.959  16.903  30.370  1.00 35.06  ? 95   ASP A CA  1 
ATOM   732  C  C   . ASP A  1 95  ? 41.446  17.095  30.347  1.00 34.38  ? 95   ASP A C   1 
ATOM   733  O  O   . ASP A  1 95  ? 40.925  18.062  30.909  1.00 42.32  ? 95   ASP A O   1 
ATOM   734  C  CB  . ASP A  1 95  ? 43.556  17.522  31.639  1.00 40.53  ? 95   ASP A CB  1 
ATOM   735  C  CG  . ASP A  1 95  ? 43.017  16.897  32.915  1.00 41.56  ? 95   ASP A CG  1 
ATOM   736  O  OD1 . ASP A  1 95  ? 42.380  15.824  32.854  1.00 39.07  ? 95   ASP A OD1 1 
ATOM   737  O  OD2 . ASP A  1 95  ? 43.245  17.482  33.992  1.00 51.69  ? 95   ASP A OD2 1 
ATOM   738  N  N   . CYS A  1 96  ? 40.743  16.163  29.708  1.00 26.09  ? 96   CYS A N   1 
ATOM   739  C  CA  . CYS A  1 96  ? 39.331  16.354  29.396  1.00 24.73  ? 96   CYS A CA  1 
ATOM   740  C  C   . CYS A  1 96  ? 38.535  15.061  29.404  1.00 22.59  ? 96   CYS A C   1 
ATOM   741  O  O   . CYS A  1 96  ? 37.360  15.054  29.037  1.00 29.10  ? 96   CYS A O   1 
ATOM   742  C  CB  . CYS A  1 96  ? 39.206  16.977  28.012  1.00 27.26  ? 96   CYS A CB  1 
ATOM   743  S  SG  . CYS A  1 96  ? 39.828  15.895  26.690  1.00 35.63  ? 96   CYS A SG  1 
ATOM   744  N  N   . LEU A  1 97  ? 39.170  13.962  29.795  1.00 25.24  ? 97   LEU A N   1 
ATOM   745  C  CA  . LEU A  1 97  ? 38.476  12.680  29.818  1.00 34.61  ? 97   LEU A CA  1 
ATOM   746  C  C   . LEU A  1 97  ? 37.637  12.523  31.088  1.00 39.94  ? 97   LEU A C   1 
ATOM   747  O  O   . LEU A  1 97  ? 38.043  11.866  32.049  1.00 35.88  ? 97   LEU A O   1 
ATOM   748  C  CB  . LEU A  1 97  ? 39.464  11.523  29.634  1.00 35.54  ? 97   LEU A CB  1 
ATOM   749  C  CG  . LEU A  1 97  ? 40.179  11.572  28.279  1.00 33.74  ? 97   LEU A CG  1 
ATOM   750  C  CD1 . LEU A  1 97  ? 41.101  10.384  28.072  1.00 26.64  ? 97   LEU A CD1 1 
ATOM   751  C  CD2 . LEU A  1 97  ? 39.159  11.655  27.155  1.00 33.22  ? 97   LEU A CD2 1 
ATOM   752  N  N   . TYR A  1 98  ? 36.460  13.142  31.079  1.00 36.74  ? 98   TYR A N   1 
ATOM   753  C  CA  . TYR A  1 98  ? 35.527  13.055  32.195  1.00 34.34  ? 98   TYR A CA  1 
ATOM   754  C  C   . TYR A  1 98  ? 34.156  12.687  31.646  1.00 35.52  ? 98   TYR A C   1 
ATOM   755  O  O   . TYR A  1 98  ? 33.861  12.958  30.483  1.00 38.79  ? 98   TYR A O   1 
ATOM   756  C  CB  . TYR A  1 98  ? 35.465  14.394  32.943  1.00 35.69  ? 98   TYR A CB  1 
ATOM   757  C  CG  . TYR A  1 98  ? 36.802  14.869  33.477  1.00 37.40  ? 98   TYR A CG  1 
ATOM   758  C  CD1 . TYR A  1 98  ? 37.682  15.580  32.670  1.00 36.09  ? 98   TYR A CD1 1 
ATOM   759  C  CD2 . TYR A  1 98  ? 37.181  14.610  34.789  1.00 31.32  ? 98   TYR A CD2 1 
ATOM   760  C  CE1 . TYR A  1 98  ? 38.902  16.017  33.151  1.00 42.39  ? 98   TYR A CE1 1 
ATOM   761  C  CE2 . TYR A  1 98  ? 38.399  15.045  35.280  1.00 32.76  ? 98   TYR A CE2 1 
ATOM   762  C  CZ  . TYR A  1 98  ? 39.254  15.746  34.457  1.00 44.76  ? 98   TYR A CZ  1 
ATOM   763  O  OH  . TYR A  1 98  ? 40.468  16.179  34.939  1.00 47.01  ? 98   TYR A OH  1 
ATOM   764  N  N   . LEU A  1 99  ? 33.328  12.048  32.468  1.00 36.78  ? 99   LEU A N   1 
ATOM   765  C  CA  . LEU A  1 99  ? 31.961  11.730  32.061  1.00 36.55  ? 99   LEU A CA  1 
ATOM   766  C  C   . LEU A  1 99  ? 30.944  12.301  33.042  1.00 40.15  ? 99   LEU A C   1 
ATOM   767  O  O   . LEU A  1 99  ? 31.295  12.708  34.154  1.00 43.97  ? 99   LEU A O   1 
ATOM   768  C  CB  . LEU A  1 99  ? 31.769  10.216  31.880  1.00 29.61  ? 99   LEU A CB  1 
ATOM   769  C  CG  . LEU A  1 99  ? 32.160  9.253   33.005  1.00 32.25  ? 99   LEU A CG  1 
ATOM   770  C  CD1 . LEU A  1 99  ? 31.079  9.167   34.069  1.00 25.20  ? 99   LEU A CD1 1 
ATOM   771  C  CD2 . LEU A  1 99  ? 32.458  7.870   32.450  1.00 25.47  ? 99   LEU A CD2 1 
ATOM   772  N  N   . ASN A  1 100 ? 29.685  12.329  32.622  1.00 34.96  ? 100  ASN A N   1 
ATOM   773  C  CA  . ASN A  1 100 ? 28.619  12.885  33.440  1.00 29.44  ? 100  ASN A CA  1 
ATOM   774  C  C   . ASN A  1 100 ? 27.487  11.886  33.610  1.00 35.93  ? 100  ASN A C   1 
ATOM   775  O  O   . ASN A  1 100 ? 27.243  11.058  32.729  1.00 38.14  ? 100  ASN A O   1 
ATOM   776  C  CB  . ASN A  1 100 ? 28.088  14.171  32.805  1.00 31.78  ? 100  ASN A CB  1 
ATOM   777  C  CG  . ASN A  1 100 ? 29.198  15.053  32.269  1.00 36.58  ? 100  ASN A CG  1 
ATOM   778  O  OD1 . ASN A  1 100 ? 29.950  15.653  33.038  1.00 37.06  ? 100  ASN A OD1 1 
ATOM   779  N  ND2 . ASN A  1 100 ? 29.308  15.138  30.946  1.00 37.95  ? 100  ASN A ND2 1 
ATOM   780  N  N   . VAL A  1 101 ? 26.802  11.967  34.749  1.00 38.89  ? 101  VAL A N   1 
ATOM   781  C  CA  . VAL A  1 101 ? 25.698  11.063  35.057  1.00 34.80  ? 101  VAL A CA  1 
ATOM   782  C  C   . VAL A  1 101 ? 24.484  11.820  35.592  1.00 37.57  ? 101  VAL A C   1 
ATOM   783  O  O   . VAL A  1 101 ? 24.596  12.585  36.555  1.00 41.74  ? 101  VAL A O   1 
ATOM   784  C  CB  . VAL A  1 101 ? 26.112  10.004  36.105  1.00 37.18  ? 101  VAL A CB  1 
ATOM   785  C  CG1 . VAL A  1 101 ? 24.945  9.087   36.424  1.00 37.09  ? 101  VAL A CG1 1 
ATOM   786  C  CG2 . VAL A  1 101 ? 27.294  9.190   35.616  1.00 32.45  ? 101  VAL A CG2 1 
ATOM   787  N  N   . TRP A  1 102 ? 23.330  11.607  34.963  1.00 36.55  ? 102  TRP A N   1 
ATOM   788  C  CA  . TRP A  1 102 ? 22.058  12.111  35.479  1.00 31.35  ? 102  TRP A CA  1 
ATOM   789  C  C   . TRP A  1 102 ? 21.194  10.935  35.911  1.00 39.99  ? 102  TRP A C   1 
ATOM   790  O  O   . TRP A  1 102 ? 21.043  9.964   35.166  1.00 38.86  ? 102  TRP A O   1 
ATOM   791  C  CB  . TRP A  1 102 ? 21.297  12.896  34.409  1.00 40.42  ? 102  TRP A CB  1 
ATOM   792  C  CG  . TRP A  1 102 ? 21.878  14.226  34.067  1.00 38.93  ? 102  TRP A CG  1 
ATOM   793  C  CD1 . TRP A  1 102 ? 21.566  15.430  34.631  1.00 41.90  ? 102  TRP A CD1 1 
ATOM   794  C  CD2 . TRP A  1 102 ? 22.858  14.495  33.060  1.00 34.62  ? 102  TRP A CD2 1 
ATOM   795  N  NE1 . TRP A  1 102 ? 22.300  16.432  34.039  1.00 36.04  ? 102  TRP A NE1 1 
ATOM   796  C  CE2 . TRP A  1 102 ? 23.102  15.883  33.072  1.00 39.50  ? 102  TRP A CE2 1 
ATOM   797  C  CE3 . TRP A  1 102 ? 23.552  13.697  32.148  1.00 43.79  ? 102  TRP A CE3 1 
ATOM   798  C  CZ2 . TRP A  1 102 ? 24.015  16.488  32.203  1.00 46.10  ? 102  TRP A CZ2 1 
ATOM   799  C  CZ3 . TRP A  1 102 ? 24.458  14.297  31.288  1.00 40.60  ? 102  TRP A CZ3 1 
ATOM   800  C  CH2 . TRP A  1 102 ? 24.683  15.678  31.322  1.00 38.48  ? 102  TRP A CH2 1 
ATOM   801  N  N   . THR A  1 103 ? 20.633  11.020  37.114  1.00 40.66  ? 103  THR A N   1 
ATOM   802  C  CA  . THR A  1 103 ? 19.694  10.015  37.606  1.00 33.08  ? 103  THR A CA  1 
ATOM   803  C  C   . THR A  1 103 ? 18.503  10.727  38.240  1.00 42.03  ? 103  THR A C   1 
ATOM   804  O  O   . THR A  1 103 ? 18.586  11.921  38.533  1.00 43.49  ? 103  THR A O   1 
ATOM   805  C  CB  . THR A  1 103 ? 20.343  9.071   38.652  1.00 46.35  ? 103  THR A CB  1 
ATOM   806  O  OG1 . THR A  1 103 ? 20.651  9.802   39.846  1.00 43.09  ? 103  THR A OG1 1 
ATOM   807  C  CG2 . THR A  1 103 ? 21.607  8.434   38.106  1.00 43.27  ? 103  THR A CG2 1 
ATOM   808  N  N   . PRO A  1 104 ? 17.381  10.008  38.424  1.00 44.49  ? 104  PRO A N   1 
ATOM   809  C  CA  . PRO A  1 104 ? 16.265  10.547  39.213  1.00 48.91  ? 104  PRO A CA  1 
ATOM   810  C  C   . PRO A  1 104 ? 16.683  10.954  40.631  1.00 43.46  ? 104  PRO A C   1 
ATOM   811  O  O   . PRO A  1 104 ? 17.715  10.488  41.118  1.00 45.70  ? 104  PRO A O   1 
ATOM   812  C  CB  . PRO A  1 104 ? 15.298  9.366   39.280  1.00 47.04  ? 104  PRO A CB  1 
ATOM   813  C  CG  . PRO A  1 104 ? 15.527  8.634   37.979  1.00 35.64  ? 104  PRO A CG  1 
ATOM   814  C  CD  . PRO A  1 104 ? 17.005  8.778   37.696  1.00 37.07  ? 104  PRO A CD  1 
ATOM   815  N  N   . TYR A  1 105 ? 15.895  11.817  41.270  1.00 40.47  ? 105  TYR A N   1 
ATOM   816  C  CA  . TYR A  1 105 ? 16.138  12.217  42.659  1.00 47.16  ? 105  TYR A CA  1 
ATOM   817  C  C   . TYR A  1 105 ? 14.874  11.992  43.486  1.00 53.59  ? 105  TYR A C   1 
ATOM   818  O  O   . TYR A  1 105 ? 13.844  12.623  43.235  1.00 54.38  ? 105  TYR A O   1 
ATOM   819  C  CB  . TYR A  1 105 ? 16.575  13.685  42.742  1.00 44.04  ? 105  TYR A CB  1 
ATOM   820  C  CG  . TYR A  1 105 ? 16.967  14.158  44.130  1.00 46.36  ? 105  TYR A CG  1 
ATOM   821  C  CD1 . TYR A  1 105 ? 16.000  14.469  45.081  1.00 46.09  ? 105  TYR A CD1 1 
ATOM   822  C  CD2 . TYR A  1 105 ? 18.301  14.322  44.479  1.00 51.50  ? 105  TYR A CD2 1 
ATOM   823  C  CE1 . TYR A  1 105 ? 16.348  14.908  46.340  1.00 42.32  ? 105  TYR A CE1 1 
ATOM   824  C  CE2 . TYR A  1 105 ? 18.659  14.764  45.745  1.00 46.90  ? 105  TYR A CE2 1 
ATOM   825  C  CZ  . TYR A  1 105 ? 17.674  15.055  46.667  1.00 43.92  ? 105  TYR A CZ  1 
ATOM   826  O  OH  . TYR A  1 105 ? 18.006  15.497  47.927  1.00 41.18  ? 105  TYR A OH  1 
ATOM   827  N  N   . PRO A  1 106 ? 14.946  11.092  44.481  1.00 52.25  ? 106  PRO A N   1 
ATOM   828  C  CA  . PRO A  1 106 ? 16.124  10.289  44.834  1.00 46.71  ? 106  PRO A CA  1 
ATOM   829  C  C   . PRO A  1 106 ? 16.390  9.180   43.820  1.00 44.54  ? 106  PRO A C   1 
ATOM   830  O  O   . PRO A  1 106 ? 15.539  8.927   42.964  1.00 50.04  ? 106  PRO A O   1 
ATOM   831  C  CB  . PRO A  1 106 ? 15.738  9.682   46.186  1.00 49.19  ? 106  PRO A CB  1 
ATOM   832  C  CG  . PRO A  1 106 ? 14.247  9.622   46.156  1.00 52.38  ? 106  PRO A CG  1 
ATOM   833  C  CD  . PRO A  1 106 ? 13.808  10.831  45.380  1.00 54.64  ? 106  PRO A CD  1 
ATOM   834  N  N   . ARG A  1 107 ? 17.558  8.547   43.918  1.00 40.83  ? 107  ARG A N   1 
ATOM   835  C  CA  . ARG A  1 107 ? 17.996  7.525   42.962  1.00 47.67  ? 107  ARG A CA  1 
ATOM   836  C  C   . ARG A  1 107 ? 17.041  6.327   42.877  1.00 50.84  ? 107  ARG A C   1 
ATOM   837  O  O   . ARG A  1 107 ? 16.334  6.030   43.839  1.00 62.55  ? 107  ARG A O   1 
ATOM   838  C  CB  . ARG A  1 107 ? 19.430  7.073   43.292  1.00 48.96  ? 107  ARG A CB  1 
ATOM   839  C  CG  . ARG A  1 107 ? 20.471  8.180   43.120  1.00 50.64  ? 107  ARG A CG  1 
ATOM   840  C  CD  . ARG A  1 107 ? 21.893  7.633   43.044  1.00 49.76  ? 107  ARG A CD  1 
ATOM   841  N  NE  . ARG A  1 107 ? 22.256  6.847   44.220  1.00 50.96  ? 107  ARG A NE  1 
ATOM   842  C  CZ  . ARG A  1 107 ? 22.729  7.363   45.350  1.00 46.03  ? 107  ARG A CZ  1 
ATOM   843  N  NH1 . ARG A  1 107 ? 22.892  8.672   45.470  1.00 41.13  ? 107  ARG A NH1 1 
ATOM   844  N  NH2 . ARG A  1 107 ? 23.034  6.569   46.367  1.00 55.49  ? 107  ARG A NH2 1 
ATOM   845  N  N   . PRO A  1 108 ? 17.006  5.652   41.711  1.00 57.39  ? 108  PRO A N   1 
ATOM   846  C  CA  . PRO A  1 108 ? 16.062  4.559   41.428  1.00 60.91  ? 108  PRO A CA  1 
ATOM   847  C  C   . PRO A  1 108 ? 16.057  3.415   42.444  1.00 59.45  ? 108  PRO A C   1 
ATOM   848  O  O   . PRO A  1 108 ? 17.102  3.067   42.994  1.00 62.48  ? 108  PRO A O   1 
ATOM   849  C  CB  . PRO A  1 108 ? 16.546  4.035   40.075  1.00 52.14  ? 108  PRO A CB  1 
ATOM   850  C  CG  . PRO A  1 108 ? 17.144  5.225   39.415  1.00 45.23  ? 108  PRO A CG  1 
ATOM   851  C  CD  . PRO A  1 108 ? 17.819  5.984   40.523  1.00 47.92  ? 108  PRO A CD  1 
ATOM   852  N  N   . ALA A  1 109 ? 14.880  2.833   42.670  1.00 62.44  ? 109  ALA A N   1 
ATOM   853  C  CA  . ALA A  1 109 ? 14.733  1.691   43.572  1.00 69.25  ? 109  ALA A CA  1 
ATOM   854  C  C   . ALA A  1 109 ? 15.215  0.404   42.910  1.00 72.03  ? 109  ALA A C   1 
ATOM   855  O  O   . ALA A  1 109 ? 16.063  -0.307  43.449  1.00 75.16  ? 109  ALA A O   1 
ATOM   856  C  CB  . ALA A  1 109 ? 13.281  1.547   44.010  1.00 64.24  ? 109  ALA A CB  1 
ATOM   857  N  N   . SER A  1 110 ? 14.653  0.110   41.743  1.00 69.33  ? 110  SER A N   1 
ATOM   858  C  CA  . SER A  1 110 ? 15.049  -1.050  40.956  1.00 65.28  ? 110  SER A CA  1 
ATOM   859  C  C   . SER A  1 110 ? 16.123  -0.665  39.933  1.00 59.69  ? 110  SER A C   1 
ATOM   860  O  O   . SER A  1 110 ? 16.269  0.513   39.606  1.00 52.73  ? 110  SER A O   1 
ATOM   861  C  CB  . SER A  1 110 ? 13.821  -1.641  40.257  1.00 70.44  ? 110  SER A CB  1 
ATOM   862  O  OG  . SER A  1 110 ? 12.976  -0.619  39.756  1.00 78.29  ? 110  SER A OG  1 
ATOM   863  N  N   . PRO A  1 111 ? 16.899  -1.652  39.447  1.00 58.24  ? 111  PRO A N   1 
ATOM   864  C  CA  . PRO A  1 111 ? 17.885  -1.375  38.392  1.00 60.31  ? 111  PRO A CA  1 
ATOM   865  C  C   . PRO A  1 111 ? 17.257  -0.709  37.162  1.00 61.45  ? 111  PRO A C   1 
ATOM   866  O  O   . PRO A  1 111 ? 16.281  -1.224  36.614  1.00 58.52  ? 111  PRO A O   1 
ATOM   867  C  CB  . PRO A  1 111 ? 18.405  -2.768  38.035  1.00 62.95  ? 111  PRO A CB  1 
ATOM   868  C  CG  . PRO A  1 111 ? 18.268  -3.551  39.310  1.00 57.13  ? 111  PRO A CG  1 
ATOM   869  C  CD  . PRO A  1 111 ? 17.002  -3.036  39.953  1.00 55.73  ? 111  PRO A CD  1 
ATOM   870  N  N   . THR A  1 112 ? 17.823  0.418   36.735  1.00 56.01  ? 112  THR A N   1 
ATOM   871  C  CA  . THR A  1 112 ? 17.228  1.231   35.674  1.00 52.03  ? 112  THR A CA  1 
ATOM   872  C  C   . THR A  1 112 ? 18.061  1.224   34.390  1.00 44.37  ? 112  THR A C   1 
ATOM   873  O  O   . THR A  1 112 ? 19.275  1.431   34.438  1.00 45.59  ? 112  THR A O   1 
ATOM   874  C  CB  . THR A  1 112 ? 17.032  2.685   36.153  1.00 51.12  ? 112  THR A CB  1 
ATOM   875  O  OG1 . THR A  1 112 ? 16.144  2.698   37.278  1.00 54.71  ? 112  THR A OG1 1 
ATOM   876  C  CG2 . THR A  1 112 ? 16.452  3.551   35.044  1.00 45.32  ? 112  THR A CG2 1 
ATOM   877  N  N   . PRO A  1 113 ? 17.405  0.980   33.241  1.00 41.78  ? 113  PRO A N   1 
ATOM   878  C  CA  . PRO A  1 113 ? 18.063  0.993   31.927  1.00 44.32  ? 113  PRO A CA  1 
ATOM   879  C  C   . PRO A  1 113 ? 18.881  2.265   31.709  1.00 42.56  ? 113  PRO A C   1 
ATOM   880  O  O   . PRO A  1 113 ? 18.439  3.351   32.088  1.00 45.03  ? 113  PRO A O   1 
ATOM   881  C  CB  . PRO A  1 113 ? 16.884  0.954   30.951  1.00 40.72  ? 113  PRO A CB  1 
ATOM   882  C  CG  . PRO A  1 113 ? 15.817  0.212   31.697  1.00 43.77  ? 113  PRO A CG  1 
ATOM   883  C  CD  . PRO A  1 113 ? 15.979  0.611   33.141  1.00 39.52  ? 113  PRO A CD  1 
ATOM   884  N  N   . VAL A  1 114 ? 20.058  2.122   31.108  1.00 43.11  ? 114  VAL A N   1 
ATOM   885  C  CA  . VAL A  1 114 ? 20.996  3.232   30.967  1.00 40.12  ? 114  VAL A CA  1 
ATOM   886  C  C   . VAL A  1 114 ? 21.075  3.729   29.528  1.00 45.46  ? 114  VAL A C   1 
ATOM   887  O  O   . VAL A  1 114 ? 21.100  2.934   28.587  1.00 40.26  ? 114  VAL A O   1 
ATOM   888  C  CB  . VAL A  1 114 ? 22.410  2.820   31.425  1.00 37.29  ? 114  VAL A CB  1 
ATOM   889  C  CG1 . VAL A  1 114 ? 23.360  4.014   31.404  1.00 31.16  ? 114  VAL A CG1 1 
ATOM   890  C  CG2 . VAL A  1 114 ? 22.356  2.208   32.815  1.00 38.80  ? 114  VAL A CG2 1 
ATOM   891  N  N   . LEU A  1 115 ? 21.102  5.047   29.363  1.00 42.80  ? 115  LEU A N   1 
ATOM   892  C  CA  . LEU A  1 115 ? 21.349  5.649   28.060  1.00 35.06  ? 115  LEU A CA  1 
ATOM   893  C  C   . LEU A  1 115 ? 22.726  6.298   28.074  1.00 34.81  ? 115  LEU A C   1 
ATOM   894  O  O   . LEU A  1 115 ? 23.029  7.102   28.959  1.00 38.11  ? 115  LEU A O   1 
ATOM   895  C  CB  . LEU A  1 115 ? 20.279  6.694   27.729  1.00 40.11  ? 115  LEU A CB  1 
ATOM   896  C  CG  . LEU A  1 115 ? 18.908  6.169   27.303  1.00 51.01  ? 115  LEU A CG  1 
ATOM   897  C  CD1 . LEU A  1 115 ? 17.948  7.302   26.977  1.00 52.79  ? 115  LEU A CD1 1 
ATOM   898  C  CD2 . LEU A  1 115 ? 19.063  5.265   26.107  1.00 55.15  ? 115  LEU A CD2 1 
ATOM   899  N  N   . ILE A  1 116 ? 23.565  5.937   27.108  1.00 33.17  ? 116  ILE A N   1 
ATOM   900  C  CA  . ILE A  1 116 ? 24.867  6.576   26.965  1.00 37.39  ? 116  ILE A CA  1 
ATOM   901  C  C   . ILE A  1 116 ? 24.917  7.422   25.695  1.00 37.91  ? 116  ILE A C   1 
ATOM   902  O  O   . ILE A  1 116 ? 24.778  6.904   24.586  1.00 35.67  ? 116  ILE A O   1 
ATOM   903  C  CB  . ILE A  1 116 ? 26.012  5.548   26.954  1.00 35.24  ? 116  ILE A CB  1 
ATOM   904  C  CG1 . ILE A  1 116 ? 25.948  4.677   28.212  1.00 33.05  ? 116  ILE A CG1 1 
ATOM   905  C  CG2 . ILE A  1 116 ? 27.353  6.250   26.863  1.00 31.32  ? 116  ILE A CG2 1 
ATOM   906  C  CD1 . ILE A  1 116 ? 27.088  3.691   28.336  1.00 33.54  ? 116  ILE A CD1 1 
ATOM   907  N  N   . TRP A  1 117 ? 25.113  8.726   25.863  1.00 35.93  ? 117  TRP A N   1 
ATOM   908  C  CA  . TRP A  1 117 ? 25.170  9.645   24.731  1.00 33.18  ? 117  TRP A CA  1 
ATOM   909  C  C   . TRP A  1 117 ? 26.601  9.864   24.237  1.00 39.35  ? 117  TRP A C   1 
ATOM   910  O  O   . TRP A  1 117 ? 27.516  10.091  25.033  1.00 37.94  ? 117  TRP A O   1 
ATOM   911  C  CB  . TRP A  1 117 ? 24.521  10.978  25.111  1.00 31.70  ? 117  TRP A CB  1 
ATOM   912  C  CG  . TRP A  1 117 ? 24.681  12.039  24.076  1.00 36.31  ? 117  TRP A CG  1 
ATOM   913  C  CD1 . TRP A  1 117 ? 25.534  13.103  24.116  1.00 31.21  ? 117  TRP A CD1 1 
ATOM   914  C  CD2 . TRP A  1 117 ? 23.969  12.142  22.839  1.00 35.03  ? 117  TRP A CD2 1 
ATOM   915  N  NE1 . TRP A  1 117 ? 25.391  13.862  22.980  1.00 35.28  ? 117  TRP A NE1 1 
ATOM   916  C  CE2 . TRP A  1 117 ? 24.437  13.291  22.180  1.00 38.47  ? 117  TRP A CE2 1 
ATOM   917  C  CE3 . TRP A  1 117 ? 22.980  11.369  22.226  1.00 30.99  ? 117  TRP A CE3 1 
ATOM   918  C  CZ2 . TRP A  1 117 ? 23.947  13.687  20.933  1.00 38.46  ? 117  TRP A CZ2 1 
ATOM   919  C  CZ3 . TRP A  1 117 ? 22.493  11.763  20.997  1.00 34.87  ? 117  TRP A CZ3 1 
ATOM   920  C  CH2 . TRP A  1 117 ? 22.976  12.909  20.361  1.00 33.76  ? 117  TRP A CH2 1 
ATOM   921  N  N   . ILE A  1 118 ? 26.781  9.778   22.922  1.00 36.36  ? 118  ILE A N   1 
ATOM   922  C  CA  . ILE A  1 118 ? 28.063  10.059  22.284  1.00 32.17  ? 118  ILE A CA  1 
ATOM   923  C  C   . ILE A  1 118 ? 27.883  11.242  21.335  1.00 35.20  ? 118  ILE A C   1 
ATOM   924  O  O   . ILE A  1 118 ? 27.250  11.105  20.284  1.00 35.49  ? 118  ILE A O   1 
ATOM   925  C  CB  . ILE A  1 118 ? 28.577  8.837   21.486  1.00 31.61  ? 118  ILE A CB  1 
ATOM   926  C  CG1 . ILE A  1 118 ? 28.551  7.572   22.357  1.00 34.23  ? 118  ILE A CG1 1 
ATOM   927  C  CG2 . ILE A  1 118 ? 29.980  9.089   20.954  1.00 29.34  ? 118  ILE A CG2 1 
ATOM   928  C  CD1 . ILE A  1 118 ? 29.134  6.335   21.678  1.00 33.65  ? 118  ILE A CD1 1 
ATOM   929  N  N   . TYR A  1 119 ? 28.427  12.403  21.706  1.00 27.00  ? 119  TYR A N   1 
ATOM   930  C  CA  . TYR A  1 119 ? 28.249  13.622  20.909  1.00 31.69  ? 119  TYR A CA  1 
ATOM   931  C  C   . TYR A  1 119 ? 28.883  13.536  19.520  1.00 32.61  ? 119  TYR A C   1 
ATOM   932  O  O   . TYR A  1 119 ? 29.775  12.723  19.288  1.00 29.19  ? 119  TYR A O   1 
ATOM   933  C  CB  . TYR A  1 119 ? 28.757  14.868  21.656  1.00 31.42  ? 119  TYR A CB  1 
ATOM   934  C  CG  . TYR A  1 119 ? 30.224  14.856  22.060  1.00 36.79  ? 119  TYR A CG  1 
ATOM   935  C  CD1 . TYR A  1 119 ? 31.232  15.072  21.127  1.00 31.50  ? 119  TYR A CD1 1 
ATOM   936  C  CD2 . TYR A  1 119 ? 30.593  14.674  23.388  1.00 34.66  ? 119  TYR A CD2 1 
ATOM   937  C  CE1 . TYR A  1 119 ? 32.568  15.077  21.502  1.00 37.85  ? 119  TYR A CE1 1 
ATOM   938  C  CE2 . TYR A  1 119 ? 31.919  14.676  23.772  1.00 37.88  ? 119  TYR A CE2 1 
ATOM   939  C  CZ  . TYR A  1 119 ? 32.904  14.877  22.829  1.00 43.67  ? 119  TYR A CZ  1 
ATOM   940  O  OH  . TYR A  1 119 ? 34.229  14.880  23.221  1.00 32.27  ? 119  TYR A OH  1 
ATOM   941  N  N   . GLY A  1 120 ? 28.406  14.373  18.600  1.00 31.67  ? 120  GLY A N   1 
ATOM   942  C  CA  . GLY A  1 120 ? 28.988  14.473  17.271  1.00 34.93  ? 120  GLY A CA  1 
ATOM   943  C  C   . GLY A  1 120 ? 29.855  15.710  17.134  1.00 35.99  ? 120  GLY A C   1 
ATOM   944  O  O   . GLY A  1 120 ? 30.216  16.328  18.136  1.00 41.50  ? 120  GLY A O   1 
ATOM   945  N  N   . GLY A  1 121 ? 30.188  16.075  15.899  1.00 44.05  ? 121  GLY A N   1 
ATOM   946  C  CA  . GLY A  1 121 ? 31.061  17.208  15.649  1.00 34.22  ? 121  GLY A CA  1 
ATOM   947  C  C   . GLY A  1 121 ? 32.203  16.845  14.715  1.00 34.72  ? 121  GLY A C   1 
ATOM   948  O  O   . GLY A  1 121 ? 33.312  17.372  14.842  1.00 35.70  ? 121  GLY A O   1 
ATOM   949  N  N   . GLY A  1 122 ? 31.931  15.929  13.788  1.00 31.31  ? 122  GLY A N   1 
ATOM   950  C  CA  . GLY A  1 122 ? 32.901  15.513  12.785  1.00 34.63  ? 122  GLY A CA  1 
ATOM   951  C  C   . GLY A  1 122 ? 34.228  14.966  13.294  1.00 39.23  ? 122  GLY A C   1 
ATOM   952  O  O   . GLY A  1 122 ? 35.227  15.009  12.570  1.00 33.36  ? 122  GLY A O   1 
ATOM   953  N  N   . PHE A  1 123 ? 34.241  14.464  14.530  1.00 34.80  ? 123  PHE A N   1 
ATOM   954  C  CA  . PHE A  1 123 ? 35.457  13.932  15.166  1.00 29.80  ? 123  PHE A CA  1 
ATOM   955  C  C   . PHE A  1 123 ? 36.545  14.985  15.415  1.00 26.66  ? 123  PHE A C   1 
ATOM   956  O  O   . PHE A  1 123 ? 37.667  14.641  15.804  1.00 36.80  ? 123  PHE A O   1 
ATOM   957  C  CB  . PHE A  1 123 ? 36.047  12.750  14.372  1.00 25.93  ? 123  PHE A CB  1 
ATOM   958  C  CG  . PHE A  1 123 ? 35.156  11.536  14.318  1.00 29.45  ? 123  PHE A CG  1 
ATOM   959  C  CD1 . PHE A  1 123 ? 35.006  10.720  15.430  1.00 29.28  ? 123  PHE A CD1 1 
ATOM   960  C  CD2 . PHE A  1 123 ? 34.487  11.201  13.149  1.00 32.11  ? 123  PHE A CD2 1 
ATOM   961  C  CE1 . PHE A  1 123 ? 34.191  9.597   15.384  1.00 30.10  ? 123  PHE A CE1 1 
ATOM   962  C  CE2 . PHE A  1 123 ? 33.670  10.078  13.093  1.00 28.17  ? 123  PHE A CE2 1 
ATOM   963  C  CZ  . PHE A  1 123 ? 33.523  9.276   14.211  1.00 34.02  ? 123  PHE A CZ  1 
ATOM   964  N  N   . TYR A  1 124 ? 36.219  16.258  15.189  1.00 24.23  ? 124  TYR A N   1 
ATOM   965  C  CA  . TYR A  1 124 ? 37.168  17.352  15.429  1.00 35.20  ? 124  TYR A CA  1 
ATOM   966  C  C   . TYR A  1 124 ? 36.667  18.299  16.522  1.00 35.69  ? 124  TYR A C   1 
ATOM   967  O  O   . TYR A  1 124 ? 37.373  19.228  16.928  1.00 36.48  ? 124  TYR A O   1 
ATOM   968  C  CB  . TYR A  1 124 ? 37.445  18.137  14.138  1.00 33.17  ? 124  TYR A CB  1 
ATOM   969  C  CG  . TYR A  1 124 ? 36.347  19.105  13.749  1.00 36.61  ? 124  TYR A CG  1 
ATOM   970  C  CD1 . TYR A  1 124 ? 36.355  20.420  14.204  1.00 34.74  ? 124  TYR A CD1 1 
ATOM   971  C  CD2 . TYR A  1 124 ? 35.309  18.706  12.920  1.00 35.61  ? 124  TYR A CD2 1 
ATOM   972  C  CE1 . TYR A  1 124 ? 35.354  21.299  13.858  1.00 36.23  ? 124  TYR A CE1 1 
ATOM   973  C  CE2 . TYR A  1 124 ? 34.306  19.580  12.566  1.00 37.05  ? 124  TYR A CE2 1 
ATOM   974  C  CZ  . TYR A  1 124 ? 34.335  20.876  13.037  1.00 41.77  ? 124  TYR A CZ  1 
ATOM   975  O  OH  . TYR A  1 124 ? 33.340  21.759  12.688  1.00 49.39  ? 124  TYR A OH  1 
ATOM   976  N  N   . SER A  1 125 ? 35.443  18.067  16.987  1.00 28.16  ? 125  SER A N   1 
ATOM   977  C  CA  . SER A  1 125 ? 34.815  18.972  17.939  1.00 29.40  ? 125  SER A CA  1 
ATOM   978  C  C   . SER A  1 125 ? 33.701  18.284  18.716  1.00 30.73  ? 125  SER A C   1 
ATOM   979  O  O   . SER A  1 125 ? 33.299  17.162  18.393  1.00 26.77  ? 125  SER A O   1 
ATOM   980  C  CB  . SER A  1 125 ? 34.239  20.173  17.195  1.00 29.74  ? 125  SER A CB  1 
ATOM   981  O  OG  . SER A  1 125 ? 33.215  19.760  16.304  1.00 29.06  ? 125  SER A OG  1 
ATOM   982  N  N   . GLY A  1 126 ? 33.195  18.970  19.736  1.00 27.49  ? 126  GLY A N   1 
ATOM   983  C  CA  . GLY A  1 126 ? 32.086  18.456  20.517  1.00 35.64  ? 126  GLY A CA  1 
ATOM   984  C  C   . GLY A  1 126 ? 32.378  18.453  22.004  1.00 35.61  ? 126  GLY A C   1 
ATOM   985  O  O   . GLY A  1 126 ? 33.536  18.532  22.420  1.00 34.83  ? 126  GLY A O   1 
ATOM   986  N  N   . ALA A  1 127 ? 31.322  18.366  22.806  1.00 33.48  ? 127  ALA A N   1 
ATOM   987  C  CA  . ALA A  1 127 ? 31.454  18.266  24.257  1.00 36.65  ? 127  ALA A CA  1 
ATOM   988  C  C   . ALA A  1 127 ? 30.172  17.706  24.848  1.00 39.86  ? 127  ALA A C   1 
ATOM   989  O  O   . ALA A  1 127 ? 29.088  17.949  24.327  1.00 39.51  ? 127  ALA A O   1 
ATOM   990  C  CB  . ALA A  1 127 ? 31.758  19.625  24.863  1.00 34.66  ? 127  ALA A CB  1 
ATOM   991  N  N   . ALA A  1 128 ? 30.290  16.966  25.943  1.00 37.60  ? 128  ALA A N   1 
ATOM   992  C  CA  . ALA A  1 128 ? 29.113  16.396  26.583  1.00 35.21  ? 128  ALA A CA  1 
ATOM   993  C  C   . ALA A  1 128 ? 28.454  17.414  27.509  1.00 32.73  ? 128  ALA A C   1 
ATOM   994  O  O   . ALA A  1 128 ? 27.407  17.140  28.099  1.00 35.94  ? 128  ALA A O   1 
ATOM   995  C  CB  . ALA A  1 128 ? 29.483  15.128  27.344  1.00 27.94  ? 128  ALA A CB  1 
ATOM   996  N  N   . SER A  1 129 ? 29.065  18.592  27.622  1.00 31.47  ? 129  SER A N   1 
ATOM   997  C  CA  . SER A  1 129 ? 28.616  19.615  28.567  1.00 33.78  ? 129  SER A CA  1 
ATOM   998  C  C   . SER A  1 129 ? 27.666  20.635  27.939  1.00 37.64  ? 129  SER A C   1 
ATOM   999  O  O   . SER A  1 129 ? 27.159  21.527  28.623  1.00 41.03  ? 129  SER A O   1 
ATOM   1000 C  CB  . SER A  1 129 ? 29.823  20.327  29.185  1.00 31.19  ? 129  SER A CB  1 
ATOM   1001 O  OG  . SER A  1 129 ? 30.585  21.006  28.205  1.00 35.65  ? 129  SER A OG  1 
ATOM   1002 N  N   . LEU A  1 130 ? 27.421  20.491  26.639  1.00 33.35  ? 130  LEU A N   1 
ATOM   1003 C  CA  . LEU A  1 130 ? 26.558  21.418  25.907  1.00 33.30  ? 130  LEU A CA  1 
ATOM   1004 C  C   . LEU A  1 130 ? 25.098  21.354  26.368  1.00 33.09  ? 130  LEU A C   1 
ATOM   1005 O  O   . LEU A  1 130 ? 24.624  20.310  26.824  1.00 31.28  ? 130  LEU A O   1 
ATOM   1006 C  CB  . LEU A  1 130 ? 26.655  21.153  24.403  1.00 38.22  ? 130  LEU A CB  1 
ATOM   1007 C  CG  . LEU A  1 130 ? 28.060  21.249  23.799  1.00 37.39  ? 130  LEU A CG  1 
ATOM   1008 C  CD1 . LEU A  1 130 ? 28.049  20.878  22.327  1.00 31.00  ? 130  LEU A CD1 1 
ATOM   1009 C  CD2 . LEU A  1 130 ? 28.632  22.641  23.990  1.00 41.19  ? 130  LEU A CD2 1 
ATOM   1010 N  N   . ASP A  1 131 ? 24.395  22.477  26.242  1.00 32.22  ? 131  ASP A N   1 
ATOM   1011 C  CA  . ASP A  1 131 ? 23.015  22.597  26.714  1.00 36.59  ? 131  ASP A CA  1 
ATOM   1012 C  C   . ASP A  1 131 ? 22.044  21.621  26.037  1.00 40.39  ? 131  ASP A C   1 
ATOM   1013 O  O   . ASP A  1 131 ? 21.102  21.145  26.670  1.00 48.68  ? 131  ASP A O   1 
ATOM   1014 C  CB  . ASP A  1 131 ? 22.526  24.045  26.550  1.00 37.62  ? 131  ASP A CB  1 
ATOM   1015 C  CG  . ASP A  1 131 ? 23.154  24.995  27.560  1.00 47.66  ? 131  ASP A CG  1 
ATOM   1016 O  OD1 . ASP A  1 131 ? 24.079  24.572  28.286  1.00 51.16  ? 131  ASP A OD1 1 
ATOM   1017 O  OD2 . ASP A  1 131 ? 22.728  26.169  27.619  1.00 52.58  ? 131  ASP A OD2 1 
ATOM   1018 N  N   . VAL A  1 132 ? 22.282  21.316  24.761  1.00 35.10  ? 132  VAL A N   1 
ATOM   1019 C  CA  . VAL A  1 132 ? 21.405  20.412  24.009  1.00 34.83  ? 132  VAL A CA  1 
ATOM   1020 C  C   . VAL A  1 132 ? 21.593  18.938  24.383  1.00 32.78  ? 132  VAL A C   1 
ATOM   1021 O  O   . VAL A  1 132 ? 20.844  18.073  23.924  1.00 36.13  ? 132  VAL A O   1 
ATOM   1022 C  CB  . VAL A  1 132 ? 21.545  20.600  22.466  1.00 36.44  ? 132  VAL A CB  1 
ATOM   1023 C  CG1 . VAL A  1 132 ? 21.021  21.955  22.051  1.00 40.55  ? 132  VAL A CG1 1 
ATOM   1024 C  CG2 . VAL A  1 132 ? 22.991  20.437  22.019  1.00 31.50  ? 132  VAL A CG2 1 
ATOM   1025 N  N   . TYR A  1 133 ? 22.588  18.661  25.221  1.00 36.67  ? 133  TYR A N   1 
ATOM   1026 C  CA  . TYR A  1 133 ? 22.830  17.304  25.705  1.00 36.24  ? 133  TYR A CA  1 
ATOM   1027 C  C   . TYR A  1 133 ? 22.474  17.193  27.188  1.00 35.35  ? 133  TYR A C   1 
ATOM   1028 O  O   . TYR A  1 133 ? 22.957  16.299  27.889  1.00 37.02  ? 133  TYR A O   1 
ATOM   1029 C  CB  . TYR A  1 133 ? 24.291  16.893  25.473  1.00 33.10  ? 133  TYR A CB  1 
ATOM   1030 C  CG  . TYR A  1 133 ? 24.775  17.060  24.047  1.00 39.79  ? 133  TYR A CG  1 
ATOM   1031 C  CD1 . TYR A  1 133 ? 23.915  16.875  22.973  1.00 38.39  ? 133  TYR A CD1 1 
ATOM   1032 C  CD2 . TYR A  1 133 ? 26.093  17.404  23.778  1.00 39.80  ? 133  TYR A CD2 1 
ATOM   1033 C  CE1 . TYR A  1 133 ? 24.355  17.030  21.670  1.00 34.42  ? 133  TYR A CE1 1 
ATOM   1034 C  CE2 . TYR A  1 133 ? 26.543  17.560  22.479  1.00 37.21  ? 133  TYR A CE2 1 
ATOM   1035 C  CZ  . TYR A  1 133 ? 25.668  17.371  21.430  1.00 37.44  ? 133  TYR A CZ  1 
ATOM   1036 O  OH  . TYR A  1 133 ? 26.105  17.525  20.132  1.00 31.33  ? 133  TYR A OH  1 
ATOM   1037 N  N   . ASP A  1 134 ? 21.627  18.106  27.658  1.00 37.19  ? 134  ASP A N   1 
ATOM   1038 C  CA  . ASP A  1 134 ? 21.215  18.140  29.062  1.00 39.41  ? 134  ASP A CA  1 
ATOM   1039 C  C   . ASP A  1 134 ? 20.347  16.928  29.390  1.00 42.22  ? 134  ASP A C   1 
ATOM   1040 O  O   . ASP A  1 134 ? 19.255  16.770  28.842  1.00 37.95  ? 134  ASP A O   1 
ATOM   1041 C  CB  . ASP A  1 134 ? 20.455  19.438  29.361  1.00 37.84  ? 134  ASP A CB  1 
ATOM   1042 C  CG  . ASP A  1 134 ? 20.293  19.703  30.851  1.00 48.16  ? 134  ASP A CG  1 
ATOM   1043 O  OD1 . ASP A  1 134 ? 20.447  18.765  31.664  1.00 45.01  ? 134  ASP A OD1 1 
ATOM   1044 O  OD2 . ASP A  1 134 ? 19.999  20.862  31.212  1.00 51.26  ? 134  ASP A OD2 1 
ATOM   1045 N  N   . GLY A  1 135 ? 20.833  16.079  30.290  1.00 40.84  ? 135  GLY A N   1 
ATOM   1046 C  CA  . GLY A  1 135 ? 20.159  14.829  30.594  1.00 39.64  ? 135  GLY A CA  1 
ATOM   1047 C  C   . GLY A  1 135 ? 19.085  14.923  31.664  1.00 36.60  ? 135  GLY A C   1 
ATOM   1048 O  O   . GLY A  1 135 ? 18.474  13.911  32.016  1.00 30.57  ? 135  GLY A O   1 
ATOM   1049 N  N   . ARG A  1 136 ? 18.834  16.129  32.170  1.00 37.90  ? 136  ARG A N   1 
ATOM   1050 C  CA  . ARG A  1 136 ? 17.927  16.303  33.311  1.00 40.58  ? 136  ARG A CA  1 
ATOM   1051 C  C   . ARG A  1 136 ? 16.466  15.963  33.004  1.00 46.54  ? 136  ARG A C   1 
ATOM   1052 O  O   . ARG A  1 136 ? 15.736  15.497  33.881  1.00 47.97  ? 136  ARG A O   1 
ATOM   1053 C  CB  . ARG A  1 136 ? 18.043  17.720  33.899  1.00 35.54  ? 136  ARG A CB  1 
ATOM   1054 C  CG  . ARG A  1 136 ? 17.284  18.810  33.141  1.00 40.47  ? 136  ARG A CG  1 
ATOM   1055 C  CD  . ARG A  1 136 ? 17.423  20.161  33.838  1.00 35.94  ? 136  ARG A CD  1 
ATOM   1056 N  NE  . ARG A  1 136 ? 18.816  20.602  33.887  1.00 44.00  ? 136  ARG A NE  1 
ATOM   1057 C  CZ  . ARG A  1 136 ? 19.304  21.466  34.773  1.00 49.96  ? 136  ARG A CZ  1 
ATOM   1058 N  NH1 . ARG A  1 136 ? 18.517  21.993  35.701  1.00 47.18  ? 136  ARG A NH1 1 
ATOM   1059 N  NH2 . ARG A  1 136 ? 20.586  21.803  34.735  1.00 49.03  ? 136  ARG A NH2 1 
ATOM   1060 N  N   . PHE A  1 137 ? 16.045  16.189  31.763  1.00 45.32  ? 137  PHE A N   1 
ATOM   1061 C  CA  . PHE A  1 137 ? 14.649  15.983  31.386  1.00 37.56  ? 137  PHE A CA  1 
ATOM   1062 C  C   . PHE A  1 137 ? 14.322  14.498  31.218  1.00 32.33  ? 137  PHE A C   1 
ATOM   1063 O  O   . PHE A  1 137 ? 13.321  14.013  31.751  1.00 35.76  ? 137  PHE A O   1 
ATOM   1064 C  CB  . PHE A  1 137 ? 14.305  16.772  30.115  1.00 33.88  ? 137  PHE A CB  1 
ATOM   1065 C  CG  . PHE A  1 137 ? 14.686  18.230  30.181  1.00 41.74  ? 137  PHE A CG  1 
ATOM   1066 C  CD1 . PHE A  1 137 ? 13.919  19.135  30.908  1.00 42.01  ? 137  PHE A CD1 1 
ATOM   1067 C  CD2 . PHE A  1 137 ? 15.809  18.696  29.510  1.00 37.76  ? 137  PHE A CD2 1 
ATOM   1068 C  CE1 . PHE A  1 137 ? 14.271  20.479  30.971  1.00 40.93  ? 137  PHE A CE1 1 
ATOM   1069 C  CE2 . PHE A  1 137 ? 16.169  20.038  29.568  1.00 33.73  ? 137  PHE A CE2 1 
ATOM   1070 C  CZ  . PHE A  1 137 ? 15.398  20.931  30.298  1.00 38.31  ? 137  PHE A CZ  1 
ATOM   1071 N  N   . LEU A  1 138 ? 15.166  13.784  30.477  1.00 32.31  ? 138  LEU A N   1 
ATOM   1072 C  CA  . LEU A  1 138 ? 15.042  12.329  30.351  1.00 36.35  ? 138  LEU A CA  1 
ATOM   1073 C  C   . LEU A  1 138 ? 15.075  11.629  31.715  1.00 39.64  ? 138  LEU A C   1 
ATOM   1074 O  O   . LEU A  1 138 ? 14.299  10.705  31.967  1.00 41.33  ? 138  LEU A O   1 
ATOM   1075 C  CB  . LEU A  1 138 ? 16.133  11.775  29.428  1.00 35.97  ? 138  LEU A CB  1 
ATOM   1076 C  CG  . LEU A  1 138 ? 15.859  11.937  27.928  1.00 41.23  ? 138  LEU A CG  1 
ATOM   1077 C  CD1 . LEU A  1 138 ? 17.132  11.894  27.103  1.00 35.52  ? 138  LEU A CD1 1 
ATOM   1078 C  CD2 . LEU A  1 138 ? 14.899  10.862  27.458  1.00 42.40  ? 138  LEU A CD2 1 
ATOM   1079 N  N   . ALA A  1 139 ? 15.962  12.081  32.596  1.00 35.91  ? 139  ALA A N   1 
ATOM   1080 C  CA  . ALA A  1 139 ? 16.078  11.497  33.930  1.00 42.83  ? 139  ALA A CA  1 
ATOM   1081 C  C   . ALA A  1 139 ? 14.848  11.774  34.794  1.00 49.69  ? 139  ALA A C   1 
ATOM   1082 O  O   . ALA A  1 139 ? 14.403  10.908  35.544  1.00 54.33  ? 139  ALA A O   1 
ATOM   1083 C  CB  . ALA A  1 139 ? 17.339  12.002  34.622  1.00 34.10  ? 139  ALA A CB  1 
ATOM   1084 N  N   . GLN A  1 140 ? 14.307  12.984  34.692  1.00 49.49  ? 140  GLN A N   1 
ATOM   1085 C  CA  . GLN A  1 140 ? 13.145  13.372  35.490  1.00 53.96  ? 140  GLN A CA  1 
ATOM   1086 C  C   . GLN A  1 140 ? 11.852  12.760  34.949  1.00 53.78  ? 140  GLN A C   1 
ATOM   1087 O  O   . GLN A  1 140 ? 11.123  12.077  35.673  1.00 56.16  ? 140  GLN A O   1 
ATOM   1088 C  CB  . GLN A  1 140 ? 13.023  14.901  35.535  1.00 54.08  ? 140  GLN A CB  1 
ATOM   1089 C  CG  . GLN A  1 140 ? 12.285  15.442  36.759  1.00 51.35  ? 140  GLN A CG  1 
ATOM   1090 C  CD  . GLN A  1 140 ? 10.782  15.225  36.700  1.00 55.66  ? 140  GLN A CD  1 
ATOM   1091 O  OE1 . GLN A  1 140 ? 10.156  15.409  35.655  1.00 51.98  ? 140  GLN A OE1 1 
ATOM   1092 N  NE2 . GLN A  1 140 ? 10.195  14.833  37.828  1.00 46.94  ? 140  GLN A NE2 1 
ATOM   1093 N  N   . VAL A  1 141 ? 11.575  13.007  33.673  1.00 53.89  ? 141  VAL A N   1 
ATOM   1094 C  CA  . VAL A  1 141 ? 10.304  12.612  33.074  1.00 48.96  ? 141  VAL A CA  1 
ATOM   1095 C  C   . VAL A  1 141 ? 10.209  11.109  32.793  1.00 46.62  ? 141  VAL A C   1 
ATOM   1096 O  O   . VAL A  1 141 ? 9.179   10.487  33.068  1.00 43.81  ? 141  VAL A O   1 
ATOM   1097 C  CB  . VAL A  1 141 ? 10.022  13.425  31.794  1.00 42.54  ? 141  VAL A CB  1 
ATOM   1098 C  CG1 . VAL A  1 141 ? 8.653   13.095  31.232  1.00 48.82  ? 141  VAL A CG1 1 
ATOM   1099 C  CG2 . VAL A  1 141 ? 10.107  14.905  32.099  1.00 34.87  ? 141  VAL A CG2 1 
ATOM   1100 N  N   . GLU A  1 142 ? 11.282  10.526  32.264  1.00 36.40  ? 142  GLU A N   1 
ATOM   1101 C  CA  . GLU A  1 142 ? 11.281  9.103   31.934  1.00 37.27  ? 142  GLU A CA  1 
ATOM   1102 C  C   . GLU A  1 142 ? 11.950  8.223   32.986  1.00 40.77  ? 142  GLU A C   1 
ATOM   1103 O  O   . GLU A  1 142 ? 11.906  6.997   32.889  1.00 43.52  ? 142  GLU A O   1 
ATOM   1104 C  CB  . GLU A  1 142 ? 11.929  8.863   30.569  1.00 39.18  ? 142  GLU A CB  1 
ATOM   1105 C  CG  . GLU A  1 142 ? 11.153  9.454   29.400  1.00 45.79  ? 142  GLU A CG  1 
ATOM   1106 C  CD  . GLU A  1 142 ? 9.741   8.910   29.301  1.00 58.19  ? 142  GLU A CD  1 
ATOM   1107 O  OE1 . GLU A  1 142 ? 9.509   7.753   29.716  1.00 58.62  ? 142  GLU A OE1 1 
ATOM   1108 O  OE2 . GLU A  1 142 ? 8.858   9.642   28.808  1.00 63.91  ? 142  GLU A OE2 1 
ATOM   1109 N  N   . GLY A  1 143 ? 12.571  8.843   33.985  1.00 43.75  ? 143  GLY A N   1 
ATOM   1110 C  CA  . GLY A  1 143 ? 13.239  8.095   35.036  1.00 43.06  ? 143  GLY A CA  1 
ATOM   1111 C  C   . GLY A  1 143 ? 14.459  7.333   34.551  1.00 45.20  ? 143  GLY A C   1 
ATOM   1112 O  O   . GLY A  1 143 ? 14.792  6.277   35.086  1.00 48.49  ? 143  GLY A O   1 
ATOM   1113 N  N   . ALA A  1 144 ? 15.134  7.874   33.542  1.00 46.89  ? 144  ALA A N   1 
ATOM   1114 C  CA  . ALA A  1 144 ? 16.281  7.198   32.943  1.00 46.01  ? 144  ALA A CA  1 
ATOM   1115 C  C   . ALA A  1 144 ? 17.603  7.556   33.621  1.00 39.00  ? 144  ALA A C   1 
ATOM   1116 O  O   . ALA A  1 144 ? 17.748  8.645   34.177  1.00 32.96  ? 144  ALA A O   1 
ATOM   1117 C  CB  . ALA A  1 144 ? 16.358  7.519   31.461  1.00 39.33  ? 144  ALA A CB  1 
ATOM   1118 N  N   . VAL A  1 145 ? 18.564  6.635   33.571  1.00 29.92  ? 145  VAL A N   1 
ATOM   1119 C  CA  . VAL A  1 145 ? 19.941  6.949   33.940  1.00 32.13  ? 145  VAL A CA  1 
ATOM   1120 C  C   . VAL A  1 145 ? 20.686  7.311   32.660  1.00 43.50  ? 145  VAL A C   1 
ATOM   1121 O  O   . VAL A  1 145 ? 20.744  6.513   31.720  1.00 38.56  ? 145  VAL A O   1 
ATOM   1122 C  CB  . VAL A  1 145 ? 20.638  5.764   34.645  1.00 35.91  ? 145  VAL A CB  1 
ATOM   1123 C  CG1 . VAL A  1 145 ? 22.088  6.111   34.960  1.00 29.04  ? 145  VAL A CG1 1 
ATOM   1124 C  CG2 . VAL A  1 145 ? 19.893  5.391   35.925  1.00 31.68  ? 145  VAL A CG2 1 
ATOM   1125 N  N   . LEU A  1 146 ? 21.231  8.523   32.609  1.00 45.38  ? 146  LEU A N   1 
ATOM   1126 C  CA  . LEU A  1 146 ? 21.897  8.987   31.397  1.00 38.65  ? 146  LEU A CA  1 
ATOM   1127 C  C   . LEU A  1 146 ? 23.375  9.257   31.641  1.00 40.26  ? 146  LEU A C   1 
ATOM   1128 O  O   . LEU A  1 146 ? 23.745  9.906   32.624  1.00 41.71  ? 146  LEU A O   1 
ATOM   1129 C  CB  . LEU A  1 146 ? 21.207  10.235  30.836  1.00 38.42  ? 146  LEU A CB  1 
ATOM   1130 C  CG  . LEU A  1 146 ? 21.507  10.546  29.365  1.00 40.94  ? 146  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A  1 146 ? 20.281  11.107  28.673  1.00 47.76  ? 146  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A  1 146 ? 22.662  11.519  29.249  1.00 37.21  ? 146  LEU A CD2 1 
ATOM   1133 N  N   . VAL A  1 147 ? 24.212  8.750   30.739  1.00 36.81  ? 147  VAL A N   1 
ATOM   1134 C  CA  . VAL A  1 147 ? 25.654  8.937   30.827  1.00 36.53  ? 147  VAL A CA  1 
ATOM   1135 C  C   . VAL A  1 147 ? 26.169  9.581   29.548  1.00 37.49  ? 147  VAL A C   1 
ATOM   1136 O  O   . VAL A  1 147 ? 25.849  9.131   28.449  1.00 36.08  ? 147  VAL A O   1 
ATOM   1137 C  CB  . VAL A  1 147 ? 26.384  7.594   31.046  1.00 41.56  ? 147  VAL A CB  1 
ATOM   1138 C  CG1 . VAL A  1 147 ? 27.877  7.819   31.221  1.00 37.56  ? 147  VAL A CG1 1 
ATOM   1139 C  CG2 . VAL A  1 147 ? 25.818  6.875   32.257  1.00 41.34  ? 147  VAL A CG2 1 
ATOM   1140 N  N   . SER A  1 148 ? 26.949  10.646  29.687  1.00 40.49  ? 148  SER A N   1 
ATOM   1141 C  CA  . SER A  1 148 ? 27.616  11.250  28.537  1.00 38.72  ? 148  SER A CA  1 
ATOM   1142 C  C   . SER A  1 148 ? 29.100  11.385  28.848  1.00 40.68  ? 148  SER A C   1 
ATOM   1143 O  O   . SER A  1 148 ? 29.472  11.778  29.956  1.00 37.38  ? 148  SER A O   1 
ATOM   1144 C  CB  . SER A  1 148 ? 27.003  12.610  28.193  1.00 41.99  ? 148  SER A CB  1 
ATOM   1145 O  OG  . SER A  1 148 ? 27.152  13.534  29.257  1.00 48.61  ? 148  SER A OG  1 
ATOM   1146 N  N   . MET A  1 149 ? 29.952  11.036  27.889  1.00 37.05  ? 149  MET A N   1 
ATOM   1147 C  CA  . MET A  1 149 ? 31.390  11.132  28.116  1.00 32.26  ? 149  MET A CA  1 
ATOM   1148 C  C   . MET A  1 149 ? 32.072  12.070  27.131  1.00 42.23  ? 149  MET A C   1 
ATOM   1149 O  O   . MET A  1 149 ? 31.602  12.267  26.004  1.00 38.05  ? 149  MET A O   1 
ATOM   1150 C  CB  . MET A  1 149 ? 32.046  9.746   28.060  1.00 30.06  ? 149  MET A CB  1 
ATOM   1151 C  CG  . MET A  1 149 ? 32.552  9.342   26.679  1.00 29.45  ? 149  MET A CG  1 
ATOM   1152 S  SD  . MET A  1 149 ? 31.235  8.990   25.499  1.00 38.11  ? 149  MET A SD  1 
ATOM   1153 C  CE  . MET A  1 149 ? 30.696  7.380   26.078  1.00 23.88  ? 149  MET A CE  1 
ATOM   1154 N  N   . ASN A  1 150 ? 33.174  12.663  27.573  1.00 34.69  ? 150  ASN A N   1 
ATOM   1155 C  CA  . ASN A  1 150 ? 34.056  13.388  26.674  1.00 37.03  ? 150  ASN A CA  1 
ATOM   1156 C  C   . ASN A  1 150 ? 35.024  12.398  26.041  1.00 39.58  ? 150  ASN A C   1 
ATOM   1157 O  O   . ASN A  1 150 ? 35.491  11.470  26.705  1.00 37.28  ? 150  ASN A O   1 
ATOM   1158 C  CB  . ASN A  1 150 ? 34.844  14.452  27.440  1.00 28.95  ? 150  ASN A CB  1 
ATOM   1159 C  CG  . ASN A  1 150 ? 34.057  15.730  27.663  1.00 31.52  ? 150  ASN A CG  1 
ATOM   1160 O  OD1 . ASN A  1 150 ? 32.896  15.841  27.267  1.00 27.13  ? 150  ASN A OD1 1 
ATOM   1161 N  ND2 . ASN A  1 150 ? 34.690  16.703  28.306  1.00 33.77  ? 150  ASN A ND2 1 
ATOM   1162 N  N   . TYR A  1 151 ? 35.316  12.583  24.758  1.00 37.50  ? 151  TYR A N   1 
ATOM   1163 C  CA  . TYR A  1 151 ? 36.327  11.773  24.088  1.00 33.94  ? 151  TYR A CA  1 
ATOM   1164 C  C   . TYR A  1 151 ? 37.216  12.680  23.247  1.00 37.07  ? 151  TYR A C   1 
ATOM   1165 O  O   . TYR A  1 151 ? 36.757  13.709  22.743  1.00 38.63  ? 151  TYR A O   1 
ATOM   1166 C  CB  . TYR A  1 151 ? 35.694  10.653  23.244  1.00 29.75  ? 151  TYR A CB  1 
ATOM   1167 C  CG  . TYR A  1 151 ? 34.750  11.119  22.156  1.00 37.05  ? 151  TYR A CG  1 
ATOM   1168 C  CD1 . TYR A  1 151 ? 33.402  11.329  22.422  1.00 35.73  ? 151  TYR A CD1 1 
ATOM   1169 C  CD2 . TYR A  1 151 ? 35.202  11.320  20.856  1.00 33.93  ? 151  TYR A CD2 1 
ATOM   1170 C  CE1 . TYR A  1 151 ? 32.537  11.741  21.427  1.00 39.93  ? 151  TYR A CE1 1 
ATOM   1171 C  CE2 . TYR A  1 151 ? 34.344  11.734  19.858  1.00 34.55  ? 151  TYR A CE2 1 
ATOM   1172 C  CZ  . TYR A  1 151 ? 33.016  11.943  20.148  1.00 39.35  ? 151  TYR A CZ  1 
ATOM   1173 O  OH  . TYR A  1 151 ? 32.170  12.355  19.147  1.00 42.61  ? 151  TYR A OH  1 
ATOM   1174 N  N   . ARG A  1 152 ? 38.489  12.318  23.120  1.00 32.57  ? 152  ARG A N   1 
ATOM   1175 C  CA  . ARG A  1 152 ? 39.442  13.142  22.381  1.00 37.33  ? 152  ARG A CA  1 
ATOM   1176 C  C   . ARG A  1 152 ? 39.068  13.265  20.906  1.00 40.56  ? 152  ARG A C   1 
ATOM   1177 O  O   . ARG A  1 152 ? 38.745  12.273  20.247  1.00 33.72  ? 152  ARG A O   1 
ATOM   1178 C  CB  . ARG A  1 152 ? 40.861  12.588  22.527  1.00 34.49  ? 152  ARG A CB  1 
ATOM   1179 C  CG  . ARG A  1 152 ? 41.553  12.974  23.827  1.00 33.77  ? 152  ARG A CG  1 
ATOM   1180 C  CD  . ARG A  1 152 ? 42.847  12.199  23.991  1.00 32.06  ? 152  ARG A CD  1 
ATOM   1181 N  NE  . ARG A  1 152 ? 42.588  10.785  24.256  1.00 32.44  ? 152  ARG A NE  1 
ATOM   1182 C  CZ  . ARG A  1 152 ? 43.523  9.842   24.274  1.00 31.76  ? 152  ARG A CZ  1 
ATOM   1183 N  NH1 . ARG A  1 152 ? 44.789  10.155  24.033  1.00 27.87  ? 152  ARG A NH1 1 
ATOM   1184 N  NH2 . ARG A  1 152 ? 43.193  8.582   24.527  1.00 28.76  ? 152  ARG A NH2 1 
ATOM   1185 N  N   . VAL A  1 153 ? 39.104  14.492  20.399  1.00 36.16  ? 153  VAL A N   1 
ATOM   1186 C  CA  . VAL A  1 153 ? 38.734  14.757  19.017  1.00 36.94  ? 153  VAL A CA  1 
ATOM   1187 C  C   . VAL A  1 153 ? 39.913  15.373  18.270  1.00 43.82  ? 153  VAL A C   1 
ATOM   1188 O  O   . VAL A  1 153 ? 40.897  15.788  18.886  1.00 42.22  ? 153  VAL A O   1 
ATOM   1189 C  CB  . VAL A  1 153 ? 37.507  15.687  18.938  1.00 33.64  ? 153  VAL A CB  1 
ATOM   1190 C  CG1 . VAL A  1 153 ? 36.287  14.996  19.519  1.00 28.73  ? 153  VAL A CG1 1 
ATOM   1191 C  CG2 . VAL A  1 153 ? 37.775  16.991  19.678  1.00 26.81  ? 153  VAL A CG2 1 
ATOM   1192 N  N   . GLY A  1 154 ? 39.816  15.422  16.945  1.00 35.87  ? 154  GLY A N   1 
ATOM   1193 C  CA  . GLY A  1 154 ? 40.878  15.977  16.125  1.00 25.94  ? 154  GLY A CA  1 
ATOM   1194 C  C   . GLY A  1 154 ? 42.167  15.178  16.178  1.00 31.50  ? 154  GLY A C   1 
ATOM   1195 O  O   . GLY A  1 154 ? 42.143  13.948  16.265  1.00 35.60  ? 154  GLY A O   1 
ATOM   1196 N  N   . THR A  1 155 ? 43.294  15.883  16.120  1.00 32.13  ? 155  THR A N   1 
ATOM   1197 C  CA  . THR A  1 155 ? 44.610  15.255  16.178  1.00 39.75  ? 155  THR A CA  1 
ATOM   1198 C  C   . THR A  1 155 ? 44.801  14.420  17.441  1.00 37.98  ? 155  THR A C   1 
ATOM   1199 O  O   . THR A  1 155 ? 45.258  13.278  17.379  1.00 45.86  ? 155  THR A O   1 
ATOM   1200 C  CB  . THR A  1 155 ? 45.740  16.302  16.071  1.00 39.79  ? 155  THR A CB  1 
ATOM   1201 O  OG1 . THR A  1 155 ? 45.488  17.392  16.971  1.00 37.14  ? 155  THR A OG1 1 
ATOM   1202 C  CG2 . THR A  1 155 ? 45.829  16.834  14.659  1.00 33.75  ? 155  THR A CG2 1 
ATOM   1203 N  N   . PHE A  1 156 ? 44.435  14.992  18.581  1.00 36.52  ? 156  PHE A N   1 
ATOM   1204 C  CA  . PHE A  1 156 ? 44.644  14.345  19.873  1.00 40.96  ? 156  PHE A CA  1 
ATOM   1205 C  C   . PHE A  1 156 ? 43.886  13.028  19.989  1.00 34.43  ? 156  PHE A C   1 
ATOM   1206 O  O   . PHE A  1 156 ? 44.287  12.140  20.739  1.00 32.97  ? 156  PHE A O   1 
ATOM   1207 C  CB  . PHE A  1 156 ? 44.234  15.296  20.999  1.00 38.48  ? 156  PHE A CB  1 
ATOM   1208 C  CG  . PHE A  1 156 ? 44.697  16.708  20.785  1.00 35.35  ? 156  PHE A CG  1 
ATOM   1209 C  CD1 . PHE A  1 156 ? 45.965  17.104  21.191  1.00 31.78  ? 156  PHE A CD1 1 
ATOM   1210 C  CD2 . PHE A  1 156 ? 43.873  17.635  20.158  1.00 29.50  ? 156  PHE A CD2 1 
ATOM   1211 C  CE1 . PHE A  1 156 ? 46.400  18.401  20.983  1.00 37.90  ? 156  PHE A CE1 1 
ATOM   1212 C  CE2 . PHE A  1 156 ? 44.301  18.934  19.947  1.00 32.13  ? 156  PHE A CE2 1 
ATOM   1213 C  CZ  . PHE A  1 156 ? 45.568  19.317  20.359  1.00 36.92  ? 156  PHE A CZ  1 
ATOM   1214 N  N   . GLY A  1 157 ? 42.803  12.896  19.231  1.00 37.56  ? 157  GLY A N   1 
ATOM   1215 C  CA  . GLY A  1 157 ? 41.984  11.701  19.301  1.00 32.72  ? 157  GLY A CA  1 
ATOM   1216 C  C   . GLY A  1 157 ? 42.163  10.729  18.154  1.00 34.53  ? 157  GLY A C   1 
ATOM   1217 O  O   . GLY A  1 157 ? 41.921  9.529   18.312  1.00 36.27  ? 157  GLY A O   1 
ATOM   1218 N  N   . PHE A  1 158 ? 42.592  11.231  16.998  1.00 34.82  ? 158  PHE A N   1 
ATOM   1219 C  CA  . PHE A  1 158 ? 42.558  10.415  15.788  1.00 26.26  ? 158  PHE A CA  1 
ATOM   1220 C  C   . PHE A  1 158 ? 43.763  10.528  14.853  1.00 31.21  ? 158  PHE A C   1 
ATOM   1221 O  O   . PHE A  1 158 ? 43.797  9.863   13.815  1.00 39.58  ? 158  PHE A O   1 
ATOM   1222 C  CB  . PHE A  1 158 ? 41.251  10.671  15.028  1.00 24.59  ? 158  PHE A CB  1 
ATOM   1223 C  CG  . PHE A  1 158 ? 40.024  10.321  15.821  1.00 33.91  ? 158  PHE A CG  1 
ATOM   1224 C  CD1 . PHE A  1 158 ? 39.623  8.997   15.948  1.00 31.46  ? 158  PHE A CD1 1 
ATOM   1225 C  CD2 . PHE A  1 158 ? 39.286  11.309  16.459  1.00 34.60  ? 158  PHE A CD2 1 
ATOM   1226 C  CE1 . PHE A  1 158 ? 38.498  8.663   16.691  1.00 36.93  ? 158  PHE A CE1 1 
ATOM   1227 C  CE2 . PHE A  1 158 ? 38.159  10.985  17.207  1.00 30.92  ? 158  PHE A CE2 1 
ATOM   1228 C  CZ  . PHE A  1 158 ? 37.764  9.661   17.323  1.00 30.31  ? 158  PHE A CZ  1 
ATOM   1229 N  N   . LEU A  1 159 ? 44.751  11.348  15.204  1.00 30.49  ? 159  LEU A N   1 
ATOM   1230 C  CA  . LEU A  1 159 ? 45.995  11.355  14.429  1.00 33.31  ? 159  LEU A CA  1 
ATOM   1231 C  C   . LEU A  1 159 ? 46.651  9.983   14.515  1.00 33.55  ? 159  LEU A C   1 
ATOM   1232 O  O   . LEU A  1 159 ? 46.867  9.458   15.606  1.00 44.40  ? 159  LEU A O   1 
ATOM   1233 C  CB  . LEU A  1 159 ? 46.969  12.438  14.911  1.00 36.52  ? 159  LEU A CB  1 
ATOM   1234 C  CG  . LEU A  1 159 ? 48.248  12.601  14.072  1.00 42.44  ? 159  LEU A CG  1 
ATOM   1235 C  CD1 . LEU A  1 159 ? 48.618  14.064  13.913  1.00 41.14  ? 159  LEU A CD1 1 
ATOM   1236 C  CD2 . LEU A  1 159 ? 49.414  11.835  14.678  1.00 33.06  ? 159  LEU A CD2 1 
ATOM   1237 N  N   . ALA A  1 160 ? 46.972  9.402   13.367  1.00 40.30  ? 160  ALA A N   1 
ATOM   1238 C  CA  . ALA A  1 160 ? 47.515  8.049   13.359  1.00 37.03  ? 160  ALA A CA  1 
ATOM   1239 C  C   . ALA A  1 160 ? 48.720  7.861   12.454  1.00 43.18  ? 160  ALA A C   1 
ATOM   1240 O  O   . ALA A  1 160 ? 48.762  8.360   11.328  1.00 43.89  ? 160  ALA A O   1 
ATOM   1241 C  CB  . ALA A  1 160 ? 46.432  7.046   12.987  1.00 33.52  ? 160  ALA A CB  1 
ATOM   1242 N  N   . LEU A  1 161 ? 49.698  7.127   12.967  1.00 44.43  ? 161  LEU A N   1 
ATOM   1243 C  CA  . LEU A  1 161 ? 50.726  6.529   12.134  1.00 43.71  ? 161  LEU A CA  1 
ATOM   1244 C  C   . LEU A  1 161 ? 50.555  5.019   12.279  1.00 40.62  ? 161  LEU A C   1 
ATOM   1245 O  O   . LEU A  1 161 ? 51.201  4.392   13.121  1.00 40.01  ? 161  LEU A O   1 
ATOM   1246 C  CB  . LEU A  1 161 ? 52.122  7.003   12.554  1.00 41.04  ? 161  LEU A CB  1 
ATOM   1247 C  CG  . LEU A  1 161 ? 52.396  8.480   12.240  1.00 47.32  ? 161  LEU A CG  1 
ATOM   1248 C  CD1 . LEU A  1 161 ? 53.725  8.958   12.794  1.00 58.24  ? 161  LEU A CD1 1 
ATOM   1249 C  CD2 . LEU A  1 161 ? 52.353  8.715   10.742  1.00 37.06  ? 161  LEU A CD2 1 
ATOM   1250 N  N   . PRO A  1 162 ? 49.649  4.440   11.469  1.00 40.29  ? 162  PRO A N   1 
ATOM   1251 C  CA  . PRO A  1 162 ? 49.230  3.034   11.560  1.00 43.12  ? 162  PRO A CA  1 
ATOM   1252 C  C   . PRO A  1 162 ? 50.401  2.061   11.650  1.00 52.06  ? 162  PRO A C   1 
ATOM   1253 O  O   . PRO A  1 162 ? 51.311  2.117   10.822  1.00 53.36  ? 162  PRO A O   1 
ATOM   1254 C  CB  . PRO A  1 162 ? 48.475  2.816   10.246  1.00 36.49  ? 162  PRO A CB  1 
ATOM   1255 C  CG  . PRO A  1 162 ? 47.918  4.167   9.914   1.00 29.64  ? 162  PRO A CG  1 
ATOM   1256 C  CD  . PRO A  1 162 ? 48.968  5.146   10.365  1.00 33.11  ? 162  PRO A CD  1 
ATOM   1257 N  N   . GLY A  1 163 ? 50.372  1.182   12.647  1.00 54.23  ? 163  GLY A N   1 
ATOM   1258 C  CA  . GLY A  1 163 ? 51.443  0.224   12.849  1.00 51.32  ? 163  GLY A CA  1 
ATOM   1259 C  C   . GLY A  1 163 ? 52.387  0.617   13.970  1.00 54.18  ? 163  GLY A C   1 
ATOM   1260 O  O   . GLY A  1 163 ? 53.003  -0.244  14.603  1.00 66.00  ? 163  GLY A O   1 
ATOM   1261 N  N   . SER A  1 164 ? 52.506  1.921   14.212  1.00 42.73  ? 164  SER A N   1 
ATOM   1262 C  CA  . SER A  1 164 ? 53.356  2.427   15.288  1.00 47.81  ? 164  SER A CA  1 
ATOM   1263 C  C   . SER A  1 164 ? 52.706  2.210   16.652  1.00 48.87  ? 164  SER A C   1 
ATOM   1264 O  O   . SER A  1 164 ? 51.514  1.915   16.740  1.00 52.17  ? 164  SER A O   1 
ATOM   1265 C  CB  . SER A  1 164 ? 53.642  3.915   15.090  1.00 48.24  ? 164  SER A CB  1 
ATOM   1266 O  OG  . SER A  1 164 ? 52.546  4.704   15.519  1.00 47.20  ? 164  SER A OG  1 
ATOM   1267 N  N   . ARG A  1 165 ? 53.489  2.358   17.715  1.00 49.46  ? 165  ARG A N   1 
ATOM   1268 C  CA  . ARG A  1 165 ? 52.965  2.177   19.066  1.00 57.93  ? 165  ARG A CA  1 
ATOM   1269 C  C   . ARG A  1 165 ? 52.718  3.511   19.765  1.00 50.65  ? 165  ARG A C   1 
ATOM   1270 O  O   . ARG A  1 165 ? 52.008  3.570   20.772  1.00 53.68  ? 165  ARG A O   1 
ATOM   1271 C  CB  . ARG A  1 165 ? 53.912  1.314   19.905  1.00 70.41  ? 165  ARG A CB  1 
ATOM   1272 C  CG  . ARG A  1 165 ? 55.027  2.093   20.589  1.00 82.53  ? 165  ARG A CG  1 
ATOM   1273 C  CD  . ARG A  1 165 ? 55.435  1.435   21.902  1.00 90.05  ? 165  ARG A CD  1 
ATOM   1274 N  NE  . ARG A  1 165 ? 56.374  2.255   22.664  1.00 96.64  ? 165  ARG A NE  1 
ATOM   1275 C  CZ  . ARG A  1 165 ? 56.013  3.181   23.548  1.00 96.79  ? 165  ARG A CZ  1 
ATOM   1276 N  NH1 . ARG A  1 165 ? 54.729  3.414   23.784  1.00 93.64  ? 165  ARG A NH1 1 
ATOM   1277 N  NH2 . ARG A  1 165 ? 56.935  3.878   24.195  1.00 97.51  ? 165  ARG A NH2 1 
ATOM   1278 N  N   . GLU A  1 166 ? 53.308  4.578   19.233  1.00 37.23  ? 166  GLU A N   1 
ATOM   1279 C  CA  . GLU A  1 166 ? 53.162  5.907   19.821  1.00 41.50  ? 166  GLU A CA  1 
ATOM   1280 C  C   . GLU A  1 166 ? 51.944  6.646   19.261  1.00 45.37  ? 166  GLU A C   1 
ATOM   1281 O  O   . GLU A  1 166 ? 51.528  7.670   19.807  1.00 51.13  ? 166  GLU A O   1 
ATOM   1282 C  CB  . GLU A  1 166 ? 54.432  6.738   19.603  1.00 51.72  ? 166  GLU A CB  1 
ATOM   1283 C  CG  . GLU A  1 166 ? 55.737  6.051   20.002  1.00 65.16  ? 166  GLU A CG  1 
ATOM   1284 C  CD  . GLU A  1 166 ? 56.316  5.182   18.894  1.00 76.88  ? 166  GLU A CD  1 
ATOM   1285 O  OE1 . GLU A  1 166 ? 55.537  4.593   18.114  1.00 75.41  ? 166  GLU A OE1 1 
ATOM   1286 O  OE2 . GLU A  1 166 ? 57.558  5.088   18.801  1.00 81.56  ? 166  GLU A OE2 1 
ATOM   1287 N  N   . ALA A  1 167 ? 51.380  6.122   18.174  1.00 46.39  ? 167  ALA A N   1 
ATOM   1288 C  CA  . ALA A  1 167 ? 50.165  6.679   17.576  1.00 49.50  ? 167  ALA A CA  1 
ATOM   1289 C  C   . ALA A  1 167 ? 49.412  5.630   16.768  1.00 50.85  ? 167  ALA A C   1 
ATOM   1290 O  O   . ALA A  1 167 ? 49.385  5.690   15.536  1.00 44.83  ? 167  ALA A O   1 
ATOM   1291 C  CB  . ALA A  1 167 ? 50.497  7.870   16.694  1.00 46.90  ? 167  ALA A CB  1 
ATOM   1292 N  N   . PRO A  1 168 ? 48.776  4.678   17.464  1.00 48.80  ? 168  PRO A N   1 
ATOM   1293 C  CA  . PRO A  1 168 ? 48.090  3.558   16.813  1.00 43.25  ? 168  PRO A CA  1 
ATOM   1294 C  C   . PRO A  1 168 ? 46.808  4.003   16.122  1.00 43.36  ? 168  PRO A C   1 
ATOM   1295 O  O   . PRO A  1 168 ? 46.279  3.274   15.282  1.00 44.74  ? 168  PRO A O   1 
ATOM   1296 C  CB  . PRO A  1 168 ? 47.752  2.640   17.987  1.00 43.62  ? 168  PRO A CB  1 
ATOM   1297 C  CG  . PRO A  1 168 ? 47.587  3.575   19.153  1.00 39.92  ? 168  PRO A CG  1 
ATOM   1298 C  CD  . PRO A  1 168 ? 48.597  4.668   18.930  1.00 40.81  ? 168  PRO A CD  1 
ATOM   1299 N  N   . GLY A  1 169 ? 46.321  5.188   16.482  1.00 45.24  ? 169  GLY A N   1 
ATOM   1300 C  CA  . GLY A  1 169 ? 45.083  5.710   15.932  1.00 40.37  ? 169  GLY A CA  1 
ATOM   1301 C  C   . GLY A  1 169 ? 43.862  5.230   16.692  1.00 41.09  ? 169  GLY A C   1 
ATOM   1302 O  O   . GLY A  1 169 ? 43.959  4.312   17.508  1.00 43.14  ? 169  GLY A O   1 
ATOM   1303 N  N   . ASN A  1 170 ? 42.719  5.861   16.426  1.00 38.85  ? 170  ASN A N   1 
ATOM   1304 C  CA  . ASN A  1 170 ? 41.441  5.487   17.035  1.00 41.68  ? 170  ASN A CA  1 
ATOM   1305 C  C   . ASN A  1 170 ? 41.360  5.640   18.558  1.00 41.44  ? 170  ASN A C   1 
ATOM   1306 O  O   . ASN A  1 170 ? 40.465  5.070   19.181  1.00 46.07  ? 170  ASN A O   1 
ATOM   1307 C  CB  . ASN A  1 170 ? 41.045  4.052   16.643  1.00 39.70  ? 170  ASN A CB  1 
ATOM   1308 C  CG  . ASN A  1 170 ? 40.731  3.911   15.166  1.00 45.15  ? 170  ASN A CG  1 
ATOM   1309 O  OD1 . ASN A  1 170 ? 40.236  4.840   14.540  1.00 47.73  ? 170  ASN A OD1 1 
ATOM   1310 N  ND2 . ASN A  1 170 ? 41.010  2.738   14.606  1.00 35.40  ? 170  ASN A ND2 1 
ATOM   1311 N  N   . VAL A  1 171 ? 42.275  6.398   19.160  1.00 34.47  ? 171  VAL A N   1 
ATOM   1312 C  CA  . VAL A  1 171 ? 42.294  6.516   20.623  1.00 38.82  ? 171  VAL A CA  1 
ATOM   1313 C  C   . VAL A  1 171 ? 41.083  7.272   21.174  1.00 41.01  ? 171  VAL A C   1 
ATOM   1314 O  O   . VAL A  1 171 ? 40.703  7.087   22.332  1.00 35.36  ? 171  VAL A O   1 
ATOM   1315 C  CB  . VAL A  1 171 ? 43.614  7.129   21.160  1.00 34.08  ? 171  VAL A CB  1 
ATOM   1316 C  CG1 . VAL A  1 171 ? 44.805  6.387   20.595  1.00 32.19  ? 171  VAL A CG1 1 
ATOM   1317 C  CG2 . VAL A  1 171 ? 43.712  8.613   20.830  1.00 34.10  ? 171  VAL A CG2 1 
ATOM   1318 N  N   . GLY A  1 172 ? 40.472  8.112   20.342  1.00 41.28  ? 172  GLY A N   1 
ATOM   1319 C  CA  . GLY A  1 172 ? 39.238  8.781   20.718  1.00 34.96  ? 172  GLY A CA  1 
ATOM   1320 C  C   . GLY A  1 172 ? 38.110  7.777   20.885  1.00 40.49  ? 172  GLY A C   1 
ATOM   1321 O  O   . GLY A  1 172 ? 37.229  7.945   21.735  1.00 37.72  ? 172  GLY A O   1 
ATOM   1322 N  N   . LEU A  1 173 ? 38.144  6.728   20.065  1.00 37.89  ? 173  LEU A N   1 
ATOM   1323 C  CA  . LEU A  1 173 ? 37.186  5.629   20.164  1.00 37.27  ? 173  LEU A CA  1 
ATOM   1324 C  C   . LEU A  1 173 ? 37.482  4.746   21.379  1.00 37.65  ? 173  LEU A C   1 
ATOM   1325 O  O   . LEU A  1 173 ? 36.573  4.141   21.950  1.00 38.69  ? 173  LEU A O   1 
ATOM   1326 C  CB  . LEU A  1 173 ? 37.188  4.793   18.879  1.00 32.44  ? 173  LEU A CB  1 
ATOM   1327 C  CG  . LEU A  1 173 ? 36.550  5.422   17.634  1.00 39.95  ? 173  LEU A CG  1 
ATOM   1328 C  CD1 . LEU A  1 173 ? 36.812  4.584   16.394  1.00 36.76  ? 173  LEU A CD1 1 
ATOM   1329 C  CD2 . LEU A  1 173 ? 35.060  5.605   17.837  1.00 33.53  ? 173  LEU A CD2 1 
ATOM   1330 N  N   . LEU A  1 174 ? 38.752  4.675   21.773  1.00 33.67  ? 174  LEU A N   1 
ATOM   1331 C  CA  . LEU A  1 174 ? 39.138  3.908   22.954  1.00 36.52  ? 174  LEU A CA  1 
ATOM   1332 C  C   . LEU A  1 174 ? 38.731  4.628   24.241  1.00 37.20  ? 174  LEU A C   1 
ATOM   1333 O  O   . LEU A  1 174 ? 38.471  3.985   25.261  1.00 37.72  ? 174  LEU A O   1 
ATOM   1334 C  CB  . LEU A  1 174 ? 40.641  3.609   22.949  1.00 34.01  ? 174  LEU A CB  1 
ATOM   1335 C  CG  . LEU A  1 174 ? 41.146  2.653   21.863  1.00 38.24  ? 174  LEU A CG  1 
ATOM   1336 C  CD1 . LEU A  1 174 ? 42.655  2.508   21.917  1.00 35.18  ? 174  LEU A CD1 1 
ATOM   1337 C  CD2 . LEU A  1 174 ? 40.487  1.297   21.990  1.00 33.98  ? 174  LEU A CD2 1 
ATOM   1338 N  N   . ASP A  1 175 ? 38.673  5.959   24.187  1.00 32.79  ? 175  ASP A N   1 
ATOM   1339 C  CA  . ASP A  1 175 ? 38.206  6.753   25.322  1.00 30.67  ? 175  ASP A CA  1 
ATOM   1340 C  C   . ASP A  1 175 ? 36.737  6.425   25.575  1.00 39.06  ? 175  ASP A C   1 
ATOM   1341 O  O   . ASP A  1 175 ? 36.325  6.190   26.715  1.00 40.03  ? 175  ASP A O   1 
ATOM   1342 C  CB  . ASP A  1 175 ? 38.360  8.255   25.041  1.00 27.62  ? 175  ASP A CB  1 
ATOM   1343 C  CG  . ASP A  1 175 ? 39.805  8.675   24.815  1.00 39.28  ? 175  ASP A CG  1 
ATOM   1344 O  OD1 . ASP A  1 175 ? 40.719  7.942   25.237  1.00 44.91  ? 175  ASP A OD1 1 
ATOM   1345 O  OD2 . ASP A  1 175 ? 40.027  9.754   24.222  1.00 35.91  ? 175  ASP A OD2 1 
ATOM   1346 N  N   . GLN A  1 176 ? 35.955  6.404   24.496  1.00 36.56  ? 176  GLN A N   1 
ATOM   1347 C  CA  . GLN A  1 176 ? 34.543  6.035   24.558  1.00 38.11  ? 176  GLN A CA  1 
ATOM   1348 C  C   . GLN A  1 176 ? 34.356  4.639   25.150  1.00 39.03  ? 176  GLN A C   1 
ATOM   1349 O  O   . GLN A  1 176 ? 33.539  4.451   26.051  1.00 40.04  ? 176  GLN A O   1 
ATOM   1350 C  CB  . GLN A  1 176 ? 33.904  6.097   23.163  1.00 30.62  ? 176  GLN A CB  1 
ATOM   1351 C  CG  . GLN A  1 176 ? 33.950  7.469   22.479  1.00 30.39  ? 176  GLN A CG  1 
ATOM   1352 C  CD  . GLN A  1 176 ? 33.431  7.420   21.047  1.00 40.42  ? 176  GLN A CD  1 
ATOM   1353 O  OE1 . GLN A  1 176 ? 32.965  6.379   20.580  1.00 35.70  ? 176  GLN A OE1 1 
ATOM   1354 N  NE2 . GLN A  1 176 ? 33.511  8.547   20.345  1.00 32.75  ? 176  GLN A NE2 1 
ATOM   1355 N  N   . ARG A  1 177 ? 35.117  3.669   24.641  1.00 39.01  ? 177  ARG A N   1 
ATOM   1356 C  CA  . ARG A  1 177 ? 35.053  2.287   25.126  1.00 37.84  ? 177  ARG A CA  1 
ATOM   1357 C  C   . ARG A  1 177 ? 35.406  2.191   26.611  1.00 40.46  ? 177  ARG A C   1 
ATOM   1358 O  O   . ARG A  1 177 ? 34.797  1.414   27.349  1.00 38.11  ? 177  ARG A O   1 
ATOM   1359 C  CB  . ARG A  1 177 ? 35.972  1.371   24.300  1.00 36.44  ? 177  ARG A CB  1 
ATOM   1360 C  CG  . ARG A  1 177 ? 36.015  -0.084  24.786  1.00 38.51  ? 177  ARG A CG  1 
ATOM   1361 C  CD  . ARG A  1 177 ? 37.012  -0.934  24.003  1.00 38.30  ? 177  ARG A CD  1 
ATOM   1362 N  NE  . ARG A  1 177 ? 36.508  -1.314  22.685  1.00 51.47  ? 177  ARG A NE  1 
ATOM   1363 C  CZ  . ARG A  1 177 ? 37.277  -1.725  21.680  1.00 48.19  ? 177  ARG A CZ  1 
ATOM   1364 N  NH1 . ARG A  1 177 ? 38.591  -1.805  21.837  1.00 42.80  ? 177  ARG A NH1 1 
ATOM   1365 N  NH2 . ARG A  1 177 ? 36.732  -2.052  20.514  1.00 34.24  ? 177  ARG A NH2 1 
ATOM   1366 N  N   . LEU A  1 178 ? 36.384  2.983   27.047  1.00 37.48  ? 178  LEU A N   1 
ATOM   1367 C  CA  . LEU A  1 178 ? 36.796  2.984   28.451  1.00 40.06  ? 178  LEU A CA  1 
ATOM   1368 C  C   . LEU A  1 178 ? 35.659  3.485   29.330  1.00 42.72  ? 178  LEU A C   1 
ATOM   1369 O  O   . LEU A  1 178 ? 35.450  2.986   30.435  1.00 44.25  ? 178  LEU A O   1 
ATOM   1370 C  CB  . LEU A  1 178 ? 38.050  3.844   28.648  1.00 36.00  ? 178  LEU A CB  1 
ATOM   1371 C  CG  . LEU A  1 178 ? 38.616  3.949   30.067  1.00 36.65  ? 178  LEU A CG  1 
ATOM   1372 C  CD1 . LEU A  1 178 ? 38.920  2.574   30.629  1.00 36.11  ? 178  LEU A CD1 1 
ATOM   1373 C  CD2 . LEU A  1 178 ? 39.866  4.808   30.079  1.00 32.85  ? 178  LEU A CD2 1 
ATOM   1374 N  N   . ALA A  1 179 ? 34.916  4.465   28.822  1.00 36.07  ? 179  ALA A N   1 
ATOM   1375 C  CA  . ALA A  1 179 ? 33.763  5.005   29.533  1.00 31.58  ? 179  ALA A CA  1 
ATOM   1376 C  C   . ALA A  1 179 ? 32.618  3.996   29.573  1.00 43.90  ? 179  ALA A C   1 
ATOM   1377 O  O   . ALA A  1 179 ? 31.840  3.970   30.530  1.00 52.80  ? 179  ALA A O   1 
ATOM   1378 C  CB  . ALA A  1 179 ? 33.309  6.305   28.891  1.00 27.76  ? 179  ALA A CB  1 
ATOM   1379 N  N   . LEU A  1 180 ? 32.511  3.176   28.529  1.00 35.98  ? 180  LEU A N   1 
ATOM   1380 C  CA  . LEU A  1 180 ? 31.526  2.097   28.514  1.00 41.25  ? 180  LEU A CA  1 
ATOM   1381 C  C   . LEU A  1 180 ? 31.873  1.043   29.570  1.00 39.75  ? 180  LEU A C   1 
ATOM   1382 O  O   . LEU A  1 180 ? 30.981  0.481   30.212  1.00 36.36  ? 180  LEU A O   1 
ATOM   1383 C  CB  . LEU A  1 180 ? 31.429  1.452   27.127  1.00 33.50  ? 180  LEU A CB  1 
ATOM   1384 C  CG  . LEU A  1 180 ? 31.127  2.348   25.918  1.00 36.78  ? 180  LEU A CG  1 
ATOM   1385 C  CD1 . LEU A  1 180 ? 30.953  1.529   24.650  1.00 40.23  ? 180  LEU A CD1 1 
ATOM   1386 C  CD2 . LEU A  1 180 ? 29.905  3.200   26.155  1.00 36.90  ? 180  LEU A CD2 1 
ATOM   1387 N  N   . GLN A  1 181 ? 33.167  0.779   29.744  1.00 34.85  ? 181  GLN A N   1 
ATOM   1388 C  CA  . GLN A  1 181 ? 33.630  -0.156  30.768  1.00 41.85  ? 181  GLN A CA  1 
ATOM   1389 C  C   . GLN A  1 181 ? 33.394  0.428   32.154  1.00 47.78  ? 181  GLN A C   1 
ATOM   1390 O  O   . GLN A  1 181 ? 33.054  -0.292  33.092  1.00 43.34  ? 181  GLN A O   1 
ATOM   1391 C  CB  . GLN A  1 181 ? 35.116  -0.481  30.574  1.00 45.16  ? 181  GLN A CB  1 
ATOM   1392 C  CG  . GLN A  1 181 ? 35.442  -1.172  29.250  1.00 59.70  ? 181  GLN A CG  1 
ATOM   1393 C  CD  . GLN A  1 181 ? 36.934  -1.379  29.046  1.00 64.72  ? 181  GLN A CD  1 
ATOM   1394 O  OE1 . GLN A  1 181 ? 37.745  -0.520  29.391  1.00 64.76  ? 181  GLN A OE1 1 
ATOM   1395 N  NE2 . GLN A  1 181 ? 37.301  -2.523  28.482  1.00 63.54  ? 181  GLN A NE2 1 
ATOM   1396 N  N   . TRP A  1 182 ? 33.569  1.740   32.274  1.00 46.47  ? 182  TRP A N   1 
ATOM   1397 C  CA  . TRP A  1 182 ? 33.320  2.433   33.531  1.00 40.77  ? 182  TRP A CA  1 
ATOM   1398 C  C   . TRP A  1 182 ? 31.859  2.295   33.951  1.00 46.29  ? 182  TRP A C   1 
ATOM   1399 O  O   . TRP A  1 182 ? 31.561  2.136   35.138  1.00 44.59  ? 182  TRP A O   1 
ATOM   1400 C  CB  . TRP A  1 182 ? 33.692  3.913   33.410  1.00 33.35  ? 182  TRP A CB  1 
ATOM   1401 C  CG  . TRP A  1 182 ? 33.599  4.648   34.718  1.00 36.57  ? 182  TRP A CG  1 
ATOM   1402 C  CD1 . TRP A  1 182 ? 34.609  4.865   35.614  1.00 29.15  ? 182  TRP A CD1 1 
ATOM   1403 C  CD2 . TRP A  1 182 ? 32.426  5.252   35.283  1.00 36.06  ? 182  TRP A CD2 1 
ATOM   1404 N  NE1 . TRP A  1 182 ? 34.135  5.569   36.697  1.00 38.87  ? 182  TRP A NE1 1 
ATOM   1405 C  CE2 . TRP A  1 182 ? 32.799  5.819   36.518  1.00 36.42  ? 182  TRP A CE2 1 
ATOM   1406 C  CE3 . TRP A  1 182 ? 31.098  5.369   34.862  1.00 36.24  ? 182  TRP A CE3 1 
ATOM   1407 C  CZ2 . TRP A  1 182 ? 31.888  6.494   37.336  1.00 40.17  ? 182  TRP A CZ2 1 
ATOM   1408 C  CZ3 . TRP A  1 182 ? 30.197  6.037   35.674  1.00 41.73  ? 182  TRP A CZ3 1 
ATOM   1409 C  CH2 . TRP A  1 182 ? 30.595  6.591   36.896  1.00 40.86  ? 182  TRP A CH2 1 
ATOM   1410 N  N   . VAL A  1 183 ? 30.958  2.363   32.973  1.00 35.66  ? 183  VAL A N   1 
ATOM   1411 C  CA  . VAL A  1 183 ? 29.529  2.196   33.224  1.00 35.57  ? 183  VAL A CA  1 
ATOM   1412 C  C   . VAL A  1 183 ? 29.223  0.760   33.648  1.00 42.88  ? 183  VAL A C   1 
ATOM   1413 O  O   . VAL A  1 183 ? 28.442  0.533   34.573  1.00 39.31  ? 183  VAL A O   1 
ATOM   1414 C  CB  . VAL A  1 183 ? 28.687  2.601   31.991  1.00 35.04  ? 183  VAL A CB  1 
ATOM   1415 C  CG1 . VAL A  1 183 ? 27.221  2.250   32.189  1.00 28.59  ? 183  VAL A CG1 1 
ATOM   1416 C  CG2 . VAL A  1 183 ? 28.832  4.088   31.723  1.00 30.24  ? 183  VAL A CG2 1 
ATOM   1417 N  N   . GLN A  1 184 ? 29.857  -0.204  32.985  1.00 40.97  ? 184  GLN A N   1 
ATOM   1418 C  CA  . GLN A  1 184 ? 29.700  -1.612  33.345  1.00 42.98  ? 184  GLN A CA  1 
ATOM   1419 C  C   . GLN A  1 184 ? 30.060  -1.886  34.803  1.00 44.68  ? 184  GLN A C   1 
ATOM   1420 O  O   . GLN A  1 184 ? 29.417  -2.702  35.462  1.00 47.61  ? 184  GLN A O   1 
ATOM   1421 C  CB  . GLN A  1 184 ? 30.545  -2.505  32.431  1.00 39.57  ? 184  GLN A CB  1 
ATOM   1422 C  CG  . GLN A  1 184 ? 29.917  -2.783  31.076  1.00 50.48  ? 184  GLN A CG  1 
ATOM   1423 C  CD  . GLN A  1 184 ? 28.608  -3.536  31.189  1.00 51.88  ? 184  GLN A CD  1 
ATOM   1424 O  OE1 . GLN A  1 184 ? 28.588  -4.717  31.533  1.00 60.98  ? 184  GLN A OE1 1 
ATOM   1425 N  NE2 . GLN A  1 184 ? 27.505  -2.853  30.903  1.00 40.10  ? 184  GLN A NE2 1 
ATOM   1426 N  N   . GLU A  1 185 ? 31.084  -1.207  35.309  1.00 37.78  ? 185  GLU A N   1 
ATOM   1427 C  CA  . GLU A  1 185 ? 31.555  -1.471  36.666  1.00 43.67  ? 185  GLU A CA  1 
ATOM   1428 C  C   . GLU A  1 185 ? 30.844  -0.633  37.734  1.00 43.00  ? 185  GLU A C   1 
ATOM   1429 O  O   . GLU A  1 185 ? 30.607  -1.113  38.841  1.00 48.46  ? 185  GLU A O   1 
ATOM   1430 C  CB  . GLU A  1 185 ? 33.079  -1.279  36.766  1.00 42.92  ? 185  GLU A CB  1 
ATOM   1431 C  CG  . GLU A  1 185 ? 33.685  -1.840  38.065  1.00 52.74  ? 185  GLU A CG  1 
ATOM   1432 C  CD  . GLU A  1 185 ? 35.162  -1.528  38.230  1.00 58.95  ? 185  GLU A CD  1 
ATOM   1433 O  OE1 . GLU A  1 185 ? 35.705  -0.755  37.413  1.00 62.10  ? 185  GLU A OE1 1 
ATOM   1434 O  OE2 . GLU A  1 185 ? 35.778  -2.051  39.185  1.00 60.24  ? 185  GLU A OE2 1 
ATOM   1435 N  N   . ASN A  1 186 ? 30.495  0.606   37.398  1.00 39.46  ? 186  ASN A N   1 
ATOM   1436 C  CA  . ASN A  1 186 ? 30.077  1.576   38.413  1.00 33.01  ? 186  ASN A CA  1 
ATOM   1437 C  C   . ASN A  1 186 ? 28.617  2.056   38.392  1.00 40.04  ? 186  ASN A C   1 
ATOM   1438 O  O   . ASN A  1 186 ? 28.144  2.616   39.387  1.00 47.39  ? 186  ASN A O   1 
ATOM   1439 C  CB  . ASN A  1 186 ? 31.019  2.792   38.392  1.00 27.23  ? 186  ASN A CB  1 
ATOM   1440 C  CG  . ASN A  1 186 ? 32.476  2.409   38.605  1.00 39.65  ? 186  ASN A CG  1 
ATOM   1441 O  OD1 . ASN A  1 186 ? 32.878  2.042   39.713  1.00 46.95  ? 186  ASN A OD1 1 
ATOM   1442 N  ND2 . ASN A  1 186 ? 33.278  2.512   37.548  1.00 35.07  ? 186  ASN A ND2 1 
ATOM   1443 N  N   . ILE A  1 187 ? 27.905  1.844   37.286  1.00 35.84  ? 187  ILE A N   1 
ATOM   1444 C  CA  . ILE A  1 187 ? 26.565  2.425   37.127  1.00 36.03  ? 187  ILE A CA  1 
ATOM   1445 C  C   . ILE A  1 187 ? 25.523  1.866   38.107  1.00 39.81  ? 187  ILE A C   1 
ATOM   1446 O  O   . ILE A  1 187 ? 24.519  2.522   38.393  1.00 39.11  ? 187  ILE A O   1 
ATOM   1447 C  CB  . ILE A  1 187 ? 26.053  2.325   35.667  1.00 27.83  ? 187  ILE A CB  1 
ATOM   1448 C  CG1 . ILE A  1 187 ? 25.107  3.487   35.356  1.00 30.04  ? 187  ILE A CG1 1 
ATOM   1449 C  CG2 . ILE A  1 187 ? 25.367  0.993   35.410  1.00 27.82  ? 187  ILE A CG2 1 
ATOM   1450 C  CD1 . ILE A  1 187 ? 25.757  4.847   35.496  1.00 27.86  ? 187  ILE A CD1 1 
ATOM   1451 N  N   . ALA A  1 188 ? 25.771  0.670   38.631  1.00 38.96  ? 188  ALA A N   1 
ATOM   1452 C  CA  . ALA A  1 188 ? 24.886  0.085   39.636  1.00 45.96  ? 188  ALA A CA  1 
ATOM   1453 C  C   . ALA A  1 188 ? 24.863  0.924   40.912  1.00 42.77  ? 188  ALA A C   1 
ATOM   1454 O  O   . ALA A  1 188 ? 23.884  0.905   41.655  1.00 45.73  ? 188  ALA A O   1 
ATOM   1455 C  CB  . ALA A  1 188 ? 25.304  -1.345  39.945  1.00 47.16  ? 188  ALA A CB  1 
ATOM   1456 N  N   . ALA A  1 189 ? 25.940  1.662   41.167  1.00 37.74  ? 189  ALA A N   1 
ATOM   1457 C  CA  . ALA A  1 189 ? 26.032  2.490   42.372  1.00 36.51  ? 189  ALA A CA  1 
ATOM   1458 C  C   . ALA A  1 189 ? 25.142  3.726   42.282  1.00 44.23  ? 189  ALA A C   1 
ATOM   1459 O  O   . ALA A  1 189 ? 25.004  4.475   43.251  1.00 53.57  ? 189  ALA A O   1 
ATOM   1460 C  CB  . ALA A  1 189 ? 27.473  2.892   42.631  1.00 29.26  ? 189  ALA A CB  1 
ATOM   1461 N  N   . PHE A  1 190 ? 24.552  3.933   41.108  1.00 46.13  ? 190  PHE A N   1 
ATOM   1462 C  CA  . PHE A  1 190 ? 23.648  5.052   40.875  1.00 41.08  ? 190  PHE A CA  1 
ATOM   1463 C  C   . PHE A  1 190 ? 22.217  4.547   40.678  1.00 42.66  ? 190  PHE A C   1 
ATOM   1464 O  O   . PHE A  1 190 ? 21.271  5.336   40.618  1.00 46.91  ? 190  PHE A O   1 
ATOM   1465 C  CB  . PHE A  1 190 ? 24.109  5.855   39.650  1.00 37.13  ? 190  PHE A CB  1 
ATOM   1466 C  CG  . PHE A  1 190 ? 25.483  6.465   39.800  1.00 37.26  ? 190  PHE A CG  1 
ATOM   1467 C  CD1 . PHE A  1 190 ? 26.624  5.738   39.475  1.00 39.39  ? 190  PHE A CD1 1 
ATOM   1468 C  CD2 . PHE A  1 190 ? 25.632  7.767   40.262  1.00 41.65  ? 190  PHE A CD2 1 
ATOM   1469 C  CE1 . PHE A  1 190 ? 27.891  6.297   39.612  1.00 33.59  ? 190  PHE A CE1 1 
ATOM   1470 C  CE2 . PHE A  1 190 ? 26.894  8.335   40.403  1.00 37.73  ? 190  PHE A CE2 1 
ATOM   1471 C  CZ  . PHE A  1 190 ? 28.027  7.599   40.076  1.00 28.43  ? 190  PHE A CZ  1 
ATOM   1472 N  N   . GLY A  1 191 ? 22.059  3.228   40.586  1.00 39.41  ? 191  GLY A N   1 
ATOM   1473 C  CA  . GLY A  1 191 ? 20.754  2.638   40.344  1.00 34.80  ? 191  GLY A CA  1 
ATOM   1474 C  C   . GLY A  1 191 ? 20.594  2.197   38.902  1.00 42.06  ? 191  GLY A C   1 
ATOM   1475 O  O   . GLY A  1 191 ? 19.515  1.768   38.488  1.00 46.88  ? 191  GLY A O   1 
ATOM   1476 N  N   . GLY A  1 192 ? 21.673  2.301   38.132  1.00 33.09  ? 192  GLY A N   1 
ATOM   1477 C  CA  . GLY A  1 192 ? 21.642  1.902   36.737  1.00 42.95  ? 192  GLY A CA  1 
ATOM   1478 C  C   . GLY A  1 192 ? 21.840  0.411   36.534  1.00 48.73  ? 192  GLY A C   1 
ATOM   1479 O  O   . GLY A  1 192 ? 22.568  -0.235  37.291  1.00 54.80  ? 192  GLY A O   1 
ATOM   1480 N  N   . ASP A  1 193 ? 21.187  -0.135  35.509  1.00 44.97  ? 193  ASP A N   1 
ATOM   1481 C  CA  . ASP A  1 193 ? 21.318  -1.550  35.173  1.00 42.08  ? 193  ASP A CA  1 
ATOM   1482 C  C   . ASP A  1 193 ? 22.368  -1.726  34.084  1.00 40.90  ? 193  ASP A C   1 
ATOM   1483 O  O   . ASP A  1 193 ? 22.138  -1.367  32.928  1.00 38.86  ? 193  ASP A O   1 
ATOM   1484 C  CB  . ASP A  1 193 ? 19.969  -2.128  34.721  1.00 44.28  ? 193  ASP A CB  1 
ATOM   1485 C  CG  . ASP A  1 193 ? 20.013  -3.637  34.495  1.00 49.18  ? 193  ASP A CG  1 
ATOM   1486 O  OD1 . ASP A  1 193 ? 21.036  -4.280  34.824  1.00 51.79  ? 193  ASP A OD1 1 
ATOM   1487 O  OD2 . ASP A  1 193 ? 19.005  -4.186  33.999  1.00 45.72  ? 193  ASP A OD2 1 
ATOM   1488 N  N   . PRO A  1 194 ? 23.529  -2.291  34.452  1.00 41.02  ? 194  PRO A N   1 
ATOM   1489 C  CA  . PRO A  1 194 ? 24.606  -2.515  33.480  1.00 39.88  ? 194  PRO A CA  1 
ATOM   1490 C  C   . PRO A  1 194 ? 24.263  -3.634  32.498  1.00 51.48  ? 194  PRO A C   1 
ATOM   1491 O  O   . PRO A  1 194 ? 25.056  -3.933  31.603  1.00 59.80  ? 194  PRO A O   1 
ATOM   1492 C  CB  . PRO A  1 194 ? 25.798  -2.909  34.361  1.00 40.72  ? 194  PRO A CB  1 
ATOM   1493 C  CG  . PRO A  1 194 ? 25.183  -3.490  35.608  1.00 34.96  ? 194  PRO A CG  1 
ATOM   1494 C  CD  . PRO A  1 194 ? 23.886  -2.752  35.809  1.00 34.46  ? 194  PRO A CD  1 
ATOM   1495 N  N   . MET A  1 195 ? 23.090  -4.242  32.672  1.00 48.66  ? 195  MET A N   1 
ATOM   1496 C  CA  . MET A  1 195 ? 22.601  -5.266  31.750  1.00 50.84  ? 195  MET A CA  1 
ATOM   1497 C  C   . MET A  1 195 ? 21.584  -4.703  30.758  1.00 48.83  ? 195  MET A C   1 
ATOM   1498 O  O   . MET A  1 195 ? 21.046  -5.434  29.923  1.00 50.33  ? 195  MET A O   1 
ATOM   1499 C  CB  . MET A  1 195 ? 22.001  -6.448  32.518  1.00 51.19  ? 195  MET A CB  1 
ATOM   1500 C  CG  . MET A  1 195 ? 23.034  -7.425  33.058  1.00 49.21  ? 195  MET A CG  1 
ATOM   1501 S  SD  . MET A  1 195 ? 22.286  -8.913  33.748  1.00 85.89  ? 195  MET A SD  1 
ATOM   1502 C  CE  . MET A  1 195 ? 23.710  -9.998  33.826  1.00 109.24 ? 195  MET A CE  1 
ATOM   1503 N  N   . SER A  1 196 ? 21.324  -3.403  30.855  1.00 42.73  ? 196  SER A N   1 
ATOM   1504 C  CA  . SER A  1 196 ? 20.451  -2.724  29.904  1.00 40.38  ? 196  SER A CA  1 
ATOM   1505 C  C   . SER A  1 196 ? 21.081  -1.393  29.511  1.00 44.43  ? 196  SER A C   1 
ATOM   1506 O  O   . SER A  1 196 ? 20.665  -0.330  29.983  1.00 42.77  ? 196  SER A O   1 
ATOM   1507 C  CB  . SER A  1 196 ? 19.059  -2.504  30.506  1.00 47.03  ? 196  SER A CB  1 
ATOM   1508 O  OG  . SER A  1 196 ? 18.116  -2.151  29.505  1.00 45.45  ? 196  SER A OG  1 
ATOM   1509 N  N   . VAL A  1 197 ? 22.092  -1.462  28.649  1.00 40.53  ? 197  VAL A N   1 
ATOM   1510 C  CA  . VAL A  1 197 ? 22.804  -0.274  28.192  1.00 42.79  ? 197  VAL A CA  1 
ATOM   1511 C  C   . VAL A  1 197 ? 22.540  0.002   26.714  1.00 44.73  ? 197  VAL A C   1 
ATOM   1512 O  O   . VAL A  1 197 ? 22.860  -0.818  25.845  1.00 43.64  ? 197  VAL A O   1 
ATOM   1513 C  CB  . VAL A  1 197 ? 24.322  -0.404  28.429  1.00 43.86  ? 197  VAL A CB  1 
ATOM   1514 C  CG1 . VAL A  1 197 ? 25.063  0.757   27.792  1.00 35.11  ? 197  VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A  1 197 ? 24.621  -0.475  29.918  1.00 44.58  ? 197  VAL A CG2 1 
ATOM   1516 N  N   . THR A  1 198 ? 21.948  1.161   26.439  1.00 41.11  ? 198  THR A N   1 
ATOM   1517 C  CA  . THR A  1 198 ? 21.664  1.580   25.072  1.00 39.22  ? 198  THR A CA  1 
ATOM   1518 C  C   . THR A  1 198 ? 22.544  2.765   24.682  1.00 39.12  ? 198  THR A C   1 
ATOM   1519 O  O   . THR A  1 198 ? 22.556  3.794   25.364  1.00 42.09  ? 198  THR A O   1 
ATOM   1520 C  CB  . THR A  1 198 ? 20.182  1.967   24.903  1.00 38.93  ? 198  THR A CB  1 
ATOM   1521 O  OG1 . THR A  1 198 ? 19.354  0.816   25.121  1.00 36.56  ? 198  THR A OG1 1 
ATOM   1522 C  CG2 . THR A  1 198 ? 19.928  2.511   23.499  1.00 39.04  ? 198  THR A CG2 1 
ATOM   1523 N  N   . LEU A  1 199 ? 23.289  2.610   23.591  1.00 35.78  ? 199  LEU A N   1 
ATOM   1524 C  CA  . LEU A  1 199 ? 24.080  3.705   23.040  1.00 34.83  ? 199  LEU A CA  1 
ATOM   1525 C  C   . LEU A  1 199 ? 23.218  4.558   22.114  1.00 34.99  ? 199  LEU A C   1 
ATOM   1526 O  O   . LEU A  1 199 ? 22.387  4.032   21.373  1.00 42.66  ? 199  LEU A O   1 
ATOM   1527 C  CB  . LEU A  1 199 ? 25.280  3.161   22.257  1.00 31.88  ? 199  LEU A CB  1 
ATOM   1528 C  CG  . LEU A  1 199 ? 26.250  2.223   22.978  1.00 41.58  ? 199  LEU A CG  1 
ATOM   1529 C  CD1 . LEU A  1 199 ? 27.417  1.870   22.071  1.00 32.97  ? 199  LEU A CD1 1 
ATOM   1530 C  CD2 . LEU A  1 199 ? 26.746  2.845   24.268  1.00 47.02  ? 199  LEU A CD2 1 
ATOM   1531 N  N   . PHE A  1 200 ? 23.393  5.875   22.178  1.00 31.91  ? 200  PHE A N   1 
ATOM   1532 C  CA  . PHE A  1 200 ? 22.809  6.767   21.177  1.00 29.43  ? 200  PHE A CA  1 
ATOM   1533 C  C   . PHE A  1 200 ? 23.687  7.990   20.943  1.00 35.32  ? 200  PHE A C   1 
ATOM   1534 O  O   . PHE A  1 200 ? 24.345  8.480   21.865  1.00 28.71  ? 200  PHE A O   1 
ATOM   1535 C  CB  . PHE A  1 200 ? 21.350  7.144   21.497  1.00 32.58  ? 200  PHE A CB  1 
ATOM   1536 C  CG  . PHE A  1 200 ? 21.181  8.136   22.616  1.00 35.92  ? 200  PHE A CG  1 
ATOM   1537 C  CD1 . PHE A  1 200 ? 21.858  7.990   23.819  1.00 39.61  ? 200  PHE A CD1 1 
ATOM   1538 C  CD2 . PHE A  1 200 ? 20.308  9.208   22.467  1.00 33.47  ? 200  PHE A CD2 1 
ATOM   1539 C  CE1 . PHE A  1 200 ? 21.680  8.905   24.851  1.00 38.78  ? 200  PHE A CE1 1 
ATOM   1540 C  CE2 . PHE A  1 200 ? 20.124  10.127  23.490  1.00 38.83  ? 200  PHE A CE2 1 
ATOM   1541 C  CZ  . PHE A  1 200 ? 20.813  9.976   24.686  1.00 33.59  ? 200  PHE A CZ  1 
ATOM   1542 N  N   . GLY A  1 201 ? 23.713  8.455   19.696  1.00 30.15  ? 201  GLY A N   1 
ATOM   1543 C  CA  . GLY A  1 201 ? 24.548  9.576   19.306  1.00 25.91  ? 201  GLY A CA  1 
ATOM   1544 C  C   . GLY A  1 201 ? 24.158  10.127  17.948  1.00 32.74  ? 201  GLY A C   1 
ATOM   1545 O  O   . GLY A  1 201 ? 23.362  9.524   17.224  1.00 30.42  ? 201  GLY A O   1 
ATOM   1546 N  N   . GLU A  1 202 ? 24.729  11.273  17.595  1.00 31.90  ? 202  GLU A N   1 
ATOM   1547 C  CA  . GLU A  1 202 ? 24.349  11.972  16.377  1.00 31.52  ? 202  GLU A CA  1 
ATOM   1548 C  C   . GLU A  1 202 ? 25.588  12.338  15.566  1.00 35.86  ? 202  GLU A C   1 
ATOM   1549 O  O   . GLU A  1 202 ? 26.631  12.664  16.137  1.00 28.22  ? 202  GLU A O   1 
ATOM   1550 C  CB  . GLU A  1 202 ? 23.539  13.222  16.737  1.00 34.14  ? 202  GLU A CB  1 
ATOM   1551 C  CG  . GLU A  1 202 ? 22.894  13.936  15.562  1.00 39.86  ? 202  GLU A CG  1 
ATOM   1552 C  CD  . GLU A  1 202 ? 23.793  14.985  14.963  1.00 45.84  ? 202  GLU A CD  1 
ATOM   1553 O  OE1 . GLU A  1 202 ? 24.827  15.305  15.588  1.00 44.81  ? 202  GLU A OE1 1 
ATOM   1554 O  OE2 . GLU A  1 202 ? 23.465  15.490  13.867  1.00 40.79  ? 202  GLU A OE2 1 
ATOM   1555 N  N   . SER A  1 203 ? 25.469  12.273  14.239  1.00 39.14  ? 203  SER A N   1 
ATOM   1556 C  CA  . SER A  1 203 ? 26.577  12.586  13.331  1.00 29.51  ? 203  SER A CA  1 
ATOM   1557 C  C   . SER A  1 203 ? 27.779  11.675  13.592  1.00 29.62  ? 203  SER A C   1 
ATOM   1558 O  O   . SER A  1 203 ? 27.676  10.451  13.454  1.00 30.07  ? 203  SER A O   1 
ATOM   1559 C  CB  . SER A  1 203 ? 26.960  14.072  13.431  1.00 28.93  ? 203  SER A CB  1 
ATOM   1560 O  OG  . SER A  1 203 ? 27.926  14.431  12.461  1.00 45.68  ? 203  SER A OG  1 
ATOM   1561 N  N   . ALA A  1 204 ? 28.910  12.262  13.976  1.00 21.12  ? 204  ALA A N   1 
ATOM   1562 C  CA  . ALA A  1 204 ? 30.102  11.475  14.288  1.00 28.11  ? 204  ALA A CA  1 
ATOM   1563 C  C   . ALA A  1 204 ? 29.872  10.557  15.488  1.00 36.07  ? 204  ALA A C   1 
ATOM   1564 O  O   . ALA A  1 204 ? 30.477  9.485   15.586  1.00 40.05  ? 204  ALA A O   1 
ATOM   1565 C  CB  . ALA A  1 204 ? 31.292  12.384  14.535  1.00 26.78  ? 204  ALA A CB  1 
ATOM   1566 N  N   . GLY A  1 205 ? 29.010  10.991  16.406  1.00 31.80  ? 205  GLY A N   1 
ATOM   1567 C  CA  . GLY A  1 205 ? 28.633  10.175  17.551  1.00 31.96  ? 205  GLY A CA  1 
ATOM   1568 C  C   . GLY A  1 205 ? 27.851  8.948   17.118  1.00 32.56  ? 205  GLY A C   1 
ATOM   1569 O  O   . GLY A  1 205 ? 28.021  7.862   17.674  1.00 30.43  ? 205  GLY A O   1 
ATOM   1570 N  N   . ALA A  1 206 ? 26.990  9.124   16.120  1.00 31.95  ? 206  ALA A N   1 
ATOM   1571 C  CA  . ALA A  1 206 ? 26.273  8.002   15.527  1.00 39.81  ? 206  ALA A CA  1 
ATOM   1572 C  C   . ALA A  1 206 ? 27.250  7.044   14.854  1.00 39.77  ? 206  ALA A C   1 
ATOM   1573 O  O   . ALA A  1 206 ? 27.156  5.828   15.023  1.00 41.83  ? 206  ALA A O   1 
ATOM   1574 C  CB  . ALA A  1 206 ? 25.239  8.497   14.526  1.00 36.74  ? 206  ALA A CB  1 
ATOM   1575 N  N   . ALA A  1 207 ? 28.183  7.593   14.084  1.00 34.41  ? 207  ALA A N   1 
ATOM   1576 C  CA  . ALA A  1 207 ? 29.220  6.775   13.465  1.00 31.60  ? 207  ALA A CA  1 
ATOM   1577 C  C   . ALA A  1 207 ? 30.015  6.025   14.528  1.00 39.32  ? 207  ALA A C   1 
ATOM   1578 O  O   . ALA A  1 207 ? 30.361  4.856   14.345  1.00 37.43  ? 207  ALA A O   1 
ATOM   1579 C  CB  . ALA A  1 207 ? 30.141  7.634   12.628  1.00 23.87  ? 207  ALA A CB  1 
ATOM   1580 N  N   . SER A  1 208 ? 30.314  6.708   15.630  1.00 35.07  ? 208  SER A N   1 
ATOM   1581 C  CA  . SER A  1 208 ? 30.992  6.076   16.756  1.00 36.79  ? 208  SER A CA  1 
ATOM   1582 C  C   . SER A  1 208 ? 30.195  4.881   17.271  1.00 32.84  ? 208  SER A C   1 
ATOM   1583 O  O   . SER A  1 208 ? 30.757  3.803   17.487  1.00 33.33  ? 208  SER A O   1 
ATOM   1584 C  CB  . SER A  1 208 ? 31.220  7.082   17.887  1.00 36.23  ? 208  SER A CB  1 
ATOM   1585 O  OG  . SER A  1 208 ? 32.088  8.125   17.477  1.00 37.04  ? 208  SER A OG  1 
ATOM   1586 N  N   . VAL A  1 209 ? 28.890  5.073   17.458  1.00 28.43  ? 209  VAL A N   1 
ATOM   1587 C  CA  . VAL A  1 209 ? 28.004  3.989   17.883  1.00 33.63  ? 209  VAL A CA  1 
ATOM   1588 C  C   . VAL A  1 209 ? 28.107  2.812   16.920  1.00 38.29  ? 209  VAL A C   1 
ATOM   1589 O  O   . VAL A  1 209 ? 28.224  1.659   17.342  1.00 41.71  ? 209  VAL A O   1 
ATOM   1590 C  CB  . VAL A  1 209 ? 26.538  4.459   17.975  1.00 36.22  ? 209  VAL A CB  1 
ATOM   1591 C  CG1 . VAL A  1 209 ? 25.611  3.279   18.205  1.00 31.20  ? 209  VAL A CG1 1 
ATOM   1592 C  CG2 . VAL A  1 209 ? 26.378  5.475   19.092  1.00 42.24  ? 209  VAL A CG2 1 
ATOM   1593 N  N   . GLY A  1 210 ? 28.089  3.113   15.626  1.00 37.36  ? 210  GLY A N   1 
ATOM   1594 C  CA  . GLY A  1 210 ? 28.195  2.088   14.604  1.00 30.53  ? 210  GLY A CA  1 
ATOM   1595 C  C   . GLY A  1 210 ? 29.494  1.310   14.679  1.00 32.15  ? 210  GLY A C   1 
ATOM   1596 O  O   . GLY A  1 210 ? 29.517  0.101   14.435  1.00 39.01  ? 210  GLY A O   1 
ATOM   1597 N  N   . MET A  1 211 ? 30.580  1.998   15.021  1.00 28.06  ? 211  MET A N   1 
ATOM   1598 C  CA  . MET A  1 211 ? 31.887  1.354   15.090  1.00 34.73  ? 211  MET A CA  1 
ATOM   1599 C  C   . MET A  1 211 ? 32.009  0.441   16.308  1.00 37.29  ? 211  MET A C   1 
ATOM   1600 O  O   . MET A  1 211 ? 32.746  -0.548  16.283  1.00 38.70  ? 211  MET A O   1 
ATOM   1601 C  CB  . MET A  1 211 ? 33.002  2.402   15.050  1.00 37.36  ? 211  MET A CB  1 
ATOM   1602 C  CG  . MET A  1 211 ? 33.023  3.183   13.744  1.00 45.80  ? 211  MET A CG  1 
ATOM   1603 S  SD  . MET A  1 211 ? 34.279  4.468   13.662  1.00 55.70  ? 211  MET A SD  1 
ATOM   1604 C  CE  . MET A  1 211 ? 33.723  5.390   12.221  1.00 28.44  ? 211  MET A CE  1 
ATOM   1605 N  N   . HIS A  1 212 ? 31.269  0.764   17.365  1.00 32.81  ? 212  HIS A N   1 
ATOM   1606 C  CA  . HIS A  1 212 ? 31.229  -0.086  18.555  1.00 33.75  ? 212  HIS A CA  1 
ATOM   1607 C  C   . HIS A  1 212 ? 30.479  -1.389  18.272  1.00 37.70  ? 212  HIS A C   1 
ATOM   1608 O  O   . HIS A  1 212 ? 30.812  -2.444  18.815  1.00 43.62  ? 212  HIS A O   1 
ATOM   1609 C  CB  . HIS A  1 212 ? 30.601  0.662   19.734  1.00 34.90  ? 212  HIS A CB  1 
ATOM   1610 C  CG  . HIS A  1 212 ? 31.480  1.732   20.304  1.00 35.15  ? 212  HIS A CG  1 
ATOM   1611 N  ND1 . HIS A  1 212 ? 32.707  1.460   20.872  1.00 34.39  ? 212  HIS A ND1 1 
ATOM   1612 C  CD2 . HIS A  1 212 ? 31.312  3.072   20.402  1.00 31.48  ? 212  HIS A CD2 1 
ATOM   1613 C  CE1 . HIS A  1 212 ? 33.258  2.586   21.287  1.00 38.25  ? 212  HIS A CE1 1 
ATOM   1614 N  NE2 . HIS A  1 212 ? 32.431  3.580   21.013  1.00 40.77  ? 212  HIS A NE2 1 
ATOM   1615 N  N   . ILE A  1 213 ? 29.462  -1.303  17.420  1.00 35.78  ? 213  ILE A N   1 
ATOM   1616 C  CA  . ILE A  1 213 ? 28.743  -2.478  16.943  1.00 39.84  ? 213  ILE A CA  1 
ATOM   1617 C  C   . ILE A  1 213 ? 29.688  -3.380  16.149  1.00 44.53  ? 213  ILE A C   1 
ATOM   1618 O  O   . ILE A  1 213 ? 29.635  -4.608  16.258  1.00 44.78  ? 213  ILE A O   1 
ATOM   1619 C  CB  . ILE A  1 213 ? 27.543  -2.062  16.053  1.00 39.61  ? 213  ILE A CB  1 
ATOM   1620 C  CG1 . ILE A  1 213 ? 26.566  -1.188  16.852  1.00 39.82  ? 213  ILE A CG1 1 
ATOM   1621 C  CG2 . ILE A  1 213 ? 26.827  -3.281  15.488  1.00 40.08  ? 213  ILE A CG2 1 
ATOM   1622 C  CD1 . ILE A  1 213 ? 25.341  -0.745  16.066  1.00 31.33  ? 213  ILE A CD1 1 
ATOM   1623 N  N   . LEU A  1 214 ? 30.569  -2.758  15.370  1.00 44.54  ? 214  LEU A N   1 
ATOM   1624 C  CA  . LEU A  1 214 ? 31.466  -3.483  14.474  1.00 43.79  ? 214  LEU A CA  1 
ATOM   1625 C  C   . LEU A  1 214 ? 32.789  -3.893  15.125  1.00 44.13  ? 214  LEU A C   1 
ATOM   1626 O  O   . LEU A  1 214 ? 33.552  -4.671  14.547  1.00 45.06  ? 214  LEU A O   1 
ATOM   1627 C  CB  . LEU A  1 214 ? 31.724  -2.654  13.212  1.00 38.03  ? 214  LEU A CB  1 
ATOM   1628 C  CG  . LEU A  1 214 ? 30.466  -2.311  12.409  1.00 40.05  ? 214  LEU A CG  1 
ATOM   1629 C  CD1 . LEU A  1 214 ? 30.768  -1.373  11.253  1.00 38.38  ? 214  LEU A CD1 1 
ATOM   1630 C  CD2 . LEU A  1 214 ? 29.812  -3.577  11.903  1.00 40.39  ? 214  LEU A CD2 1 
ATOM   1631 N  N   . SER A  1 215 ? 33.061  -3.378  16.321  1.00 40.28  ? 215  SER A N   1 
ATOM   1632 C  CA  . SER A  1 215 ? 34.277  -3.753  17.042  1.00 34.49  ? 215  SER A CA  1 
ATOM   1633 C  C   . SER A  1 215 ? 33.962  -4.715  18.190  1.00 44.57  ? 215  SER A C   1 
ATOM   1634 O  O   . SER A  1 215 ? 33.205  -4.378  19.101  1.00 47.55  ? 215  SER A O   1 
ATOM   1635 C  CB  . SER A  1 215 ? 34.996  -2.506  17.567  1.00 38.81  ? 215  SER A CB  1 
ATOM   1636 O  OG  . SER A  1 215 ? 36.347  -2.796  17.880  1.00 43.96  ? 215  SER A OG  1 
ATOM   1637 N  N   . LEU A  1 216 ? 34.549  -5.907  18.142  1.00 52.73  ? 216  LEU A N   1 
ATOM   1638 C  CA  . LEU A  1 216 ? 34.233  -6.973  19.100  1.00 58.33  ? 216  LEU A CA  1 
ATOM   1639 C  C   . LEU A  1 216 ? 34.376  -6.620  20.598  1.00 56.25  ? 216  LEU A C   1 
ATOM   1640 O  O   . LEU A  1 216 ? 33.465  -6.899  21.381  1.00 57.37  ? 216  LEU A O   1 
ATOM   1641 C  CB  . LEU A  1 216 ? 34.996  -8.262  18.754  1.00 66.00  ? 216  LEU A CB  1 
ATOM   1642 C  CG  . LEU A  1 216 ? 34.689  -9.493  19.611  1.00 73.78  ? 216  LEU A CG  1 
ATOM   1643 C  CD1 . LEU A  1 216 ? 33.236  -9.924  19.446  1.00 72.30  ? 216  LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A  1 216 ? 35.634  -10.639 19.280  1.00 73.43  ? 216  LEU A CD2 1 
ATOM   1645 N  N   . PRO A  1 217 ? 35.506  -6.003  21.003  1.00 52.12  ? 217  PRO A N   1 
ATOM   1646 C  CA  . PRO A  1 217 ? 35.659  -5.717  22.439  1.00 47.18  ? 217  PRO A CA  1 
ATOM   1647 C  C   . PRO A  1 217 ? 34.686  -4.663  22.997  1.00 47.32  ? 217  PRO A C   1 
ATOM   1648 O  O   . PRO A  1 217 ? 34.776  -4.331  24.180  1.00 60.40  ? 217  PRO A O   1 
ATOM   1649 C  CB  . PRO A  1 217 ? 37.106  -5.208  22.541  1.00 42.85  ? 217  PRO A CB  1 
ATOM   1650 C  CG  . PRO A  1 217 ? 37.798  -5.747  21.317  1.00 38.65  ? 217  PRO A CG  1 
ATOM   1651 C  CD  . PRO A  1 217 ? 36.742  -5.702  20.253  1.00 44.90  ? 217  PRO A CD  1 
ATOM   1652 N  N   . SER A  1 218 ? 33.780  -4.153  22.165  1.00 44.71  ? 218  SER A N   1 
ATOM   1653 C  CA  . SER A  1 218 ? 32.779  -3.185  22.610  1.00 37.57  ? 218  SER A CA  1 
ATOM   1654 C  C   . SER A  1 218 ? 31.390  -3.815  22.746  1.00 41.88  ? 218  SER A C   1 
ATOM   1655 O  O   . SER A  1 218 ? 30.520  -3.272  23.430  1.00 45.82  ? 218  SER A O   1 
ATOM   1656 C  CB  . SER A  1 218 ? 32.710  -1.992  21.644  1.00 31.59  ? 218  SER A CB  1 
ATOM   1657 O  OG  . SER A  1 218 ? 33.941  -1.292  21.585  1.00 42.14  ? 218  SER A OG  1 
ATOM   1658 N  N   . ARG A  1 219 ? 31.191  -4.963  22.102  1.00 41.87  ? 219  ARG A N   1 
ATOM   1659 C  CA  . ARG A  1 219 ? 29.875  -5.603  22.044  1.00 50.52  ? 219  ARG A CA  1 
ATOM   1660 C  C   . ARG A  1 219 ? 29.425  -6.222  23.362  1.00 56.00  ? 219  ARG A C   1 
ATOM   1661 O  O   . ARG A  1 219 ? 28.261  -6.590  23.511  1.00 66.97  ? 219  ARG A O   1 
ATOM   1662 C  CB  . ARG A  1 219 ? 29.833  -6.659  20.936  1.00 54.27  ? 219  ARG A CB  1 
ATOM   1663 C  CG  . ARG A  1 219 ? 29.910  -6.088  19.529  1.00 53.70  ? 219  ARG A CG  1 
ATOM   1664 C  CD  . ARG A  1 219 ? 29.739  -7.182  18.493  1.00 69.87  ? 219  ARG A CD  1 
ATOM   1665 N  NE  . ARG A  1 219 ? 30.499  -6.902  17.278  1.00 84.63  ? 219  ARG A NE  1 
ATOM   1666 C  CZ  . ARG A  1 219 ? 31.076  -7.837  16.531  1.00 92.59  ? 219  ARG A CZ  1 
ATOM   1667 N  NH1 . ARG A  1 219 ? 30.978  -9.114  16.875  1.00 92.68  ? 219  ARG A NH1 1 
ATOM   1668 N  NH2 . ARG A  1 219 ? 31.752  -7.496  15.441  1.00 90.61  ? 219  ARG A NH2 1 
ATOM   1669 N  N   . SER A  1 220 ? 30.345  -6.344  24.311  1.00 56.95  ? 220  SER A N   1 
ATOM   1670 C  CA  . SER A  1 220 ? 30.002  -6.834  25.640  1.00 60.49  ? 220  SER A CA  1 
ATOM   1671 C  C   . SER A  1 220 ? 29.624  -5.679  26.563  1.00 55.19  ? 220  SER A C   1 
ATOM   1672 O  O   . SER A  1 220 ? 29.274  -5.890  27.725  1.00 55.54  ? 220  SER A O   1 
ATOM   1673 C  CB  . SER A  1 220 ? 31.168  -7.633  26.232  1.00 61.78  ? 220  SER A CB  1 
ATOM   1674 O  OG  . SER A  1 220 ? 32.417  -7.121  25.799  1.00 65.69  ? 220  SER A OG  1 
ATOM   1675 N  N   . LEU A  1 221 ? 29.675  -4.460  26.028  1.00 38.76  ? 221  LEU A N   1 
ATOM   1676 C  CA  . LEU A  1 221 ? 29.535  -3.256  26.844  1.00 34.24  ? 221  LEU A CA  1 
ATOM   1677 C  C   . LEU A  1 221 ? 28.195  -2.551  26.647  1.00 36.91  ? 221  LEU A C   1 
ATOM   1678 O  O   . LEU A  1 221 ? 27.857  -1.621  27.388  1.00 43.12  ? 221  LEU A O   1 
ATOM   1679 C  CB  . LEU A  1 221 ? 30.685  -2.291  26.551  1.00 33.31  ? 221  LEU A CB  1 
ATOM   1680 C  CG  . LEU A  1 221 ? 32.092  -2.885  26.647  1.00 40.59  ? 221  LEU A CG  1 
ATOM   1681 C  CD1 . LEU A  1 221 ? 33.150  -1.846  26.318  1.00 43.47  ? 221  LEU A CD1 1 
ATOM   1682 C  CD2 . LEU A  1 221 ? 32.335  -3.468  28.027  1.00 40.89  ? 221  LEU A CD2 1 
ATOM   1683 N  N   . PHE A  1 222 ? 27.435  -2.992  25.648  1.00 33.73  ? 222  PHE A N   1 
ATOM   1684 C  CA  . PHE A  1 222 ? 26.102  -2.439  25.405  1.00 37.31  ? 222  PHE A CA  1 
ATOM   1685 C  C   . PHE A  1 222 ? 25.166  -3.489  24.814  1.00 38.46  ? 222  PHE A C   1 
ATOM   1686 O  O   . PHE A  1 222 ? 25.599  -4.588  24.463  1.00 43.20  ? 222  PHE A O   1 
ATOM   1687 C  CB  . PHE A  1 222 ? 26.166  -1.178  24.529  1.00 32.08  ? 222  PHE A CB  1 
ATOM   1688 C  CG  . PHE A  1 222 ? 26.605  -1.430  23.115  1.00 34.35  ? 222  PHE A CG  1 
ATOM   1689 C  CD1 . PHE A  1 222 ? 27.948  -1.604  22.814  1.00 33.54  ? 222  PHE A CD1 1 
ATOM   1690 C  CD2 . PHE A  1 222 ? 25.678  -1.463  22.080  1.00 37.67  ? 222  PHE A CD2 1 
ATOM   1691 C  CE1 . PHE A  1 222 ? 28.362  -1.826  21.511  1.00 34.77  ? 222  PHE A CE1 1 
ATOM   1692 C  CE2 . PHE A  1 222 ? 26.081  -1.684  20.772  1.00 32.10  ? 222  PHE A CE2 1 
ATOM   1693 C  CZ  . PHE A  1 222 ? 27.427  -1.865  20.488  1.00 32.80  ? 222  PHE A CZ  1 
ATOM   1694 N  N   . HIS A  1 223 ? 23.883  -3.153  24.718  1.00 42.21  ? 223  HIS A N   1 
ATOM   1695 C  CA  . HIS A  1 223 ? 22.878  -4.128  24.306  1.00 46.76  ? 223  HIS A CA  1 
ATOM   1696 C  C   . HIS A  1 223 ? 22.017  -3.629  23.146  1.00 48.39  ? 223  HIS A C   1 
ATOM   1697 O  O   . HIS A  1 223 ? 21.500  -4.423  22.360  1.00 52.40  ? 223  HIS A O   1 
ATOM   1698 C  CB  . HIS A  1 223 ? 22.016  -4.520  25.508  1.00 46.91  ? 223  HIS A CB  1 
ATOM   1699 C  CG  . HIS A  1 223 ? 22.812  -4.973  26.690  1.00 51.63  ? 223  HIS A CG  1 
ATOM   1700 N  ND1 . HIS A  1 223 ? 23.347  -4.094  27.612  1.00 51.44  ? 223  HIS A ND1 1 
ATOM   1701 C  CD2 . HIS A  1 223 ? 23.191  -6.209  27.095  1.00 44.88  ? 223  HIS A CD2 1 
ATOM   1702 C  CE1 . HIS A  1 223 ? 24.008  -4.768  28.531  1.00 47.71  ? 223  HIS A CE1 1 
ATOM   1703 N  NE2 . HIS A  1 223 ? 23.928  -6.057  28.241  1.00 50.16  ? 223  HIS A NE2 1 
ATOM   1704 N  N   . ARG A  1 224 ? 21.875  -2.312  23.040  1.00 41.76  ? 224  ARG A N   1 
ATOM   1705 C  CA  . ARG A  1 224 ? 21.101  -1.705  21.960  1.00 46.61  ? 224  ARG A CA  1 
ATOM   1706 C  C   . ARG A  1 224 ? 21.742  -0.406  21.479  1.00 47.50  ? 224  ARG A C   1 
ATOM   1707 O  O   . ARG A  1 224 ? 22.579  0.179   22.173  1.00 45.45  ? 224  ARG A O   1 
ATOM   1708 C  CB  . ARG A  1 224 ? 19.657  -1.462  22.402  1.00 49.04  ? 224  ARG A CB  1 
ATOM   1709 C  CG  . ARG A  1 224 ? 18.788  -2.700  22.328  1.00 49.55  ? 224  ARG A CG  1 
ATOM   1710 C  CD  . ARG A  1 224 ? 17.448  -2.494  23.006  1.00 54.80  ? 224  ARG A CD  1 
ATOM   1711 N  NE  . ARG A  1 224 ? 17.589  -2.306  24.444  1.00 66.32  ? 224  ARG A NE  1 
ATOM   1712 C  CZ  . ARG A  1 224 ? 17.758  -3.298  25.314  1.00 69.56  ? 224  ARG A CZ  1 
ATOM   1713 N  NH1 . ARG A  1 224 ? 17.813  -4.555  24.897  1.00 71.58  ? 224  ARG A NH1 1 
ATOM   1714 N  NH2 . ARG A  1 224 ? 17.878  -3.031  26.605  1.00 70.43  ? 224  ARG A NH2 1 
ATOM   1715 N  N   . ALA A  1 225 ? 21.343  0.046   20.293  1.00 41.10  ? 225  ALA A N   1 
ATOM   1716 C  CA  . ALA A  1 225 ? 22.001  1.184   19.655  1.00 40.65  ? 225  ALA A CA  1 
ATOM   1717 C  C   . ALA A  1 225 ? 21.034  2.087   18.894  1.00 39.35  ? 225  ALA A C   1 
ATOM   1718 O  O   . ALA A  1 225 ? 20.106  1.605   18.241  1.00 39.95  ? 225  ALA A O   1 
ATOM   1719 C  CB  . ALA A  1 225 ? 23.099  0.692   18.719  1.00 36.81  ? 225  ALA A CB  1 
ATOM   1720 N  N   . VAL A  1 226 ? 21.266  3.397   18.981  1.00 34.33  ? 226  VAL A N   1 
ATOM   1721 C  CA  . VAL A  1 226 ? 20.523  4.383   18.195  1.00 40.89  ? 226  VAL A CA  1 
ATOM   1722 C  C   . VAL A  1 226 ? 21.501  5.249   17.403  1.00 39.40  ? 226  VAL A C   1 
ATOM   1723 O  O   . VAL A  1 226 ? 22.442  5.808   17.972  1.00 35.11  ? 226  VAL A O   1 
ATOM   1724 C  CB  . VAL A  1 226 ? 19.669  5.298   19.090  1.00 44.04  ? 226  VAL A CB  1 
ATOM   1725 C  CG1 . VAL A  1 226 ? 18.886  6.295   18.245  1.00 40.08  ? 226  VAL A CG1 1 
ATOM   1726 C  CG2 . VAL A  1 226 ? 18.734  4.478   19.954  1.00 35.59  ? 226  VAL A CG2 1 
ATOM   1727 N  N   . LEU A  1 227 ? 21.280  5.358   16.095  1.00 36.63  ? 227  LEU A N   1 
ATOM   1728 C  CA  . LEU A  1 227 ? 22.171  6.125   15.225  1.00 35.04  ? 227  LEU A CA  1 
ATOM   1729 C  C   . LEU A  1 227 ? 21.433  7.267   14.531  1.00 34.79  ? 227  LEU A C   1 
ATOM   1730 O  O   . LEU A  1 227 ? 20.654  7.039   13.599  1.00 35.11  ? 227  LEU A O   1 
ATOM   1731 C  CB  . LEU A  1 227 ? 22.827  5.219   14.173  1.00 36.60  ? 227  LEU A CB  1 
ATOM   1732 C  CG  . LEU A  1 227 ? 23.896  4.219   14.632  1.00 37.66  ? 227  LEU A CG  1 
ATOM   1733 C  CD1 . LEU A  1 227 ? 23.281  3.002   15.302  1.00 31.82  ? 227  LEU A CD1 1 
ATOM   1734 C  CD2 . LEU A  1 227 ? 24.773  3.794   13.466  1.00 32.24  ? 227  LEU A CD2 1 
ATOM   1735 N  N   . GLN A  1 228 ? 21.687  8.494   14.977  1.00 35.94  ? 228  GLN A N   1 
ATOM   1736 C  CA  . GLN A  1 228 ? 20.992  9.663   14.443  1.00 33.84  ? 228  GLN A CA  1 
ATOM   1737 C  C   . GLN A  1 228 ? 21.854  10.419  13.434  1.00 40.08  ? 228  GLN A C   1 
ATOM   1738 O  O   . GLN A  1 228 ? 22.861  11.026  13.801  1.00 36.17  ? 228  GLN A O   1 
ATOM   1739 C  CB  . GLN A  1 228 ? 20.579  10.600  15.585  1.00 28.49  ? 228  GLN A CB  1 
ATOM   1740 C  CG  . GLN A  1 228 ? 19.859  9.891   16.728  1.00 33.27  ? 228  GLN A CG  1 
ATOM   1741 C  CD  . GLN A  1 228 ? 19.507  10.810  17.884  1.00 32.85  ? 228  GLN A CD  1 
ATOM   1742 O  OE1 . GLN A  1 228 ? 19.147  10.348  18.966  1.00 37.93  ? 228  GLN A OE1 1 
ATOM   1743 N  NE2 . GLN A  1 228 ? 19.605  12.117  17.661  1.00 27.05  ? 228  GLN A NE2 1 
ATOM   1744 N  N   . SER A  1 229 ? 21.452  10.369  12.166  1.00 35.81  ? 229  SER A N   1 
ATOM   1745 C  CA  . SER A  1 229 ? 22.121  11.110  11.100  1.00 23.85  ? 229  SER A CA  1 
ATOM   1746 C  C   . SER A  1 229 ? 23.622  10.840  11.021  1.00 30.11  ? 229  SER A C   1 
ATOM   1747 O  O   . SER A  1 229 ? 24.424  11.774  10.921  1.00 28.33  ? 229  SER A O   1 
ATOM   1748 C  CB  . SER A  1 229 ? 21.871  12.610  11.263  1.00 20.96  ? 229  SER A CB  1 
ATOM   1749 O  OG  . SER A  1 229 ? 20.488  12.872  11.430  1.00 32.06  ? 229  SER A OG  1 
ATOM   1750 N  N   . GLY A  1 230 ? 24.001  9.566   11.063  1.00 27.55  ? 230  GLY A N   1 
ATOM   1751 C  CA  . GLY A  1 230 ? 25.404  9.201   10.983  1.00 21.50  ? 230  GLY A CA  1 
ATOM   1752 C  C   . GLY A  1 230 ? 25.619  7.701   10.938  1.00 27.56  ? 230  GLY A C   1 
ATOM   1753 O  O   . GLY A  1 230 ? 24.848  6.933   11.518  1.00 29.30  ? 230  GLY A O   1 
ATOM   1754 N  N   . THR A  1 231 ? 26.683  7.287   10.254  1.00 29.43  ? 231  THR A N   1 
ATOM   1755 C  CA  . THR A  1 231 ? 26.969  5.874   10.027  1.00 35.16  ? 231  THR A CA  1 
ATOM   1756 C  C   . THR A  1 231 ? 28.469  5.630   10.031  1.00 31.45  ? 231  THR A C   1 
ATOM   1757 O  O   . THR A  1 231 ? 29.240  6.503   9.628   1.00 34.48  ? 231  THR A O   1 
ATOM   1758 C  CB  . THR A  1 231 ? 26.441  5.415   8.652   1.00 40.18  ? 231  THR A CB  1 
ATOM   1759 O  OG1 . THR A  1 231 ? 26.897  6.324   7.640   1.00 33.95  ? 231  THR A OG1 1 
ATOM   1760 C  CG2 . THR A  1 231 ? 24.925  5.359   8.639   1.00 30.81  ? 231  THR A CG2 1 
ATOM   1761 N  N   . PRO A  1 232 ? 28.892  4.435   10.476  1.00 35.03  ? 232  PRO A N   1 
ATOM   1762 C  CA  . PRO A  1 232 ? 30.318  4.102   10.408  1.00 32.58  ? 232  PRO A CA  1 
ATOM   1763 C  C   . PRO A  1 232 ? 30.732  3.900   8.958   1.00 38.89  ? 232  PRO A C   1 
ATOM   1764 O  O   . PRO A  1 232 ? 31.876  4.175   8.596   1.00 39.25  ? 232  PRO A O   1 
ATOM   1765 C  CB  . PRO A  1 232 ? 30.407  2.783   11.181  1.00 27.21  ? 232  PRO A CB  1 
ATOM   1766 C  CG  . PRO A  1 232 ? 29.035  2.174   11.057  1.00 27.78  ? 232  PRO A CG  1 
ATOM   1767 C  CD  . PRO A  1 232 ? 28.090  3.347   11.070  1.00 33.19  ? 232  PRO A CD  1 
ATOM   1768 N  N   . ASN A  1 233 ? 29.803  3.416   8.139   1.00 41.72  ? 233  ASN A N   1 
ATOM   1769 C  CA  . ASN A  1 233 ? 30.022  3.344   6.702   1.00 43.55  ? 233  ASN A CA  1 
ATOM   1770 C  C   . ASN A  1 233 ? 29.815  4.725   6.086   1.00 42.84  ? 233  ASN A C   1 
ATOM   1771 O  O   . ASN A  1 233 ? 29.214  5.603   6.714   1.00 37.20  ? 233  ASN A O   1 
ATOM   1772 C  CB  . ASN A  1 233 ? 29.082  2.312   6.067   1.00 38.10  ? 233  ASN A CB  1 
ATOM   1773 C  CG  . ASN A  1 233 ? 27.615  2.607   6.344   1.00 41.42  ? 233  ASN A CG  1 
ATOM   1774 O  OD1 . ASN A  1 233 ? 27.154  2.511   7.482   1.00 43.97  ? 233  ASN A OD1 1 
ATOM   1775 N  ND2 . ASN A  1 233 ? 26.870  2.950   5.296   1.00 34.38  ? 233  ASN A ND2 1 
ATOM   1776 N  N   . GLY A  1 234 ? 30.322  4.929   4.872   1.00 36.87  ? 234  GLY A N   1 
ATOM   1777 C  CA  . GLY A  1 234 ? 30.190  6.219   4.214   1.00 33.06  ? 234  GLY A CA  1 
ATOM   1778 C  C   . GLY A  1 234 ? 31.504  6.915   3.905   1.00 41.50  ? 234  GLY A C   1 
ATOM   1779 O  O   . GLY A  1 234 ? 32.575  6.403   4.234   1.00 49.77  ? 234  GLY A O   1 
ATOM   1780 N  N   . PRO A  1 235 ? 31.423  8.102   3.280   1.00 40.55  ? 235  PRO A N   1 
ATOM   1781 C  CA  . PRO A  1 235 ? 32.573  8.828   2.723   1.00 37.21  ? 235  PRO A CA  1 
ATOM   1782 C  C   . PRO A  1 235 ? 33.418  9.639   3.716   1.00 37.95  ? 235  PRO A C   1 
ATOM   1783 O  O   . PRO A  1 235 ? 34.575  9.919   3.399   1.00 38.53  ? 235  PRO A O   1 
ATOM   1784 C  CB  . PRO A  1 235 ? 31.922  9.765   1.695   1.00 29.89  ? 235  PRO A CB  1 
ATOM   1785 C  CG  . PRO A  1 235 ? 30.538  10.002  2.220   1.00 33.91  ? 235  PRO A CG  1 
ATOM   1786 C  CD  . PRO A  1 235 ? 30.136  8.743   2.942   1.00 37.95  ? 235  PRO A CD  1 
ATOM   1787 N  N   . TRP A  1 236 ? 32.870  10.003  4.875   1.00 39.91  ? 236  TRP A N   1 
ATOM   1788 C  CA  . TRP A  1 236 ? 33.574  10.894  5.810   1.00 38.43  ? 236  TRP A CA  1 
ATOM   1789 C  C   . TRP A  1 236 ? 33.995  10.255  7.138   1.00 33.92  ? 236  TRP A C   1 
ATOM   1790 O  O   . TRP A  1 236 ? 34.887  10.760  7.817   1.00 33.09  ? 236  TRP A O   1 
ATOM   1791 C  CB  . TRP A  1 236 ? 32.718  12.132  6.106   1.00 30.34  ? 236  TRP A CB  1 
ATOM   1792 C  CG  . TRP A  1 236 ? 31.367  11.794  6.653   1.00 34.47  ? 236  TRP A CG  1 
ATOM   1793 C  CD1 . TRP A  1 236 ? 30.219  11.634  5.943   1.00 38.46  ? 236  TRP A CD1 1 
ATOM   1794 C  CD2 . TRP A  1 236 ? 31.025  11.572  8.027   1.00 38.24  ? 236  TRP A CD2 1 
ATOM   1795 N  NE1 . TRP A  1 236 ? 29.180  11.327  6.787   1.00 43.46  ? 236  TRP A NE1 1 
ATOM   1796 C  CE2 . TRP A  1 236 ? 29.648  11.283  8.072   1.00 40.37  ? 236  TRP A CE2 1 
ATOM   1797 C  CE3 . TRP A  1 236 ? 31.748  11.594  9.222   1.00 38.05  ? 236  TRP A CE3 1 
ATOM   1798 C  CZ2 . TRP A  1 236 ? 28.981  11.014  9.268   1.00 42.85  ? 236  TRP A CZ2 1 
ATOM   1799 C  CZ3 . TRP A  1 236 ? 31.085  11.327  10.406  1.00 39.88  ? 236  TRP A CZ3 1 
ATOM   1800 C  CH2 . TRP A  1 236 ? 29.716  11.041  10.421  1.00 38.90  ? 236  TRP A CH2 1 
ATOM   1801 N  N   . ALA A  1 237 ? 33.349  9.156   7.510   1.00 34.33  ? 237  ALA A N   1 
ATOM   1802 C  CA  . ALA A  1 237 ? 33.523  8.582   8.848   1.00 40.86  ? 237  ALA A CA  1 
ATOM   1803 C  C   . ALA A  1 237 ? 34.865  7.877   9.085   1.00 44.88  ? 237  ALA A C   1 
ATOM   1804 O  O   . ALA A  1 237 ? 35.353  7.845   10.216  1.00 44.29  ? 237  ALA A O   1 
ATOM   1805 C  CB  . ALA A  1 237 ? 32.361  7.654   9.182   1.00 25.70  ? 237  ALA A CB  1 
ATOM   1806 N  N   . THR A  1 238 ? 35.446  7.304   8.031   1.00 33.43  ? 238  THR A N   1 
ATOM   1807 C  CA  . THR A  1 238 ? 36.753  6.646   8.132   1.00 36.56  ? 238  THR A CA  1 
ATOM   1808 C  C   . THR A  1 238 ? 37.740  7.087   7.054   1.00 37.54  ? 238  THR A C   1 
ATOM   1809 O  O   . THR A  1 238 ? 37.354  7.666   6.039   1.00 46.29  ? 238  THR A O   1 
ATOM   1810 C  CB  . THR A  1 238 ? 36.640  5.110   8.042   1.00 34.60  ? 238  THR A CB  1 
ATOM   1811 O  OG1 . THR A  1 238 ? 35.886  4.747   6.878   1.00 46.21  ? 238  THR A OG1 1 
ATOM   1812 C  CG2 . THR A  1 238 ? 35.968  4.544   9.276   1.00 36.73  ? 238  THR A CG2 1 
ATOM   1813 N  N   . VAL A  1 239 ? 39.019  6.806   7.291   1.00 34.88  ? 239  VAL A N   1 
ATOM   1814 C  CA  . VAL A  1 239 ? 40.057  6.933   6.269   1.00 37.03  ? 239  VAL A CA  1 
ATOM   1815 C  C   . VAL A  1 239 ? 40.908  5.665   6.294   1.00 46.61  ? 239  VAL A C   1 
ATOM   1816 O  O   . VAL A  1 239 ? 40.908  4.937   7.287   1.00 46.88  ? 239  VAL A O   1 
ATOM   1817 C  CB  . VAL A  1 239 ? 40.961  8.171   6.492   1.00 31.14  ? 239  VAL A CB  1 
ATOM   1818 C  CG1 . VAL A  1 239 ? 40.191  9.453   6.228   1.00 24.01  ? 239  VAL A CG1 1 
ATOM   1819 C  CG2 . VAL A  1 239 ? 41.552  8.169   7.905   1.00 32.59  ? 239  VAL A CG2 1 
ATOM   1820 N  N   . SER A  1 240 ? 41.619  5.391   5.205   1.00 46.99  ? 240  SER A N   1 
ATOM   1821 C  CA  . SER A  1 240 ? 42.508  4.234   5.150   1.00 43.96  ? 240  SER A CA  1 
ATOM   1822 C  C   . SER A  1 240 ? 43.753  4.490   5.985   1.00 38.85  ? 240  SER A C   1 
ATOM   1823 O  O   . SER A  1 240 ? 44.030  5.628   6.363   1.00 39.23  ? 240  SER A O   1 
ATOM   1824 C  CB  . SER A  1 240 ? 42.921  3.948   3.708   1.00 35.89  ? 240  SER A CB  1 
ATOM   1825 O  OG  . SER A  1 240 ? 43.643  5.044   3.171   1.00 40.15  ? 240  SER A OG  1 
ATOM   1826 N  N   . ALA A  1 241 ? 44.505  3.432   6.269   1.00 37.43  ? 241  ALA A N   1 
ATOM   1827 C  CA  . ALA A  1 241 ? 45.771  3.574   6.980   1.00 38.75  ? 241  ALA A CA  1 
ATOM   1828 C  C   . ALA A  1 241 ? 46.736  4.451   6.188   1.00 41.79  ? 241  ALA A C   1 
ATOM   1829 O  O   . ALA A  1 241 ? 47.434  5.294   6.754   1.00 37.69  ? 241  ALA A O   1 
ATOM   1830 C  CB  . ALA A  1 241 ? 46.384  2.210   7.245   1.00 36.20  ? 241  ALA A CB  1 
ATOM   1831 N  N   . GLY A  1 242 ? 46.770  4.242   4.875   1.00 40.83  ? 242  GLY A N   1 
ATOM   1832 C  CA  . GLY A  1 242 ? 47.620  5.028   4.002   1.00 35.64  ? 242  GLY A CA  1 
ATOM   1833 C  C   . GLY A  1 242 ? 47.266  6.502   4.004   1.00 34.50  ? 242  GLY A C   1 
ATOM   1834 O  O   . GLY A  1 242 ? 48.153  7.360   4.009   1.00 39.99  ? 242  GLY A O   1 
ATOM   1835 N  N   . GLU A  1 243 ? 45.971  6.805   3.999   1.00 29.47  ? 243  GLU A N   1 
ATOM   1836 C  CA  . GLU A  1 243 ? 45.533  8.198   4.000   1.00 32.82  ? 243  GLU A CA  1 
ATOM   1837 C  C   . GLU A  1 243 ? 45.766  8.854   5.359   1.00 37.73  ? 243  GLU A C   1 
ATOM   1838 O  O   . GLU A  1 243 ? 46.155  10.022  5.437   1.00 39.74  ? 243  GLU A O   1 
ATOM   1839 C  CB  . GLU A  1 243 ? 44.065  8.314   3.568   1.00 35.01  ? 243  GLU A CB  1 
ATOM   1840 C  CG  . GLU A  1 243 ? 43.502  9.742   3.562   1.00 35.74  ? 243  GLU A CG  1 
ATOM   1841 C  CD  . GLU A  1 243 ? 44.180  10.668  2.560   1.00 42.10  ? 243  GLU A CD  1 
ATOM   1842 O  OE1 . GLU A  1 243 ? 45.000  10.198  1.741   1.00 42.82  ? 243  GLU A OE1 1 
ATOM   1843 O  OE2 . GLU A  1 243 ? 43.884  11.882  2.589   1.00 43.51  ? 243  GLU A OE2 1 
ATOM   1844 N  N   . ALA A  1 244 ? 45.541  8.098   6.428   1.00 42.84  ? 244  ALA A N   1 
ATOM   1845 C  CA  . ALA A  1 244 ? 45.766  8.613   7.774   1.00 39.65  ? 244  ALA A CA  1 
ATOM   1846 C  C   . ALA A  1 244 ? 47.246  8.915   8.005   1.00 38.07  ? 244  ALA A C   1 
ATOM   1847 O  O   . ALA A  1 244 ? 47.594  9.956   8.570   1.00 34.93  ? 244  ALA A O   1 
ATOM   1848 C  CB  . ALA A  1 244 ? 45.243  7.637   8.817   1.00 35.51  ? 244  ALA A CB  1 
ATOM   1849 N  N   . ARG A  1 245 ? 48.110  7.998   7.575   1.00 36.85  ? 245  ARG A N   1 
ATOM   1850 C  CA  . ARG A  1 245 ? 49.554  8.200   7.645   1.00 40.69  ? 245  ARG A CA  1 
ATOM   1851 C  C   . ARG A  1 245 ? 49.945  9.449   6.869   1.00 47.05  ? 245  ARG A C   1 
ATOM   1852 O  O   . ARG A  1 245 ? 50.706  10.286  7.356   1.00 50.04  ? 245  ARG A O   1 
ATOM   1853 C  CB  . ARG A  1 245 ? 50.300  6.976   7.092   1.00 36.64  ? 245  ARG A CB  1 
ATOM   1854 C  CG  . ARG A  1 245 ? 51.792  7.212   6.829   1.00 34.95  ? 245  ARG A CG  1 
ATOM   1855 C  CD  . ARG A  1 245 ? 52.559  5.903   6.638   1.00 35.84  ? 245  ARG A CD  1 
ATOM   1856 N  NE  . ARG A  1 245 ? 52.439  5.034   7.806   1.00 45.26  ? 245  ARG A NE  1 
ATOM   1857 C  CZ  . ARG A  1 245 ? 53.246  5.081   8.862   1.00 48.41  ? 245  ARG A CZ  1 
ATOM   1858 N  NH1 . ARG A  1 245 ? 54.242  5.954   8.906   1.00 47.95  ? 245  ARG A NH1 1 
ATOM   1859 N  NH2 . ARG A  1 245 ? 53.057  4.256   9.880   1.00 57.28  ? 245  ARG A NH2 1 
ATOM   1860 N  N   . ARG A  1 246 ? 49.399  9.568   5.663   1.00 46.24  ? 246  ARG A N   1 
ATOM   1861 C  CA  . ARG A  1 246 ? 49.669  10.702  4.788   1.00 45.76  ? 246  ARG A CA  1 
ATOM   1862 C  C   . ARG A  1 246 ? 49.321  12.035  5.450   1.00 44.05  ? 246  ARG A C   1 
ATOM   1863 O  O   . ARG A  1 246 ? 50.125  12.971  5.438   1.00 37.18  ? 246  ARG A O   1 
ATOM   1864 C  CB  . ARG A  1 246 ? 48.892  10.552  3.478   1.00 45.51  ? 246  ARG A CB  1 
ATOM   1865 C  CG  . ARG A  1 246 ? 49.308  11.540  2.403   1.00 44.77  ? 246  ARG A CG  1 
ATOM   1866 C  CD  . ARG A  1 246 ? 48.138  11.937  1.523   1.00 47.67  ? 246  ARG A CD  1 
ATOM   1867 N  NE  . ARG A  1 246 ? 47.988  13.388  1.485   1.00 48.89  ? 246  ARG A NE  1 
ATOM   1868 C  CZ  . ARG A  1 246 ? 46.891  14.036  1.857   1.00 42.18  ? 246  ARG A CZ  1 
ATOM   1869 N  NH1 . ARG A  1 246 ? 45.833  13.362  2.281   1.00 33.21  ? 246  ARG A NH1 1 
ATOM   1870 N  NH2 . ARG A  1 246 ? 46.848  15.358  1.793   1.00 51.11  ? 246  ARG A NH2 1 
ATOM   1871 N  N   . ARG A  1 247 ? 48.125  12.117  6.029   1.00 45.70  ? 247  ARG A N   1 
ATOM   1872 C  CA  . ARG A  1 247 ? 47.677  13.340  6.689   1.00 41.32  ? 247  ARG A CA  1 
ATOM   1873 C  C   . ARG A  1 247 ? 48.482  13.627  7.957   1.00 41.23  ? 247  ARG A C   1 
ATOM   1874 O  O   . ARG A  1 247 ? 48.652  14.781  8.350   1.00 37.90  ? 247  ARG A O   1 
ATOM   1875 C  CB  . ARG A  1 247 ? 46.186  13.253  7.036   1.00 35.61  ? 247  ARG A CB  1 
ATOM   1876 C  CG  . ARG A  1 247 ? 45.246  13.084  5.845   1.00 33.88  ? 247  ARG A CG  1 
ATOM   1877 C  CD  . ARG A  1 247 ? 43.802  12.923  6.321   1.00 33.39  ? 247  ARG A CD  1 
ATOM   1878 N  NE  . ARG A  1 247 ? 42.861  12.746  5.216   1.00 36.14  ? 247  ARG A NE  1 
ATOM   1879 C  CZ  . ARG A  1 247 ? 41.539  12.799  5.342   1.00 39.67  ? 247  ARG A CZ  1 
ATOM   1880 N  NH1 . ARG A  1 247 ? 40.991  13.029  6.528   1.00 37.35  ? 247  ARG A NH1 1 
ATOM   1881 N  NH2 . ARG A  1 247 ? 40.765  12.628  4.281   1.00 30.36  ? 247  ARG A NH2 1 
ATOM   1882 N  N   . ALA A  1 248 ? 48.978  12.574  8.595   1.00 38.57  ? 248  ALA A N   1 
ATOM   1883 C  CA  . ALA A  1 248 ? 49.726  12.726  9.837   1.00 37.61  ? 248  ALA A CA  1 
ATOM   1884 C  C   . ALA A  1 248 ? 51.109  13.332  9.614   1.00 43.83  ? 248  ALA A C   1 
ATOM   1885 O  O   . ALA A  1 248 ? 51.505  14.249  10.335  1.00 45.61  ? 248  ALA A O   1 
ATOM   1886 C  CB  . ALA A  1 248 ? 49.834  11.395  10.562  1.00 32.41  ? 248  ALA A CB  1 
ATOM   1887 N  N   . THR A  1 249 ? 51.847  12.823  8.628   1.00 43.38  ? 249  THR A N   1 
ATOM   1888 C  CA  . THR A  1 249 ? 53.184  13.350  8.359   1.00 46.03  ? 249  THR A CA  1 
ATOM   1889 C  C   . THR A  1 249 ? 53.121  14.742  7.742   1.00 39.87  ? 249  THR A C   1 
ATOM   1890 O  O   . THR A  1 249 ? 54.048  15.539  7.905   1.00 47.38  ? 249  THR A O   1 
ATOM   1891 C  CB  . THR A  1 249 ? 54.045  12.419  7.460   1.00 48.12  ? 249  THR A CB  1 
ATOM   1892 O  OG1 . THR A  1 249 ? 53.846  12.744  6.080   1.00 60.98  ? 249  THR A OG1 1 
ATOM   1893 C  CG2 . THR A  1 249 ? 53.711  10.959  7.702   1.00 42.13  ? 249  THR A CG2 1 
ATOM   1894 N  N   . LEU A  1 250 ? 52.032  15.035  7.036   1.00 38.25  ? 250  LEU A N   1 
ATOM   1895 C  CA  . LEU A  1 250 ? 51.848  16.363  6.454   1.00 39.28  ? 250  LEU A CA  1 
ATOM   1896 C  C   . LEU A  1 250 ? 51.639  17.395  7.558   1.00 42.49  ? 250  LEU A C   1 
ATOM   1897 O  O   . LEU A  1 250 ? 52.269  18.455  7.552   1.00 44.89  ? 250  LEU A O   1 
ATOM   1898 C  CB  . LEU A  1 250 ? 50.678  16.389  5.462   1.00 30.80  ? 250  LEU A CB  1 
ATOM   1899 C  CG  . LEU A  1 250 ? 50.381  17.771  4.863   1.00 37.20  ? 250  LEU A CG  1 
ATOM   1900 C  CD1 . LEU A  1 250 ? 51.656  18.398  4.331   1.00 32.19  ? 250  LEU A CD1 1 
ATOM   1901 C  CD2 . LEU A  1 250 ? 49.327  17.719  3.764   1.00 30.66  ? 250  LEU A CD2 1 
ATOM   1902 N  N   . LEU A  1 251 ? 50.758  17.084  8.507   1.00 41.59  ? 251  LEU A N   1 
ATOM   1903 C  CA  . LEU A  1 251 ? 50.538  17.971  9.645   1.00 42.10  ? 251  LEU A CA  1 
ATOM   1904 C  C   . LEU A  1 251 ? 51.837  18.190  10.409  1.00 38.25  ? 251  LEU A C   1 
ATOM   1905 O  O   . LEU A  1 251 ? 52.125  19.300  10.856  1.00 40.66  ? 251  LEU A O   1 
ATOM   1906 C  CB  . LEU A  1 251 ? 49.473  17.417  10.591  1.00 43.00  ? 251  LEU A CB  1 
ATOM   1907 C  CG  . LEU A  1 251 ? 49.270  18.316  11.816  1.00 43.98  ? 251  LEU A CG  1 
ATOM   1908 C  CD1 . LEU A  1 251 ? 48.205  19.377  11.568  1.00 35.22  ? 251  LEU A CD1 1 
ATOM   1909 C  CD2 . LEU A  1 251 ? 48.956  17.505  13.053  1.00 43.81  ? 251  LEU A CD2 1 
ATOM   1910 N  N   . ALA A  1 252 ? 52.621  17.126  10.550  1.00 34.37  ? 252  ALA A N   1 
ATOM   1911 C  CA  . ALA A  1 252 ? 53.933  17.222  11.182  1.00 39.95  ? 252  ALA A CA  1 
ATOM   1912 C  C   . ALA A  1 252 ? 54.818  18.256  10.484  1.00 43.97  ? 252  ALA A C   1 
ATOM   1913 O  O   . ALA A  1 252 ? 55.415  19.110  11.141  1.00 40.83  ? 252  ALA A O   1 
ATOM   1914 C  CB  . ALA A  1 252 ? 54.612  15.866  11.197  1.00 34.94  ? 252  ALA A CB  1 
ATOM   1915 N  N   . ARG A  1 253 ? 54.907  18.168  9.159   1.00 44.57  ? 253  ARG A N   1 
ATOM   1916 C  CA  . ARG A  1 253 ? 55.672  19.137  8.381   1.00 47.22  ? 253  ARG A CA  1 
ATOM   1917 C  C   . ARG A  1 253 ? 55.183  20.560  8.644   1.00 44.63  ? 253  ARG A C   1 
ATOM   1918 O  O   . ARG A  1 253 ? 55.980  21.467  8.884   1.00 47.87  ? 253  ARG A O   1 
ATOM   1919 C  CB  . ARG A  1 253 ? 55.572  18.836  6.878   1.00 45.74  ? 253  ARG A CB  1 
ATOM   1920 C  CG  . ARG A  1 253 ? 56.247  17.547  6.427   1.00 59.34  ? 253  ARG A CG  1 
ATOM   1921 C  CD  . ARG A  1 253 ? 56.324  17.468  4.900   1.00 75.35  ? 253  ARG A CD  1 
ATOM   1922 N  NE  . ARG A  1 253 ? 56.860  16.191  4.423   1.00 84.54  ? 253  ARG A NE  1 
ATOM   1923 C  CZ  . ARG A  1 253 ? 56.113  15.177  3.993   1.00 84.62  ? 253  ARG A CZ  1 
ATOM   1924 N  NH1 . ARG A  1 253 ? 54.790  15.283  3.973   1.00 77.16  ? 253  ARG A NH1 1 
ATOM   1925 N  NH2 . ARG A  1 253 ? 56.688  14.056  3.576   1.00 81.25  ? 253  ARG A NH2 1 
ATOM   1926 N  N   . LEU A  1 254 ? 53.866  20.738  8.610   1.00 38.73  ? 254  LEU A N   1 
ATOM   1927 C  CA  . LEU A  1 254 ? 53.252  22.057  8.755   1.00 40.94  ? 254  LEU A CA  1 
ATOM   1928 C  C   . LEU A  1 254 ? 53.533  22.728  10.103  1.00 48.58  ? 254  LEU A C   1 
ATOM   1929 O  O   . LEU A  1 254 ? 53.387  23.943  10.231  1.00 49.10  ? 254  LEU A O   1 
ATOM   1930 C  CB  . LEU A  1 254 ? 51.740  21.972  8.509   1.00 34.92  ? 254  LEU A CB  1 
ATOM   1931 C  CG  . LEU A  1 254 ? 51.285  21.485  7.128   1.00 43.41  ? 254  LEU A CG  1 
ATOM   1932 C  CD1 . LEU A  1 254 ? 49.767  21.424  7.028   1.00 40.77  ? 254  LEU A CD1 1 
ATOM   1933 C  CD2 . LEU A  1 254 ? 51.852  22.366  6.027   1.00 39.91  ? 254  LEU A CD2 1 
ATOM   1934 N  N   . VAL A  1 255 ? 53.940  21.946  11.102  1.00 46.55  ? 255  VAL A N   1 
ATOM   1935 C  CA  . VAL A  1 255 ? 54.216  22.504  12.425  1.00 54.40  ? 255  VAL A CA  1 
ATOM   1936 C  C   . VAL A  1 255 ? 55.705  22.487  12.789  1.00 62.89  ? 255  VAL A C   1 
ATOM   1937 O  O   . VAL A  1 255 ? 56.124  23.137  13.751  1.00 71.60  ? 255  VAL A O   1 
ATOM   1938 C  CB  . VAL A  1 255 ? 53.372  21.821  13.538  1.00 44.67  ? 255  VAL A CB  1 
ATOM   1939 C  CG1 . VAL A  1 255 ? 51.894  22.048  13.294  1.00 40.98  ? 255  VAL A CG1 1 
ATOM   1940 C  CG2 . VAL A  1 255 ? 53.671  20.333  13.619  1.00 39.08  ? 255  VAL A CG2 1 
ATOM   1941 N  N   . GLY A  1 256 ? 56.501  21.748  12.018  1.00 57.70  ? 256  GLY A N   1 
ATOM   1942 C  CA  . GLY A  1 256 ? 57.941  21.729  12.217  1.00 57.38  ? 256  GLY A CA  1 
ATOM   1943 C  C   . GLY A  1 256 ? 58.557  20.367  12.483  1.00 61.63  ? 256  GLY A C   1 
ATOM   1944 O  O   . GLY A  1 256 ? 59.722  20.277  12.868  1.00 67.48  ? 256  GLY A O   1 
ATOM   1945 N  N   . CYS A  1 257 ? 57.787  19.305  12.267  1.00 62.97  ? 257  CYS A N   1 
ATOM   1946 C  CA  . CYS A  1 257 ? 58.259  17.956  12.556  1.00 61.18  ? 257  CYS A CA  1 
ATOM   1947 C  C   . CYS A  1 257 ? 58.248  17.083  11.308  1.00 60.76  ? 257  CYS A C   1 
ATOM   1948 O  O   . CYS A  1 257 ? 59.301  16.700  10.804  1.00 68.99  ? 257  CYS A O   1 
ATOM   1949 C  CB  . CYS A  1 257 ? 57.399  17.315  13.644  1.00 64.71  ? 257  CYS A CB  1 
ATOM   1950 S  SG  . CYS A  1 257 ? 57.169  18.340  15.108  1.00 67.55  ? 257  CYS A SG  1 
ATOM   1951 N  N   . ASN A  1 265 ? 61.346  7.258   10.404  1.00 76.25  ? 265  ASN A N   1 
ATOM   1952 C  CA  . ASN A  1 265 ? 61.116  6.807   11.772  1.00 76.20  ? 265  ASN A CA  1 
ATOM   1953 C  C   . ASN A  1 265 ? 59.907  7.484   12.419  1.00 71.94  ? 265  ASN A C   1 
ATOM   1954 O  O   . ASN A  1 265 ? 59.897  8.700   12.618  1.00 72.15  ? 265  ASN A O   1 
ATOM   1955 C  CB  . ASN A  1 265 ? 62.373  7.026   12.619  1.00 80.66  ? 265  ASN A CB  1 
ATOM   1956 C  CG  . ASN A  1 265 ? 62.162  6.674   14.074  1.00 84.12  ? 265  ASN A CG  1 
ATOM   1957 O  OD1 . ASN A  1 265 ? 61.998  7.555   14.917  1.00 83.75  ? 265  ASN A OD1 1 
ATOM   1958 N  ND2 . ASN A  1 265 ? 62.163  5.382   14.378  1.00 83.05  ? 265  ASN A ND2 1 
ATOM   1959 N  N   . ASP A  1 266 ? 58.890  6.690   12.742  1.00 63.78  ? 266  ASP A N   1 
ATOM   1960 C  CA  . ASP A  1 266 ? 57.665  7.214   13.343  1.00 63.15  ? 266  ASP A CA  1 
ATOM   1961 C  C   . ASP A  1 266 ? 57.888  7.748   14.761  1.00 61.42  ? 266  ASP A C   1 
ATOM   1962 O  O   . ASP A  1 266 ? 57.235  8.705   15.178  1.00 58.26  ? 266  ASP A O   1 
ATOM   1963 C  CB  . ASP A  1 266 ? 56.565  6.143   13.356  1.00 62.61  ? 266  ASP A CB  1 
ATOM   1964 C  CG  . ASP A  1 266 ? 56.000  5.856   11.974  1.00 64.33  ? 266  ASP A CG  1 
ATOM   1965 O  OD1 . ASP A  1 266 ? 56.195  6.678   11.054  1.00 67.31  ? 266  ASP A OD1 1 
ATOM   1966 O  OD2 . ASP A  1 266 ? 55.344  4.804   11.814  1.00 62.14  ? 266  ASP A OD2 1 
ATOM   1967 N  N   . THR A  1 267 ? 58.810  7.128   15.493  1.00 60.96  ? 267  THR A N   1 
ATOM   1968 C  CA  . THR A  1 267 ? 59.078  7.500   16.883  1.00 53.37  ? 267  THR A CA  1 
ATOM   1969 C  C   . THR A  1 267 ? 59.549  8.946   17.030  1.00 49.22  ? 267  THR A C   1 
ATOM   1970 O  O   . THR A  1 267 ? 59.014  9.702   17.843  1.00 55.22  ? 267  THR A O   1 
ATOM   1971 C  CB  . THR A  1 267 ? 60.120  6.557   17.527  1.00 57.75  ? 267  THR A CB  1 
ATOM   1972 O  OG1 . THR A  1 267 ? 59.580  5.232   17.615  1.00 63.96  ? 267  THR A OG1 1 
ATOM   1973 C  CG2 . THR A  1 267 ? 60.482  7.034   18.921  1.00 55.74  ? 267  THR A CG2 1 
ATOM   1974 N  N   . GLU A  1 268 ? 60.545  9.324   16.236  1.00 53.65  ? 268  GLU A N   1 
ATOM   1975 C  CA  . GLU A  1 268 ? 61.116  10.666  16.289  1.00 57.39  ? 268  GLU A CA  1 
ATOM   1976 C  C   . GLU A  1 268 ? 60.115  11.729  15.841  1.00 59.00  ? 268  GLU A C   1 
ATOM   1977 O  O   . GLU A  1 268 ? 60.173  12.877  16.286  1.00 63.36  ? 268  GLU A O   1 
ATOM   1978 C  CB  . GLU A  1 268 ? 62.375  10.733  15.418  1.00 46.95  ? 268  GLU A CB  1 
ATOM   1979 N  N   . LEU A  1 269 ? 59.198  11.335  14.961  1.00 57.85  ? 269  LEU A N   1 
ATOM   1980 C  CA  . LEU A  1 269 ? 58.190  12.242  14.412  1.00 51.53  ? 269  LEU A CA  1 
ATOM   1981 C  C   . LEU A  1 269 ? 57.109  12.568  15.445  1.00 52.36  ? 269  LEU A C   1 
ATOM   1982 O  O   . LEU A  1 269 ? 56.782  13.736  15.669  1.00 52.78  ? 269  LEU A O   1 
ATOM   1983 C  CB  . LEU A  1 269 ? 57.566  11.620  13.155  1.00 46.99  ? 269  LEU A CB  1 
ATOM   1984 C  CG  . LEU A  1 269 ? 56.685  12.471  12.233  1.00 50.76  ? 269  LEU A CG  1 
ATOM   1985 C  CD1 . LEU A  1 269 ? 56.744  11.931  10.821  1.00 53.38  ? 269  LEU A CD1 1 
ATOM   1986 C  CD2 . LEU A  1 269 ? 55.245  12.490  12.705  1.00 54.71  ? 269  LEU A CD2 1 
ATOM   1987 N  N   . ILE A  1 270 ? 56.557  11.525  16.061  1.00 52.86  ? 270  ILE A N   1 
ATOM   1988 C  CA  . ILE A  1 270 ? 55.521  11.668  17.082  1.00 46.31  ? 270  ILE A CA  1 
ATOM   1989 C  C   . ILE A  1 270 ? 56.084  12.362  18.318  1.00 45.08  ? 270  ILE A C   1 
ATOM   1990 O  O   . ILE A  1 270 ? 55.390  13.131  18.986  1.00 50.50  ? 270  ILE A O   1 
ATOM   1991 C  CB  . ILE A  1 270 ? 54.927  10.288  17.463  1.00 47.61  ? 270  ILE A CB  1 
ATOM   1992 C  CG1 . ILE A  1 270 ? 54.313  9.624   16.229  1.00 49.17  ? 270  ILE A CG1 1 
ATOM   1993 C  CG2 . ILE A  1 270 ? 53.868  10.421  18.551  1.00 44.92  ? 270  ILE A CG2 1 
ATOM   1994 C  CD1 . ILE A  1 270 ? 54.112  8.128   16.360  1.00 56.07  ? 270  ILE A CD1 1 
ATOM   1995 N  N   . ALA A  1 271 ? 57.352  12.095  18.612  1.00 40.74  ? 271  ALA A N   1 
ATOM   1996 C  CA  . ALA A  1 271 ? 58.020  12.734  19.735  1.00 43.22  ? 271  ALA A CA  1 
ATOM   1997 C  C   . ALA A  1 271 ? 58.073  14.246  19.539  1.00 46.85  ? 271  ALA A C   1 
ATOM   1998 O  O   . ALA A  1 271 ? 57.915  15.008  20.494  1.00 46.61  ? 271  ALA A O   1 
ATOM   1999 C  CB  . ALA A  1 271 ? 59.416  12.166  19.911  1.00 39.07  ? 271  ALA A CB  1 
ATOM   2000 N  N   . CYS A  1 272 ? 58.295  14.677  18.300  1.00 47.06  ? 272  CYS A N   1 
ATOM   2001 C  CA  . CYS A  1 272 ? 58.310  16.102  17.989  1.00 46.10  ? 272  CYS A CA  1 
ATOM   2002 C  C   . CYS A  1 272 ? 56.916  16.717  18.119  1.00 42.95  ? 272  CYS A C   1 
ATOM   2003 O  O   . CYS A  1 272 ? 56.765  17.801  18.686  1.00 46.71  ? 272  CYS A O   1 
ATOM   2004 C  CB  . CYS A  1 272 ? 58.880  16.354  16.588  1.00 36.49  ? 272  CYS A CB  1 
ATOM   2005 S  SG  . CYS A  1 272 ? 58.924  18.107  16.114  1.00 70.61  ? 272  CYS A SG  1 
ATOM   2006 N  N   . LEU A  1 273 ? 55.905  16.024  17.597  1.00 40.09  ? 273  LEU A N   1 
ATOM   2007 C  CA  . LEU A  1 273 ? 54.516  16.481  17.705  1.00 43.35  ? 273  LEU A CA  1 
ATOM   2008 C  C   . LEU A  1 273 ? 54.095  16.710  19.159  1.00 42.23  ? 273  LEU A C   1 
ATOM   2009 O  O   . LEU A  1 273 ? 53.321  17.623  19.455  1.00 41.02  ? 273  LEU A O   1 
ATOM   2010 C  CB  . LEU A  1 273 ? 53.556  15.490  17.034  1.00 43.27  ? 273  LEU A CB  1 
ATOM   2011 C  CG  . LEU A  1 273 ? 53.498  15.470  15.505  1.00 48.20  ? 273  LEU A CG  1 
ATOM   2012 C  CD1 . LEU A  1 273 ? 52.497  14.441  14.990  1.00 42.73  ? 273  LEU A CD1 1 
ATOM   2013 C  CD2 . LEU A  1 273 ? 53.147  16.847  14.985  1.00 53.24  ? 273  LEU A CD2 1 
ATOM   2014 N  N   . ARG A  1 274 ? 54.614  15.885  20.064  1.00 34.75  ? 274  ARG A N   1 
ATOM   2015 C  CA  . ARG A  1 274 ? 54.278  16.004  21.481  1.00 43.15  ? 274  ARG A CA  1 
ATOM   2016 C  C   . ARG A  1 274 ? 54.875  17.253  22.127  1.00 45.44  ? 274  ARG A C   1 
ATOM   2017 O  O   . ARG A  1 274 ? 54.406  17.701  23.173  1.00 45.96  ? 274  ARG A O   1 
ATOM   2018 C  CB  . ARG A  1 274 ? 54.703  14.747  22.250  1.00 37.82  ? 274  ARG A CB  1 
ATOM   2019 C  CG  . ARG A  1 274 ? 53.797  13.549  22.017  1.00 40.68  ? 274  ARG A CG  1 
ATOM   2020 C  CD  . ARG A  1 274 ? 53.921  12.528  23.139  1.00 52.18  ? 274  ARG A CD  1 
ATOM   2021 N  NE  . ARG A  1 274 ? 54.716  11.363  22.758  1.00 64.33  ? 274  ARG A NE  1 
ATOM   2022 C  CZ  . ARG A  1 274 ? 54.205  10.233  22.277  1.00 74.24  ? 274  ARG A CZ  1 
ATOM   2023 N  NH1 . ARG A  1 274 ? 52.895  10.107  22.109  1.00 69.97  ? 274  ARG A NH1 1 
ATOM   2024 N  NH2 . ARG A  1 274 ? 55.005  9.226   21.961  1.00 80.08  ? 274  ARG A NH2 1 
ATOM   2025 N  N   . THR A  1 275 ? 55.902  17.816  21.494  1.00 42.05  ? 275  THR A N   1 
ATOM   2026 C  CA  . THR A  1 275 ? 56.531  19.039  21.990  1.00 44.84  ? 275  THR A CA  1 
ATOM   2027 C  C   . THR A  1 275 ? 55.754  20.277  21.552  1.00 44.57  ? 275  THR A C   1 
ATOM   2028 O  O   . THR A  1 275 ? 56.016  21.387  22.020  1.00 53.00  ? 275  THR A O   1 
ATOM   2029 C  CB  . THR A  1 275 ? 57.996  19.167  21.508  1.00 44.04  ? 275  THR A CB  1 
ATOM   2030 O  OG1 . THR A  1 275 ? 58.029  19.447  20.103  1.00 47.45  ? 275  THR A OG1 1 
ATOM   2031 C  CG2 . THR A  1 275 ? 58.757  17.888  21.781  1.00 40.21  ? 275  THR A CG2 1 
ATOM   2032 N  N   . ARG A  1 276 ? 54.789  20.067  20.660  1.00 38.10  ? 276  ARG A N   1 
ATOM   2033 C  CA  A ARG A  1 276 ? 54.012  21.159  20.087  0.43 41.69  ? 276  ARG A CA  1 
ATOM   2034 C  CA  B ARG A  1 276 ? 54.010  21.162  20.089  0.57 41.56  ? 276  ARG A CA  1 
ATOM   2035 C  C   . ARG A  1 276 ? 52.849  21.562  20.985  1.00 43.34  ? 276  ARG A C   1 
ATOM   2036 O  O   . ARG A  1 276 ? 52.203  20.706  21.595  1.00 43.86  ? 276  ARG A O   1 
ATOM   2037 C  CB  A ARG A  1 276 ? 53.476  20.757  18.711  0.43 43.48  ? 276  ARG A CB  1 
ATOM   2038 C  CB  B ARG A  1 276 ? 53.468  20.777  18.709  0.57 43.65  ? 276  ARG A CB  1 
ATOM   2039 C  CG  A ARG A  1 276 ? 54.545  20.281  17.742  0.43 43.55  ? 276  ARG A CG  1 
ATOM   2040 C  CG  B ARG A  1 276 ? 54.537  20.589  17.648  0.57 43.59  ? 276  ARG A CG  1 
ATOM   2041 C  CD  A ARG A  1 276 ? 55.574  21.365  17.504  0.43 46.47  ? 276  ARG A CD  1 
ATOM   2042 C  CD  B ARG A  1 276 ? 55.214  21.907  17.336  0.57 47.47  ? 276  ARG A CD  1 
ATOM   2043 N  NE  A ARG A  1 276 ? 54.971  22.537  16.876  0.43 46.63  ? 276  ARG A NE  1 
ATOM   2044 N  NE  B ARG A  1 276 ? 56.515  21.726  16.694  0.57 50.81  ? 276  ARG A NE  1 
ATOM   2045 C  CZ  A ARG A  1 276 ? 55.366  23.788  17.089  0.43 41.36  ? 276  ARG A CZ  1 
ATOM   2046 C  CZ  B ARG A  1 276 ? 57.679  21.852  17.324  0.57 50.19  ? 276  ARG A CZ  1 
ATOM   2047 N  NH1 A ARG A  1 276 ? 56.368  24.041  17.922  0.43 31.15  ? 276  ARG A NH1 1 
ATOM   2048 N  NH1 B ARG A  1 276 ? 57.705  22.162  18.614  0.57 48.23  ? 276  ARG A NH1 1 
ATOM   2049 N  NH2 A ARG A  1 276 ? 54.755  24.789  16.471  0.43 41.92  ? 276  ARG A NH2 1 
ATOM   2050 N  NH2 B ARG A  1 276 ? 58.815  21.674  16.665  0.57 47.19  ? 276  ARG A NH2 1 
ATOM   2051 N  N   . PRO A  1 277 ? 52.576  22.874  21.068  1.00 48.41  ? 277  PRO A N   1 
ATOM   2052 C  CA  . PRO A  1 277 ? 51.410  23.346  21.823  1.00 46.57  ? 277  PRO A CA  1 
ATOM   2053 C  C   . PRO A  1 277 ? 50.148  22.779  21.189  1.00 50.46  ? 277  PRO A C   1 
ATOM   2054 O  O   . PRO A  1 277 ? 50.126  22.601  19.971  1.00 53.21  ? 277  PRO A O   1 
ATOM   2055 C  CB  . PRO A  1 277 ? 51.448  24.860  21.607  1.00 48.22  ? 277  PRO A CB  1 
ATOM   2056 C  CG  . PRO A  1 277 ? 52.876  25.176  21.295  1.00 43.62  ? 277  PRO A CG  1 
ATOM   2057 C  CD  . PRO A  1 277 ? 53.390  23.986  20.539  1.00 46.18  ? 277  PRO A CD  1 
ATOM   2058 N  N   . ALA A  1 278 ? 49.121  22.498  21.983  1.00 44.91  ? 278  ALA A N   1 
ATOM   2059 C  CA  . ALA A  1 278 ? 47.885  21.939  21.439  1.00 40.12  ? 278  ALA A CA  1 
ATOM   2060 C  C   . ALA A  1 278 ? 47.278  22.827  20.352  1.00 41.96  ? 278  ALA A C   1 
ATOM   2061 O  O   . ALA A  1 278 ? 46.729  22.332  19.367  1.00 40.35  ? 278  ALA A O   1 
ATOM   2062 C  CB  . ALA A  1 278 ? 46.878  21.688  22.551  1.00 27.87  ? 278  ALA A CB  1 
ATOM   2063 N  N   . GLN A  1 279 ? 47.385  24.138  20.535  1.00 44.96  ? 279  GLN A N   1 
ATOM   2064 C  CA  . GLN A  1 279 ? 46.792  25.099  19.612  1.00 40.05  ? 279  GLN A CA  1 
ATOM   2065 C  C   . GLN A  1 279 ? 47.450  25.076  18.231  1.00 43.90  ? 279  GLN A C   1 
ATOM   2066 O  O   . GLN A  1 279 ? 46.785  25.305  17.215  1.00 45.47  ? 279  GLN A O   1 
ATOM   2067 C  CB  . GLN A  1 279 ? 46.867  26.505  20.207  1.00 35.01  ? 279  GLN A CB  1 
ATOM   2068 C  CG  . GLN A  1 279 ? 46.013  27.527  19.480  1.00 37.91  ? 279  GLN A CG  1 
ATOM   2069 C  CD  . GLN A  1 279 ? 44.534  27.198  19.540  1.00 43.55  ? 279  GLN A CD  1 
ATOM   2070 O  OE1 . GLN A  1 279 ? 43.987  26.937  20.611  1.00 52.86  ? 279  GLN A OE1 1 
ATOM   2071 N  NE2 . GLN A  1 279 ? 43.879  27.203  18.386  1.00 39.27  ? 279  GLN A NE2 1 
ATOM   2072 N  N   . ASP A  1 280 ? 48.752  24.803  18.195  1.00 39.49  ? 280  ASP A N   1 
ATOM   2073 C  CA  . ASP A  1 280 ? 49.476  24.725  16.924  1.00 45.01  ? 280  ASP A CA  1 
ATOM   2074 C  C   . ASP A  1 280 ? 48.924  23.596  16.056  1.00 41.69  ? 280  ASP A C   1 
ATOM   2075 O  O   . ASP A  1 280 ? 48.804  23.740  14.838  1.00 51.27  ? 280  ASP A O   1 
ATOM   2076 C  CB  . ASP A  1 280 ? 50.980  24.535  17.159  1.00 59.40  ? 280  ASP A CB  1 
ATOM   2077 C  CG  . ASP A  1 280 ? 51.703  25.845  17.436  1.00 74.00  ? 280  ASP A CG  1 
ATOM   2078 O  OD1 . ASP A  1 280 ? 51.026  26.850  17.742  1.00 77.49  ? 280  ASP A OD1 1 
ATOM   2079 O  OD2 . ASP A  1 280 ? 52.951  25.864  17.355  1.00 78.46  ? 280  ASP A OD2 1 
ATOM   2080 N  N   . LEU A  1 281 ? 48.579  22.479  16.692  1.00 37.75  ? 281  LEU A N   1 
ATOM   2081 C  CA  . LEU A  1 281 ? 47.990  21.342  15.987  1.00 42.91  ? 281  LEU A CA  1 
ATOM   2082 C  C   . LEU A  1 281 ? 46.607  21.703  15.449  1.00 45.28  ? 281  LEU A C   1 
ATOM   2083 O  O   . LEU A  1 281 ? 46.281  21.409  14.294  1.00 40.45  ? 281  LEU A O   1 
ATOM   2084 C  CB  . LEU A  1 281 ? 47.911  20.113  16.900  1.00 39.12  ? 281  LEU A CB  1 
ATOM   2085 C  CG  . LEU A  1 281 ? 49.229  19.597  17.490  1.00 36.50  ? 281  LEU A CG  1 
ATOM   2086 C  CD1 . LEU A  1 281 ? 49.087  18.178  18.002  1.00 40.65  ? 281  LEU A CD1 1 
ATOM   2087 C  CD2 . LEU A  1 281 ? 50.335  19.665  16.466  1.00 35.82  ? 281  LEU A CD2 1 
ATOM   2088 N  N   . VAL A  1 282 ? 45.803  22.353  16.285  1.00 40.51  ? 282  VAL A N   1 
ATOM   2089 C  CA  . VAL A  1 282 ? 44.480  22.817  15.877  1.00 40.02  ? 282  VAL A CA  1 
ATOM   2090 C  C   . VAL A  1 282 ? 44.559  23.827  14.723  1.00 39.64  ? 282  VAL A C   1 
ATOM   2091 O  O   . VAL A  1 282 ? 43.732  23.796  13.810  1.00 37.64  ? 282  VAL A O   1 
ATOM   2092 C  CB  . VAL A  1 282 ? 43.702  23.412  17.076  1.00 36.85  ? 282  VAL A CB  1 
ATOM   2093 C  CG1 . VAL A  1 282 ? 42.412  24.065  16.615  1.00 27.48  ? 282  VAL A CG1 1 
ATOM   2094 C  CG2 . VAL A  1 282 ? 43.411  22.325  18.111  1.00 32.89  ? 282  VAL A CG2 1 
ATOM   2095 N  N   . ASP A  1 283 ? 45.565  24.700  14.751  1.00 38.47  ? 283  ASP A N   1 
ATOM   2096 C  CA  . ASP A  1 283 ? 45.699  25.754  13.739  1.00 40.63  ? 283  ASP A CA  1 
ATOM   2097 C  C   . ASP A  1 283 ? 45.989  25.244  12.318  1.00 40.06  ? 283  ASP A C   1 
ATOM   2098 O  O   . ASP A  1 283 ? 45.746  25.956  11.343  1.00 44.80  ? 283  ASP A O   1 
ATOM   2099 C  CB  . ASP A  1 283 ? 46.776  26.772  14.148  1.00 41.53  ? 283  ASP A CB  1 
ATOM   2100 C  CG  . ASP A  1 283 ? 46.337  27.678  15.287  1.00 50.23  ? 283  ASP A CG  1 
ATOM   2101 O  OD1 . ASP A  1 283 ? 45.131  27.710  15.609  1.00 49.49  ? 283  ASP A OD1 1 
ATOM   2102 O  OD2 . ASP A  1 283 ? 47.210  28.373  15.853  1.00 56.04  ? 283  ASP A OD2 1 
ATOM   2103 N  N   . HIS A  1 284 ? 46.509  24.024  12.204  1.00 37.53  ? 284  HIS A N   1 
ATOM   2104 C  CA  . HIS A  1 284 ? 46.874  23.453  10.905  1.00 44.13  ? 284  HIS A CA  1 
ATOM   2105 C  C   . HIS A  1 284 ? 46.060  22.211  10.549  1.00 47.18  ? 284  HIS A C   1 
ATOM   2106 O  O   . HIS A  1 284 ? 46.350  21.532  9.562   1.00 50.37  ? 284  HIS A O   1 
ATOM   2107 C  CB  . HIS A  1 284 ? 48.367  23.115  10.872  1.00 48.65  ? 284  HIS A CB  1 
ATOM   2108 C  CG  . HIS A  1 284 ? 49.257  24.314  10.959  1.00 55.75  ? 284  HIS A CG  1 
ATOM   2109 N  ND1 . HIS A  1 284 ? 49.661  24.857  12.161  1.00 64.53  ? 284  HIS A ND1 1 
ATOM   2110 C  CD2 . HIS A  1 284 ? 49.815  25.081  9.994   1.00 56.43  ? 284  HIS A CD2 1 
ATOM   2111 C  CE1 . HIS A  1 284 ? 50.431  25.903  11.931  1.00 67.46  ? 284  HIS A CE1 1 
ATOM   2112 N  NE2 . HIS A  1 284 ? 50.542  26.062  10.623  1.00 60.50  ? 284  HIS A NE2 1 
ATOM   2113 N  N   . GLU A  1 285 ? 45.034  21.931  11.345  1.00 43.42  ? 285  GLU A N   1 
ATOM   2114 C  CA  . GLU A  1 285 ? 44.229  20.722  11.187  1.00 45.77  ? 285  GLU A CA  1 
ATOM   2115 C  C   . GLU A  1 285 ? 43.541  20.610  9.819   1.00 42.68  ? 285  GLU A C   1 
ATOM   2116 O  O   . GLU A  1 285 ? 43.565  19.552  9.195   1.00 38.22  ? 285  GLU A O   1 
ATOM   2117 C  CB  . GLU A  1 285 ? 43.193  20.648  12.313  1.00 42.12  ? 285  GLU A CB  1 
ATOM   2118 C  CG  . GLU A  1 285 ? 42.452  19.330  12.399  1.00 52.66  ? 285  GLU A CG  1 
ATOM   2119 C  CD  . GLU A  1 285 ? 41.423  19.315  13.509  1.00 62.12  ? 285  GLU A CD  1 
ATOM   2120 O  OE1 . GLU A  1 285 ? 41.503  20.171  14.418  1.00 53.93  ? 285  GLU A OE1 1 
ATOM   2121 O  OE2 . GLU A  1 285 ? 40.531  18.445  13.472  1.00 71.88  ? 285  GLU A OE2 1 
ATOM   2122 N  N   . TRP A  1 286 ? 42.939  21.697  9.350   1.00 36.93  ? 286  TRP A N   1 
ATOM   2123 C  CA  . TRP A  1 286 ? 42.185  21.663  8.095   1.00 40.38  ? 286  TRP A CA  1 
ATOM   2124 C  C   . TRP A  1 286 ? 43.064  21.672  6.844   1.00 42.17  ? 286  TRP A C   1 
ATOM   2125 O  O   . TRP A  1 286 ? 42.572  21.475  5.734   1.00 56.69  ? 286  TRP A O   1 
ATOM   2126 C  CB  . TRP A  1 286 ? 41.201  22.836  8.043   1.00 40.00  ? 286  TRP A CB  1 
ATOM   2127 C  CG  . TRP A  1 286 ? 40.180  22.786  9.129   1.00 45.42  ? 286  TRP A CG  1 
ATOM   2128 C  CD1 . TRP A  1 286 ? 40.225  23.431  10.330  1.00 39.86  ? 286  TRP A CD1 1 
ATOM   2129 C  CD2 . TRP A  1 286 ? 38.960  22.036  9.119   1.00 50.57  ? 286  TRP A CD2 1 
ATOM   2130 N  NE1 . TRP A  1 286 ? 39.103  23.130  11.067  1.00 46.28  ? 286  TRP A NE1 1 
ATOM   2131 C  CE2 . TRP A  1 286 ? 38.311  22.275  10.345  1.00 48.05  ? 286  TRP A CE2 1 
ATOM   2132 C  CE3 . TRP A  1 286 ? 38.354  21.185  8.189   1.00 43.44  ? 286  TRP A CE3 1 
ATOM   2133 C  CZ2 . TRP A  1 286 ? 37.082  21.694  10.666  1.00 44.58  ? 286  TRP A CZ2 1 
ATOM   2134 C  CZ3 . TRP A  1 286 ? 37.136  20.611  8.507   1.00 49.54  ? 286  TRP A CZ3 1 
ATOM   2135 C  CH2 . TRP A  1 286 ? 36.513  20.867  9.734   1.00 52.27  ? 286  TRP A CH2 1 
ATOM   2136 N  N   . HIS A  1 287 ? 44.362  21.890  7.030   1.00 39.02  ? 287  HIS A N   1 
ATOM   2137 C  CA  . HIS A  1 287 ? 45.282  22.086  5.909   1.00 43.55  ? 287  HIS A CA  1 
ATOM   2138 C  C   . HIS A  1 287 ? 45.827  20.788  5.304   1.00 40.63  ? 287  HIS A C   1 
ATOM   2139 O  O   . HIS A  1 287 ? 46.657  20.828  4.395   1.00 44.50  ? 287  HIS A O   1 
ATOM   2140 C  CB  . HIS A  1 287 ? 46.443  22.986  6.347   1.00 44.96  ? 287  HIS A CB  1 
ATOM   2141 C  CG  . HIS A  1 287 ? 46.013  24.351  6.787   1.00 53.89  ? 287  HIS A CG  1 
ATOM   2142 N  ND1 . HIS A  1 287 ? 46.711  25.083  7.730   1.00 60.21  ? 287  HIS A ND1 1 
ATOM   2143 C  CD2 . HIS A  1 287 ? 44.967  25.123  6.415   1.00 54.61  ? 287  HIS A CD2 1 
ATOM   2144 C  CE1 . HIS A  1 287 ? 46.108  26.241  7.917   1.00 60.50  ? 287  HIS A CE1 1 
ATOM   2145 N  NE2 . HIS A  1 287 ? 45.046  26.294  7.130   1.00 60.73  ? 287  HIS A NE2 1 
ATOM   2146 N  N   . VAL A  1 288 ? 45.361  19.644  5.801   1.00 36.69  ? 288  VAL A N   1 
ATOM   2147 C  CA  . VAL A  1 288 ? 45.863  18.352  5.328   1.00 34.09  ? 288  VAL A CA  1 
ATOM   2148 C  C   . VAL A  1 288 ? 44.856  17.566  4.477   1.00 34.18  ? 288  VAL A C   1 
ATOM   2149 O  O   . VAL A  1 288 ? 45.150  16.455  4.035   1.00 35.72  ? 288  VAL A O   1 
ATOM   2150 C  CB  . VAL A  1 288 ? 46.365  17.463  6.497   1.00 34.06  ? 288  VAL A CB  1 
ATOM   2151 C  CG1 . VAL A  1 288 ? 47.377  18.215  7.339   1.00 27.22  ? 288  VAL A CG1 1 
ATOM   2152 C  CG2 . VAL A  1 288 ? 45.204  16.988  7.354   1.00 25.38  ? 288  VAL A CG2 1 
ATOM   2153 N  N   . LEU A  1 289 ? 43.676  18.139  4.250   1.00 38.81  ? 289  LEU A N   1 
ATOM   2154 C  CA  . LEU A  1 289 ? 42.668  17.505  3.396   1.00 40.59  ? 289  LEU A CA  1 
ATOM   2155 C  C   . LEU A  1 289 ? 43.127  17.485  1.933   1.00 41.22  ? 289  LEU A C   1 
ATOM   2156 O  O   . LEU A  1 289 ? 43.729  18.451  1.455   1.00 40.74  ? 289  LEU A O   1 
ATOM   2157 C  CB  . LEU A  1 289 ? 41.309  18.205  3.538   1.00 38.06  ? 289  LEU A CB  1 
ATOM   2158 C  CG  . LEU A  1 289 ? 40.550  17.954  4.846   1.00 43.46  ? 289  LEU A CG  1 
ATOM   2159 C  CD1 . LEU A  1 289 ? 39.272  18.774  4.918   1.00 42.56  ? 289  LEU A CD1 1 
ATOM   2160 C  CD2 . LEU A  1 289 ? 40.235  16.478  5.007   1.00 37.98  ? 289  LEU A CD2 1 
ATOM   2161 N  N   . PRO A  1 290 ? 42.850  16.377  1.222   1.00 42.01  ? 290  PRO A N   1 
ATOM   2162 C  CA  . PRO A  1 290 ? 43.372  16.151  -0.132  1.00 45.82  ? 290  PRO A CA  1 
ATOM   2163 C  C   . PRO A  1 290 ? 42.733  17.068  -1.164  1.00 45.48  ? 290  PRO A C   1 
ATOM   2164 O  O   . PRO A  1 290 ? 43.415  17.497  -2.093  1.00 45.75  ? 290  PRO A O   1 
ATOM   2165 C  CB  . PRO A  1 290 ? 42.973  14.698  -0.431  1.00 45.23  ? 290  PRO A CB  1 
ATOM   2166 C  CG  . PRO A  1 290 ? 42.475  14.125  0.868   1.00 46.83  ? 290  PRO A CG  1 
ATOM   2167 C  CD  . PRO A  1 290 ? 41.966  15.281  1.653   1.00 45.02  ? 290  PRO A CD  1 
ATOM   2168 N  N   . GLN A  1 291 ? 41.442  17.347  -1.013  1.00 45.92  ? 291  GLN A N   1 
ATOM   2169 C  CA  . GLN A  1 291 ? 40.746  18.225  -1.946  1.00 50.41  ? 291  GLN A CA  1 
ATOM   2170 C  C   . GLN A  1 291 ? 39.993  19.335  -1.228  1.00 51.03  ? 291  GLN A C   1 
ATOM   2171 O  O   . GLN A  1 291 ? 39.744  19.256  -0.025  1.00 53.53  ? 291  GLN A O   1 
ATOM   2172 C  CB  . GLN A  1 291 ? 39.766  17.427  -2.813  1.00 45.45  ? 291  GLN A CB  1 
ATOM   2173 C  CG  . GLN A  1 291 ? 40.389  16.266  -3.573  1.00 48.98  ? 291  GLN A CG  1 
ATOM   2174 C  CD  . GLN A  1 291 ? 40.284  14.949  -2.825  1.00 58.98  ? 291  GLN A CD  1 
ATOM   2175 O  OE1 . GLN A  1 291 ? 39.447  14.792  -1.933  1.00 61.37  ? 291  GLN A OE1 1 
ATOM   2176 N  NE2 . GLN A  1 291 ? 41.132  13.993  -3.189  1.00 56.06  ? 291  GLN A NE2 1 
ATOM   2177 N  N   . GLU A  1 292 ? 39.650  20.376  -1.978  1.00 49.54  ? 292  GLU A N   1 
ATOM   2178 C  CA  . GLU A  1 292 ? 38.708  21.386  -1.518  1.00 44.31  ? 292  GLU A CA  1 
ATOM   2179 C  C   . GLU A  1 292 ? 37.376  20.674  -1.303  1.00 42.50  ? 292  GLU A C   1 
ATOM   2180 O  O   . GLU A  1 292 ? 36.863  20.031  -2.219  1.00 43.61  ? 292  GLU A O   1 
ATOM   2181 C  CB  . GLU A  1 292 ? 38.570  22.470  -2.589  1.00 48.19  ? 292  GLU A CB  1 
ATOM   2182 C  CG  . GLU A  1 292 ? 37.659  23.631  -2.240  1.00 63.00  ? 292  GLU A CG  1 
ATOM   2183 C  CD  . GLU A  1 292 ? 37.551  24.627  -3.379  1.00 77.84  ? 292  GLU A CD  1 
ATOM   2184 O  OE1 . GLU A  1 292 ? 38.166  24.383  -4.440  1.00 83.39  ? 292  GLU A OE1 1 
ATOM   2185 O  OE2 . GLU A  1 292 ? 36.855  25.650  -3.217  1.00 80.04  ? 292  GLU A OE2 1 
ATOM   2186 N  N   . SER A  1 293 ? 36.819  20.769  -0.098  1.00 38.14  ? 293  SER A N   1 
ATOM   2187 C  CA  . SER A  1 293 ? 35.658  19.952  0.241   1.00 36.29  ? 293  SER A CA  1 
ATOM   2188 C  C   . SER A  1 293 ? 34.801  20.510  1.372   1.00 33.93  ? 293  SER A C   1 
ATOM   2189 O  O   . SER A  1 293 ? 35.217  21.411  2.097   1.00 35.36  ? 293  SER A O   1 
ATOM   2190 C  CB  . SER A  1 293 ? 36.114  18.540  0.614   1.00 31.20  ? 293  SER A CB  1 
ATOM   2191 O  OG  . SER A  1 293 ? 37.058  18.578  1.670   1.00 38.34  ? 293  SER A OG  1 
ATOM   2192 N  N   . ILE A  1 294 ? 33.592  19.968  1.493   1.00 35.90  ? 294  ILE A N   1 
ATOM   2193 C  CA  . ILE A  1 294 ? 32.768  20.131  2.686   1.00 35.57  ? 294  ILE A CA  1 
ATOM   2194 C  C   . ILE A  1 294 ? 32.358  18.737  3.158   1.00 35.08  ? 294  ILE A C   1 
ATOM   2195 O  O   . ILE A  1 294 ? 32.429  17.776  2.388   1.00 34.66  ? 294  ILE A O   1 
ATOM   2196 C  CB  . ILE A  1 294 ? 31.514  20.984  2.424   1.00 30.00  ? 294  ILE A CB  1 
ATOM   2197 C  CG1 . ILE A  1 294 ? 30.647  20.354  1.333   1.00 32.86  ? 294  ILE A CG1 1 
ATOM   2198 C  CG2 . ILE A  1 294 ? 31.896  22.415  2.064   1.00 29.80  ? 294  ILE A CG2 1 
ATOM   2199 C  CD1 . ILE A  1 294 ? 29.298  21.035  1.170   1.00 34.87  ? 294  ILE A CD1 1 
ATOM   2200 N  N   . PHE A  1 295 ? 31.943  18.629  4.418   1.00 35.12  ? 295  PHE A N   1 
ATOM   2201 C  CA  . PHE A  1 295 ? 31.607  17.340  5.026   1.00 31.51  ? 295  PHE A CA  1 
ATOM   2202 C  C   . PHE A  1 295 ? 32.783  16.359  4.952   1.00 32.57  ? 295  PHE A C   1 
ATOM   2203 O  O   . PHE A  1 295 ? 32.602  15.149  4.786   1.00 33.62  ? 295  PHE A O   1 
ATOM   2204 C  CB  . PHE A  1 295 ? 30.336  16.755  4.399   1.00 28.73  ? 295  PHE A CB  1 
ATOM   2205 C  CG  . PHE A  1 295 ? 29.419  16.090  5.388   1.00 41.24  ? 295  PHE A CG  1 
ATOM   2206 C  CD1 . PHE A  1 295 ? 29.922  15.230  6.355   1.00 46.69  ? 295  PHE A CD1 1 
ATOM   2207 C  CD2 . PHE A  1 295 ? 28.053  16.334  5.358   1.00 39.01  ? 295  PHE A CD2 1 
ATOM   2208 C  CE1 . PHE A  1 295 ? 29.079  14.612  7.268   1.00 37.17  ? 295  PHE A CE1 1 
ATOM   2209 C  CE2 . PHE A  1 295 ? 27.201  15.722  6.263   1.00 37.59  ? 295  PHE A CE2 1 
ATOM   2210 C  CZ  . PHE A  1 295 ? 27.714  14.859  7.222   1.00 40.43  ? 295  PHE A CZ  1 
ATOM   2211 N  N   . ARG A  1 296 ? 33.994  16.899  5.066   1.00 27.83  ? 296  ARG A N   1 
ATOM   2212 C  CA  . ARG A  1 296 ? 35.200  16.081  5.173   1.00 33.72  ? 296  ARG A CA  1 
ATOM   2213 C  C   . ARG A  1 296 ? 36.030  16.562  6.352   1.00 33.77  ? 296  ARG A C   1 
ATOM   2214 O  O   . ARG A  1 296 ? 36.214  17.769  6.546   1.00 32.72  ? 296  ARG A O   1 
ATOM   2215 C  CB  . ARG A  1 296 ? 36.034  16.136  3.889   1.00 25.20  ? 296  ARG A CB  1 
ATOM   2216 C  CG  . ARG A  1 296 ? 35.384  15.476  2.679   1.00 30.41  ? 296  ARG A CG  1 
ATOM   2217 C  CD  . ARG A  1 296 ? 35.192  13.976  2.876   1.00 29.12  ? 296  ARG A CD  1 
ATOM   2218 N  NE  . ARG A  1 296 ? 34.605  13.352  1.692   1.00 38.04  ? 296  ARG A NE  1 
ATOM   2219 C  CZ  . ARG A  1 296 ? 33.298  13.217  1.492   1.00 40.09  ? 296  ARG A CZ  1 
ATOM   2220 N  NH1 . ARG A  1 296 ? 32.438  13.653  2.401   1.00 44.78  ? 296  ARG A NH1 1 
ATOM   2221 N  NH2 . ARG A  1 296 ? 32.851  12.646  0.383   1.00 34.22  ? 296  ARG A NH2 1 
ATOM   2222 N  N   . PHE A  1 297 ? 36.541  15.616  7.132   1.00 31.42  ? 297  PHE A N   1 
ATOM   2223 C  CA  . PHE A  1 297 ? 37.271  15.960  8.343   1.00 31.73  ? 297  PHE A CA  1 
ATOM   2224 C  C   . PHE A  1 297 ? 38.652  15.310  8.371   1.00 30.45  ? 297  PHE A C   1 
ATOM   2225 O  O   . PHE A  1 297 ? 38.802  14.131  8.041   1.00 36.93  ? 297  PHE A O   1 
ATOM   2226 C  CB  . PHE A  1 297 ? 36.429  15.586  9.563   1.00 30.81  ? 297  PHE A CB  1 
ATOM   2227 C  CG  . PHE A  1 297 ? 34.974  15.942  9.410   1.00 27.39  ? 297  PHE A CG  1 
ATOM   2228 C  CD1 . PHE A  1 297 ? 34.562  17.275  9.425   1.00 21.75  ? 297  PHE A CD1 1 
ATOM   2229 C  CD2 . PHE A  1 297 ? 34.020  14.948  9.224   1.00 24.58  ? 297  PHE A CD2 1 
ATOM   2230 C  CE1 . PHE A  1 297 ? 33.214  17.609  9.273   1.00 24.62  ? 297  PHE A CE1 1 
ATOM   2231 C  CE2 . PHE A  1 297 ? 32.671  15.268  9.069   1.00 24.71  ? 297  PHE A CE2 1 
ATOM   2232 C  CZ  . PHE A  1 297 ? 32.266  16.601  9.094   1.00 21.96  ? 297  PHE A CZ  1 
ATOM   2233 N  N   . SER A  1 298 ? 39.658  16.097  8.749   1.00 27.35  ? 298  SER A N   1 
ATOM   2234 C  CA  . SER A  1 298 ? 41.053  15.678  8.642   1.00 31.15  ? 298  SER A CA  1 
ATOM   2235 C  C   . SER A  1 298 ? 41.391  14.450  9.481   1.00 35.67  ? 298  SER A C   1 
ATOM   2236 O  O   . SER A  1 298 ? 42.049  13.527  9.000   1.00 37.87  ? 298  SER A O   1 
ATOM   2237 C  CB  . SER A  1 298 ? 41.990  16.832  9.007   1.00 32.17  ? 298  SER A CB  1 
ATOM   2238 O  OG  . SER A  1 298 ? 41.840  17.919  8.114   1.00 41.68  ? 298  SER A OG  1 
ATOM   2239 N  N   . PHE A  1 299 ? 40.936  14.431  10.729  1.00 34.89  ? 299  PHE A N   1 
ATOM   2240 C  CA  . PHE A  1 299 ? 41.298  13.339  11.626  1.00 36.11  ? 299  PHE A CA  1 
ATOM   2241 C  C   . PHE A  1 299 ? 40.106  12.566  12.191  1.00 37.50  ? 299  PHE A C   1 
ATOM   2242 O  O   . PHE A  1 299 ? 39.426  13.012  13.117  1.00 34.52  ? 299  PHE A O   1 
ATOM   2243 C  CB  . PHE A  1 299 ? 42.254  13.843  12.710  1.00 25.76  ? 299  PHE A CB  1 
ATOM   2244 C  CG  . PHE A  1 299 ? 43.549  14.367  12.151  1.00 27.27  ? 299  PHE A CG  1 
ATOM   2245 C  CD1 . PHE A  1 299 ? 44.593  13.498  11.866  1.00 26.15  ? 299  PHE A CD1 1 
ATOM   2246 C  CD2 . PHE A  1 299 ? 43.708  15.720  11.871  1.00 31.24  ? 299  PHE A CD2 1 
ATOM   2247 C  CE1 . PHE A  1 299 ? 45.786  13.969  11.333  1.00 30.85  ? 299  PHE A CE1 1 
ATOM   2248 C  CE2 . PHE A  1 299 ? 44.897  16.201  11.335  1.00 30.15  ? 299  PHE A CE2 1 
ATOM   2249 C  CZ  . PHE A  1 299 ? 45.940  15.323  11.069  1.00 25.36  ? 299  PHE A CZ  1 
ATOM   2250 N  N   . VAL A  1 300 ? 39.883  11.392  11.607  1.00 34.92  ? 300  VAL A N   1 
ATOM   2251 C  CA  . VAL A  1 300 ? 38.722  10.553  11.882  1.00 30.65  ? 300  VAL A CA  1 
ATOM   2252 C  C   . VAL A  1 300 ? 39.215  9.132   12.161  1.00 27.20  ? 300  VAL A C   1 
ATOM   2253 O  O   . VAL A  1 300 ? 40.402  8.857   11.989  1.00 28.61  ? 300  VAL A O   1 
ATOM   2254 C  CB  . VAL A  1 300 ? 37.765  10.550  10.663  1.00 28.11  ? 300  VAL A CB  1 
ATOM   2255 C  CG1 . VAL A  1 300 ? 37.226  11.941  10.408  1.00 15.54  ? 300  VAL A CG1 1 
ATOM   2256 C  CG2 . VAL A  1 300 ? 38.479  10.028  9.423   1.00 25.36  ? 300  VAL A CG2 1 
ATOM   2257 N  N   . PRO A  1 301 ? 38.321  8.232   12.615  1.00 32.85  ? 301  PRO A N   1 
ATOM   2258 C  CA  . PRO A  1 301 ? 38.739  6.831   12.763  1.00 26.89  ? 301  PRO A CA  1 
ATOM   2259 C  C   . PRO A  1 301 ? 39.466  6.241   11.548  1.00 37.60  ? 301  PRO A C   1 
ATOM   2260 O  O   . PRO A  1 301 ? 39.088  6.508   10.402  1.00 32.23  ? 301  PRO A O   1 
ATOM   2261 C  CB  . PRO A  1 301 ? 37.411  6.108   12.989  1.00 25.43  ? 301  PRO A CB  1 
ATOM   2262 C  CG  . PRO A  1 301 ? 36.608  7.112   13.790  1.00 32.46  ? 301  PRO A CG  1 
ATOM   2263 C  CD  . PRO A  1 301 ? 37.008  8.479   13.250  1.00 33.61  ? 301  PRO A CD  1 
ATOM   2264 N  N   . VAL A  1 302 ? 40.506  5.453   11.810  1.00 37.78  ? 302  VAL A N   1 
ATOM   2265 C  CA  . VAL A  1 302 ? 41.279  4.801   10.754  1.00 37.57  ? 302  VAL A CA  1 
ATOM   2266 C  C   . VAL A  1 302 ? 40.944  3.307   10.701  1.00 43.90  ? 302  VAL A C   1 
ATOM   2267 O  O   . VAL A  1 302 ? 40.677  2.692   11.738  1.00 31.42  ? 302  VAL A O   1 
ATOM   2268 C  CB  . VAL A  1 302 ? 42.809  5.000   10.970  1.00 38.01  ? 302  VAL A CB  1 
ATOM   2269 C  CG1 . VAL A  1 302 ? 43.271  4.337   12.260  1.00 38.99  ? 302  VAL A CG1 1 
ATOM   2270 C  CG2 . VAL A  1 302 ? 43.605  4.457   9.793   1.00 31.86  ? 302  VAL A CG2 1 
ATOM   2271 N  N   . VAL A  1 303 ? 40.932  2.729   9.500   1.00 45.13  ? 303  VAL A N   1 
ATOM   2272 C  CA  . VAL A  1 303 ? 40.803  1.278   9.357   1.00 43.83  ? 303  VAL A CA  1 
ATOM   2273 C  C   . VAL A  1 303 ? 42.160  0.632   9.641   1.00 45.56  ? 303  VAL A C   1 
ATOM   2274 O  O   . VAL A  1 303 ? 43.041  0.611   8.778   1.00 48.36  ? 303  VAL A O   1 
ATOM   2275 C  CB  . VAL A  1 303 ? 40.298  0.877   7.953   1.00 43.12  ? 303  VAL A CB  1 
ATOM   2276 C  CG1 . VAL A  1 303 ? 40.215  -0.637  7.823   1.00 39.49  ? 303  VAL A CG1 1 
ATOM   2277 C  CG2 . VAL A  1 303 ? 38.940  1.497   7.687   1.00 37.00  ? 303  VAL A CG2 1 
ATOM   2278 N  N   . ASP A  1 304 ? 42.320  0.109   10.854  1.00 49.91  ? 304  ASP A N   1 
ATOM   2279 C  CA  . ASP A  1 304 ? 43.629  -0.318  11.352  1.00 48.05  ? 304  ASP A CA  1 
ATOM   2280 C  C   . ASP A  1 304 ? 43.830  -1.831  11.389  1.00 47.64  ? 304  ASP A C   1 
ATOM   2281 O  O   . ASP A  1 304 ? 44.937  -2.306  11.655  1.00 54.14  ? 304  ASP A O   1 
ATOM   2282 C  CB  . ASP A  1 304 ? 43.861  0.255   12.755  1.00 50.41  ? 304  ASP A CB  1 
ATOM   2283 C  CG  . ASP A  1 304 ? 42.710  -0.045  13.710  1.00 56.60  ? 304  ASP A CG  1 
ATOM   2284 O  OD1 . ASP A  1 304 ? 41.657  -0.545  13.251  1.00 49.77  ? 304  ASP A OD1 1 
ATOM   2285 O  OD2 . ASP A  1 304 ? 42.847  0.235   14.921  1.00 57.57  ? 304  ASP A OD2 1 
ATOM   2286 N  N   . GLY A  1 305 ? 42.766  -2.586  11.133  1.00 42.34  ? 305  GLY A N   1 
ATOM   2287 C  CA  . GLY A  1 305 ? 42.824  -4.030  11.279  1.00 50.46  ? 305  GLY A CA  1 
ATOM   2288 C  C   . GLY A  1 305 ? 42.888  -4.444  12.740  1.00 52.27  ? 305  GLY A C   1 
ATOM   2289 O  O   . GLY A  1 305 ? 43.363  -5.534  13.064  1.00 55.29  ? 305  GLY A O   1 
ATOM   2290 N  N   . ASP A  1 306 ? 42.408  -3.565  13.620  1.00 49.71  ? 306  ASP A N   1 
ATOM   2291 C  CA  . ASP A  1 306 ? 42.423  -3.803  15.061  1.00 46.26  ? 306  ASP A CA  1 
ATOM   2292 C  C   . ASP A  1 306 ? 41.061  -3.457  15.670  1.00 42.52  ? 306  ASP A C   1 
ATOM   2293 O  O   . ASP A  1 306 ? 40.218  -4.336  15.846  1.00 43.86  ? 306  ASP A O   1 
ATOM   2294 C  CB  . ASP A  1 306 ? 43.537  -2.983  15.716  1.00 53.99  ? 306  ASP A CB  1 
ATOM   2295 C  CG  . ASP A  1 306 ? 43.747  -3.338  17.176  1.00 60.47  ? 306  ASP A CG  1 
ATOM   2296 O  OD1 . ASP A  1 306 ? 43.250  -4.398  17.621  1.00 61.96  ? 306  ASP A OD1 1 
ATOM   2297 O  OD2 . ASP A  1 306 ? 44.424  -2.559  17.880  1.00 60.02  ? 306  ASP A OD2 1 
ATOM   2298 N  N   . PHE A  1 307 ? 40.853  -2.185  16.002  1.00 35.07  ? 307  PHE A N   1 
ATOM   2299 C  CA  . PHE A  1 307 ? 39.529  -1.712  16.400  1.00 33.84  ? 307  PHE A CA  1 
ATOM   2300 C  C   . PHE A  1 307 ? 38.560  -1.996  15.255  1.00 41.05  ? 307  PHE A C   1 
ATOM   2301 O  O   . PHE A  1 307 ? 37.452  -2.490  15.469  1.00 43.05  ? 307  PHE A O   1 
ATOM   2302 C  CB  . PHE A  1 307 ? 39.561  -0.210  16.701  1.00 28.06  ? 307  PHE A CB  1 
ATOM   2303 C  CG  . PHE A  1 307 ? 38.339  0.299   17.428  1.00 39.02  ? 307  PHE A CG  1 
ATOM   2304 C  CD1 . PHE A  1 307 ? 37.133  0.494   16.757  1.00 33.87  ? 307  PHE A CD1 1 
ATOM   2305 C  CD2 . PHE A  1 307 ? 38.404  0.599   18.785  1.00 41.18  ? 307  PHE A CD2 1 
ATOM   2306 C  CE1 . PHE A  1 307 ? 36.013  0.966   17.430  1.00 40.26  ? 307  PHE A CE1 1 
ATOM   2307 C  CE2 . PHE A  1 307 ? 37.291  1.072   19.465  1.00 35.48  ? 307  PHE A CE2 1 
ATOM   2308 C  CZ  . PHE A  1 307 ? 36.093  1.255   18.789  1.00 38.41  ? 307  PHE A CZ  1 
ATOM   2309 N  N   . LEU A  1 308 ? 38.993  -1.679  14.037  1.00 42.31  ? 308  LEU A N   1 
ATOM   2310 C  CA  . LEU A  1 308 ? 38.230  -1.998  12.836  1.00 41.34  ? 308  LEU A CA  1 
ATOM   2311 C  C   . LEU A  1 308 ? 38.989  -3.021  11.993  1.00 44.28  ? 308  LEU A C   1 
ATOM   2312 O  O   . LEU A  1 308 ? 39.943  -2.673  11.293  1.00 43.70  ? 308  LEU A O   1 
ATOM   2313 C  CB  . LEU A  1 308 ? 37.955  -0.732  12.019  1.00 44.27  ? 308  LEU A CB  1 
ATOM   2314 C  CG  . LEU A  1 308 ? 37.035  0.314   12.655  1.00 43.57  ? 308  LEU A CG  1 
ATOM   2315 C  CD1 . LEU A  1 308 ? 36.974  1.568   11.805  1.00 37.81  ? 308  LEU A CD1 1 
ATOM   2316 C  CD2 . LEU A  1 308 ? 35.643  -0.255  12.854  1.00 44.92  ? 308  LEU A CD2 1 
ATOM   2317 N  N   . SER A  1 309 ? 38.563  -4.280  12.066  1.00 47.22  ? 309  SER A N   1 
ATOM   2318 C  CA  . SER A  1 309 ? 39.245  -5.374  11.372  1.00 52.88  ? 309  SER A CA  1 
ATOM   2319 C  C   . SER A  1 309 ? 39.263  -5.197  9.851   1.00 55.04  ? 309  SER A C   1 
ATOM   2320 O  O   . SER A  1 309 ? 40.203  -5.624  9.180   1.00 55.27  ? 309  SER A O   1 
ATOM   2321 C  CB  . SER A  1 309 ? 38.617  -6.719  11.747  1.00 53.25  ? 309  SER A CB  1 
ATOM   2322 O  OG  . SER A  1 309 ? 37.230  -6.737  11.464  1.00 61.46  ? 309  SER A OG  1 
ATOM   2323 N  N   . ASP A  1 310 ? 38.220  -4.569  9.319   1.00 53.98  ? 310  ASP A N   1 
ATOM   2324 C  CA  . ASP A  1 310 ? 38.131  -4.264  7.895   1.00 44.96  ? 310  ASP A CA  1 
ATOM   2325 C  C   . ASP A  1 310 ? 37.351  -2.961  7.752   1.00 45.55  ? 310  ASP A C   1 
ATOM   2326 O  O   . ASP A  1 310 ? 36.995  -2.340  8.757   1.00 41.11  ? 310  ASP A O   1 
ATOM   2327 C  CB  . ASP A  1 310 ? 37.421  -5.400  7.152   1.00 42.71  ? 310  ASP A CB  1 
ATOM   2328 C  CG  . ASP A  1 310 ? 37.925  -5.580  5.730   1.00 56.45  ? 310  ASP A CG  1 
ATOM   2329 O  OD1 . ASP A  1 310 ? 38.418  -4.593  5.135   1.00 53.65  ? 310  ASP A OD1 1 
ATOM   2330 O  OD2 . ASP A  1 310 ? 37.826  -6.712  5.206   1.00 54.82  ? 310  ASP A OD2 1 
ATOM   2331 N  N   . THR A  1 311 ? 37.091  -2.539  6.516   1.00 40.61  ? 311  THR A N   1 
ATOM   2332 C  CA  . THR A  1 311 ? 36.258  -1.363  6.277   1.00 36.50  ? 311  THR A CA  1 
ATOM   2333 C  C   . THR A  1 311 ? 34.867  -1.629  6.831   1.00 43.89  ? 311  THR A C   1 
ATOM   2334 O  O   . THR A  1 311 ? 34.399  -2.771  6.796   1.00 48.52  ? 311  THR A O   1 
ATOM   2335 C  CB  . THR A  1 311 ? 36.133  -1.042  4.775   1.00 41.45  ? 311  THR A CB  1 
ATOM   2336 O  OG1 . THR A  1 311 ? 35.434  -2.103  4.111   1.00 42.35  ? 311  THR A OG1 1 
ATOM   2337 C  CG2 . THR A  1 311 ? 37.506  -0.874  4.145   1.00 38.14  ? 311  THR A CG2 1 
ATOM   2338 N  N   . PRO A  1 312 ? 34.213  -0.583  7.367   1.00 42.80  ? 312  PRO A N   1 
ATOM   2339 C  CA  . PRO A  1 312 ? 32.844  -0.717  7.870   1.00 44.52  ? 312  PRO A CA  1 
ATOM   2340 C  C   . PRO A  1 312 ? 31.928  -1.350  6.829   1.00 44.81  ? 312  PRO A C   1 
ATOM   2341 O  O   . PRO A  1 312 ? 31.141  -2.224  7.181   1.00 45.30  ? 312  PRO A O   1 
ATOM   2342 C  CB  . PRO A  1 312 ? 32.431  0.732   8.128   1.00 43.50  ? 312  PRO A CB  1 
ATOM   2343 C  CG  . PRO A  1 312 ? 33.712  1.416   8.486   1.00 38.09  ? 312  PRO A CG  1 
ATOM   2344 C  CD  . PRO A  1 312 ? 34.763  0.765   7.618   1.00 37.46  ? 312  PRO A CD  1 
ATOM   2345 N  N   . GLU A  1 313 ? 32.045  -0.927  5.573   1.00 52.85  ? 313  GLU A N   1 
ATOM   2346 C  CA  . GLU A  1 313 ? 31.265  -1.520  4.488   1.00 54.65  ? 313  GLU A CA  1 
ATOM   2347 C  C   . GLU A  1 313 ? 31.454  -3.041  4.386   1.00 50.88  ? 313  GLU A C   1 
ATOM   2348 O  O   . GLU A  1 313 ? 30.487  -3.781  4.210   1.00 47.36  ? 313  GLU A O   1 
ATOM   2349 C  CB  . GLU A  1 313 ? 31.579  -0.833  3.148   1.00 59.77  ? 313  GLU A CB  1 
ATOM   2350 C  CG  . GLU A  1 313 ? 30.904  0.533   2.957   1.00 68.01  ? 313  GLU A CG  1 
ATOM   2351 C  CD  . GLU A  1 313 ? 31.801  1.710   3.321   1.00 74.65  ? 313  GLU A CD  1 
ATOM   2352 O  OE1 . GLU A  1 313 ? 32.830  1.501   3.998   1.00 72.67  ? 313  GLU A OE1 1 
ATOM   2353 O  OE2 . GLU A  1 313 ? 31.477  2.850   2.921   1.00 78.81  ? 313  GLU A OE2 1 
ATOM   2354 N  N   . ALA A  1 314 ? 32.693  -3.507  4.518   1.00 44.82  ? 314  ALA A N   1 
ATOM   2355 C  CA  . ALA A  1 314 ? 32.971  -4.942  4.497   1.00 42.26  ? 314  ALA A CA  1 
ATOM   2356 C  C   . ALA A  1 314 ? 32.356  -5.668  5.697   1.00 46.04  ? 314  ALA A C   1 
ATOM   2357 O  O   . ALA A  1 314 ? 31.762  -6.736  5.547   1.00 50.35  ? 314  ALA A O   1 
ATOM   2358 C  CB  . ALA A  1 314 ? 34.472  -5.189  4.439   1.00 36.54  ? 314  ALA A CB  1 
ATOM   2359 N  N   . LEU A  1 315 ? 32.518  -5.090  6.885   1.00 46.83  ? 315  LEU A N   1 
ATOM   2360 C  CA  . LEU A  1 315 ? 31.983  -5.669  8.119   1.00 51.38  ? 315  LEU A CA  1 
ATOM   2361 C  C   . LEU A  1 315 ? 30.455  -5.720  8.114   1.00 52.86  ? 315  LEU A C   1 
ATOM   2362 O  O   . LEU A  1 315 ? 29.849  -6.677  8.599   1.00 60.79  ? 315  LEU A O   1 
ATOM   2363 C  CB  . LEU A  1 315 ? 32.465  -4.869  9.333   1.00 46.14  ? 315  LEU A CB  1 
ATOM   2364 C  CG  . LEU A  1 315 ? 33.978  -4.777  9.540   1.00 43.86  ? 315  LEU A CG  1 
ATOM   2365 C  CD1 . LEU A  1 315 ? 34.308  -3.946  10.763  1.00 36.91  ? 315  LEU A CD1 1 
ATOM   2366 C  CD2 . LEU A  1 315 ? 34.577  -6.160  9.665   1.00 40.53  ? 315  LEU A CD2 1 
ATOM   2367 N  N   . ILE A  1 316 ? 29.843  -4.675  7.567   1.00 42.42  ? 316  ILE A N   1 
ATOM   2368 C  CA  . ILE A  1 316 ? 28.391  -4.567  7.478   1.00 48.64  ? 316  ILE A CA  1 
ATOM   2369 C  C   . ILE A  1 316 ? 27.813  -5.577  6.471   1.00 60.63  ? 316  ILE A C   1 
ATOM   2370 O  O   . ILE A  1 316 ? 26.762  -6.177  6.713   1.00 62.35  ? 316  ILE A O   1 
ATOM   2371 C  CB  . ILE A  1 316 ? 27.983  -3.111  7.122   1.00 66.17  ? 316  ILE A CB  1 
ATOM   2372 C  CG1 . ILE A  1 316 ? 28.244  -2.178  8.309   1.00 64.23  ? 316  ILE A CG1 1 
ATOM   2373 C  CG2 . ILE A  1 316 ? 26.529  -3.022  6.747   1.00 68.58  ? 316  ILE A CG2 1 
ATOM   2374 C  CD1 . ILE A  1 316 ? 28.263  -0.707  7.937   1.00 61.22  ? 316  ILE A CD1 1 
ATOM   2375 N  N   . ASN A  1 317 ? 28.514  -5.779  5.356   1.00 62.02  ? 317  ASN A N   1 
ATOM   2376 C  CA  . ASN A  1 317 ? 28.080  -6.728  4.330   1.00 64.83  ? 317  ASN A CA  1 
ATOM   2377 C  C   . ASN A  1 317 ? 28.151  -8.194  4.762   1.00 69.69  ? 317  ASN A C   1 
ATOM   2378 O  O   . ASN A  1 317 ? 27.367  -9.022  4.296   1.00 74.13  ? 317  ASN A O   1 
ATOM   2379 C  CB  . ASN A  1 317 ? 28.902  -6.552  3.045   1.00 67.80  ? 317  ASN A CB  1 
ATOM   2380 C  CG  . ASN A  1 317 ? 28.623  -5.236  2.334   1.00 74.71  ? 317  ASN A CG  1 
ATOM   2381 O  OD1 . ASN A  1 317 ? 27.633  -4.557  2.614   1.00 79.44  ? 317  ASN A OD1 1 
ATOM   2382 N  ND2 . ASN A  1 317 ? 29.498  -4.874  1.398   1.00 65.97  ? 317  ASN A ND2 1 
ATOM   2383 N  N   . THR A  1 318 ? 29.092  -8.510  5.649   1.00 67.69  ? 318  THR A N   1 
ATOM   2384 C  CA  . THR A  1 318 ? 29.416  -9.902  5.960   1.00 68.97  ? 318  THR A CA  1 
ATOM   2385 C  C   . THR A  1 318 ? 29.185  -10.283 7.423   1.00 74.74  ? 318  THR A C   1 
ATOM   2386 O  O   . THR A  1 318 ? 29.664  -11.322 7.879   1.00 83.96  ? 318  THR A O   1 
ATOM   2387 C  CB  . THR A  1 318 ? 30.883  -10.218 5.598   1.00 66.31  ? 318  THR A CB  1 
ATOM   2388 O  OG1 . THR A  1 318 ? 31.760  -9.580  6.535   1.00 60.83  ? 318  THR A OG1 1 
ATOM   2389 C  CG2 . THR A  1 318 ? 31.204  -9.719  4.194   1.00 61.89  ? 318  THR A CG2 1 
ATOM   2390 N  N   . GLY A  1 319 ? 28.447  -9.453  8.153   1.00 71.96  ? 319  GLY A N   1 
ATOM   2391 C  CA  . GLY A  1 319 ? 28.230  -9.692  9.570   1.00 64.76  ? 319  GLY A CA  1 
ATOM   2392 C  C   . GLY A  1 319 ? 26.883  -10.301 9.921   1.00 66.67  ? 319  GLY A C   1 
ATOM   2393 O  O   . GLY A  1 319 ? 25.890  -10.088 9.224   1.00 71.64  ? 319  GLY A O   1 
ATOM   2394 N  N   . ASP A  1 320 ? 26.853  -11.066 11.009  1.00 66.41  ? 320  ASP A N   1 
ATOM   2395 C  CA  . ASP A  1 320 ? 25.608  -11.623 11.531  1.00 67.69  ? 320  ASP A CA  1 
ATOM   2396 C  C   . ASP A  1 320 ? 25.077  -10.715 12.639  1.00 63.63  ? 320  ASP A C   1 
ATOM   2397 O  O   . ASP A  1 320 ? 25.749  -10.499 13.647  1.00 65.22  ? 320  ASP A O   1 
ATOM   2398 C  CB  . ASP A  1 320 ? 25.842  -13.041 12.064  1.00 73.14  ? 320  ASP A CB  1 
ATOM   2399 C  CG  . ASP A  1 320 ? 24.560  -13.719 12.519  1.00 79.45  ? 320  ASP A CG  1 
ATOM   2400 O  OD1 . ASP A  1 320 ? 23.464  -13.296 12.091  1.00 81.19  ? 320  ASP A OD1 1 
ATOM   2401 O  OD2 . ASP A  1 320 ? 24.652  -14.689 13.301  1.00 83.22  ? 320  ASP A OD2 1 
ATOM   2402 N  N   . PHE A  1 321 ? 23.873  -10.181 12.449  1.00 60.01  ? 321  PHE A N   1 
ATOM   2403 C  CA  . PHE A  1 321 ? 23.327  -9.198  13.382  1.00 63.21  ? 321  PHE A CA  1 
ATOM   2404 C  C   . PHE A  1 321 ? 22.005  -9.615  14.027  1.00 64.11  ? 321  PHE A C   1 
ATOM   2405 O  O   . PHE A  1 321 ? 21.186  -8.758  14.352  1.00 60.14  ? 321  PHE A O   1 
ATOM   2406 C  CB  . PHE A  1 321 ? 23.145  -7.844  12.686  1.00 60.09  ? 321  PHE A CB  1 
ATOM   2407 C  CG  . PHE A  1 321 ? 24.423  -7.245  12.173  1.00 54.57  ? 321  PHE A CG  1 
ATOM   2408 C  CD1 . PHE A  1 321 ? 25.375  -6.753  13.054  1.00 48.58  ? 321  PHE A CD1 1 
ATOM   2409 C  CD2 . PHE A  1 321 ? 24.666  -7.163  10.811  1.00 61.45  ? 321  PHE A CD2 1 
ATOM   2410 C  CE1 . PHE A  1 321 ? 26.554  -6.198  12.584  1.00 51.44  ? 321  PHE A CE1 1 
ATOM   2411 C  CE2 . PHE A  1 321 ? 25.839  -6.608  10.333  1.00 58.25  ? 321  PHE A CE2 1 
ATOM   2412 C  CZ  . PHE A  1 321 ? 26.786  -6.124  11.222  1.00 53.60  ? 321  PHE A CZ  1 
ATOM   2413 N  N   . GLN A  1 322 ? 21.799  -10.914 14.229  1.00 70.15  ? 322  GLN A N   1 
ATOM   2414 C  CA  . GLN A  1 322 ? 20.563  -11.389 14.854  1.00 72.31  ? 322  GLN A CA  1 
ATOM   2415 C  C   . GLN A  1 322 ? 20.377  -10.864 16.280  1.00 64.12  ? 322  GLN A C   1 
ATOM   2416 O  O   . GLN A  1 322 ? 19.247  -10.686 16.739  1.00 65.11  ? 322  GLN A O   1 
ATOM   2417 C  CB  . GLN A  1 322 ? 20.482  -12.921 14.830  1.00 80.73  ? 322  GLN A CB  1 
ATOM   2418 C  CG  . GLN A  1 322 ? 21.703  -13.634 15.390  1.00 89.31  ? 322  GLN A CG  1 
ATOM   2419 C  CD  . GLN A  1 322 ? 21.497  -15.134 15.498  1.00 96.96  ? 322  GLN A CD  1 
ATOM   2420 O  OE1 . GLN A  1 322 ? 20.384  -15.605 15.731  1.00 99.43  ? 322  GLN A OE1 1 
ATOM   2421 N  NE2 . GLN A  1 322 ? 22.573  -15.892 15.327  1.00 99.61  ? 322  GLN A NE2 1 
ATOM   2422 N  N   . ASP A  1 323 ? 21.484  -10.603 16.970  1.00 60.89  ? 323  ASP A N   1 
ATOM   2423 C  CA  . ASP A  1 323 ? 21.433  -10.110 18.346  1.00 71.46  ? 323  ASP A CA  1 
ATOM   2424 C  C   . ASP A  1 323 ? 21.140  -8.612  18.418  1.00 68.29  ? 323  ASP A C   1 
ATOM   2425 O  O   . ASP A  1 323 ? 20.782  -8.093  19.478  1.00 66.55  ? 323  ASP A O   1 
ATOM   2426 C  CB  . ASP A  1 323 ? 22.757  -10.392 19.063  1.00 80.43  ? 323  ASP A CB  1 
ATOM   2427 C  CG  . ASP A  1 323 ? 23.069  -11.871 19.166  1.00 91.61  ? 323  ASP A CG  1 
ATOM   2428 O  OD1 . ASP A  1 323 ? 22.124  -12.676 19.309  1.00 92.07  ? 323  ASP A OD1 1 
ATOM   2429 O  OD2 . ASP A  1 323 ? 24.265  -12.225 19.111  1.00 99.12  ? 323  ASP A OD2 1 
ATOM   2430 N  N   . LEU A  1 324 ? 21.290  -7.920  17.293  1.00 67.23  ? 324  LEU A N   1 
ATOM   2431 C  CA  . LEU A  1 324 ? 21.245  -6.457  17.287  1.00 59.47  ? 324  LEU A CA  1 
ATOM   2432 C  C   . LEU A  1 324 ? 19.846  -5.862  17.139  1.00 53.33  ? 324  LEU A C   1 
ATOM   2433 O  O   . LEU A  1 324 ? 19.017  -6.365  16.380  1.00 55.21  ? 324  LEU A O   1 
ATOM   2434 C  CB  . LEU A  1 324 ? 22.155  -5.893  16.188  1.00 58.65  ? 324  LEU A CB  1 
ATOM   2435 C  CG  . LEU A  1 324 ? 22.275  -4.365  16.137  1.00 56.88  ? 324  LEU A CG  1 
ATOM   2436 C  CD1 . LEU A  1 324 ? 23.088  -3.854  17.311  1.00 57.44  ? 324  LEU A CD1 1 
ATOM   2437 C  CD2 . LEU A  1 324 ? 22.875  -3.891  14.829  1.00 56.51  ? 324  LEU A CD2 1 
ATOM   2438 N  N   . GLN A  1 325 ? 19.600  -4.786  17.881  1.00 45.67  ? 325  GLN A N   1 
ATOM   2439 C  CA  . GLN A  1 325 ? 18.395  -3.984  17.722  1.00 47.19  ? 325  GLN A CA  1 
ATOM   2440 C  C   . GLN A  1 325 ? 18.791  -2.516  17.587  1.00 48.87  ? 325  GLN A C   1 
ATOM   2441 O  O   . GLN A  1 325 ? 19.374  -1.936  18.506  1.00 45.54  ? 325  GLN A O   1 
ATOM   2442 C  CB  . GLN A  1 325 ? 17.462  -4.185  18.916  1.00 50.28  ? 325  GLN A CB  1 
ATOM   2443 C  CG  . GLN A  1 325 ? 16.919  -5.598  19.032  1.00 56.42  ? 325  GLN A CG  1 
ATOM   2444 C  CD  . GLN A  1 325 ? 16.333  -5.889  20.399  1.00 64.81  ? 325  GLN A CD  1 
ATOM   2445 O  OE1 . GLN A  1 325 ? 15.269  -6.499  20.513  1.00 73.26  ? 325  GLN A OE1 1 
ATOM   2446 N  NE2 . GLN A  1 325 ? 17.032  -5.465  21.445  1.00 59.36  ? 325  GLN A NE2 1 
ATOM   2447 N  N   . VAL A  1 326 ? 18.484  -1.924  16.435  1.00 37.46  ? 326  VAL A N   1 
ATOM   2448 C  CA  . VAL A  1 326 ? 18.906  -0.556  16.139  1.00 37.10  ? 326  VAL A CA  1 
ATOM   2449 C  C   . VAL A  1 326 ? 17.769  0.396   15.779  1.00 45.56  ? 326  VAL A C   1 
ATOM   2450 O  O   . VAL A  1 326 ? 16.767  0.001   15.173  1.00 45.32  ? 326  VAL A O   1 
ATOM   2451 C  CB  . VAL A  1 326 ? 19.951  -0.504  14.996  1.00 42.27  ? 326  VAL A CB  1 
ATOM   2452 C  CG1 . VAL A  1 326 ? 21.354  -0.552  15.555  1.00 38.42  ? 326  VAL A CG1 1 
ATOM   2453 C  CG2 . VAL A  1 326 ? 19.726  -1.633  13.996  1.00 47.44  ? 326  VAL A CG2 1 
ATOM   2454 N  N   . LEU A  1 327 ? 17.947  1.656   16.164  1.00 47.81  ? 327  LEU A N   1 
ATOM   2455 C  CA  . LEU A  1 327 ? 17.068  2.739   15.754  1.00 45.46  ? 327  LEU A CA  1 
ATOM   2456 C  C   . LEU A  1 327 ? 17.898  3.714   14.929  1.00 42.86  ? 327  LEU A C   1 
ATOM   2457 O  O   . LEU A  1 327 ? 18.871  4.281   15.426  1.00 47.52  ? 327  LEU A O   1 
ATOM   2458 C  CB  . LEU A  1 327 ? 16.489  3.445   16.981  1.00 51.73  ? 327  LEU A CB  1 
ATOM   2459 C  CG  . LEU A  1 327 ? 15.631  4.681   16.708  1.00 54.83  ? 327  LEU A CG  1 
ATOM   2460 C  CD1 . LEU A  1 327 ? 14.490  4.308   15.809  1.00 58.37  ? 327  LEU A CD1 1 
ATOM   2461 C  CD2 . LEU A  1 327 ? 15.102  5.275   17.994  1.00 54.14  ? 327  LEU A CD2 1 
ATOM   2462 N  N   . VAL A  1 328 ? 17.530  3.894   13.665  1.00 40.18  ? 328  VAL A N   1 
ATOM   2463 C  CA  . VAL A  1 328 ? 18.271  4.783   12.777  1.00 34.70  ? 328  VAL A CA  1 
ATOM   2464 C  C   . VAL A  1 328 ? 17.341  5.793   12.134  1.00 39.26  ? 328  VAL A C   1 
ATOM   2465 O  O   . VAL A  1 328 ? 16.134  5.569   12.050  1.00 46.34  ? 328  VAL A O   1 
ATOM   2466 C  CB  . VAL A  1 328 ? 18.988  4.002   11.660  1.00 36.44  ? 328  VAL A CB  1 
ATOM   2467 C  CG1 . VAL A  1 328 ? 20.018  3.067   12.248  1.00 33.65  ? 328  VAL A CG1 1 
ATOM   2468 C  CG2 . VAL A  1 328 ? 17.987  3.220   10.826  1.00 29.42  ? 328  VAL A CG2 1 
ATOM   2469 N  N   . GLY A  1 329 ? 17.901  6.903   11.667  1.00 39.08  ? 329  GLY A N   1 
ATOM   2470 C  CA  . GLY A  1 329 ? 17.096  7.906   11.000  1.00 31.65  ? 329  GLY A CA  1 
ATOM   2471 C  C   . GLY A  1 329 ? 17.857  9.151   10.603  1.00 33.18  ? 329  GLY A C   1 
ATOM   2472 O  O   . GLY A  1 329 ? 19.048  9.289   10.891  1.00 39.18  ? 329  GLY A O   1 
ATOM   2473 N  N   . VAL A  1 330 ? 17.154  10.064  9.940   1.00 29.33  ? 330  VAL A N   1 
ATOM   2474 C  CA  . VAL A  1 330 ? 17.762  11.272  9.405   1.00 29.47  ? 330  VAL A CA  1 
ATOM   2475 C  C   . VAL A  1 330 ? 16.825  12.451  9.613   1.00 26.85  ? 330  VAL A C   1 
ATOM   2476 O  O   . VAL A  1 330 ? 15.648  12.262  9.925   1.00 29.69  ? 330  VAL A O   1 
ATOM   2477 C  CB  . VAL A  1 330 ? 18.029  11.137  7.886   1.00 32.56  ? 330  VAL A CB  1 
ATOM   2478 C  CG1 . VAL A  1 330 ? 19.053  10.044  7.604   1.00 26.80  ? 330  VAL A CG1 1 
ATOM   2479 C  CG2 . VAL A  1 330 ? 16.734  10.848  7.145   1.00 21.80  ? 330  VAL A CG2 1 
ATOM   2480 N  N   . VAL A  1 331 ? 17.344  13.664  9.444   1.00 29.32  ? 331  VAL A N   1 
ATOM   2481 C  CA  . VAL A  1 331 ? 16.497  14.853  9.420   1.00 33.83  ? 331  VAL A CA  1 
ATOM   2482 C  C   . VAL A  1 331 ? 16.168  15.181  7.967   1.00 43.03  ? 331  VAL A C   1 
ATOM   2483 O  O   . VAL A  1 331 ? 16.756  14.602  7.049   1.00 38.92  ? 331  VAL A O   1 
ATOM   2484 C  CB  . VAL A  1 331 ? 17.163  16.074  10.103  1.00 32.20  ? 331  VAL A CB  1 
ATOM   2485 C  CG1 . VAL A  1 331 ? 17.464  15.782  11.565  1.00 30.97  ? 331  VAL A CG1 1 
ATOM   2486 C  CG2 . VAL A  1 331 ? 18.432  16.469  9.373   1.00 34.69  ? 331  VAL A CG2 1 
ATOM   2487 N  N   . LYS A  1 332 ? 15.236  16.106  7.758   1.00 42.31  ? 332  LYS A N   1 
ATOM   2488 C  CA  . LYS A  1 332 ? 14.737  16.406  6.417   1.00 45.16  ? 332  LYS A CA  1 
ATOM   2489 C  C   . LYS A  1 332 ? 15.793  17.021  5.498   1.00 49.25  ? 332  LYS A C   1 
ATOM   2490 O  O   . LYS A  1 332 ? 15.847  16.701  4.309   1.00 47.98  ? 332  LYS A O   1 
ATOM   2491 C  CB  . LYS A  1 332 ? 13.505  17.316  6.504   1.00 48.01  ? 332  LYS A CB  1 
ATOM   2492 C  CG  . LYS A  1 332 ? 12.713  17.427  5.204   1.00 39.28  ? 332  LYS A CG  1 
ATOM   2493 C  CD  . LYS A  1 332 ? 11.367  18.110  5.425   1.00 51.69  ? 332  LYS A CD  1 
ATOM   2494 C  CE  . LYS A  1 332 ? 11.340  19.528  4.861   1.00 61.56  ? 332  LYS A CE  1 
ATOM   2495 N  NZ  . LYS A  1 332 ? 12.267  20.463  5.565   1.00 59.64  ? 332  LYS A NZ  1 
ATOM   2496 N  N   . ASP A  1 333 ? 16.631  17.895  6.052   1.00 45.60  ? 333  ASP A N   1 
ATOM   2497 C  CA  . ASP A  1 333 ? 17.616  18.623  5.254   1.00 34.27  ? 333  ASP A CA  1 
ATOM   2498 C  C   . ASP A  1 333 ? 19.035  18.444  5.794   1.00 35.47  ? 333  ASP A C   1 
ATOM   2499 O  O   . ASP A  1 333 ? 19.622  19.375  6.346   1.00 40.71  ? 333  ASP A O   1 
ATOM   2500 C  CB  . ASP A  1 333 ? 17.245  20.108  5.207   1.00 30.13  ? 333  ASP A CB  1 
ATOM   2501 C  CG  . ASP A  1 333 ? 15.836  20.338  4.700   1.00 39.28  ? 333  ASP A CG  1 
ATOM   2502 O  OD1 . ASP A  1 333 ? 14.889  20.243  5.507   1.00 40.66  ? 333  ASP A OD1 1 
ATOM   2503 O  OD2 . ASP A  1 333 ? 15.675  20.616  3.495   1.00 46.89  ? 333  ASP A OD2 1 
ATOM   2504 N  N   . GLU A  1 334 ? 19.584  17.247  5.612   1.00 30.77  ? 334  GLU A N   1 
ATOM   2505 C  CA  . GLU A  1 334 ? 20.884  16.883  6.174   1.00 29.59  ? 334  GLU A CA  1 
ATOM   2506 C  C   . GLU A  1 334 ? 22.054  17.748  5.700   1.00 34.45  ? 334  GLU A C   1 
ATOM   2507 O  O   . GLU A  1 334 ? 22.992  17.996  6.459   1.00 34.41  ? 334  GLU A O   1 
ATOM   2508 C  CB  . GLU A  1 334 ? 21.183  15.405  5.884   1.00 30.80  ? 334  GLU A CB  1 
ATOM   2509 C  CG  . GLU A  1 334 ? 20.321  14.422  6.663   1.00 33.87  ? 334  GLU A CG  1 
ATOM   2510 C  CD  . GLU A  1 334 ? 20.740  14.294  8.118   1.00 41.10  ? 334  GLU A CD  1 
ATOM   2511 O  OE1 . GLU A  1 334 ? 21.797  14.844  8.494   1.00 37.25  ? 334  GLU A OE1 1 
ATOM   2512 O  OE2 . GLU A  1 334 ? 20.012  13.636  8.892   1.00 36.61  ? 334  GLU A OE2 1 
ATOM   2513 N  N   . GLY A  1 335 ? 21.998  18.217  4.457   1.00 31.18  ? 335  GLY A N   1 
ATOM   2514 C  CA  . GLY A  1 335 ? 23.145  18.879  3.858   1.00 24.87  ? 335  GLY A CA  1 
ATOM   2515 C  C   . GLY A  1 335 ? 23.172  20.399  3.869   1.00 30.05  ? 335  GLY A C   1 
ATOM   2516 O  O   . GLY A  1 335 ? 24.234  20.992  3.673   1.00 33.53  ? 335  GLY A O   1 
ATOM   2517 N  N   . SER A  1 336 ? 22.022  21.030  4.105   1.00 30.76  ? 336  SER A N   1 
ATOM   2518 C  CA  . SER A  1 336 ? 21.878  22.483  3.947   1.00 35.82  ? 336  SER A CA  1 
ATOM   2519 C  C   . SER A  1 336 ? 22.955  23.336  4.638   1.00 39.33  ? 336  SER A C   1 
ATOM   2520 O  O   . SER A  1 336 ? 23.460  24.299  4.062   1.00 43.96  ? 336  SER A O   1 
ATOM   2521 C  CB  . SER A  1 336 ? 20.484  22.930  4.393   1.00 36.87  ? 336  SER A CB  1 
ATOM   2522 O  OG  . SER A  1 336 ? 20.247  22.595  5.748   1.00 37.34  ? 336  SER A OG  1 
ATOM   2523 N  N   A TYR A  1 337 ? 23.271  22.898  5.854   0.44 42.90  ? 337  TYR A N   1 
ATOM   2524 N  N   B TYR A  1 337 ? 23.330  23.044  5.876   0.56 43.25  ? 337  TYR A N   1 
ATOM   2525 C  CA  A TYR A  1 337 ? 24.230  23.463  6.794   0.44 43.83  ? 337  TYR A CA  1 
ATOM   2526 C  CA  B TYR A  1 337 ? 24.302  23.960  6.486   0.56 44.06  ? 337  TYR A CA  1 
ATOM   2527 C  C   A TYR A  1 337 ? 25.633  23.606  6.217   0.44 40.33  ? 337  TYR A C   1 
ATOM   2528 C  C   B TYR A  1 337 ? 25.779  23.670  6.206   0.56 39.81  ? 337  TYR A C   1 
ATOM   2529 O  O   A TYR A  1 337 ? 26.275  24.649  6.333   0.44 37.42  ? 337  TYR A O   1 
ATOM   2530 O  O   B TYR A  1 337 ? 26.636  24.492  6.530   0.56 35.33  ? 337  TYR A O   1 
ATOM   2531 C  CB  A TYR A  1 337 ? 24.292  22.475  7.968   0.44 44.28  ? 337  TYR A CB  1 
ATOM   2532 C  CB  B TYR A  1 337 ? 24.021  24.264  7.974   0.56 45.35  ? 337  TYR A CB  1 
ATOM   2533 C  CG  A TYR A  1 337 ? 24.778  22.998  9.301   0.44 43.74  ? 337  TYR A CG  1 
ATOM   2534 C  CG  B TYR A  1 337 ? 24.528  23.261  8.989   0.56 43.91  ? 337  TYR A CG  1 
ATOM   2535 C  CD1 A TYR A  1 337 ? 25.940  23.745  9.408   0.44 46.62  ? 337  TYR A CD1 1 
ATOM   2536 C  CD1 B TYR A  1 337 ? 25.889  23.037  9.175   0.56 43.91  ? 337  TYR A CD1 1 
ATOM   2537 C  CD2 A TYR A  1 337 ? 24.077  22.712  10.464  0.44 44.22  ? 337  TYR A CD2 1 
ATOM   2538 C  CD2 B TYR A  1 337 ? 23.642  22.587  9.807   0.56 43.70  ? 337  TYR A CD2 1 
ATOM   2539 C  CE1 A TYR A  1 337 ? 26.378  24.208  10.631  0.44 51.35  ? 337  TYR A CE1 1 
ATOM   2540 C  CE1 B TYR A  1 337 ? 26.341  22.136  10.103  0.56 42.26  ? 337  TYR A CE1 1 
ATOM   2541 C  CE2 A TYR A  1 337 ? 24.506  23.170  11.691  0.44 50.43  ? 337  TYR A CE2 1 
ATOM   2542 C  CE2 B TYR A  1 337 ? 24.085  21.694  10.741  0.56 44.71  ? 337  TYR A CE2 1 
ATOM   2543 C  CZ  A TYR A  1 337 ? 25.660  23.918  11.770  0.44 52.47  ? 337  TYR A CZ  1 
ATOM   2544 C  CZ  B TYR A  1 337 ? 25.434  21.470  10.888  0.56 49.65  ? 337  TYR A CZ  1 
ATOM   2545 O  OH  A TYR A  1 337 ? 26.100  24.380  12.989  0.44 52.38  ? 337  TYR A OH  1 
ATOM   2546 O  OH  B TYR A  1 337 ? 25.878  20.572  11.825  0.56 55.19  ? 337  TYR A OH  1 
ATOM   2547 N  N   . PHE A  1 338 ? 26.097  22.523  5.613   1.00 38.37  ? 338  PHE A N   1 
ATOM   2548 C  CA  . PHE A  1 338 ? 27.487  22.326  5.238   1.00 36.68  ? 338  PHE A CA  1 
ATOM   2549 C  C   . PHE A  1 338 ? 27.887  23.210  4.062   1.00 34.67  ? 338  PHE A C   1 
ATOM   2550 O  O   . PHE A  1 338 ? 29.067  23.505  3.873   1.00 33.44  ? 338  PHE A O   1 
ATOM   2551 C  CB  . PHE A  1 338 ? 27.748  20.846  4.957   1.00 38.62  ? 338  PHE A CB  1 
ATOM   2552 C  CG  . PHE A  1 338 ? 27.560  19.965  6.163   1.00 41.30  ? 338  PHE A CG  1 
ATOM   2553 C  CD1 . PHE A  1 338 ? 26.310  19.444  6.475   1.00 43.38  ? 338  PHE A CD1 1 
ATOM   2554 C  CD2 . PHE A  1 338 ? 28.633  19.665  6.990   1.00 43.08  ? 338  PHE A CD2 1 
ATOM   2555 C  CE1 . PHE A  1 338 ? 26.135  18.635  7.591   1.00 41.40  ? 338  PHE A CE1 1 
ATOM   2556 C  CE2 . PHE A  1 338 ? 28.469  18.856  8.104   1.00 38.64  ? 338  PHE A CE2 1 
ATOM   2557 C  CZ  . PHE A  1 338 ? 27.217  18.340  8.406   1.00 41.28  ? 338  PHE A CZ  1 
ATOM   2558 N  N   . LEU A  1 339 ? 26.887  23.655  3.304   1.00 36.61  ? 339  LEU A N   1 
ATOM   2559 C  CA  . LEU A  1 339 ? 27.099  24.480  2.118   1.00 38.61  ? 339  LEU A CA  1 
ATOM   2560 C  C   . LEU A  1 339 ? 27.740  25.836  2.424   1.00 43.31  ? 339  LEU A C   1 
ATOM   2561 O  O   . LEU A  1 339 ? 28.533  26.343  1.629   1.00 41.21  ? 339  LEU A O   1 
ATOM   2562 C  CB  . LEU A  1 339 ? 25.769  24.682  1.386   1.00 37.15  ? 339  LEU A CB  1 
ATOM   2563 C  CG  . LEU A  1 339 ? 24.999  23.392  1.097   1.00 39.05  ? 339  LEU A CG  1 
ATOM   2564 C  CD1 . LEU A  1 339 ? 23.710  23.675  0.360   1.00 41.29  ? 339  LEU A CD1 1 
ATOM   2565 C  CD2 . LEU A  1 339 ? 25.862  22.435  0.304   1.00 36.41  ? 339  LEU A CD2 1 
ATOM   2566 N  N   . VAL A  1 340 ? 27.405  26.420  3.572   1.00 44.38  ? 340  VAL A N   1 
ATOM   2567 C  CA  . VAL A  1 340 ? 27.926  27.743  3.915   1.00 42.31  ? 340  VAL A CA  1 
ATOM   2568 C  C   . VAL A  1 340 ? 29.376  27.694  4.397   1.00 34.01  ? 340  VAL A C   1 
ATOM   2569 O  O   . VAL A  1 340 ? 30.031  28.730  4.520   1.00 32.48  ? 340  VAL A O   1 
ATOM   2570 C  CB  . VAL A  1 340 ? 27.036  28.480  4.949   1.00 44.36  ? 340  VAL A CB  1 
ATOM   2571 C  CG1 . VAL A  1 340 ? 25.629  28.643  4.416   1.00 42.22  ? 340  VAL A CG1 1 
ATOM   2572 C  CG2 . VAL A  1 340 ? 27.017  27.744  6.279   1.00 47.98  ? 340  VAL A CG2 1 
ATOM   2573 N  N   . TYR A  1 341 ? 29.878  26.488  4.649   1.00 28.71  ? 341  TYR A N   1 
ATOM   2574 C  CA  . TYR A  1 341 ? 31.261  26.309  5.091   1.00 39.62  ? 341  TYR A CA  1 
ATOM   2575 C  C   . TYR A  1 341 ? 32.232  25.973  3.953   1.00 45.97  ? 341  TYR A C   1 
ATOM   2576 O  O   . TYR A  1 341 ? 33.300  25.401  4.200   1.00 54.09  ? 341  TYR A O   1 
ATOM   2577 C  CB  . TYR A  1 341 ? 31.346  25.228  6.177   1.00 40.16  ? 341  TYR A CB  1 
ATOM   2578 C  CG  . TYR A  1 341 ? 30.796  25.649  7.519   1.00 40.30  ? 341  TYR A CG  1 
ATOM   2579 C  CD1 . TYR A  1 341 ? 31.593  26.315  8.440   1.00 41.36  ? 341  TYR A CD1 1 
ATOM   2580 C  CD2 . TYR A  1 341 ? 29.481  25.375  7.868   1.00 38.00  ? 341  TYR A CD2 1 
ATOM   2581 C  CE1 . TYR A  1 341 ? 31.093  26.702  9.670   1.00 40.69  ? 341  TYR A CE1 1 
ATOM   2582 C  CE2 . TYR A  1 341 ? 28.974  25.759  9.092   1.00 41.74  ? 341  TYR A CE2 1 
ATOM   2583 C  CZ  . TYR A  1 341 ? 29.784  26.421  9.990   1.00 42.59  ? 341  TYR A CZ  1 
ATOM   2584 O  OH  . TYR A  1 341 ? 29.279  26.803  11.211  1.00 50.36  ? 341  TYR A OH  1 
ATOM   2585 N  N   . GLY A  1 342 ? 31.876  26.319  2.716   1.00 43.80  ? 342  GLY A N   1 
ATOM   2586 C  CA  . GLY A  1 342 ? 32.783  26.079  1.602   1.00 46.68  ? 342  GLY A CA  1 
ATOM   2587 C  C   . GLY A  1 342 ? 32.260  26.067  0.172   1.00 51.37  ? 342  GLY A C   1 
ATOM   2588 O  O   . GLY A  1 342 ? 33.055  26.001  -0.771  1.00 57.42  ? 342  GLY A O   1 
ATOM   2589 N  N   . VAL A  1 343 ? 30.943  26.114  -0.016  1.00 43.61  ? 343  VAL A N   1 
ATOM   2590 C  CA  . VAL A  1 343 ? 30.398  26.161  -1.375  1.00 42.61  ? 343  VAL A CA  1 
ATOM   2591 C  C   . VAL A  1 343 ? 30.007  27.585  -1.767  1.00 47.26  ? 343  VAL A C   1 
ATOM   2592 O  O   . VAL A  1 343 ? 29.066  28.149  -1.206  1.00 49.93  ? 343  VAL A O   1 
ATOM   2593 C  CB  . VAL A  1 343 ? 29.193  25.214  -1.571  1.00 37.94  ? 343  VAL A CB  1 
ATOM   2594 C  CG1 . VAL A  1 343 ? 28.731  25.250  -3.018  1.00 38.63  ? 343  VAL A CG1 1 
ATOM   2595 C  CG2 . VAL A  1 343 ? 29.567  23.797  -1.196  1.00 36.93  ? 343  VAL A CG2 1 
ATOM   2596 N  N   . PRO A  1 344 ? 30.732  28.164  -2.740  1.00 45.98  ? 344  PRO A N   1 
ATOM   2597 C  CA  . PRO A  1 344 ? 30.515  29.551  -3.169  1.00 48.17  ? 344  PRO A CA  1 
ATOM   2598 C  C   . PRO A  1 344 ? 29.068  29.798  -3.574  1.00 48.77  ? 344  PRO A C   1 
ATOM   2599 O  O   . PRO A  1 344 ? 28.496  28.992  -4.310  1.00 36.74  ? 344  PRO A O   1 
ATOM   2600 C  CB  . PRO A  1 344 ? 31.426  29.686  -4.396  1.00 39.38  ? 344  PRO A CB  1 
ATOM   2601 C  CG  . PRO A  1 344 ? 32.479  28.642  -4.210  1.00 37.84  ? 344  PRO A CG  1 
ATOM   2602 C  CD  . PRO A  1 344 ? 31.782  27.497  -3.533  1.00 42.28  ? 344  PRO A CD  1 
ATOM   2603 N  N   . GLY A  1 345 ? 28.486  30.891  -3.086  1.00 50.46  ? 345  GLY A N   1 
ATOM   2604 C  CA  . GLY A  1 345 ? 27.114  31.238  -3.411  1.00 41.40  ? 345  GLY A CA  1 
ATOM   2605 C  C   . GLY A  1 345 ? 26.141  30.982  -2.276  1.00 43.44  ? 345  GLY A C   1 
ATOM   2606 O  O   . GLY A  1 345 ? 24.968  31.355  -2.361  1.00 43.28  ? 345  GLY A O   1 
ATOM   2607 N  N   . PHE A  1 346 ? 26.627  30.349  -1.210  1.00 46.42  ? 346  PHE A N   1 
ATOM   2608 C  CA  . PHE A  1 346 ? 25.778  30.019  -0.069  1.00 46.42  ? 346  PHE A CA  1 
ATOM   2609 C  C   . PHE A  1 346 ? 26.107  30.833  1.177   1.00 49.78  ? 346  PHE A C   1 
ATOM   2610 O  O   . PHE A  1 346 ? 27.268  30.948  1.572   1.00 53.31  ? 346  PHE A O   1 
ATOM   2611 C  CB  . PHE A  1 346 ? 25.859  28.523  0.241   1.00 36.85  ? 346  PHE A CB  1 
ATOM   2612 C  CG  . PHE A  1 346 ? 25.242  27.653  -0.818  1.00 40.09  ? 346  PHE A CG  1 
ATOM   2613 C  CD1 . PHE A  1 346 ? 25.988  27.219  -1.909  1.00 39.39  ? 346  PHE A CD1 1 
ATOM   2614 C  CD2 . PHE A  1 346 ? 23.912  27.271  -0.725  1.00 35.69  ? 346  PHE A CD2 1 
ATOM   2615 C  CE1 . PHE A  1 346 ? 25.413  26.416  -2.886  1.00 38.99  ? 346  PHE A CE1 1 
ATOM   2616 C  CE2 . PHE A  1 346 ? 23.331  26.470  -1.697  1.00 34.85  ? 346  PHE A CE2 1 
ATOM   2617 C  CZ  . PHE A  1 346 ? 24.081  26.042  -2.777  1.00 38.26  ? 346  PHE A CZ  1 
ATOM   2618 N  N   . SER A  1 347 ? 25.068  31.396  1.789   1.00 52.44  ? 347  SER A N   1 
ATOM   2619 C  CA  . SER A  1 347 ? 25.200  32.146  3.035   1.00 54.02  ? 347  SER A CA  1 
ATOM   2620 C  C   . SER A  1 347 ? 23.949  31.944  3.876   1.00 53.73  ? 347  SER A C   1 
ATOM   2621 O  O   . SER A  1 347 ? 22.911  31.523  3.364   1.00 57.72  ? 347  SER A O   1 
ATOM   2622 C  CB  . SER A  1 347 ? 25.394  33.640  2.754   1.00 55.12  ? 347  SER A CB  1 
ATOM   2623 O  OG  . SER A  1 347 ? 25.645  34.356  3.952   1.00 61.33  ? 347  SER A OG  1 
ATOM   2624 N  N   . LYS A  1 348 ? 24.049  32.236  5.168   1.00 44.23  ? 348  LYS A N   1 
ATOM   2625 C  CA  . LYS A  1 348 ? 22.886  32.183  6.043   1.00 43.37  ? 348  LYS A CA  1 
ATOM   2626 C  C   . LYS A  1 348 ? 22.162  33.522  6.010   1.00 41.72  ? 348  LYS A C   1 
ATOM   2627 O  O   . LYS A  1 348 ? 21.037  33.645  6.500   1.00 44.98  ? 348  LYS A O   1 
ATOM   2628 C  CB  . LYS A  1 348 ? 23.303  31.853  7.480   1.00 42.26  ? 348  LYS A CB  1 
ATOM   2629 C  CG  . LYS A  1 348 ? 23.874  33.036  8.254   1.00 43.87  ? 348  LYS A CG  1 
ATOM   2630 C  CD  . LYS A  1 348 ? 24.221  32.651  9.689   1.00 51.31  ? 348  LYS A CD  1 
ATOM   2631 C  CE  . LYS A  1 348 ? 24.584  33.874  10.526  1.00 50.88  ? 348  LYS A CE  1 
ATOM   2632 N  NZ  . LYS A  1 348 ? 23.454  34.833  10.651  1.00 54.87  ? 348  LYS A NZ  1 
ATOM   2633 N  N   . ASP A  1 349 ? 22.813  34.522  5.420   1.00 40.40  ? 349  ASP A N   1 
ATOM   2634 C  CA  . ASP A  1 349 ? 22.292  35.885  5.429   1.00 43.91  ? 349  ASP A CA  1 
ATOM   2635 C  C   . ASP A  1 349 ? 21.563  36.263  4.140   1.00 49.43  ? 349  ASP A C   1 
ATOM   2636 O  O   . ASP A  1 349 ? 21.052  37.376  4.019   1.00 54.47  ? 349  ASP A O   1 
ATOM   2637 C  CB  . ASP A  1 349 ? 23.413  36.880  5.740   1.00 43.54  ? 349  ASP A CB  1 
ATOM   2638 C  CG  . ASP A  1 349 ? 24.000  36.677  7.124   1.00 52.89  ? 349  ASP A CG  1 
ATOM   2639 O  OD1 . ASP A  1 349 ? 23.216  36.532  8.089   1.00 50.12  ? 349  ASP A OD1 1 
ATOM   2640 O  OD2 . ASP A  1 349 ? 25.243  36.652  7.247   1.00 55.87  ? 349  ASP A OD2 1 
ATOM   2641 N  N   . ASN A  1 350 ? 21.521  35.339  3.183   1.00 47.48  ? 350  ASN A N   1 
ATOM   2642 C  CA  . ASN A  1 350 ? 20.658  35.491  2.010   1.00 50.29  ? 350  ASN A CA  1 
ATOM   2643 C  C   . ASN A  1 350 ? 20.027  34.164  1.588   1.00 50.23  ? 350  ASN A C   1 
ATOM   2644 O  O   . ASN A  1 350 ? 20.272  33.129  2.212   1.00 45.80  ? 350  ASN A O   1 
ATOM   2645 C  CB  . ASN A  1 350 ? 21.381  36.181  0.839   1.00 54.10  ? 350  ASN A CB  1 
ATOM   2646 C  CG  . ASN A  1 350 ? 22.590  35.404  0.336   1.00 67.08  ? 350  ASN A CG  1 
ATOM   2647 O  OD1 . ASN A  1 350 ? 22.518  34.203  0.083   1.00 71.23  ? 350  ASN A OD1 1 
ATOM   2648 N  ND2 . ASN A  1 350 ? 23.710  36.101  0.176   1.00 82.62  ? 350  ASN A ND2 1 
ATOM   2649 N  N   . GLU A  1 351 ? 19.223  34.197  0.529   1.00 46.23  ? 351  GLU A N   1 
ATOM   2650 C  CA  . GLU A  1 351 ? 18.458  33.025  0.114   1.00 41.04  ? 351  GLU A CA  1 
ATOM   2651 C  C   . GLU A  1 351 ? 19.317  31.959  -0.573  1.00 36.84  ? 351  GLU A C   1 
ATOM   2652 O  O   . GLU A  1 351 ? 18.843  30.849  -0.838  1.00 37.72  ? 351  GLU A O   1 
ATOM   2653 C  CB  . GLU A  1 351 ? 17.296  33.443  -0.793  1.00 51.12  ? 351  GLU A CB  1 
ATOM   2654 C  CG  . GLU A  1 351 ? 16.409  34.539  -0.210  1.00 63.05  ? 351  GLU A CG  1 
ATOM   2655 C  CD  . GLU A  1 351 ? 15.695  34.104  1.053   1.00 81.27  ? 351  GLU A CD  1 
ATOM   2656 O  OE1 . GLU A  1 351 ? 15.376  32.904  1.174   1.00 84.40  ? 351  GLU A OE1 1 
ATOM   2657 O  OE2 . GLU A  1 351 ? 15.452  34.964  1.926   1.00 93.39  ? 351  GLU A OE2 1 
ATOM   2658 N  N   . SER A  1 352 ? 20.573  32.303  -0.853  1.00 37.03  ? 352  SER A N   1 
ATOM   2659 C  CA  . SER A  1 352 ? 21.527  31.391  -1.488  1.00 44.47  ? 352  SER A CA  1 
ATOM   2660 C  C   . SER A  1 352 ? 21.034  30.800  -2.811  1.00 41.80  ? 352  SER A C   1 
ATOM   2661 O  O   . SER A  1 352 ? 21.336  29.649  -3.134  1.00 41.93  ? 352  SER A O   1 
ATOM   2662 C  CB  . SER A  1 352 ? 21.938  30.271  -0.527  1.00 42.10  ? 352  SER A CB  1 
ATOM   2663 O  OG  . SER A  1 352 ? 22.504  30.806  0.658   1.00 43.77  ? 352  SER A OG  1 
ATOM   2664 N  N   . LEU A  1 353 ? 20.274  31.585  -3.568  1.00 39.28  ? 353  LEU A N   1 
ATOM   2665 C  CA  . LEU A  1 353 ? 19.888  31.179  -4.913  1.00 46.17  ? 353  LEU A CA  1 
ATOM   2666 C  C   . LEU A  1 353 ? 21.137  31.178  -5.792  1.00 47.65  ? 353  LEU A C   1 
ATOM   2667 O  O   . LEU A  1 353 ? 21.846  32.179  -5.873  1.00 47.19  ? 353  LEU A O   1 
ATOM   2668 C  CB  . LEU A  1 353 ? 18.825  32.119  -5.487  1.00 42.70  ? 353  LEU A CB  1 
ATOM   2669 C  CG  . LEU A  1 353 ? 17.483  32.184  -4.751  1.00 54.14  ? 353  LEU A CG  1 
ATOM   2670 C  CD1 . LEU A  1 353 ? 16.456  32.970  -5.556  1.00 55.44  ? 353  LEU A CD1 1 
ATOM   2671 C  CD2 . LEU A  1 353 ? 16.964  30.795  -4.444  1.00 47.34  ? 353  LEU A CD2 1 
ATOM   2672 N  N   . ILE A  1 354 ? 21.415  30.049  -6.434  1.00 46.09  ? 354  ILE A N   1 
ATOM   2673 C  CA  . ILE A  1 354 ? 22.658  29.901  -7.184  1.00 42.84  ? 354  ILE A CA  1 
ATOM   2674 C  C   . ILE A  1 354 ? 22.436  29.679  -8.677  1.00 42.41  ? 354  ILE A C   1 
ATOM   2675 O  O   . ILE A  1 354 ? 21.334  29.342  -9.111  1.00 41.03  ? 354  ILE A O   1 
ATOM   2676 C  CB  . ILE A  1 354 ? 23.524  28.753  -6.624  1.00 36.20  ? 354  ILE A CB  1 
ATOM   2677 C  CG1 . ILE A  1 354 ? 22.723  27.447  -6.576  1.00 28.30  ? 354  ILE A CG1 1 
ATOM   2678 C  CG2 . ILE A  1 354 ? 24.047  29.102  -5.238  1.00 33.47  ? 354  ILE A CG2 1 
ATOM   2679 C  CD1 . ILE A  1 354 ? 23.593  26.202  -6.538  1.00 29.38  ? 354  ILE A CD1 1 
ATOM   2680 N  N   . SER A  1 355 ? 23.493  29.875  -9.461  1.00 48.00  ? 355  SER A N   1 
ATOM   2681 C  CA  . SER A  1 355 ? 23.443  29.602  -10.892 1.00 43.43  ? 355  SER A CA  1 
ATOM   2682 C  C   . SER A  1 355 ? 23.767  28.140  -11.143 1.00 45.15  ? 355  SER A C   1 
ATOM   2683 O  O   . SER A  1 355 ? 24.249  27.438  -10.251 1.00 43.55  ? 355  SER A O   1 
ATOM   2684 C  CB  . SER A  1 355 ? 24.445  30.475  -11.645 1.00 43.22  ? 355  SER A CB  1 
ATOM   2685 O  OG  . SER A  1 355 ? 25.776  30.085  -11.356 1.00 50.86  ? 355  SER A OG  1 
ATOM   2686 N  N   . ARG A  1 356 ? 23.495  27.680  -12.359 1.00 43.21  ? 356  ARG A N   1 
ATOM   2687 C  CA  . ARG A  1 356 ? 23.850  26.322  -12.747 1.00 48.46  ? 356  ARG A CA  1 
ATOM   2688 C  C   . ARG A  1 356 ? 25.361  26.122  -12.653 1.00 47.72  ? 356  ARG A C   1 
ATOM   2689 O  O   . ARG A  1 356 ? 25.828  25.072  -12.219 1.00 50.84  ? 356  ARG A O   1 
ATOM   2690 C  CB  . ARG A  1 356 ? 23.343  26.011  -14.159 1.00 51.23  ? 356  ARG A CB  1 
ATOM   2691 C  CG  . ARG A  1 356 ? 23.664  24.600  -14.619 1.00 53.71  ? 356  ARG A CG  1 
ATOM   2692 C  CD  . ARG A  1 356 ? 22.696  24.105  -15.678 1.00 54.58  ? 356  ARG A CD  1 
ATOM   2693 N  NE  . ARG A  1 356 ? 22.955  22.703  -15.996 1.00 59.60  ? 356  ARG A NE  1 
ATOM   2694 C  CZ  . ARG A  1 356 ? 22.466  21.682  -15.300 1.00 58.47  ? 356  ARG A CZ  1 
ATOM   2695 N  NH1 . ARG A  1 356 ? 21.687  21.906  -14.251 1.00 55.40  ? 356  ARG A NH1 1 
ATOM   2696 N  NH2 . ARG A  1 356 ? 22.753  20.436  -15.650 1.00 59.61  ? 356  ARG A NH2 1 
ATOM   2697 N  N   . ALA A  1 357 ? 26.119  27.142  -13.042 1.00 46.20  ? 357  ALA A N   1 
ATOM   2698 C  CA  . ALA A  1 357 ? 27.574  27.089  -12.952 1.00 47.04  ? 357  ALA A CA  1 
ATOM   2699 C  C   . ALA A  1 357 ? 28.044  26.892  -11.514 1.00 46.01  ? 357  ALA A C   1 
ATOM   2700 O  O   . ALA A  1 357 ? 28.986  26.137  -11.259 1.00 48.87  ? 357  ALA A O   1 
ATOM   2701 C  CB  . ALA A  1 357 ? 28.184  28.347  -13.537 1.00 37.78  ? 357  ALA A CB  1 
ATOM   2702 N  N   . GLN A  1 358 ? 27.397  27.582  -10.579 1.00 42.30  ? 358  GLN A N   1 
ATOM   2703 C  CA  . GLN A  1 358 ? 27.719  27.427  -9.166  1.00 44.15  ? 358  GLN A CA  1 
ATOM   2704 C  C   . GLN A  1 358 ? 27.336  26.034  -8.674  1.00 42.80  ? 358  GLN A C   1 
ATOM   2705 O  O   . GLN A  1 358 ? 27.983  25.488  -7.784  1.00 39.01  ? 358  GLN A O   1 
ATOM   2706 C  CB  . GLN A  1 358 ? 27.025  28.507  -8.327  1.00 45.13  ? 358  GLN A CB  1 
ATOM   2707 C  CG  . GLN A  1 358 ? 27.520  29.928  -8.593  1.00 46.89  ? 358  GLN A CG  1 
ATOM   2708 C  CD  . GLN A  1 358 ? 26.719  30.979  -7.848  1.00 49.13  ? 358  GLN A CD  1 
ATOM   2709 O  OE1 . GLN A  1 358 ? 25.503  31.075  -8.005  1.00 52.65  ? 358  GLN A OE1 1 
ATOM   2710 N  NE2 . GLN A  1 358 ? 27.400  31.776  -7.033  1.00 49.07  ? 358  GLN A NE2 1 
ATOM   2711 N  N   . PHE A  1 359 ? 26.286  25.464  -9.262  1.00 41.20  ? 359  PHE A N   1 
ATOM   2712 C  CA  . PHE A  1 359 ? 25.842  24.120  -8.906  1.00 37.62  ? 359  PHE A CA  1 
ATOM   2713 C  C   . PHE A  1 359 ? 26.905  23.089  -9.278  1.00 37.36  ? 359  PHE A C   1 
ATOM   2714 O  O   . PHE A  1 359 ? 27.256  22.227  -8.471  1.00 36.36  ? 359  PHE A O   1 
ATOM   2715 C  CB  . PHE A  1 359 ? 24.506  23.802  -9.587  1.00 35.30  ? 359  PHE A CB  1 
ATOM   2716 C  CG  . PHE A  1 359 ? 23.991  22.417  -9.312  1.00 33.01  ? 359  PHE A CG  1 
ATOM   2717 C  CD1 . PHE A  1 359 ? 23.784  21.980  -8.011  1.00 42.02  ? 359  PHE A CD1 1 
ATOM   2718 C  CD2 . PHE A  1 359 ? 23.695  21.556  -10.358 1.00 35.39  ? 359  PHE A CD2 1 
ATOM   2719 C  CE1 . PHE A  1 359 ? 23.305  20.701  -7.759  1.00 42.37  ? 359  PHE A CE1 1 
ATOM   2720 C  CE2 . PHE A  1 359 ? 23.216  20.277  -10.115 1.00 35.93  ? 359  PHE A CE2 1 
ATOM   2721 C  CZ  . PHE A  1 359 ? 23.020  19.850  -8.815  1.00 40.50  ? 359  PHE A CZ  1 
ATOM   2722 N  N   . LEU A  1 360 ? 27.422  23.198  -10.500 1.00 37.70  ? 360  LEU A N   1 
ATOM   2723 C  CA  . LEU A  1 360 ? 28.477  22.309  -10.981 1.00 36.68  ? 360  LEU A CA  1 
ATOM   2724 C  C   . LEU A  1 360 ? 29.748  22.439  -10.140 1.00 38.72  ? 360  LEU A C   1 
ATOM   2725 O  O   . LEU A  1 360 ? 30.388  21.441  -9.812  1.00 42.98  ? 360  LEU A O   1 
ATOM   2726 C  CB  . LEU A  1 360 ? 28.791  22.594  -12.452 1.00 40.59  ? 360  LEU A CB  1 
ATOM   2727 C  CG  . LEU A  1 360 ? 27.596  22.673  -13.409 1.00 53.25  ? 360  LEU A CG  1 
ATOM   2728 C  CD1 . LEU A  1 360 ? 28.036  22.714  -14.865 1.00 56.15  ? 360  LEU A CD1 1 
ATOM   2729 C  CD2 . LEU A  1 360 ? 26.652  21.521  -13.183 1.00 48.28  ? 360  LEU A CD2 1 
ATOM   2730 N  N   . ALA A  1 361 ? 30.108  23.670  -9.790  1.00 36.75  ? 361  ALA A N   1 
ATOM   2731 C  CA  . ALA A  1 361 ? 31.283  23.910  -8.956  1.00 37.49  ? 361  ALA A CA  1 
ATOM   2732 C  C   . ALA A  1 361 ? 31.100  23.322  -7.558  1.00 39.54  ? 361  ALA A C   1 
ATOM   2733 O  O   . ALA A  1 361 ? 32.046  22.797  -6.965  1.00 43.58  ? 361  ALA A O   1 
ATOM   2734 C  CB  . ALA A  1 361 ? 31.581  25.399  -8.874  1.00 32.78  ? 361  ALA A CB  1 
ATOM   2735 N  N   . GLY A  1 362 ? 29.879  23.412  -7.037  1.00 36.78  ? 362  GLY A N   1 
ATOM   2736 C  CA  . GLY A  1 362 ? 29.571  22.923  -5.702  1.00 39.27  ? 362  GLY A CA  1 
ATOM   2737 C  C   . GLY A  1 362 ? 29.539  21.409  -5.599  1.00 43.14  ? 362  GLY A C   1 
ATOM   2738 O  O   . GLY A  1 362 ? 29.831  20.843  -4.541  1.00 37.55  ? 362  GLY A O   1 
ATOM   2739 N  N   . VAL A  1 363 ? 29.175  20.752  -6.697  1.00 37.75  ? 363  VAL A N   1 
ATOM   2740 C  CA  . VAL A  1 363 ? 29.151  19.293  -6.750  1.00 33.34  ? 363  VAL A CA  1 
ATOM   2741 C  C   . VAL A  1 363 ? 30.572  18.734  -6.629  1.00 40.62  ? 363  VAL A C   1 
ATOM   2742 O  O   . VAL A  1 363 ? 30.796  17.741  -5.930  1.00 41.34  ? 363  VAL A O   1 
ATOM   2743 C  CB  . VAL A  1 363 ? 28.438  18.789  -8.035  1.00 38.17  ? 363  VAL A CB  1 
ATOM   2744 C  CG1 . VAL A  1 363 ? 28.714  17.312  -8.287  1.00 26.14  ? 363  VAL A CG1 1 
ATOM   2745 C  CG2 . VAL A  1 363 ? 26.940  19.033  -7.935  1.00 29.94  ? 363  VAL A CG2 1 
ATOM   2746 N  N   . ARG A  1 364 ? 31.529  19.389  -7.285  1.00 39.70  ? 364  ARG A N   1 
ATOM   2747 C  CA  . ARG A  1 364 ? 32.938  19.003  -7.170  1.00 42.69  ? 364  ARG A CA  1 
ATOM   2748 C  C   . ARG A  1 364 ? 33.453  19.146  -5.737  1.00 41.66  ? 364  ARG A C   1 
ATOM   2749 O  O   . ARG A  1 364 ? 34.330  18.396  -5.306  1.00 43.31  ? 364  ARG A O   1 
ATOM   2750 C  CB  . ARG A  1 364 ? 33.822  19.842  -8.097  1.00 41.73  ? 364  ARG A CB  1 
ATOM   2751 C  CG  . ARG A  1 364 ? 33.428  19.818  -9.564  1.00 44.64  ? 364  ARG A CG  1 
ATOM   2752 C  CD  . ARG A  1 364 ? 33.061  18.419  -10.023 1.00 52.84  ? 364  ARG A CD  1 
ATOM   2753 N  NE  . ARG A  1 364 ? 34.180  17.482  -9.960  1.00 62.32  ? 364  ARG A NE  1 
ATOM   2754 C  CZ  . ARG A  1 364 ? 34.964  17.185  -10.993 1.00 65.20  ? 364  ARG A CZ  1 
ATOM   2755 N  NH1 . ARG A  1 364 ? 34.756  17.756  -12.173 1.00 55.63  ? 364  ARG A NH1 1 
ATOM   2756 N  NH2 . ARG A  1 364 ? 35.958  16.319  -10.848 1.00 64.16  ? 364  ARG A NH2 1 
ATOM   2757 N  N   . ILE A  1 365 ? 32.914  20.123  -5.013  1.00 35.92  ? 365  ILE A N   1 
ATOM   2758 C  CA  . ILE A  1 365 ? 33.304  20.373  -3.628  1.00 46.31  ? 365  ILE A CA  1 
ATOM   2759 C  C   . ILE A  1 365 ? 32.580  19.420  -2.675  1.00 39.29  ? 365  ILE A C   1 
ATOM   2760 O  O   . ILE A  1 365 ? 33.183  18.890  -1.740  1.00 38.97  ? 365  ILE A O   1 
ATOM   2761 C  CB  . ILE A  1 365 ? 33.038  21.849  -3.237  1.00 40.27  ? 365  ILE A CB  1 
ATOM   2762 C  CG1 . ILE A  1 365 ? 33.814  22.784  -4.173  1.00 34.47  ? 365  ILE A CG1 1 
ATOM   2763 C  CG2 . ILE A  1 365 ? 33.425  22.117  -1.789  1.00 28.12  ? 365  ILE A CG2 1 
ATOM   2764 C  CD1 . ILE A  1 365 ? 33.517  24.260  -3.973  1.00 32.41  ? 365  ILE A CD1 1 
ATOM   2765 N  N   . GLY A  1 366 ? 31.292  19.193  -2.927  1.00 39.28  ? 366  GLY A N   1 
ATOM   2766 C  CA  . GLY A  1 366 ? 30.486  18.307  -2.099  1.00 41.93  ? 366  GLY A CA  1 
ATOM   2767 C  C   . GLY A  1 366 ? 30.753  16.831  -2.335  1.00 43.11  ? 366  GLY A C   1 
ATOM   2768 O  O   . GLY A  1 366 ? 30.512  16.006  -1.455  1.00 47.37  ? 366  GLY A O   1 
ATOM   2769 N  N   . VAL A  1 367 ? 31.239  16.498  -3.528  1.00 37.50  ? 367  VAL A N   1 
ATOM   2770 C  CA  . VAL A  1 367 ? 31.639  15.130  -3.848  1.00 34.34  ? 367  VAL A CA  1 
ATOM   2771 C  C   . VAL A  1 367 ? 33.108  15.133  -4.276  1.00 39.44  ? 367  VAL A C   1 
ATOM   2772 O  O   . VAL A  1 367 ? 33.413  14.864  -5.439  1.00 39.33  ? 367  VAL A O   1 
ATOM   2773 C  CB  . VAL A  1 367 ? 30.780  14.533  -4.997  1.00 38.29  ? 367  VAL A CB  1 
ATOM   2774 C  CG1 . VAL A  1 367 ? 30.849  13.016  -4.982  1.00 35.10  ? 367  VAL A CG1 1 
ATOM   2775 C  CG2 . VAL A  1 367 ? 29.329  14.976  -4.888  1.00 32.71  ? 367  VAL A CG2 1 
ATOM   2776 N  N   . PRO A  1 368 ? 34.026  15.431  -3.333  1.00 41.08  ? 368  PRO A N   1 
ATOM   2777 C  CA  . PRO A  1 368 ? 35.427  15.694  -3.697  1.00 36.06  ? 368  PRO A CA  1 
ATOM   2778 C  C   . PRO A  1 368 ? 36.192  14.501  -4.275  1.00 44.82  ? 368  PRO A C   1 
ATOM   2779 O  O   . PRO A  1 368 ? 37.203  14.711  -4.949  1.00 52.09  ? 368  PRO A O   1 
ATOM   2780 C  CB  . PRO A  1 368 ? 36.061  16.145  -2.373  1.00 39.81  ? 368  PRO A CB  1 
ATOM   2781 C  CG  . PRO A  1 368 ? 35.191  15.563  -1.307  1.00 36.96  ? 368  PRO A CG  1 
ATOM   2782 C  CD  . PRO A  1 368 ? 33.803  15.530  -1.877  1.00 34.96  ? 368  PRO A CD  1 
ATOM   2783 N  N   . GLN A  1 369 ? 35.729  13.280  -4.019  1.00 49.45  ? 369  GLN A N   1 
ATOM   2784 C  CA  . GLN A  1 369 ? 36.375  12.095  -4.592  1.00 53.00  ? 369  GLN A CA  1 
ATOM   2785 C  C   . GLN A  1 369 ? 35.858  11.713  -5.981  1.00 51.57  ? 369  GLN A C   1 
ATOM   2786 O  O   . GLN A  1 369 ? 36.322  10.736  -6.566  1.00 58.41  ? 369  GLN A O   1 
ATOM   2787 C  CB  . GLN A  1 369 ? 36.269  10.887  -3.653  1.00 54.86  ? 369  GLN A CB  1 
ATOM   2788 C  CG  . GLN A  1 369 ? 35.296  11.047  -2.495  1.00 68.12  ? 369  GLN A CG  1 
ATOM   2789 C  CD  . GLN A  1 369 ? 33.839  11.093  -2.920  1.00 69.28  ? 369  GLN A CD  1 
ATOM   2790 O  OE1 . GLN A  1 369 ? 33.189  12.137  -2.832  1.00 64.38  ? 369  GLN A OE1 1 
ATOM   2791 N  NE2 . GLN A  1 369 ? 33.313  9.957   -3.364  1.00 69.49  ? 369  GLN A NE2 1 
ATOM   2792 N  N   . ALA A  1 370 ? 34.911  12.480  -6.511  1.00 47.61  ? 370  ALA A N   1 
ATOM   2793 C  CA  . ALA A  1 370 ? 34.316  12.163  -7.812  1.00 45.01  ? 370  ALA A CA  1 
ATOM   2794 C  C   . ALA A  1 370 ? 35.213  12.517  -8.992  1.00 47.66  ? 370  ALA A C   1 
ATOM   2795 O  O   . ALA A  1 370 ? 35.768  13.614  -9.053  1.00 45.37  ? 370  ALA A O   1 
ATOM   2796 C  CB  . ALA A  1 370 ? 32.971  12.858  -7.966  1.00 41.70  ? 370  ALA A CB  1 
ATOM   2797 N  N   . SER A  1 371 ? 35.333  11.594  -9.942  1.00 53.64  ? 371  SER A N   1 
ATOM   2798 C  CA  . SER A  1 371 ? 35.960  11.909  -11.219 1.00 55.53  ? 371  SER A CA  1 
ATOM   2799 C  C   . SER A  1 371 ? 35.045  12.861  -11.976 1.00 55.50  ? 371  SER A C   1 
ATOM   2800 O  O   . SER A  1 371 ? 33.927  13.134  -11.533 1.00 56.50  ? 371  SER A O   1 
ATOM   2801 C  CB  . SER A  1 371 ? 36.200  10.641  -12.040 1.00 62.41  ? 371  SER A CB  1 
ATOM   2802 O  OG  . SER A  1 371 ? 34.983  10.000  -12.379 1.00 64.77  ? 371  SER A OG  1 
ATOM   2803 N  N   . ASP A  1 372 ? 35.515  13.380  -13.105 1.00 50.12  ? 372  ASP A N   1 
ATOM   2804 C  CA  . ASP A  1 372 ? 34.689  14.273  -13.906 1.00 55.87  ? 372  ASP A CA  1 
ATOM   2805 C  C   . ASP A  1 372 ? 33.418  13.561  -14.371 1.00 52.23  ? 372  ASP A C   1 
ATOM   2806 O  O   . ASP A  1 372 ? 32.329  14.139  -14.343 1.00 51.40  ? 372  ASP A O   1 
ATOM   2807 C  CB  . ASP A  1 372 ? 35.472  14.826  -15.103 1.00 67.73  ? 372  ASP A CB  1 
ATOM   2808 C  CG  . ASP A  1 372 ? 36.567  15.794  -14.689 1.00 78.55  ? 372  ASP A CG  1 
ATOM   2809 O  OD1 . ASP A  1 372 ? 37.408  15.421  -13.845 1.00 81.98  ? 372  ASP A OD1 1 
ATOM   2810 O  OD2 . ASP A  1 372 ? 36.582  16.930  -15.207 1.00 82.84  ? 372  ASP A OD2 1 
ATOM   2811 N  N   . LEU A  1 373 ? 33.558  12.299  -14.776 1.00 49.33  ? 373  LEU A N   1 
ATOM   2812 C  CA  . LEU A  1 373 ? 32.417  11.503  -15.230 1.00 49.47  ? 373  LEU A CA  1 
ATOM   2813 C  C   . LEU A  1 373 ? 31.401  11.268  -14.111 1.00 51.75  ? 373  LEU A C   1 
ATOM   2814 O  O   . LEU A  1 373 ? 30.193  11.393  -14.322 1.00 45.90  ? 373  LEU A O   1 
ATOM   2815 C  CB  . LEU A  1 373 ? 32.887  10.162  -15.803 1.00 45.93  ? 373  LEU A CB  1 
ATOM   2816 C  CG  . LEU A  1 373 ? 31.777  9.260   -16.355 1.00 49.81  ? 373  LEU A CG  1 
ATOM   2817 C  CD1 . LEU A  1 373 ? 30.992  10.005  -17.417 1.00 49.99  ? 373  LEU A CD1 1 
ATOM   2818 C  CD2 . LEU A  1 373 ? 32.334  7.962   -16.916 1.00 49.18  ? 373  LEU A CD2 1 
ATOM   2819 N  N   . ALA A  1 374 ? 31.893  10.928  -12.924 1.00 51.17  ? 374  ALA A N   1 
ATOM   2820 C  CA  . ALA A  1 374 ? 31.022  10.683  -11.780 1.00 46.30  ? 374  ALA A CA  1 
ATOM   2821 C  C   . ALA A  1 374 ? 30.314  11.962  -11.361 1.00 41.26  ? 374  ALA A C   1 
ATOM   2822 O  O   . ALA A  1 374 ? 29.132  11.947  -11.013 1.00 37.01  ? 374  ALA A O   1 
ATOM   2823 C  CB  . ALA A  1 374 ? 31.820  10.115  -10.620 1.00 41.94  ? 374  ALA A CB  1 
ATOM   2824 N  N   . ALA A  1 375 ? 31.049  13.067  -11.392 1.00 38.50  ? 375  ALA A N   1 
ATOM   2825 C  CA  . ALA A  1 375 ? 30.494  14.368  -11.043 1.00 43.27  ? 375  ALA A CA  1 
ATOM   2826 C  C   . ALA A  1 375 ? 29.364  14.735  -11.993 1.00 50.67  ? 375  ALA A C   1 
ATOM   2827 O  O   . ALA A  1 375 ? 28.328  15.256  -11.573 1.00 54.24  ? 375  ALA A O   1 
ATOM   2828 C  CB  . ALA A  1 375 ? 31.577  15.423  -11.082 1.00 39.99  ? 375  ALA A CB  1 
ATOM   2829 N  N   . GLU A  1 376 ? 29.580  14.474  -13.277 1.00 51.73  ? 376  GLU A N   1 
ATOM   2830 C  CA  . GLU A  1 376 ? 28.555  14.703  -14.284 1.00 54.01  ? 376  GLU A CA  1 
ATOM   2831 C  C   . GLU A  1 376 ? 27.324  13.847  -13.990 1.00 44.95  ? 376  GLU A C   1 
ATOM   2832 O  O   . GLU A  1 376 ? 26.197  14.331  -14.059 1.00 46.21  ? 376  GLU A O   1 
ATOM   2833 C  CB  . GLU A  1 376 ? 29.101  14.409  -15.684 1.00 67.67  ? 376  GLU A CB  1 
ATOM   2834 C  CG  . GLU A  1 376 ? 28.180  14.850  -16.810 1.00 83.11  ? 376  GLU A CG  1 
ATOM   2835 C  CD  . GLU A  1 376 ? 27.827  16.325  -16.731 1.00 95.67  ? 376  GLU A CD  1 
ATOM   2836 O  OE1 . GLU A  1 376 ? 28.727  17.144  -16.451 1.00 100.78 ? 376  GLU A OE1 1 
ATOM   2837 O  OE2 . GLU A  1 376 ? 26.644  16.664  -16.944 1.00 97.48  ? 376  GLU A OE2 1 
ATOM   2838 N  N   . ALA A  1 377 ? 27.542  12.580  -13.645 1.00 35.29  ? 377  ALA A N   1 
ATOM   2839 C  CA  . ALA A  1 377 ? 26.438  11.683  -13.304 1.00 38.46  ? 377  ALA A CA  1 
ATOM   2840 C  C   . ALA A  1 377 ? 25.585  12.233  -12.159 1.00 42.19  ? 377  ALA A C   1 
ATOM   2841 O  O   . ALA A  1 377 ? 24.354  12.140  -12.190 1.00 38.18  ? 377  ALA A O   1 
ATOM   2842 C  CB  . ALA A  1 377 ? 26.963  10.304  -12.955 1.00 37.89  ? 377  ALA A CB  1 
ATOM   2843 N  N   . VAL A  1 378 ? 26.248  12.794  -11.150 1.00 40.40  ? 378  VAL A N   1 
ATOM   2844 C  CA  . VAL A  1 378 ? 25.558  13.420  -10.025 1.00 39.73  ? 378  VAL A CA  1 
ATOM   2845 C  C   . VAL A  1 378 ? 24.692  14.586  -10.497 1.00 44.74  ? 378  VAL A C   1 
ATOM   2846 O  O   . VAL A  1 378 ? 23.506  14.673  -10.165 1.00 42.16  ? 378  VAL A O   1 
ATOM   2847 C  CB  . VAL A  1 378 ? 26.557  13.926  -8.961  1.00 39.46  ? 378  VAL A CB  1 
ATOM   2848 C  CG1 . VAL A  1 378 ? 25.842  14.754  -7.905  1.00 36.49  ? 378  VAL A CG1 1 
ATOM   2849 C  CG2 . VAL A  1 378 ? 27.276  12.756  -8.312  1.00 37.25  ? 378  VAL A CG2 1 
ATOM   2850 N  N   . VAL A  1 379 ? 25.298  15.473  -11.279 1.00 44.21  ? 379  VAL A N   1 
ATOM   2851 C  CA  . VAL A  1 379 ? 24.614  16.646  -11.810 1.00 47.12  ? 379  VAL A CA  1 
ATOM   2852 C  C   . VAL A  1 379 ? 23.384  16.281  -12.645 1.00 46.39  ? 379  VAL A C   1 
ATOM   2853 O  O   . VAL A  1 379 ? 22.326  16.895  -12.508 1.00 46.96  ? 379  VAL A O   1 
ATOM   2854 C  CB  . VAL A  1 379 ? 25.578  17.506  -12.649 1.00 45.04  ? 379  VAL A CB  1 
ATOM   2855 C  CG1 . VAL A  1 379 ? 24.815  18.534  -13.460 1.00 42.17  ? 379  VAL A CG1 1 
ATOM   2856 C  CG2 . VAL A  1 379 ? 26.598  18.181  -11.747 1.00 36.92  ? 379  VAL A CG2 1 
ATOM   2857 N  N   . LEU A  1 380 ? 23.522  15.270  -13.496 1.00 38.53  ? 380  LEU A N   1 
ATOM   2858 C  CA  . LEU A  1 380 ? 22.426  14.847  -14.361 1.00 41.11  ? 380  LEU A CA  1 
ATOM   2859 C  C   . LEU A  1 380 ? 21.285  14.201  -13.571 1.00 36.06  ? 380  LEU A C   1 
ATOM   2860 O  O   . LEU A  1 380 ? 20.118  14.343  -13.928 1.00 42.35  ? 380  LEU A O   1 
ATOM   2861 C  CB  . LEU A  1 380 ? 22.945  13.906  -15.454 1.00 56.07  ? 380  LEU A CB  1 
ATOM   2862 C  CG  . LEU A  1 380 ? 24.063  14.514  -16.311 1.00 64.57  ? 380  LEU A CG  1 
ATOM   2863 C  CD1 . LEU A  1 380 ? 24.633  13.517  -17.300 1.00 74.63  ? 380  LEU A CD1 1 
ATOM   2864 C  CD2 . LEU A  1 380 ? 23.580  15.754  -17.032 1.00 59.14  ? 380  LEU A CD2 1 
ATOM   2865 N  N   . HIS A  1 381 ? 21.621  13.506  -12.490 1.00 34.55  ? 381  HIS A N   1 
ATOM   2866 C  CA  . HIS A  1 381 ? 20.605  12.880  -11.650 1.00 42.24  ? 381  HIS A CA  1 
ATOM   2867 C  C   . HIS A  1 381 ? 19.810  13.928  -10.865 1.00 41.06  ? 381  HIS A C   1 
ATOM   2868 O  O   . HIS A  1 381 ? 18.586  13.827  -10.737 1.00 44.83  ? 381  HIS A O   1 
ATOM   2869 C  CB  . HIS A  1 381 ? 21.253  11.873  -10.692 1.00 49.44  ? 381  HIS A CB  1 
ATOM   2870 C  CG  . HIS A  1 381 ? 20.275  11.000  -9.979  1.00 52.60  ? 381  HIS A CG  1 
ATOM   2871 N  ND1 . HIS A  1 381 ? 19.535  11.430  -8.898  1.00 57.37  ? 381  HIS A ND1 1 
ATOM   2872 C  CD2 . HIS A  1 381 ? 19.914  9.706   -10.182 1.00 59.97  ? 381  HIS A CD2 1 
ATOM   2873 C  CE1 . HIS A  1 381 ? 18.758  10.452  -8.473  1.00 60.69  ? 381  HIS A CE1 1 
ATOM   2874 N  NE2 . HIS A  1 381 ? 18.974  9.392   -9.240  1.00 60.94  ? 381  HIS A NE2 1 
ATOM   2875 N  N   . TYR A  1 382 ? 20.509  14.937  -10.349 1.00 35.36  ? 382  TYR A N   1 
ATOM   2876 C  CA  . TYR A  1 382 ? 19.884  15.938  -9.479  1.00 38.93  ? 382  TYR A CA  1 
ATOM   2877 C  C   . TYR A  1 382 ? 19.321  17.149  -10.227 1.00 39.40  ? 382  TYR A C   1 
ATOM   2878 O  O   . TYR A  1 382 ? 18.609  17.969  -9.644  1.00 42.25  ? 382  TYR A O   1 
ATOM   2879 C  CB  . TYR A  1 382 ? 20.856  16.384  -8.380  1.00 34.50  ? 382  TYR A CB  1 
ATOM   2880 C  CG  . TYR A  1 382 ? 21.005  15.380  -7.258  1.00 36.78  ? 382  TYR A CG  1 
ATOM   2881 C  CD1 . TYR A  1 382 ? 21.914  14.333  -7.350  1.00 30.29  ? 382  TYR A CD1 1 
ATOM   2882 C  CD2 . TYR A  1 382 ? 20.239  15.485  -6.103  1.00 43.11  ? 382  TYR A CD2 1 
ATOM   2883 C  CE1 . TYR A  1 382 ? 22.051  13.415  -6.325  1.00 38.18  ? 382  TYR A CE1 1 
ATOM   2884 C  CE2 . TYR A  1 382 ? 20.370  14.575  -5.073  1.00 37.10  ? 382  TYR A CE2 1 
ATOM   2885 C  CZ  . TYR A  1 382 ? 21.276  13.544  -5.191  1.00 42.12  ? 382  TYR A CZ  1 
ATOM   2886 O  OH  . TYR A  1 382 ? 21.405  12.637  -4.169  1.00 47.51  ? 382  TYR A OH  1 
ATOM   2887 N  N   . THR A  1 383 ? 19.635  17.258  -11.514 1.00 42.13  ? 383  THR A N   1 
ATOM   2888 C  CA  . THR A  1 383 ? 19.079  18.327  -12.339 1.00 38.30  ? 383  THR A CA  1 
ATOM   2889 C  C   . THR A  1 383 ? 17.588  18.092  -12.589 1.00 41.62  ? 383  THR A C   1 
ATOM   2890 O  O   . THR A  1 383 ? 17.171  16.963  -12.860 1.00 51.25  ? 383  THR A O   1 
ATOM   2891 C  CB  . THR A  1 383 ? 19.821  18.438  -13.695 1.00 41.33  ? 383  THR A CB  1 
ATOM   2892 O  OG1 . THR A  1 383 ? 21.186  18.816  -13.469 1.00 40.79  ? 383  THR A OG1 1 
ATOM   2893 C  CG2 . THR A  1 383 ? 19.165  19.472  -14.598 1.00 24.96  ? 383  THR A CG2 1 
ATOM   2894 N  N   . ASP A  1 384 ? 16.787  19.151  -12.475 1.00 37.37  ? 384  ASP A N   1 
ATOM   2895 C  CA  . ASP A  1 384 ? 15.379  19.104  -12.870 1.00 50.89  ? 384  ASP A CA  1 
ATOM   2896 C  C   . ASP A  1 384 ? 15.264  19.541  -14.330 1.00 50.99  ? 384  ASP A C   1 
ATOM   2897 O  O   . ASP A  1 384 ? 15.251  20.731  -14.626 1.00 45.04  ? 384  ASP A O   1 
ATOM   2898 C  CB  . ASP A  1 384 ? 14.546  20.022  -11.972 1.00 55.15  ? 384  ASP A CB  1 
ATOM   2899 C  CG  . ASP A  1 384 ? 13.071  20.013  -12.324 1.00 70.08  ? 384  ASP A CG  1 
ATOM   2900 O  OD1 . ASP A  1 384 ? 12.595  19.018  -12.916 1.00 78.86  ? 384  ASP A OD1 1 
ATOM   2901 O  OD2 . ASP A  1 384 ? 12.385  21.003  -11.996 1.00 71.06  ? 384  ASP A OD2 1 
ATOM   2902 N  N   . TRP A  1 385 ? 15.174  18.583  -15.246 1.00 45.11  ? 385  TRP A N   1 
ATOM   2903 C  CA  . TRP A  1 385 ? 15.263  18.898  -16.673 1.00 52.78  ? 385  TRP A CA  1 
ATOM   2904 C  C   . TRP A  1 385 ? 14.086  19.698  -17.233 1.00 50.97  ? 385  TRP A C   1 
ATOM   2905 O  O   . TRP A  1 385 ? 14.126  20.154  -18.375 1.00 57.47  ? 385  TRP A O   1 
ATOM   2906 C  CB  . TRP A  1 385 ? 15.555  17.627  -17.480 1.00 49.54  ? 385  TRP A CB  1 
ATOM   2907 C  CG  . TRP A  1 385 ? 16.887  17.098  -17.094 1.00 49.29  ? 385  TRP A CG  1 
ATOM   2908 C  CD1 . TRP A  1 385 ? 17.152  16.051  -16.261 1.00 41.96  ? 385  TRP A CD1 1 
ATOM   2909 C  CD2 . TRP A  1 385 ? 18.152  17.652  -17.462 1.00 46.04  ? 385  TRP A CD2 1 
ATOM   2910 N  NE1 . TRP A  1 385 ? 18.513  15.902  -16.114 1.00 37.88  ? 385  TRP A NE1 1 
ATOM   2911 C  CE2 . TRP A  1 385 ? 19.147  16.876  -16.842 1.00 39.44  ? 385  TRP A CE2 1 
ATOM   2912 C  CE3 . TRP A  1 385 ? 18.539  18.727  -18.269 1.00 44.59  ? 385  TRP A CE3 1 
ATOM   2913 C  CZ2 . TRP A  1 385 ? 20.508  17.142  -17.004 1.00 41.81  ? 385  TRP A CZ2 1 
ATOM   2914 C  CZ3 . TRP A  1 385 ? 19.888  18.989  -18.429 1.00 47.04  ? 385  TRP A CZ3 1 
ATOM   2915 C  CH2 . TRP A  1 385 ? 20.856  18.200  -17.801 1.00 50.71  ? 385  TRP A CH2 1 
ATOM   2916 N  N   . LEU A  1 386 ? 13.052  19.877  -16.418 1.00 53.88  ? 386  LEU A N   1 
ATOM   2917 C  CA  . LEU A  1 386 ? 11.958  20.785  -16.748 1.00 54.28  ? 386  LEU A CA  1 
ATOM   2918 C  C   . LEU A  1 386 ? 12.343  22.227  -16.408 1.00 59.86  ? 386  LEU A C   1 
ATOM   2919 O  O   . LEU A  1 386 ? 11.848  23.173  -17.022 1.00 66.33  ? 386  LEU A O   1 
ATOM   2920 C  CB  . LEU A  1 386 ? 10.686  20.388  -15.990 1.00 58.54  ? 386  LEU A CB  1 
ATOM   2921 C  CG  . LEU A  1 386 ? 9.590   19.666  -16.779 1.00 74.46  ? 386  LEU A CG  1 
ATOM   2922 C  CD1 . LEU A  1 386 ? 9.432   18.214  -16.343 1.00 80.14  ? 386  LEU A CD1 1 
ATOM   2923 C  CD2 . LEU A  1 386 ? 8.275   20.412  -16.640 1.00 77.46  ? 386  LEU A CD2 1 
ATOM   2924 N  N   . HIS A  1 387 ? 13.228  22.381  -15.425 1.00 63.63  ? 387  HIS A N   1 
ATOM   2925 C  CA  . HIS A  1 387 ? 13.674  23.699  -14.975 1.00 65.19  ? 387  HIS A CA  1 
ATOM   2926 C  C   . HIS A  1 387 ? 15.153  23.695  -14.583 1.00 58.49  ? 387  HIS A C   1 
ATOM   2927 O  O   . HIS A  1 387 ? 15.495  24.073  -13.462 1.00 60.59  ? 387  HIS A O   1 
ATOM   2928 C  CB  . HIS A  1 387 ? 12.836  24.156  -13.774 1.00 68.47  ? 387  HIS A CB  1 
ATOM   2929 C  CG  . HIS A  1 387 ? 11.365  24.231  -14.050 1.00 76.11  ? 387  HIS A CG  1 
ATOM   2930 N  ND1 . HIS A  1 387 ? 10.523  23.149  -13.898 1.00 75.26  ? 387  HIS A ND1 1 
ATOM   2931 C  CD2 . HIS A  1 387 ? 10.587  25.257  -14.464 1.00 79.52  ? 387  HIS A CD2 1 
ATOM   2932 C  CE1 . HIS A  1 387 ? 9.290   23.507  -14.209 1.00 76.43  ? 387  HIS A CE1 1 
ATOM   2933 N  NE2 . HIS A  1 387 ? 9.300   24.782  -14.556 1.00 76.96  ? 387  HIS A NE2 1 
ATOM   2934 N  N   . PRO A  1 388 ? 16.041  23.304  -15.516 1.00 53.92  ? 388  PRO A N   1 
ATOM   2935 C  CA  . PRO A  1 388 ? 17.433  23.006  -15.150 1.00 44.76  ? 388  PRO A CA  1 
ATOM   2936 C  C   . PRO A  1 388 ? 18.257  24.234  -14.775 1.00 43.26  ? 388  PRO A C   1 
ATOM   2937 O  O   . PRO A  1 388 ? 19.439  24.097  -14.450 1.00 43.58  ? 388  PRO A O   1 
ATOM   2938 C  CB  . PRO A  1 388 ? 17.996  22.377  -16.427 1.00 48.02  ? 388  PRO A CB  1 
ATOM   2939 C  CG  . PRO A  1 388 ? 17.218  23.023  -17.528 1.00 44.55  ? 388  PRO A CG  1 
ATOM   2940 C  CD  . PRO A  1 388 ? 15.826  23.232  -16.975 1.00 52.38  ? 388  PRO A CD  1 
ATOM   2941 N  N   . GLU A  1 389 ? 17.649  25.413  -14.823 1.00 44.36  ? 389  GLU A N   1 
ATOM   2942 C  CA  . GLU A  1 389 ? 18.367  26.636  -14.484 1.00 51.47  ? 389  GLU A CA  1 
ATOM   2943 C  C   . GLU A  1 389 ? 17.703  27.427  -13.361 1.00 44.70  ? 389  GLU A C   1 
ATOM   2944 O  O   . GLU A  1 389 ? 18.144  28.528  -13.027 1.00 41.03  ? 389  GLU A O   1 
ATOM   2945 C  CB  . GLU A  1 389 ? 18.550  27.517  -15.720 1.00 57.02  ? 389  GLU A CB  1 
ATOM   2946 C  CG  . GLU A  1 389 ? 19.448  26.900  -16.777 1.00 69.93  ? 389  GLU A CG  1 
ATOM   2947 C  CD  . GLU A  1 389 ? 20.377  27.911  -17.421 1.00 82.82  ? 389  GLU A CD  1 
ATOM   2948 O  OE1 . GLU A  1 389 ? 19.890  28.961  -17.889 1.00 90.47  ? 389  GLU A OE1 1 
ATOM   2949 O  OE2 . GLU A  1 389 ? 21.598  27.651  -17.463 1.00 84.39  ? 389  GLU A OE2 1 
ATOM   2950 N  N   . ASP A  1 390 ? 16.648  26.862  -12.782 1.00 37.89  ? 390  ASP A N   1 
ATOM   2951 C  CA  . ASP A  1 390 ? 15.957  27.499  -11.670 1.00 41.00  ? 390  ASP A CA  1 
ATOM   2952 C  C   . ASP A  1 390 ? 16.853  27.545  -10.433 1.00 39.21  ? 390  ASP A C   1 
ATOM   2953 O  O   . ASP A  1 390 ? 17.235  26.501  -9.902  1.00 31.02  ? 390  ASP A O   1 
ATOM   2954 C  CB  . ASP A  1 390 ? 14.657  26.756  -11.357 1.00 46.16  ? 390  ASP A CB  1 
ATOM   2955 C  CG  . ASP A  1 390 ? 13.795  27.490  -10.355 1.00 52.45  ? 390  ASP A CG  1 
ATOM   2956 O  OD1 . ASP A  1 390 ? 13.250  28.553  -10.710 1.00 58.26  ? 390  ASP A OD1 1 
ATOM   2957 O  OD2 . ASP A  1 390 ? 13.644  26.999  -9.219  1.00 64.21  ? 390  ASP A OD2 1 
ATOM   2958 N  N   . PRO A  1 391 ? 17.189  28.763  -9.976  1.00 41.91  ? 391  PRO A N   1 
ATOM   2959 C  CA  . PRO A  1 391 ? 18.130  28.980  -8.872  1.00 39.38  ? 391  PRO A CA  1 
ATOM   2960 C  C   . PRO A  1 391 ? 17.646  28.367  -7.565  1.00 42.60  ? 391  PRO A C   1 
ATOM   2961 O  O   . PRO A  1 391 ? 18.468  27.916  -6.768  1.00 40.54  ? 391  PRO A O   1 
ATOM   2962 C  CB  . PRO A  1 391 ? 18.178  30.508  -8.744  1.00 35.06  ? 391  PRO A CB  1 
ATOM   2963 C  CG  . PRO A  1 391 ? 17.669  31.034  -10.047 1.00 45.23  ? 391  PRO A CG  1 
ATOM   2964 C  CD  . PRO A  1 391 ? 16.656  30.033  -10.502 1.00 44.99  ? 391  PRO A CD  1 
ATOM   2965 N  N   . THR A  1 392 ? 16.333  28.361  -7.349  1.00 43.48  ? 392  THR A N   1 
ATOM   2966 C  CA  . THR A  1 392 ? 15.761  27.777  -6.136  1.00 43.62  ? 392  THR A CA  1 
ATOM   2967 C  C   . THR A  1 392 ? 15.918  26.258  -6.136  1.00 43.56  ? 392  THR A C   1 
ATOM   2968 O  O   . THR A  1 392 ? 16.314  25.667  -5.127  1.00 32.88  ? 392  THR A O   1 
ATOM   2969 C  CB  . THR A  1 392 ? 14.274  28.163  -5.960  1.00 39.64  ? 392  THR A CB  1 
ATOM   2970 O  OG1 . THR A  1 392 ? 14.164  29.578  -5.756  1.00 45.27  ? 392  THR A OG1 1 
ATOM   2971 C  CG2 . THR A  1 392 ? 13.678  27.451  -4.762  1.00 32.20  ? 392  THR A CG2 1 
ATOM   2972 N  N   . HIS A  1 393 ? 15.617  25.626  -7.268  1.00 39.33  ? 393  HIS A N   1 
ATOM   2973 C  CA  . HIS A  1 393 ? 15.795  24.185  -7.373  1.00 42.47  ? 393  HIS A CA  1 
ATOM   2974 C  C   . HIS A  1 393 ? 17.261  23.792  -7.251  1.00 39.09  ? 393  HIS A C   1 
ATOM   2975 O  O   . HIS A  1 393 ? 17.593  22.819  -6.571  1.00 49.61  ? 393  HIS A O   1 
ATOM   2976 C  CB  . HIS A  1 393 ? 15.241  23.632  -8.682  1.00 40.28  ? 393  HIS A CB  1 
ATOM   2977 C  CG  . HIS A  1 393 ? 15.596  22.196  -8.905  1.00 54.05  ? 393  HIS A CG  1 
ATOM   2978 N  ND1 . HIS A  1 393 ? 14.918  21.159  -8.296  1.00 66.54  ? 393  HIS A ND1 1 
ATOM   2979 C  CD2 . HIS A  1 393 ? 16.587  21.624  -9.626  1.00 56.29  ? 393  HIS A CD2 1 
ATOM   2980 C  CE1 . HIS A  1 393 ? 15.464  20.012  -8.653  1.00 67.22  ? 393  HIS A CE1 1 
ATOM   2981 N  NE2 . HIS A  1 393 ? 16.482  20.263  -9.456  1.00 60.54  ? 393  HIS A NE2 1 
ATOM   2982 N  N   . LEU A  1 394 ? 18.131  24.540  -7.924  1.00 30.19  ? 394  LEU A N   1 
ATOM   2983 C  CA  . LEU A  1 394 ? 19.566  24.273  -7.879  1.00 33.97  ? 394  LEU A CA  1 
ATOM   2984 C  C   . LEU A  1 394 ? 20.112  24.408  -6.454  1.00 40.22  ? 394  LEU A C   1 
ATOM   2985 O  O   . LEU A  1 394 ? 20.994  23.649  -6.047  1.00 40.05  ? 394  LEU A O   1 
ATOM   2986 C  CB  . LEU A  1 394 ? 20.315  25.190  -8.851  1.00 29.23  ? 394  LEU A CB  1 
ATOM   2987 C  CG  . LEU A  1 394 ? 20.036  24.948  -10.342 1.00 38.56  ? 394  LEU A CG  1 
ATOM   2988 C  CD1 . LEU A  1 394 ? 20.484  26.123  -11.199 1.00 33.92  ? 394  LEU A CD1 1 
ATOM   2989 C  CD2 . LEU A  1 394 ? 20.710  23.670  -10.812 1.00 38.41  ? 394  LEU A CD2 1 
ATOM   2990 N  N   . ARG A  1 395 ? 19.576  25.363  -5.696  1.00 42.01  ? 395  ARG A N   1 
ATOM   2991 C  CA  . ARG A  1 395 ? 19.971  25.544  -4.300  1.00 39.82  ? 395  ARG A CA  1 
ATOM   2992 C  C   . ARG A  1 395 ? 19.572  24.332  -3.456  1.00 39.68  ? 395  ARG A C   1 
ATOM   2993 O  O   . ARG A  1 395 ? 20.387  23.794  -2.702  1.00 43.67  ? 395  ARG A O   1 
ATOM   2994 C  CB  . ARG A  1 395 ? 19.363  26.833  -3.728  1.00 43.65  ? 395  ARG A CB  1 
ATOM   2995 C  CG  . ARG A  1 395 ? 19.632  27.050  -2.242  1.00 41.29  ? 395  ARG A CG  1 
ATOM   2996 C  CD  . ARG A  1 395 ? 18.351  26.931  -1.445  1.00 36.75  ? 395  ARG A CD  1 
ATOM   2997 N  NE  . ARG A  1 395 ? 17.614  28.191  -1.380  1.00 35.93  ? 395  ARG A NE  1 
ATOM   2998 C  CZ  . ARG A  1 395 ? 16.300  28.280  -1.194  1.00 37.23  ? 395  ARG A CZ  1 
ATOM   2999 N  NH1 . ARG A  1 395 ? 15.566  27.183  -1.074  1.00 26.79  ? 395  ARG A NH1 1 
ATOM   3000 N  NH2 . ARG A  1 395 ? 15.716  29.467  -1.136  1.00 40.10  ? 395  ARG A NH2 1 
ATOM   3001 N  N   . ASP A  1 396 ? 18.322  23.896  -3.601  1.00 41.16  ? 396  ASP A N   1 
ATOM   3002 C  CA  . ASP A  1 396 ? 17.808  22.760  -2.837  1.00 41.06  ? 396  ASP A CA  1 
ATOM   3003 C  C   . ASP A  1 396 ? 18.475  21.448  -3.261  1.00 40.53  ? 396  ASP A C   1 
ATOM   3004 O  O   . ASP A  1 396 ? 18.638  20.534  -2.451  1.00 41.05  ? 396  ASP A O   1 
ATOM   3005 C  CB  . ASP A  1 396 ? 16.281  22.658  -2.977  1.00 40.60  ? 396  ASP A CB  1 
ATOM   3006 C  CG  . ASP A  1 396 ? 15.554  23.860  -2.392  1.00 43.11  ? 396  ASP A CG  1 
ATOM   3007 O  OD1 . ASP A  1 396 ? 16.195  24.651  -1.671  1.00 47.14  ? 396  ASP A OD1 1 
ATOM   3008 O  OD2 . ASP A  1 396 ? 14.338  24.008  -2.644  1.00 47.85  ? 396  ASP A OD2 1 
ATOM   3009 N  N   . ALA A  1 397 ? 18.863  21.363  -4.530  1.00 31.89  ? 397  ALA A N   1 
ATOM   3010 C  CA  . ALA A  1 397 ? 19.544  20.177  -5.050  1.00 40.14  ? 397  ALA A CA  1 
ATOM   3011 C  C   . ALA A  1 397 ? 20.977  20.064  -4.536  1.00 40.88  ? 397  ALA A C   1 
ATOM   3012 O  O   . ALA A  1 397 ? 21.467  18.960  -4.285  1.00 38.17  ? 397  ALA A O   1 
ATOM   3013 C  CB  . ALA A  1 397 ? 19.530  20.176  -6.575  1.00 31.17  ? 397  ALA A CB  1 
ATOM   3014 N  N   . MET A  1 398 ? 21.652  21.201  -4.397  1.00 37.66  ? 398  MET A N   1 
ATOM   3015 C  CA  . MET A  1 398 ? 23.007  21.214  -3.858  1.00 38.47  ? 398  MET A CA  1 
ATOM   3016 C  C   . MET A  1 398 ? 23.000  20.662  -2.438  1.00 39.54  ? 398  MET A C   1 
ATOM   3017 O  O   . MET A  1 398 ? 23.862  19.863  -2.060  1.00 31.24  ? 398  MET A O   1 
ATOM   3018 C  CB  . MET A  1 398 ? 23.572  22.634  -3.860  1.00 36.75  ? 398  MET A CB  1 
ATOM   3019 C  CG  . MET A  1 398 ? 25.036  22.720  -3.464  1.00 36.61  ? 398  MET A CG  1 
ATOM   3020 S  SD  . MET A  1 398 ? 26.149  22.056  -4.722  1.00 42.92  ? 398  MET A SD  1 
ATOM   3021 C  CE  . MET A  1 398 ? 26.499  20.429  -4.051  1.00 34.03  ? 398  MET A CE  1 
ATOM   3022 N  N   . SER A  1 399 ? 22.017  21.096  -1.657  1.00 33.44  ? 399  SER A N   1 
ATOM   3023 C  CA  . SER A  1 399 ? 21.846  20.615  -0.291  1.00 39.65  ? 399  SER A CA  1 
ATOM   3024 C  C   . SER A  1 399 ? 21.557  19.121  -0.289  1.00 36.78  ? 399  SER A C   1 
ATOM   3025 O  O   . SER A  1 399 ? 22.109  18.366  0.515   1.00 35.25  ? 399  SER A O   1 
ATOM   3026 C  CB  . SER A  1 399 ? 20.702  21.373  0.385   1.00 32.44  ? 399  SER A CB  1 
ATOM   3027 O  OG  . SER A  1 399 ? 20.284  20.718  1.569   1.00 35.17  ? 399  SER A OG  1 
ATOM   3028 N  N   . ALA A  1 400 ? 20.692  18.698  -1.204  1.00 31.40  ? 400  ALA A N   1 
ATOM   3029 C  CA  . ALA A  1 400 ? 20.301  17.294  -1.291  1.00 31.58  ? 400  ALA A CA  1 
ATOM   3030 C  C   . ALA A  1 400 ? 21.467  16.392  -1.694  1.00 31.01  ? 400  ALA A C   1 
ATOM   3031 O  O   . ALA A  1 400 ? 21.586  15.271  -1.198  1.00 36.42  ? 400  ALA A O   1 
ATOM   3032 C  CB  . ALA A  1 400 ? 19.141  17.127  -2.250  1.00 29.79  ? 400  ALA A CB  1 
ATOM   3033 N  N   . VAL A  1 401 ? 22.317  16.878  -2.595  1.00 32.95  ? 401  VAL A N   1 
ATOM   3034 C  CA  . VAL A  1 401 ? 23.523  16.145  -2.977  1.00 39.05  ? 401  VAL A CA  1 
ATOM   3035 C  C   . VAL A  1 401 ? 24.406  15.865  -1.759  1.00 33.94  ? 401  VAL A C   1 
ATOM   3036 O  O   . VAL A  1 401 ? 24.806  14.724  -1.521  1.00 35.56  ? 401  VAL A O   1 
ATOM   3037 C  CB  . VAL A  1 401 ? 24.338  16.900  -4.054  1.00 34.89  ? 401  VAL A CB  1 
ATOM   3038 C  CG1 . VAL A  1 401 ? 25.742  16.331  -4.163  1.00 25.27  ? 401  VAL A CG1 1 
ATOM   3039 C  CG2 . VAL A  1 401 ? 23.634  16.821  -5.396  1.00 23.49  ? 401  VAL A CG2 1 
ATOM   3040 N  N   . VAL A  1 402 ? 24.694  16.908  -0.987  1.00 33.58  ? 402  VAL A N   1 
ATOM   3041 C  CA  . VAL A  1 402 ? 25.528  16.780  0.206   1.00 33.56  ? 402  VAL A CA  1 
ATOM   3042 C  C   . VAL A  1 402 ? 24.859  15.915  1.272   1.00 35.07  ? 402  VAL A C   1 
ATOM   3043 O  O   . VAL A  1 402 ? 25.512  15.082  1.905   1.00 36.69  ? 402  VAL A O   1 
ATOM   3044 C  CB  . VAL A  1 402 ? 25.881  18.164  0.786   1.00 33.99  ? 402  VAL A CB  1 
ATOM   3045 C  CG1 . VAL A  1 402 ? 26.660  18.030  2.091   1.00 26.38  ? 402  VAL A CG1 1 
ATOM   3046 C  CG2 . VAL A  1 402 ? 26.686  18.950  -0.228  1.00 32.91  ? 402  VAL A CG2 1 
ATOM   3047 N  N   . GLY A  1 403 ? 23.554  16.104  1.452   1.00 31.60  ? 403  GLY A N   1 
ATOM   3048 C  CA  . GLY A  1 403 ? 22.790  15.340  2.427   1.00 32.30  ? 403  GLY A CA  1 
ATOM   3049 C  C   . GLY A  1 403 ? 22.677  13.857  2.112   1.00 37.96  ? 403  GLY A C   1 
ATOM   3050 O  O   . GLY A  1 403 ? 22.886  13.012  2.991   1.00 37.67  ? 403  GLY A O   1 
ATOM   3051 N  N   . ASP A  1 404 ? 22.344  13.540  0.863   1.00 34.81  ? 404  ASP A N   1 
ATOM   3052 C  CA  . ASP A  1 404 ? 22.196  12.150  0.441   1.00 32.89  ? 404  ASP A CA  1 
ATOM   3053 C  C   . ASP A  1 404 ? 23.534  11.403  0.449   1.00 34.09  ? 404  ASP A C   1 
ATOM   3054 O  O   . ASP A  1 404 ? 23.615  10.269  0.918   1.00 40.19  ? 404  ASP A O   1 
ATOM   3055 C  CB  . ASP A  1 404 ? 21.565  12.066  -0.957  1.00 33.06  ? 404  ASP A CB  1 
ATOM   3056 C  CG  . ASP A  1 404 ? 20.156  12.624  -1.005  1.00 41.14  ? 404  ASP A CG  1 
ATOM   3057 O  OD1 . ASP A  1 404 ? 19.593  12.946  0.064   1.00 43.58  ? 404  ASP A OD1 1 
ATOM   3058 O  OD2 . ASP A  1 404 ? 19.609  12.733  -2.122  1.00 49.09  ? 404  ASP A OD2 1 
ATOM   3059 N  N   . HIS A  1 405 ? 24.576  12.049  -0.068  1.00 36.11  ? 405  HIS A N   1 
ATOM   3060 C  CA  . HIS A  1 405 ? 25.902  11.439  -0.208  1.00 37.73  ? 405  HIS A CA  1 
ATOM   3061 C  C   . HIS A  1 405 ? 26.545  11.084  1.134   1.00 37.27  ? 405  HIS A C   1 
ATOM   3062 O  O   . HIS A  1 405 ? 27.200  10.047  1.269   1.00 38.35  ? 405  HIS A O   1 
ATOM   3063 C  CB  . HIS A  1 405 ? 26.811  12.394  -0.991  1.00 30.05  ? 405  HIS A CB  1 
ATOM   3064 C  CG  . HIS A  1 405 ? 28.237  11.944  -1.109  1.00 28.70  ? 405  HIS A CG  1 
ATOM   3065 N  ND1 . HIS A  1 405 ? 28.593  10.682  -1.534  1.00 32.87  ? 405  HIS A ND1 1 
ATOM   3066 C  CD2 . HIS A  1 405 ? 29.398  12.609  -0.891  1.00 25.19  ? 405  HIS A CD2 1 
ATOM   3067 C  CE1 . HIS A  1 405 ? 29.912  10.584  -1.560  1.00 29.70  ? 405  HIS A CE1 1 
ATOM   3068 N  NE2 . HIS A  1 405 ? 30.423  11.739  -1.173  1.00 29.53  ? 405  HIS A NE2 1 
ATOM   3069 N  N   . ASN A  1 406 ? 26.351  11.947  2.124   1.00 33.55  ? 406  ASN A N   1 
ATOM   3070 C  CA  . ASN A  1 406 ? 27.050  11.819  3.400   1.00 40.35  ? 406  ASN A CA  1 
ATOM   3071 C  C   . ASN A  1 406 ? 26.241  11.174  4.524   1.00 38.69  ? 406  ASN A C   1 
ATOM   3072 O  O   . ASN A  1 406 ? 26.815  10.568  5.430   1.00 40.21  ? 406  ASN A O   1 
ATOM   3073 C  CB  . ASN A  1 406 ? 27.559  13.190  3.855   1.00 35.84  ? 406  ASN A CB  1 
ATOM   3074 C  CG  . ASN A  1 406 ? 28.721  13.683  3.021   1.00 41.50  ? 406  ASN A CG  1 
ATOM   3075 O  OD1 . ASN A  1 406 ? 29.758  13.026  2.934   1.00 41.45  ? 406  ASN A OD1 1 
ATOM   3076 N  ND2 . ASN A  1 406 ? 28.552  14.841  2.394   1.00 46.92  ? 406  ASN A ND2 1 
ATOM   3077 N  N   . VAL A  1 407 ? 24.917  11.310  4.478   1.00 36.12  ? 407  VAL A N   1 
ATOM   3078 C  CA  . VAL A  1 407 ? 24.068  10.797  5.556   1.00 30.81  ? 407  VAL A CA  1 
ATOM   3079 C  C   . VAL A  1 407 ? 22.951  9.867   5.078   1.00 36.98  ? 407  VAL A C   1 
ATOM   3080 O  O   . VAL A  1 407 ? 22.956  8.675   5.393   1.00 38.32  ? 407  VAL A O   1 
ATOM   3081 C  CB  . VAL A  1 407 ? 23.446  11.946  6.392   1.00 34.94  ? 407  VAL A CB  1 
ATOM   3082 C  CG1 . VAL A  1 407 ? 22.577  11.382  7.508   1.00 35.47  ? 407  VAL A CG1 1 
ATOM   3083 C  CG2 . VAL A  1 407 ? 24.533  12.834  6.972   1.00 25.62  ? 407  VAL A CG2 1 
ATOM   3084 N  N   . VAL A  1 408 ? 22.004  10.422  4.322   1.00 40.67  ? 408  VAL A N   1 
ATOM   3085 C  CA  . VAL A  1 408 ? 20.767  9.720   3.967   1.00 36.75  ? 408  VAL A CA  1 
ATOM   3086 C  C   . VAL A  1 408 ? 20.984  8.365   3.286   1.00 36.87  ? 408  VAL A C   1 
ATOM   3087 O  O   . VAL A  1 408 ? 20.302  7.392   3.602   1.00 47.80  ? 408  VAL A O   1 
ATOM   3088 C  CB  . VAL A  1 408 ? 19.838  10.604  3.098   1.00 35.72  ? 408  VAL A CB  1 
ATOM   3089 C  CG1 . VAL A  1 408 ? 18.517  9.902   2.836   1.00 29.73  ? 408  VAL A CG1 1 
ATOM   3090 C  CG2 . VAL A  1 408 ? 19.579  11.926  3.785   1.00 31.41  ? 408  VAL A CG2 1 
ATOM   3091 N  N   . CYS A  1 409 ? 21.944  8.292   2.373   1.00 28.66  ? 409  CYS A N   1 
ATOM   3092 C  CA  . CYS A  1 409 ? 22.199  7.036   1.668   1.00 39.79  ? 409  CYS A CA  1 
ATOM   3093 C  C   . CYS A  1 409 ? 23.107  6.043   2.417   1.00 39.56  ? 409  CYS A C   1 
ATOM   3094 O  O   . CYS A  1 409 ? 22.881  4.834   2.341   1.00 42.14  ? 409  CYS A O   1 
ATOM   3095 C  CB  . CYS A  1 409 ? 22.674  7.295   0.235   1.00 25.31  ? 409  CYS A CB  1 
ATOM   3096 S  SG  . CYS A  1 409 ? 21.363  8.002   -0.817  1.00 40.20  ? 409  CYS A SG  1 
ATOM   3097 N  N   . PRO A  1 410 ? 24.138  6.542   3.131   1.00 34.87  ? 410  PRO A N   1 
ATOM   3098 C  CA  . PRO A  1 410 ? 24.844  5.622   4.030   1.00 39.68  ? 410  PRO A CA  1 
ATOM   3099 C  C   . PRO A  1 410 ? 23.924  5.005   5.084   1.00 34.08  ? 410  PRO A C   1 
ATOM   3100 O  O   . PRO A  1 410 ? 24.097  3.830   5.411   1.00 35.99  ? 410  PRO A O   1 
ATOM   3101 C  CB  . PRO A  1 410 ? 25.882  6.527   4.695   1.00 29.79  ? 410  PRO A CB  1 
ATOM   3102 C  CG  . PRO A  1 410 ? 26.213  7.530   3.637   1.00 32.97  ? 410  PRO A CG  1 
ATOM   3103 C  CD  . PRO A  1 410 ? 24.905  7.788   2.917   1.00 30.69  ? 410  PRO A CD  1 
ATOM   3104 N  N   . VAL A  1 411 ? 22.973  5.780   5.605   1.00 30.07  ? 411  VAL A N   1 
ATOM   3105 C  CA  . VAL A  1 411 ? 21.987  5.263   6.561   1.00 35.68  ? 411  VAL A CA  1 
ATOM   3106 C  C   . VAL A  1 411 ? 21.078  4.211   5.924   1.00 41.94  ? 411  VAL A C   1 
ATOM   3107 O  O   . VAL A  1 411 ? 20.855  3.138   6.491   1.00 42.08  ? 411  VAL A O   1 
ATOM   3108 C  CB  . VAL A  1 411 ? 21.121  6.400   7.158   1.00 36.31  ? 411  VAL A CB  1 
ATOM   3109 C  CG1 . VAL A  1 411 ? 19.912  5.835   7.885   1.00 31.21  ? 411  VAL A CG1 1 
ATOM   3110 C  CG2 . VAL A  1 411 ? 21.942  7.259   8.103   1.00 34.89  ? 411  VAL A CG2 1 
ATOM   3111 N  N   . ALA A  1 412 ? 20.550  4.529   4.746   1.00 36.66  ? 412  ALA A N   1 
ATOM   3112 C  CA  . ALA A  1 412 ? 19.710  3.593   4.010   1.00 38.79  ? 412  ALA A CA  1 
ATOM   3113 C  C   . ALA A  1 412 ? 20.468  2.303   3.713   1.00 38.56  ? 412  ALA A C   1 
ATOM   3114 O  O   . ALA A  1 412 ? 19.918  1.207   3.831   1.00 42.59  ? 412  ALA A O   1 
ATOM   3115 C  CB  . ALA A  1 412 ? 19.219  4.229   2.724   1.00 34.18  ? 412  ALA A CB  1 
ATOM   3116 N  N   . GLN A  1 413 ? 21.732  2.448   3.326   1.00 30.33  ? 413  GLN A N   1 
ATOM   3117 C  CA  . GLN A  1 413 ? 22.625  1.312   3.104   1.00 34.69  ? 413  GLN A CA  1 
ATOM   3118 C  C   . GLN A  1 413 ? 22.812  0.492   4.386   1.00 41.99  ? 413  GLN A C   1 
ATOM   3119 O  O   . GLN A  1 413 ? 22.778  -0.743  4.364   1.00 34.24  ? 413  GLN A O   1 
ATOM   3120 C  CB  . GLN A  1 413 ? 23.979  1.818   2.588   1.00 37.64  ? 413  GLN A CB  1 
ATOM   3121 C  CG  . GLN A  1 413 ? 25.109  0.792   2.610   1.00 51.46  ? 413  GLN A CG  1 
ATOM   3122 C  CD  . GLN A  1 413 ? 25.021  -0.222  1.486   1.00 73.34  ? 413  GLN A CD  1 
ATOM   3123 O  OE1 . GLN A  1 413 ? 24.086  -0.202  0.684   1.00 82.67  ? 413  GLN A OE1 1 
ATOM   3124 N  NE2 . GLN A  1 413 ? 26.003  -1.114  1.418   1.00 80.73  ? 413  GLN A NE2 1 
ATOM   3125 N  N   . LEU A  1 414 ? 23.004  1.184   5.505   1.00 47.88  ? 414  LEU A N   1 
ATOM   3126 C  CA  . LEU A  1 414 ? 23.209  0.516   6.787   1.00 41.10  ? 414  LEU A CA  1 
ATOM   3127 C  C   . LEU A  1 414 ? 21.950  -0.228  7.221   1.00 41.40  ? 414  LEU A C   1 
ATOM   3128 O  O   . LEU A  1 414 ? 22.005  -1.409  7.566   1.00 37.58  ? 414  LEU A O   1 
ATOM   3129 C  CB  . LEU A  1 414 ? 23.633  1.528   7.855   1.00 39.15  ? 414  LEU A CB  1 
ATOM   3130 C  CG  . LEU A  1 414 ? 23.808  1.014   9.288   1.00 41.54  ? 414  LEU A CG  1 
ATOM   3131 C  CD1 . LEU A  1 414 ? 25.017  0.103   9.415   1.00 39.20  ? 414  LEU A CD1 1 
ATOM   3132 C  CD2 . LEU A  1 414 ? 23.920  2.172   10.255  1.00 45.46  ? 414  LEU A CD2 1 
ATOM   3133 N  N   . ALA A  1 415 ? 20.814  0.463   7.190   1.00 36.62  ? 415  ALA A N   1 
ATOM   3134 C  CA  . ALA A  1 415 ? 19.535  -0.140  7.560   1.00 35.31  ? 415  ALA A CA  1 
ATOM   3135 C  C   . ALA A  1 415 ? 19.232  -1.392  6.740   1.00 42.69  ? 415  ALA A C   1 
ATOM   3136 O  O   . ALA A  1 415 ? 18.760  -2.396  7.275   1.00 41.71  ? 415  ALA A O   1 
ATOM   3137 C  CB  . ALA A  1 415 ? 18.416  0.871   7.402   1.00 32.68  ? 415  ALA A CB  1 
ATOM   3138 N  N   . GLY A  1 416 ? 19.502  -1.320  5.441   1.00 47.23  ? 416  GLY A N   1 
ATOM   3139 C  CA  . GLY A  1 416 ? 19.226  -2.424  4.541   1.00 50.16  ? 416  GLY A CA  1 
ATOM   3140 C  C   . GLY A  1 416 ? 20.071  -3.660  4.787   1.00 50.65  ? 416  GLY A C   1 
ATOM   3141 O  O   . GLY A  1 416 ? 19.561  -4.782  4.760   1.00 58.28  ? 416  GLY A O   1 
ATOM   3142 N  N   . ARG A  1 417 ? 21.366  -3.465  5.018   1.00 45.43  ? 417  ARG A N   1 
ATOM   3143 C  CA  . ARG A  1 417 ? 22.256  -4.594  5.270   1.00 50.71  ? 417  ARG A CA  1 
ATOM   3144 C  C   . ARG A  1 417 ? 22.020  -5.209  6.649   1.00 49.93  ? 417  ARG A C   1 
ATOM   3145 O  O   . ARG A  1 417 ? 22.085  -6.428  6.812   1.00 55.53  ? 417  ARG A O   1 
ATOM   3146 C  CB  . ARG A  1 417 ? 23.722  -4.185  5.100   1.00 50.83  ? 417  ARG A CB  1 
ATOM   3147 C  CG  . ARG A  1 417 ? 24.098  -3.794  3.680   1.00 55.38  ? 417  ARG A CG  1 
ATOM   3148 C  CD  . ARG A  1 417 ? 23.632  -4.849  2.685   1.00 63.38  ? 417  ARG A CD  1 
ATOM   3149 N  NE  . ARG A  1 417 ? 24.552  -5.982  2.586   1.00 73.10  ? 417  ARG A NE  1 
ATOM   3150 C  CZ  . ARG A  1 417 ? 25.191  -6.323  1.470   1.00 83.53  ? 417  ARG A CZ  1 
ATOM   3151 N  NH1 . ARG A  1 417 ? 25.002  -5.625  0.358   1.00 83.20  ? 417  ARG A NH1 1 
ATOM   3152 N  NH2 . ARG A  1 417 ? 26.014  -7.364  1.461   1.00 84.98  ? 417  ARG A NH2 1 
ATOM   3153 N  N   . LEU A  1 418 ? 21.739  -4.362  7.634   1.00 39.53  ? 418  LEU A N   1 
ATOM   3154 C  CA  . LEU A  1 418 ? 21.452  -4.832  8.989   1.00 40.43  ? 418  LEU A CA  1 
ATOM   3155 C  C   . LEU A  1 418 ? 20.162  -5.650  9.027   1.00 45.44  ? 418  LEU A C   1 
ATOM   3156 O  O   . LEU A  1 418 ? 20.117  -6.730  9.617   1.00 51.94  ? 418  LEU A O   1 
ATOM   3157 C  CB  . LEU A  1 418 ? 21.363  -3.646  9.956   1.00 37.28  ? 418  LEU A CB  1 
ATOM   3158 C  CG  . LEU A  1 418 ? 22.615  -3.281  10.763  1.00 39.51  ? 418  LEU A CG  1 
ATOM   3159 C  CD1 . LEU A  1 418 ? 23.875  -3.496  9.951   1.00 45.18  ? 418  LEU A CD1 1 
ATOM   3160 C  CD2 . LEU A  1 418 ? 22.542  -1.845  11.234  1.00 39.19  ? 418  LEU A CD2 1 
ATOM   3161 N  N   . ALA A  1 419 ? 19.118  -5.132  8.387   1.00 42.20  ? 419  ALA A N   1 
ATOM   3162 C  CA  . ALA A  1 419 ? 17.822  -5.803  8.361   1.00 46.47  ? 419  ALA A CA  1 
ATOM   3163 C  C   . ALA A  1 419 ? 17.895  -7.149  7.647   1.00 58.50  ? 419  ALA A C   1 
ATOM   3164 O  O   . ALA A  1 419 ? 17.309  -8.135  8.095   1.00 67.00  ? 419  ALA A O   1 
ATOM   3165 C  CB  . ALA A  1 419 ? 16.785  -4.911  7.700   1.00 41.73  ? 419  ALA A CB  1 
ATOM   3166 N  N   . ALA A  1 420 ? 18.611  -7.179  6.529   1.00 54.96  ? 420  ALA A N   1 
ATOM   3167 C  CA  . ALA A  1 420 ? 18.768  -8.401  5.748   1.00 53.18  ? 420  ALA A CA  1 
ATOM   3168 C  C   . ALA A  1 420 ? 19.614  -9.448  6.466   1.00 56.82  ? 420  ALA A C   1 
ATOM   3169 O  O   . ALA A  1 420 ? 19.650  -10.609 6.056   1.00 61.88  ? 420  ALA A O   1 
ATOM   3170 C  CB  . ALA A  1 420 ? 19.376  -8.080  4.389   1.00 43.85  ? 420  ALA A CB  1 
ATOM   3171 N  N   . GLN A  1 421 ? 20.295  -9.038  7.533   1.00 53.84  ? 421  GLN A N   1 
ATOM   3172 C  CA  . GLN A  1 421 ? 21.226  -9.927  8.217   1.00 57.25  ? 421  GLN A CA  1 
ATOM   3173 C  C   . GLN A  1 421 ? 20.885  -10.148 9.692   1.00 54.78  ? 421  GLN A C   1 
ATOM   3174 O  O   . GLN A  1 421 ? 21.778  -10.350 10.517  1.00 56.64  ? 421  GLN A O   1 
ATOM   3175 C  CB  . GLN A  1 421 ? 22.669  -9.431  8.033   1.00 61.02  ? 421  GLN A CB  1 
ATOM   3176 C  CG  . GLN A  1 421 ? 23.125  -9.450  6.571   1.00 70.49  ? 421  GLN A CG  1 
ATOM   3177 C  CD  . GLN A  1 421 ? 24.454  -8.752  6.333   1.00 76.27  ? 421  GLN A CD  1 
ATOM   3178 O  OE1 . GLN A  1 421 ? 24.716  -8.254  5.237   1.00 72.33  ? 421  GLN A OE1 1 
ATOM   3179 N  NE2 . GLN A  1 421 ? 25.303  -8.723  7.353   1.00 78.33  ? 421  GLN A NE2 1 
ATOM   3180 N  N   . GLY A  1 422 ? 19.593  -10.115 10.015  1.00 56.53  ? 422  GLY A N   1 
ATOM   3181 C  CA  . GLY A  1 422 ? 19.128  -10.524 11.333  1.00 62.52  ? 422  GLY A CA  1 
ATOM   3182 C  C   . GLY A  1 422 ? 18.643  -9.443  12.284  1.00 63.78  ? 422  GLY A C   1 
ATOM   3183 O  O   . GLY A  1 422 ? 17.800  -9.702  13.144  1.00 68.12  ? 422  GLY A O   1 
ATOM   3184 N  N   . ALA A  1 423 ? 19.173  -8.234  12.137  1.00 60.64  ? 423  ALA A N   1 
ATOM   3185 C  CA  . ALA A  1 423 ? 18.888  -7.152  13.075  1.00 55.40  ? 423  ALA A CA  1 
ATOM   3186 C  C   . ALA A  1 423 ? 17.436  -6.695  13.074  1.00 54.29  ? 423  ALA A C   1 
ATOM   3187 O  O   . ALA A  1 423 ? 16.759  -6.744  12.046  1.00 60.71  ? 423  ALA A O   1 
ATOM   3188 C  CB  . ALA A  1 423 ? 19.801  -5.974  12.799  1.00 50.24  ? 423  ALA A CB  1 
ATOM   3189 N  N   . ARG A  1 424 ? 16.966  -6.254  14.238  1.00 46.44  ? 424  ARG A N   1 
ATOM   3190 C  CA  . ARG A  1 424 ? 15.696  -5.544  14.335  1.00 48.90  ? 424  ARG A CA  1 
ATOM   3191 C  C   . ARG A  1 424 ? 15.975  -4.062  14.122  1.00 46.39  ? 424  ARG A C   1 
ATOM   3192 O  O   . ARG A  1 424 ? 16.678  -3.437  14.920  1.00 42.08  ? 424  ARG A O   1 
ATOM   3193 C  CB  . ARG A  1 424 ? 15.054  -5.761  15.705  1.00 56.30  ? 424  ARG A CB  1 
ATOM   3194 C  CG  . ARG A  1 424 ? 13.697  -5.091  15.869  1.00 68.06  ? 424  ARG A CG  1 
ATOM   3195 C  CD  . ARG A  1 424 ? 12.618  -6.118  16.166  1.00 84.01  ? 424  ARG A CD  1 
ATOM   3196 N  NE  . ARG A  1 424 ? 13.011  -7.004  17.259  1.00 95.54  ? 424  ARG A NE  1 
ATOM   3197 C  CZ  . ARG A  1 424 ? 12.667  -6.831  18.533  1.00 97.49  ? 424  ARG A CZ  1 
ATOM   3198 N  NH1 . ARG A  1 424 ? 11.906  -5.806  18.891  1.00 95.01  ? 424  ARG A NH1 1 
ATOM   3199 N  NH2 . ARG A  1 424 ? 13.083  -7.692  19.452  1.00 96.10  ? 424  ARG A NH2 1 
ATOM   3200 N  N   . VAL A  1 425 ? 15.433  -3.504  13.044  1.00 47.09  ? 425  VAL A N   1 
ATOM   3201 C  CA  . VAL A  1 425 ? 15.725  -2.123  12.671  1.00 42.44  ? 425  VAL A CA  1 
ATOM   3202 C  C   . VAL A  1 425 ? 14.483  -1.237  12.663  1.00 37.76  ? 425  VAL A C   1 
ATOM   3203 O  O   . VAL A  1 425 ? 13.476  -1.572  12.039  1.00 39.31  ? 425  VAL A O   1 
ATOM   3204 C  CB  . VAL A  1 425 ? 16.378  -2.050  11.275  1.00 45.28  ? 425  VAL A CB  1 
ATOM   3205 C  CG1 . VAL A  1 425 ? 16.758  -0.616  10.941  1.00 37.25  ? 425  VAL A CG1 1 
ATOM   3206 C  CG2 . VAL A  1 425 ? 17.599  -2.951  11.209  1.00 41.58  ? 425  VAL A CG2 1 
ATOM   3207 N  N   . TYR A  1 426 ? 14.559  -0.106  13.360  1.00 36.04  ? 426  TYR A N   1 
ATOM   3208 C  CA  . TYR A  1 426 ? 13.520  0.916   13.269  1.00 36.94  ? 426  TYR A CA  1 
ATOM   3209 C  C   . TYR A  1 426 ? 14.096  2.167   12.610  1.00 37.26  ? 426  TYR A C   1 
ATOM   3210 O  O   . TYR A  1 426 ? 15.191  2.614   12.959  1.00 33.44  ? 426  TYR A O   1 
ATOM   3211 C  CB  . TYR A  1 426 ? 12.936  1.231   14.648  1.00 43.08  ? 426  TYR A CB  1 
ATOM   3212 C  CG  . TYR A  1 426 ? 12.129  0.091   15.227  1.00 47.91  ? 426  TYR A CG  1 
ATOM   3213 C  CD1 . TYR A  1 426 ? 12.733  -0.884  16.008  1.00 51.11  ? 426  TYR A CD1 1 
ATOM   3214 C  CD2 . TYR A  1 426 ? 10.764  -0.017  14.984  1.00 47.87  ? 426  TYR A CD2 1 
ATOM   3215 C  CE1 . TYR A  1 426 ? 12.005  -1.930  16.535  1.00 60.17  ? 426  TYR A CE1 1 
ATOM   3216 C  CE2 . TYR A  1 426 ? 10.027  -1.063  15.507  1.00 52.66  ? 426  TYR A CE2 1 
ATOM   3217 C  CZ  . TYR A  1 426 ? 10.654  -2.015  16.283  1.00 60.03  ? 426  TYR A CZ  1 
ATOM   3218 O  OH  . TYR A  1 426 ? 9.930   -3.059  16.811  1.00 59.85  ? 426  TYR A OH  1 
ATOM   3219 N  N   . ALA A  1 427 ? 13.363  2.717   11.645  1.00 35.23  ? 427  ALA A N   1 
ATOM   3220 C  CA  . ALA A  1 427 ? 13.852  3.850   10.863  1.00 37.02  ? 427  ALA A CA  1 
ATOM   3221 C  C   . ALA A  1 427 ? 12.888  5.036   10.899  1.00 39.47  ? 427  ALA A C   1 
ATOM   3222 O  O   . ALA A  1 427 ? 11.669  4.851   10.885  1.00 40.77  ? 427  ALA A O   1 
ATOM   3223 C  CB  . ALA A  1 427 ? 14.124  3.425   9.423   1.00 36.22  ? 427  ALA A CB  1 
ATOM   3224 N  N   . TYR A  1 428 ? 13.440  6.250   10.937  1.00 36.98  ? 428  TYR A N   1 
ATOM   3225 C  CA  . TYR A  1 428 ? 12.629  7.469   10.981  1.00 41.22  ? 428  TYR A CA  1 
ATOM   3226 C  C   . TYR A  1 428 ? 13.169  8.554   10.053  1.00 40.96  ? 428  TYR A C   1 
ATOM   3227 O  O   . TYR A  1 428 ? 14.344  8.541   9.683   1.00 34.28  ? 428  TYR A O   1 
ATOM   3228 C  CB  . TYR A  1 428 ? 12.564  8.024   12.413  1.00 34.57  ? 428  TYR A CB  1 
ATOM   3229 C  CG  . TYR A  1 428 ? 13.885  8.559   12.937  1.00 39.45  ? 428  TYR A CG  1 
ATOM   3230 C  CD1 . TYR A  1 428 ? 14.284  9.868   12.683  1.00 36.12  ? 428  TYR A CD1 1 
ATOM   3231 C  CD2 . TYR A  1 428 ? 14.724  7.759   13.698  1.00 34.22  ? 428  TYR A CD2 1 
ATOM   3232 C  CE1 . TYR A  1 428 ? 15.487  10.355  13.159  1.00 32.47  ? 428  TYR A CE1 1 
ATOM   3233 C  CE2 . TYR A  1 428 ? 15.924  8.239   14.181  1.00 33.14  ? 428  TYR A CE2 1 
ATOM   3234 C  CZ  . TYR A  1 428 ? 16.300  9.535   13.907  1.00 35.89  ? 428  TYR A CZ  1 
ATOM   3235 O  OH  . TYR A  1 428 ? 17.498  10.012  14.386  1.00 43.19  ? 428  TYR A OH  1 
ATOM   3236 N  N   . ILE A  1 429 ? 12.304  9.495   9.682   1.00 33.61  ? 429  ILE A N   1 
ATOM   3237 C  CA  . ILE A  1 429 ? 12.763  10.783  9.171   1.00 26.85  ? 429  ILE A CA  1 
ATOM   3238 C  C   . ILE A  1 429 ? 12.198  11.902  10.056  1.00 39.42  ? 429  ILE A C   1 
ATOM   3239 O  O   . ILE A  1 429 ? 11.002  11.924  10.358  1.00 38.39  ? 429  ILE A O   1 
ATOM   3240 C  CB  . ILE A  1 429 ? 12.415  10.994  7.674   1.00 41.20  ? 429  ILE A CB  1 
ATOM   3241 C  CG1 . ILE A  1 429 ? 12.986  12.325  7.182   1.00 33.61  ? 429  ILE A CG1 1 
ATOM   3242 C  CG2 . ILE A  1 429 ? 10.912  10.920  7.430   1.00 37.83  ? 429  ILE A CG2 1 
ATOM   3243 C  CD1 . ILE A  1 429 ? 12.730  12.593  5.716   1.00 43.32  ? 429  ILE A CD1 1 
ATOM   3244 N  N   . PHE A  1 430 ? 13.067  12.808  10.497  1.00 40.57  ? 430  PHE A N   1 
ATOM   3245 C  CA  . PHE A  1 430 ? 12.661  13.897  11.383  1.00 40.30  ? 430  PHE A CA  1 
ATOM   3246 C  C   . PHE A  1 430 ? 12.386  15.164  10.575  1.00 40.21  ? 430  PHE A C   1 
ATOM   3247 O  O   . PHE A  1 430 ? 13.311  15.778  10.034  1.00 35.09  ? 430  PHE A O   1 
ATOM   3248 C  CB  . PHE A  1 430 ? 13.753  14.150  12.420  1.00 35.85  ? 430  PHE A CB  1 
ATOM   3249 C  CG  . PHE A  1 430 ? 13.356  15.103  13.507  1.00 31.81  ? 430  PHE A CG  1 
ATOM   3250 C  CD1 . PHE A  1 430 ? 13.578  16.466  13.366  1.00 35.87  ? 430  PHE A CD1 1 
ATOM   3251 C  CD2 . PHE A  1 430 ? 12.787  14.634  14.683  1.00 37.68  ? 430  PHE A CD2 1 
ATOM   3252 C  CE1 . PHE A  1 430 ? 13.225  17.347  14.373  1.00 46.16  ? 430  PHE A CE1 1 
ATOM   3253 C  CE2 . PHE A  1 430 ? 12.433  15.507  15.695  1.00 38.50  ? 430  PHE A CE2 1 
ATOM   3254 C  CZ  . PHE A  1 430 ? 12.652  16.867  15.539  1.00 40.98  ? 430  PHE A CZ  1 
ATOM   3255 N  N   . GLU A  1 431 ? 11.116  15.560  10.508  1.00 41.41  ? 431  GLU A N   1 
ATOM   3256 C  CA  . GLU A  1 431 ? 10.695  16.635  9.609   1.00 42.49  ? 431  GLU A CA  1 
ATOM   3257 C  C   . GLU A  1 431 ? 10.225  17.919  10.292  1.00 46.44  ? 431  GLU A C   1 
ATOM   3258 O  O   . GLU A  1 431 ? 9.704   18.811  9.623   1.00 50.52  ? 431  GLU A O   1 
ATOM   3259 C  CB  . GLU A  1 431 ? 9.573   16.148  8.690   1.00 47.35  ? 431  GLU A CB  1 
ATOM   3260 C  CG  . GLU A  1 431 ? 9.935   15.013  7.753   1.00 55.39  ? 431  GLU A CG  1 
ATOM   3261 C  CD  . GLU A  1 431 ? 8.754   14.588  6.904   1.00 64.47  ? 431  GLU A CD  1 
ATOM   3262 O  OE1 . GLU A  1 431 ? 7.610   14.946  7.261   1.00 58.65  ? 431  GLU A OE1 1 
ATOM   3263 O  OE2 . GLU A  1 431 ? 8.966   13.905  5.881   1.00 72.05  ? 431  GLU A OE2 1 
ATOM   3264 N  N   . HIS A  1 432 ? 10.385  18.025  11.607  1.00 45.98  ? 432  HIS A N   1 
ATOM   3265 C  CA  . HIS A  1 432 ? 9.945   19.240  12.293  1.00 42.53  ? 432  HIS A CA  1 
ATOM   3266 C  C   . HIS A  1 432 ? 11.048  20.282  12.472  1.00 42.53  ? 432  HIS A C   1 
ATOM   3267 O  O   . HIS A  1 432 ? 12.109  19.986  13.026  1.00 40.92  ? 432  HIS A O   1 
ATOM   3268 C  CB  . HIS A  1 432 ? 9.329   18.922  13.653  1.00 45.62  ? 432  HIS A CB  1 
ATOM   3269 C  CG  . HIS A  1 432 ? 8.934   20.142  14.424  1.00 46.60  ? 432  HIS A CG  1 
ATOM   3270 N  ND1 . HIS A  1 432 ? 7.862   20.931  14.065  1.00 48.25  ? 432  HIS A ND1 1 
ATOM   3271 C  CD2 . HIS A  1 432 ? 9.478   20.719  15.519  1.00 45.03  ? 432  HIS A CD2 1 
ATOM   3272 C  CE1 . HIS A  1 432 ? 7.758   21.938  14.913  1.00 47.30  ? 432  HIS A CE1 1 
ATOM   3273 N  NE2 . HIS A  1 432 ? 8.726   21.834  15.806  1.00 51.14  ? 432  HIS A NE2 1 
ATOM   3274 N  N   . ARG A  1 433 ? 10.782  21.504  12.016  1.00 42.66  ? 433  ARG A N   1 
ATOM   3275 C  CA  . ARG A  1 433 ? 11.704  22.622  12.200  1.00 41.83  ? 433  ARG A CA  1 
ATOM   3276 C  C   . ARG A  1 433 ? 11.365  23.359  13.488  1.00 46.69  ? 433  ARG A C   1 
ATOM   3277 O  O   . ARG A  1 433 ? 10.225  23.781  13.686  1.00 51.42  ? 433  ARG A O   1 
ATOM   3278 C  CB  . ARG A  1 433 ? 11.616  23.588  11.013  1.00 38.52  ? 433  ARG A CB  1 
ATOM   3279 C  CG  . ARG A  1 433 ? 12.579  24.773  11.081  1.00 37.72  ? 433  ARG A CG  1 
ATOM   3280 C  CD  . ARG A  1 433 ? 12.388  25.714  9.896   1.00 34.09  ? 433  ARG A CD  1 
ATOM   3281 N  NE  . ARG A  1 433 ? 13.624  26.412  9.547   1.00 46.80  ? 433  ARG A NE  1 
ATOM   3282 C  CZ  . ARG A  1 433 ? 13.939  27.632  9.970   1.00 49.23  ? 433  ARG A CZ  1 
ATOM   3283 N  NH1 . ARG A  1 433 ? 13.107  28.296  10.758  1.00 61.66  ? 433  ARG A NH1 1 
ATOM   3284 N  NH2 . ARG A  1 433 ? 15.085  28.188  9.608   1.00 44.98  ? 433  ARG A NH2 1 
ATOM   3285 N  N   . ALA A  1 434 ? 12.351  23.509  14.365  1.00 44.49  ? 434  ALA A N   1 
ATOM   3286 C  CA  . ALA A  1 434 ? 12.142  24.207  15.629  1.00 42.78  ? 434  ALA A CA  1 
ATOM   3287 C  C   . ALA A  1 434 ? 11.724  25.649  15.388  1.00 45.05  ? 434  ALA A C   1 
ATOM   3288 O  O   . ALA A  1 434 ? 12.288  26.328  14.532  1.00 51.35  ? 434  ALA A O   1 
ATOM   3289 C  CB  . ALA A  1 434 ? 13.400  24.163  16.475  1.00 37.86  ? 434  ALA A CB  1 
ATOM   3290 N  N   . SER A  1 435 ? 10.740  26.112  16.154  1.00 43.72  ? 435  SER A N   1 
ATOM   3291 C  CA  . SER A  1 435 ? 10.264  27.488  16.058  1.00 48.37  ? 435  SER A CA  1 
ATOM   3292 C  C   . SER A  1 435 ? 11.344  28.466  16.505  1.00 50.14  ? 435  SER A C   1 
ATOM   3293 O  O   . SER A  1 435 ? 11.264  29.663  16.226  1.00 48.61  ? 435  SER A O   1 
ATOM   3294 C  CB  . SER A  1 435 ? 9.013   27.671  16.919  1.00 46.12  ? 435  SER A CB  1 
ATOM   3295 O  OG  . SER A  1 435 ? 9.275   27.336  18.270  1.00 49.24  ? 435  SER A OG  1 
ATOM   3296 N  N   . THR A  1 436 ? 12.354  27.937  17.194  1.00 46.03  ? 436  THR A N   1 
ATOM   3297 C  CA  . THR A  1 436 ? 13.429  28.739  17.767  1.00 46.38  ? 436  THR A CA  1 
ATOM   3298 C  C   . THR A  1 436 ? 14.703  28.706  16.928  1.00 49.73  ? 436  THR A C   1 
ATOM   3299 O  O   . THR A  1 436 ? 15.722  29.282  17.314  1.00 50.97  ? 436  THR A O   1 
ATOM   3300 C  CB  . THR A  1 436 ? 13.775  28.264  19.193  1.00 43.56  ? 436  THR A CB  1 
ATOM   3301 O  OG1 . THR A  1 436 ? 14.206  26.897  19.158  1.00 49.62  ? 436  THR A OG1 1 
ATOM   3302 C  CG2 . THR A  1 436 ? 12.567  28.379  20.099  1.00 43.34  ? 436  THR A CG2 1 
ATOM   3303 N  N   . LEU A  1 437 ? 14.647  28.030  15.784  1.00 49.42  ? 437  LEU A N   1 
ATOM   3304 C  CA  . LEU A  1 437 ? 15.811  27.903  14.909  1.00 44.11  ? 437  LEU A CA  1 
ATOM   3305 C  C   . LEU A  1 437 ? 16.275  29.270  14.398  1.00 41.96  ? 437  LEU A C   1 
ATOM   3306 O  O   . LEU A  1 437 ? 15.464  30.078  13.941  1.00 42.70  ? 437  LEU A O   1 
ATOM   3307 C  CB  . LEU A  1 437 ? 15.491  26.962  13.741  1.00 50.64  ? 437  LEU A CB  1 
ATOM   3308 C  CG  . LEU A  1 437 ? 16.629  26.288  12.970  1.00 54.38  ? 437  LEU A CG  1 
ATOM   3309 C  CD1 . LEU A  1 437 ? 17.818  26.062  13.868  1.00 54.18  ? 437  LEU A CD1 1 
ATOM   3310 C  CD2 . LEU A  1 437 ? 16.153  24.963  12.409  1.00 53.55  ? 437  LEU A CD2 1 
ATOM   3311 N  N   . THR A  1 438 ? 17.577  29.534  14.495  1.00 34.85  ? 438  THR A N   1 
ATOM   3312 C  CA  . THR A  1 438 ? 18.132  30.814  14.052  1.00 39.04  ? 438  THR A CA  1 
ATOM   3313 C  C   . THR A  1 438 ? 18.694  30.749  12.635  1.00 46.11  ? 438  THR A C   1 
ATOM   3314 O  O   . THR A  1 438 ? 18.946  31.783  12.016  1.00 51.03  ? 438  THR A O   1 
ATOM   3315 C  CB  . THR A  1 438 ? 19.219  31.339  15.009  1.00 39.68  ? 438  THR A CB  1 
ATOM   3316 O  OG1 . THR A  1 438 ? 20.173  30.302  15.275  1.00 48.68  ? 438  THR A OG1 1 
ATOM   3317 C  CG2 . THR A  1 438 ? 18.601  31.807  16.316  1.00 38.75  ? 438  THR A CG2 1 
ATOM   3318 N  N   . TRP A  1 439 ? 18.899  29.537  12.127  1.00 43.54  ? 439  TRP A N   1 
ATOM   3319 C  CA  . TRP A  1 439 ? 19.316  29.363  10.739  1.00 42.20  ? 439  TRP A CA  1 
ATOM   3320 C  C   . TRP A  1 439 ? 18.172  29.801  9.821   1.00 38.99  ? 439  TRP A C   1 
ATOM   3321 O  O   . TRP A  1 439 ? 17.005  29.742  10.219  1.00 41.11  ? 439  TRP A O   1 
ATOM   3322 C  CB  . TRP A  1 439 ? 19.711  27.905  10.473  1.00 34.98  ? 439  TRP A CB  1 
ATOM   3323 C  CG  . TRP A  1 439 ? 20.957  27.477  11.197  1.00 34.98  ? 439  TRP A CG  1 
ATOM   3324 C  CD1 . TRP A  1 439 ? 21.034  26.706  12.323  1.00 40.36  ? 439  TRP A CD1 1 
ATOM   3325 C  CD2 . TRP A  1 439 ? 22.307  27.798  10.839  1.00 33.91  ? 439  TRP A CD2 1 
ATOM   3326 N  NE1 . TRP A  1 439 ? 22.351  26.530  12.688  1.00 34.98  ? 439  TRP A NE1 1 
ATOM   3327 C  CE2 . TRP A  1 439 ? 23.152  27.193  11.793  1.00 35.05  ? 439  TRP A CE2 1 
ATOM   3328 C  CE3 . TRP A  1 439 ? 22.883  28.543  9.805   1.00 34.24  ? 439  TRP A CE3 1 
ATOM   3329 C  CZ2 . TRP A  1 439 ? 24.547  27.310  11.740  1.00 37.01  ? 439  TRP A CZ2 1 
ATOM   3330 C  CZ3 . TRP A  1 439 ? 24.263  28.655  9.752   1.00 37.02  ? 439  TRP A CZ3 1 
ATOM   3331 C  CH2 . TRP A  1 439 ? 25.079  28.044  10.712  1.00 43.81  ? 439  TRP A CH2 1 
ATOM   3332 N  N   . PRO A  1 440 ? 18.498  30.261  8.599   1.00 37.99  ? 440  PRO A N   1 
ATOM   3333 C  CA  . PRO A  1 440 ? 17.432  30.746  7.713   1.00 35.31  ? 440  PRO A CA  1 
ATOM   3334 C  C   . PRO A  1 440 ? 16.488  29.636  7.270   1.00 34.22  ? 440  PRO A C   1 
ATOM   3335 O  O   . PRO A  1 440 ? 16.824  28.457  7.392   1.00 37.34  ? 440  PRO A O   1 
ATOM   3336 C  CB  . PRO A  1 440 ? 18.199  31.301  6.505   1.00 35.14  ? 440  PRO A CB  1 
ATOM   3337 C  CG  . PRO A  1 440 ? 19.521  30.605  6.531   1.00 37.27  ? 440  PRO A CG  1 
ATOM   3338 C  CD  . PRO A  1 440 ? 19.833  30.395  7.986   1.00 36.54  ? 440  PRO A CD  1 
ATOM   3339 N  N   . LEU A  1 441 ? 15.319  30.019  6.766   1.00 36.27  ? 441  LEU A N   1 
ATOM   3340 C  CA  . LEU A  1 441 ? 14.285  29.067  6.368   1.00 42.96  ? 441  LEU A CA  1 
ATOM   3341 C  C   . LEU A  1 441 ? 14.715  28.094  5.270   1.00 47.81  ? 441  LEU A C   1 
ATOM   3342 O  O   . LEU A  1 441 ? 14.301  26.933  5.282   1.00 53.06  ? 441  LEU A O   1 
ATOM   3343 C  CB  . LEU A  1 441 ? 13.019  29.816  5.937   1.00 52.23  ? 441  LEU A CB  1 
ATOM   3344 C  CG  . LEU A  1 441 ? 12.270  30.561  7.043   1.00 60.20  ? 441  LEU A CG  1 
ATOM   3345 C  CD1 . LEU A  1 441 ? 11.338  31.618  6.471   1.00 60.53  ? 441  LEU A CD1 1 
ATOM   3346 C  CD2 . LEU A  1 441 ? 11.493  29.576  7.895   1.00 62.02  ? 441  LEU A CD2 1 
ATOM   3347 N  N   . TRP A  1 442 ? 15.542  28.557  4.332   1.00 45.10  ? 442  TRP A N   1 
ATOM   3348 C  CA  . TRP A  1 442 ? 15.940  27.723  3.193   1.00 47.48  ? 442  TRP A CA  1 
ATOM   3349 C  C   . TRP A  1 442 ? 16.689  26.458  3.604   1.00 49.01  ? 442  TRP A C   1 
ATOM   3350 O  O   . TRP A  1 442 ? 16.763  25.497  2.834   1.00 50.24  ? 442  TRP A O   1 
ATOM   3351 C  CB  . TRP A  1 442 ? 16.731  28.522  2.139   1.00 38.57  ? 442  TRP A CB  1 
ATOM   3352 C  CG  . TRP A  1 442 ? 18.138  28.911  2.511   1.00 40.45  ? 442  TRP A CG  1 
ATOM   3353 C  CD1 . TRP A  1 442 ? 18.554  30.125  2.972   1.00 40.51  ? 442  TRP A CD1 1 
ATOM   3354 C  CD2 . TRP A  1 442 ? 19.317  28.095  2.408   1.00 34.41  ? 442  TRP A CD2 1 
ATOM   3355 N  NE1 . TRP A  1 442 ? 19.914  30.111  3.181   1.00 38.07  ? 442  TRP A NE1 1 
ATOM   3356 C  CE2 . TRP A  1 442 ? 20.405  28.876  2.844   1.00 33.70  ? 442  TRP A CE2 1 
ATOM   3357 C  CE3 . TRP A  1 442 ? 19.554  26.777  2.003   1.00 22.94  ? 442  TRP A CE3 1 
ATOM   3358 C  CZ2 . TRP A  1 442 ? 21.712  28.381  2.886   1.00 30.50  ? 442  TRP A CZ2 1 
ATOM   3359 C  CZ3 . TRP A  1 442 ? 20.850  26.288  2.046   1.00 25.35  ? 442  TRP A CZ3 1 
ATOM   3360 C  CH2 . TRP A  1 442 ? 21.912  27.088  2.484   1.00 32.10  ? 442  TRP A CH2 1 
ATOM   3361 N  N   . MET A  1 443 ? 17.233  26.460  4.818   1.00 43.05  ? 443  MET A N   1 
ATOM   3362 C  CA  . MET A  1 443 ? 17.952  25.298  5.325   1.00 41.95  ? 443  MET A CA  1 
ATOM   3363 C  C   . MET A  1 443 ? 17.009  24.227  5.869   1.00 37.30  ? 443  MET A C   1 
ATOM   3364 O  O   . MET A  1 443 ? 17.447  23.124  6.190   1.00 41.53  ? 443  MET A O   1 
ATOM   3365 C  CB  . MET A  1 443 ? 18.977  25.702  6.394   1.00 40.27  ? 443  MET A CB  1 
ATOM   3366 C  CG  . MET A  1 443 ? 20.150  26.539  5.873   1.00 41.33  ? 443  MET A CG  1 
ATOM   3367 S  SD  . MET A  1 443 ? 21.440  26.783  7.120   1.00 39.93  ? 443  MET A SD  1 
ATOM   3368 C  CE  . MET A  1 443 ? 22.559  27.900  6.271   1.00 46.36  ? 443  MET A CE  1 
ATOM   3369 N  N   . GLY A  1 444 ? 15.721  24.550  5.963   1.00 30.27  ? 444  GLY A N   1 
ATOM   3370 C  CA  . GLY A  1 444 ? 14.722  23.595  6.418   1.00 36.59  ? 444  GLY A CA  1 
ATOM   3371 C  C   . GLY A  1 444 ? 14.981  23.059  7.816   1.00 41.11  ? 444  GLY A C   1 
ATOM   3372 O  O   . GLY A  1 444 ? 15.082  23.829  8.775   1.00 31.08  ? 444  GLY A O   1 
ATOM   3373 N  N   . VAL A  1 445 ? 15.073  21.736  7.927   1.00 34.46  ? 445  VAL A N   1 
ATOM   3374 C  CA  . VAL A  1 445 ? 15.411  21.073  9.182   1.00 37.46  ? 445  VAL A CA  1 
ATOM   3375 C  C   . VAL A  1 445 ? 16.843  20.549  9.079   1.00 38.54  ? 445  VAL A C   1 
ATOM   3376 O  O   . VAL A  1 445 ? 17.062  19.436  8.598   1.00 37.07  ? 445  VAL A O   1 
ATOM   3377 C  CB  . VAL A  1 445 ? 14.449  19.902  9.459   1.00 38.76  ? 445  VAL A CB  1 
ATOM   3378 C  CG1 . VAL A  1 445 ? 14.772  19.254  10.789  1.00 37.78  ? 445  VAL A CG1 1 
ATOM   3379 C  CG2 . VAL A  1 445 ? 13.004  20.381  9.442   1.00 33.95  ? 445  VAL A CG2 1 
ATOM   3380 N  N   . PRO A  1 446 ? 17.827  21.356  9.518   1.00 37.58  ? 446  PRO A N   1 
ATOM   3381 C  CA  . PRO A  1 446 ? 19.234  21.011  9.276   1.00 32.68  ? 446  PRO A CA  1 
ATOM   3382 C  C   . PRO A  1 446 ? 19.829  19.987  10.242  1.00 36.32  ? 446  PRO A C   1 
ATOM   3383 O  O   . PRO A  1 446 ? 19.228  19.649  11.261  1.00 35.23  ? 446  PRO A O   1 
ATOM   3384 C  CB  . PRO A  1 446 ? 19.955  22.358  9.425   1.00 26.75  ? 446  PRO A CB  1 
ATOM   3385 C  CG  . PRO A  1 446 ? 19.098  23.146  10.355  1.00 30.17  ? 446  PRO A CG  1 
ATOM   3386 C  CD  . PRO A  1 446 ? 17.678  22.694  10.123  1.00 33.00  ? 446  PRO A CD  1 
ATOM   3387 N  N   . HIS A  1 447 ? 21.019  19.509  9.886   1.00 35.74  ? 447  HIS A N   1 
ATOM   3388 C  CA  . HIS A  1 447 ? 21.781  18.512  10.638  1.00 34.95  ? 447  HIS A CA  1 
ATOM   3389 C  C   . HIS A  1 447 ? 21.915  18.854  12.126  1.00 38.82  ? 447  HIS A C   1 
ATOM   3390 O  O   . HIS A  1 447 ? 22.443  19.906  12.482  1.00 33.63  ? 447  HIS A O   1 
ATOM   3391 C  CB  . HIS A  1 447 ? 23.176  18.415  10.010  1.00 32.55  ? 447  HIS A CB  1 
ATOM   3392 C  CG  . HIS A  1 447 ? 23.918  17.150  10.319  1.00 39.48  ? 447  HIS A CG  1 
ATOM   3393 N  ND1 . HIS A  1 447 ? 23.421  15.899  10.014  1.00 40.61  ? 447  HIS A ND1 1 
ATOM   3394 C  CD2 . HIS A  1 447 ? 25.141  16.947  10.858  1.00 32.56  ? 447  HIS A CD2 1 
ATOM   3395 C  CE1 . HIS A  1 447 ? 24.299  14.982  10.375  1.00 36.93  ? 447  HIS A CE1 1 
ATOM   3396 N  NE2 . HIS A  1 447 ? 25.353  15.588  10.892  1.00 37.50  ? 447  HIS A NE2 1 
ATOM   3397 N  N   . GLY A  1 448 ? 21.437  17.961  12.989  1.00 33.96  ? 448  GLY A N   1 
ATOM   3398 C  CA  . GLY A  1 448 ? 21.608  18.120  14.423  1.00 36.13  ? 448  GLY A CA  1 
ATOM   3399 C  C   . GLY A  1 448 ? 20.453  18.777  15.160  1.00 36.34  ? 448  GLY A C   1 
ATOM   3400 O  O   . GLY A  1 448 ? 20.515  18.947  16.376  1.00 36.56  ? 448  GLY A O   1 
ATOM   3401 N  N   . TYR A  1 449 ? 19.393  19.145  14.447  1.00 34.66  ? 449  TYR A N   1 
ATOM   3402 C  CA  . TYR A  1 449 ? 18.304  19.877  15.093  1.00 35.82  ? 449  TYR A CA  1 
ATOM   3403 C  C   . TYR A  1 449 ? 17.089  19.019  15.459  1.00 35.94  ? 449  TYR A C   1 
ATOM   3404 O  O   . TYR A  1 449 ? 15.966  19.515  15.575  1.00 36.79  ? 449  TYR A O   1 
ATOM   3405 C  CB  . TYR A  1 449 ? 17.947  21.140  14.299  1.00 31.62  ? 449  TYR A CB  1 
ATOM   3406 C  CG  . TYR A  1 449 ? 19.010  22.200  14.468  1.00 39.61  ? 449  TYR A CG  1 
ATOM   3407 C  CD1 . TYR A  1 449 ? 18.988  23.057  15.559  1.00 39.03  ? 449  TYR A CD1 1 
ATOM   3408 C  CD2 . TYR A  1 449 ? 20.065  22.308  13.571  1.00 36.44  ? 449  TYR A CD2 1 
ATOM   3409 C  CE1 . TYR A  1 449 ? 19.967  24.011  15.738  1.00 34.78  ? 449  TYR A CE1 1 
ATOM   3410 C  CE2 . TYR A  1 449 ? 21.050  23.261  13.741  1.00 38.40  ? 449  TYR A CE2 1 
ATOM   3411 C  CZ  . TYR A  1 449 ? 20.994  24.109  14.829  1.00 37.72  ? 449  TYR A CZ  1 
ATOM   3412 O  OH  . TYR A  1 449 ? 21.966  25.063  15.017  1.00 35.60  ? 449  TYR A OH  1 
ATOM   3413 N  N   . GLU A  1 450 ? 17.343  17.729  15.657  1.00 29.63  ? 450  GLU A N   1 
ATOM   3414 C  CA  . GLU A  1 450 ? 16.383  16.839  16.296  1.00 35.19  ? 450  GLU A CA  1 
ATOM   3415 C  C   . GLU A  1 450 ? 16.806  16.610  17.747  1.00 33.42  ? 450  GLU A C   1 
ATOM   3416 O  O   . GLU A  1 450 ? 15.981  16.279  18.600  1.00 32.04  ? 450  GLU A O   1 
ATOM   3417 C  CB  . GLU A  1 450 ? 16.303  15.503  15.547  1.00 25.84  ? 450  GLU A CB  1 
ATOM   3418 C  CG  . GLU A  1 450 ? 17.369  14.475  15.929  1.00 23.63  ? 450  GLU A CG  1 
ATOM   3419 C  CD  . GLU A  1 450 ? 18.722  14.743  15.291  1.00 33.64  ? 450  GLU A CD  1 
ATOM   3420 O  OE1 . GLU A  1 450 ? 19.013  15.906  14.930  1.00 32.77  ? 450  GLU A OE1 1 
ATOM   3421 O  OE2 . GLU A  1 450 ? 19.503  13.778  15.145  1.00 34.65  ? 450  GLU A OE2 1 
ATOM   3422 N  N   . ILE A  1 451 ? 18.096  16.813  18.015  1.00 32.35  ? 451  ILE A N   1 
ATOM   3423 C  CA  . ILE A  1 451 ? 18.696  16.501  19.314  1.00 41.11  ? 451  ILE A CA  1 
ATOM   3424 C  C   . ILE A  1 451 ? 17.981  17.169  20.486  1.00 34.16  ? 451  ILE A C   1 
ATOM   3425 O  O   . ILE A  1 451 ? 17.639  16.504  21.462  1.00 34.64  ? 451  ILE A O   1 
ATOM   3426 C  CB  . ILE A  1 451 ? 20.193  16.890  19.355  1.00 36.41  ? 451  ILE A CB  1 
ATOM   3427 C  CG1 . ILE A  1 451 ? 20.971  16.188  18.237  1.00 27.77  ? 451  ILE A CG1 1 
ATOM   3428 C  CG2 . ILE A  1 451 ? 20.797  16.546  20.704  1.00 30.04  ? 451  ILE A CG2 1 
ATOM   3429 C  CD1 . ILE A  1 451 ? 22.458  16.541  18.199  1.00 25.81  ? 451  ILE A CD1 1 
ATOM   3430 N  N   . GLU A  1 452 ? 17.746  18.475  20.380  1.00 32.57  ? 452  GLU A N   1 
ATOM   3431 C  CA  . GLU A  1 452 ? 17.112  19.245  21.454  1.00 34.92  ? 452  GLU A CA  1 
ATOM   3432 C  C   . GLU A  1 452 ? 15.714  18.731  21.791  1.00 41.64  ? 452  GLU A C   1 
ATOM   3433 O  O   . GLU A  1 452 ? 15.204  18.967  22.889  1.00 44.75  ? 452  GLU A O   1 
ATOM   3434 C  CB  . GLU A  1 452 ? 17.060  20.734  21.080  1.00 35.63  ? 452  GLU A CB  1 
ATOM   3435 C  CG  . GLU A  1 452 ? 16.216  21.044  19.840  1.00 37.72  ? 452  GLU A CG  1 
ATOM   3436 C  CD  . GLU A  1 452 ? 16.575  22.367  19.188  1.00 34.25  ? 452  GLU A CD  1 
ATOM   3437 O  OE1 . GLU A  1 452 ? 17.721  22.513  18.717  1.00 38.71  ? 452  GLU A OE1 1 
ATOM   3438 O  OE2 . GLU A  1 452 ? 15.705  23.262  19.128  1.00 38.33  ? 452  GLU A OE2 1 
ATOM   3439 N  N   . PHE A  1 453 ? 15.101  18.026  20.843  1.00 36.69  ? 453  PHE A N   1 
ATOM   3440 C  CA  . PHE A  1 453 ? 13.782  17.434  21.049  1.00 33.21  ? 453  PHE A CA  1 
ATOM   3441 C  C   . PHE A  1 453 ? 13.864  16.061  21.718  1.00 36.81  ? 453  PHE A C   1 
ATOM   3442 O  O   . PHE A  1 453 ? 13.022  15.723  22.550  1.00 39.62  ? 453  PHE A O   1 
ATOM   3443 C  CB  . PHE A  1 453 ? 13.028  17.347  19.720  1.00 38.13  ? 453  PHE A CB  1 
ATOM   3444 C  CG  . PHE A  1 453 ? 12.488  18.667  19.244  1.00 39.38  ? 453  PHE A CG  1 
ATOM   3445 C  CD1 . PHE A  1 453 ? 11.219  19.085  19.623  1.00 37.31  ? 453  PHE A CD1 1 
ATOM   3446 C  CD2 . PHE A  1 453 ? 13.245  19.488  18.419  1.00 35.16  ? 453  PHE A CD2 1 
ATOM   3447 C  CE1 . PHE A  1 453 ? 10.713  20.300  19.192  1.00 38.85  ? 453  PHE A CE1 1 
ATOM   3448 C  CE2 . PHE A  1 453 ? 12.748  20.707  17.982  1.00 37.84  ? 453  PHE A CE2 1 
ATOM   3449 C  CZ  . PHE A  1 453 ? 11.479  21.114  18.370  1.00 38.19  ? 453  PHE A CZ  1 
ATOM   3450 N  N   . ILE A  1 454 ? 14.873  15.275  21.348  1.00 33.05  ? 454  ILE A N   1 
ATOM   3451 C  CA  . ILE A  1 454 ? 15.114  13.977  21.975  1.00 34.98  ? 454  ILE A CA  1 
ATOM   3452 C  C   . ILE A  1 454 ? 15.462  14.139  23.461  1.00 42.59  ? 454  ILE A C   1 
ATOM   3453 O  O   . ILE A  1 454 ? 15.101  13.303  24.293  1.00 42.37  ? 454  ILE A O   1 
ATOM   3454 C  CB  . ILE A  1 454 ? 16.262  13.215  21.262  1.00 42.75  ? 454  ILE A CB  1 
ATOM   3455 C  CG1 . ILE A  1 454 ? 16.031  13.168  19.747  1.00 41.26  ? 454  ILE A CG1 1 
ATOM   3456 C  CG2 . ILE A  1 454 ? 16.420  11.807  21.831  1.00 35.24  ? 454  ILE A CG2 1 
ATOM   3457 C  CD1 . ILE A  1 454 ? 14.849  12.317  19.333  1.00 38.93  ? 454  ILE A CD1 1 
ATOM   3458 N  N   . PHE A  1 455 ? 16.165  15.219  23.789  1.00 40.25  ? 455  PHE A N   1 
ATOM   3459 C  CA  . PHE A  1 455 ? 16.583  15.470  25.165  1.00 41.49  ? 455  PHE A CA  1 
ATOM   3460 C  C   . PHE A  1 455 ? 15.501  16.172  25.987  1.00 45.17  ? 455  PHE A C   1 
ATOM   3461 O  O   . PHE A  1 455 ? 15.590  16.233  27.215  1.00 42.61  ? 455  PHE A O   1 
ATOM   3462 C  CB  . PHE A  1 455 ? 17.900  16.257  25.196  1.00 38.11  ? 455  PHE A CB  1 
ATOM   3463 C  CG  . PHE A  1 455 ? 19.131  15.390  25.083  1.00 34.94  ? 455  PHE A CG  1 
ATOM   3464 C  CD1 . PHE A  1 455 ? 19.602  14.981  23.840  1.00 25.56  ? 455  PHE A CD1 1 
ATOM   3465 C  CD2 . PHE A  1 455 ? 19.820  14.989  26.223  1.00 30.08  ? 455  PHE A CD2 1 
ATOM   3466 C  CE1 . PHE A  1 455 ? 20.737  14.182  23.738  1.00 31.93  ? 455  PHE A CE1 1 
ATOM   3467 C  CE2 . PHE A  1 455 ? 20.955  14.192  26.130  1.00 34.32  ? 455  PHE A CE2 1 
ATOM   3468 C  CZ  . PHE A  1 455 ? 21.414  13.788  24.885  1.00 43.94  ? 455  PHE A CZ  1 
ATOM   3469 N  N   . GLY A  1 456 ? 14.480  16.697  25.310  1.00 38.10  ? 456  GLY A N   1 
ATOM   3470 C  CA  . GLY A  1 456 ? 13.324  17.264  25.989  1.00 33.91  ? 456  GLY A CA  1 
ATOM   3471 C  C   . GLY A  1 456 ? 13.465  18.715  26.415  1.00 39.21  ? 456  GLY A C   1 
ATOM   3472 O  O   . GLY A  1 456 ? 12.764  19.173  27.317  1.00 48.42  ? 456  GLY A O   1 
ATOM   3473 N  N   . LEU A  1 457 ? 14.371  19.439  25.765  1.00 38.53  ? 457  LEU A N   1 
ATOM   3474 C  CA  . LEU A  1 457 ? 14.529  20.876  26.008  1.00 38.90  ? 457  LEU A CA  1 
ATOM   3475 C  C   . LEU A  1 457 ? 13.240  21.724  25.901  1.00 44.80  ? 457  LEU A C   1 
ATOM   3476 O  O   . LEU A  1 457 ? 13.094  22.701  26.639  1.00 46.93  ? 457  LEU A O   1 
ATOM   3477 C  CB  . LEU A  1 457 ? 15.658  21.467  25.146  1.00 33.36  ? 457  LEU A CB  1 
ATOM   3478 C  CG  . LEU A  1 457 ? 17.080  21.445  25.731  1.00 38.99  ? 457  LEU A CG  1 
ATOM   3479 C  CD1 . LEU A  1 457 ? 17.603  20.026  25.892  1.00 38.77  ? 457  LEU A CD1 1 
ATOM   3480 C  CD2 . LEU A  1 457 ? 18.047  22.271  24.891  1.00 37.23  ? 457  LEU A CD2 1 
ATOM   3481 N  N   . PRO A  1 458 ? 12.303  21.366  24.993  1.00 48.24  ? 458  PRO A N   1 
ATOM   3482 C  CA  . PRO A  1 458 ? 11.056  22.145  24.980  1.00 49.20  ? 458  PRO A CA  1 
ATOM   3483 C  C   . PRO A  1 458 ? 10.252  22.077  26.284  1.00 48.11  ? 458  PRO A C   1 
ATOM   3484 O  O   . PRO A  1 458 ? 9.305   22.848  26.440  1.00 47.52  ? 458  PRO A O   1 
ATOM   3485 C  CB  . PRO A  1 458 ? 10.256  21.502  23.842  1.00 40.75  ? 458  PRO A CB  1 
ATOM   3486 C  CG  . PRO A  1 458 ? 11.286  20.983  22.912  1.00 45.95  ? 458  PRO A CG  1 
ATOM   3487 C  CD  . PRO A  1 458 ? 12.417  20.513  23.792  1.00 45.89  ? 458  PRO A CD  1 
ATOM   3488 N  N   . LEU A  1 459 ? 10.612  21.171  27.190  1.00 51.24  ? 459  LEU A N   1 
ATOM   3489 C  CA  . LEU A  1 459 ? 9.956   21.091  28.498  1.00 51.67  ? 459  LEU A CA  1 
ATOM   3490 C  C   . LEU A  1 459 ? 10.314  22.284  29.384  1.00 51.40  ? 459  LEU A C   1 
ATOM   3491 O  O   . LEU A  1 459 ? 9.505   22.721  30.205  1.00 56.82  ? 459  LEU A O   1 
ATOM   3492 C  CB  . LEU A  1 459 ? 10.301  19.775  29.207  1.00 42.27  ? 459  LEU A CB  1 
ATOM   3493 C  CG  . LEU A  1 459 ? 9.386   18.564  28.993  1.00 45.48  ? 459  LEU A CG  1 
ATOM   3494 C  CD1 . LEU A  1 459 ? 8.876   18.492  27.573  1.00 51.33  ? 459  LEU A CD1 1 
ATOM   3495 C  CD2 . LEU A  1 459 ? 10.122  17.286  29.335  1.00 44.41  ? 459  LEU A CD2 1 
ATOM   3496 N  N   . ASP A  1 460 ? 11.527  22.804  29.210  1.00 49.15  ? 460  ASP A N   1 
ATOM   3497 C  CA  . ASP A  1 460 ? 11.964  24.006  29.911  1.00 52.63  ? 460  ASP A CA  1 
ATOM   3498 C  C   . ASP A  1 460 ? 11.197  25.201  29.353  1.00 58.67  ? 460  ASP A C   1 
ATOM   3499 O  O   . ASP A  1 460 ? 11.414  25.605  28.209  1.00 59.98  ? 460  ASP A O   1 
ATOM   3500 C  CB  . ASP A  1 460 ? 13.472  24.201  29.731  1.00 52.49  ? 460  ASP A CB  1 
ATOM   3501 C  CG  . ASP A  1 460 ? 14.040  25.281  30.633  1.00 58.11  ? 460  ASP A CG  1 
ATOM   3502 O  OD1 . ASP A  1 460 ? 13.273  26.137  31.125  1.00 58.05  ? 460  ASP A OD1 1 
ATOM   3503 O  OD2 . ASP A  1 460 ? 15.270  25.277  30.842  1.00 63.98  ? 460  ASP A OD2 1 
ATOM   3504 N  N   . PRO A  1 461 ? 10.296  25.774  30.167  1.00 61.18  ? 461  PRO A N   1 
ATOM   3505 C  CA  . PRO A  1 461 ? 9.402   26.837  29.698  1.00 59.61  ? 461  PRO A CA  1 
ATOM   3506 C  C   . PRO A  1 461 ? 10.143  28.141  29.433  1.00 58.68  ? 461  PRO A C   1 
ATOM   3507 O  O   . PRO A  1 461 ? 9.607   29.022  28.760  1.00 65.81  ? 461  PRO A O   1 
ATOM   3508 C  CB  . PRO A  1 461 ? 8.423   27.006  30.865  1.00 58.61  ? 461  PRO A CB  1 
ATOM   3509 C  CG  . PRO A  1 461 ? 9.199   26.584  32.066  1.00 58.53  ? 461  PRO A CG  1 
ATOM   3510 C  CD  . PRO A  1 461 ? 10.113  25.484  31.601  1.00 56.76  ? 461  PRO A CD  1 
ATOM   3511 N  N   . SER A  1 462 ? 11.363  28.255  29.948  1.00 54.86  ? 462  SER A N   1 
ATOM   3512 C  CA  . SER A  1 462 ? 12.186  29.440  29.717  1.00 58.14  ? 462  SER A CA  1 
ATOM   3513 C  C   . SER A  1 462 ? 12.811  29.480  28.314  1.00 63.28  ? 462  SER A C   1 
ATOM   3514 O  O   . SER A  1 462 ? 13.498  30.442  27.966  1.00 64.05  ? 462  SER A O   1 
ATOM   3515 C  CB  . SER A  1 462 ? 13.283  29.539  30.782  1.00 50.75  ? 462  SER A CB  1 
ATOM   3516 O  OG  . SER A  1 462 ? 14.141  28.412  30.740  1.00 54.04  ? 462  SER A OG  1 
ATOM   3517 N  N   . LEU A  1 463 ? 12.563  28.449  27.508  1.00 58.71  ? 463  LEU A N   1 
ATOM   3518 C  CA  . LEU A  1 463 ? 13.197  28.336  26.191  1.00 53.04  ? 463  LEU A CA  1 
ATOM   3519 C  C   . LEU A  1 463 ? 12.297  28.732  25.014  1.00 62.13  ? 463  LEU A C   1 
ATOM   3520 O  O   . LEU A  1 463 ? 12.741  28.725  23.862  1.00 63.22  ? 463  LEU A O   1 
ATOM   3521 C  CB  . LEU A  1 463 ? 13.764  26.926  25.982  1.00 46.76  ? 463  LEU A CB  1 
ATOM   3522 C  CG  . LEU A  1 463 ? 14.989  26.570  26.827  1.00 52.68  ? 463  LEU A CG  1 
ATOM   3523 C  CD1 . LEU A  1 463 ? 15.488  25.172  26.510  1.00 50.53  ? 463  LEU A CD1 1 
ATOM   3524 C  CD2 . LEU A  1 463 ? 16.092  27.589  26.614  1.00 49.43  ? 463  LEU A CD2 1 
ATOM   3525 N  N   . ASN A  1 464 ? 11.041  29.065  25.309  1.00 66.99  ? 464  ASN A N   1 
ATOM   3526 C  CA  . ASN A  1 464 ? 10.106  29.620  24.320  1.00 72.48  ? 464  ASN A CA  1 
ATOM   3527 C  C   . ASN A  1 464 ? 9.629   28.687  23.201  1.00 57.12  ? 464  ASN A C   1 
ATOM   3528 O  O   . ASN A  1 464 ? 9.154   29.155  22.165  1.00 58.31  ? 464  ASN A O   1 
ATOM   3529 C  CB  . ASN A  1 464 ? 10.651  30.925  23.716  1.00 80.72  ? 464  ASN A CB  1 
ATOM   3530 C  CG  . ASN A  1 464 ? 10.789  32.030  24.742  1.00 93.47  ? 464  ASN A CG  1 
ATOM   3531 O  OD1 . ASN A  1 464 ? 10.054  32.071  25.730  1.00 90.48  ? 464  ASN A OD1 1 
ATOM   3532 N  ND2 . ASN A  1 464 ? 11.731  32.939  24.511  1.00 107.86 ? 464  ASN A ND2 1 
ATOM   3533 N  N   . TYR A  1 465 ? 9.746   27.378  23.402  1.00 44.68  ? 465  TYR A N   1 
ATOM   3534 C  CA  . TYR A  1 465 ? 9.143   26.430  22.468  1.00 40.20  ? 465  TYR A CA  1 
ATOM   3535 C  C   . TYR A  1 465 ? 7.620   26.521  22.590  1.00 47.05  ? 465  TYR A C   1 
ATOM   3536 O  O   . TYR A  1 465 ? 7.109   27.037  23.582  1.00 56.24  ? 465  TYR A O   1 
ATOM   3537 C  CB  . TYR A  1 465 ? 9.618   25.002  22.755  1.00 36.80  ? 465  TYR A CB  1 
ATOM   3538 C  CG  . TYR A  1 465 ? 11.085  24.751  22.467  1.00 42.05  ? 465  TYR A CG  1 
ATOM   3539 C  CD1 . TYR A  1 465 ? 12.067  25.128  23.374  1.00 41.78  ? 465  TYR A CD1 1 
ATOM   3540 C  CD2 . TYR A  1 465 ? 11.486  24.124  21.293  1.00 46.51  ? 465  TYR A CD2 1 
ATOM   3541 C  CE1 . TYR A  1 465 ? 13.404  24.895  23.118  1.00 43.40  ? 465  TYR A CE1 1 
ATOM   3542 C  CE2 . TYR A  1 465 ? 12.826  23.885  21.030  1.00 46.14  ? 465  TYR A CE2 1 
ATOM   3543 C  CZ  . TYR A  1 465 ? 13.778  24.275  21.948  1.00 46.68  ? 465  TYR A CZ  1 
ATOM   3544 O  OH  . TYR A  1 465 ? 15.112  24.046  21.703  1.00 44.97  ? 465  TYR A OH  1 
ATOM   3545 N  N   . THR A  1 466 ? 6.896   26.037  21.583  1.00 47.19  ? 466  THR A N   1 
ATOM   3546 C  CA  . THR A  1 466 ? 5.434   26.049  21.631  1.00 41.91  ? 466  THR A CA  1 
ATOM   3547 C  C   . THR A  1 466 ? 4.907   24.876  22.445  1.00 41.90  ? 466  THR A C   1 
ATOM   3548 O  O   . THR A  1 466 ? 5.643   23.930  22.726  1.00 49.57  ? 466  THR A O   1 
ATOM   3549 C  CB  . THR A  1 466 ? 4.810   25.985  20.223  1.00 44.09  ? 466  THR A CB  1 
ATOM   3550 O  OG1 . THR A  1 466 ? 5.048   24.695  19.645  1.00 40.96  ? 466  THR A OG1 1 
ATOM   3551 C  CG2 . THR A  1 466 ? 5.397   27.059  19.329  1.00 37.68  ? 466  THR A CG2 1 
ATOM   3552 N  N   . THR A  1 467 ? 3.631   24.945  22.815  1.00 45.44  ? 467  THR A N   1 
ATOM   3553 C  CA  . THR A  1 467 ? 2.976   23.881  23.576  1.00 57.64  ? 467  THR A CA  1 
ATOM   3554 C  C   . THR A  1 467 ? 3.001   22.567  22.794  1.00 56.60  ? 467  THR A C   1 
ATOM   3555 O  O   . THR A  1 467 ? 3.172   21.489  23.367  1.00 55.72  ? 467  THR A O   1 
ATOM   3556 C  CB  . THR A  1 467 ? 1.518   24.271  23.934  1.00 69.58  ? 467  THR A CB  1 
ATOM   3557 O  OG1 . THR A  1 467 ? 1.525   25.411  24.805  1.00 63.65  ? 467  THR A OG1 1 
ATOM   3558 C  CG2 . THR A  1 467 ? 0.794   23.125  24.625  1.00 66.73  ? 467  THR A CG2 1 
ATOM   3559 N  N   . GLU A  1 468 ? 2.858   22.673  21.478  1.00 59.34  ? 468  GLU A N   1 
ATOM   3560 C  CA  . GLU A  1 468 ? 2.868   21.510  20.602  1.00 61.60  ? 468  GLU A CA  1 
ATOM   3561 C  C   . GLU A  1 468 ? 4.257   20.881  20.535  1.00 52.29  ? 468  GLU A C   1 
ATOM   3562 O  O   . GLU A  1 468 ? 4.388   19.657  20.515  1.00 51.59  ? 468  GLU A O   1 
ATOM   3563 C  CB  . GLU A  1 468 ? 2.385   21.890  19.198  1.00 68.30  ? 468  GLU A CB  1 
ATOM   3564 C  CG  . GLU A  1 468 ? 0.926   22.339  19.124  1.00 82.14  ? 468  GLU A CG  1 
ATOM   3565 C  CD  . GLU A  1 468 ? 0.684   23.690  19.777  1.00 95.22  ? 468  GLU A CD  1 
ATOM   3566 O  OE1 . GLU A  1 468 ? 1.654   24.464  19.926  1.00 97.88  ? 468  GLU A OE1 1 
ATOM   3567 O  OE2 . GLU A  1 468 ? -0.474  23.980  20.146  1.00 99.22  ? 468  GLU A OE2 1 
ATOM   3568 N  N   . GLU A  1 469 ? 5.290   21.721  20.504  1.00 43.91  ? 469  GLU A N   1 
ATOM   3569 C  CA  . GLU A  1 469 ? 6.669   21.243  20.495  1.00 51.06  ? 469  GLU A CA  1 
ATOM   3570 C  C   . GLU A  1 469 ? 7.012   20.560  21.811  1.00 51.48  ? 469  GLU A C   1 
ATOM   3571 O  O   . GLU A  1 469 ? 7.836   19.647  21.853  1.00 52.12  ? 469  GLU A O   1 
ATOM   3572 C  CB  . GLU A  1 469 ? 7.642   22.399  20.245  1.00 56.65  ? 469  GLU A CB  1 
ATOM   3573 C  CG  . GLU A  1 469 ? 7.598   22.973  18.835  1.00 53.08  ? 469  GLU A CG  1 
ATOM   3574 C  CD  . GLU A  1 469 ? 8.626   24.060  18.620  1.00 47.82  ? 469  GLU A CD  1 
ATOM   3575 O  OE1 . GLU A  1 469 ? 8.618   25.048  19.386  1.00 46.88  ? 469  GLU A OE1 1 
ATOM   3576 O  OE2 . GLU A  1 469 ? 9.445   23.927  17.687  1.00 48.94  ? 469  GLU A OE2 1 
ATOM   3577 N  N   . ARG A  1 470 ? 6.383   21.018  22.888  1.00 55.78  ? 470  ARG A N   1 
ATOM   3578 C  CA  . ARG A  1 470 ? 6.582   20.422  24.201  1.00 54.86  ? 470  ARG A CA  1 
ATOM   3579 C  C   . ARG A  1 470 ? 5.969   19.022  24.225  1.00 51.21  ? 470  ARG A C   1 
ATOM   3580 O  O   . ARG A  1 470 ? 6.610   18.056  24.648  1.00 48.89  ? 470  ARG A O   1 
ATOM   3581 C  CB  . ARG A  1 470 ? 5.959   21.315  25.280  1.00 60.26  ? 470  ARG A CB  1 
ATOM   3582 C  CG  . ARG A  1 470 ? 6.325   20.936  26.703  1.00 71.77  ? 470  ARG A CG  1 
ATOM   3583 C  CD  . ARG A  1 470 ? 5.135   20.336  27.431  1.00 86.10  ? 470  ARG A CD  1 
ATOM   3584 N  NE  . ARG A  1 470 ? 4.032   21.285  27.557  1.00 92.57  ? 470  ARG A NE  1 
ATOM   3585 C  CZ  . ARG A  1 470 ? 2.756   20.933  27.682  1.00 94.54  ? 470  ARG A CZ  1 
ATOM   3586 N  NH1 . ARG A  1 470 ? 2.419   19.651  27.689  1.00 92.25  ? 470  ARG A NH1 1 
ATOM   3587 N  NH2 . ARG A  1 470 ? 1.816   21.863  27.792  1.00 96.51  ? 470  ARG A NH2 1 
ATOM   3588 N  N   . ILE A  1 471 ? 4.731   18.925  23.748  1.00 46.84  ? 471  ILE A N   1 
ATOM   3589 C  CA  . ILE A  1 471 ? 4.034   17.647  23.622  1.00 48.06  ? 471  ILE A CA  1 
ATOM   3590 C  C   . ILE A  1 471 ? 4.770   16.718  22.649  1.00 49.56  ? 471  ILE A C   1 
ATOM   3591 O  O   . ILE A  1 471 ? 4.863   15.509  22.876  1.00 54.12  ? 471  ILE A O   1 
ATOM   3592 C  CB  . ILE A  1 471 ? 2.565   17.867  23.167  1.00 52.54  ? 471  ILE A CB  1 
ATOM   3593 C  CG1 . ILE A  1 471 ? 1.783   18.638  24.243  1.00 58.96  ? 471  ILE A CG1 1 
ATOM   3594 C  CG2 . ILE A  1 471 ? 1.881   16.543  22.855  1.00 46.18  ? 471  ILE A CG2 1 
ATOM   3595 C  CD1 . ILE A  1 471 ? 0.416   19.123  23.789  1.00 67.89  ? 471  ILE A CD1 1 
ATOM   3596 N  N   . PHE A  1 472 ? 5.304   17.299  21.578  1.00 47.74  ? 472  PHE A N   1 
ATOM   3597 C  CA  . PHE A  1 472 ? 6.078   16.565  20.577  1.00 44.95  ? 472  PHE A CA  1 
ATOM   3598 C  C   . PHE A  1 472 ? 7.361   15.991  21.171  1.00 43.23  ? 472  PHE A C   1 
ATOM   3599 O  O   . PHE A  1 472 ? 7.743   14.862  20.871  1.00 48.33  ? 472  PHE A O   1 
ATOM   3600 C  CB  . PHE A  1 472 ? 6.405   17.489  19.398  1.00 39.16  ? 472  PHE A CB  1 
ATOM   3601 C  CG  . PHE A  1 472 ? 7.299   16.869  18.356  1.00 39.77  ? 472  PHE A CG  1 
ATOM   3602 C  CD1 . PHE A  1 472 ? 6.987   15.638  17.791  1.00 40.93  ? 472  PHE A CD1 1 
ATOM   3603 C  CD2 . PHE A  1 472 ? 8.441   17.533  17.922  1.00 39.05  ? 472  PHE A CD2 1 
ATOM   3604 C  CE1 . PHE A  1 472 ? 7.811   15.071  16.825  1.00 44.42  ? 472  PHE A CE1 1 
ATOM   3605 C  CE2 . PHE A  1 472 ? 9.267   16.975  16.956  1.00 45.03  ? 472  PHE A CE2 1 
ATOM   3606 C  CZ  . PHE A  1 472 ? 8.951   15.743  16.405  1.00 46.71  ? 472  PHE A CZ  1 
ATOM   3607 N  N   . ALA A  1 473 ? 8.021   16.775  22.017  1.00 40.46  ? 473  ALA A N   1 
ATOM   3608 C  CA  . ALA A  1 473 ? 9.263   16.345  22.649  1.00 39.07  ? 473  ALA A CA  1 
ATOM   3609 C  C   . ALA A  1 473 ? 9.056   15.132  23.556  1.00 43.68  ? 473  ALA A C   1 
ATOM   3610 O  O   . ALA A  1 473 ? 9.912   14.246  23.629  1.00 41.52  ? 473  ALA A O   1 
ATOM   3611 C  CB  . ALA A  1 473 ? 9.879   17.493  23.428  1.00 34.17  ? 473  ALA A CB  1 
ATOM   3612 N  N   . GLN A  1 474 ? 7.920   15.102  24.248  1.00 44.69  ? 474  GLN A N   1 
ATOM   3613 C  CA  . GLN A  1 474 ? 7.597   14.005  25.156  1.00 50.49  ? 474  GLN A CA  1 
ATOM   3614 C  C   . GLN A  1 474 ? 7.376   12.691  24.407  1.00 50.93  ? 474  GLN A C   1 
ATOM   3615 O  O   . GLN A  1 474 ? 7.744   11.622  24.899  1.00 52.85  ? 474  GLN A O   1 
ATOM   3616 C  CB  . GLN A  1 474 ? 6.367   14.356  26.002  1.00 55.40  ? 474  GLN A CB  1 
ATOM   3617 C  CG  . GLN A  1 474 ? 6.588   15.510  26.978  1.00 60.30  ? 474  GLN A CG  1 
ATOM   3618 C  CD  . GLN A  1 474 ? 5.288   16.087  27.511  1.00 71.05  ? 474  GLN A CD  1 
ATOM   3619 O  OE1 . GLN A  1 474 ? 4.206   15.561  27.249  1.00 74.89  ? 474  GLN A OE1 1 
ATOM   3620 N  NE2 . GLN A  1 474 ? 5.390   17.178  28.256  1.00 73.39  ? 474  GLN A NE2 1 
ATOM   3621 N  N   . ARG A  1 475 ? 6.771   12.776  23.224  1.00 50.74  ? 475  ARG A N   1 
ATOM   3622 C  CA  . ARG A  1 475 ? 6.579   11.603  22.374  1.00 49.94  ? 475  ARG A CA  1 
ATOM   3623 C  C   . ARG A  1 475 ? 7.922   10.983  21.997  1.00 49.60  ? 475  ARG A C   1 
ATOM   3624 O  O   . ARG A  1 475 ? 8.097   9.765   22.067  1.00 46.99  ? 475  ARG A O   1 
ATOM   3625 C  CB  . ARG A  1 475 ? 5.801   11.971  21.102  1.00 52.14  ? 475  ARG A CB  1 
ATOM   3626 C  CG  . ARG A  1 475 ? 4.281   11.990  21.252  1.00 56.89  ? 475  ARG A CG  1 
ATOM   3627 C  CD  . ARG A  1 475 ? 3.608   12.363  19.934  1.00 57.42  ? 475  ARG A CD  1 
ATOM   3628 N  NE  . ARG A  1 475 ? 4.101   11.543  18.831  1.00 54.75  ? 475  ARG A NE  1 
ATOM   3629 C  CZ  . ARG A  1 475 ? 4.264   11.978  17.586  1.00 46.77  ? 475  ARG A CZ  1 
ATOM   3630 N  NH1 . ARG A  1 475 ? 3.970   13.231  17.269  1.00 46.42  ? 475  ARG A NH1 1 
ATOM   3631 N  NH2 . ARG A  1 475 ? 4.727   11.158  16.655  1.00 40.37  ? 475  ARG A NH2 1 
ATOM   3632 N  N   . LEU A  1 476 ? 8.870   11.833  21.610  1.00 42.10  ? 476  LEU A N   1 
ATOM   3633 C  CA  . LEU A  1 476 ? 10.195  11.379  21.197  1.00 43.45  ? 476  LEU A CA  1 
ATOM   3634 C  C   . LEU A  1 476 ? 10.962  10.745  22.353  1.00 40.27  ? 476  LEU A C   1 
ATOM   3635 O  O   . LEU A  1 476 ? 11.622  9.718   22.173  1.00 41.22  ? 476  LEU A O   1 
ATOM   3636 C  CB  . LEU A  1 476 ? 10.993  12.535  20.590  1.00 39.19  ? 476  LEU A CB  1 
ATOM   3637 C  CG  . LEU A  1 476 ? 10.341  13.164  19.356  1.00 36.73  ? 476  LEU A CG  1 
ATOM   3638 C  CD1 . LEU A  1 476 ? 11.146  14.338  18.835  1.00 38.43  ? 476  LEU A CD1 1 
ATOM   3639 C  CD2 . LEU A  1 476 ? 10.179  12.117  18.276  1.00 37.97  ? 476  LEU A CD2 1 
ATOM   3640 N  N   . MET A  1 477 ? 10.875  11.355  23.534  1.00 34.46  ? 477  MET A N   1 
ATOM   3641 C  CA  . MET A  1 477 ? 11.490  10.790  24.731  1.00 41.72  ? 477  MET A CA  1 
ATOM   3642 C  C   . MET A  1 477 ? 10.890  9.416   25.016  1.00 36.35  ? 477  MET A C   1 
ATOM   3643 O  O   . MET A  1 477 ? 11.608  8.483   25.371  1.00 38.16  ? 477  MET A O   1 
ATOM   3644 C  CB  . MET A  1 477 ? 11.310  11.726  25.933  1.00 46.42  ? 477  MET A CB  1 
ATOM   3645 C  CG  . MET A  1 477 ? 11.990  13.082  25.767  1.00 44.86  ? 477  MET A CG  1 
ATOM   3646 S  SD  . MET A  1 477 ? 11.392  14.349  26.909  1.00 59.27  ? 477  MET A SD  1 
ATOM   3647 C  CE  . MET A  1 477 ? 12.593  14.220  28.224  1.00 38.65  ? 477  MET A CE  1 
ATOM   3648 N  N   . LYS A  1 478 ? 9.578   9.292   24.832  1.00 33.06  ? 478  LYS A N   1 
ATOM   3649 C  CA  . LYS A  1 478 ? 8.901   8.002   24.962  1.00 42.61  ? 478  LYS A CA  1 
ATOM   3650 C  C   . LYS A  1 478 ? 9.481   6.952   24.015  1.00 41.89  ? 478  LYS A C   1 
ATOM   3651 O  O   . LYS A  1 478 ? 9.828   5.854   24.448  1.00 36.24  ? 478  LYS A O   1 
ATOM   3652 C  CB  . LYS A  1 478 ? 7.394   8.147   24.723  1.00 53.36  ? 478  LYS A CB  1 
ATOM   3653 C  CG  . LYS A  1 478 ? 6.587   8.439   25.979  1.00 60.22  ? 478  LYS A CG  1 
ATOM   3654 C  CD  . LYS A  1 478 ? 6.721   7.304   26.981  1.00 68.62  ? 478  LYS A CD  1 
ATOM   3655 C  CE  . LYS A  1 478 ? 6.128   7.668   28.336  1.00 66.82  ? 478  LYS A CE  1 
ATOM   3656 N  NZ  . LYS A  1 478 ? 6.428   6.619   29.354  1.00 67.21  ? 478  LYS A NZ  1 
ATOM   3657 N  N   . TYR A  1 479 ? 9.587   7.297   22.732  1.00 44.54  ? 479  TYR A N   1 
ATOM   3658 C  CA  . TYR A  1 479 ? 10.129  6.389   21.720  1.00 36.63  ? 479  TYR A CA  1 
ATOM   3659 C  C   . TYR A  1 479 ? 11.531  5.908   22.081  1.00 34.30  ? 479  TYR A C   1 
ATOM   3660 O  O   . TYR A  1 479 ? 11.793  4.703   22.127  1.00 33.70  ? 479  TYR A O   1 
ATOM   3661 C  CB  . TYR A  1 479 ? 10.178  7.080   20.355  1.00 41.00  ? 479  TYR A CB  1 
ATOM   3662 C  CG  . TYR A  1 479 ? 8.830   7.357   19.731  1.00 46.04  ? 479  TYR A CG  1 
ATOM   3663 C  CD1 . TYR A  1 479 ? 7.784   6.451   19.849  1.00 42.79  ? 479  TYR A CD1 1 
ATOM   3664 C  CD2 . TYR A  1 479 ? 8.608   8.524   19.012  1.00 41.97  ? 479  TYR A CD2 1 
ATOM   3665 C  CE1 . TYR A  1 479 ? 6.553   6.707   19.271  1.00 41.93  ? 479  TYR A CE1 1 
ATOM   3666 C  CE2 . TYR A  1 479 ? 7.386   8.788   18.436  1.00 36.46  ? 479  TYR A CE2 1 
ATOM   3667 C  CZ  . TYR A  1 479 ? 6.363   7.878   18.566  1.00 43.42  ? 479  TYR A CZ  1 
ATOM   3668 O  OH  . TYR A  1 479 ? 5.143   8.146   17.987  1.00 43.23  ? 479  TYR A OH  1 
ATOM   3669 N  N   . TRP A  1 480 ? 12.428  6.860   22.325  1.00 28.45  ? 480  TRP A N   1 
ATOM   3670 C  CA  . TRP A  1 480 ? 13.823  6.557   22.638  1.00 36.40  ? 480  TRP A CA  1 
ATOM   3671 C  C   . TRP A  1 480 ? 13.956  5.712   23.910  1.00 40.44  ? 480  TRP A C   1 
ATOM   3672 O  O   . TRP A  1 480 ? 14.715  4.742   23.939  1.00 41.22  ? 480  TRP A O   1 
ATOM   3673 C  CB  . TRP A  1 480 ? 14.633  7.857   22.759  1.00 36.04  ? 480  TRP A CB  1 
ATOM   3674 C  CG  . TRP A  1 480 ? 15.395  8.242   21.512  1.00 40.01  ? 480  TRP A CG  1 
ATOM   3675 C  CD1 . TRP A  1 480 ? 16.747  8.407   21.396  1.00 45.82  ? 480  TRP A CD1 1 
ATOM   3676 C  CD2 . TRP A  1 480 ? 14.848  8.509   20.211  1.00 43.21  ? 480  TRP A CD2 1 
ATOM   3677 N  NE1 . TRP A  1 480 ? 17.073  8.763   20.106  1.00 32.72  ? 480  TRP A NE1 1 
ATOM   3678 C  CE2 . TRP A  1 480 ? 15.926  8.830   19.360  1.00 36.20  ? 480  TRP A CE2 1 
ATOM   3679 C  CE3 . TRP A  1 480 ? 13.553  8.505   19.683  1.00 39.12  ? 480  TRP A CE3 1 
ATOM   3680 C  CZ2 . TRP A  1 480 ? 15.746  9.142   18.012  1.00 39.50  ? 480  TRP A CZ2 1 
ATOM   3681 C  CZ3 . TRP A  1 480 ? 13.377  8.819   18.349  1.00 37.27  ? 480  TRP A CZ3 1 
ATOM   3682 C  CH2 . TRP A  1 480 ? 14.467  9.132   17.529  1.00 39.53  ? 480  TRP A CH2 1 
ATOM   3683 N  N   . THR A  1 481 ? 13.209  6.071   24.952  1.00 39.05  ? 481  THR A N   1 
ATOM   3684 C  CA  . THR A  1 481 ? 13.265  5.340   26.221  1.00 38.98  ? 481  THR A CA  1 
ATOM   3685 C  C   . THR A  1 481 ? 12.584  3.973   26.165  1.00 40.55  ? 481  THR A C   1 
ATOM   3686 O  O   . THR A  1 481 ? 13.073  3.007   26.758  1.00 47.72  ? 481  THR A O   1 
ATOM   3687 C  CB  . THR A  1 481 ? 12.689  6.164   27.389  1.00 36.92  ? 481  THR A CB  1 
ATOM   3688 O  OG1 . THR A  1 481 ? 11.343  6.560   27.090  1.00 41.13  ? 481  THR A OG1 1 
ATOM   3689 C  CG2 . THR A  1 481 ? 13.541  7.392   27.625  1.00 32.14  ? 481  THR A CG2 1 
ATOM   3690 N  N   . ASN A  1 482 ? 11.455  3.892   25.465  1.00 38.35  ? 482  ASN A N   1 
ATOM   3691 C  CA  . ASN A  1 482 ? 10.800  2.605   25.255  1.00 44.82  ? 482  ASN A CA  1 
ATOM   3692 C  C   . ASN A  1 482 ? 11.725  1.650   24.506  1.00 47.94  ? 482  ASN A C   1 
ATOM   3693 O  O   . ASN A  1 482 ? 11.814  0.469   24.840  1.00 50.46  ? 482  ASN A O   1 
ATOM   3694 C  CB  . ASN A  1 482 ? 9.483   2.762   24.481  1.00 43.50  ? 482  ASN A CB  1 
ATOM   3695 C  CG  . ASN A  1 482 ? 8.344   3.277   25.346  1.00 49.43  ? 482  ASN A CG  1 
ATOM   3696 O  OD1 . ASN A  1 482 ? 8.297   3.030   26.552  1.00 58.39  ? 482  ASN A OD1 1 
ATOM   3697 N  ND2 . ASN A  1 482 ? 7.409   3.985   24.724  1.00 53.85  ? 482  ASN A ND2 1 
ATOM   3698 N  N   . PHE A  1 483 ? 12.412  2.173   23.493  1.00 42.21  ? 483  PHE A N   1 
ATOM   3699 C  CA  . PHE A  1 483 ? 13.375  1.387   22.729  1.00 45.02  ? 483  PHE A CA  1 
ATOM   3700 C  C   . PHE A  1 483 ? 14.563  0.956   23.591  1.00 47.80  ? 483  PHE A C   1 
ATOM   3701 O  O   . PHE A  1 483 ? 15.089  -0.147  23.438  1.00 48.61  ? 483  PHE A O   1 
ATOM   3702 C  CB  . PHE A  1 483 ? 13.870  2.161   21.504  1.00 42.29  ? 483  PHE A CB  1 
ATOM   3703 C  CG  . PHE A  1 483 ? 14.958  1.453   20.752  1.00 32.23  ? 483  PHE A CG  1 
ATOM   3704 C  CD1 . PHE A  1 483 ? 14.661  0.362   19.947  1.00 33.77  ? 483  PHE A CD1 1 
ATOM   3705 C  CD2 . PHE A  1 483 ? 16.283  1.859   20.870  1.00 28.97  ? 483  PHE A CD2 1 
ATOM   3706 C  CE1 . PHE A  1 483 ? 15.663  -0.310  19.260  1.00 36.90  ? 483  PHE A CE1 1 
ATOM   3707 C  CE2 . PHE A  1 483 ? 17.292  1.194   20.188  1.00 38.95  ? 483  PHE A CE2 1 
ATOM   3708 C  CZ  . PHE A  1 483 ? 16.982  0.107   19.379  1.00 38.63  ? 483  PHE A CZ  1 
ATOM   3709 N  N   . ALA A  1 484 ? 14.987  1.832   24.494  1.00 46.26  ? 484  ALA A N   1 
ATOM   3710 C  CA  . ALA A  1 484 ? 16.080  1.513   25.404  1.00 47.08  ? 484  ALA A CA  1 
ATOM   3711 C  C   . ALA A  1 484 ? 15.675  0.418   26.386  1.00 47.95  ? 484  ALA A C   1 
ATOM   3712 O  O   . ALA A  1 484 ? 16.486  -0.439  26.745  1.00 50.38  ? 484  ALA A O   1 
ATOM   3713 C  CB  . ALA A  1 484 ? 16.513  2.753   26.154  1.00 36.87  ? 484  ALA A CB  1 
ATOM   3714 N  N   . ARG A  1 485 ? 14.418  0.458   26.820  1.00 41.07  ? 485  ARG A N   1 
ATOM   3715 C  CA  . ARG A  1 485 ? 13.897  -0.506  27.788  1.00 47.11  ? 485  ARG A CA  1 
ATOM   3716 C  C   . ARG A  1 485 ? 13.617  -1.870  27.161  1.00 48.02  ? 485  ARG A C   1 
ATOM   3717 O  O   . ARG A  1 485 ? 13.922  -2.906  27.751  1.00 48.53  ? 485  ARG A O   1 
ATOM   3718 C  CB  . ARG A  1 485 ? 12.606  0.022   28.432  1.00 46.35  ? 485  ARG A CB  1 
ATOM   3719 C  CG  . ARG A  1 485 ? 12.798  1.105   29.489  1.00 59.56  ? 485  ARG A CG  1 
ATOM   3720 C  CD  . ARG A  1 485 ? 11.473  1.483   30.165  1.00 68.88  ? 485  ARG A CD  1 
ATOM   3721 N  NE  . ARG A  1 485 ? 10.641  2.356   29.335  1.00 75.74  ? 485  ARG A NE  1 
ATOM   3722 C  CZ  . ARG A  1 485 ? 10.594  3.681   29.453  1.00 75.83  ? 485  ARG A CZ  1 
ATOM   3723 N  NH1 . ARG A  1 485 ? 11.329  4.296   30.371  1.00 66.34  ? 485  ARG A NH1 1 
ATOM   3724 N  NH2 . ARG A  1 485 ? 9.810   4.395   28.656  1.00 77.05  ? 485  ARG A NH2 1 
ATOM   3725 N  N   . THR A  1 486 ? 13.043  -1.859  25.960  1.00 47.78  ? 486  THR A N   1 
ATOM   3726 C  CA  . THR A  1 486 ? 12.454  -3.062  25.374  1.00 47.25  ? 486  THR A CA  1 
ATOM   3727 C  C   . THR A  1 486 ? 13.041  -3.485  24.026  1.00 53.67  ? 486  THR A C   1 
ATOM   3728 O  O   . THR A  1 486 ? 12.893  -4.637  23.614  1.00 55.76  ? 486  THR A O   1 
ATOM   3729 C  CB  . THR A  1 486 ? 10.927  -2.894  25.205  1.00 46.94  ? 486  THR A CB  1 
ATOM   3730 O  OG1 . THR A  1 486 ? 10.654  -1.810  24.304  1.00 45.47  ? 486  THR A OG1 1 
ATOM   3731 C  CG2 . THR A  1 486 ? 10.277  -2.603  26.547  1.00 37.82  ? 486  THR A CG2 1 
ATOM   3732 N  N   . GLY A  1 487 ? 13.697  -2.559  23.336  1.00 57.10  ? 487  GLY A N   1 
ATOM   3733 C  CA  . GLY A  1 487 ? 14.139  -2.815  21.975  1.00 54.25  ? 487  GLY A CA  1 
ATOM   3734 C  C   . GLY A  1 487 ? 13.012  -2.551  20.997  1.00 53.08  ? 487  GLY A C   1 
ATOM   3735 O  O   . GLY A  1 487 ? 13.006  -3.058  19.872  1.00 59.85  ? 487  GLY A O   1 
ATOM   3736 N  N   . ASP A  1 488 ? 12.053  -1.746  21.449  1.00 52.08  ? 488  ASP A N   1 
ATOM   3737 C  CA  . ASP A  1 488 ? 10.851  -1.421  20.694  1.00 49.55  ? 488  ASP A CA  1 
ATOM   3738 C  C   . ASP A  1 488 ? 10.358  -0.048  21.142  1.00 48.31  ? 488  ASP A C   1 
ATOM   3739 O  O   . ASP A  1 488 ? 9.994   0.135   22.304  1.00 50.25  ? 488  ASP A O   1 
ATOM   3740 C  CB  . ASP A  1 488 ? 9.769   -2.473  20.954  1.00 48.76  ? 488  ASP A CB  1 
ATOM   3741 C  CG  . ASP A  1 488 ? 8.558   -2.315  20.049  1.00 49.68  ? 488  ASP A CG  1 
ATOM   3742 O  OD1 . ASP A  1 488 ? 8.415   -1.264  19.385  1.00 53.80  ? 488  ASP A OD1 1 
ATOM   3743 O  OD2 . ASP A  1 488 ? 7.733   -3.250  20.011  1.00 50.45  ? 488  ASP A OD2 1 
ATOM   3744 N  N   . PRO A  1 489 ? 10.333  0.920   20.213  1.00 51.35  ? 489  PRO A N   1 
ATOM   3745 C  CA  . PRO A  1 489 ? 9.917   2.293   20.520  1.00 51.07  ? 489  PRO A CA  1 
ATOM   3746 C  C   . PRO A  1 489 ? 8.427   2.410   20.832  1.00 48.29  ? 489  PRO A C   1 
ATOM   3747 O  O   . PRO A  1 489 ? 8.004   3.425   21.387  1.00 54.76  ? 489  PRO A O   1 
ATOM   3748 C  CB  . PRO A  1 489 ? 10.235  3.051   19.225  1.00 47.60  ? 489  PRO A CB  1 
ATOM   3749 C  CG  . PRO A  1 489 ? 10.182  2.008   18.156  1.00 49.92  ? 489  PRO A CG  1 
ATOM   3750 C  CD  . PRO A  1 489 ? 10.723  0.764   18.799  1.00 47.66  ? 489  PRO A CD  1 
ATOM   3751 N  N   . ASN A  1 490 ? 7.649   1.390   20.484  1.00 42.99  ? 490  ASN A N   1 
ATOM   3752 C  CA  . ASN A  1 490 ? 6.202   1.426   20.688  1.00 49.67  ? 490  ASN A CA  1 
ATOM   3753 C  C   . ASN A  1 490 ? 5.777   1.245   22.148  1.00 61.47  ? 490  ASN A C   1 
ATOM   3754 O  O   . ASN A  1 490 ? 6.422   0.519   22.908  1.00 57.37  ? 490  ASN A O   1 
ATOM   3755 C  CB  . ASN A  1 490 ? 5.513   0.374   19.809  1.00 50.35  ? 490  ASN A CB  1 
ATOM   3756 C  CG  . ASN A  1 490 ? 5.677   0.653   18.321  1.00 54.46  ? 490  ASN A CG  1 
ATOM   3757 O  OD1 . ASN A  1 490 ? 5.067   1.579   17.781  1.00 51.49  ? 490  ASN A OD1 1 
ATOM   3758 N  ND2 . ASN A  1 490 ? 6.490   -0.157  17.649  1.00 46.59  ? 490  ASN A ND2 1 
ATOM   3759 N  N   . ASP A  1 491 ? 4.686   1.906   22.532  1.00 73.64  ? 491  ASP A N   1 
ATOM   3760 C  CA  . ASP A  1 491 ? 4.124   1.746   23.869  1.00 78.05  ? 491  ASP A CA  1 
ATOM   3761 C  C   . ASP A  1 491 ? 3.232   0.510   23.889  1.00 79.40  ? 491  ASP A C   1 
ATOM   3762 O  O   . ASP A  1 491 ? 2.264   0.427   23.130  1.00 76.13  ? 491  ASP A O   1 
ATOM   3763 C  CB  . ASP A  1 491 ? 3.322   2.988   24.273  1.00 87.91  ? 491  ASP A CB  1 
ATOM   3764 C  CG  . ASP A  1 491 ? 3.054   3.057   25.770  1.00 91.76  ? 491  ASP A CG  1 
ATOM   3765 O  OD1 . ASP A  1 491 ? 2.281   2.219   26.287  1.00 86.40  ? 491  ASP A OD1 1 
ATOM   3766 O  OD2 . ASP A  1 491 ? 3.605   3.966   26.427  1.00 92.73  ? 491  ASP A OD2 1 
ATOM   3767 N  N   . PRO A  1 492 ? 3.563   -0.462  24.754  1.00 88.69  ? 492  PRO A N   1 
ATOM   3768 C  CA  . PRO A  1 492 ? 2.829   -1.729  24.848  1.00 94.29  ? 492  PRO A CA  1 
ATOM   3769 C  C   . PRO A  1 492 ? 1.423   -1.521  25.395  1.00 96.39  ? 492  PRO A C   1 
ATOM   3770 O  O   . PRO A  1 492 ? 0.556   -2.381  25.228  1.00 91.73  ? 492  PRO A O   1 
ATOM   3771 C  CB  . PRO A  1 492 ? 3.666   -2.540  25.842  1.00 94.95  ? 492  PRO A CB  1 
ATOM   3772 C  CG  . PRO A  1 492 ? 4.351   -1.510  26.680  1.00 94.08  ? 492  PRO A CG  1 
ATOM   3773 C  CD  . PRO A  1 492 ? 4.657   -0.382  25.739  1.00 89.58  ? 492  PRO A CD  1 
ATOM   3774 N  N   . ARG A  1 493 ? 1.208   -0.380  26.042  1.00 102.97 ? 493  ARG A N   1 
ATOM   3775 C  CA  . ARG A  1 493 ? -0.096  -0.043  26.600  1.00 111.06 ? 493  ARG A CA  1 
ATOM   3776 C  C   . ARG A  1 493 ? -0.700  1.183   25.918  1.00 115.00 ? 493  ARG A C   1 
ATOM   3777 O  O   . ARG A  1 493 ? -1.131  2.121   26.590  1.00 115.85 ? 493  ARG A O   1 
ATOM   3778 C  CB  . ARG A  1 493 ? 0.015   0.205   28.106  1.00 109.71 ? 493  ARG A CB  1 
ATOM   3779 N  N   . ASP A  1 494 ? -0.728  1.166   24.586  1.00 114.32 ? 494  ASP A N   1 
ATOM   3780 C  CA  . ASP A  1 494 ? -1.311  2.256   23.807  1.00 111.37 ? 494  ASP A CA  1 
ATOM   3781 C  C   . ASP A  1 494 ? -1.650  1.808   22.383  1.00 114.77 ? 494  ASP A C   1 
ATOM   3782 O  O   . ASP A  1 494 ? -0.815  1.887   21.480  1.00 112.95 ? 494  ASP A O   1 
ATOM   3783 C  CB  . ASP A  1 494 ? -0.369  3.466   23.782  1.00 105.91 ? 494  ASP A CB  1 
ATOM   3784 C  CG  . ASP A  1 494 ? -1.006  4.695   23.158  1.00 107.68 ? 494  ASP A CG  1 
ATOM   3785 O  OD1 . ASP A  1 494 ? -2.237  4.694   22.942  1.00 111.58 ? 494  ASP A OD1 1 
ATOM   3786 O  OD2 . ASP A  1 494 ? -0.273  5.672   22.896  1.00 105.36 ? 494  ASP A OD2 1 
ATOM   3787 N  N   . SER A  1 495 ? -2.879  1.334   22.195  1.00 120.84 ? 495  SER A N   1 
ATOM   3788 C  CA  . SER A  1 495 ? -3.367  0.945   20.876  1.00 123.48 ? 495  SER A CA  1 
ATOM   3789 C  C   . SER A  1 495 ? -3.990  2.142   20.166  1.00 124.82 ? 495  SER A C   1 
ATOM   3790 O  O   . SER A  1 495 ? -4.147  2.140   18.944  1.00 125.96 ? 495  SER A O   1 
ATOM   3791 C  CB  . SER A  1 495 ? -4.392  -0.186  20.992  1.00 125.00 ? 495  SER A CB  1 
ATOM   3792 O  OG  . SER A  1 495 ? -3.824  -1.332  21.602  1.00 124.14 ? 495  SER A OG  1 
ATOM   3793 N  N   . LYS A  1 496 ? -4.332  3.167   20.942  1.00 123.32 ? 496  LYS A N   1 
ATOM   3794 C  CA  . LYS A  1 496 ? -4.931  4.386   20.400  1.00 119.74 ? 496  LYS A CA  1 
ATOM   3795 C  C   . LYS A  1 496 ? -3.947  5.205   19.556  1.00 117.04 ? 496  LYS A C   1 
ATOM   3796 O  O   . LYS A  1 496 ? -4.349  6.121   18.838  1.00 118.03 ? 496  LYS A O   1 
ATOM   3797 C  CB  . LYS A  1 496 ? -5.510  5.245   21.529  1.00 112.92 ? 496  LYS A CB  1 
ATOM   3798 N  N   . SER A  1 497 ? -2.662  4.872   19.649  1.00 108.32 ? 497  SER A N   1 
ATOM   3799 C  CA  . SER A  1 497 ? -1.633  5.534   18.850  1.00 98.45  ? 497  SER A CA  1 
ATOM   3800 C  C   . SER A  1 497 ? -1.173  4.646   17.700  1.00 90.86  ? 497  SER A C   1 
ATOM   3801 O  O   . SER A  1 497 ? -1.157  3.419   17.827  1.00 90.67  ? 497  SER A O   1 
ATOM   3802 C  CB  . SER A  1 497 ? -0.434  5.919   19.720  1.00 95.18  ? 497  SER A CB  1 
ATOM   3803 O  OG  . SER A  1 497 ? -0.754  6.990   20.590  1.00 94.68  ? 497  SER A OG  1 
ATOM   3804 N  N   . PRO A  1 498 ? -0.799  5.267   16.568  1.00 80.34  ? 498  PRO A N   1 
ATOM   3805 C  CA  . PRO A  1 498 ? -0.309  4.512   15.410  1.00 75.17  ? 498  PRO A CA  1 
ATOM   3806 C  C   . PRO A  1 498 ? 0.987   3.789   15.747  1.00 67.61  ? 498  PRO A C   1 
ATOM   3807 O  O   . PRO A  1 498 ? 1.763   4.282   16.567  1.00 65.69  ? 498  PRO A O   1 
ATOM   3808 C  CB  . PRO A  1 498 ? -0.038  5.603   14.370  1.00 72.43  ? 498  PRO A CB  1 
ATOM   3809 C  CG  . PRO A  1 498 ? -0.866  6.767   14.801  1.00 73.68  ? 498  PRO A CG  1 
ATOM   3810 C  CD  . PRO A  1 498 ? -0.872  6.713   16.293  1.00 73.44  ? 498  PRO A CD  1 
ATOM   3811 N  N   . GLN A  1 499 ? 1.217   2.640   15.121  1.00 64.17  ? 499  GLN A N   1 
ATOM   3812 C  CA  . GLN A  1 499 ? 2.396   1.834   15.421  1.00 56.96  ? 499  GLN A CA  1 
ATOM   3813 C  C   . GLN A  1 499 ? 3.592   2.183   14.540  1.00 58.90  ? 499  GLN A C   1 
ATOM   3814 O  O   . GLN A  1 499 ? 3.442   2.772   13.469  1.00 52.73  ? 499  GLN A O   1 
ATOM   3815 C  CB  . GLN A  1 499 ? 2.070   0.345   15.291  1.00 58.31  ? 499  GLN A CB  1 
ATOM   3816 C  CG  . GLN A  1 499 ? 1.059   -0.163  16.312  1.00 71.30  ? 499  GLN A CG  1 
ATOM   3817 C  CD  . GLN A  1 499 ? 1.551   -0.027  17.743  1.00 73.16  ? 499  GLN A CD  1 
ATOM   3818 O  OE1 . GLN A  1 499 ? 1.108   0.852   18.484  1.00 69.90  ? 499  GLN A OE1 1 
ATOM   3819 N  NE2 . GLN A  1 499 ? 2.471   -0.902  18.138  1.00 68.93  ? 499  GLN A NE2 1 
ATOM   3820 N  N   . TRP A  1 500 ? 4.777   1.810   15.017  1.00 57.36  ? 500  TRP A N   1 
ATOM   3821 C  CA  . TRP A  1 500 ? 6.033   2.022   14.307  1.00 53.15  ? 500  TRP A CA  1 
ATOM   3822 C  C   . TRP A  1 500 ? 6.576   0.656   13.904  1.00 56.16  ? 500  TRP A C   1 
ATOM   3823 O  O   . TRP A  1 500 ? 7.181   -0.036  14.723  1.00 55.29  ? 500  TRP A O   1 
ATOM   3824 C  CB  . TRP A  1 500 ? 7.024   2.735   15.236  1.00 52.23  ? 500  TRP A CB  1 
ATOM   3825 C  CG  . TRP A  1 500 ? 8.349   3.121   14.623  1.00 49.60  ? 500  TRP A CG  1 
ATOM   3826 C  CD1 . TRP A  1 500 ? 8.933   2.596   13.504  1.00 51.65  ? 500  TRP A CD1 1 
ATOM   3827 C  CD2 . TRP A  1 500 ? 9.251   4.126   15.110  1.00 47.89  ? 500  TRP A CD2 1 
ATOM   3828 N  NE1 . TRP A  1 500 ? 10.141  3.211   13.269  1.00 48.35  ? 500  TRP A NE1 1 
ATOM   3829 C  CE2 . TRP A  1 500 ? 10.358  4.153   14.241  1.00 45.86  ? 500  TRP A CE2 1 
ATOM   3830 C  CE3 . TRP A  1 500 ? 9.225   5.006   16.199  1.00 36.19  ? 500  TRP A CE3 1 
ATOM   3831 C  CZ2 . TRP A  1 500 ? 11.429  5.031   14.424  1.00 44.96  ? 500  TRP A CZ2 1 
ATOM   3832 C  CZ3 . TRP A  1 500 ? 10.293  5.874   16.382  1.00 29.97  ? 500  TRP A CZ3 1 
ATOM   3833 C  CH2 . TRP A  1 500 ? 11.378  5.879   15.500  1.00 43.58  ? 500  TRP A CH2 1 
ATOM   3834 N  N   . PRO A  1 501 ? 6.368   0.262   12.638  1.00 57.66  ? 501  PRO A N   1 
ATOM   3835 C  CA  . PRO A  1 501 ? 6.818   -1.063  12.203  1.00 51.02  ? 501  PRO A CA  1 
ATOM   3836 C  C   . PRO A  1 501 ? 8.318   -1.090  11.958  1.00 44.22  ? 501  PRO A C   1 
ATOM   3837 O  O   . PRO A  1 501 ? 8.885   -0.059  11.602  1.00 43.62  ? 501  PRO A O   1 
ATOM   3838 C  CB  . PRO A  1 501 ? 6.086   -1.253  10.874  1.00 56.16  ? 501  PRO A CB  1 
ATOM   3839 C  CG  . PRO A  1 501 ? 5.948   0.135   10.330  1.00 55.67  ? 501  PRO A CG  1 
ATOM   3840 C  CD  . PRO A  1 501 ? 5.748   1.027   11.538  1.00 56.79  ? 501  PRO A CD  1 
ATOM   3841 N  N   . PRO A  1 502 ? 8.955   -2.254  12.156  1.00 43.14  ? 502  PRO A N   1 
ATOM   3842 C  CA  . PRO A  1 502 ? 10.386  -2.406  11.860  1.00 42.40  ? 502  PRO A CA  1 
ATOM   3843 C  C   . PRO A  1 502 ? 10.697  -2.169  10.383  1.00 52.85  ? 502  PRO A C   1 
ATOM   3844 O  O   . PRO A  1 502 ? 9.804   -2.315  9.547   1.00 48.10  ? 502  PRO A O   1 
ATOM   3845 C  CB  . PRO A  1 502 ? 10.654  -3.875  12.201  1.00 41.46  ? 502  PRO A CB  1 
ATOM   3846 C  CG  . PRO A  1 502 ? 9.602   -4.230  13.216  1.00 50.97  ? 502  PRO A CG  1 
ATOM   3847 C  CD  . PRO A  1 502 ? 8.384   -3.458  12.790  1.00 43.27  ? 502  PRO A CD  1 
ATOM   3848 N  N   . TYR A  1 503 ? 11.941  -1.814  10.070  1.00 53.33  ? 503  TYR A N   1 
ATOM   3849 C  CA  . TYR A  1 503 ? 12.372  -1.663  8.683   1.00 50.54  ? 503  TYR A CA  1 
ATOM   3850 C  C   . TYR A  1 503 ? 12.766  -3.026  8.118   1.00 52.46  ? 503  TYR A C   1 
ATOM   3851 O  O   . TYR A  1 503 ? 13.626  -3.706  8.677   1.00 52.31  ? 503  TYR A O   1 
ATOM   3852 C  CB  . TYR A  1 503 ? 13.554  -0.687  8.592   1.00 47.19  ? 503  TYR A CB  1 
ATOM   3853 C  CG  . TYR A  1 503 ? 14.085  -0.464  7.188   1.00 47.88  ? 503  TYR A CG  1 
ATOM   3854 C  CD1 . TYR A  1 503 ? 13.550  0.522   6.369   1.00 45.36  ? 503  TYR A CD1 1 
ATOM   3855 C  CD2 . TYR A  1 503 ? 15.131  -1.233  6.688   1.00 52.88  ? 503  TYR A CD2 1 
ATOM   3856 C  CE1 . TYR A  1 503 ? 14.036  0.730   5.091   1.00 52.25  ? 503  TYR A CE1 1 
ATOM   3857 C  CE2 . TYR A  1 503 ? 15.621  -1.033  5.412   1.00 48.22  ? 503  TYR A CE2 1 
ATOM   3858 C  CZ  . TYR A  1 503 ? 15.071  -0.051  4.619   1.00 52.35  ? 503  TYR A CZ  1 
ATOM   3859 O  OH  . TYR A  1 503 ? 15.557  0.150   3.348   1.00 56.85  ? 503  TYR A OH  1 
ATOM   3860 N  N   . THR A  1 504 ? 12.129  -3.425  7.021   1.00 53.16  ? 504  THR A N   1 
ATOM   3861 C  CA  . THR A  1 504 ? 12.460  -4.683  6.355   1.00 52.82  ? 504  THR A CA  1 
ATOM   3862 C  C   . THR A  1 504 ? 12.942  -4.465  4.926   1.00 55.35  ? 504  THR A C   1 
ATOM   3863 O  O   . THR A  1 504 ? 12.701  -3.418  4.335   1.00 52.78  ? 504  THR A O   1 
ATOM   3864 C  CB  . THR A  1 504 ? 11.263  -5.654  6.325   1.00 53.69  ? 504  THR A CB  1 
ATOM   3865 O  OG1 . THR A  1 504 ? 10.096  -4.974  5.839   1.00 54.96  ? 504  THR A OG1 1 
ATOM   3866 C  CG2 . THR A  1 504 ? 10.992  -6.206  7.715   1.00 49.45  ? 504  THR A CG2 1 
ATOM   3867 N  N   . THR A  1 505 ? 13.632  -5.457  4.376   1.00 56.53  ? 505  THR A N   1 
ATOM   3868 C  CA  . THR A  1 505 ? 14.006  -5.423  2.969   1.00 61.11  ? 505  THR A CA  1 
ATOM   3869 C  C   . THR A  1 505 ? 12.745  -5.528  2.124   1.00 62.39  ? 505  THR A C   1 
ATOM   3870 O  O   . THR A  1 505 ? 12.598  -4.853  1.108   1.00 60.98  ? 505  THR A O   1 
ATOM   3871 C  CB  . THR A  1 505 ? 14.953  -6.581  2.614   1.00 64.35  ? 505  THR A CB  1 
ATOM   3872 O  OG1 . THR A  1 505 ? 14.316  -7.831  2.907   1.00 72.09  ? 505  THR A OG1 1 
ATOM   3873 C  CG2 . THR A  1 505 ? 16.232  -6.476  3.419   1.00 59.95  ? 505  THR A CG2 1 
ATOM   3874 N  N   . ALA A  1 506 ? 11.824  -6.369  2.577   1.00 66.02  ? 506  ALA A N   1 
ATOM   3875 C  CA  . ALA A  1 506 ? 10.595  -6.651  1.843   1.00 66.46  ? 506  ALA A CA  1 
ATOM   3876 C  C   . ALA A  1 506 ? 9.654   -5.452  1.719   1.00 71.90  ? 506  ALA A C   1 
ATOM   3877 O  O   . ALA A  1 506 ? 8.965   -5.307  0.708   1.00 77.91  ? 506  ALA A O   1 
ATOM   3878 C  CB  . ALA A  1 506 ? 9.866   -7.820  2.488   1.00 64.22  ? 506  ALA A CB  1 
ATOM   3879 N  N   . ALA A  1 507 ? 9.617   -4.605  2.747   1.00 66.63  ? 507  ALA A N   1 
ATOM   3880 C  CA  . ALA A  1 507 ? 8.661   -3.496  2.789   1.00 59.36  ? 507  ALA A CA  1 
ATOM   3881 C  C   . ALA A  1 507 ? 9.299   -2.109  2.929   1.00 56.41  ? 507  ALA A C   1 
ATOM   3882 O  O   . ALA A  1 507 ? 8.685   -1.109  2.554   1.00 60.56  ? 507  ALA A O   1 
ATOM   3883 C  CB  . ALA A  1 507 ? 7.637   -3.720  3.893   1.00 59.26  ? 507  ALA A CB  1 
ATOM   3884 N  N   . GLN A  1 508 ? 10.507  -2.054  3.489   1.00 51.06  ? 508  GLN A N   1 
ATOM   3885 C  CA  . GLN A  1 508 ? 11.268  -0.805  3.602   1.00 54.45  ? 508  GLN A CA  1 
ATOM   3886 C  C   . GLN A  1 508 ? 10.506  0.315   4.304   1.00 51.46  ? 508  GLN A C   1 
ATOM   3887 O  O   . GLN A  1 508 ? 10.533  1.468   3.864   1.00 46.91  ? 508  GLN A O   1 
ATOM   3888 C  CB  . GLN A  1 508 ? 11.733  -0.326  2.222   1.00 50.30  ? 508  GLN A CB  1 
ATOM   3889 C  CG  . GLN A  1 508 ? 12.559  -1.335  1.440   1.00 52.02  ? 508  GLN A CG  1 
ATOM   3890 C  CD  . GLN A  1 508 ? 13.033  -0.783  0.103   1.00 64.05  ? 508  GLN A CD  1 
ATOM   3891 O  OE1 . GLN A  1 508 ? 13.639  0.288   0.038   1.00 66.69  ? 508  GLN A OE1 1 
ATOM   3892 N  NE2 . GLN A  1 508 ? 12.751  -1.512  -0.972  1.00 61.39  ? 508  GLN A NE2 1 
ATOM   3893 N  N   . GLN A  1 509 ? 9.834   -0.026  5.396   1.00 51.67  ? 509  GLN A N   1 
ATOM   3894 C  CA  . GLN A  1 509 ? 9.012   0.939   6.111   1.00 52.96  ? 509  GLN A CA  1 
ATOM   3895 C  C   . GLN A  1 509 ? 9.809   1.790   7.092   1.00 50.18  ? 509  GLN A C   1 
ATOM   3896 O  O   . GLN A  1 509 ? 10.762  1.319   7.717   1.00 52.39  ? 509  GLN A O   1 
ATOM   3897 C  CB  . GLN A  1 509 ? 7.872   0.223   6.842   1.00 50.70  ? 509  GLN A CB  1 
ATOM   3898 C  CG  . GLN A  1 509 ? 6.902   -0.490  5.918   1.00 50.95  ? 509  GLN A CG  1 
ATOM   3899 C  CD  . GLN A  1 509 ? 5.856   -1.271  6.677   1.00 51.40  ? 509  GLN A CD  1 
ATOM   3900 O  OE1 . GLN A  1 509 ? 4.710   -0.842  6.796   1.00 57.49  ? 509  GLN A OE1 1 
ATOM   3901 N  NE2 . GLN A  1 509 ? 6.245   -2.428  7.197   1.00 50.50  ? 509  GLN A NE2 1 
ATOM   3902 N  N   . TYR A  1 510 ? 9.412   3.055   7.199   1.00 47.85  ? 510  TYR A N   1 
ATOM   3903 C  CA  . TYR A  1 510 ? 9.945   3.976   8.198   1.00 48.82  ? 510  TYR A CA  1 
ATOM   3904 C  C   . TYR A  1 510 ? 8.852   4.982   8.535   1.00 52.56  ? 510  TYR A C   1 
ATOM   3905 O  O   . TYR A  1 510 ? 7.821   5.025   7.862   1.00 61.63  ? 510  TYR A O   1 
ATOM   3906 C  CB  . TYR A  1 510 ? 11.190  4.692   7.675   1.00 42.36  ? 510  TYR A CB  1 
ATOM   3907 C  CG  . TYR A  1 510 ? 10.933  5.625   6.519   1.00 45.00  ? 510  TYR A CG  1 
ATOM   3908 C  CD1 . TYR A  1 510 ? 10.808  5.138   5.226   1.00 49.94  ? 510  TYR A CD1 1 
ATOM   3909 C  CD2 . TYR A  1 510 ? 10.834  6.996   6.718   1.00 41.35  ? 510  TYR A CD2 1 
ATOM   3910 C  CE1 . TYR A  1 510 ? 10.580  5.985   4.167   1.00 49.12  ? 510  TYR A CE1 1 
ATOM   3911 C  CE2 . TYR A  1 510 ? 10.607  7.852   5.665   1.00 47.59  ? 510  TYR A CE2 1 
ATOM   3912 C  CZ  . TYR A  1 510 ? 10.482  7.341   4.391   1.00 54.33  ? 510  TYR A CZ  1 
ATOM   3913 O  OH  . TYR A  1 510 ? 10.257  8.189   3.331   1.00 55.79  ? 510  TYR A OH  1 
ATOM   3914 N  N   . VAL A  1 511 ? 9.065   5.790   9.569   1.00 45.01  ? 511  VAL A N   1 
ATOM   3915 C  CA  . VAL A  1 511 ? 8.034   6.736   9.992   1.00 44.63  ? 511  VAL A CA  1 
ATOM   3916 C  C   . VAL A  1 511 ? 8.466   8.198   9.915   1.00 40.87  ? 511  VAL A C   1 
ATOM   3917 O  O   . VAL A  1 511 ? 9.650   8.518   10.023  1.00 39.98  ? 511  VAL A O   1 
ATOM   3918 C  CB  . VAL A  1 511 ? 7.526   6.433   11.420  1.00 44.12  ? 511  VAL A CB  1 
ATOM   3919 C  CG1 . VAL A  1 511 ? 6.790   5.111   11.454  1.00 41.21  ? 511  VAL A CG1 1 
ATOM   3920 C  CG2 . VAL A  1 511 ? 8.677   6.421   12.406  1.00 45.59  ? 511  VAL A CG2 1 
ATOM   3921 N  N   . SER A  1 512 ? 7.490   9.081   9.721   1.00 38.98  ? 512  SER A N   1 
ATOM   3922 C  CA  . SER A  1 512 ? 7.728   10.517  9.795   1.00 42.51  ? 512  SER A CA  1 
ATOM   3923 C  C   . SER A  1 512 ? 7.635   11.007  11.237  1.00 49.10  ? 512  SER A C   1 
ATOM   3924 O  O   . SER A  1 512 ? 6.670   10.706  11.945  1.00 50.90  ? 512  SER A O   1 
ATOM   3925 C  CB  . SER A  1 512 ? 6.726   11.276  8.924   1.00 35.50  ? 512  SER A CB  1 
ATOM   3926 O  OG  . SER A  1 512 ? 5.389   10.943  9.254   1.00 44.04  ? 512  SER A OG  1 
ATOM   3927 N  N   . LEU A  1 513 ? 8.644   11.755  11.674  1.00 47.70  ? 513  LEU A N   1 
ATOM   3928 C  CA  . LEU A  1 513 ? 8.617   12.355  13.005  1.00 41.95  ? 513  LEU A CA  1 
ATOM   3929 C  C   . LEU A  1 513 ? 8.339   13.859  12.916  1.00 44.06  ? 513  LEU A C   1 
ATOM   3930 O  O   . LEU A  1 513 ? 9.222   14.646  12.560  1.00 42.26  ? 513  LEU A O   1 
ATOM   3931 C  CB  . LEU A  1 513 ? 9.925   12.085  13.759  1.00 42.09  ? 513  LEU A CB  1 
ATOM   3932 C  CG  . LEU A  1 513 ? 10.200  10.641  14.201  1.00 40.32  ? 513  LEU A CG  1 
ATOM   3933 C  CD1 . LEU A  1 513 ? 11.511  10.517  14.976  1.00 27.76  ? 513  LEU A CD1 1 
ATOM   3934 C  CD2 . LEU A  1 513 ? 9.048   10.110  15.032  1.00 39.78  ? 513  LEU A CD2 1 
ATOM   3935 N  N   . ASN A  1 514 ? 7.101   14.242  13.227  1.00 43.70  ? 514  ASN A N   1 
ATOM   3936 C  CA  . ASN A  1 514 ? 6.689   15.647  13.239  1.00 49.22  ? 514  ASN A CA  1 
ATOM   3937 C  C   . ASN A  1 514 ? 5.528   15.901  14.200  1.00 50.14  ? 514  ASN A C   1 
ATOM   3938 O  O   . ASN A  1 514 ? 5.217   15.059  15.043  1.00 53.57  ? 514  ASN A O   1 
ATOM   3939 C  CB  . ASN A  1 514 ? 6.333   16.133  11.827  1.00 51.09  ? 514  ASN A CB  1 
ATOM   3940 C  CG  . ASN A  1 514 ? 5.421   15.167  11.084  1.00 54.58  ? 514  ASN A CG  1 
ATOM   3941 O  OD1 . ASN A  1 514 ? 4.268   14.961  11.468  1.00 45.65  ? 514  ASN A OD1 1 
ATOM   3942 N  ND2 . ASN A  1 514 ? 5.929   14.585  10.004  1.00 62.74  ? 514  ASN A ND2 1 
ATOM   3943 N  N   . LEU A  1 515 ? 4.881   17.055  14.064  1.00 52.32  ? 515  LEU A N   1 
ATOM   3944 C  CA  . LEU A  1 515 ? 3.802   17.442  14.976  1.00 49.47  ? 515  LEU A CA  1 
ATOM   3945 C  C   . LEU A  1 515 ? 2.554   16.565  14.841  1.00 50.84  ? 515  LEU A C   1 
ATOM   3946 O  O   . LEU A  1 515 ? 1.736   16.483  15.761  1.00 53.36  ? 515  LEU A O   1 
ATOM   3947 C  CB  . LEU A  1 515 ? 3.450   18.922  14.794  1.00 45.82  ? 515  LEU A CB  1 
ATOM   3948 C  CG  . LEU A  1 515 ? 4.581   19.900  15.128  1.00 51.82  ? 515  LEU A CG  1 
ATOM   3949 C  CD1 . LEU A  1 515 ? 4.111   21.343  15.070  1.00 52.96  ? 515  LEU A CD1 1 
ATOM   3950 C  CD2 . LEU A  1 515 ? 5.171   19.585  16.494  1.00 44.37  ? 515  LEU A CD2 1 
ATOM   3951 N  N   . LYS A  1 516 ? 2.423   15.905  13.695  1.00 52.57  ? 516  LYS A N   1 
ATOM   3952 C  CA  . LYS A  1 516 ? 1.292   15.022  13.433  1.00 52.72  ? 516  LYS A CA  1 
ATOM   3953 C  C   . LYS A  1 516 ? 1.607   13.604  13.907  1.00 50.60  ? 516  LYS A C   1 
ATOM   3954 O  O   . LYS A  1 516 ? 2.775   13.266  14.105  1.00 46.17  ? 516  LYS A O   1 
ATOM   3955 C  CB  . LYS A  1 516 ? 0.957   15.039  11.938  1.00 50.90  ? 516  LYS A CB  1 
ATOM   3956 C  CG  . LYS A  1 516 ? 0.586   16.421  11.420  1.00 60.86  ? 516  LYS A CG  1 
ATOM   3957 C  CD  . LYS A  1 516 ? 0.020   16.366  10.007  1.00 70.58  ? 516  LYS A CD  1 
ATOM   3958 C  CE  . LYS A  1 516 ? 1.014   15.773  9.022   1.00 76.72  ? 516  LYS A CE  1 
ATOM   3959 N  NZ  . LYS A  1 516 ? 0.480   15.752  7.629   1.00 78.99  ? 516  LYS A NZ  1 
ATOM   3960 N  N   . PRO A  1 517 ? 0.566   12.778  14.120  1.00 51.76  ? 517  PRO A N   1 
ATOM   3961 C  CA  . PRO A  1 517 ? 0.785   11.388  14.540  1.00 52.79  ? 517  PRO A CA  1 
ATOM   3962 C  C   . PRO A  1 517 ? 1.654   10.625  13.548  1.00 55.45  ? 517  PRO A C   1 
ATOM   3963 O  O   . PRO A  1 517 ? 1.759   11.051  12.396  1.00 57.77  ? 517  PRO A O   1 
ATOM   3964 C  CB  . PRO A  1 517 ? -0.628  10.802  14.534  1.00 50.59  ? 517  PRO A CB  1 
ATOM   3965 C  CG  . PRO A  1 517 ? -1.511  11.964  14.825  1.00 51.40  ? 517  PRO A CG  1 
ATOM   3966 C  CD  . PRO A  1 517 ? -0.866  13.140  14.140  1.00 47.38  ? 517  PRO A CD  1 
ATOM   3967 N  N   . LEU A  1 518 ? 2.259   9.522   13.989  1.00 51.59  ? 518  LEU A N   1 
ATOM   3968 C  CA  . LEU A  1 518 ? 3.107   8.705   13.119  1.00 49.58  ? 518  LEU A CA  1 
ATOM   3969 C  C   . LEU A  1 518 ? 2.447   8.385   11.782  1.00 46.91  ? 518  LEU A C   1 
ATOM   3970 O  O   . LEU A  1 518 ? 1.289   7.972   11.729  1.00 44.46  ? 518  LEU A O   1 
ATOM   3971 C  CB  . LEU A  1 518 ? 3.502   7.389   13.796  1.00 44.96  ? 518  LEU A CB  1 
ATOM   3972 C  CG  . LEU A  1 518 ? 4.608   7.391   14.849  1.00 41.40  ? 518  LEU A CG  1 
ATOM   3973 C  CD1 . LEU A  1 518 ? 5.206   6.001   15.002  1.00 44.75  ? 518  LEU A CD1 1 
ATOM   3974 C  CD2 . LEU A  1 518 ? 5.678   8.396   14.493  1.00 41.53  ? 518  LEU A CD2 1 
ATOM   3975 N  N   . GLU A  1 519 ? 3.198   8.596   10.708  1.00 50.90  ? 519  GLU A N   1 
ATOM   3976 C  CA  . GLU A  1 519 ? 2.791   8.170   9.379   1.00 49.68  ? 519  GLU A CA  1 
ATOM   3977 C  C   . GLU A  1 519 ? 3.850   7.210   8.852   1.00 42.41  ? 519  GLU A C   1 
ATOM   3978 O  O   . GLU A  1 519 ? 5.042   7.516   8.886   1.00 46.21  ? 519  GLU A O   1 
ATOM   3979 C  CB  . GLU A  1 519 ? 2.638   9.382   8.453   1.00 58.95  ? 519  GLU A CB  1 
ATOM   3980 C  CG  . GLU A  1 519 ? 2.744   9.069   6.965   1.00 72.90  ? 519  GLU A CG  1 
ATOM   3981 C  CD  . GLU A  1 519 ? 2.542   10.299  6.097   1.00 81.63  ? 519  GLU A CD  1 
ATOM   3982 O  OE1 . GLU A  1 519 ? 1.801   11.212  6.520   1.00 92.31  ? 519  GLU A OE1 1 
ATOM   3983 O  OE2 . GLU A  1 519 ? 3.124   10.353  4.992   1.00 74.49  ? 519  GLU A OE2 1 
ATOM   3984 N  N   . VAL A  1 520 ? 3.421   6.038   8.395   1.00 42.67  ? 520  VAL A N   1 
ATOM   3985 C  CA  . VAL A  1 520 ? 4.347   5.048   7.852   1.00 48.91  ? 520  VAL A CA  1 
ATOM   3986 C  C   . VAL A  1 520 ? 4.585   5.297   6.366   1.00 49.98  ? 520  VAL A C   1 
ATOM   3987 O  O   . VAL A  1 520 ? 3.639   5.529   5.611   1.00 49.87  ? 520  VAL A O   1 
ATOM   3988 C  CB  . VAL A  1 520 ? 3.814   3.616   8.051   1.00 50.29  ? 520  VAL A CB  1 
ATOM   3989 C  CG1 . VAL A  1 520 ? 4.789   2.598   7.482   1.00 47.29  ? 520  VAL A CG1 1 
ATOM   3990 C  CG2 . VAL A  1 520 ? 3.569   3.348   9.528   1.00 42.30  ? 520  VAL A CG2 1 
ATOM   3991 N  N   . ARG A  1 521 ? 5.850   5.264   5.954   1.00 48.46  ? 521  ARG A N   1 
ATOM   3992 C  CA  . ARG A  1 521 ? 6.211   5.419   4.548   1.00 49.40  ? 521  ARG A CA  1 
ATOM   3993 C  C   . ARG A  1 521 ? 7.113   4.273   4.102   1.00 51.42  ? 521  ARG A C   1 
ATOM   3994 O  O   . ARG A  1 521 ? 7.710   3.586   4.934   1.00 45.68  ? 521  ARG A O   1 
ATOM   3995 C  CB  . ARG A  1 521 ? 6.914   6.762   4.314   1.00 48.44  ? 521  ARG A CB  1 
ATOM   3996 C  CG  . ARG A  1 521 ? 6.053   7.978   4.620   1.00 43.96  ? 521  ARG A CG  1 
ATOM   3997 C  CD  . ARG A  1 521 ? 6.850   9.273   4.554   1.00 43.47  ? 521  ARG A CD  1 
ATOM   3998 N  NE  . ARG A  1 521 ? 6.120   10.389  5.157   1.00 45.92  ? 521  ARG A NE  1 
ATOM   3999 C  CZ  . ARG A  1 521 ? 6.654   11.575  5.434   1.00 45.15  ? 521  ARG A CZ  1 
ATOM   4000 N  NH1 . ARG A  1 521 ? 7.929   11.811  5.164   1.00 47.50  ? 521  ARG A NH1 1 
ATOM   4001 N  NH2 . ARG A  1 521 ? 5.915   12.527  5.985   1.00 44.19  ? 521  ARG A NH2 1 
ATOM   4002 N  N   . ARG A  1 522 ? 7.203   4.073   2.788   1.00 47.84  ? 522  ARG A N   1 
ATOM   4003 C  CA  . ARG A  1 522 ? 8.033   3.017   2.218   1.00 50.98  ? 522  ARG A CA  1 
ATOM   4004 C  C   . ARG A  1 522 ? 9.143   3.601   1.353   1.00 53.41  ? 522  ARG A C   1 
ATOM   4005 O  O   . ARG A  1 522 ? 8.914   4.526   0.568   1.00 56.86  ? 522  ARG A O   1 
ATOM   4006 C  CB  . ARG A  1 522 ? 7.186   2.049   1.382   1.00 53.86  ? 522  ARG A CB  1 
ATOM   4007 C  CG  . ARG A  1 522 ? 6.177   1.241   2.186   1.00 66.60  ? 522  ARG A CG  1 
ATOM   4008 C  CD  . ARG A  1 522 ? 5.319   0.339   1.298   1.00 75.30  ? 522  ARG A CD  1 
ATOM   4009 N  NE  . ARG A  1 522 ? 6.014   -0.877  0.877   1.00 83.49  ? 522  ARG A NE  1 
ATOM   4010 C  CZ  . ARG A  1 522 ? 6.534   -1.067  -0.333  1.00 82.59  ? 522  ARG A CZ  1 
ATOM   4011 N  NH1 . ARG A  1 522 ? 6.440   -0.120  -1.257  1.00 85.20  ? 522  ARG A NH1 1 
ATOM   4012 N  NH2 . ARG A  1 522 ? 7.146   -2.208  -0.621  1.00 72.66  ? 522  ARG A NH2 1 
ATOM   4013 N  N   . GLY A  1 523 ? 10.347  3.059   1.506   1.00 46.53  ? 523  GLY A N   1 
ATOM   4014 C  CA  . GLY A  1 523 ? 11.475  3.467   0.690   1.00 40.70  ? 523  GLY A CA  1 
ATOM   4015 C  C   . GLY A  1 523 ? 12.268  4.634   1.241   1.00 43.70  ? 523  GLY A C   1 
ATOM   4016 O  O   . GLY A  1 523 ? 11.783  5.765   1.293   1.00 53.53  ? 523  GLY A O   1 
ATOM   4017 N  N   . LEU A  1 524 ? 13.503  4.355   1.640   1.00 42.07  ? 524  LEU A N   1 
ATOM   4018 C  CA  . LEU A  1 524 ? 14.399  5.389   2.139   1.00 45.30  ? 524  LEU A CA  1 
ATOM   4019 C  C   . LEU A  1 524 ? 15.150  6.025   0.977   1.00 45.23  ? 524  LEU A C   1 
ATOM   4020 O  O   . LEU A  1 524 ? 16.332  5.740   0.778   1.00 53.28  ? 524  LEU A O   1 
ATOM   4021 C  CB  . LEU A  1 524 ? 15.395  4.780   3.127   1.00 51.65  ? 524  LEU A CB  1 
ATOM   4022 C  CG  . LEU A  1 524 ? 15.352  5.233   4.589   1.00 66.60  ? 524  LEU A CG  1 
ATOM   4023 C  CD1 . LEU A  1 524 ? 14.222  6.217   4.828   1.00 72.55  ? 524  LEU A CD1 1 
ATOM   4024 C  CD2 . LEU A  1 524 ? 15.227  4.037   5.518   1.00 69.16  ? 524  LEU A CD2 1 
ATOM   4025 N  N   . ARG A  1 525 ? 14.468  6.890   0.225   1.00 48.97  ? 525  ARG A N   1 
ATOM   4026 C  CA  . ARG A  1 525 ? 15.027  7.471   -0.996  1.00 54.60  ? 525  ARG A CA  1 
ATOM   4027 C  C   . ARG A  1 525 ? 15.567  6.370   -1.890  1.00 45.77  ? 525  ARG A C   1 
ATOM   4028 O  O   . ARG A  1 525 ? 16.723  6.414   -2.312  1.00 47.03  ? 525  ARG A O   1 
ATOM   4029 C  CB  . ARG A  1 525 ? 16.141  8.465   -0.667  1.00 58.54  ? 525  ARG A CB  1 
ATOM   4030 C  CG  . ARG A  1 525 ? 15.645  9.803   -0.174  1.00 63.87  ? 525  ARG A CG  1 
ATOM   4031 C  CD  . ARG A  1 525 ? 16.011  10.912  -1.145  1.00 62.84  ? 525  ARG A CD  1 
ATOM   4032 N  NE  . ARG A  1 525 ? 16.696  12.009  -0.467  1.00 68.90  ? 525  ARG A NE  1 
ATOM   4033 C  CZ  . ARG A  1 525 ? 16.090  12.908  0.303   1.00 65.23  ? 525  ARG A CZ  1 
ATOM   4034 N  NH1 . ARG A  1 525 ? 14.779  12.845  0.503   1.00 66.08  ? 525  ARG A NH1 1 
ATOM   4035 N  NH2 . ARG A  1 525 ? 16.795  13.872  0.879   1.00 61.88  ? 525  ARG A NH2 1 
ATOM   4036 N  N   . ALA A  1 526 ? 14.722  5.379   -2.157  1.00 38.25  ? 526  ALA A N   1 
ATOM   4037 C  CA  . ALA A  1 526 ? 15.135  4.152   -2.831  1.00 41.40  ? 526  ALA A CA  1 
ATOM   4038 C  C   . ALA A  1 526 ? 15.874  4.387   -4.151  1.00 41.94  ? 526  ALA A C   1 
ATOM   4039 O  O   . ALA A  1 526 ? 16.988  3.892   -4.332  1.00 49.73  ? 526  ALA A O   1 
ATOM   4040 C  CB  . ALA A  1 526 ? 13.935  3.242   -3.039  1.00 45.65  ? 526  ALA A CB  1 
ATOM   4041 N  N   . GLN A  1 527 ? 15.263  5.138   -5.064  1.00 32.46  ? 527  GLN A N   1 
ATOM   4042 C  CA  . GLN A  1 527 ? 15.870  5.377   -6.377  1.00 44.36  ? 527  GLN A CA  1 
ATOM   4043 C  C   . GLN A  1 527 ? 17.211  6.095   -6.282  1.00 43.68  ? 527  GLN A C   1 
ATOM   4044 O  O   . GLN A  1 527 ? 18.226  5.594   -6.764  1.00 50.39  ? 527  GLN A O   1 
ATOM   4045 C  CB  . GLN A  1 527 ? 14.921  6.163   -7.292  1.00 46.81  ? 527  GLN A CB  1 
ATOM   4046 C  CG  . GLN A  1 527 ? 13.629  5.436   -7.630  1.00 49.99  ? 527  GLN A CG  1 
ATOM   4047 C  CD  . GLN A  1 527 ? 13.866  4.067   -8.240  1.00 58.53  ? 527  GLN A CD  1 
ATOM   4048 O  OE1 . GLN A  1 527 ? 13.230  3.087   -7.853  1.00 64.48  ? 527  GLN A OE1 1 
ATOM   4049 N  NE2 . GLN A  1 527 ? 14.777  3.995   -9.203  1.00 57.20  ? 527  GLN A NE2 1 
ATOM   4050 N  N   . THR A  1 528 ? 17.207  7.267   -5.658  1.00 37.74  ? 528  THR A N   1 
ATOM   4051 C  CA  . THR A  1 528 ? 18.410  8.088   -5.544  1.00 40.01  ? 528  THR A CA  1 
ATOM   4052 C  C   . THR A  1 528 ? 19.549  7.367   -4.810  1.00 46.67  ? 528  THR A C   1 
ATOM   4053 O  O   . THR A  1 528 ? 20.717  7.490   -5.187  1.00 50.88  ? 528  THR A O   1 
ATOM   4054 C  CB  . THR A  1 528 ? 18.084  9.436   -4.861  1.00 47.18  ? 528  THR A CB  1 
ATOM   4055 O  OG1 . THR A  1 528 ? 17.085  10.127  -5.625  1.00 44.46  ? 528  THR A OG1 1 
ATOM   4056 C  CG2 . THR A  1 528 ? 19.319  10.309  -4.757  1.00 49.53  ? 528  THR A CG2 1 
ATOM   4057 N  N   . CYS A  1 529 ? 19.211  6.602   -3.775  1.00 40.72  ? 529  CYS A N   1 
ATOM   4058 C  CA  . CYS A  1 529 ? 20.228  5.852   -3.038  1.00 41.02  ? 529  CYS A CA  1 
ATOM   4059 C  C   . CYS A  1 529 ? 20.758  4.639   -3.809  1.00 41.53  ? 529  CYS A C   1 
ATOM   4060 O  O   . CYS A  1 529 ? 21.885  4.202   -3.583  1.00 43.05  ? 529  CYS A O   1 
ATOM   4061 C  CB  . CYS A  1 529 ? 19.730  5.457   -1.646  1.00 38.08  ? 529  CYS A CB  1 
ATOM   4062 S  SG  . CYS A  1 529 ? 19.734  6.838   -0.459  1.00 53.99  ? 529  CYS A SG  1 
ATOM   4063 N  N   . ALA A  1 530 ? 19.956  4.101   -4.722  1.00 35.63  ? 530  ALA A N   1 
ATOM   4064 C  CA  . ALA A  1 530 ? 20.461  3.087   -5.643  1.00 43.83  ? 530  ALA A CA  1 
ATOM   4065 C  C   . ALA A  1 530 ? 21.610  3.666   -6.464  1.00 46.65  ? 530  ALA A C   1 
ATOM   4066 O  O   . ALA A  1 530 ? 22.599  2.986   -6.728  1.00 48.51  ? 530  ALA A O   1 
ATOM   4067 C  CB  . ALA A  1 530 ? 19.361  2.595   -6.553  1.00 38.84  ? 530  ALA A CB  1 
ATOM   4068 N  N   . PHE A  1 531 ? 21.470  4.929   -6.860  1.00 39.30  ? 531  PHE A N   1 
ATOM   4069 C  CA  . PHE A  1 531 ? 22.518  5.637   -7.590  1.00 37.13  ? 531  PHE A CA  1 
ATOM   4070 C  C   . PHE A  1 531 ? 23.798  5.763   -6.763  1.00 37.18  ? 531  PHE A C   1 
ATOM   4071 O  O   . PHE A  1 531 ? 24.885  5.452   -7.249  1.00 38.73  ? 531  PHE A O   1 
ATOM   4072 C  CB  . PHE A  1 531 ? 22.021  7.020   -8.030  1.00 39.53  ? 531  PHE A CB  1 
ATOM   4073 C  CG  . PHE A  1 531 ? 23.117  7.951   -8.483  1.00 43.72  ? 531  PHE A CG  1 
ATOM   4074 C  CD1 . PHE A  1 531 ? 23.668  7.833   -9.752  1.00 41.66  ? 531  PHE A CD1 1 
ATOM   4075 C  CD2 . PHE A  1 531 ? 23.584  8.955   -7.642  1.00 44.79  ? 531  PHE A CD2 1 
ATOM   4076 C  CE1 . PHE A  1 531 ? 24.674  8.690   -10.169 1.00 43.15  ? 531  PHE A CE1 1 
ATOM   4077 C  CE2 . PHE A  1 531 ? 24.590  9.815   -8.053  1.00 51.49  ? 531  PHE A CE2 1 
ATOM   4078 C  CZ  . PHE A  1 531 ? 25.135  9.683   -9.317  1.00 50.61  ? 531  PHE A CZ  1 
ATOM   4079 N  N   . TRP A  1 532 ? 23.669  6.219   -5.520  1.00 33.82  ? 532  TRP A N   1 
ATOM   4080 C  CA  . TRP A  1 532 ? 24.834  6.428   -4.661  1.00 42.55  ? 532  TRP A CA  1 
ATOM   4081 C  C   . TRP A  1 532 ? 25.447  5.118   -4.167  1.00 47.30  ? 532  TRP A C   1 
ATOM   4082 O  O   . TRP A  1 532 ? 26.671  4.983   -4.102  1.00 50.18  ? 532  TRP A O   1 
ATOM   4083 C  CB  . TRP A  1 532 ? 24.472  7.300   -3.449  1.00 38.81  ? 532  TRP A CB  1 
ATOM   4084 C  CG  . TRP A  1 532 ? 24.177  8.740   -3.774  1.00 38.02  ? 532  TRP A CG  1 
ATOM   4085 C  CD1 . TRP A  1 532 ? 22.951  9.342   -3.815  1.00 36.99  ? 532  TRP A CD1 1 
ATOM   4086 C  CD2 . TRP A  1 532 ? 25.135  9.758   -4.091  1.00 32.66  ? 532  TRP A CD2 1 
ATOM   4087 N  NE1 . TRP A  1 532 ? 23.090  10.672  -4.145  1.00 36.14  ? 532  TRP A NE1 1 
ATOM   4088 C  CE2 . TRP A  1 532 ? 24.420  10.951  -4.320  1.00 34.44  ? 532  TRP A CE2 1 
ATOM   4089 C  CE3 . TRP A  1 532 ? 26.527  9.774   -4.207  1.00 30.89  ? 532  TRP A CE3 1 
ATOM   4090 C  CZ2 . TRP A  1 532 ? 25.058  12.150  -4.660  1.00 35.76  ? 532  TRP A CZ2 1 
ATOM   4091 C  CZ3 . TRP A  1 532 ? 27.157  10.960  -4.543  1.00 29.31  ? 532  TRP A CZ3 1 
ATOM   4092 C  CH2 . TRP A  1 532 ? 26.424  12.131  -4.765  1.00 36.72  ? 532  TRP A CH2 1 
ATOM   4093 N  N   . ASN A  1 533 ? 24.596  4.160   -3.810  1.00 44.57  ? 533  ASN A N   1 
ATOM   4094 C  CA  . ASN A  1 533 ? 25.053  2.927   -3.162  1.00 44.14  ? 533  ASN A CA  1 
ATOM   4095 C  C   . ASN A  1 533 ? 25.344  1.743   -4.098  1.00 47.15  ? 533  ASN A C   1 
ATOM   4096 O  O   . ASN A  1 533 ? 26.126  0.857   -3.751  1.00 51.14  ? 533  ASN A O   1 
ATOM   4097 C  CB  . ASN A  1 533 ? 24.060  2.496   -2.078  1.00 40.78  ? 533  ASN A CB  1 
ATOM   4098 C  CG  . ASN A  1 533 ? 23.857  3.558   -1.015  1.00 38.89  ? 533  ASN A CG  1 
ATOM   4099 O  OD1 . ASN A  1 533 ? 24.756  4.348   -0.732  1.00 43.51  ? 533  ASN A OD1 1 
ATOM   4100 N  ND2 . ASN A  1 533 ? 22.670  3.581   -0.417  1.00 36.22  ? 533  ASN A ND2 1 
ATOM   4101 N  N   . ARG A  1 534 ? 24.712  1.724   -5.269  1.00 44.65  ? 534  ARG A N   1 
ATOM   4102 C  CA  . ARG A  1 534 ? 24.881  0.609   -6.202  1.00 49.32  ? 534  ARG A CA  1 
ATOM   4103 C  C   . ARG A  1 534 ? 25.653  0.971   -7.472  1.00 53.10  ? 534  ARG A C   1 
ATOM   4104 O  O   . ARG A  1 534 ? 26.550  0.238   -7.884  1.00 59.12  ? 534  ARG A O   1 
ATOM   4105 C  CB  . ARG A  1 534 ? 23.522  0.000   -6.579  1.00 46.54  ? 534  ARG A CB  1 
ATOM   4106 C  CG  . ARG A  1 534 ? 22.723  -0.531  -5.402  1.00 54.62  ? 534  ARG A CG  1 
ATOM   4107 C  CD  . ARG A  1 534 ? 21.374  -1.091  -5.837  1.00 58.88  ? 534  ARG A CD  1 
ATOM   4108 N  NE  . ARG A  1 534 ? 20.558  -1.481  -4.688  1.00 66.40  ? 534  ARG A NE  1 
ATOM   4109 C  CZ  . ARG A  1 534 ? 20.523  -2.705  -4.168  1.00 63.96  ? 534  ARG A CZ  1 
ATOM   4110 N  NH1 . ARG A  1 534 ? 21.255  -3.680  -4.693  1.00 62.37  ? 534  ARG A NH1 1 
ATOM   4111 N  NH2 . ARG A  1 534 ? 19.752  -2.957  -3.120  1.00 61.45  ? 534  ARG A NH2 1 
ATOM   4112 N  N   . PHE A  1 535 ? 25.304  2.093   -8.093  1.00 50.16  ? 535  PHE A N   1 
ATOM   4113 C  CA  . PHE A  1 535 ? 25.922  2.467   -9.362  1.00 44.90  ? 535  PHE A CA  1 
ATOM   4114 C  C   . PHE A  1 535 ? 27.236  3.224   -9.218  1.00 50.67  ? 535  PHE A C   1 
ATOM   4115 O  O   . PHE A  1 535 ? 28.218  2.889   -9.878  1.00 52.37  ? 535  PHE A O   1 
ATOM   4116 C  CB  . PHE A  1 535 ? 24.976  3.294   -10.233 1.00 37.43  ? 535  PHE A CB  1 
ATOM   4117 C  CG  . PHE A  1 535 ? 25.627  3.806   -11.482 1.00 39.97  ? 535  PHE A CG  1 
ATOM   4118 C  CD1 . PHE A  1 535 ? 25.854  2.953   -12.553 1.00 39.51  ? 535  PHE A CD1 1 
ATOM   4119 C  CD2 . PHE A  1 535 ? 26.052  5.126   -11.575 1.00 38.46  ? 535  PHE A CD2 1 
ATOM   4120 C  CE1 . PHE A  1 535 ? 26.476  3.409   -13.705 1.00 46.13  ? 535  PHE A CE1 1 
ATOM   4121 C  CE2 . PHE A  1 535 ? 26.676  5.591   -12.726 1.00 50.10  ? 535  PHE A CE2 1 
ATOM   4122 C  CZ  . PHE A  1 535 ? 26.884  4.731   -13.795 1.00 47.11  ? 535  PHE A CZ  1 
ATOM   4123 N  N   . LEU A  1 536 ? 27.243  4.264   -8.387  1.00 54.39  ? 536  LEU A N   1 
ATOM   4124 C  CA  . LEU A  1 536 ? 28.430  5.107   -8.229  1.00 54.13  ? 536  LEU A CA  1 
ATOM   4125 C  C   . LEU A  1 536 ? 29.734  4.354   -7.912  1.00 57.55  ? 536  LEU A C   1 
ATOM   4126 O  O   . LEU A  1 536 ? 30.783  4.700   -8.465  1.00 60.16  ? 536  LEU A O   1 
ATOM   4127 C  CB  . LEU A  1 536 ? 28.188  6.232   -7.211  1.00 58.67  ? 536  LEU A CB  1 
ATOM   4128 C  CG  . LEU A  1 536 ? 28.439  7.672   -7.675  1.00 66.01  ? 536  LEU A CG  1 
ATOM   4129 C  CD1 . LEU A  1 536 ? 29.283  8.433   -6.663  1.00 68.29  ? 536  LEU A CD1 1 
ATOM   4130 C  CD2 . LEU A  1 536 ? 29.091  7.711   -9.048  1.00 71.02  ? 536  LEU A CD2 1 
ATOM   4131 N  N   . PRO A  1 537 ? 29.682  3.331   -7.029  1.00 55.53  ? 537  PRO A N   1 
ATOM   4132 C  CA  . PRO A  1 537 ? 30.918  2.575   -6.791  1.00 59.52  ? 537  PRO A CA  1 
ATOM   4133 C  C   . PRO A  1 537 ? 31.430  1.863   -8.042  1.00 64.05  ? 537  PRO A C   1 
ATOM   4134 O  O   . PRO A  1 537 ? 32.631  1.922   -8.305  1.00 72.75  ? 537  PRO A O   1 
ATOM   4135 C  CB  . PRO A  1 537 ? 30.499  1.542   -5.740  1.00 53.47  ? 537  PRO A CB  1 
ATOM   4136 C  CG  . PRO A  1 537 ? 29.370  2.180   -5.018  1.00 46.22  ? 537  PRO A CG  1 
ATOM   4137 C  CD  . PRO A  1 537 ? 28.619  2.929   -6.086  1.00 52.07  ? 537  PRO A CD  1 
ATOM   4138 N  N   . LYS A  1 538 ? 30.540  1.202   -8.780  1.00 60.72  ? 538  LYS A N   1 
ATOM   4139 C  CA  . LYS A  1 538 ? 30.892  0.551   -10.044 1.00 64.77  ? 538  LYS A CA  1 
ATOM   4140 C  C   . LYS A  1 538 ? 31.571  1.520   -11.011 1.00 63.35  ? 538  LYS A C   1 
ATOM   4141 O  O   . LYS A  1 538 ? 32.514  1.154   -11.716 1.00 68.00  ? 538  LYS A O   1 
ATOM   4142 C  CB  . LYS A  1 538 ? 29.638  -0.022  -10.715 1.00 62.76  ? 538  LYS A CB  1 
ATOM   4143 C  CG  . LYS A  1 538 ? 28.882  -1.059  -9.898  1.00 75.51  ? 538  LYS A CG  1 
ATOM   4144 C  CD  . LYS A  1 538 ? 29.481  -2.445  -10.062 1.00 85.19  ? 538  LYS A CD  1 
ATOM   4145 C  CE  . LYS A  1 538 ? 28.545  -3.516  -9.517  1.00 88.86  ? 538  LYS A CE  1 
ATOM   4146 N  NZ  . LYS A  1 538 ? 28.967  -4.886  -9.928  1.00 91.88  ? 538  LYS A NZ  1 
ATOM   4147 N  N   . LEU A  1 539 ? 31.083  2.756   -11.035 1.00 65.09  ? 539  LEU A N   1 
ATOM   4148 C  CA  . LEU A  1 539 ? 31.598  3.780   -11.941 1.00 69.60  ? 539  LEU A CA  1 
ATOM   4149 C  C   . LEU A  1 539 ? 33.017  4.210   -11.577 1.00 80.22  ? 539  LEU A C   1 
ATOM   4150 O  O   . LEU A  1 539 ? 33.916  4.195   -12.421 1.00 80.52  ? 539  LEU A O   1 
ATOM   4151 C  CB  . LEU A  1 539 ? 30.668  4.997   -11.946 1.00 57.75  ? 539  LEU A CB  1 
ATOM   4152 C  CG  . LEU A  1 539 ? 31.091  6.177   -12.821 1.00 51.35  ? 539  LEU A CG  1 
ATOM   4153 C  CD1 . LEU A  1 539 ? 31.282  5.711   -14.251 1.00 45.03  ? 539  LEU A CD1 1 
ATOM   4154 C  CD2 . LEU A  1 539 ? 30.069  7.301   -12.758 1.00 47.98  ? 539  LEU A CD2 1 
ATOM   4155 N  N   . LEU A  1 540 ? 33.204  4.594   -10.317 1.00 85.60  ? 540  LEU A N   1 
ATOM   4156 C  CA  . LEU A  1 540 ? 34.491  5.088   -9.832  1.00 93.67  ? 540  LEU A CA  1 
ATOM   4157 C  C   . LEU A  1 540 ? 35.624  4.068   -9.969  1.00 101.23 ? 540  LEU A C   1 
ATOM   4158 O  O   . LEU A  1 540 ? 36.790  4.444   -10.109 1.00 105.68 ? 540  LEU A O   1 
ATOM   4159 C  CB  . LEU A  1 540 ? 34.365  5.563   -8.380  1.00 89.94  ? 540  LEU A CB  1 
ATOM   4160 C  CG  . LEU A  1 540 ? 33.697  6.926   -8.176  1.00 81.70  ? 540  LEU A CG  1 
ATOM   4161 C  CD1 . LEU A  1 540 ? 33.214  7.095   -6.744  1.00 66.98  ? 540  LEU A CD1 1 
ATOM   4162 C  CD2 . LEU A  1 540 ? 34.660  8.042   -8.543  1.00 78.18  ? 540  LEU A CD2 1 
ATOM   4163 N  N   . SER A  1 541 ? 35.282  2.782   -9.933  1.00 97.81  ? 541  SER A N   1 
ATOM   4164 C  CA  . SER A  1 541 ? 36.270  1.728   -10.146 1.00 95.75  ? 541  SER A CA  1 
ATOM   4165 C  C   . SER A  1 541 ? 36.369  1.371   -11.629 1.00 99.20  ? 541  SER A C   1 
ATOM   4166 O  O   . SER A  1 541 ? 36.373  0.194   -11.999 1.00 99.39  ? 541  SER A O   1 
ATOM   4167 C  CB  . SER A  1 541 ? 35.942  0.485   -9.311  1.00 93.63  ? 541  SER A CB  1 
ATOM   4168 O  OG  . SER A  1 541 ? 34.811  -0.200  -9.817  1.00 96.16  ? 541  SER A OG  1 
ATOM   4169 N  N   . ALA A  1 542 ? 36.446  2.402   -12.468 1.00 95.76  ? 542  ALA A N   1 
ATOM   4170 C  CA  . ALA A  1 542 ? 36.595  2.241   -13.911 1.00 89.91  ? 542  ALA A CA  1 
ATOM   4171 C  C   . ALA A  1 542 ? 37.013  3.558   -14.559 1.00 87.64  ? 542  ALA A C   1 
ATOM   4172 O  O   . ALA A  1 542 ? 37.470  4.478   -13.879 1.00 83.57  ? 542  ALA A O   1 
ATOM   4173 C  CB  . ALA A  1 542 ? 35.302  1.734   -14.531 1.00 82.88  ? 542  ALA A CB  1 
ATOM   4174 N  N   . GLU B  1 4   ? -17.030 6.294   -70.555 1.00 79.44  ? 4    GLU B N   1 
ATOM   4175 C  CA  . GLU B  1 4   ? -16.129 6.235   -69.407 1.00 77.06  ? 4    GLU B CA  1 
ATOM   4176 C  C   . GLU B  1 4   ? -16.224 7.497   -68.549 1.00 81.81  ? 4    GLU B C   1 
ATOM   4177 O  O   . GLU B  1 4   ? -16.458 8.591   -69.064 1.00 82.59  ? 4    GLU B O   1 
ATOM   4178 C  CB  . GLU B  1 4   ? -14.687 6.020   -69.872 1.00 68.72  ? 4    GLU B CB  1 
ATOM   4179 N  N   . ASP B  1 5   ? -16.040 7.334   -67.241 1.00 78.01  ? 5    ASP B N   1 
ATOM   4180 C  CA  . ASP B  1 5   ? -16.080 8.452   -66.301 1.00 75.56  ? 5    ASP B CA  1 
ATOM   4181 C  C   . ASP B  1 5   ? -14.876 9.370   -66.508 1.00 77.00  ? 5    ASP B C   1 
ATOM   4182 O  O   . ASP B  1 5   ? -13.734 8.944   -66.339 1.00 79.77  ? 5    ASP B O   1 
ATOM   4183 C  CB  . ASP B  1 5   ? -16.089 7.921   -64.866 1.00 74.87  ? 5    ASP B CB  1 
ATOM   4184 C  CG  . ASP B  1 5   ? -16.625 8.927   -63.868 1.00 69.93  ? 5    ASP B CG  1 
ATOM   4185 O  OD1 . ASP B  1 5   ? -16.484 10.148  -64.100 1.00 71.95  ? 5    ASP B OD1 1 
ATOM   4186 O  OD2 . ASP B  1 5   ? -17.187 8.491   -62.842 1.00 63.90  ? 5    ASP B OD2 1 
ATOM   4187 N  N   . PRO B  1 6   ? -15.129 10.637  -66.879 1.00 78.68  ? 6    PRO B N   1 
ATOM   4188 C  CA  . PRO B  1 6   ? -14.043 11.591  -67.137 1.00 78.03  ? 6    PRO B CA  1 
ATOM   4189 C  C   . PRO B  1 6   ? -13.339 12.047  -65.861 1.00 79.69  ? 6    PRO B C   1 
ATOM   4190 O  O   . PRO B  1 6   ? -12.297 12.697  -65.947 1.00 80.65  ? 6    PRO B O   1 
ATOM   4191 C  CB  . PRO B  1 6   ? -14.762 12.769  -67.805 1.00 80.08  ? 6    PRO B CB  1 
ATOM   4192 C  CG  . PRO B  1 6   ? -16.168 12.679  -67.323 1.00 81.43  ? 6    PRO B CG  1 
ATOM   4193 C  CD  . PRO B  1 6   ? -16.455 11.214  -67.164 1.00 81.03  ? 6    PRO B CD  1 
ATOM   4194 N  N   . GLN B  1 7   ? -13.902 11.718  -64.701 1.00 74.99  ? 7    GLN B N   1 
ATOM   4195 C  CA  . GLN B  1 7   ? -13.248 12.006  -63.430 1.00 72.60  ? 7    GLN B CA  1 
ATOM   4196 C  C   . GLN B  1 7   ? -12.113 11.025  -63.183 1.00 68.67  ? 7    GLN B C   1 
ATOM   4197 O  O   . GLN B  1 7   ? -11.137 11.347  -62.503 1.00 65.35  ? 7    GLN B O   1 
ATOM   4198 C  CB  . GLN B  1 7   ? -14.249 11.930  -62.272 1.00 75.12  ? 7    GLN B CB  1 
ATOM   4199 C  CG  . GLN B  1 7   ? -15.268 13.059  -62.237 1.00 75.20  ? 7    GLN B CG  1 
ATOM   4200 C  CD  . GLN B  1 7   ? -14.628 14.419  -62.046 1.00 74.85  ? 7    GLN B CD  1 
ATOM   4201 O  OE1 . GLN B  1 7   ? -13.530 14.531  -61.503 1.00 75.49  ? 7    GLN B OE1 1 
ATOM   4202 N  NE2 . GLN B  1 7   ? -15.313 15.462  -62.496 1.00 78.34  ? 7    GLN B NE2 1 
ATOM   4203 N  N   . LEU B  1 8   ? -12.252 9.827   -63.745 1.00 62.05  ? 8    LEU B N   1 
ATOM   4204 C  CA  . LEU B  1 8   ? -11.282 8.755   -63.549 1.00 65.25  ? 8    LEU B CA  1 
ATOM   4205 C  C   . LEU B  1 8   ? -10.203 8.781   -64.628 1.00 64.13  ? 8    LEU B C   1 
ATOM   4206 O  O   . LEU B  1 8   ? -9.346  7.898   -64.686 1.00 64.88  ? 8    LEU B O   1 
ATOM   4207 C  CB  . LEU B  1 8   ? -11.989 7.395   -63.530 1.00 61.27  ? 8    LEU B CB  1 
ATOM   4208 C  CG  . LEU B  1 8   ? -13.150 7.268   -62.540 1.00 59.04  ? 8    LEU B CG  1 
ATOM   4209 C  CD1 . LEU B  1 8   ? -13.686 5.845   -62.491 1.00 56.91  ? 8    LEU B CD1 1 
ATOM   4210 C  CD2 . LEU B  1 8   ? -12.715 7.728   -61.160 1.00 47.49  ? 8    LEU B CD2 1 
ATOM   4211 N  N   . LEU B  1 9   ? -10.247 9.805   -65.476 1.00 64.36  ? 9    LEU B N   1 
ATOM   4212 C  CA  . LEU B  1 9   ? -9.257  9.962   -66.538 1.00 66.07  ? 9    LEU B CA  1 
ATOM   4213 C  C   . LEU B  1 9   ? -8.341  11.158  -66.291 1.00 61.02  ? 9    LEU B C   1 
ATOM   4214 O  O   . LEU B  1 9   ? -8.781  12.309  -66.317 1.00 64.94  ? 9    LEU B O   1 
ATOM   4215 C  CB  . LEU B  1 9   ? -9.938  10.081  -67.905 1.00 71.50  ? 9    LEU B CB  1 
ATOM   4216 C  CG  . LEU B  1 9   ? -10.197 8.752   -68.620 1.00 73.01  ? 9    LEU B CG  1 
ATOM   4217 C  CD1 . LEU B  1 9   ? -10.954 8.954   -69.925 1.00 69.86  ? 9    LEU B CD1 1 
ATOM   4218 C  CD2 . LEU B  1 9   ? -8.880  8.040   -68.874 1.00 70.56  ? 9    LEU B CD2 1 
ATOM   4219 N  N   . VAL B  1 10  ? -7.064  10.871  -66.053 1.00 51.82  ? 10   VAL B N   1 
ATOM   4220 C  CA  . VAL B  1 10  ? -6.071  11.907  -65.798 1.00 54.62  ? 10   VAL B CA  1 
ATOM   4221 C  C   . VAL B  1 10  ? -4.918  11.770  -66.782 1.00 55.08  ? 10   VAL B C   1 
ATOM   4222 O  O   . VAL B  1 10  ? -4.500  10.655  -67.104 1.00 52.46  ? 10   VAL B O   1 
ATOM   4223 C  CB  . VAL B  1 10  ? -5.510  11.805  -64.364 1.00 49.52  ? 10   VAL B CB  1 
ATOM   4224 C  CG1 . VAL B  1 10  ? -4.614  12.990  -64.053 1.00 47.72  ? 10   VAL B CG1 1 
ATOM   4225 C  CG2 . VAL B  1 10  ? -6.639  11.747  -63.368 1.00 58.74  ? 10   VAL B CG2 1 
ATOM   4226 N  N   . ARG B  1 11  ? -4.413  12.898  -67.270 1.00 56.15  ? 11   ARG B N   1 
ATOM   4227 C  CA  . ARG B  1 11  ? -3.207  12.877  -68.086 1.00 61.25  ? 11   ARG B CA  1 
ATOM   4228 C  C   . ARG B  1 11  ? -2.022  13.402  -67.283 1.00 58.87  ? 11   ARG B C   1 
ATOM   4229 O  O   . ARG B  1 11  ? -2.036  14.540  -66.809 1.00 52.53  ? 11   ARG B O   1 
ATOM   4230 C  CB  . ARG B  1 11  ? -3.384  13.704  -69.362 1.00 65.77  ? 11   ARG B CB  1 
ATOM   4231 C  CG  . ARG B  1 11  ? -2.553  13.184  -70.526 1.00 81.42  ? 11   ARG B CG  1 
ATOM   4232 C  CD  . ARG B  1 11  ? -1.922  14.297  -71.352 1.00 94.15  ? 11   ARG B CD  1 
ATOM   4233 N  NE  . ARG B  1 11  ? -0.469  14.152  -71.427 1.00 103.95 ? 11   ARG B NE  1 
ATOM   4234 C  CZ  . ARG B  1 11  ? 0.160   13.243  -72.168 1.00 103.69 ? 11   ARG B CZ  1 
ATOM   4235 N  NH1 . ARG B  1 11  ? -0.533  12.382  -72.903 1.00 106.44 ? 11   ARG B NH1 1 
ATOM   4236 N  NH2 . ARG B  1 11  ? 1.486   13.189  -72.170 1.00 97.20  ? 11   ARG B NH2 1 
ATOM   4237 N  N   . VAL B  1 12  ? -1.006  12.560  -67.119 1.00 57.60  ? 12   VAL B N   1 
ATOM   4238 C  CA  . VAL B  1 12  ? 0.237   12.969  -66.478 1.00 52.65  ? 12   VAL B CA  1 
ATOM   4239 C  C   . VAL B  1 12  ? 1.361   12.965  -67.512 1.00 56.65  ? 12   VAL B C   1 
ATOM   4240 O  O   . VAL B  1 12  ? 1.152   12.550  -68.653 1.00 57.32  ? 12   VAL B O   1 
ATOM   4241 C  CB  . VAL B  1 12  ? 0.592   12.066  -65.270 1.00 44.75  ? 12   VAL B CB  1 
ATOM   4242 C  CG1 . VAL B  1 12  ? -0.544  12.056  -64.270 1.00 42.45  ? 12   VAL B CG1 1 
ATOM   4243 C  CG2 . VAL B  1 12  ? 0.907   10.649  -65.721 1.00 43.39  ? 12   VAL B CG2 1 
ATOM   4244 N  N   . ARG B  1 13  ? 2.546   13.419  -67.110 1.00 55.92  ? 13   ARG B N   1 
ATOM   4245 C  CA  . ARG B  1 13  ? 3.665   13.599  -68.037 1.00 60.65  ? 13   ARG B CA  1 
ATOM   4246 C  C   . ARG B  1 13  ? 4.134   12.315  -68.733 1.00 60.17  ? 13   ARG B C   1 
ATOM   4247 O  O   . ARG B  1 13  ? 4.926   12.373  -69.673 1.00 62.19  ? 13   ARG B O   1 
ATOM   4248 C  CB  . ARG B  1 13  ? 4.841   14.280  -67.325 1.00 61.27  ? 13   ARG B CB  1 
ATOM   4249 C  CG  . ARG B  1 13  ? 4.848   15.806  -67.420 1.00 76.04  ? 13   ARG B CG  1 
ATOM   4250 C  CD  . ARG B  1 13  ? 5.903   16.405  -66.501 1.00 90.46  ? 13   ARG B CD  1 
ATOM   4251 N  NE  . ARG B  1 13  ? 7.068   15.531  -66.397 1.00 105.77 ? 13   ARG B NE  1 
ATOM   4252 C  CZ  . ARG B  1 13  ? 8.168   15.653  -67.132 1.00 112.47 ? 13   ARG B CZ  1 
ATOM   4253 N  NH1 . ARG B  1 13  ? 8.269   16.627  -68.026 1.00 114.61 ? 13   ARG B NH1 1 
ATOM   4254 N  NH2 . ARG B  1 13  ? 9.172   14.802  -66.967 1.00 111.22 ? 13   ARG B NH2 1 
ATOM   4255 N  N   . GLY B  1 14  ? 3.642   11.165  -68.282 1.00 54.06  ? 14   GLY B N   1 
ATOM   4256 C  CA  . GLY B  1 14  ? 4.039   9.898   -68.869 1.00 48.05  ? 14   GLY B CA  1 
ATOM   4257 C  C   . GLY B  1 14  ? 2.984   9.301   -69.778 1.00 45.94  ? 14   GLY B C   1 
ATOM   4258 O  O   . GLY B  1 14  ? 3.245   8.334   -70.495 1.00 42.59  ? 14   GLY B O   1 
ATOM   4259 N  N   . GLY B  1 15  ? 1.787   9.875   -69.749 1.00 43.99  ? 15   GLY B N   1 
ATOM   4260 C  CA  . GLY B  1 15  ? 0.695   9.383   -70.569 1.00 46.27  ? 15   GLY B CA  1 
ATOM   4261 C  C   . GLY B  1 15  ? -0.629  9.474   -69.839 1.00 54.07  ? 15   GLY B C   1 
ATOM   4262 O  O   . GLY B  1 15  ? -0.791  10.314  -68.951 1.00 54.79  ? 15   GLY B O   1 
ATOM   4263 N  N   . GLN B  1 16  ? -1.575  8.608   -70.195 1.00 52.03  ? 16   GLN B N   1 
ATOM   4264 C  CA  . GLN B  1 16  ? -2.893  8.655   -69.566 1.00 55.10  ? 16   GLN B CA  1 
ATOM   4265 C  C   . GLN B  1 16  ? -3.144  7.541   -68.554 1.00 48.17  ? 16   GLN B C   1 
ATOM   4266 O  O   . GLN B  1 16  ? -2.662  6.419   -68.709 1.00 53.47  ? 16   GLN B O   1 
ATOM   4267 C  CB  . GLN B  1 16  ? -3.998  8.680   -70.622 1.00 61.61  ? 16   GLN B CB  1 
ATOM   4268 C  CG  . GLN B  1 16  ? -3.944  9.912   -71.501 1.00 71.97  ? 16   GLN B CG  1 
ATOM   4269 C  CD  . GLN B  1 16  ? -5.313  10.370  -71.952 1.00 86.65  ? 16   GLN B CD  1 
ATOM   4270 O  OE1 . GLN B  1 16  ? -5.787  11.432  -71.545 1.00 91.38  ? 16   GLN B OE1 1 
ATOM   4271 N  NE2 . GLN B  1 16  ? -5.956  9.576   -72.800 1.00 85.75  ? 16   GLN B NE2 1 
ATOM   4272 N  N   . LEU B  1 17  ? -3.907  7.869   -67.518 1.00 39.14  ? 17   LEU B N   1 
ATOM   4273 C  CA  . LEU B  1 17  ? -4.234  6.920   -66.467 1.00 42.25  ? 17   LEU B CA  1 
ATOM   4274 C  C   . LEU B  1 17  ? -5.741  6.756   -66.383 1.00 42.49  ? 17   LEU B C   1 
ATOM   4275 O  O   . LEU B  1 17  ? -6.491  7.681   -66.704 1.00 45.03  ? 17   LEU B O   1 
ATOM   4276 C  CB  . LEU B  1 17  ? -3.715  7.428   -65.119 1.00 51.08  ? 17   LEU B CB  1 
ATOM   4277 C  CG  . LEU B  1 17  ? -2.223  7.753   -65.038 1.00 52.05  ? 17   LEU B CG  1 
ATOM   4278 C  CD1 . LEU B  1 17  ? -1.942  8.710   -63.899 1.00 47.83  ? 17   LEU B CD1 1 
ATOM   4279 C  CD2 . LEU B  1 17  ? -1.404  6.487   -64.875 1.00 55.72  ? 17   LEU B CD2 1 
ATOM   4280 N  N   . ARG B  1 18  ? -6.185  5.577   -65.958 1.00 50.63  ? 18   ARG B N   1 
ATOM   4281 C  CA  . ARG B  1 18  ? -7.585  5.377   -65.605 1.00 53.10  ? 18   ARG B CA  1 
ATOM   4282 C  C   . ARG B  1 18  ? -7.664  4.972   -64.149 1.00 50.36  ? 18   ARG B C   1 
ATOM   4283 O  O   . ARG B  1 18  ? -7.139  3.928   -63.758 1.00 48.83  ? 18   ARG B O   1 
ATOM   4284 C  CB  . ARG B  1 18  ? -8.236  4.294   -66.465 1.00 53.98  ? 18   ARG B CB  1 
ATOM   4285 C  CG  . ARG B  1 18  ? -9.721  4.091   -66.167 1.00 56.99  ? 18   ARG B CG  1 
ATOM   4286 C  CD  . ARG B  1 18  ? -10.224 2.766   -66.720 1.00 76.07  ? 18   ARG B CD  1 
ATOM   4287 N  NE  . ARG B  1 18  ? -9.533  2.398   -67.953 1.00 86.68  ? 18   ARG B NE  1 
ATOM   4288 C  CZ  . ARG B  1 18  ? -9.845  2.867   -69.157 1.00 91.49  ? 18   ARG B CZ  1 
ATOM   4289 N  NH1 . ARG B  1 18  ? -10.840 3.731   -69.300 1.00 93.54  ? 18   ARG B NH1 1 
ATOM   4290 N  NH2 . ARG B  1 18  ? -9.156  2.478   -70.221 1.00 97.08  ? 18   ARG B NH2 1 
ATOM   4291 N  N   . GLY B  1 19  ? -8.318  5.800   -63.344 1.00 52.10  ? 19   GLY B N   1 
ATOM   4292 C  CA  . GLY B  1 19  ? -8.519  5.477   -61.946 1.00 49.51  ? 19   GLY B CA  1 
ATOM   4293 C  C   . GLY B  1 19  ? -9.777  4.665   -61.743 1.00 56.54  ? 19   GLY B C   1 
ATOM   4294 O  O   . GLY B  1 19  ? -10.455 4.298   -62.704 1.00 57.79  ? 19   GLY B O   1 
ATOM   4295 N  N   . ILE B  1 20  ? -10.085 4.381   -60.484 1.00 52.46  ? 20   ILE B N   1 
ATOM   4296 C  CA  . ILE B  1 20  ? -11.292 3.650   -60.138 1.00 52.49  ? 20   ILE B CA  1 
ATOM   4297 C  C   . ILE B  1 20  ? -12.052 4.421   -59.064 1.00 60.12  ? 20   ILE B C   1 
ATOM   4298 O  O   . ILE B  1 20  ? -11.445 4.997   -58.161 1.00 66.64  ? 20   ILE B O   1 
ATOM   4299 C  CB  . ILE B  1 20  ? -10.955 2.214   -59.663 1.00 50.35  ? 20   ILE B CB  1 
ATOM   4300 C  CG1 . ILE B  1 20  ? -12.226 1.455   -59.274 1.00 51.30  ? 20   ILE B CG1 1 
ATOM   4301 C  CG2 . ILE B  1 20  ? -9.963  2.240   -58.510 1.00 44.67  ? 20   ILE B CG2 1 
ATOM   4302 C  CD1 . ILE B  1 20  ? -11.996 -0.017  -58.999 1.00 48.40  ? 20   ILE B CD1 1 
ATOM   4303 N  N   . ARG B  1 21  ? -13.377 4.455   -59.174 1.00 58.19  ? 21   ARG B N   1 
ATOM   4304 C  CA  . ARG B  1 21  ? -14.199 5.146   -58.187 1.00 55.46  ? 21   ARG B CA  1 
ATOM   4305 C  C   . ARG B  1 21  ? -14.503 4.207   -57.029 1.00 59.15  ? 21   ARG B C   1 
ATOM   4306 O  O   . ARG B  1 21  ? -15.112 3.154   -57.220 1.00 65.45  ? 21   ARG B O   1 
ATOM   4307 C  CB  . ARG B  1 21  ? -15.502 5.633   -58.822 1.00 58.61  ? 21   ARG B CB  1 
ATOM   4308 C  CG  . ARG B  1 21  ? -16.280 6.627   -57.975 1.00 66.11  ? 21   ARG B CG  1 
ATOM   4309 C  CD  . ARG B  1 21  ? -17.674 6.825   -58.538 1.00 74.89  ? 21   ARG B CD  1 
ATOM   4310 N  NE  . ARG B  1 21  ? -18.407 5.562   -58.579 1.00 86.68  ? 21   ARG B NE  1 
ATOM   4311 C  CZ  . ARG B  1 21  ? -19.601 5.370   -58.028 1.00 99.87  ? 21   ARG B CZ  1 
ATOM   4312 N  NH1 . ARG B  1 21  ? -20.214 6.364   -57.400 1.00 101.67 ? 21   ARG B NH1 1 
ATOM   4313 N  NH2 . ARG B  1 21  ? -20.187 4.183   -58.112 1.00 104.17 ? 21   ARG B NH2 1 
ATOM   4314 N  N   . LEU B  1 22  ? -14.071 4.588   -55.832 1.00 53.90  ? 22   LEU B N   1 
ATOM   4315 C  CA  . LEU B  1 22  ? -14.221 3.736   -54.657 1.00 60.23  ? 22   LEU B CA  1 
ATOM   4316 C  C   . LEU B  1 22  ? -15.268 4.267   -53.685 1.00 63.87  ? 22   LEU B C   1 
ATOM   4317 O  O   . LEU B  1 22  ? -15.552 5.465   -53.654 1.00 58.67  ? 22   LEU B O   1 
ATOM   4318 C  CB  . LEU B  1 22  ? -12.875 3.560   -53.947 1.00 59.82  ? 22   LEU B CB  1 
ATOM   4319 C  CG  . LEU B  1 22  ? -11.850 2.745   -54.740 1.00 63.42  ? 22   LEU B CG  1 
ATOM   4320 C  CD1 . LEU B  1 22  ? -10.586 2.516   -53.940 1.00 60.07  ? 22   LEU B CD1 1 
ATOM   4321 C  CD2 . LEU B  1 22  ? -12.454 1.421   -55.163 1.00 67.40  ? 22   LEU B CD2 1 
ATOM   4322 N  N   . LYS B  1 23  ? -15.844 3.367   -52.895 1.00 70.78  ? 23   LYS B N   1 
ATOM   4323 C  CA  . LYS B  1 23  ? -16.874 3.748   -51.938 1.00 69.67  ? 23   LYS B CA  1 
ATOM   4324 C  C   . LYS B  1 23  ? -16.304 4.005   -50.548 1.00 63.43  ? 23   LYS B C   1 
ATOM   4325 O  O   . LYS B  1 23  ? -15.645 3.145   -49.963 1.00 62.43  ? 23   LYS B O   1 
ATOM   4326 C  CB  . LYS B  1 23  ? -17.966 2.677   -51.863 1.00 74.68  ? 23   LYS B CB  1 
ATOM   4327 C  CG  . LYS B  1 23  ? -19.210 3.127   -51.119 1.00 82.90  ? 23   LYS B CG  1 
ATOM   4328 C  CD  . LYS B  1 23  ? -19.700 4.460   -51.666 1.00 92.93  ? 23   LYS B CD  1 
ATOM   4329 C  CE  . LYS B  1 23  ? -20.813 5.051   -50.816 1.00 96.20  ? 23   LYS B CE  1 
ATOM   4330 N  NZ  . LYS B  1 23  ? -21.201 6.405   -51.302 1.00 95.11  ? 23   LYS B NZ  1 
ATOM   4331 N  N   . ALA B  1 24  ? -16.551 5.208   -50.040 1.00 62.14  ? 24   ALA B N   1 
ATOM   4332 C  CA  . ALA B  1 24  ? -16.299 5.540   -48.643 1.00 61.28  ? 24   ALA B CA  1 
ATOM   4333 C  C   . ALA B  1 24  ? -17.662 5.723   -47.981 1.00 64.11  ? 24   ALA B C   1 
ATOM   4334 O  O   . ALA B  1 24  ? -18.627 6.083   -48.657 1.00 66.42  ? 24   ALA B O   1 
ATOM   4335 C  CB  . ALA B  1 24  ? -15.472 6.811   -48.542 1.00 57.44  ? 24   ALA B CB  1 
ATOM   4336 N  N   . PRO B  1 25  ? -17.752 5.479   -46.661 1.00 68.32  ? 25   PRO B N   1 
ATOM   4337 C  CA  . PRO B  1 25  ? -19.056 5.500   -45.983 1.00 67.42  ? 25   PRO B CA  1 
ATOM   4338 C  C   . PRO B  1 25  ? -19.816 6.818   -46.130 1.00 66.20  ? 25   PRO B C   1 
ATOM   4339 O  O   . PRO B  1 25  ? -21.037 6.835   -45.963 1.00 69.46  ? 25   PRO B O   1 
ATOM   4340 C  CB  . PRO B  1 25  ? -18.697 5.252   -44.509 1.00 57.20  ? 25   PRO B CB  1 
ATOM   4341 C  CG  . PRO B  1 25  ? -17.231 5.549   -44.399 1.00 58.48  ? 25   PRO B CG  1 
ATOM   4342 C  CD  . PRO B  1 25  ? -16.657 5.164   -45.727 1.00 61.02  ? 25   PRO B CD  1 
ATOM   4343 N  N   . GLY B  1 26  ? -19.109 7.897   -46.450 1.00 64.48  ? 26   GLY B N   1 
ATOM   4344 C  CA  . GLY B  1 26  ? -19.742 9.192   -46.620 1.00 65.98  ? 26   GLY B CA  1 
ATOM   4345 C  C   . GLY B  1 26  ? -19.845 9.673   -48.058 1.00 66.89  ? 26   GLY B C   1 
ATOM   4346 O  O   . GLY B  1 26  ? -20.355 10.767  -48.307 1.00 67.97  ? 26   GLY B O   1 
ATOM   4347 N  N   . GLY B  1 27  ? -19.363 8.867   -49.003 1.00 65.09  ? 27   GLY B N   1 
ATOM   4348 C  CA  . GLY B  1 27  ? -19.427 9.214   -50.417 1.00 65.16  ? 27   GLY B CA  1 
ATOM   4349 C  C   . GLY B  1 27  ? -18.369 8.516   -51.254 1.00 63.93  ? 27   GLY B C   1 
ATOM   4350 O  O   . GLY B  1 27  ? -17.665 7.641   -50.755 1.00 66.26  ? 27   GLY B O   1 
ATOM   4351 N  N   . PRO B  1 28  ? -18.247 8.898   -52.537 1.00 64.05  ? 28   PRO B N   1 
ATOM   4352 C  CA  . PRO B  1 28  ? -17.262 8.274   -53.426 1.00 58.14  ? 28   PRO B CA  1 
ATOM   4353 C  C   . PRO B  1 28  ? -15.925 9.014   -53.433 1.00 56.13  ? 28   PRO B C   1 
ATOM   4354 O  O   . PRO B  1 28  ? -15.886 10.221  -53.188 1.00 55.80  ? 28   PRO B O   1 
ATOM   4355 C  CB  . PRO B  1 28  ? -17.928 8.392   -54.797 1.00 50.99  ? 28   PRO B CB  1 
ATOM   4356 C  CG  . PRO B  1 28  ? -18.704 9.675   -54.712 1.00 45.73  ? 28   PRO B CG  1 
ATOM   4357 C  CD  . PRO B  1 28  ? -19.123 9.839   -53.262 1.00 62.16  ? 28   PRO B CD  1 
ATOM   4358 N  N   . VAL B  1 29  ? -14.843 8.284   -53.694 1.00 51.11  ? 29   VAL B N   1 
ATOM   4359 C  CA  . VAL B  1 29  ? -13.532 8.889   -53.910 1.00 50.17  ? 29   VAL B CA  1 
ATOM   4360 C  C   . VAL B  1 29  ? -12.945 8.366   -55.216 1.00 48.78  ? 29   VAL B C   1 
ATOM   4361 O  O   . VAL B  1 29  ? -13.353 7.315   -55.710 1.00 50.05  ? 29   VAL B O   1 
ATOM   4362 C  CB  . VAL B  1 29  ? -12.546 8.586   -52.755 1.00 47.90  ? 29   VAL B CB  1 
ATOM   4363 C  CG1 . VAL B  1 29  ? -13.060 9.151   -51.446 1.00 48.94  ? 29   VAL B CG1 1 
ATOM   4364 C  CG2 . VAL B  1 29  ? -12.305 7.093   -52.628 1.00 46.99  ? 29   VAL B CG2 1 
ATOM   4365 N  N   . SER B  1 30  ? -11.995 9.102   -55.782 1.00 47.56  ? 30   SER B N   1 
ATOM   4366 C  CA  . SER B  1 30  ? -11.276 8.610   -56.948 1.00 48.69  ? 30   SER B CA  1 
ATOM   4367 C  C   . SER B  1 30  ? -9.923  8.073   -56.507 1.00 47.35  ? 30   SER B C   1 
ATOM   4368 O  O   . SER B  1 30  ? -9.165  8.766   -55.825 1.00 54.39  ? 30   SER B O   1 
ATOM   4369 C  CB  . SER B  1 30  ? -11.093 9.712   -57.989 1.00 50.47  ? 30   SER B CB  1 
ATOM   4370 O  OG  . SER B  1 30  ? -12.281 10.462  -58.156 1.00 56.87  ? 30   SER B OG  1 
ATOM   4371 N  N   . ALA B  1 31  ? -9.627  6.834   -56.885 1.00 47.66  ? 31   ALA B N   1 
ATOM   4372 C  CA  . ALA B  1 31  ? -8.349  6.220   -56.546 1.00 45.45  ? 31   ALA B CA  1 
ATOM   4373 C  C   . ALA B  1 31  ? -7.552  5.881   -57.796 1.00 54.27  ? 31   ALA B C   1 
ATOM   4374 O  O   . ALA B  1 31  ? -8.083  5.312   -58.754 1.00 50.55  ? 31   ALA B O   1 
ATOM   4375 C  CB  . ALA B  1 31  ? -8.562  4.977   -55.705 1.00 46.79  ? 31   ALA B CB  1 
ATOM   4376 N  N   . PHE B  1 32  ? -6.272  6.228   -57.774 1.00 53.34  ? 32   PHE B N   1 
ATOM   4377 C  CA  . PHE B  1 32  ? -5.372  5.915   -58.870 1.00 44.98  ? 32   PHE B CA  1 
ATOM   4378 C  C   . PHE B  1 32  ? -4.224  5.088   -58.300 1.00 44.36  ? 32   PHE B C   1 
ATOM   4379 O  O   . PHE B  1 32  ? -3.265  5.634   -57.752 1.00 44.22  ? 32   PHE B O   1 
ATOM   4380 C  CB  . PHE B  1 32  ? -4.868  7.206   -59.522 1.00 48.48  ? 32   PHE B CB  1 
ATOM   4381 C  CG  . PHE B  1 32  ? -5.972  8.133   -59.961 1.00 50.89  ? 32   PHE B CG  1 
ATOM   4382 C  CD1 . PHE B  1 32  ? -6.494  9.083   -59.089 1.00 55.47  ? 32   PHE B CD1 1 
ATOM   4383 C  CD2 . PHE B  1 32  ? -6.490  8.054   -61.244 1.00 53.87  ? 32   PHE B CD2 1 
ATOM   4384 C  CE1 . PHE B  1 32  ? -7.515  9.932   -59.492 1.00 56.82  ? 32   PHE B CE1 1 
ATOM   4385 C  CE2 . PHE B  1 32  ? -7.512  8.894   -61.653 1.00 55.31  ? 32   PHE B CE2 1 
ATOM   4386 C  CZ  . PHE B  1 32  ? -8.024  9.837   -60.777 1.00 59.04  ? 32   PHE B CZ  1 
ATOM   4387 N  N   . LEU B  1 33  ? -4.344  3.768   -58.422 1.00 43.23  ? 33   LEU B N   1 
ATOM   4388 C  CA  . LEU B  1 33  ? -3.427  2.836   -57.770 1.00 40.62  ? 33   LEU B CA  1 
ATOM   4389 C  C   . LEU B  1 33  ? -2.487  2.162   -58.768 1.00 42.44  ? 33   LEU B C   1 
ATOM   4390 O  O   . LEU B  1 33  ? -2.894  1.805   -59.873 1.00 49.19  ? 33   LEU B O   1 
ATOM   4391 C  CB  . LEU B  1 33  ? -4.218  1.767   -57.009 1.00 43.91  ? 33   LEU B CB  1 
ATOM   4392 C  CG  . LEU B  1 33  ? -5.480  2.236   -56.279 1.00 45.24  ? 33   LEU B CG  1 
ATOM   4393 C  CD1 . LEU B  1 33  ? -6.256  1.060   -55.718 1.00 47.29  ? 33   LEU B CD1 1 
ATOM   4394 C  CD2 . LEU B  1 33  ? -5.135  3.219   -55.173 1.00 42.14  ? 33   LEU B CD2 1 
ATOM   4395 N  N   . GLY B  1 34  ? -1.228  1.989   -58.376 1.00 43.92  ? 34   GLY B N   1 
ATOM   4396 C  CA  . GLY B  1 34  ? -0.263  1.295   -59.213 1.00 45.41  ? 34   GLY B CA  1 
ATOM   4397 C  C   . GLY B  1 34  ? 0.368   2.138   -60.309 1.00 45.97  ? 34   GLY B C   1 
ATOM   4398 O  O   . GLY B  1 34  ? 0.749   1.613   -61.356 1.00 49.86  ? 34   GLY B O   1 
ATOM   4399 N  N   . ILE B  1 35  ? 0.483   3.443   -60.073 1.00 41.38  ? 35   ILE B N   1 
ATOM   4400 C  CA  . ILE B  1 35  ? 1.129   4.336   -61.033 1.00 37.81  ? 35   ILE B CA  1 
ATOM   4401 C  C   . ILE B  1 35  ? 2.646   4.238   -60.900 1.00 37.37  ? 35   ILE B C   1 
ATOM   4402 O  O   . ILE B  1 35  ? 3.190   4.510   -59.830 1.00 51.53  ? 35   ILE B O   1 
ATOM   4403 C  CB  . ILE B  1 35  ? 0.715   5.812   -60.819 1.00 34.34  ? 35   ILE B CB  1 
ATOM   4404 C  CG1 . ILE B  1 35  ? -0.806  5.950   -60.712 1.00 37.28  ? 35   ILE B CG1 1 
ATOM   4405 C  CG2 . ILE B  1 35  ? 1.252   6.690   -61.945 1.00 32.48  ? 35   ILE B CG2 1 
ATOM   4406 C  CD1 . ILE B  1 35  ? -1.265  7.325   -60.231 1.00 33.36  ? 35   ILE B CD1 1 
ATOM   4407 N  N   . PRO B  1 36  ? 3.332   3.860   -61.991 1.00 36.38  ? 36   PRO B N   1 
ATOM   4408 C  CA  . PRO B  1 36  ? 4.797   3.761   -61.996 1.00 36.31  ? 36   PRO B CA  1 
ATOM   4409 C  C   . PRO B  1 36  ? 5.453   5.135   -62.003 1.00 42.58  ? 36   PRO B C   1 
ATOM   4410 O  O   . PRO B  1 36  ? 5.081   5.985   -62.816 1.00 46.73  ? 36   PRO B O   1 
ATOM   4411 C  CB  . PRO B  1 36  ? 5.093   3.040   -63.318 1.00 31.73  ? 36   PRO B CB  1 
ATOM   4412 C  CG  . PRO B  1 36  ? 3.939   3.406   -64.213 1.00 29.28  ? 36   PRO B CG  1 
ATOM   4413 C  CD  . PRO B  1 36  ? 2.744   3.509   -63.299 1.00 36.60  ? 36   PRO B CD  1 
ATOM   4414 N  N   . PHE B  1 37  ? 6.407   5.351   -61.101 1.00 39.78  ? 37   PHE B N   1 
ATOM   4415 C  CA  . PHE B  1 37  ? 7.174   6.594   -61.094 1.00 39.87  ? 37   PHE B CA  1 
ATOM   4416 C  C   . PHE B  1 37  ? 8.628   6.339   -61.483 1.00 37.56  ? 37   PHE B C   1 
ATOM   4417 O  O   . PHE B  1 37  ? 9.410   7.279   -61.648 1.00 39.64  ? 37   PHE B O   1 
ATOM   4418 C  CB  . PHE B  1 37  ? 7.084   7.306   -59.737 1.00 43.35  ? 37   PHE B CB  1 
ATOM   4419 C  CG  . PHE B  1 37  ? 7.562   6.478   -58.575 1.00 37.09  ? 37   PHE B CG  1 
ATOM   4420 C  CD1 . PHE B  1 37  ? 8.891   6.515   -58.170 1.00 38.00  ? 37   PHE B CD1 1 
ATOM   4421 C  CD2 . PHE B  1 37  ? 6.673   5.676   -57.876 1.00 39.60  ? 37   PHE B CD2 1 
ATOM   4422 C  CE1 . PHE B  1 37  ? 9.327   5.754   -57.092 1.00 38.99  ? 37   PHE B CE1 1 
ATOM   4423 C  CE2 . PHE B  1 37  ? 7.094   4.915   -56.803 1.00 28.90  ? 37   PHE B CE2 1 
ATOM   4424 C  CZ  . PHE B  1 37  ? 8.426   4.952   -56.407 1.00 25.99  ? 37   PHE B CZ  1 
ATOM   4425 N  N   . ALA B  1 38  ? 8.978   5.066   -61.651 1.00 33.89  ? 38   ALA B N   1 
ATOM   4426 C  CA  . ALA B  1 38  ? 10.346  4.692   -61.995 1.00 34.43  ? 38   ALA B CA  1 
ATOM   4427 C  C   . ALA B  1 38  ? 10.418  3.514   -62.958 1.00 39.06  ? 38   ALA B C   1 
ATOM   4428 O  O   . ALA B  1 38  ? 9.482   2.714   -63.055 1.00 37.69  ? 38   ALA B O   1 
ATOM   4429 C  CB  . ALA B  1 38  ? 11.131  4.374   -60.739 1.00 34.79  ? 38   ALA B CB  1 
ATOM   4430 N  N   . GLU B  1 39  ? 11.541  3.409   -63.664 1.00 30.60  ? 39   GLU B N   1 
ATOM   4431 C  CA  . GLU B  1 39  ? 11.848  2.202   -64.419 1.00 33.16  ? 39   GLU B CA  1 
ATOM   4432 C  C   . GLU B  1 39  ? 12.104  1.083   -63.421 1.00 45.66  ? 39   GLU B C   1 
ATOM   4433 O  O   . GLU B  1 39  ? 12.838  1.276   -62.450 1.00 49.72  ? 39   GLU B O   1 
ATOM   4434 C  CB  . GLU B  1 39  ? 13.081  2.408   -65.304 1.00 32.95  ? 39   GLU B CB  1 
ATOM   4435 C  CG  . GLU B  1 39  ? 12.866  3.373   -66.462 1.00 43.60  ? 39   GLU B CG  1 
ATOM   4436 C  CD  . GLU B  1 39  ? 11.876  2.853   -67.482 1.00 43.17  ? 39   GLU B CD  1 
ATOM   4437 O  OE1 . GLU B  1 39  ? 12.220  1.910   -68.225 1.00 45.94  ? 39   GLU B OE1 1 
ATOM   4438 O  OE2 . GLU B  1 39  ? 10.752  3.389   -67.544 1.00 49.09  ? 39   GLU B OE2 1 
ATOM   4439 N  N   . PRO B  1 40  ? 11.483  -0.085  -63.648 1.00 46.36  ? 40   PRO B N   1 
ATOM   4440 C  CA  . PRO B  1 40  ? 11.660  -1.266  -62.794 1.00 43.01  ? 40   PRO B CA  1 
ATOM   4441 C  C   . PRO B  1 40  ? 13.128  -1.574  -62.505 1.00 46.79  ? 40   PRO B C   1 
ATOM   4442 O  O   . PRO B  1 40  ? 13.881  -1.872  -63.433 1.00 46.89  ? 40   PRO B O   1 
ATOM   4443 C  CB  . PRO B  1 40  ? 11.044  -2.386  -63.632 1.00 40.10  ? 40   PRO B CB  1 
ATOM   4444 C  CG  . PRO B  1 40  ? 9.969   -1.699  -64.417 1.00 39.87  ? 40   PRO B CG  1 
ATOM   4445 C  CD  . PRO B  1 40  ? 10.502  -0.322  -64.725 1.00 44.39  ? 40   PRO B CD  1 
ATOM   4446 N  N   . PRO B  1 41  ? 13.520  -1.518  -61.221 1.00 49.94  ? 41   PRO B N   1 
ATOM   4447 C  CA  . PRO B  1 41  ? 14.908  -1.659  -60.773 1.00 47.80  ? 41   PRO B CA  1 
ATOM   4448 C  C   . PRO B  1 41  ? 15.339  -3.117  -60.738 1.00 48.01  ? 41   PRO B C   1 
ATOM   4449 O  O   . PRO B  1 41  ? 15.811  -3.597  -59.704 1.00 47.38  ? 41   PRO B O   1 
ATOM   4450 C  CB  . PRO B  1 41  ? 14.858  -1.102  -59.350 1.00 42.93  ? 41   PRO B CB  1 
ATOM   4451 C  CG  . PRO B  1 41  ? 13.489  -1.472  -58.877 1.00 43.21  ? 41   PRO B CG  1 
ATOM   4452 C  CD  . PRO B  1 41  ? 12.593  -1.352  -60.084 1.00 37.95  ? 41   PRO B CD  1 
ATOM   4453 N  N   . VAL B  1 42  ? 15.184  -3.802  -61.866 1.00 46.13  ? 42   VAL B N   1 
ATOM   4454 C  CA  . VAL B  1 42  ? 15.497  -5.222  -61.961 1.00 46.66  ? 42   VAL B CA  1 
ATOM   4455 C  C   . VAL B  1 42  ? 16.751  -5.491  -62.795 1.00 44.44  ? 42   VAL B C   1 
ATOM   4456 O  O   . VAL B  1 42  ? 17.212  -4.627  -63.545 1.00 43.68  ? 42   VAL B O   1 
ATOM   4457 C  CB  . VAL B  1 42  ? 14.312  -6.014  -62.552 1.00 44.11  ? 42   VAL B CB  1 
ATOM   4458 C  CG1 . VAL B  1 42  ? 13.063  -5.811  -61.701 1.00 33.59  ? 42   VAL B CG1 1 
ATOM   4459 C  CG2 . VAL B  1 42  ? 14.049  -5.591  -63.993 1.00 42.55  ? 42   VAL B CG2 1 
ATOM   4460 N  N   . GLY B  1 43  ? 17.299  -6.696  -62.661 1.00 44.00  ? 43   GLY B N   1 
ATOM   4461 C  CA  . GLY B  1 43  ? 18.485  -7.080  -63.406 1.00 42.62  ? 43   GLY B CA  1 
ATOM   4462 C  C   . GLY B  1 43  ? 19.735  -6.359  -62.939 1.00 52.21  ? 43   GLY B C   1 
ATOM   4463 O  O   . GLY B  1 43  ? 20.126  -6.474  -61.775 1.00 56.03  ? 43   GLY B O   1 
ATOM   4464 N  N   . SER B  1 44  ? 20.363  -5.615  -63.847 1.00 53.12  ? 44   SER B N   1 
ATOM   4465 C  CA  . SER B  1 44  ? 21.579  -4.870  -63.530 1.00 51.25  ? 44   SER B CA  1 
ATOM   4466 C  C   . SER B  1 44  ? 21.244  -3.565  -62.810 1.00 47.83  ? 44   SER B C   1 
ATOM   4467 O  O   . SER B  1 44  ? 22.132  -2.773  -62.483 1.00 44.74  ? 44   SER B O   1 
ATOM   4468 C  CB  . SER B  1 44  ? 22.377  -4.579  -64.802 1.00 44.16  ? 44   SER B CB  1 
ATOM   4469 O  OG  . SER B  1 44  ? 21.687  -3.658  -65.626 1.00 54.02  ? 44   SER B OG  1 
ATOM   4470 N  N   . ARG B  1 45  ? 19.957  -3.347  -62.566 1.00 46.87  ? 45   ARG B N   1 
ATOM   4471 C  CA  . ARG B  1 45  ? 19.506  -2.145  -61.875 1.00 50.26  ? 45   ARG B CA  1 
ATOM   4472 C  C   . ARG B  1 45  ? 19.286  -2.392  -60.385 1.00 48.91  ? 45   ARG B C   1 
ATOM   4473 O  O   . ARG B  1 45  ? 18.880  -1.488  -59.651 1.00 52.04  ? 45   ARG B O   1 
ATOM   4474 C  CB  . ARG B  1 45  ? 18.232  -1.606  -62.525 1.00 49.54  ? 45   ARG B CB  1 
ATOM   4475 C  CG  . ARG B  1 45  ? 18.487  -0.724  -63.738 1.00 48.37  ? 45   ARG B CG  1 
ATOM   4476 C  CD  . ARG B  1 45  ? 18.862  0.681   -63.309 1.00 57.60  ? 45   ARG B CD  1 
ATOM   4477 N  NE  . ARG B  1 45  ? 20.147  1.121   -63.847 1.00 59.92  ? 45   ARG B NE  1 
ATOM   4478 C  CZ  . ARG B  1 45  ? 20.695  2.302   -63.578 1.00 66.86  ? 45   ARG B CZ  1 
ATOM   4479 N  NH1 . ARG B  1 45  ? 20.071  3.155   -62.773 1.00 58.93  ? 45   ARG B NH1 1 
ATOM   4480 N  NH2 . ARG B  1 45  ? 21.864  2.630   -64.107 1.00 70.72  ? 45   ARG B NH2 1 
ATOM   4481 N  N   . ARG B  1 46  ? 19.552  -3.620  -59.948 1.00 45.03  ? 46   ARG B N   1 
ATOM   4482 C  CA  . ARG B  1 46  ? 19.491  -3.967  -58.531 1.00 49.34  ? 46   ARG B CA  1 
ATOM   4483 C  C   . ARG B  1 46  ? 20.560  -3.158  -57.805 1.00 49.55  ? 46   ARG B C   1 
ATOM   4484 O  O   . ARG B  1 46  ? 21.653  -2.970  -58.335 1.00 48.26  ? 46   ARG B O   1 
ATOM   4485 C  CB  . ARG B  1 46  ? 19.731  -5.473  -58.356 1.00 45.47  ? 46   ARG B CB  1 
ATOM   4486 C  CG  . ARG B  1 46  ? 19.512  -6.017  -56.951 1.00 46.26  ? 46   ARG B CG  1 
ATOM   4487 C  CD  . ARG B  1 46  ? 19.800  -7.519  -56.898 1.00 50.21  ? 46   ARG B CD  1 
ATOM   4488 N  NE  . ARG B  1 46  ? 18.600  -8.342  -57.051 1.00 44.94  ? 46   ARG B NE  1 
ATOM   4489 C  CZ  . ARG B  1 46  ? 18.596  -9.670  -56.987 1.00 42.10  ? 46   ARG B CZ  1 
ATOM   4490 N  NH1 . ARG B  1 46  ? 19.728  -10.326 -56.780 1.00 37.62  ? 46   ARG B NH1 1 
ATOM   4491 N  NH2 . ARG B  1 46  ? 17.464  -10.344 -57.130 1.00 45.80  ? 46   ARG B NH2 1 
ATOM   4492 N  N   . PHE B  1 47  ? 20.222  -2.653  -56.620 1.00 42.53  ? 47   PHE B N   1 
ATOM   4493 C  CA  . PHE B  1 47  ? 21.118  -1.813  -55.807 1.00 37.30  ? 47   PHE B CA  1 
ATOM   4494 C  C   . PHE B  1 47  ? 21.411  -0.429  -56.401 1.00 43.74  ? 47   PHE B C   1 
ATOM   4495 O  O   . PHE B  1 47  ? 22.154  0.355   -55.807 1.00 49.82  ? 47   PHE B O   1 
ATOM   4496 C  CB  . PHE B  1 47  ? 22.447  -2.522  -55.493 1.00 35.04  ? 47   PHE B CB  1 
ATOM   4497 C  CG  . PHE B  1 47  ? 22.298  -3.970  -55.116 1.00 39.71  ? 47   PHE B CG  1 
ATOM   4498 C  CD1 . PHE B  1 47  ? 21.578  -4.341  -53.986 1.00 37.38  ? 47   PHE B CD1 1 
ATOM   4499 C  CD2 . PHE B  1 47  ? 22.899  -4.961  -55.882 1.00 39.10  ? 47   PHE B CD2 1 
ATOM   4500 C  CE1 . PHE B  1 47  ? 21.447  -5.679  -53.636 1.00 42.91  ? 47   PHE B CE1 1 
ATOM   4501 C  CE2 . PHE B  1 47  ? 22.775  -6.297  -55.539 1.00 38.43  ? 47   PHE B CE2 1 
ATOM   4502 C  CZ  . PHE B  1 47  ? 22.048  -6.658  -54.414 1.00 41.99  ? 47   PHE B CZ  1 
ATOM   4503 N  N   . MET B  1 48  ? 20.834  -0.127  -57.561 1.00 46.39  ? 48   MET B N   1 
ATOM   4504 C  CA  . MET B  1 48  ? 21.127  1.128   -58.256 1.00 47.30  ? 48   MET B CA  1 
ATOM   4505 C  C   . MET B  1 48  ? 20.072  2.203   -57.987 1.00 41.90  ? 48   MET B C   1 
ATOM   4506 O  O   . MET B  1 48  ? 18.927  1.884   -57.656 1.00 38.76  ? 48   MET B O   1 
ATOM   4507 C  CB  . MET B  1 48  ? 21.262  0.888   -59.766 1.00 52.75  ? 48   MET B CB  1 
ATOM   4508 C  CG  . MET B  1 48  ? 22.472  0.058   -60.164 1.00 62.91  ? 48   MET B CG  1 
ATOM   4509 S  SD  . MET B  1 48  ? 24.031  0.914   -59.862 1.00 62.79  ? 48   MET B SD  1 
ATOM   4510 C  CE  . MET B  1 48  ? 23.983  2.151   -61.157 1.00 58.86  ? 48   MET B CE  1 
ATOM   4511 N  N   . PRO B  1 49  ? 20.462  3.485   -58.111 1.00 41.00  ? 49   PRO B N   1 
ATOM   4512 C  CA  . PRO B  1 49  ? 19.493  4.584   -58.016 1.00 41.88  ? 49   PRO B CA  1 
ATOM   4513 C  C   . PRO B  1 49  ? 18.371  4.409   -59.033 1.00 43.02  ? 49   PRO B C   1 
ATOM   4514 O  O   . PRO B  1 49  ? 18.624  3.879   -60.114 1.00 47.81  ? 49   PRO B O   1 
ATOM   4515 C  CB  . PRO B  1 49  ? 20.328  5.813   -58.387 1.00 38.25  ? 49   PRO B CB  1 
ATOM   4516 C  CG  . PRO B  1 49  ? 21.720  5.457   -57.983 1.00 41.68  ? 49   PRO B CG  1 
ATOM   4517 C  CD  . PRO B  1 49  ? 21.848  3.975   -58.240 1.00 41.23  ? 49   PRO B CD  1 
ATOM   4518 N  N   . PRO B  1 50  ? 17.150  4.854   -58.698 1.00 40.96  ? 50   PRO B N   1 
ATOM   4519 C  CA  . PRO B  1 50  ? 16.014  4.686   -59.613 1.00 37.49  ? 50   PRO B CA  1 
ATOM   4520 C  C   . PRO B  1 50  ? 16.069  5.658   -60.792 1.00 44.30  ? 50   PRO B C   1 
ATOM   4521 O  O   . PRO B  1 50  ? 16.619  6.750   -60.652 1.00 45.18  ? 50   PRO B O   1 
ATOM   4522 C  CB  . PRO B  1 50  ? 14.812  5.015   -58.725 1.00 34.30  ? 50   PRO B CB  1 
ATOM   4523 C  CG  . PRO B  1 50  ? 15.350  5.999   -57.727 1.00 33.57  ? 50   PRO B CG  1 
ATOM   4524 C  CD  . PRO B  1 50  ? 16.765  5.552   -57.456 1.00 35.23  ? 50   PRO B CD  1 
ATOM   4525 N  N   . GLU B  1 51  ? 15.512  5.261   -61.934 1.00 43.71  ? 51   GLU B N   1 
ATOM   4526 C  CA  . GLU B  1 51  ? 15.443  6.132   -63.105 1.00 37.66  ? 51   GLU B CA  1 
ATOM   4527 C  C   . GLU B  1 51  ? 13.985  6.481   -63.381 1.00 36.86  ? 51   GLU B C   1 
ATOM   4528 O  O   . GLU B  1 51  ? 13.105  5.650   -63.166 1.00 42.54  ? 51   GLU B O   1 
ATOM   4529 C  CB  . GLU B  1 51  ? 16.049  5.437   -64.330 1.00 48.90  ? 51   GLU B CB  1 
ATOM   4530 C  CG  . GLU B  1 51  ? 17.546  5.164   -64.241 1.00 64.93  ? 51   GLU B CG  1 
ATOM   4531 C  CD  . GLU B  1 51  ? 18.014  4.115   -65.241 1.00 79.30  ? 51   GLU B CD  1 
ATOM   4532 O  OE1 . GLU B  1 51  ? 17.274  3.132   -65.468 1.00 82.71  ? 51   GLU B OE1 1 
ATOM   4533 O  OE2 . GLU B  1 51  ? 19.121  4.272   -65.798 1.00 82.71  ? 51   GLU B OE2 1 
ATOM   4534 N  N   . PRO B  1 52  ? 13.724  7.711   -63.855 1.00 43.70  ? 52   PRO B N   1 
ATOM   4535 C  CA  . PRO B  1 52  ? 12.360  8.149   -64.187 1.00 44.32  ? 52   PRO B CA  1 
ATOM   4536 C  C   . PRO B  1 52  ? 11.649  7.186   -65.144 1.00 47.92  ? 52   PRO B C   1 
ATOM   4537 O  O   . PRO B  1 52  ? 12.265  6.735   -66.113 1.00 38.64  ? 52   PRO B O   1 
ATOM   4538 C  CB  . PRO B  1 52  ? 12.591  9.493   -64.886 1.00 42.03  ? 52   PRO B CB  1 
ATOM   4539 C  CG  . PRO B  1 52  ? 13.877  10.006  -64.302 1.00 50.09  ? 52   PRO B CG  1 
ATOM   4540 C  CD  . PRO B  1 52  ? 14.722  8.778   -64.074 1.00 49.13  ? 52   PRO B CD  1 
ATOM   4541 N  N   . LYS B  1 53  ? 10.381  6.882   -64.875 1.00 46.07  ? 53   LYS B N   1 
ATOM   4542 C  CA  . LYS B  1 53  ? 9.597   5.981   -65.724 1.00 48.32  ? 53   LYS B CA  1 
ATOM   4543 C  C   . LYS B  1 53  ? 9.460   6.518   -67.147 1.00 51.95  ? 53   LYS B C   1 
ATOM   4544 O  O   . LYS B  1 53  ? 9.173   7.700   -67.344 1.00 51.43  ? 53   LYS B O   1 
ATOM   4545 C  CB  . LYS B  1 53  ? 8.205   5.762   -65.120 1.00 46.23  ? 53   LYS B CB  1 
ATOM   4546 C  CG  . LYS B  1 53  ? 7.222   5.029   -66.034 1.00 47.68  ? 53   LYS B CG  1 
ATOM   4547 C  CD  . LYS B  1 53  ? 7.609   3.570   -66.219 1.00 44.61  ? 53   LYS B CD  1 
ATOM   4548 C  CE  . LYS B  1 53  ? 6.576   2.809   -67.044 1.00 40.88  ? 53   LYS B CE  1 
ATOM   4549 N  NZ  . LYS B  1 53  ? 6.550   3.222   -68.473 1.00 41.30  ? 53   LYS B NZ  1 
ATOM   4550 N  N   . ARG B  1 54  ? 9.670   5.651   -68.134 1.00 52.42  ? 54   ARG B N   1 
ATOM   4551 C  CA  . ARG B  1 54  ? 9.488   6.031   -69.534 1.00 45.08  ? 54   ARG B CA  1 
ATOM   4552 C  C   . ARG B  1 54  ? 8.003   6.177   -69.860 1.00 41.57  ? 54   ARG B C   1 
ATOM   4553 O  O   . ARG B  1 54  ? 7.173   5.438   -69.328 1.00 39.04  ? 54   ARG B O   1 
ATOM   4554 C  CB  . ARG B  1 54  ? 10.127  4.993   -70.466 1.00 41.51  ? 54   ARG B CB  1 
ATOM   4555 C  CG  . ARG B  1 54  ? 11.648  4.943   -70.403 1.00 46.56  ? 54   ARG B CG  1 
ATOM   4556 C  CD  . ARG B  1 54  ? 12.215  3.826   -71.276 1.00 39.83  ? 54   ARG B CD  1 
ATOM   4557 N  NE  . ARG B  1 54  ? 11.651  2.524   -70.919 1.00 48.62  ? 54   ARG B NE  1 
ATOM   4558 C  CZ  . ARG B  1 54  ? 10.825  1.825   -71.693 1.00 58.96  ? 54   ARG B CZ  1 
ATOM   4559 N  NH1 . ARG B  1 54  ? 10.472  2.288   -72.885 1.00 60.94  ? 54   ARG B NH1 1 
ATOM   4560 N  NH2 . ARG B  1 54  ? 10.357  0.657   -71.280 1.00 58.06  ? 54   ARG B NH2 1 
ATOM   4561 N  N   . PRO B  1 55  ? 7.664   7.142   -70.730 1.00 47.57  ? 55   PRO B N   1 
ATOM   4562 C  CA  . PRO B  1 55  ? 6.288   7.346   -71.202 1.00 52.95  ? 55   PRO B CA  1 
ATOM   4563 C  C   . PRO B  1 55  ? 5.637   6.062   -71.725 1.00 46.13  ? 55   PRO B C   1 
ATOM   4564 O  O   . PRO B  1 55  ? 6.343   5.132   -72.124 1.00 42.23  ? 55   PRO B O   1 
ATOM   4565 C  CB  . PRO B  1 55  ? 6.465   8.334   -72.356 1.00 57.08  ? 55   PRO B CB  1 
ATOM   4566 C  CG  . PRO B  1 55  ? 7.686   9.113   -71.994 1.00 59.49  ? 55   PRO B CG  1 
ATOM   4567 C  CD  . PRO B  1 55  ? 8.595   8.148   -71.278 1.00 51.47  ? 55   PRO B CD  1 
ATOM   4568 N  N   . TRP B  1 56  ? 4.306   6.023   -71.718 1.00 40.87  ? 56   TRP B N   1 
ATOM   4569 C  CA  . TRP B  1 56  ? 3.553   4.860   -72.195 1.00 43.11  ? 56   TRP B CA  1 
ATOM   4570 C  C   . TRP B  1 56  ? 2.482   5.266   -73.209 1.00 51.62  ? 56   TRP B C   1 
ATOM   4571 O  O   . TRP B  1 56  ? 2.082   6.429   -73.266 1.00 50.97  ? 56   TRP B O   1 
ATOM   4572 C  CB  . TRP B  1 56  ? 2.900   4.120   -71.022 1.00 38.89  ? 56   TRP B CB  1 
ATOM   4573 C  CG  . TRP B  1 56  ? 2.017   4.988   -70.185 1.00 45.05  ? 56   TRP B CG  1 
ATOM   4574 C  CD1 . TRP B  1 56  ? 0.699   5.275   -70.399 1.00 49.03  ? 56   TRP B CD1 1 
ATOM   4575 C  CD2 . TRP B  1 56  ? 2.391   5.682   -68.991 1.00 49.30  ? 56   TRP B CD2 1 
ATOM   4576 N  NE1 . TRP B  1 56  ? 0.232   6.111   -69.410 1.00 51.89  ? 56   TRP B NE1 1 
ATOM   4577 C  CE2 . TRP B  1 56  ? 1.252   6.374   -68.534 1.00 53.07  ? 56   TRP B CE2 1 
ATOM   4578 C  CE3 . TRP B  1 56  ? 3.579   5.785   -68.264 1.00 45.72  ? 56   TRP B CE3 1 
ATOM   4579 C  CZ2 . TRP B  1 56  ? 1.270   7.159   -67.379 1.00 51.94  ? 56   TRP B CZ2 1 
ATOM   4580 C  CZ3 . TRP B  1 56  ? 3.597   6.566   -67.122 1.00 50.09  ? 56   TRP B CZ3 1 
ATOM   4581 C  CH2 . TRP B  1 56  ? 2.451   7.242   -66.690 1.00 50.91  ? 56   TRP B CH2 1 
ATOM   4582 N  N   . SER B  1 57  ? 2.020   4.304   -74.006 1.00 52.70  ? 57   SER B N   1 
ATOM   4583 C  CA  . SER B  1 57  ? 0.977   4.558   -75.001 1.00 53.62  ? 57   SER B CA  1 
ATOM   4584 C  C   . SER B  1 57  ? -0.402  4.175   -74.466 1.00 57.69  ? 57   SER B C   1 
ATOM   4585 O  O   . SER B  1 57  ? -0.514  3.317   -73.596 1.00 64.21  ? 57   SER B O   1 
ATOM   4586 C  CB  . SER B  1 57  ? 1.259   3.772   -76.281 1.00 50.19  ? 57   SER B CB  1 
ATOM   4587 O  OG  . SER B  1 57  ? 1.140   2.377   -76.060 1.00 48.11  ? 57   SER B OG  1 
ATOM   4588 N  N   . GLY B  1 58  ? -1.449  4.809   -74.984 1.00 51.78  ? 58   GLY B N   1 
ATOM   4589 C  CA  . GLY B  1 58  ? -2.808  4.470   -74.592 1.00 49.54  ? 58   GLY B CA  1 
ATOM   4590 C  C   . GLY B  1 58  ? -3.166  4.862   -73.169 1.00 56.28  ? 58   GLY B C   1 
ATOM   4591 O  O   . GLY B  1 58  ? -2.591  5.796   -72.608 1.00 48.90  ? 58   GLY B O   1 
ATOM   4592 N  N   . VAL B  1 59  ? -4.124  4.149   -72.583 1.00 57.16  ? 59   VAL B N   1 
ATOM   4593 C  CA  . VAL B  1 59  ? -4.560  4.441   -71.220 1.00 51.71  ? 59   VAL B CA  1 
ATOM   4594 C  C   . VAL B  1 59  ? -4.057  3.386   -70.232 1.00 48.19  ? 59   VAL B C   1 
ATOM   4595 O  O   . VAL B  1 59  ? -4.406  2.206   -70.335 1.00 37.45  ? 59   VAL B O   1 
ATOM   4596 C  CB  . VAL B  1 59  ? -6.097  4.559   -71.132 1.00 50.31  ? 59   VAL B CB  1 
ATOM   4597 C  CG1 . VAL B  1 59  ? -6.517  5.008   -69.743 1.00 39.46  ? 59   VAL B CG1 1 
ATOM   4598 C  CG2 . VAL B  1 59  ? -6.609  5.539   -72.173 1.00 43.28  ? 59   VAL B CG2 1 
ATOM   4599 N  N   . LEU B  1 60  ? -3.238  3.815   -69.275 1.00 50.90  ? 60   LEU B N   1 
ATOM   4600 C  CA  . LEU B  1 60  ? -2.689  2.904   -68.269 1.00 47.63  ? 60   LEU B CA  1 
ATOM   4601 C  C   . LEU B  1 60  ? -3.711  2.568   -67.182 1.00 47.38  ? 60   LEU B C   1 
ATOM   4602 O  O   . LEU B  1 60  ? -4.269  3.462   -66.543 1.00 51.60  ? 60   LEU B O   1 
ATOM   4603 C  CB  . LEU B  1 60  ? -1.417  3.492   -67.645 1.00 52.60  ? 60   LEU B CB  1 
ATOM   4604 C  CG  . LEU B  1 60  ? -0.628  2.586   -66.699 1.00 58.00  ? 60   LEU B CG  1 
ATOM   4605 C  CD1 . LEU B  1 60  ? -0.394  1.245   -67.355 1.00 62.08  ? 60   LEU B CD1 1 
ATOM   4606 C  CD2 . LEU B  1 60  ? 0.698   3.219   -66.319 1.00 55.41  ? 60   LEU B CD2 1 
ATOM   4607 N  N   . ASP B  1 61  ? -3.958  1.275   -66.985 1.00 46.74  ? 61   ASP B N   1 
ATOM   4608 C  CA  . ASP B  1 61  ? -4.875  0.813   -65.945 1.00 53.89  ? 61   ASP B CA  1 
ATOM   4609 C  C   . ASP B  1 61  ? -4.317  1.117   -64.558 1.00 53.71  ? 61   ASP B C   1 
ATOM   4610 O  O   . ASP B  1 61  ? -3.360  0.480   -64.119 1.00 54.73  ? 61   ASP B O   1 
ATOM   4611 C  CB  . ASP B  1 61  ? -5.127  -0.692  -66.085 1.00 63.84  ? 61   ASP B CB  1 
ATOM   4612 C  CG  . ASP B  1 61  ? -6.060  -1.230  -65.015 1.00 77.20  ? 61   ASP B CG  1 
ATOM   4613 O  OD1 . ASP B  1 61  ? -7.033  -0.528  -64.665 1.00 81.43  ? 61   ASP B OD1 1 
ATOM   4614 O  OD2 . ASP B  1 61  ? -5.821  -2.353  -64.522 1.00 83.47  ? 61   ASP B OD2 1 
ATOM   4615 N  N   . ALA B  1 62  ? -4.912  2.093   -63.875 1.00 51.73  ? 62   ALA B N   1 
ATOM   4616 C  CA  . ALA B  1 62  ? -4.498  2.446   -62.516 1.00 52.82  ? 62   ALA B CA  1 
ATOM   4617 C  C   . ALA B  1 62  ? -5.636  2.237   -61.519 1.00 48.33  ? 62   ALA B C   1 
ATOM   4618 O  O   . ALA B  1 62  ? -5.968  3.136   -60.743 1.00 38.99  ? 62   ALA B O   1 
ATOM   4619 C  CB  . ALA B  1 62  ? -4.000  3.886   -62.464 1.00 48.96  ? 62   ALA B CB  1 
ATOM   4620 N  N   . THR B  1 63  ? -6.217  1.040   -61.540 1.00 46.44  ? 63   THR B N   1 
ATOM   4621 C  CA  . THR B  1 63  ? -7.389  0.721   -60.729 1.00 47.41  ? 63   THR B CA  1 
ATOM   4622 C  C   . THR B  1 63  ? -7.094  -0.348  -59.678 1.00 55.27  ? 63   THR B C   1 
ATOM   4623 O  O   . THR B  1 63  ? -7.988  -0.752  -58.932 1.00 56.99  ? 63   THR B O   1 
ATOM   4624 C  CB  . THR B  1 63  ? -8.556  0.221   -61.609 1.00 52.53  ? 63   THR B CB  1 
ATOM   4625 O  OG1 . THR B  1 63  ? -8.218  -1.044  -62.196 1.00 46.80  ? 63   THR B OG1 1 
ATOM   4626 C  CG2 . THR B  1 63  ? -8.869  1.226   -62.709 1.00 45.82  ? 63   THR B CG2 1 
ATOM   4627 N  N   . THR B  1 64  ? -5.845  -0.808  -59.623 1.00 54.57  ? 64   THR B N   1 
ATOM   4628 C  CA  . THR B  1 64  ? -5.460  -1.855  -58.676 1.00 49.38  ? 64   THR B CA  1 
ATOM   4629 C  C   . THR B  1 64  ? -4.061  -1.642  -58.098 1.00 48.03  ? 64   THR B C   1 
ATOM   4630 O  O   . THR B  1 64  ? -3.207  -1.014  -58.729 1.00 43.11  ? 64   THR B O   1 
ATOM   4631 C  CB  . THR B  1 64  ? -5.537  -3.257  -59.322 1.00 55.54  ? 64   THR B CB  1 
ATOM   4632 O  OG1 . THR B  1 64  ? -5.384  -4.262  -58.313 1.00 76.63  ? 64   THR B OG1 1 
ATOM   4633 C  CG2 . THR B  1 64  ? -4.448  -3.426  -60.367 1.00 46.87  ? 64   THR B CG2 1 
ATOM   4634 N  N   . PHE B  1 65  ? -3.834  -2.161  -56.892 1.00 47.52  ? 65   PHE B N   1 
ATOM   4635 C  CA  . PHE B  1 65  ? -2.520  -2.074  -56.257 1.00 44.82  ? 65   PHE B CA  1 
ATOM   4636 C  C   . PHE B  1 65  ? -1.496  -2.903  -57.013 1.00 43.56  ? 65   PHE B C   1 
ATOM   4637 O  O   . PHE B  1 65  ? -1.785  -4.024  -57.433 1.00 42.73  ? 65   PHE B O   1 
ATOM   4638 C  CB  . PHE B  1 65  ? -2.582  -2.543  -54.800 1.00 41.80  ? 65   PHE B CB  1 
ATOM   4639 C  CG  . PHE B  1 65  ? -3.173  -1.530  -53.862 1.00 42.51  ? 65   PHE B CG  1 
ATOM   4640 C  CD1 . PHE B  1 65  ? -2.556  -0.300  -53.674 1.00 41.51  ? 65   PHE B CD1 1 
ATOM   4641 C  CD2 . PHE B  1 65  ? -4.337  -1.809  -53.159 1.00 45.17  ? 65   PHE B CD2 1 
ATOM   4642 C  CE1 . PHE B  1 65  ? -3.095  0.640   -52.811 1.00 46.20  ? 65   PHE B CE1 1 
ATOM   4643 C  CE2 . PHE B  1 65  ? -4.884  -0.876  -52.295 1.00 38.14  ? 65   PHE B CE2 1 
ATOM   4644 C  CZ  . PHE B  1 65  ? -4.261  0.351   -52.121 1.00 45.63  ? 65   PHE B CZ  1 
ATOM   4645 N  N   . GLN B  1 66  ? -0.300  -2.350  -57.184 1.00 44.48  ? 66   GLN B N   1 
ATOM   4646 C  CA  . GLN B  1 66  ? 0.786   -3.081  -57.826 1.00 51.36  ? 66   GLN B CA  1 
ATOM   4647 C  C   . GLN B  1 66  ? 1.483   -4.001  -56.835 1.00 53.56  ? 66   GLN B C   1 
ATOM   4648 O  O   . GLN B  1 66  ? 1.043   -4.141  -55.694 1.00 48.64  ? 66   GLN B O   1 
ATOM   4649 C  CB  . GLN B  1 66  ? 1.787   -2.116  -58.456 1.00 51.15  ? 66   GLN B CB  1 
ATOM   4650 C  CG  . GLN B  1 66  ? 1.496   -1.810  -59.912 1.00 57.75  ? 66   GLN B CG  1 
ATOM   4651 C  CD  . GLN B  1 66  ? 1.688   -3.018  -60.806 1.00 70.66  ? 66   GLN B CD  1 
ATOM   4652 O  OE1 . GLN B  1 66  ? 2.557   -3.854  -60.561 1.00 74.74  ? 66   GLN B OE1 1 
ATOM   4653 N  NE2 . GLN B  1 66  ? 0.870   -3.121  -61.846 1.00 73.34  ? 66   GLN B NE2 1 
ATOM   4654 N  N   . ASN B  1 67  ? 2.570   -4.628  -57.271 1.00 49.46  ? 67   ASN B N   1 
ATOM   4655 C  CA  . ASN B  1 67  ? 3.266   -5.597  -56.433 1.00 48.23  ? 67   ASN B CA  1 
ATOM   4656 C  C   . ASN B  1 67  ? 3.998   -4.978  -55.245 1.00 47.82  ? 67   ASN B C   1 
ATOM   4657 O  O   . ASN B  1 67  ? 4.320   -3.788  -55.245 1.00 49.83  ? 67   ASN B O   1 
ATOM   4658 C  CB  . ASN B  1 67  ? 4.231   -6.435  -57.273 1.00 48.39  ? 67   ASN B CB  1 
ATOM   4659 C  CG  . ASN B  1 67  ? 3.511   -7.378  -58.218 1.00 56.49  ? 67   ASN B CG  1 
ATOM   4660 O  OD1 . ASN B  1 67  ? 2.408   -7.843  -57.929 1.00 58.51  ? 67   ASN B OD1 1 
ATOM   4661 N  ND2 . ASN B  1 67  ? 4.134   -7.668  -59.353 1.00 54.37  ? 67   ASN B ND2 1 
ATOM   4662 N  N   . VAL B  1 68  ? 4.249   -5.804  -54.233 1.00 40.63  ? 68   VAL B N   1 
ATOM   4663 C  CA  . VAL B  1 68  ? 4.967   -5.385  -53.036 1.00 38.98  ? 68   VAL B CA  1 
ATOM   4664 C  C   . VAL B  1 68  ? 6.459   -5.595  -53.250 1.00 39.77  ? 68   VAL B C   1 
ATOM   4665 O  O   . VAL B  1 68  ? 6.869   -6.643  -53.754 1.00 40.69  ? 68   VAL B O   1 
ATOM   4666 C  CB  . VAL B  1 68  ? 4.492   -6.190  -51.807 1.00 46.51  ? 68   VAL B CB  1 
ATOM   4667 C  CG1 . VAL B  1 68  ? 5.334   -5.873  -50.575 1.00 46.76  ? 68   VAL B CG1 1 
ATOM   4668 C  CG2 . VAL B  1 68  ? 3.028   -5.904  -51.536 1.00 45.82  ? 68   VAL B CG2 1 
ATOM   4669 N  N   . CYS B  1 69  ? 7.263   -4.593  -52.895 1.00 35.43  ? 69   CYS B N   1 
ATOM   4670 C  CA  . CYS B  1 69  ? 8.720   -4.702  -52.983 1.00 32.19  ? 69   CYS B CA  1 
ATOM   4671 C  C   . CYS B  1 69  ? 9.214   -5.957  -52.276 1.00 42.11  ? 69   CYS B C   1 
ATOM   4672 O  O   . CYS B  1 69  ? 8.727   -6.292  -51.193 1.00 43.53  ? 69   CYS B O   1 
ATOM   4673 C  CB  . CYS B  1 69  ? 9.389   -3.461  -52.383 1.00 33.58  ? 69   CYS B CB  1 
ATOM   4674 S  SG  . CYS B  1 69  ? 9.317   -1.982  -53.434 1.00 48.30  ? 69   CYS B SG  1 
ATOM   4675 N  N   . TYR B  1 70  ? 10.162  -6.660  -52.892 1.00 44.70  ? 70   TYR B N   1 
ATOM   4676 C  CA  . TYR B  1 70  ? 10.611  -7.935  -52.341 1.00 46.43  ? 70   TYR B CA  1 
ATOM   4677 C  C   . TYR B  1 70  ? 11.189  -7.764  -50.945 1.00 42.46  ? 70   TYR B C   1 
ATOM   4678 O  O   . TYR B  1 70  ? 12.087  -6.951  -50.721 1.00 47.07  ? 70   TYR B O   1 
ATOM   4679 C  CB  . TYR B  1 70  ? 11.606  -8.648  -53.260 1.00 39.93  ? 70   TYR B CB  1 
ATOM   4680 C  CG  . TYR B  1 70  ? 11.520  -10.148 -53.103 1.00 48.81  ? 70   TYR B CG  1 
ATOM   4681 C  CD1 . TYR B  1 70  ? 12.273  -10.813 -52.144 1.00 47.64  ? 70   TYR B CD1 1 
ATOM   4682 C  CD2 . TYR B  1 70  ? 10.652  -10.893 -53.886 1.00 52.76  ? 70   TYR B CD2 1 
ATOM   4683 C  CE1 . TYR B  1 70  ? 12.178  -12.184 -51.988 1.00 47.57  ? 70   TYR B CE1 1 
ATOM   4684 C  CE2 . TYR B  1 70  ? 10.549  -12.258 -53.738 1.00 51.77  ? 70   TYR B CE2 1 
ATOM   4685 C  CZ  . TYR B  1 70  ? 11.312  -12.899 -52.790 1.00 50.53  ? 70   TYR B CZ  1 
ATOM   4686 O  OH  . TYR B  1 70  ? 11.201  -14.263 -52.650 1.00 47.66  ? 70   TYR B OH  1 
ATOM   4687 N  N   . GLN B  1 71  ? 10.654  -8.534  -50.006 1.00 42.92  ? 71   GLN B N   1 
ATOM   4688 C  CA  . GLN B  1 71  ? 10.996  -8.355  -48.606 1.00 42.19  ? 71   GLN B CA  1 
ATOM   4689 C  C   . GLN B  1 71  ? 10.791  -9.631  -47.801 1.00 45.80  ? 71   GLN B C   1 
ATOM   4690 O  O   . GLN B  1 71  ? 10.148  -10.577 -48.259 1.00 42.94  ? 71   GLN B O   1 
ATOM   4691 C  CB  . GLN B  1 71  ? 10.140  -7.236  -48.012 1.00 33.80  ? 71   GLN B CB  1 
ATOM   4692 C  CG  . GLN B  1 71  ? 8.659   -7.585  -47.912 1.00 32.61  ? 71   GLN B CG  1 
ATOM   4693 C  CD  . GLN B  1 71  ? 7.805   -6.392  -47.529 1.00 48.04  ? 71   GLN B CD  1 
ATOM   4694 O  OE1 . GLN B  1 71  ? 7.012   -6.452  -46.587 1.00 47.94  ? 71   GLN B OE1 1 
ATOM   4695 N  NE2 . GLN B  1 71  ? 7.959   -5.299  -48.266 1.00 49.54  ? 71   GLN B NE2 1 
ATOM   4696 N  N   . TYR B  1 72  ? 11.353  -9.643  -46.597 1.00 49.71  ? 72   TYR B N   1 
ATOM   4697 C  CA  . TYR B  1 72  ? 11.135  -10.717 -45.643 1.00 46.36  ? 72   TYR B CA  1 
ATOM   4698 C  C   . TYR B  1 72  ? 9.671   -10.737 -45.208 1.00 45.80  ? 72   TYR B C   1 
ATOM   4699 O  O   . TYR B  1 72  ? 9.045   -9.685  -45.080 1.00 47.81  ? 72   TYR B O   1 
ATOM   4700 C  CB  . TYR B  1 72  ? 12.048  -10.510 -44.431 1.00 47.25  ? 72   TYR B CB  1 
ATOM   4701 C  CG  . TYR B  1 72  ? 11.778  -11.436 -43.272 1.00 55.68  ? 72   TYR B CG  1 
ATOM   4702 C  CD1 . TYR B  1 72  ? 12.287  -12.729 -43.256 1.00 54.76  ? 72   TYR B CD1 1 
ATOM   4703 C  CD2 . TYR B  1 72  ? 11.021  -11.015 -42.187 1.00 54.39  ? 72   TYR B CD2 1 
ATOM   4704 C  CE1 . TYR B  1 72  ? 12.042  -13.576 -42.193 1.00 62.15  ? 72   TYR B CE1 1 
ATOM   4705 C  CE2 . TYR B  1 72  ? 10.771  -11.855 -41.124 1.00 53.49  ? 72   TYR B CE2 1 
ATOM   4706 C  CZ  . TYR B  1 72  ? 11.285  -13.132 -41.129 1.00 61.27  ? 72   TYR B CZ  1 
ATOM   4707 O  OH  . TYR B  1 72  ? 11.036  -13.970 -40.066 1.00 64.74  ? 72   TYR B OH  1 
ATOM   4708 N  N   . VAL B  1 73  ? 9.129   -11.934 -45.000 1.00 46.18  ? 73   VAL B N   1 
ATOM   4709 C  CA  . VAL B  1 73  ? 7.751   -12.090 -44.538 1.00 49.48  ? 73   VAL B CA  1 
ATOM   4710 C  C   . VAL B  1 73  ? 7.705   -12.739 -43.151 1.00 52.74  ? 73   VAL B C   1 
ATOM   4711 O  O   . VAL B  1 73  ? 8.260   -13.820 -42.943 1.00 47.43  ? 73   VAL B O   1 
ATOM   4712 C  CB  . VAL B  1 73  ? 6.904   -12.905 -45.542 1.00 56.79  ? 73   VAL B CB  1 
ATOM   4713 C  CG1 . VAL B  1 73  ? 5.589   -13.325 -44.915 1.00 62.64  ? 73   VAL B CG1 1 
ATOM   4714 C  CG2 . VAL B  1 73  ? 6.648   -12.092 -46.793 1.00 52.76  ? 73   VAL B CG2 1 
ATOM   4715 N  N   . ASP B  1 74  ? 7.043   -12.070 -42.210 1.00 61.43  ? 74   ASP B N   1 
ATOM   4716 C  CA  . ASP B  1 74  ? 7.016   -12.503 -40.811 1.00 53.03  ? 74   ASP B CA  1 
ATOM   4717 C  C   . ASP B  1 74  ? 6.221   -13.794 -40.591 1.00 54.29  ? 74   ASP B C   1 
ATOM   4718 O  O   . ASP B  1 74  ? 5.086   -13.926 -41.056 1.00 56.38  ? 74   ASP B O   1 
ATOM   4719 C  CB  . ASP B  1 74  ? 6.467   -11.380 -39.926 1.00 61.52  ? 74   ASP B CB  1 
ATOM   4720 C  CG  . ASP B  1 74  ? 6.678   -11.639 -38.448 1.00 61.71  ? 74   ASP B CG  1 
ATOM   4721 O  OD1 . ASP B  1 74  ? 7.589   -12.417 -38.091 1.00 62.69  ? 74   ASP B OD1 1 
ATOM   4722 O  OD2 . ASP B  1 74  ? 5.933   -11.049 -37.638 1.00 66.97  ? 74   ASP B OD2 1 
ATOM   4723 N  N   . THR B  1 75  ? 6.830   -14.734 -39.870 1.00 57.15  ? 75   THR B N   1 
ATOM   4724 C  CA  . THR B  1 75  ? 6.251   -16.057 -39.645 1.00 60.74  ? 75   THR B CA  1 
ATOM   4725 C  C   . THR B  1 75  ? 6.168   -16.429 -38.166 1.00 61.77  ? 75   THR B C   1 
ATOM   4726 O  O   . THR B  1 75  ? 5.898   -17.584 -37.833 1.00 62.04  ? 75   THR B O   1 
ATOM   4727 C  CB  . THR B  1 75  ? 7.062   -17.153 -40.371 1.00 64.10  ? 75   THR B CB  1 
ATOM   4728 O  OG1 . THR B  1 75  ? 8.465   -16.876 -40.250 1.00 65.77  ? 75   THR B OG1 1 
ATOM   4729 C  CG2 . THR B  1 75  ? 6.688   -17.213 -41.843 1.00 61.01  ? 75   THR B CG2 1 
ATOM   4730 N  N   . LEU B  1 76  ? 6.400   -15.455 -37.287 1.00 65.91  ? 76   LEU B N   1 
ATOM   4731 C  CA  . LEU B  1 76  ? 6.408   -15.702 -35.843 1.00 65.94  ? 76   LEU B CA  1 
ATOM   4732 C  C   . LEU B  1 76  ? 5.067   -16.237 -35.344 1.00 70.06  ? 76   LEU B C   1 
ATOM   4733 O  O   . LEU B  1 76  ? 5.020   -17.224 -34.606 1.00 73.49  ? 76   LEU B O   1 
ATOM   4734 C  CB  . LEU B  1 76  ? 6.795   -14.434 -35.069 1.00 61.60  ? 76   LEU B CB  1 
ATOM   4735 C  CG  . LEU B  1 76  ? 7.051   -14.624 -33.566 1.00 63.96  ? 76   LEU B CG  1 
ATOM   4736 C  CD1 . LEU B  1 76  ? 8.231   -15.553 -33.338 1.00 64.96  ? 76   LEU B CD1 1 
ATOM   4737 C  CD2 . LEU B  1 76  ? 7.281   -13.300 -32.852 1.00 54.18  ? 76   LEU B CD2 1 
ATOM   4738 N  N   . TYR B  1 77  ? 3.983   -15.581 -35.748 1.00 61.37  ? 77   TYR B N   1 
ATOM   4739 C  CA  . TYR B  1 77  ? 2.640   -16.035 -35.403 1.00 60.28  ? 77   TYR B CA  1 
ATOM   4740 C  C   . TYR B  1 77  ? 1.782   -16.196 -36.661 1.00 66.72  ? 77   TYR B C   1 
ATOM   4741 O  O   . TYR B  1 77  ? 1.017   -15.297 -37.018 1.00 69.22  ? 77   TYR B O   1 
ATOM   4742 C  CB  . TYR B  1 77  ? 1.985   -15.067 -34.411 1.00 60.47  ? 77   TYR B CB  1 
ATOM   4743 C  CG  . TYR B  1 77  ? 2.714   -14.950 -33.084 1.00 63.08  ? 77   TYR B CG  1 
ATOM   4744 C  CD1 . TYR B  1 77  ? 2.676   -15.981 -32.156 1.00 65.68  ? 77   TYR B CD1 1 
ATOM   4745 C  CD2 . TYR B  1 77  ? 3.429   -13.803 -32.758 1.00 56.90  ? 77   TYR B CD2 1 
ATOM   4746 C  CE1 . TYR B  1 77  ? 3.336   -15.879 -30.943 1.00 69.18  ? 77   TYR B CE1 1 
ATOM   4747 C  CE2 . TYR B  1 77  ? 4.090   -13.692 -31.548 1.00 62.74  ? 77   TYR B CE2 1 
ATOM   4748 C  CZ  . TYR B  1 77  ? 4.041   -14.735 -30.644 1.00 68.13  ? 77   TYR B CZ  1 
ATOM   4749 O  OH  . TYR B  1 77  ? 4.696   -14.636 -29.436 1.00 63.95  ? 77   TYR B OH  1 
ATOM   4750 N  N   . PRO B  1 78  ? 1.914   -17.350 -37.339 1.00 65.16  ? 78   PRO B N   1 
ATOM   4751 C  CA  . PRO B  1 78  ? 1.220   -17.617 -38.607 1.00 63.08  ? 78   PRO B CA  1 
ATOM   4752 C  C   . PRO B  1 78  ? -0.302  -17.587 -38.470 1.00 65.52  ? 78   PRO B C   1 
ATOM   4753 O  O   . PRO B  1 78  ? -0.863  -18.298 -37.635 1.00 65.41  ? 78   PRO B O   1 
ATOM   4754 C  CB  . PRO B  1 78  ? 1.695   -19.031 -38.979 1.00 53.14  ? 78   PRO B CB  1 
ATOM   4755 C  CG  . PRO B  1 78  ? 2.992   -19.206 -38.247 1.00 63.09  ? 78   PRO B CG  1 
ATOM   4756 C  CD  . PRO B  1 78  ? 2.801   -18.463 -36.953 1.00 64.54  ? 78   PRO B CD  1 
ATOM   4757 N  N   . GLY B  1 79  ? -0.960  -16.768 -39.285 1.00 62.65  ? 79   GLY B N   1 
ATOM   4758 C  CA  . GLY B  1 79  ? -2.407  -16.649 -39.234 1.00 62.63  ? 79   GLY B CA  1 
ATOM   4759 C  C   . GLY B  1 79  ? -2.918  -15.634 -38.226 1.00 64.32  ? 79   GLY B C   1 
ATOM   4760 O  O   . GLY B  1 79  ? -4.106  -15.307 -38.222 1.00 65.36  ? 79   GLY B O   1 
ATOM   4761 N  N   . PHE B  1 80  ? -2.027  -15.139 -37.370 1.00 58.69  ? 80   PHE B N   1 
ATOM   4762 C  CA  . PHE B  1 80  ? -2.398  -14.144 -36.365 1.00 53.52  ? 80   PHE B CA  1 
ATOM   4763 C  C   . PHE B  1 80  ? -2.521  -12.757 -36.985 1.00 51.43  ? 80   PHE B C   1 
ATOM   4764 O  O   . PHE B  1 80  ? -1.553  -12.209 -37.514 1.00 52.01  ? 80   PHE B O   1 
ATOM   4765 C  CB  . PHE B  1 80  ? -1.391  -14.138 -35.211 1.00 51.07  ? 80   PHE B CB  1 
ATOM   4766 C  CG  . PHE B  1 80  ? -1.635  -13.062 -34.192 1.00 56.07  ? 80   PHE B CG  1 
ATOM   4767 C  CD1 . PHE B  1 80  ? -2.857  -12.967 -33.540 1.00 59.38  ? 80   PHE B CD1 1 
ATOM   4768 C  CD2 . PHE B  1 80  ? -0.635  -12.155 -33.874 1.00 58.82  ? 80   PHE B CD2 1 
ATOM   4769 C  CE1 . PHE B  1 80  ? -3.081  -11.978 -32.595 1.00 57.09  ? 80   PHE B CE1 1 
ATOM   4770 C  CE2 . PHE B  1 80  ? -0.849  -11.165 -32.930 1.00 60.13  ? 80   PHE B CE2 1 
ATOM   4771 C  CZ  . PHE B  1 80  ? -2.074  -11.075 -32.289 1.00 56.17  ? 80   PHE B CZ  1 
ATOM   4772 N  N   . GLU B  1 81  ? -3.721  -12.195 -36.898 1.00 52.90  ? 81   GLU B N   1 
ATOM   4773 C  CA  . GLU B  1 81  ? -4.063  -10.940 -37.562 1.00 58.30  ? 81   GLU B CA  1 
ATOM   4774 C  C   . GLU B  1 81  ? -3.275  -9.729  -37.071 1.00 64.51  ? 81   GLU B C   1 
ATOM   4775 O  O   . GLU B  1 81  ? -3.293  -8.681  -37.712 1.00 70.33  ? 81   GLU B O   1 
ATOM   4776 C  CB  . GLU B  1 81  ? -5.571  -10.676 -37.449 1.00 68.92  ? 81   GLU B CB  1 
ATOM   4777 C  CG  . GLU B  1 81  ? -6.122  -10.667 -36.024 1.00 89.90  ? 81   GLU B CG  1 
ATOM   4778 C  CD  . GLU B  1 81  ? -6.312  -12.059 -35.425 1.00 104.24 ? 81   GLU B CD  1 
ATOM   4779 O  OE1 . GLU B  1 81  ? -5.855  -13.052 -36.033 1.00 109.26 ? 81   GLU B OE1 1 
ATOM   4780 O  OE2 . GLU B  1 81  ? -6.920  -12.159 -34.336 1.00 105.39 ? 81   GLU B OE2 1 
ATOM   4781 N  N   . GLY B  1 82  ? -2.586  -9.869  -35.942 1.00 64.76  ? 82   GLY B N   1 
ATOM   4782 C  CA  . GLY B  1 82  ? -1.776  -8.784  -35.417 1.00 56.71  ? 82   GLY B CA  1 
ATOM   4783 C  C   . GLY B  1 82  ? -0.426  -8.660  -36.103 1.00 49.28  ? 82   GLY B C   1 
ATOM   4784 O  O   . GLY B  1 82  ? 0.194   -7.596  -36.077 1.00 45.61  ? 82   GLY B O   1 
ATOM   4785 N  N   . THR B  1 83  ? 0.032   -9.751  -36.711 1.00 47.53  ? 83   THR B N   1 
ATOM   4786 C  CA  . THR B  1 83  ? 1.295   -9.757  -37.449 1.00 50.55  ? 83   THR B CA  1 
ATOM   4787 C  C   . THR B  1 83  ? 1.055   -9.736  -38.958 1.00 51.95  ? 83   THR B C   1 
ATOM   4788 O  O   . THR B  1 83  ? 1.787   -9.087  -39.710 1.00 47.24  ? 83   THR B O   1 
ATOM   4789 C  CB  . THR B  1 83  ? 2.158   -10.986 -37.089 1.00 53.34  ? 83   THR B CB  1 
ATOM   4790 O  OG1 . THR B  1 83  ? 1.332   -12.156 -37.024 1.00 61.28  ? 83   THR B OG1 1 
ATOM   4791 C  CG2 . THR B  1 83  ? 2.843   -10.786 -35.752 1.00 45.89  ? 83   THR B CG2 1 
ATOM   4792 N  N   . GLU B  1 84  ? 0.017   -10.446 -39.388 1.00 54.26  ? 84   GLU B N   1 
ATOM   4793 C  CA  . GLU B  1 84  ? -0.332  -10.546 -40.800 1.00 54.84  ? 84   GLU B CA  1 
ATOM   4794 C  C   . GLU B  1 84  ? -0.790  -9.210  -41.379 1.00 55.54  ? 84   GLU B C   1 
ATOM   4795 O  O   . GLU B  1 84  ? -0.700  -8.990  -42.587 1.00 54.94  ? 84   GLU B O   1 
ATOM   4796 C  CB  . GLU B  1 84  ? -1.427  -11.601 -41.000 1.00 58.21  ? 84   GLU B CB  1 
ATOM   4797 C  CG  . GLU B  1 84  ? -1.080  -13.001 -40.494 1.00 65.60  ? 84   GLU B CG  1 
ATOM   4798 C  CD  . GLU B  1 84  ? -0.085  -13.729 -41.378 1.00 72.16  ? 84   GLU B CD  1 
ATOM   4799 O  OE1 . GLU B  1 84  ? 0.339   -13.160 -42.407 1.00 74.17  ? 84   GLU B OE1 1 
ATOM   4800 O  OE2 . GLU B  1 84  ? 0.272   -14.879 -41.043 1.00 71.45  ? 84   GLU B OE2 1 
ATOM   4801 N  N   . MET B  1 85  ? -1.270  -8.319  -40.514 1.00 49.90  ? 85   MET B N   1 
ATOM   4802 C  CA  . MET B  1 85  ? -1.762  -7.012  -40.950 1.00 48.59  ? 85   MET B CA  1 
ATOM   4803 C  C   . MET B  1 85  ? -0.641  -6.137  -41.504 1.00 47.77  ? 85   MET B C   1 
ATOM   4804 O  O   . MET B  1 85  ? -0.898  -5.145  -42.187 1.00 47.13  ? 85   MET B O   1 
ATOM   4805 C  CB  . MET B  1 85  ? -2.483  -6.293  -39.804 1.00 43.89  ? 85   MET B CB  1 
ATOM   4806 C  CG  . MET B  1 85  ? -1.632  -6.075  -38.564 1.00 44.13  ? 85   MET B CG  1 
ATOM   4807 S  SD  . MET B  1 85  ? -2.496  -5.175  -37.256 1.00 59.10  ? 85   MET B SD  1 
ATOM   4808 C  CE  . MET B  1 85  ? -2.761  -3.600  -38.065 1.00 32.41  ? 85   MET B CE  1 
ATOM   4809 N  N   . TRP B  1 86  ? 0.600   -6.514  -41.207 1.00 45.24  ? 86   TRP B N   1 
ATOM   4810 C  CA  . TRP B  1 86  ? 1.767   -5.801  -41.715 1.00 45.41  ? 86   TRP B CA  1 
ATOM   4811 C  C   . TRP B  1 86  ? 2.428   -6.579  -42.849 1.00 43.91  ? 86   TRP B C   1 
ATOM   4812 O  O   . TRP B  1 86  ? 3.336   -6.077  -43.510 1.00 38.19  ? 86   TRP B O   1 
ATOM   4813 C  CB  . TRP B  1 86  ? 2.768   -5.556  -40.584 1.00 40.70  ? 86   TRP B CB  1 
ATOM   4814 C  CG  . TRP B  1 86  ? 2.132   -4.948  -39.376 1.00 50.06  ? 86   TRP B CG  1 
ATOM   4815 C  CD1 . TRP B  1 86  ? 1.797   -5.584  -38.216 1.00 45.97  ? 86   TRP B CD1 1 
ATOM   4816 C  CD2 . TRP B  1 86  ? 1.738   -3.581  -39.214 1.00 49.28  ? 86   TRP B CD2 1 
ATOM   4817 N  NE1 . TRP B  1 86  ? 1.223   -4.693  -37.340 1.00 46.56  ? 86   TRP B NE1 1 
ATOM   4818 C  CE2 . TRP B  1 86  ? 1.175   -3.457  -37.930 1.00 47.48  ? 86   TRP B CE2 1 
ATOM   4819 C  CE3 . TRP B  1 86  ? 1.811   -2.448  -40.030 1.00 40.26  ? 86   TRP B CE3 1 
ATOM   4820 C  CZ2 . TRP B  1 86  ? 0.686   -2.241  -37.442 1.00 44.78  ? 86   TRP B CZ2 1 
ATOM   4821 C  CZ3 . TRP B  1 86  ? 1.325   -1.245  -39.546 1.00 44.45  ? 86   TRP B CZ3 1 
ATOM   4822 C  CH2 . TRP B  1 86  ? 0.769   -1.150  -38.265 1.00 43.45  ? 86   TRP B CH2 1 
ATOM   4823 N  N   . ASN B  1 87  ? 1.969   -7.808  -43.066 1.00 35.71  ? 87   ASN B N   1 
ATOM   4824 C  CA  . ASN B  1 87  ? 2.523   -8.660  -44.115 1.00 42.26  ? 87   ASN B CA  1 
ATOM   4825 C  C   . ASN B  1 87  ? 2.037   -8.244  -45.504 1.00 48.29  ? 87   ASN B C   1 
ATOM   4826 O  O   . ASN B  1 87  ? 0.956   -7.664  -45.631 1.00 48.14  ? 87   ASN B O   1 
ATOM   4827 C  CB  . ASN B  1 87  ? 2.184   -10.132 -43.840 1.00 44.01  ? 87   ASN B CB  1 
ATOM   4828 C  CG  . ASN B  1 87  ? 3.210   -10.815 -42.949 1.00 49.43  ? 87   ASN B CG  1 
ATOM   4829 O  OD1 . ASN B  1 87  ? 4.376   -10.419 -42.905 1.00 46.04  ? 87   ASN B OD1 1 
ATOM   4830 N  ND2 . ASN B  1 87  ? 2.780   -11.852 -42.241 1.00 52.68  ? 87   ASN B ND2 1 
ATOM   4831 N  N   . PRO B  1 88  ? 2.839   -8.534  -46.547 1.00 48.77  ? 88   PRO B N   1 
ATOM   4832 C  CA  . PRO B  1 88  ? 2.470   -8.167  -47.922 1.00 47.69  ? 88   PRO B CA  1 
ATOM   4833 C  C   . PRO B  1 88  ? 1.096   -8.697  -48.317 1.00 49.80  ? 88   PRO B C   1 
ATOM   4834 O  O   . PRO B  1 88  ? 0.823   -9.882  -48.123 1.00 56.00  ? 88   PRO B O   1 
ATOM   4835 C  CB  . PRO B  1 88  ? 3.557   -8.843  -48.767 1.00 40.34  ? 88   PRO B CB  1 
ATOM   4836 C  CG  . PRO B  1 88  ? 4.739   -8.934  -47.856 1.00 43.86  ? 88   PRO B CG  1 
ATOM   4837 C  CD  . PRO B  1 88  ? 4.165   -9.183  -46.485 1.00 44.09  ? 88   PRO B CD  1 
ATOM   4838 N  N   . ASN B  1 89  ? 0.245   -7.822  -48.847 1.00 44.32  ? 89   ASN B N   1 
ATOM   4839 C  CA  . ASN B  1 89  ? -1.087  -8.216  -49.298 1.00 44.46  ? 89   ASN B CA  1 
ATOM   4840 C  C   . ASN B  1 89  ? -1.169  -8.294  -50.823 1.00 50.64  ? 89   ASN B C   1 
ATOM   4841 O  O   . ASN B  1 89  ? -2.250  -8.454  -51.393 1.00 55.10  ? 89   ASN B O   1 
ATOM   4842 C  CB  . ASN B  1 89  ? -2.159  -7.271  -48.732 1.00 41.38  ? 89   ASN B CB  1 
ATOM   4843 C  CG  . ASN B  1 89  ? -1.957  -5.825  -49.161 1.00 46.21  ? 89   ASN B CG  1 
ATOM   4844 O  OD1 . ASN B  1 89  ? -0.865  -5.433  -49.570 1.00 47.10  ? 89   ASN B OD1 1 
ATOM   4845 N  ND2 . ASN B  1 89  ? -3.015  -5.024  -49.062 1.00 42.77  ? 89   ASN B ND2 1 
ATOM   4846 N  N   . ARG B  1 90  ? -0.015  -8.166  -51.474 1.00 47.48  ? 90   ARG B N   1 
ATOM   4847 C  CA  . ARG B  1 90  ? 0.105   -8.402  -52.912 1.00 51.38  ? 90   ARG B CA  1 
ATOM   4848 C  C   . ARG B  1 90  ? 1.314   -9.293  -53.183 1.00 52.59  ? 90   ARG B C   1 
ATOM   4849 O  O   . ARG B  1 90  ? 2.016   -9.698  -52.256 1.00 50.37  ? 90   ARG B O   1 
ATOM   4850 C  CB  . ARG B  1 90  ? 0.248   -7.083  -53.677 1.00 43.70  ? 90   ARG B CB  1 
ATOM   4851 C  CG  . ARG B  1 90  ? -1.003  -6.218  -53.697 1.00 46.20  ? 90   ARG B CG  1 
ATOM   4852 C  CD  . ARG B  1 90  ? -2.173  -6.948  -54.346 1.00 50.23  ? 90   ARG B CD  1 
ATOM   4853 N  NE  . ARG B  1 90  ? -3.364  -6.109  -54.436 1.00 60.80  ? 90   ARG B NE  1 
ATOM   4854 C  CZ  . ARG B  1 90  ? -4.281  -6.010  -53.478 1.00 66.62  ? 90   ARG B CZ  1 
ATOM   4855 N  NH1 . ARG B  1 90  ? -4.144  -6.700  -52.353 1.00 67.42  ? 90   ARG B NH1 1 
ATOM   4856 N  NH2 . ARG B  1 90  ? -5.333  -5.221  -53.642 1.00 65.56  ? 90   ARG B NH2 1 
ATOM   4857 N  N   . GLU B  1 91  ? 1.556   -9.596  -54.454 1.00 54.73  ? 91   GLU B N   1 
ATOM   4858 C  CA  . GLU B  1 91  ? 2.681   -10.449 -54.833 1.00 54.88  ? 91   GLU B CA  1 
ATOM   4859 C  C   . GLU B  1 91  ? 4.015   -9.725  -54.666 1.00 45.92  ? 91   GLU B C   1 
ATOM   4860 O  O   . GLU B  1 91  ? 4.095   -8.509  -54.845 1.00 46.32  ? 91   GLU B O   1 
ATOM   4861 C  CB  . GLU B  1 91  ? 2.524   -10.936 -56.279 1.00 64.42  ? 91   GLU B CB  1 
ATOM   4862 C  CG  . GLU B  1 91  ? 1.410   -11.965 -56.491 1.00 75.12  ? 91   GLU B CG  1 
ATOM   4863 C  CD  . GLU B  1 91  ? 1.829   -13.369 -56.104 1.00 84.38  ? 91   GLU B CD  1 
ATOM   4864 O  OE1 . GLU B  1 91  ? 3.049   -13.617 -56.016 1.00 85.30  ? 91   GLU B OE1 1 
ATOM   4865 O  OE2 . GLU B  1 91  ? 0.944   -14.224 -55.889 1.00 90.58  ? 91   GLU B OE2 1 
ATOM   4866 N  N   . LEU B  1 92  ? 5.056   -10.476 -54.317 1.00 44.26  ? 92   LEU B N   1 
ATOM   4867 C  CA  . LEU B  1 92  ? 6.392   -9.911  -54.151 1.00 42.65  ? 92   LEU B CA  1 
ATOM   4868 C  C   . LEU B  1 92  ? 7.113   -9.817  -55.496 1.00 50.71  ? 92   LEU B C   1 
ATOM   4869 O  O   . LEU B  1 92  ? 7.029   -10.729 -56.321 1.00 46.69  ? 92   LEU B O   1 
ATOM   4870 C  CB  . LEU B  1 92  ? 7.215   -10.748 -53.166 1.00 39.48  ? 92   LEU B CB  1 
ATOM   4871 C  CG  . LEU B  1 92  ? 6.659   -10.905 -51.745 1.00 43.84  ? 92   LEU B CG  1 
ATOM   4872 C  CD1 . LEU B  1 92  ? 7.638   -11.627 -50.825 1.00 35.26  ? 92   LEU B CD1 1 
ATOM   4873 C  CD2 . LEU B  1 92  ? 6.301   -9.554  -51.174 1.00 36.38  ? 92   LEU B CD2 1 
ATOM   4874 N  N   . SER B  1 93  ? 7.816   -8.707  -55.707 1.00 48.73  ? 93   SER B N   1 
ATOM   4875 C  CA  . SER B  1 93  ? 8.571   -8.476  -56.939 1.00 42.71  ? 93   SER B CA  1 
ATOM   4876 C  C   . SER B  1 93  ? 9.542   -7.316  -56.755 1.00 42.83  ? 93   SER B C   1 
ATOM   4877 O  O   . SER B  1 93  ? 9.247   -6.373  -56.018 1.00 41.10  ? 93   SER B O   1 
ATOM   4878 C  CB  . SER B  1 93  ? 7.620   -8.169  -58.100 1.00 38.77  ? 93   SER B CB  1 
ATOM   4879 O  OG  . SER B  1 93  ? 8.341   -7.721  -59.236 1.00 37.00  ? 93   SER B OG  1 
ATOM   4880 N  N   . GLU B  1 94  ? 10.695  -7.378  -57.419 1.00 39.60  ? 94   GLU B N   1 
ATOM   4881 C  CA  . GLU B  1 94  ? 11.628  -6.254  -57.407 1.00 33.21  ? 94   GLU B CA  1 
ATOM   4882 C  C   . GLU B  1 94  ? 11.069  -5.145  -58.292 1.00 32.44  ? 94   GLU B C   1 
ATOM   4883 O  O   . GLU B  1 94  ? 11.459  -3.980  -58.182 1.00 33.21  ? 94   GLU B O   1 
ATOM   4884 C  CB  . GLU B  1 94  ? 13.032  -6.683  -57.862 1.00 28.88  ? 94   GLU B CB  1 
ATOM   4885 C  CG  . GLU B  1 94  ? 13.647  -7.816  -57.034 1.00 29.07  ? 94   GLU B CG  1 
ATOM   4886 C  CD  . GLU B  1 94  ? 15.108  -8.071  -57.363 1.00 37.14  ? 94   GLU B CD  1 
ATOM   4887 O  OE1 . GLU B  1 94  ? 15.897  -7.102  -57.376 1.00 36.00  ? 94   GLU B OE1 1 
ATOM   4888 O  OE2 . GLU B  1 94  ? 15.470  -9.244  -57.600 1.00 40.67  ? 94   GLU B OE2 1 
ATOM   4889 N  N   . ASP B  1 95  ? 10.144  -5.524  -59.170 1.00 33.14  ? 95   ASP B N   1 
ATOM   4890 C  CA  . ASP B  1 95  ? 9.373   -4.560  -59.945 1.00 37.38  ? 95   ASP B CA  1 
ATOM   4891 C  C   . ASP B  1 95  ? 8.236   -4.051  -59.063 1.00 35.54  ? 95   ASP B C   1 
ATOM   4892 O  O   . ASP B  1 95  ? 7.131   -4.590  -59.097 1.00 37.47  ? 95   ASP B O   1 
ATOM   4893 C  CB  . ASP B  1 95  ? 8.814   -5.227  -61.207 1.00 40.78  ? 95   ASP B CB  1 
ATOM   4894 C  CG  . ASP B  1 95  ? 8.094   -4.256  -62.122 1.00 43.59  ? 95   ASP B CG  1 
ATOM   4895 O  OD1 . ASP B  1 95  ? 7.954   -3.067  -61.768 1.00 44.88  ? 95   ASP B OD1 1 
ATOM   4896 O  OD2 . ASP B  1 95  ? 7.655   -4.695  -63.205 1.00 50.18  ? 95   ASP B OD2 1 
ATOM   4897 N  N   . CYS B  1 96  ? 8.503   -3.005  -58.285 1.00 36.74  ? 96   CYS B N   1 
ATOM   4898 C  CA  . CYS B  1 96  ? 7.543   -2.542  -57.286 1.00 36.27  ? 96   CYS B CA  1 
ATOM   4899 C  C   . CYS B  1 96  ? 7.454   -1.027  -57.150 1.00 35.96  ? 96   CYS B C   1 
ATOM   4900 O  O   . CYS B  1 96  ? 6.720   -0.526  -56.300 1.00 40.68  ? 96   CYS B O   1 
ATOM   4901 C  CB  . CYS B  1 96  ? 7.904   -3.128  -55.925 1.00 30.03  ? 96   CYS B CB  1 
ATOM   4902 S  SG  . CYS B  1 96  ? 9.562   -2.661  -55.338 1.00 48.19  ? 96   CYS B SG  1 
ATOM   4903 N  N   . LEU B  1 97  ? 8.200   -0.296  -57.971 1.00 32.43  ? 97   LEU B N   1 
ATOM   4904 C  CA  . LEU B  1 97  ? 8.236   1.158   -57.838 1.00 33.16  ? 97   LEU B CA  1 
ATOM   4905 C  C   . LEU B  1 97  ? 6.992   1.822   -58.425 1.00 37.79  ? 97   LEU B C   1 
ATOM   4906 O  O   . LEU B  1 97  ? 7.018   2.381   -59.527 1.00 39.64  ? 97   LEU B O   1 
ATOM   4907 C  CB  . LEU B  1 97  ? 9.527   1.736   -58.427 1.00 32.54  ? 97   LEU B CB  1 
ATOM   4908 C  CG  . LEU B  1 97  ? 10.783  1.242   -57.702 1.00 34.45  ? 97   LEU B CG  1 
ATOM   4909 C  CD1 . LEU B  1 97  ? 12.014  2.017   -58.127 1.00 27.42  ? 97   LEU B CD1 1 
ATOM   4910 C  CD2 . LEU B  1 97  ? 10.597  1.323   -56.191 1.00 44.77  ? 97   LEU B CD2 1 
ATOM   4911 N  N   . TYR B  1 98  ? 5.905   1.752   -57.664 1.00 37.73  ? 98   TYR B N   1 
ATOM   4912 C  CA  . TYR B  1 98  ? 4.639   2.348   -58.060 1.00 42.09  ? 98   TYR B CA  1 
ATOM   4913 C  C   . TYR B  1 98  ? 4.083   3.163   -56.898 1.00 44.71  ? 98   TYR B C   1 
ATOM   4914 O  O   . TYR B  1 98  ? 4.413   2.903   -55.741 1.00 45.54  ? 98   TYR B O   1 
ATOM   4915 C  CB  . TYR B  1 98  ? 3.643   1.255   -58.458 1.00 39.54  ? 98   TYR B CB  1 
ATOM   4916 C  CG  . TYR B  1 98  ? 4.126   0.341   -59.564 1.00 43.77  ? 98   TYR B CG  1 
ATOM   4917 C  CD1 . TYR B  1 98  ? 4.875   -0.793  -59.277 1.00 40.73  ? 98   TYR B CD1 1 
ATOM   4918 C  CD2 . TYR B  1 98  ? 3.816   0.603   -60.892 1.00 41.28  ? 98   TYR B CD2 1 
ATOM   4919 C  CE1 . TYR B  1 98  ? 5.310   -1.636  -60.280 1.00 45.86  ? 98   TYR B CE1 1 
ATOM   4920 C  CE2 . TYR B  1 98  ? 4.246   -0.234  -61.902 1.00 40.98  ? 98   TYR B CE2 1 
ATOM   4921 C  CZ  . TYR B  1 98  ? 4.993   -1.351  -61.589 1.00 45.70  ? 98   TYR B CZ  1 
ATOM   4922 O  OH  . TYR B  1 98  ? 5.427   -2.190  -62.588 1.00 47.16  ? 98   TYR B OH  1 
ATOM   4923 N  N   . LEU B  1 99  ? 3.251   4.154   -57.203 1.00 44.88  ? 99   LEU B N   1 
ATOM   4924 C  CA  . LEU B  1 99  ? 2.613   4.948   -56.156 1.00 39.18  ? 99   LEU B CA  1 
ATOM   4925 C  C   . LEU B  1 99  ? 1.097   4.984   -56.312 1.00 42.18  ? 99   LEU B C   1 
ATOM   4926 O  O   . LEU B  1 99  ? 0.555   4.569   -57.339 1.00 43.35  ? 99   LEU B O   1 
ATOM   4927 C  CB  . LEU B  1 99  ? 3.201   6.366   -56.094 1.00 40.25  ? 99   LEU B CB  1 
ATOM   4928 C  CG  . LEU B  1 99  ? 3.240   7.250   -57.345 1.00 42.89  ? 99   LEU B CG  1 
ATOM   4929 C  CD1 . LEU B  1 99  ? 1.892   7.888   -57.639 1.00 36.03  ? 99   LEU B CD1 1 
ATOM   4930 C  CD2 . LEU B  1 99  ? 4.304   8.323   -57.197 1.00 38.83  ? 99   LEU B CD2 1 
ATOM   4931 N  N   . ASN B  1 100 ? 0.422   5.486   -55.284 1.00 45.68  ? 100  ASN B N   1 
ATOM   4932 C  CA  . ASN B  1 100 ? -1.030  5.549   -55.269 1.00 40.31  ? 100  ASN B CA  1 
ATOM   4933 C  C   . ASN B  1 100 ? -1.512  6.957   -54.939 1.00 42.29  ? 100  ASN B C   1 
ATOM   4934 O  O   . ASN B  1 100 ? -0.883  7.667   -54.151 1.00 43.99  ? 100  ASN B O   1 
ATOM   4935 C  CB  . ASN B  1 100 ? -1.577  4.563   -54.235 1.00 38.81  ? 100  ASN B CB  1 
ATOM   4936 C  CG  . ASN B  1 100 ? -0.947  3.186   -54.353 1.00 39.44  ? 100  ASN B CG  1 
ATOM   4937 O  OD1 . ASN B  1 100 ? -0.950  2.580   -55.425 1.00 41.76  ? 100  ASN B OD1 1 
ATOM   4938 N  ND2 . ASN B  1 100 ? -0.393  2.691   -53.253 1.00 33.70  ? 100  ASN B ND2 1 
ATOM   4939 N  N   . VAL B  1 101 ? -2.627  7.358   -55.544 1.00 44.52  ? 101  VAL B N   1 
ATOM   4940 C  CA  . VAL B  1 101 ? -3.218  8.667   -55.282 1.00 42.67  ? 101  VAL B CA  1 
ATOM   4941 C  C   . VAL B  1 101 ? -4.703  8.539   -54.960 1.00 45.85  ? 101  VAL B C   1 
ATOM   4942 O  O   . VAL B  1 101 ? -5.469  7.974   -55.749 1.00 44.17  ? 101  VAL B O   1 
ATOM   4943 C  CB  . VAL B  1 101 ? -3.057  9.620   -56.493 1.00 48.23  ? 101  VAL B CB  1 
ATOM   4944 C  CG1 . VAL B  1 101 ? -3.819  10.913  -56.261 1.00 36.40  ? 101  VAL B CG1 1 
ATOM   4945 C  CG2 . VAL B  1 101 ? -1.595  9.921   -56.756 1.00 49.10  ? 101  VAL B CG2 1 
ATOM   4946 N  N   . TRP B  1 102 ? -5.103  9.049   -53.797 1.00 47.11  ? 102  TRP B N   1 
ATOM   4947 C  CA  . TRP B  1 102 ? -6.522  9.208   -53.483 1.00 46.89  ? 102  TRP B CA  1 
ATOM   4948 C  C   . TRP B  1 102 ? -6.914  10.673  -53.609 1.00 46.82  ? 102  TRP B C   1 
ATOM   4949 O  O   . TRP B  1 102 ? -6.125  11.566  -53.290 1.00 43.41  ? 102  TRP B O   1 
ATOM   4950 C  CB  . TRP B  1 102 ? -6.853  8.709   -52.074 1.00 51.00  ? 102  TRP B CB  1 
ATOM   4951 C  CG  . TRP B  1 102 ? -6.870  7.224   -51.952 1.00 43.39  ? 102  TRP B CG  1 
ATOM   4952 C  CD1 . TRP B  1 102 ? -7.938  6.390   -52.138 1.00 42.38  ? 102  TRP B CD1 1 
ATOM   4953 C  CD2 . TRP B  1 102 ? -5.763  6.390   -51.608 1.00 35.99  ? 102  TRP B CD2 1 
ATOM   4954 N  NE1 . TRP B  1 102 ? -7.555  5.084   -51.928 1.00 43.64  ? 102  TRP B NE1 1 
ATOM   4955 C  CE2 . TRP B  1 102 ? -6.223  5.059   -51.602 1.00 37.87  ? 102  TRP B CE2 1 
ATOM   4956 C  CE3 . TRP B  1 102 ? -4.423  6.641   -51.304 1.00 38.51  ? 102  TRP B CE3 1 
ATOM   4957 C  CZ2 . TRP B  1 102 ? -5.385  3.982   -51.303 1.00 35.33  ? 102  TRP B CZ2 1 
ATOM   4958 C  CZ3 . TRP B  1 102 ? -3.595  5.577   -51.008 1.00 37.27  ? 102  TRP B CZ3 1 
ATOM   4959 C  CH2 . TRP B  1 102 ? -4.076  4.265   -51.008 1.00 40.26  ? 102  TRP B CH2 1 
ATOM   4960 N  N   . THR B  1 103 ? -8.134  10.916  -54.076 1.00 46.13  ? 103  THR B N   1 
ATOM   4961 C  CA  . THR B  1 103 ? -8.622  12.276  -54.288 1.00 52.30  ? 103  THR B CA  1 
ATOM   4962 C  C   . THR B  1 103 ? -10.136 12.283  -54.084 1.00 56.63  ? 103  THR B C   1 
ATOM   4963 O  O   . THR B  1 103 ? -10.774 11.231  -54.168 1.00 59.57  ? 103  THR B O   1 
ATOM   4964 C  CB  . THR B  1 103 ? -8.252  12.794  -55.716 1.00 56.30  ? 103  THR B CB  1 
ATOM   4965 O  OG1 . THR B  1 103 ? -8.036  14.212  -55.694 1.00 67.06  ? 103  THR B OG1 1 
ATOM   4966 C  CG2 . THR B  1 103 ? -9.345  12.475  -56.714 1.00 41.96  ? 103  THR B CG2 1 
ATOM   4967 N  N   . PRO B  1 104 ? -10.716 13.458  -53.781 1.00 55.01  ? 104  PRO B N   1 
ATOM   4968 C  CA  . PRO B  1 104 ? -12.180 13.520  -53.677 1.00 52.87  ? 104  PRO B CA  1 
ATOM   4969 C  C   . PRO B  1 104 ? -12.860 13.224  -55.013 1.00 56.71  ? 104  PRO B C   1 
ATOM   4970 O  O   . PRO B  1 104 ? -12.260 13.459  -56.060 1.00 52.62  ? 104  PRO B O   1 
ATOM   4971 C  CB  . PRO B  1 104 ? -12.437 14.976  -53.278 1.00 50.61  ? 104  PRO B CB  1 
ATOM   4972 C  CG  . PRO B  1 104 ? -11.182 15.407  -52.582 1.00 52.70  ? 104  PRO B CG  1 
ATOM   4973 C  CD  . PRO B  1 104 ? -10.075 14.704  -53.319 1.00 53.31  ? 104  PRO B CD  1 
ATOM   4974 N  N   . TYR B  1 105 ? -14.083 12.701  -54.969 1.00 60.00  ? 105  TYR B N   1 
ATOM   4975 C  CA  . TYR B  1 105 ? -14.891 12.514  -56.171 1.00 56.21  ? 105  TYR B CA  1 
ATOM   4976 C  C   . TYR B  1 105 ? -16.082 13.459  -56.082 1.00 65.21  ? 105  TYR B C   1 
ATOM   4977 O  O   . TYR B  1 105 ? -16.907 13.338  -55.173 1.00 69.73  ? 105  TYR B O   1 
ATOM   4978 C  CB  . TYR B  1 105 ? -15.362 11.058  -56.299 1.00 51.07  ? 105  TYR B CB  1 
ATOM   4979 C  CG  . TYR B  1 105 ? -16.091 10.734  -57.592 1.00 51.65  ? 105  TYR B CG  1 
ATOM   4980 C  CD1 . TYR B  1 105 ? -17.426 11.079  -57.768 1.00 54.65  ? 105  TYR B CD1 1 
ATOM   4981 C  CD2 . TYR B  1 105 ? -15.450 10.065  -58.627 1.00 58.07  ? 105  TYR B CD2 1 
ATOM   4982 C  CE1 . TYR B  1 105 ? -18.094 10.784  -58.937 1.00 64.85  ? 105  TYR B CE1 1 
ATOM   4983 C  CE2 . TYR B  1 105 ? -16.112 9.764   -59.803 1.00 61.64  ? 105  TYR B CE2 1 
ATOM   4984 C  CZ  . TYR B  1 105 ? -17.435 10.127  -59.949 1.00 66.75  ? 105  TYR B CZ  1 
ATOM   4985 O  OH  . TYR B  1 105 ? -18.111 9.836   -61.110 1.00 69.68  ? 105  TYR B OH  1 
ATOM   4986 N  N   . PRO B  1 106 ? -16.181 14.411  -57.022 1.00 70.06  ? 106  PRO B N   1 
ATOM   4987 C  CA  . PRO B  1 106 ? -15.275 14.626  -58.158 1.00 73.35  ? 106  PRO B CA  1 
ATOM   4988 C  C   . PRO B  1 106 ? -13.981 15.308  -57.730 1.00 66.38  ? 106  PRO B C   1 
ATOM   4989 O  O   . PRO B  1 106 ? -13.903 15.793  -56.601 1.00 63.48  ? 106  PRO B O   1 
ATOM   4990 C  CB  . PRO B  1 106 ? -16.081 15.563  -59.059 1.00 73.85  ? 106  PRO B CB  1 
ATOM   4991 C  CG  . PRO B  1 106 ? -16.919 16.349  -58.102 1.00 73.94  ? 106  PRO B CG  1 
ATOM   4992 C  CD  . PRO B  1 106 ? -17.283 15.390  -57.001 1.00 67.57  ? 106  PRO B CD  1 
ATOM   4993 N  N   . ARG B  1 107 ? -12.987 15.324  -58.616 1.00 64.66  ? 107  ARG B N   1 
ATOM   4994 C  CA  . ARG B  1 107 ? -11.692 15.949  -58.341 1.00 64.95  ? 107  ARG B CA  1 
ATOM   4995 C  C   . ARG B  1 107 ? -11.844 17.376  -57.821 1.00 68.19  ? 107  ARG B C   1 
ATOM   4996 O  O   . ARG B  1 107 ? -12.736 18.101  -58.261 1.00 71.45  ? 107  ARG B O   1 
ATOM   4997 C  CB  . ARG B  1 107 ? -10.824 15.947  -59.603 1.00 56.01  ? 107  ARG B CB  1 
ATOM   4998 N  N   . PRO B  1 108 ? -10.976 17.776  -56.875 1.00 64.24  ? 108  PRO B N   1 
ATOM   4999 C  CA  . PRO B  1 108 ? -11.035 19.102  -56.245 1.00 68.47  ? 108  PRO B CA  1 
ATOM   5000 C  C   . PRO B  1 108 ? -11.160 20.253  -57.246 1.00 76.07  ? 108  PRO B C   1 
ATOM   5001 O  O   . PRO B  1 108 ? -10.460 20.269  -58.259 1.00 71.17  ? 108  PRO B O   1 
ATOM   5002 C  CB  . PRO B  1 108 ? -9.694  19.190  -55.512 1.00 61.17  ? 108  PRO B CB  1 
ATOM   5003 C  CG  . PRO B  1 108 ? -9.382  17.775  -55.156 1.00 57.66  ? 108  PRO B CG  1 
ATOM   5004 C  CD  . PRO B  1 108 ? -9.887  16.951  -56.316 1.00 57.92  ? 108  PRO B CD  1 
ATOM   5005 N  N   . ALA B  1 109 ? -12.047 21.202  -56.961 1.00 83.11  ? 109  ALA B N   1 
ATOM   5006 C  CA  . ALA B  1 109 ? -12.237 22.357  -57.833 1.00 83.06  ? 109  ALA B CA  1 
ATOM   5007 C  C   . ALA B  1 109 ? -11.032 23.291  -57.772 1.00 79.39  ? 109  ALA B C   1 
ATOM   5008 O  O   . ALA B  1 109 ? -10.616 23.853  -58.786 1.00 81.81  ? 109  ALA B O   1 
ATOM   5009 C  CB  . ALA B  1 109 ? -13.510 23.104  -57.456 1.00 85.22  ? 109  ALA B CB  1 
ATOM   5010 N  N   . SER B  1 110 ? -10.483 23.449  -56.571 1.00 69.92  ? 110  SER B N   1 
ATOM   5011 C  CA  . SER B  1 110 ? -9.312  24.288  -56.342 1.00 68.43  ? 110  SER B CA  1 
ATOM   5012 C  C   . SER B  1 110 ? -8.126  23.443  -55.862 1.00 66.77  ? 110  SER B C   1 
ATOM   5013 O  O   . SER B  1 110 ? -8.324  22.343  -55.342 1.00 69.85  ? 110  SER B O   1 
ATOM   5014 C  CB  . SER B  1 110 ? -9.649  25.380  -55.321 1.00 70.60  ? 110  SER B CB  1 
ATOM   5015 O  OG  . SER B  1 110 ? -10.414 24.860  -54.248 1.00 76.19  ? 110  SER B OG  1 
ATOM   5016 N  N   . PRO B  1 111 ? -6.890  23.947  -56.050 1.00 57.69  ? 111  PRO B N   1 
ATOM   5017 C  CA  . PRO B  1 111 ? -5.685  23.231  -55.601 1.00 58.20  ? 111  PRO B CA  1 
ATOM   5018 C  C   . PRO B  1 111 ? -5.743  22.805  -54.131 1.00 61.58  ? 111  PRO B C   1 
ATOM   5019 O  O   . PRO B  1 111 ? -5.922  23.645  -53.247 1.00 55.54  ? 111  PRO B O   1 
ATOM   5020 C  CB  . PRO B  1 111 ? -4.577  24.264  -55.807 1.00 57.50  ? 111  PRO B CB  1 
ATOM   5021 C  CG  . PRO B  1 111 ? -5.055  25.084  -56.962 1.00 56.08  ? 111  PRO B CG  1 
ATOM   5022 C  CD  . PRO B  1 111 ? -6.551  25.182  -56.785 1.00 55.33  ? 111  PRO B CD  1 
ATOM   5023 N  N   . THR B  1 112 ? -5.574  21.509  -53.884 1.00 61.66  ? 112  THR B N   1 
ATOM   5024 C  CA  . THR B  1 112 ? -5.777  20.936  -52.557 1.00 58.93  ? 112  THR B CA  1 
ATOM   5025 C  C   . THR B  1 112 ? -4.476  20.395  -51.965 1.00 57.06  ? 112  THR B C   1 
ATOM   5026 O  O   . THR B  1 112 ? -3.739  19.679  -52.645 1.00 58.62  ? 112  THR B O   1 
ATOM   5027 C  CB  . THR B  1 112 ? -6.826  19.806  -52.608 1.00 60.74  ? 112  THR B CB  1 
ATOM   5028 O  OG1 . THR B  1 112 ? -8.113  20.357  -52.920 1.00 66.37  ? 112  THR B OG1 1 
ATOM   5029 C  CG2 . THR B  1 112 ? -6.900  19.084  -51.279 1.00 55.23  ? 112  THR B CG2 1 
ATOM   5030 N  N   . PRO B  1 113 ? -4.190  20.749  -50.696 1.00 49.76  ? 113  PRO B N   1 
ATOM   5031 C  CA  . PRO B  1 113 ? -2.998  20.287  -49.974 1.00 47.47  ? 113  PRO B CA  1 
ATOM   5032 C  C   . PRO B  1 113 ? -2.788  18.780  -50.081 1.00 40.51  ? 113  PRO B C   1 
ATOM   5033 O  O   . PRO B  1 113 ? -3.763  18.025  -50.099 1.00 43.05  ? 113  PRO B O   1 
ATOM   5034 C  CB  . PRO B  1 113 ? -3.305  20.674  -48.526 1.00 49.87  ? 113  PRO B CB  1 
ATOM   5035 C  CG  . PRO B  1 113 ? -4.126  21.913  -48.659 1.00 51.78  ? 113  PRO B CG  1 
ATOM   5036 C  CD  . PRO B  1 113 ? -4.965  21.723  -49.904 1.00 46.02  ? 113  PRO B CD  1 
ATOM   5037 N  N   . VAL B  1 114 ? -1.529  18.358  -50.152 1.00 30.49  ? 114  VAL B N   1 
ATOM   5038 C  CA  . VAL B  1 114 ? -1.198  16.959  -50.394 1.00 35.49  ? 114  VAL B CA  1 
ATOM   5039 C  C   . VAL B  1 114 ? -0.538  16.331  -49.177 1.00 40.20  ? 114  VAL B C   1 
ATOM   5040 O  O   . VAL B  1 114 ? 0.367   16.917  -48.578 1.00 37.58  ? 114  VAL B O   1 
ATOM   5041 C  CB  . VAL B  1 114 ? -0.245  16.814  -51.601 1.00 39.49  ? 114  VAL B CB  1 
ATOM   5042 C  CG1 . VAL B  1 114 ? -0.024  15.344  -51.939 1.00 38.03  ? 114  VAL B CG1 1 
ATOM   5043 C  CG2 . VAL B  1 114 ? -0.802  17.559  -52.803 1.00 36.64  ? 114  VAL B CG2 1 
ATOM   5044 N  N   . LEU B  1 115 ? -1.000  15.141  -48.806 1.00 45.61  ? 115  LEU B N   1 
ATOM   5045 C  CA  . LEU B  1 115 ? -0.320  14.352  -47.785 1.00 45.68  ? 115  LEU B CA  1 
ATOM   5046 C  C   . LEU B  1 115 ? 0.363   13.159  -48.449 1.00 44.24  ? 115  LEU B C   1 
ATOM   5047 O  O   . LEU B  1 115 ? -0.279  12.383  -49.162 1.00 46.06  ? 115  LEU B O   1 
ATOM   5048 C  CB  . LEU B  1 115 ? -1.295  13.878  -46.702 1.00 50.61  ? 115  LEU B CB  1 
ATOM   5049 C  CG  . LEU B  1 115 ? -1.790  14.912  -45.682 1.00 51.11  ? 115  LEU B CG  1 
ATOM   5050 C  CD1 . LEU B  1 115 ? -2.895  15.783  -46.258 1.00 57.81  ? 115  LEU B CD1 1 
ATOM   5051 C  CD2 . LEU B  1 115 ? -2.261  14.242  -44.407 1.00 48.25  ? 115  LEU B CD2 1 
ATOM   5052 N  N   . ILE B  1 116 ? 1.666   13.027  -48.233 1.00 36.34  ? 116  ILE B N   1 
ATOM   5053 C  CA  . ILE B  1 116 ? 2.399   11.886  -48.762 1.00 37.91  ? 116  ILE B CA  1 
ATOM   5054 C  C   . ILE B  1 116 ? 2.777   10.942  -47.628 1.00 34.97  ? 116  ILE B C   1 
ATOM   5055 O  O   . ILE B  1 116 ? 3.523   11.315  -46.721 1.00 38.61  ? 116  ILE B O   1 
ATOM   5056 C  CB  . ILE B  1 116 ? 3.657   12.324  -49.536 1.00 37.47  ? 116  ILE B CB  1 
ATOM   5057 C  CG1 . ILE B  1 116 ? 3.268   13.259  -50.688 1.00 36.50  ? 116  ILE B CG1 1 
ATOM   5058 C  CG2 . ILE B  1 116 ? 4.402   11.114  -50.067 1.00 31.51  ? 116  ILE B CG2 1 
ATOM   5059 C  CD1 . ILE B  1 116 ? 4.433   13.668  -51.577 1.00 34.83  ? 116  ILE B CD1 1 
ATOM   5060 N  N   . TRP B  1 117 ? 2.246   9.724   -47.675 1.00 33.88  ? 117  TRP B N   1 
ATOM   5061 C  CA  . TRP B  1 117 ? 2.550   8.716   -46.665 1.00 36.05  ? 117  TRP B CA  1 
ATOM   5062 C  C   . TRP B  1 117 ? 3.768   7.881   -47.048 1.00 42.35  ? 117  TRP B C   1 
ATOM   5063 O  O   . TRP B  1 117 ? 3.858   7.372   -48.167 1.00 46.51  ? 117  TRP B O   1 
ATOM   5064 C  CB  . TRP B  1 117 ? 1.339   7.809   -46.438 1.00 38.12  ? 117  TRP B CB  1 
ATOM   5065 C  CG  . TRP B  1 117 ? 1.630   6.657   -45.539 1.00 40.79  ? 117  TRP B CG  1 
ATOM   5066 C  CD1 . TRP B  1 117 ? 1.841   5.362   -45.908 1.00 43.11  ? 117  TRP B CD1 1 
ATOM   5067 C  CD2 . TRP B  1 117 ? 1.752   6.695   -44.114 1.00 43.53  ? 117  TRP B CD2 1 
ATOM   5068 N  NE1 . TRP B  1 117 ? 2.083   4.590   -44.797 1.00 39.81  ? 117  TRP B NE1 1 
ATOM   5069 C  CE2 . TRP B  1 117 ? 2.034   5.386   -43.683 1.00 40.38  ? 117  TRP B CE2 1 
ATOM   5070 C  CE3 . TRP B  1 117 ? 1.649   7.712   -43.160 1.00 39.49  ? 117  TRP B CE3 1 
ATOM   5071 C  CZ2 . TRP B  1 117 ? 2.214   5.067   -42.335 1.00 40.35  ? 117  TRP B CZ2 1 
ATOM   5072 C  CZ3 . TRP B  1 117 ? 1.827   7.396   -41.827 1.00 31.17  ? 117  TRP B CZ3 1 
ATOM   5073 C  CH2 . TRP B  1 117 ? 2.106   6.085   -41.425 1.00 34.60  ? 117  TRP B CH2 1 
ATOM   5074 N  N   . ILE B  1 118 ? 4.704   7.758   -46.111 1.00 36.73  ? 118  ILE B N   1 
ATOM   5075 C  CA  . ILE B  1 118 ? 5.862   6.889   -46.276 1.00 34.92  ? 118  ILE B CA  1 
ATOM   5076 C  C   . ILE B  1 118 ? 5.788   5.780   -45.223 1.00 46.60  ? 118  ILE B C   1 
ATOM   5077 O  O   . ILE B  1 118 ? 5.970   6.037   -44.031 1.00 48.31  ? 118  ILE B O   1 
ATOM   5078 C  CB  . ILE B  1 118 ? 7.183   7.678   -46.121 1.00 28.63  ? 118  ILE B CB  1 
ATOM   5079 C  CG1 . ILE B  1 118 ? 7.182   8.918   -47.025 1.00 30.10  ? 118  ILE B CG1 1 
ATOM   5080 C  CG2 . ILE B  1 118 ? 8.377   6.795   -46.439 1.00 25.02  ? 118  ILE B CG2 1 
ATOM   5081 C  CD1 . ILE B  1 118 ? 8.477   9.725   -46.976 1.00 34.64  ? 118  ILE B CD1 1 
ATOM   5082 N  N   . TYR B  1 119 ? 5.514   4.553   -45.660 1.00 42.08  ? 119  TYR B N   1 
ATOM   5083 C  CA  . TYR B  1 119 ? 5.299   3.438   -44.732 1.00 40.47  ? 119  TYR B CA  1 
ATOM   5084 C  C   . TYR B  1 119 ? 6.534   3.049   -43.921 1.00 40.87  ? 119  TYR B C   1 
ATOM   5085 O  O   . TYR B  1 119 ? 7.661   3.370   -44.297 1.00 37.81  ? 119  TYR B O   1 
ATOM   5086 C  CB  . TYR B  1 119 ? 4.726   2.207   -45.455 1.00 44.64  ? 119  TYR B CB  1 
ATOM   5087 C  CG  . TYR B  1 119 ? 5.586   1.626   -46.565 1.00 41.97  ? 119  TYR B CG  1 
ATOM   5088 C  CD1 . TYR B  1 119 ? 6.717   0.870   -46.278 1.00 37.93  ? 119  TYR B CD1 1 
ATOM   5089 C  CD2 . TYR B  1 119 ? 5.239   1.798   -47.898 1.00 44.16  ? 119  TYR B CD2 1 
ATOM   5090 C  CE1 . TYR B  1 119 ? 7.492   0.327   -47.288 1.00 42.56  ? 119  TYR B CE1 1 
ATOM   5091 C  CE2 . TYR B  1 119 ? 6.007   1.260   -48.915 1.00 43.39  ? 119  TYR B CE2 1 
ATOM   5092 C  CZ  . TYR B  1 119 ? 7.133   0.525   -48.604 1.00 45.55  ? 119  TYR B CZ  1 
ATOM   5093 O  OH  . TYR B  1 119 ? 7.907   -0.017  -49.609 1.00 37.87  ? 119  TYR B OH  1 
ATOM   5094 N  N   . GLY B  1 120 ? 6.308   2.366   -42.800 1.00 37.18  ? 120  GLY B N   1 
ATOM   5095 C  CA  . GLY B  1 120 ? 7.388   1.826   -41.993 1.00 34.12  ? 120  GLY B CA  1 
ATOM   5096 C  C   . GLY B  1 120 ? 7.566   0.336   -42.226 1.00 39.75  ? 120  GLY B C   1 
ATOM   5097 O  O   . GLY B  1 120 ? 7.022   -0.220  -43.186 1.00 45.92  ? 120  GLY B O   1 
ATOM   5098 N  N   . GLY B  1 121 ? 8.325   -0.312  -41.347 1.00 36.26  ? 121  GLY B N   1 
ATOM   5099 C  CA  . GLY B  1 121 ? 8.658   -1.717  -41.513 1.00 35.41  ? 121  GLY B CA  1 
ATOM   5100 C  C   . GLY B  1 121 ? 10.143  -1.975  -41.317 1.00 43.01  ? 121  GLY B C   1 
ATOM   5101 O  O   . GLY B  1 121 ? 10.696  -2.923  -41.880 1.00 38.29  ? 121  GLY B O   1 
ATOM   5102 N  N   . GLY B  1 122 ? 10.788  -1.119  -40.526 1.00 41.93  ? 122  GLY B N   1 
ATOM   5103 C  CA  . GLY B  1 122 ? 12.204  -1.251  -40.212 1.00 39.69  ? 122  GLY B CA  1 
ATOM   5104 C  C   . GLY B  1 122 ? 13.176  -1.219  -41.384 1.00 42.37  ? 122  GLY B C   1 
ATOM   5105 O  O   . GLY B  1 122 ? 14.265  -1.790  -41.296 1.00 44.20  ? 122  GLY B O   1 
ATOM   5106 N  N   . PHE B  1 123 ? 12.790  -0.555  -42.472 1.00 42.87  ? 123  PHE B N   1 
ATOM   5107 C  CA  . PHE B  1 123 ? 13.591  -0.517  -43.706 1.00 39.03  ? 123  PHE B CA  1 
ATOM   5108 C  C   . PHE B  1 123 ? 13.821  -1.900  -44.334 1.00 41.02  ? 123  PHE B C   1 
ATOM   5109 O  O   . PHE B  1 123 ? 14.639  -2.037  -45.249 1.00 45.57  ? 123  PHE B O   1 
ATOM   5110 C  CB  . PHE B  1 123 ? 14.944  0.190   -43.487 1.00 35.65  ? 123  PHE B CB  1 
ATOM   5111 C  CG  . PHE B  1 123 ? 14.832  1.664   -43.186 1.00 38.30  ? 123  PHE B CG  1 
ATOM   5112 C  CD1 . PHE B  1 123 ? 14.433  2.563   -44.171 1.00 34.00  ? 123  PHE B CD1 1 
ATOM   5113 C  CD2 . PHE B  1 123 ? 15.151  2.153   -41.926 1.00 33.86  ? 123  PHE B CD2 1 
ATOM   5114 C  CE1 . PHE B  1 123 ? 14.335  3.922   -43.899 1.00 32.68  ? 123  PHE B CE1 1 
ATOM   5115 C  CE2 . PHE B  1 123 ? 15.056  3.511   -41.643 1.00 25.34  ? 123  PHE B CE2 1 
ATOM   5116 C  CZ  . PHE B  1 123 ? 14.649  4.397   -42.631 1.00 34.96  ? 123  PHE B CZ  1 
ATOM   5117 N  N   . TYR B  1 124 ? 13.109  -2.916  -43.844 1.00 40.05  ? 124  TYR B N   1 
ATOM   5118 C  CA  . TYR B  1 124 ? 13.242  -4.277  -44.376 1.00 38.47  ? 124  TYR B CA  1 
ATOM   5119 C  C   . TYR B  1 124 ? 11.920  -4.818  -44.920 1.00 38.82  ? 124  TYR B C   1 
ATOM   5120 O  O   . TYR B  1 124 ? 11.881  -5.879  -45.550 1.00 39.14  ? 124  TYR B O   1 
ATOM   5121 C  CB  . TYR B  1 124 ? 13.813  -5.238  -43.320 1.00 37.04  ? 124  TYR B CB  1 
ATOM   5122 C  CG  . TYR B  1 124 ? 12.839  -5.666  -42.236 1.00 44.28  ? 124  TYR B CG  1 
ATOM   5123 C  CD1 . TYR B  1 124 ? 12.004  -6.766  -42.411 1.00 42.16  ? 124  TYR B CD1 1 
ATOM   5124 C  CD2 . TYR B  1 124 ? 12.779  -4.989  -41.027 1.00 45.04  ? 124  TYR B CD2 1 
ATOM   5125 C  CE1 . TYR B  1 124 ? 11.124  -7.159  -41.425 1.00 44.32  ? 124  TYR B CE1 1 
ATOM   5126 C  CE2 . TYR B  1 124 ? 11.902  -5.376  -40.035 1.00 46.09  ? 124  TYR B CE2 1 
ATOM   5127 C  CZ  . TYR B  1 124 ? 11.079  -6.462  -40.238 1.00 48.61  ? 124  TYR B CZ  1 
ATOM   5128 O  OH  . TYR B  1 124 ? 10.205  -6.851  -39.250 1.00 48.01  ? 124  TYR B OH  1 
ATOM   5129 N  N   . SER B  1 125 ? 10.842  -4.082  -44.672 1.00 31.70  ? 125  SER B N   1 
ATOM   5130 C  CA  . SER B  1 125 ? 9.512   -4.535  -45.050 1.00 34.25  ? 125  SER B CA  1 
ATOM   5131 C  C   . SER B  1 125 ? 8.566   -3.361  -45.236 1.00 37.85  ? 125  SER B C   1 
ATOM   5132 O  O   . SER B  1 125 ? 8.943   -2.203  -45.024 1.00 36.92  ? 125  SER B O   1 
ATOM   5133 C  CB  . SER B  1 125 ? 8.956   -5.465  -43.975 1.00 45.00  ? 125  SER B CB  1 
ATOM   5134 O  OG  . SER B  1 125 ? 8.875   -4.802  -42.725 1.00 45.82  ? 125  SER B OG  1 
ATOM   5135 N  N   . GLY B  1 126 ? 7.335   -3.670  -45.632 1.00 39.33  ? 126  GLY B N   1 
ATOM   5136 C  CA  . GLY B  1 126 ? 6.304   -2.661  -45.774 1.00 38.62  ? 126  GLY B CA  1 
ATOM   5137 C  C   . GLY B  1 126 ? 5.755   -2.566  -47.183 1.00 42.39  ? 126  GLY B C   1 
ATOM   5138 O  O   . GLY B  1 126 ? 6.382   -3.021  -48.142 1.00 43.36  ? 126  GLY B O   1 
ATOM   5139 N  N   . ALA B  1 127 ? 4.574   -1.966  -47.298 1.00 40.55  ? 127  ALA B N   1 
ATOM   5140 C  CA  . ALA B  1 127 ? 3.932   -1.735  -48.586 1.00 39.39  ? 127  ALA B CA  1 
ATOM   5141 C  C   . ALA B  1 127 ? 2.876   -0.654  -48.428 1.00 39.02  ? 127  ALA B C   1 
ATOM   5142 O  O   . ALA B  1 127 ? 2.307   -0.494  -47.351 1.00 41.87  ? 127  ALA B O   1 
ATOM   5143 C  CB  . ALA B  1 127 ? 3.300   -3.015  -49.102 1.00 39.41  ? 127  ALA B CB  1 
ATOM   5144 N  N   . ALA B  1 128 ? 2.603   0.078   -49.501 1.00 33.46  ? 128  ALA B N   1 
ATOM   5145 C  CA  . ALA B  1 128 ? 1.616   1.151   -49.456 1.00 32.50  ? 128  ALA B CA  1 
ATOM   5146 C  C   . ALA B  1 128 ? 0.216   0.623   -49.736 1.00 35.99  ? 128  ALA B C   1 
ATOM   5147 O  O   . ALA B  1 128 ? -0.736  1.398   -49.824 1.00 44.52  ? 128  ALA B O   1 
ATOM   5148 C  CB  . ALA B  1 128 ? 1.977   2.242   -50.448 1.00 25.67  ? 128  ALA B CB  1 
ATOM   5149 N  N   . SER B  1 129 ? 0.096   -0.695  -49.877 1.00 38.83  ? 129  SER B N   1 
ATOM   5150 C  CA  . SER B  1 129 ? -1.181  -1.316  -50.215 1.00 37.98  ? 129  SER B CA  1 
ATOM   5151 C  C   . SER B  1 129 ? -1.916  -1.884  -48.998 1.00 36.42  ? 129  SER B C   1 
ATOM   5152 O  O   . SER B  1 129 ? -3.041  -2.369  -49.123 1.00 38.16  ? 129  SER B O   1 
ATOM   5153 C  CB  . SER B  1 129 ? -0.987  -2.404  -51.275 1.00 40.08  ? 129  SER B CB  1 
ATOM   5154 O  OG  . SER B  1 129 ? -0.100  -3.412  -50.826 1.00 40.79  ? 129  SER B OG  1 
ATOM   5155 N  N   . LEU B  1 130 ? -1.285  -1.814  -47.827 1.00 32.29  ? 130  LEU B N   1 
ATOM   5156 C  CA  . LEU B  1 130 ? -1.894  -2.306  -46.589 1.00 42.55  ? 130  LEU B CA  1 
ATOM   5157 C  C   . LEU B  1 130 ? -3.191  -1.565  -46.257 1.00 43.81  ? 130  LEU B C   1 
ATOM   5158 O  O   . LEU B  1 130 ? -3.340  -0.384  -46.579 1.00 48.94  ? 130  LEU B O   1 
ATOM   5159 C  CB  . LEU B  1 130 ? -0.906  -2.198  -45.421 1.00 44.75  ? 130  LEU B CB  1 
ATOM   5160 C  CG  . LEU B  1 130 ? 0.446   -2.898  -45.597 1.00 46.41  ? 130  LEU B CG  1 
ATOM   5161 C  CD1 . LEU B  1 130 ? 1.275   -2.826  -44.322 1.00 42.21  ? 130  LEU B CD1 1 
ATOM   5162 C  CD2 . LEU B  1 130 ? 0.266   -4.341  -46.028 1.00 45.71  ? 130  LEU B CD2 1 
ATOM   5163 N  N   . ASP B  1 131 ? -4.125  -2.270  -45.622 1.00 41.86  ? 131  ASP B N   1 
ATOM   5164 C  CA  . ASP B  1 131 ? -5.428  -1.705  -45.273 1.00 44.39  ? 131  ASP B CA  1 
ATOM   5165 C  C   . ASP B  1 131 ? -5.344  -0.494  -44.336 1.00 45.88  ? 131  ASP B C   1 
ATOM   5166 O  O   . ASP B  1 131 ? -6.148  0.430   -44.446 1.00 53.01  ? 131  ASP B O   1 
ATOM   5167 C  CB  . ASP B  1 131 ? -6.334  -2.781  -44.663 1.00 50.07  ? 131  ASP B CB  1 
ATOM   5168 C  CG  . ASP B  1 131 ? -6.641  -3.908  -45.631 1.00 63.72  ? 131  ASP B CG  1 
ATOM   5169 O  OD1 . ASP B  1 131 ? -6.461  -3.715  -46.852 1.00 67.52  ? 131  ASP B OD1 1 
ATOM   5170 O  OD2 . ASP B  1 131 ? -7.073  -4.984  -45.169 1.00 68.04  ? 131  ASP B OD2 1 
ATOM   5171 N  N   . VAL B  1 132 ? -4.372  -0.495  -43.422 1.00 40.59  ? 132  VAL B N   1 
ATOM   5172 C  CA  . VAL B  1 132 ? -4.224  0.608   -42.467 1.00 45.92  ? 132  VAL B CA  1 
ATOM   5173 C  C   . VAL B  1 132 ? -3.749  1.903   -43.120 1.00 49.23  ? 132  VAL B C   1 
ATOM   5174 O  O   . VAL B  1 132 ? -3.777  2.964   -42.495 1.00 57.64  ? 132  VAL B O   1 
ATOM   5175 C  CB  . VAL B  1 132 ? -3.273  0.254   -41.289 1.00 44.23  ? 132  VAL B CB  1 
ATOM   5176 C  CG1 . VAL B  1 132 ? -3.926  -0.742  -40.356 1.00 41.59  ? 132  VAL B CG1 1 
ATOM   5177 C  CG2 . VAL B  1 132 ? -1.944  -0.281  -41.801 1.00 42.15  ? 132  VAL B CG2 1 
ATOM   5178 N  N   . TYR B  1 133 ? -3.314  1.811   -44.374 1.00 44.78  ? 133  TYR B N   1 
ATOM   5179 C  CA  . TYR B  1 133 ? -2.858  2.983   -45.117 1.00 41.84  ? 133  TYR B CA  1 
ATOM   5180 C  C   . TYR B  1 133 ? -3.875  3.404   -46.177 1.00 40.78  ? 133  TYR B C   1 
ATOM   5181 O  O   . TYR B  1 133 ? -3.563  4.203   -47.062 1.00 47.77  ? 133  TYR B O   1 
ATOM   5182 C  CB  . TYR B  1 133 ? -1.502  2.715   -45.784 1.00 41.42  ? 133  TYR B CB  1 
ATOM   5183 C  CG  . TYR B  1 133 ? -0.427  2.187   -44.855 1.00 36.16  ? 133  TYR B CG  1 
ATOM   5184 C  CD1 . TYR B  1 133 ? -0.388  2.554   -43.517 1.00 34.95  ? 133  TYR B CD1 1 
ATOM   5185 C  CD2 . TYR B  1 133 ? 0.549   1.318   -45.324 1.00 31.04  ? 133  TYR B CD2 1 
ATOM   5186 C  CE1 . TYR B  1 133 ? 0.594   2.067   -42.672 1.00 31.99  ? 133  TYR B CE1 1 
ATOM   5187 C  CE2 . TYR B  1 133 ? 1.533   0.828   -44.491 1.00 34.27  ? 133  TYR B CE2 1 
ATOM   5188 C  CZ  . TYR B  1 133 ? 1.551   1.205   -43.167 1.00 37.05  ? 133  TYR B CZ  1 
ATOM   5189 O  OH  . TYR B  1 133 ? 2.531   0.716   -42.336 1.00 36.19  ? 133  TYR B OH  1 
ATOM   5190 N  N   . ASP B  1 134 ? -5.086  2.860   -46.088 1.00 39.82  ? 134  ASP B N   1 
ATOM   5191 C  CA  . ASP B  1 134 ? -6.159  3.219   -47.014 1.00 42.89  ? 134  ASP B CA  1 
ATOM   5192 C  C   . ASP B  1 134 ? -6.462  4.712   -46.909 1.00 47.82  ? 134  ASP B C   1 
ATOM   5193 O  O   . ASP B  1 134 ? -6.868  5.199   -45.850 1.00 43.70  ? 134  ASP B O   1 
ATOM   5194 C  CB  . ASP B  1 134 ? -7.416  2.396   -46.714 1.00 45.10  ? 134  ASP B CB  1 
ATOM   5195 C  CG  . ASP B  1 134 ? -8.464  2.502   -47.804 1.00 50.18  ? 134  ASP B CG  1 
ATOM   5196 O  OD1 . ASP B  1 134 ? -8.555  3.561   -48.462 1.00 52.27  ? 134  ASP B OD1 1 
ATOM   5197 O  OD2 . ASP B  1 134 ? -9.209  1.519   -47.999 1.00 52.89  ? 134  ASP B OD2 1 
ATOM   5198 N  N   . GLY B  1 135 ? -6.268  5.432   -48.011 1.00 42.04  ? 135  GLY B N   1 
ATOM   5199 C  CA  . GLY B  1 135 ? -6.392  6.880   -48.010 1.00 43.28  ? 135  GLY B CA  1 
ATOM   5200 C  C   . GLY B  1 135 ? -7.767  7.421   -48.374 1.00 43.42  ? 135  GLY B C   1 
ATOM   5201 O  O   . GLY B  1 135 ? -7.935  8.633   -48.527 1.00 45.11  ? 135  GLY B O   1 
ATOM   5202 N  N   . ARG B  1 136 ? -8.755  6.538   -48.499 1.00 37.42  ? 136  ARG B N   1 
ATOM   5203 C  CA  . ARG B  1 136 ? -10.090 6.945   -48.949 1.00 47.78  ? 136  ARG B CA  1 
ATOM   5204 C  C   . ARG B  1 136 ? -10.831 7.829   -47.934 1.00 50.73  ? 136  ARG B C   1 
ATOM   5205 O  O   . ARG B  1 136 ? -11.604 8.712   -48.315 1.00 54.54  ? 136  ARG B O   1 
ATOM   5206 C  CB  . ARG B  1 136 ? -10.936 5.718   -49.341 1.00 48.84  ? 136  ARG B CB  1 
ATOM   5207 C  CG  . ARG B  1 136 ? -11.697 5.061   -48.191 1.00 52.46  ? 136  ARG B CG  1 
ATOM   5208 C  CD  . ARG B  1 136 ? -11.675 3.538   -48.269 1.00 51.17  ? 136  ARG B CD  1 
ATOM   5209 N  NE  . ARG B  1 136 ? -12.625 2.980   -49.229 1.00 63.35  ? 136  ARG B NE  1 
ATOM   5210 C  CZ  . ARG B  1 136 ? -12.375 1.926   -50.003 1.00 65.28  ? 136  ARG B CZ  1 
ATOM   5211 N  NH1 . ARG B  1 136 ? -11.198 1.319   -49.949 1.00 63.34  ? 136  ARG B NH1 1 
ATOM   5212 N  NH2 . ARG B  1 136 ? -13.299 1.479   -50.840 1.00 69.79  ? 136  ARG B NH2 1 
ATOM   5213 N  N   . PHE B  1 137 ? -10.585 7.598   -46.648 1.00 45.95  ? 137  PHE B N   1 
ATOM   5214 C  CA  . PHE B  1 137 ? -11.284 8.334   -45.599 1.00 48.23  ? 137  PHE B CA  1 
ATOM   5215 C  C   . PHE B  1 137 ? -10.818 9.788   -45.534 1.00 46.24  ? 137  PHE B C   1 
ATOM   5216 O  O   . PHE B  1 137 ? -11.635 10.710  -45.481 1.00 48.51  ? 137  PHE B O   1 
ATOM   5217 C  CB  . PHE B  1 137 ? -11.091 7.649   -44.240 1.00 46.13  ? 137  PHE B CB  1 
ATOM   5218 C  CG  . PHE B  1 137 ? -11.420 6.181   -44.247 1.00 54.94  ? 137  PHE B CG  1 
ATOM   5219 C  CD1 . PHE B  1 137 ? -12.741 5.750   -44.257 1.00 56.31  ? 137  PHE B CD1 1 
ATOM   5220 C  CD2 . PHE B  1 137 ? -10.407 5.231   -44.235 1.00 57.94  ? 137  PHE B CD2 1 
ATOM   5221 C  CE1 . PHE B  1 137 ? -13.046 4.396   -44.263 1.00 57.99  ? 137  PHE B CE1 1 
ATOM   5222 C  CE2 . PHE B  1 137 ? -10.703 3.875   -44.241 1.00 59.81  ? 137  PHE B CE2 1 
ATOM   5223 C  CZ  . PHE B  1 137 ? -12.024 3.457   -44.255 1.00 59.59  ? 137  PHE B CZ  1 
ATOM   5224 N  N   . LEU B  1 138 ? -9.503  9.985   -45.539 1.00 41.07  ? 138  LEU B N   1 
ATOM   5225 C  CA  . LEU B  1 138 ? -8.920  11.326  -45.530 1.00 43.20  ? 138  LEU B CA  1 
ATOM   5226 C  C   . LEU B  1 138 ? -9.307  12.124  -46.779 1.00 49.11  ? 138  LEU B C   1 
ATOM   5227 O  O   . LEU B  1 138 ? -9.475  13.344  -46.725 1.00 51.39  ? 138  LEU B O   1 
ATOM   5228 C  CB  . LEU B  1 138 ? -7.397  11.243  -45.379 1.00 39.29  ? 138  LEU B CB  1 
ATOM   5229 C  CG  . LEU B  1 138 ? -6.911  10.904  -43.966 1.00 42.68  ? 138  LEU B CG  1 
ATOM   5230 C  CD1 . LEU B  1 138 ? -5.542  10.249  -43.969 1.00 39.84  ? 138  LEU B CD1 1 
ATOM   5231 C  CD2 . LEU B  1 138 ? -6.883  12.158  -43.118 1.00 41.93  ? 138  LEU B CD2 1 
ATOM   5232 N  N   . ALA B  1 139 ? -9.466  11.427  -47.899 1.00 49.12  ? 139  ALA B N   1 
ATOM   5233 C  CA  . ALA B  1 139 ? -9.864  12.073  -49.142 1.00 45.51  ? 139  ALA B CA  1 
ATOM   5234 C  C   . ALA B  1 139 ? -11.336 12.480  -49.134 1.00 48.84  ? 139  ALA B C   1 
ATOM   5235 O  O   . ALA B  1 139 ? -11.696 13.542  -49.640 1.00 53.06  ? 139  ALA B O   1 
ATOM   5236 C  CB  . ALA B  1 139 ? -9.568  11.165  -50.328 1.00 34.27  ? 139  ALA B CB  1 
ATOM   5237 N  N   . GLN B  1 140 ? -12.186 11.632  -48.565 1.00 51.60  ? 140  GLN B N   1 
ATOM   5238 C  CA  . GLN B  1 140 ? -13.628 11.876  -48.568 1.00 52.18  ? 140  GLN B CA  1 
ATOM   5239 C  C   . GLN B  1 140 ? -14.050 12.865  -47.477 1.00 55.53  ? 140  GLN B C   1 
ATOM   5240 O  O   . GLN B  1 140 ? -14.779 13.823  -47.743 1.00 57.40  ? 140  GLN B O   1 
ATOM   5241 C  CB  . GLN B  1 140 ? -14.383 10.551  -48.404 1.00 53.64  ? 140  GLN B CB  1 
ATOM   5242 C  CG  . GLN B  1 140 ? -15.815 10.560  -48.939 1.00 56.52  ? 140  GLN B CG  1 
ATOM   5243 C  CD  . GLN B  1 140 ? -16.784 11.307  -48.039 1.00 61.60  ? 140  GLN B CD  1 
ATOM   5244 O  OE1 . GLN B  1 140 ? -16.877 11.031  -46.842 1.00 62.02  ? 140  GLN B OE1 1 
ATOM   5245 N  NE2 . GLN B  1 140 ? -17.508 12.261  -48.612 1.00 57.18  ? 140  GLN B NE2 1 
ATOM   5246 N  N   . VAL B  1 141 ? -13.585 12.626  -46.254 1.00 51.22  ? 141  VAL B N   1 
ATOM   5247 C  CA  . VAL B  1 141 ? -13.992 13.429  -45.103 1.00 50.40  ? 141  VAL B CA  1 
ATOM   5248 C  C   . VAL B  1 141 ? -13.313 14.799  -45.056 1.00 53.62  ? 141  VAL B C   1 
ATOM   5249 O  O   . VAL B  1 141 ? -13.972 15.816  -44.828 1.00 55.87  ? 141  VAL B O   1 
ATOM   5250 C  CB  . VAL B  1 141 ? -13.735 12.670  -43.778 1.00 56.74  ? 141  VAL B CB  1 
ATOM   5251 C  CG1 . VAL B  1 141 ? -14.185 13.496  -42.578 1.00 41.97  ? 141  VAL B CG1 1 
ATOM   5252 C  CG2 . VAL B  1 141 ? -14.451 11.334  -43.793 1.00 56.92  ? 141  VAL B CG2 1 
ATOM   5253 N  N   . GLU B  1 142 ? -12.001 14.824  -45.273 1.00 52.32  ? 142  GLU B N   1 
ATOM   5254 C  CA  . GLU B  1 142 ? -11.239 16.068  -45.183 1.00 51.56  ? 142  GLU B CA  1 
ATOM   5255 C  C   . GLU B  1 142 ? -10.903 16.673  -46.543 1.00 56.54  ? 142  GLU B C   1 
ATOM   5256 O  O   . GLU B  1 142 ? -10.259 17.721  -46.618 1.00 56.17  ? 142  GLU B O   1 
ATOM   5257 C  CB  . GLU B  1 142 ? -9.961  15.858  -44.370 1.00 54.96  ? 142  GLU B CB  1 
ATOM   5258 C  CG  . GLU B  1 142 ? -10.204 15.601  -42.890 1.00 62.43  ? 142  GLU B CG  1 
ATOM   5259 C  CD  . GLU B  1 142 ? -10.879 16.767  -42.193 1.00 70.69  ? 142  GLU B CD  1 
ATOM   5260 O  OE1 . GLU B  1 142 ? -10.713 17.919  -42.647 1.00 74.97  ? 142  GLU B OE1 1 
ATOM   5261 O  OE2 . GLU B  1 142 ? -11.580 16.532  -41.186 1.00 72.75  ? 142  GLU B OE2 1 
ATOM   5262 N  N   . GLY B  1 143 ? -11.343 16.014  -47.611 1.00 54.18  ? 143  GLY B N   1 
ATOM   5263 C  CA  . GLY B  1 143 ? -11.119 16.507  -48.958 1.00 53.71  ? 143  GLY B CA  1 
ATOM   5264 C  C   . GLY B  1 143 ? -9.655  16.620  -49.337 1.00 54.05  ? 143  GLY B C   1 
ATOM   5265 O  O   . GLY B  1 143 ? -9.275  17.511  -50.093 1.00 56.24  ? 143  GLY B O   1 
ATOM   5266 N  N   . ALA B  1 144 ? -8.837  15.710  -48.817 1.00 50.36  ? 144  ALA B N   1 
ATOM   5267 C  CA  . ALA B  1 144 ? -7.395  15.747  -49.050 1.00 46.40  ? 144  ALA B CA  1 
ATOM   5268 C  C   . ALA B  1 144 ? -6.969  14.911  -50.251 1.00 47.09  ? 144  ALA B C   1 
ATOM   5269 O  O   . ALA B  1 144 ? -7.590  13.892  -50.554 1.00 47.61  ? 144  ALA B O   1 
ATOM   5270 C  CB  . ALA B  1 144 ? -6.655  15.276  -47.808 1.00 33.24  ? 144  ALA B CB  1 
ATOM   5271 N  N   . VAL B  1 145 ? -5.906  15.341  -50.929 1.00 41.28  ? 145  VAL B N   1 
ATOM   5272 C  CA  . VAL B  1 145 ? -5.240  14.491  -51.912 1.00 44.97  ? 145  VAL B CA  1 
ATOM   5273 C  C   . VAL B  1 145 ? -4.139  13.726  -51.193 1.00 42.76  ? 145  VAL B C   1 
ATOM   5274 O  O   . VAL B  1 145 ? -3.188  14.325  -50.686 1.00 38.07  ? 145  VAL B O   1 
ATOM   5275 C  CB  . VAL B  1 145 ? -4.628  15.295  -53.076 1.00 40.74  ? 145  VAL B CB  1 
ATOM   5276 C  CG1 . VAL B  1 145 ? -3.834  14.375  -53.992 1.00 30.40  ? 145  VAL B CG1 1 
ATOM   5277 C  CG2 . VAL B  1 145 ? -5.715  16.000  -53.862 1.00 36.67  ? 145  VAL B CG2 1 
ATOM   5278 N  N   . LEU B  1 146 ? -4.275  12.405  -51.129 1.00 43.34  ? 146  LEU B N   1 
ATOM   5279 C  CA  . LEU B  1 146 ? -3.311  11.590  -50.399 1.00 43.98  ? 146  LEU B CA  1 
ATOM   5280 C  C   . LEU B  1 146 ? -2.489  10.718  -51.341 1.00 41.89  ? 146  LEU B C   1 
ATOM   5281 O  O   . LEU B  1 146 ? -3.034  10.059  -52.230 1.00 46.81  ? 146  LEU B O   1 
ATOM   5282 C  CB  . LEU B  1 146 ? -4.013  10.731  -49.342 1.00 47.73  ? 146  LEU B CB  1 
ATOM   5283 C  CG  . LEU B  1 146 ? -3.085  10.073  -48.316 1.00 50.69  ? 146  LEU B CG  1 
ATOM   5284 C  CD1 . LEU B  1 146 ? -3.564  10.337  -46.908 1.00 55.58  ? 146  LEU B CD1 1 
ATOM   5285 C  CD2 . LEU B  1 146 ? -2.980  8.583   -48.560 1.00 53.56  ? 146  LEU B CD2 1 
ATOM   5286 N  N   . VAL B  1 147 ? -1.174  10.721  -51.139 1.00 40.79  ? 147  VAL B N   1 
ATOM   5287 C  CA  . VAL B  1 147 ? -0.261  9.948   -51.974 1.00 37.95  ? 147  VAL B CA  1 
ATOM   5288 C  C   . VAL B  1 147 ? 0.568   8.989   -51.121 1.00 38.89  ? 147  VAL B C   1 
ATOM   5289 O  O   . VAL B  1 147 ? 0.984   9.337   -50.018 1.00 44.87  ? 147  VAL B O   1 
ATOM   5290 C  CB  . VAL B  1 147 ? 0.681   10.879  -52.767 1.00 41.57  ? 147  VAL B CB  1 
ATOM   5291 C  CG1 . VAL B  1 147 ? 1.560   10.082  -53.724 1.00 33.13  ? 147  VAL B CG1 1 
ATOM   5292 C  CG2 . VAL B  1 147 ? -0.126  11.907  -53.535 1.00 44.22  ? 147  VAL B CG2 1 
ATOM   5293 N  N   . SER B  1 148 ? 0.784   7.775   -51.622 1.00 39.57  ? 148  SER B N   1 
ATOM   5294 C  CA  . SER B  1 148 ? 1.694   6.830   -50.979 1.00 39.22  ? 148  SER B CA  1 
ATOM   5295 C  C   . SER B  1 148 ? 2.463   6.054   -52.040 1.00 40.06  ? 148  SER B C   1 
ATOM   5296 O  O   . SER B  1 148 ? 1.884   5.627   -53.045 1.00 36.91  ? 148  SER B O   1 
ATOM   5297 C  CB  . SER B  1 148 ? 0.937   5.868   -50.060 1.00 36.40  ? 148  SER B CB  1 
ATOM   5298 O  OG  . SER B  1 148 ? 0.081   5.012   -50.797 1.00 38.91  ? 148  SER B OG  1 
ATOM   5299 N  N   . MET B  1 149 ? 3.765   5.882   -51.827 1.00 35.39  ? 149  MET B N   1 
ATOM   5300 C  CA  . MET B  1 149 ? 4.596   5.150   -52.782 1.00 36.79  ? 149  MET B CA  1 
ATOM   5301 C  C   . MET B  1 149 ? 5.155   3.866   -52.188 1.00 40.16  ? 149  MET B C   1 
ATOM   5302 O  O   . MET B  1 149 ? 5.185   3.687   -50.968 1.00 44.03  ? 149  MET B O   1 
ATOM   5303 C  CB  . MET B  1 149 ? 5.762   6.024   -53.251 1.00 34.64  ? 149  MET B CB  1 
ATOM   5304 C  CG  . MET B  1 149 ? 6.963   6.007   -52.312 1.00 42.15  ? 149  MET B CG  1 
ATOM   5305 S  SD  . MET B  1 149 ? 6.664   6.788   -50.712 1.00 42.64  ? 149  MET B SD  1 
ATOM   5306 C  CE  . MET B  1 149 ? 6.763   8.516   -51.178 1.00 30.98  ? 149  MET B CE  1 
ATOM   5307 N  N   . ASN B  1 150 ? 5.591   2.967   -53.059 1.00 31.31  ? 150  ASN B N   1 
ATOM   5308 C  CA  . ASN B  1 150 ? 6.421   1.855   -52.633 1.00 32.91  ? 150  ASN B CA  1 
ATOM   5309 C  C   . ASN B  1 150 ? 7.878   2.261   -52.813 1.00 32.70  ? 150  ASN B C   1 
ATOM   5310 O  O   . ASN B  1 150 ? 8.217   2.950   -53.776 1.00 40.31  ? 150  ASN B O   1 
ATOM   5311 C  CB  . ASN B  1 150 ? 6.121   0.602   -53.462 1.00 42.14  ? 150  ASN B CB  1 
ATOM   5312 C  CG  . ASN B  1 150 ? 4.864   -0.119  -53.008 1.00 47.63  ? 150  ASN B CG  1 
ATOM   5313 O  OD1 . ASN B  1 150 ? 4.152   0.344   -52.117 1.00 46.16  ? 150  ASN B OD1 1 
ATOM   5314 N  ND2 . ASN B  1 150 ? 4.583   -1.257  -53.631 1.00 50.89  ? 150  ASN B ND2 1 
ATOM   5315 N  N   . TYR B  1 151 ? 8.728   1.859   -51.875 1.00 35.43  ? 151  TYR B N   1 
ATOM   5316 C  CA  . TYR B  1 151 ? 10.167  2.071   -51.998 1.00 33.31  ? 151  TYR B CA  1 
ATOM   5317 C  C   . TYR B  1 151 ? 10.883  0.782   -51.621 1.00 35.26  ? 151  TYR B C   1 
ATOM   5318 O  O   . TYR B  1 151 ? 10.409  0.033   -50.764 1.00 39.13  ? 151  TYR B O   1 
ATOM   5319 C  CB  . TYR B  1 151 ? 10.641  3.237   -51.120 1.00 39.80  ? 151  TYR B CB  1 
ATOM   5320 C  CG  . TYR B  1 151 ? 10.416  3.040   -49.640 1.00 35.87  ? 151  TYR B CG  1 
ATOM   5321 C  CD1 . TYR B  1 151 ? 9.226   3.432   -49.045 1.00 35.62  ? 151  TYR B CD1 1 
ATOM   5322 C  CD2 . TYR B  1 151 ? 11.400  2.478   -48.835 1.00 34.65  ? 151  TYR B CD2 1 
ATOM   5323 C  CE1 . TYR B  1 151 ? 9.019   3.263   -47.694 1.00 36.18  ? 151  TYR B CE1 1 
ATOM   5324 C  CE2 . TYR B  1 151 ? 11.201  2.304   -47.484 1.00 43.99  ? 151  TYR B CE2 1 
ATOM   5325 C  CZ  . TYR B  1 151 ? 10.011  2.696   -46.920 1.00 43.81  ? 151  TYR B CZ  1 
ATOM   5326 O  OH  . TYR B  1 151 ? 9.820   2.517   -45.571 1.00 42.61  ? 151  TYR B OH  1 
ATOM   5327 N  N   . ARG B  1 152 ? 12.016  0.522   -52.267 1.00 36.89  ? 152  ARG B N   1 
ATOM   5328 C  CA  . ARG B  1 152 ? 12.764  -0.711  -52.038 1.00 41.77  ? 152  ARG B CA  1 
ATOM   5329 C  C   . ARG B  1 152 ? 13.259  -0.839  -50.596 1.00 44.70  ? 152  ARG B C   1 
ATOM   5330 O  O   . ARG B  1 152 ? 13.799  0.109   -50.022 1.00 39.96  ? 152  ARG B O   1 
ATOM   5331 C  CB  . ARG B  1 152 ? 13.930  -0.816  -53.026 1.00 39.92  ? 152  ARG B CB  1 
ATOM   5332 C  CG  . ARG B  1 152 ? 13.502  -1.121  -54.459 1.00 37.96  ? 152  ARG B CG  1 
ATOM   5333 C  CD  . ARG B  1 152 ? 14.683  -1.048  -55.417 1.00 36.09  ? 152  ARG B CD  1 
ATOM   5334 N  NE  . ARG B  1 152 ? 15.070  0.334   -55.690 1.00 34.97  ? 152  ARG B NE  1 
ATOM   5335 C  CZ  . ARG B  1 152 ? 16.167  0.693   -56.348 1.00 36.03  ? 152  ARG B CZ  1 
ATOM   5336 N  NH1 . ARG B  1 152 ? 17.005  -0.228  -56.807 1.00 33.03  ? 152  ARG B NH1 1 
ATOM   5337 N  NH2 . ARG B  1 152 ? 16.427  1.978   -56.542 1.00 34.01  ? 152  ARG B NH2 1 
ATOM   5338 N  N   . VAL B  1 153 ? 13.052  -2.019  -50.016 1.00 43.65  ? 153  VAL B N   1 
ATOM   5339 C  CA  . VAL B  1 153 ? 13.468  -2.301  -48.646 1.00 44.08  ? 153  VAL B CA  1 
ATOM   5340 C  C   . VAL B  1 153 ? 14.518  -3.408  -48.627 1.00 46.79  ? 153  VAL B C   1 
ATOM   5341 O  O   . VAL B  1 153 ? 14.763  -4.057  -49.646 1.00 45.74  ? 153  VAL B O   1 
ATOM   5342 C  CB  . VAL B  1 153 ? 12.270  -2.726  -47.770 1.00 37.66  ? 153  VAL B CB  1 
ATOM   5343 C  CG1 . VAL B  1 153 ? 11.306  -1.568  -47.588 1.00 33.10  ? 153  VAL B CG1 1 
ATOM   5344 C  CG2 . VAL B  1 153 ? 11.549  -3.915  -48.390 1.00 32.05  ? 153  VAL B CG2 1 
ATOM   5345 N  N   . GLY B  1 154 ? 15.135  -3.624  -47.468 1.00 42.81  ? 154  GLY B N   1 
ATOM   5346 C  CA  . GLY B  1 154 ? 16.130  -4.672  -47.316 1.00 37.19  ? 154  GLY B CA  1 
ATOM   5347 C  C   . GLY B  1 154 ? 17.370  -4.468  -48.168 1.00 36.97  ? 154  GLY B C   1 
ATOM   5348 O  O   . GLY B  1 154 ? 17.782  -3.333  -48.414 1.00 37.72  ? 154  GLY B O   1 
ATOM   5349 N  N   . THR B  1 155 ? 17.967  -5.572  -48.611 1.00 38.35  ? 155  THR B N   1 
ATOM   5350 C  CA  . THR B  1 155 ? 19.158  -5.529  -49.454 1.00 46.27  ? 155  THR B CA  1 
ATOM   5351 C  C   . THR B  1 155 ? 18.917  -4.707  -50.715 1.00 44.53  ? 155  THR B C   1 
ATOM   5352 O  O   . THR B  1 155 ? 19.763  -3.918  -51.137 1.00 45.67  ? 155  THR B O   1 
ATOM   5353 C  CB  . THR B  1 155 ? 19.615  -6.947  -49.852 1.00 44.36  ? 155  THR B CB  1 
ATOM   5354 O  OG1 . THR B  1 155 ? 18.518  -7.668  -50.426 1.00 45.56  ? 155  THR B OG1 1 
ATOM   5355 C  CG2 . THR B  1 155 ? 20.118  -7.698  -48.640 1.00 41.72  ? 155  THR B CG2 1 
ATOM   5356 N  N   . PHE B  1 156 ? 17.741  -4.880  -51.299 1.00 32.18  ? 156  PHE B N   1 
ATOM   5357 C  CA  . PHE B  1 156 ? 17.408  -4.223  -52.554 1.00 44.85  ? 156  PHE B CA  1 
ATOM   5358 C  C   . PHE B  1 156 ? 17.353  -2.701  -52.421 1.00 45.75  ? 156  PHE B C   1 
ATOM   5359 O  O   . PHE B  1 156 ? 17.631  -1.980  -53.380 1.00 41.83  ? 156  PHE B O   1 
ATOM   5360 C  CB  . PHE B  1 156 ? 16.085  -4.780  -53.082 1.00 44.18  ? 156  PHE B CB  1 
ATOM   5361 C  CG  . PHE B  1 156 ? 16.026  -6.281  -53.069 1.00 45.43  ? 156  PHE B CG  1 
ATOM   5362 C  CD1 . PHE B  1 156 ? 16.599  -7.019  -54.098 1.00 38.30  ? 156  PHE B CD1 1 
ATOM   5363 C  CD2 . PHE B  1 156 ? 15.414  -6.958  -52.019 1.00 42.29  ? 156  PHE B CD2 1 
ATOM   5364 C  CE1 . PHE B  1 156 ? 16.558  -8.404  -54.086 1.00 39.51  ? 156  PHE B CE1 1 
ATOM   5365 C  CE2 . PHE B  1 156 ? 15.368  -8.344  -51.999 1.00 43.19  ? 156  PHE B CE2 1 
ATOM   5366 C  CZ  . PHE B  1 156 ? 15.943  -9.068  -53.034 1.00 44.89  ? 156  PHE B CZ  1 
ATOM   5367 N  N   . GLY B  1 157 ? 17.016  -2.218  -51.229 1.00 37.56  ? 157  GLY B N   1 
ATOM   5368 C  CA  . GLY B  1 157 ? 16.895  -0.790  -51.004 1.00 35.49  ? 157  GLY B CA  1 
ATOM   5369 C  C   . GLY B  1 157 ? 18.072  -0.142  -50.297 1.00 38.14  ? 157  GLY B C   1 
ATOM   5370 O  O   . GLY B  1 157 ? 18.333  1.050   -50.488 1.00 39.93  ? 157  GLY B O   1 
ATOM   5371 N  N   . PHE B  1 158 ? 18.790  -0.910  -49.481 1.00 39.85  ? 158  PHE B N   1 
ATOM   5372 C  CA  . PHE B  1 158 ? 19.830  -0.310  -48.648 1.00 39.66  ? 158  PHE B CA  1 
ATOM   5373 C  C   . PHE B  1 158 ? 21.146  -1.077  -48.530 1.00 39.11  ? 158  PHE B C   1 
ATOM   5374 O  O   . PHE B  1 158 ? 22.027  -0.661  -47.772 1.00 38.95  ? 158  PHE B O   1 
ATOM   5375 C  CB  . PHE B  1 158 ? 19.272  0.019   -47.260 1.00 27.15  ? 158  PHE B CB  1 
ATOM   5376 C  CG  . PHE B  1 158 ? 18.110  0.973   -47.293 1.00 28.59  ? 158  PHE B CG  1 
ATOM   5377 C  CD1 . PHE B  1 158 ? 18.321  2.345   -47.373 1.00 28.02  ? 158  PHE B CD1 1 
ATOM   5378 C  CD2 . PHE B  1 158 ? 16.805  0.497   -47.260 1.00 30.45  ? 158  PHE B CD2 1 
ATOM   5379 C  CE1 . PHE B  1 158 ? 17.248  3.230   -47.409 1.00 32.65  ? 158  PHE B CE1 1 
ATOM   5380 C  CE2 . PHE B  1 158 ? 15.725  1.372   -47.298 1.00 30.99  ? 158  PHE B CE2 1 
ATOM   5381 C  CZ  . PHE B  1 158 ? 15.945  2.740   -47.373 1.00 31.46  ? 158  PHE B CZ  1 
ATOM   5382 N  N   . LEU B  1 159 ? 21.299  -2.179  -49.263 1.00 40.96  ? 159  LEU B N   1 
ATOM   5383 C  CA  . LEU B  1 159 ? 22.615  -2.820  -49.329 1.00 40.44  ? 159  LEU B CA  1 
ATOM   5384 C  C   . LEU B  1 159 ? 23.590  -1.850  -49.974 1.00 49.91  ? 159  LEU B C   1 
ATOM   5385 O  O   . LEU B  1 159 ? 23.338  -1.337  -51.065 1.00 60.01  ? 159  LEU B O   1 
ATOM   5386 C  CB  . LEU B  1 159 ? 22.590  -4.138  -50.113 1.00 43.68  ? 159  LEU B CB  1 
ATOM   5387 C  CG  . LEU B  1 159 ? 23.905  -4.932  -50.142 1.00 46.57  ? 159  LEU B CG  1 
ATOM   5388 C  CD1 . LEU B  1 159 ? 23.646  -6.419  -49.986 1.00 45.07  ? 159  LEU B CD1 1 
ATOM   5389 C  CD2 . LEU B  1 159 ? 24.680  -4.674  -51.422 1.00 41.83  ? 159  LEU B CD2 1 
ATOM   5390 N  N   . ALA B  1 160 ? 24.703  -1.594  -49.297 1.00 54.00  ? 160  ALA B N   1 
ATOM   5391 C  CA  . ALA B  1 160 ? 25.658  -0.604  -49.778 1.00 48.15  ? 160  ALA B CA  1 
ATOM   5392 C  C   . ALA B  1 160 ? 27.104  -1.059  -49.689 1.00 46.66  ? 160  ALA B C   1 
ATOM   5393 O  O   . ALA B  1 160 ? 27.530  -1.641  -48.690 1.00 51.42  ? 160  ALA B O   1 
ATOM   5394 C  CB  . ALA B  1 160 ? 25.488  0.706   -49.023 1.00 49.64  ? 160  ALA B CB  1 
ATOM   5395 N  N   . LEU B  1 161 ? 27.850  -0.781  -50.750 1.00 49.13  ? 161  LEU B N   1 
ATOM   5396 C  CA  . LEU B  1 161 ? 29.301  -0.793  -50.690 1.00 48.90  ? 161  LEU B CA  1 
ATOM   5397 C  C   . LEU B  1 161 ? 29.745  0.642   -50.942 1.00 48.72  ? 161  LEU B C   1 
ATOM   5398 O  O   . LEU B  1 161 ? 30.041  1.012   -52.075 1.00 53.14  ? 161  LEU B O   1 
ATOM   5399 C  CB  . LEU B  1 161 ? 29.890  -1.759  -51.724 1.00 45.81  ? 161  LEU B CB  1 
ATOM   5400 C  CG  . LEU B  1 161 ? 29.716  -3.247  -51.399 1.00 49.39  ? 161  LEU B CG  1 
ATOM   5401 C  CD1 . LEU B  1 161 ? 30.332  -4.144  -52.456 1.00 62.08  ? 161  LEU B CD1 1 
ATOM   5402 C  CD2 . LEU B  1 161 ? 30.332  -3.555  -50.054 1.00 55.44  ? 161  LEU B CD2 1 
ATOM   5403 N  N   . PRO B  1 162 ? 29.764  1.462   -49.876 1.00 47.96  ? 162  PRO B N   1 
ATOM   5404 C  CA  . PRO B  1 162 ? 29.998  2.910   -49.955 1.00 47.92  ? 162  PRO B CA  1 
ATOM   5405 C  C   . PRO B  1 162 ? 31.204  3.272   -50.808 1.00 50.59  ? 162  PRO B C   1 
ATOM   5406 O  O   . PRO B  1 162 ? 32.272  2.684   -50.646 1.00 55.12  ? 162  PRO B O   1 
ATOM   5407 C  CB  . PRO B  1 162 ? 30.253  3.297   -48.498 1.00 48.95  ? 162  PRO B CB  1 
ATOM   5408 C  CG  . PRO B  1 162 ? 29.456  2.302   -47.715 1.00 44.35  ? 162  PRO B CG  1 
ATOM   5409 C  CD  . PRO B  1 162 ? 29.568  1.013   -48.484 1.00 41.98  ? 162  PRO B CD  1 
ATOM   5410 N  N   . GLY B  1 163 ? 31.025  4.228   -51.713 1.00 53.21  ? 163  GLY B N   1 
ATOM   5411 C  CA  . GLY B  1 163 ? 32.081  4.610   -52.630 1.00 51.52  ? 163  GLY B CA  1 
ATOM   5412 C  C   . GLY B  1 163 ? 31.995  3.896   -53.965 1.00 56.28  ? 163  GLY B C   1 
ATOM   5413 O  O   . GLY B  1 163 ? 32.557  4.362   -54.960 1.00 58.19  ? 163  GLY B O   1 
ATOM   5414 N  N   . SER B  1 164 ? 31.300  2.761   -53.995 1.00 57.55  ? 164  SER B N   1 
ATOM   5415 C  CA  . SER B  1 164 ? 31.110  2.032   -55.248 1.00 54.74  ? 164  SER B CA  1 
ATOM   5416 C  C   . SER B  1 164 ? 30.108  2.752   -56.140 1.00 54.02  ? 164  SER B C   1 
ATOM   5417 O  O   . SER B  1 164 ? 29.379  3.637   -55.689 1.00 56.62  ? 164  SER B O   1 
ATOM   5418 C  CB  . SER B  1 164 ? 30.633  0.603   -54.996 1.00 50.57  ? 164  SER B CB  1 
ATOM   5419 O  OG  . SER B  1 164 ? 29.271  0.587   -54.605 1.00 45.53  ? 164  SER B OG  1 
ATOM   5420 N  N   . ARG B  1 165 ? 30.081  2.364   -57.410 1.00 52.35  ? 165  ARG B N   1 
ATOM   5421 C  CA  . ARG B  1 165 ? 29.170  2.951   -58.381 1.00 56.33  ? 165  ARG B CA  1 
ATOM   5422 C  C   . ARG B  1 165 ? 27.913  2.095   -58.501 1.00 52.63  ? 165  ARG B C   1 
ATOM   5423 O  O   . ARG B  1 165 ? 26.857  2.577   -58.917 1.00 52.89  ? 165  ARG B O   1 
ATOM   5424 C  CB  . ARG B  1 165 ? 29.864  3.055   -59.742 1.00 64.44  ? 165  ARG B CB  1 
ATOM   5425 C  CG  . ARG B  1 165 ? 29.105  3.864   -60.782 1.00 78.46  ? 165  ARG B CG  1 
ATOM   5426 C  CD  . ARG B  1 165 ? 29.510  3.469   -62.193 1.00 88.40  ? 165  ARG B CD  1 
ATOM   5427 N  NE  . ARG B  1 165 ? 29.012  2.142   -62.546 1.00 92.69  ? 165  ARG B NE  1 
ATOM   5428 C  CZ  . ARG B  1 165 ? 27.825  1.919   -63.103 1.00 94.54  ? 165  ARG B CZ  1 
ATOM   5429 N  NH1 . ARG B  1 165 ? 27.018  2.936   -63.371 1.00 97.90  ? 165  ARG B NH1 1 
ATOM   5430 N  NH2 . ARG B  1 165 ? 27.444  0.684   -63.393 1.00 90.30  ? 165  ARG B NH2 1 
ATOM   5431 N  N   . GLU B  1 166 ? 28.029  0.826   -58.116 1.00 48.52  ? 166  GLU B N   1 
ATOM   5432 C  CA  . GLU B  1 166 ? 26.958  -0.148  -58.330 1.00 55.82  ? 166  GLU B CA  1 
ATOM   5433 C  C   . GLU B  1 166 ? 26.140  -0.477  -57.076 1.00 52.25  ? 166  GLU B C   1 
ATOM   5434 O  O   . GLU B  1 166 ? 25.118  -1.161  -57.161 1.00 53.03  ? 166  GLU B O   1 
ATOM   5435 C  CB  . GLU B  1 166 ? 27.503  -1.424  -58.985 1.00 67.68  ? 166  GLU B CB  1 
ATOM   5436 C  CG  . GLU B  1 166 ? 28.893  -1.835  -58.520 1.00 77.17  ? 166  GLU B CG  1 
ATOM   5437 C  CD  . GLU B  1 166 ? 30.005  -1.077  -59.223 1.00 80.75  ? 166  GLU B CD  1 
ATOM   5438 O  OE1 . GLU B  1 166 ? 30.163  -1.249  -60.450 1.00 80.85  ? 166  GLU B OE1 1 
ATOM   5439 O  OE2 . GLU B  1 166 ? 30.720  -0.306  -58.547 1.00 74.47  ? 166  GLU B OE2 1 
ATOM   5440 N  N   . ALA B  1 167 ? 26.596  0.009   -55.923 1.00 50.02  ? 167  ALA B N   1 
ATOM   5441 C  CA  . ALA B  1 167 ? 25.813  -0.041  -54.685 1.00 48.45  ? 167  ALA B CA  1 
ATOM   5442 C  C   . ALA B  1 167 ? 26.171  1.125   -53.775 1.00 49.81  ? 167  ALA B C   1 
ATOM   5443 O  O   . ALA B  1 167 ? 26.781  0.928   -52.723 1.00 48.82  ? 167  ALA B O   1 
ATOM   5444 C  CB  . ALA B  1 167 ? 26.036  -1.345  -53.957 1.00 38.54  ? 167  ALA B CB  1 
ATOM   5445 N  N   . PRO B  1 168 ? 25.778  2.343   -54.175 1.00 51.07  ? 168  PRO B N   1 
ATOM   5446 C  CA  . PRO B  1 168 ? 26.139  3.565   -53.449 1.00 50.37  ? 168  PRO B CA  1 
ATOM   5447 C  C   . PRO B  1 168 ? 25.346  3.746   -52.158 1.00 48.19  ? 168  PRO B C   1 
ATOM   5448 O  O   . PRO B  1 168 ? 25.708  4.596   -51.341 1.00 39.50  ? 168  PRO B O   1 
ATOM   5449 C  CB  . PRO B  1 168 ? 25.788  4.670   -54.447 1.00 47.86  ? 168  PRO B CB  1 
ATOM   5450 C  CG  . PRO B  1 168 ? 24.672  4.095   -55.262 1.00 48.56  ? 168  PRO B CG  1 
ATOM   5451 C  CD  . PRO B  1 168 ? 24.955  2.625   -55.368 1.00 45.42  ? 168  PRO B CD  1 
ATOM   5452 N  N   . GLY B  1 169 ? 24.282  2.964   -51.985 1.00 42.58  ? 169  GLY B N   1 
ATOM   5453 C  CA  . GLY B  1 169 ? 23.472  3.022   -50.779 1.00 38.72  ? 169  GLY B CA  1 
ATOM   5454 C  C   . GLY B  1 169 ? 22.320  4.005   -50.860 1.00 42.80  ? 169  GLY B C   1 
ATOM   5455 O  O   . GLY B  1 169 ? 22.305  4.876   -51.731 1.00 50.72  ? 169  GLY B O   1 
ATOM   5456 N  N   . ASN B  1 170 ? 21.356  3.851   -49.954 1.00 36.26  ? 170  ASN B N   1 
ATOM   5457 C  CA  . ASN B  1 170 ? 20.211  4.756   -49.837 1.00 42.36  ? 170  ASN B CA  1 
ATOM   5458 C  C   . ASN B  1 170 ? 19.314  4.876   -51.082 1.00 44.74  ? 170  ASN B C   1 
ATOM   5459 O  O   . ASN B  1 170 ? 18.637  5.892   -51.256 1.00 46.51  ? 170  ASN B O   1 
ATOM   5460 C  CB  . ASN B  1 170 ? 20.673  6.154   -49.396 1.00 46.99  ? 170  ASN B CB  1 
ATOM   5461 C  CG  . ASN B  1 170 ? 21.514  6.128   -48.130 1.00 50.28  ? 170  ASN B CG  1 
ATOM   5462 O  OD1 . ASN B  1 170 ? 21.331  5.274   -47.265 1.00 56.94  ? 170  ASN B OD1 1 
ATOM   5463 N  ND2 . ASN B  1 170 ? 22.439  7.075   -48.014 1.00 44.73  ? 170  ASN B ND2 1 
ATOM   5464 N  N   . VAL B  1 171 ? 19.302  3.857   -51.941 1.00 41.52  ? 171  VAL B N   1 
ATOM   5465 C  CA  . VAL B  1 171 ? 18.465  3.917   -53.144 1.00 39.83  ? 171  VAL B CA  1 
ATOM   5466 C  C   . VAL B  1 171 ? 16.977  3.871   -52.803 1.00 39.22  ? 171  VAL B C   1 
ATOM   5467 O  O   . VAL B  1 171 ? 16.149  4.417   -53.535 1.00 43.31  ? 171  VAL B O   1 
ATOM   5468 C  CB  . VAL B  1 171 ? 18.816  2.819   -54.190 1.00 40.24  ? 171  VAL B CB  1 
ATOM   5469 C  CG1 . VAL B  1 171 ? 20.277  2.898   -54.569 1.00 35.43  ? 171  VAL B CG1 1 
ATOM   5470 C  CG2 . VAL B  1 171 ? 18.479  1.425   -53.674 1.00 38.49  ? 171  VAL B CG2 1 
ATOM   5471 N  N   . GLY B  1 172 ? 16.643  3.228   -51.688 1.00 40.02  ? 172  GLY B N   1 
ATOM   5472 C  CA  . GLY B  1 172 ? 15.270  3.193   -51.217 1.00 34.09  ? 172  GLY B CA  1 
ATOM   5473 C  C   . GLY B  1 172 ? 14.803  4.577   -50.809 1.00 36.95  ? 172  GLY B C   1 
ATOM   5474 O  O   . GLY B  1 172 ? 13.619  4.906   -50.926 1.00 38.35  ? 172  GLY B O   1 
ATOM   5475 N  N   . LEU B  1 173 ? 15.740  5.389   -50.324 1.00 37.26  ? 173  LEU B N   1 
ATOM   5476 C  CA  . LEU B  1 173 ? 15.454  6.781   -49.989 1.00 37.84  ? 173  LEU B CA  1 
ATOM   5477 C  C   . LEU B  1 173 ? 15.318  7.604   -51.268 1.00 42.37  ? 173  LEU B C   1 
ATOM   5478 O  O   . LEU B  1 173 ? 14.499  8.522   -51.342 1.00 48.16  ? 173  LEU B O   1 
ATOM   5479 C  CB  . LEU B  1 173 ? 16.550  7.361   -49.087 1.00 37.46  ? 173  LEU B CB  1 
ATOM   5480 C  CG  . LEU B  1 173 ? 16.576  6.906   -47.623 1.00 35.43  ? 173  LEU B CG  1 
ATOM   5481 C  CD1 . LEU B  1 173 ? 17.763  7.486   -46.876 1.00 27.93  ? 173  LEU B CD1 1 
ATOM   5482 C  CD2 . LEU B  1 173 ? 15.292  7.302   -46.935 1.00 31.36  ? 173  LEU B CD2 1 
ATOM   5483 N  N   . LEU B  1 174 ? 16.120  7.264   -52.275 1.00 35.36  ? 174  LEU B N   1 
ATOM   5484 C  CA  . LEU B  1 174 ? 16.038  7.921   -53.576 1.00 39.35  ? 174  LEU B CA  1 
ATOM   5485 C  C   . LEU B  1 174 ? 14.738  7.569   -54.297 1.00 35.68  ? 174  LEU B C   1 
ATOM   5486 O  O   . LEU B  1 174 ? 14.216  8.374   -55.075 1.00 38.12  ? 174  LEU B O   1 
ATOM   5487 C  CB  . LEU B  1 174 ? 17.254  7.569   -54.440 1.00 34.78  ? 174  LEU B CB  1 
ATOM   5488 C  CG  . LEU B  1 174 ? 18.574  8.183   -53.962 1.00 42.31  ? 174  LEU B CG  1 
ATOM   5489 C  CD1 . LEU B  1 174 ? 19.767  7.601   -54.703 1.00 36.81  ? 174  LEU B CD1 1 
ATOM   5490 C  CD2 . LEU B  1 174 ? 18.546  9.696   -54.111 1.00 38.35  ? 174  LEU B CD2 1 
ATOM   5491 N  N   . ASP B  1 175 ? 14.216  6.372   -54.035 1.00 34.44  ? 175  ASP B N   1 
ATOM   5492 C  CA  . ASP B  1 175 ? 12.914  5.973   -54.566 1.00 36.77  ? 175  ASP B CA  1 
ATOM   5493 C  C   . ASP B  1 175 ? 11.845  6.945   -54.060 1.00 40.39  ? 175  ASP B C   1 
ATOM   5494 O  O   . ASP B  1 175 ? 11.045  7.465   -54.841 1.00 41.47  ? 175  ASP B O   1 
ATOM   5495 C  CB  . ASP B  1 175 ? 12.565  4.540   -54.138 1.00 37.56  ? 175  ASP B CB  1 
ATOM   5496 C  CG  . ASP B  1 175 ? 13.465  3.492   -54.775 1.00 41.41  ? 175  ASP B CG  1 
ATOM   5497 O  OD1 . ASP B  1 175 ? 14.226  3.827   -55.707 1.00 42.05  ? 175  ASP B OD1 1 
ATOM   5498 O  OD2 . ASP B  1 175 ? 13.400  2.318   -54.342 1.00 46.13  ? 175  ASP B OD2 1 
ATOM   5499 N  N   . GLN B  1 176 ? 11.849  7.188   -52.749 1.00 33.21  ? 176  GLN B N   1 
ATOM   5500 C  CA  . GLN B  1 176 ? 10.948  8.153   -52.121 1.00 33.08  ? 176  GLN B CA  1 
ATOM   5501 C  C   . GLN B  1 176 ? 11.091  9.551   -52.730 1.00 35.04  ? 176  GLN B C   1 
ATOM   5502 O  O   . GLN B  1 176 ? 10.095  10.196  -53.059 1.00 34.86  ? 176  GLN B O   1 
ATOM   5503 C  CB  . GLN B  1 176 ? 11.203  8.212   -50.604 1.00 31.75  ? 176  GLN B CB  1 
ATOM   5504 C  CG  . GLN B  1 176 ? 11.107  6.861   -49.871 1.00 30.14  ? 176  GLN B CG  1 
ATOM   5505 C  CD  . GLN B  1 176 ? 11.496  6.962   -48.401 1.00 36.53  ? 176  GLN B CD  1 
ATOM   5506 O  OE1 . GLN B  1 176 ? 11.755  8.052   -47.892 1.00 39.13  ? 176  GLN B OE1 1 
ATOM   5507 N  NE2 . GLN B  1 176 ? 11.541  5.824   -47.716 1.00 32.05  ? 176  GLN B NE2 1 
ATOM   5508 N  N   . ARG B  1 177 ? 12.331  10.015  -52.880 1.00 34.06  ? 177  ARG B N   1 
ATOM   5509 C  CA  . ARG B  1 177 ? 12.603  11.336  -53.453 1.00 38.68  ? 177  ARG B CA  1 
ATOM   5510 C  C   . ARG B  1 177 ? 12.083  11.452  -54.889 1.00 38.73  ? 177  ARG B C   1 
ATOM   5511 O  O   . ARG B  1 177 ? 11.572  12.502  -55.287 1.00 34.27  ? 177  ARG B O   1 
ATOM   5512 C  CB  . ARG B  1 177 ? 14.107  11.661  -53.388 1.00 28.83  ? 177  ARG B CB  1 
ATOM   5513 C  CG  . ARG B  1 177 ? 14.513  12.944  -54.114 1.00 40.39  ? 177  ARG B CG  1 
ATOM   5514 C  CD  . ARG B  1 177 ? 16.005  13.219  -54.013 1.00 41.07  ? 177  ARG B CD  1 
ATOM   5515 N  NE  . ARG B  1 177 ? 16.400  13.556  -52.650 1.00 49.27  ? 177  ARG B NE  1 
ATOM   5516 C  CZ  . ARG B  1 177 ? 17.646  13.487  -52.195 1.00 55.14  ? 177  ARG B CZ  1 
ATOM   5517 N  NH1 . ARG B  1 177 ? 18.624  13.087  -52.997 1.00 52.34  ? 177  ARG B NH1 1 
ATOM   5518 N  NH2 . ARG B  1 177 ? 17.915  13.808  -50.936 1.00 42.02  ? 177  ARG B NH2 1 
ATOM   5519 N  N   . LEU B  1 178 ? 12.198  10.372  -55.660 1.00 32.80  ? 178  LEU B N   1 
ATOM   5520 C  CA  . LEU B  1 178 ? 11.701  10.370  -57.039 1.00 36.12  ? 178  LEU B CA  1 
ATOM   5521 C  C   . LEU B  1 178 ? 10.178  10.436  -57.064 1.00 37.89  ? 178  LEU B C   1 
ATOM   5522 O  O   . LEU B  1 178 ? 9.590   11.085  -57.930 1.00 39.81  ? 178  LEU B O   1 
ATOM   5523 C  CB  . LEU B  1 178 ? 12.198  9.140   -57.807 1.00 30.58  ? 178  LEU B CB  1 
ATOM   5524 C  CG  . LEU B  1 178 ? 11.724  9.004   -59.262 1.00 39.86  ? 178  LEU B CG  1 
ATOM   5525 C  CD1 . LEU B  1 178 ? 12.205  10.166  -60.115 1.00 38.64  ? 178  LEU B CD1 1 
ATOM   5526 C  CD2 . LEU B  1 178 ? 12.189  7.695   -59.863 1.00 35.20  ? 178  LEU B CD2 1 
ATOM   5527 N  N   . ALA B  1 179 ? 9.543   9.765   -56.108 1.00 34.27  ? 179  ALA B N   1 
ATOM   5528 C  CA  . ALA B  1 179 ? 8.091   9.811   -55.982 1.00 38.28  ? 179  ALA B CA  1 
ATOM   5529 C  C   . ALA B  1 179 ? 7.647   11.213  -55.580 1.00 42.17  ? 179  ALA B C   1 
ATOM   5530 O  O   . ALA B  1 179 ? 6.582   11.686  -55.987 1.00 45.39  ? 179  ALA B O   1 
ATOM   5531 C  CB  . ALA B  1 179 ? 7.624   8.796   -54.962 1.00 38.22  ? 179  ALA B CB  1 
ATOM   5532 N  N   . LEU B  1 180 ? 8.471   11.863  -54.763 1.00 35.87  ? 180  LEU B N   1 
ATOM   5533 C  CA  . LEU B  1 180 ? 8.247   13.251  -54.371 1.00 40.52  ? 180  LEU B CA  1 
ATOM   5534 C  C   . LEU B  1 180 ? 8.346   14.197  -55.578 1.00 43.87  ? 180  LEU B C   1 
ATOM   5535 O  O   . LEU B  1 180 ? 7.524   15.105  -55.727 1.00 43.24  ? 180  LEU B O   1 
ATOM   5536 C  CB  . LEU B  1 180 ? 9.230   13.658  -53.266 1.00 34.77  ? 180  LEU B CB  1 
ATOM   5537 C  CG  . LEU B  1 180 ? 8.765   13.547  -51.804 1.00 37.80  ? 180  LEU B CG  1 
ATOM   5538 C  CD1 . LEU B  1 180 ? 8.072   12.224  -51.520 1.00 36.74  ? 180  LEU B CD1 1 
ATOM   5539 C  CD2 . LEU B  1 180 ? 9.922   13.742  -50.835 1.00 33.68  ? 180  LEU B CD2 1 
ATOM   5540 N  N   . GLN B  1 181 ? 9.348   13.980  -56.432 1.00 46.19  ? 181  GLN B N   1 
ATOM   5541 C  CA  . GLN B  1 181 ? 9.514   14.771  -57.654 1.00 48.83  ? 181  GLN B CA  1 
ATOM   5542 C  C   . GLN B  1 181 ? 8.335   14.554  -58.590 1.00 40.85  ? 181  GLN B C   1 
ATOM   5543 O  O   . GLN B  1 181 ? 7.866   15.486  -59.250 1.00 39.55  ? 181  GLN B O   1 
ATOM   5544 C  CB  . GLN B  1 181 ? 10.823  14.401  -58.367 1.00 53.10  ? 181  GLN B CB  1 
ATOM   5545 C  CG  . GLN B  1 181 ? 12.082  14.986  -57.727 1.00 70.37  ? 181  GLN B CG  1 
ATOM   5546 C  CD  . GLN B  1 181 ? 13.339  14.205  -58.082 1.00 81.11  ? 181  GLN B CD  1 
ATOM   5547 O  OE1 . GLN B  1 181 ? 13.266  13.075  -58.565 1.00 86.96  ? 181  GLN B OE1 1 
ATOM   5548 N  NE2 . GLN B  1 181 ? 14.499  14.803  -57.836 1.00 78.79  ? 181  GLN B NE2 1 
ATOM   5549 N  N   . TRP B  1 182 ? 7.859   13.315  -58.636 1.00 35.69  ? 182  TRP B N   1 
ATOM   5550 C  CA  . TRP B  1 182 ? 6.701   12.953  -59.442 1.00 36.31  ? 182  TRP B CA  1 
ATOM   5551 C  C   . TRP B  1 182 ? 5.479   13.764  -59.020 1.00 41.93  ? 182  TRP B C   1 
ATOM   5552 O  O   . TRP B  1 182 ? 4.728   14.255  -59.865 1.00 44.24  ? 182  TRP B O   1 
ATOM   5553 C  CB  . TRP B  1 182 ? 6.420   11.457  -59.299 1.00 40.60  ? 182  TRP B CB  1 
ATOM   5554 C  CG  . TRP B  1 182 ? 5.404   10.940  -60.271 1.00 48.79  ? 182  TRP B CG  1 
ATOM   5555 C  CD1 . TRP B  1 182 ? 5.645   10.373  -61.490 1.00 52.38  ? 182  TRP B CD1 1 
ATOM   5556 C  CD2 . TRP B  1 182 ? 3.982   10.943  -60.104 1.00 46.04  ? 182  TRP B CD2 1 
ATOM   5557 N  NE1 . TRP B  1 182 ? 4.458   10.023  -62.091 1.00 48.03  ? 182  TRP B NE1 1 
ATOM   5558 C  CE2 . TRP B  1 182 ? 3.422   10.364  -61.259 1.00 48.38  ? 182  TRP B CE2 1 
ATOM   5559 C  CE3 . TRP B  1 182 ? 3.127   11.382  -59.088 1.00 42.89  ? 182  TRP B CE3 1 
ATOM   5560 C  CZ2 . TRP B  1 182 ? 2.044   10.212  -61.427 1.00 51.39  ? 182  TRP B CZ2 1 
ATOM   5561 C  CZ3 . TRP B  1 182 ? 1.763   11.231  -59.255 1.00 44.62  ? 182  TRP B CZ3 1 
ATOM   5562 C  CH2 . TRP B  1 182 ? 1.234   10.650  -60.414 1.00 51.86  ? 182  TRP B CH2 1 
ATOM   5563 N  N   . VAL B  1 183 ? 5.297   13.903  -57.708 1.00 41.97  ? 183  VAL B N   1 
ATOM   5564 C  CA  . VAL B  1 183 ? 4.204   14.691  -57.145 1.00 35.99  ? 183  VAL B CA  1 
ATOM   5565 C  C   . VAL B  1 183 ? 4.315   16.169  -57.530 1.00 41.83  ? 183  VAL B C   1 
ATOM   5566 O  O   . VAL B  1 183 ? 3.318   16.798  -57.877 1.00 50.58  ? 183  VAL B O   1 
ATOM   5567 C  CB  . VAL B  1 183 ? 4.134   14.527  -55.607 1.00 35.92  ? 183  VAL B CB  1 
ATOM   5568 C  CG1 . VAL B  1 183 ? 3.180   15.538  -54.984 1.00 28.97  ? 183  VAL B CG1 1 
ATOM   5569 C  CG2 . VAL B  1 183 ? 3.702   13.115  -55.257 1.00 31.81  ? 183  VAL B CG2 1 
ATOM   5570 N  N   . GLN B  1 184 ? 5.526   16.718  -57.483 1.00 38.75  ? 184  GLN B N   1 
ATOM   5571 C  CA  . GLN B  1 184 ? 5.752   18.089  -57.934 1.00 40.58  ? 184  GLN B CA  1 
ATOM   5572 C  C   . GLN B  1 184 ? 5.314   18.274  -59.385 1.00 47.82  ? 184  GLN B C   1 
ATOM   5573 O  O   . GLN B  1 184 ? 4.650   19.256  -59.719 1.00 48.34  ? 184  GLN B O   1 
ATOM   5574 C  CB  . GLN B  1 184 ? 7.228   18.471  -57.784 1.00 41.98  ? 184  GLN B CB  1 
ATOM   5575 C  CG  . GLN B  1 184 ? 7.647   18.806  -56.360 1.00 56.82  ? 184  GLN B CG  1 
ATOM   5576 C  CD  . GLN B  1 184 ? 6.886   19.989  -55.798 1.00 59.33  ? 184  GLN B CD  1 
ATOM   5577 O  OE1 . GLN B  1 184 ? 6.957   21.097  -56.331 1.00 62.04  ? 184  GLN B OE1 1 
ATOM   5578 N  NE2 . GLN B  1 184 ? 6.141   19.757  -54.721 1.00 44.58  ? 184  GLN B NE2 1 
ATOM   5579 N  N   . GLU B  1 185 ? 5.673   17.317  -60.237 1.00 45.77  ? 185  GLU B N   1 
ATOM   5580 C  CA  . GLU B  1 185 ? 5.409   17.414  -61.673 1.00 54.04  ? 185  GLU B CA  1 
ATOM   5581 C  C   . GLU B  1 185 ? 3.975   17.061  -62.073 1.00 57.88  ? 185  GLU B C   1 
ATOM   5582 O  O   . GLU B  1 185 ? 3.461   17.582  -63.064 1.00 69.82  ? 185  GLU B O   1 
ATOM   5583 C  CB  . GLU B  1 185 ? 6.386   16.520  -62.453 1.00 50.74  ? 185  GLU B CB  1 
ATOM   5584 C  CG  . GLU B  1 185 ? 7.838   16.980  -62.414 1.00 61.44  ? 185  GLU B CG  1 
ATOM   5585 C  CD  . GLU B  1 185 ? 8.815   15.861  -62.725 1.00 74.96  ? 185  GLU B CD  1 
ATOM   5586 O  OE1 . GLU B  1 185 ? 8.367   14.705  -62.882 1.00 81.07  ? 185  GLU B OE1 1 
ATOM   5587 O  OE2 . GLU B  1 185 ? 10.031  16.137  -62.803 1.00 77.89  ? 185  GLU B OE2 1 
ATOM   5588 N  N   . ASN B  1 186 ? 3.331   16.180  -61.310 1.00 44.63  ? 186  ASN B N   1 
ATOM   5589 C  CA  . ASN B  1 186 ? 2.078   15.573  -61.764 1.00 40.63  ? 186  ASN B CA  1 
ATOM   5590 C  C   . ASN B  1 186 ? 0.827   15.790  -60.898 1.00 46.01  ? 186  ASN B C   1 
ATOM   5591 O  O   . ASN B  1 186 ? -0.291  15.596  -61.382 1.00 44.78  ? 186  ASN B O   1 
ATOM   5592 C  CB  . ASN B  1 186 ? 2.281   14.071  -62.015 1.00 43.72  ? 186  ASN B CB  1 
ATOM   5593 C  CG  . ASN B  1 186 ? 3.306   13.791  -63.106 1.00 47.00  ? 186  ASN B CG  1 
ATOM   5594 O  OD1 . ASN B  1 186 ? 3.038   13.992  -64.291 1.00 48.98  ? 186  ASN B OD1 1 
ATOM   5595 N  ND2 . ASN B  1 186 ? 4.480   13.314  -62.709 1.00 45.43  ? 186  ASN B ND2 1 
ATOM   5596 N  N   . ILE B  1 187 ? 1.000   16.190  -59.639 1.00 49.90  ? 187  ILE B N   1 
ATOM   5597 C  CA  . ILE B  1 187 ? -0.130  16.240  -58.704 1.00 37.90  ? 187  ILE B CA  1 
ATOM   5598 C  C   . ILE B  1 187 ? -1.211  17.266  -59.073 1.00 36.36  ? 187  ILE B C   1 
ATOM   5599 O  O   . ILE B  1 187 ? -2.389  17.052  -58.793 1.00 41.52  ? 187  ILE B O   1 
ATOM   5600 C  CB  . ILE B  1 187 ? 0.327   16.427  -57.227 1.00 39.16  ? 187  ILE B CB  1 
ATOM   5601 C  CG1 . ILE B  1 187 ? -0.657  15.750  -56.271 1.00 38.86  ? 187  ILE B CG1 1 
ATOM   5602 C  CG2 . ILE B  1 187 ? 0.502   17.901  -56.875 1.00 32.79  ? 187  ILE B CG2 1 
ATOM   5603 C  CD1 . ILE B  1 187 ? -0.815  14.265  -56.525 1.00 34.43  ? 187  ILE B CD1 1 
ATOM   5604 N  N   . ALA B  1 188 ? -0.820  18.361  -59.719 1.00 39.09  ? 188  ALA B N   1 
ATOM   5605 C  CA  . ALA B  1 188 ? -1.782  19.385  -60.125 1.00 46.19  ? 188  ALA B CA  1 
ATOM   5606 C  C   . ALA B  1 188 ? -2.851  18.828  -61.068 1.00 49.89  ? 188  ALA B C   1 
ATOM   5607 O  O   . ALA B  1 188 ? -3.959  19.358  -61.149 1.00 51.34  ? 188  ALA B O   1 
ATOM   5608 C  CB  . ALA B  1 188 ? -1.067  20.560  -60.769 1.00 38.00  ? 188  ALA B CB  1 
ATOM   5609 N  N   . ALA B  1 189 ? -2.515  17.760  -61.783 1.00 48.37  ? 189  ALA B N   1 
ATOM   5610 C  CA  . ALA B  1 189 ? -3.463  17.129  -62.696 1.00 51.32  ? 189  ALA B CA  1 
ATOM   5611 C  C   . ALA B  1 189 ? -4.566  16.378  -61.950 1.00 55.04  ? 189  ALA B C   1 
ATOM   5612 O  O   . ALA B  1 189 ? -5.606  16.055  -62.527 1.00 59.15  ? 189  ALA B O   1 
ATOM   5613 C  CB  . ALA B  1 189 ? -2.736  16.200  -63.650 1.00 44.17  ? 189  ALA B CB  1 
ATOM   5614 N  N   . PHE B  1 190 ? -4.329  16.093  -60.673 1.00 50.39  ? 190  PHE B N   1 
ATOM   5615 C  CA  . PHE B  1 190 ? -5.312  15.400  -59.846 1.00 48.11  ? 190  PHE B CA  1 
ATOM   5616 C  C   . PHE B  1 190 ? -6.112  16.386  -58.993 1.00 57.55  ? 190  PHE B C   1 
ATOM   5617 O  O   . PHE B  1 190 ? -7.169  16.043  -58.456 1.00 62.69  ? 190  PHE B O   1 
ATOM   5618 C  CB  . PHE B  1 190 ? -4.622  14.366  -58.947 1.00 39.83  ? 190  PHE B CB  1 
ATOM   5619 C  CG  . PHE B  1 190 ? -3.860  13.306  -59.703 1.00 43.81  ? 190  PHE B CG  1 
ATOM   5620 C  CD1 . PHE B  1 190 ? -2.583  13.560  -60.194 1.00 44.15  ? 190  PHE B CD1 1 
ATOM   5621 C  CD2 . PHE B  1 190 ? -4.412  12.048  -59.903 1.00 43.01  ? 190  PHE B CD2 1 
ATOM   5622 C  CE1 . PHE B  1 190 ? -1.878  12.583  -60.884 1.00 42.99  ? 190  PHE B CE1 1 
ATOM   5623 C  CE2 . PHE B  1 190 ? -3.715  11.065  -60.592 1.00 43.33  ? 190  PHE B CE2 1 
ATOM   5624 C  CZ  . PHE B  1 190 ? -2.445  11.333  -61.084 1.00 44.22  ? 190  PHE B CZ  1 
ATOM   5625 N  N   . GLY B  1 191 ? -5.603  17.612  -58.877 1.00 50.24  ? 191  GLY B N   1 
ATOM   5626 C  CA  . GLY B  1 191 ? -6.225  18.628  -58.045 1.00 50.93  ? 191  GLY B CA  1 
ATOM   5627 C  C   . GLY B  1 191 ? -5.334  19.026  -56.884 1.00 55.91  ? 191  GLY B C   1 
ATOM   5628 O  O   . GLY B  1 191 ? -5.661  19.929  -56.111 1.00 54.55  ? 191  GLY B O   1 
ATOM   5629 N  N   . GLY B  1 192 ? -4.197  18.348  -56.761 1.00 50.37  ? 192  GLY B N   1 
ATOM   5630 C  CA  . GLY B  1 192 ? -3.268  18.621  -55.681 1.00 45.95  ? 192  GLY B CA  1 
ATOM   5631 C  C   . GLY B  1 192 ? -2.501  19.921  -55.838 1.00 48.05  ? 192  GLY B C   1 
ATOM   5632 O  O   . GLY B  1 192 ? -2.203  20.347  -56.955 1.00 61.05  ? 192  GLY B O   1 
ATOM   5633 N  N   . ASP B  1 193 ? -2.188  20.552  -54.709 1.00 49.27  ? 193  ASP B N   1 
ATOM   5634 C  CA  . ASP B  1 193 ? -1.349  21.745  -54.688 1.00 47.81  ? 193  ASP B CA  1 
ATOM   5635 C  C   . ASP B  1 193 ? 0.095   21.339  -54.411 1.00 55.56  ? 193  ASP B C   1 
ATOM   5636 O  O   . ASP B  1 193 ? 0.412   20.863  -53.319 1.00 59.87  ? 193  ASP B O   1 
ATOM   5637 C  CB  . ASP B  1 193 ? -1.833  22.720  -53.610 1.00 43.02  ? 193  ASP B CB  1 
ATOM   5638 C  CG  . ASP B  1 193 ? -1.146  24.080  -53.685 1.00 52.42  ? 193  ASP B CG  1 
ATOM   5639 O  OD1 . ASP B  1 193 ? -0.159  24.233  -54.440 1.00 60.09  ? 193  ASP B OD1 1 
ATOM   5640 O  OD2 . ASP B  1 193 ? -1.594  25.003  -52.972 1.00 51.41  ? 193  ASP B OD2 1 
ATOM   5641 N  N   . PRO B  1 194 ? 0.979   21.528  -55.403 1.00 54.10  ? 194  PRO B N   1 
ATOM   5642 C  CA  . PRO B  1 194 ? 2.386   21.148  -55.244 1.00 50.71  ? 194  PRO B CA  1 
ATOM   5643 C  C   . PRO B  1 194 ? 3.107   22.087  -54.282 1.00 47.00  ? 194  PRO B C   1 
ATOM   5644 O  O   . PRO B  1 194 ? 4.184   21.744  -53.788 1.00 41.68  ? 194  PRO B O   1 
ATOM   5645 C  CB  . PRO B  1 194 ? 2.963   21.306  -56.661 1.00 46.83  ? 194  PRO B CB  1 
ATOM   5646 C  CG  . PRO B  1 194 ? 1.776   21.511  -57.576 1.00 48.17  ? 194  PRO B CG  1 
ATOM   5647 C  CD  . PRO B  1 194 ? 0.708   22.114  -56.727 1.00 51.67  ? 194  PRO B CD  1 
ATOM   5648 N  N   . MET B  1 195 ? 2.517   23.255  -54.027 1.00 43.84  ? 195  MET B N   1 
ATOM   5649 C  CA  . MET B  1 195 ? 3.103   24.233  -53.109 1.00 50.83  ? 195  MET B CA  1 
ATOM   5650 C  C   . MET B  1 195 ? 2.643   24.013  -51.664 1.00 51.92  ? 195  MET B C   1 
ATOM   5651 O  O   . MET B  1 195 ? 2.954   24.812  -50.776 1.00 54.31  ? 195  MET B O   1 
ATOM   5652 C  CB  . MET B  1 195 ? 2.815   25.673  -53.567 1.00 48.19  ? 195  MET B CB  1 
ATOM   5653 C  CG  . MET B  1 195 ? 3.333   26.004  -54.968 1.00 42.48  ? 195  MET B CG  1 
ATOM   5654 S  SD  . MET B  1 195 ? 3.180   27.748  -55.423 1.00 100.99 ? 195  MET B SD  1 
ATOM   5655 C  CE  . MET B  1 195 ? 4.657   28.439  -54.675 1.00 87.77  ? 195  MET B CE  1 
ATOM   5656 N  N   . SER B  1 196 ? 1.916   22.921  -51.436 1.00 47.94  ? 196  SER B N   1 
ATOM   5657 C  CA  . SER B  1 196 ? 1.545   22.505  -50.082 1.00 48.37  ? 196  SER B CA  1 
ATOM   5658 C  C   . SER B  1 196 ? 1.613   20.984  -49.956 1.00 45.60  ? 196  SER B C   1 
ATOM   5659 O  O   . SER B  1 196 ? 0.594   20.290  -50.048 1.00 40.43  ? 196  SER B O   1 
ATOM   5660 C  CB  . SER B  1 196 ? 0.151   23.014  -49.703 1.00 44.29  ? 196  SER B CB  1 
ATOM   5661 O  OG  . SER B  1 196 ? -0.155  22.692  -48.354 1.00 46.55  ? 196  SER B OG  1 
ATOM   5662 N  N   . VAL B  1 197 ? 2.824   20.476  -49.747 1.00 37.56  ? 197  VAL B N   1 
ATOM   5663 C  CA  . VAL B  1 197 ? 3.060   19.043  -49.623 1.00 42.06  ? 197  VAL B CA  1 
ATOM   5664 C  C   . VAL B  1 197 ? 3.582   18.689  -48.234 1.00 38.30  ? 197  VAL B C   1 
ATOM   5665 O  O   . VAL B  1 197 ? 4.661   19.131  -47.835 1.00 43.35  ? 197  VAL B O   1 
ATOM   5666 C  CB  . VAL B  1 197 ? 4.058   18.549  -50.689 1.00 40.08  ? 197  VAL B CB  1 
ATOM   5667 C  CG1 . VAL B  1 197 ? 4.484   17.117  -50.401 1.00 36.79  ? 197  VAL B CG1 1 
ATOM   5668 C  CG2 . VAL B  1 197 ? 3.442   18.661  -52.074 1.00 31.13  ? 197  VAL B CG2 1 
ATOM   5669 N  N   . THR B  1 198 ? 2.804   17.898  -47.501 1.00 32.18  ? 198  THR B N   1 
ATOM   5670 C  CA  . THR B  1 198 ? 3.194   17.450  -46.168 1.00 35.56  ? 198  THR B CA  1 
ATOM   5671 C  C   . THR B  1 198 ? 3.578   15.975  -46.202 1.00 38.17  ? 198  THR B C   1 
ATOM   5672 O  O   . THR B  1 198 ? 2.791   15.132  -46.643 1.00 44.74  ? 198  THR B O   1 
ATOM   5673 C  CB  . THR B  1 198 ? 2.047   17.652  -45.153 1.00 36.84  ? 198  THR B CB  1 
ATOM   5674 O  OG1 . THR B  1 198 ? 1.595   19.011  -45.203 1.00 50.91  ? 198  THR B OG1 1 
ATOM   5675 C  CG2 . THR B  1 198 ? 2.509   17.327  -43.736 1.00 30.08  ? 198  THR B CG2 1 
ATOM   5676 N  N   . LEU B  1 199 ? 4.793   15.668  -45.755 1.00 28.64  ? 199  LEU B N   1 
ATOM   5677 C  CA  . LEU B  1 199 ? 5.213   14.281  -45.583 1.00 31.17  ? 199  LEU B CA  1 
ATOM   5678 C  C   . LEU B  1 199 ? 4.741   13.781  -44.222 1.00 36.64  ? 199  LEU B C   1 
ATOM   5679 O  O   . LEU B  1 199 ? 4.840   14.501  -43.229 1.00 41.53  ? 199  LEU B O   1 
ATOM   5680 C  CB  . LEU B  1 199 ? 6.738   14.160  -45.665 1.00 31.29  ? 199  LEU B CB  1 
ATOM   5681 C  CG  . LEU B  1 199 ? 7.474   14.719  -46.882 1.00 37.63  ? 199  LEU B CG  1 
ATOM   5682 C  CD1 . LEU B  1 199 ? 8.965   14.426  -46.780 1.00 31.50  ? 199  LEU B CD1 1 
ATOM   5683 C  CD2 . LEU B  1 199 ? 6.899   14.149  -48.166 1.00 31.47  ? 199  LEU B CD2 1 
ATOM   5684 N  N   . PHE B  1 200 ? 4.206   12.564  -44.175 1.00 40.85  ? 200  PHE B N   1 
ATOM   5685 C  CA  . PHE B  1 200 ? 3.955   11.903  -42.893 1.00 41.22  ? 200  PHE B CA  1 
ATOM   5686 C  C   . PHE B  1 200 ? 4.229   10.404  -42.970 1.00 45.43  ? 200  PHE B C   1 
ATOM   5687 O  O   . PHE B  1 200 ? 3.899   9.752   -43.962 1.00 47.50  ? 200  PHE B O   1 
ATOM   5688 C  CB  . PHE B  1 200 ? 2.561   12.226  -42.320 1.00 37.50  ? 200  PHE B CB  1 
ATOM   5689 C  CG  . PHE B  1 200 ? 1.414   11.529  -43.001 1.00 38.78  ? 200  PHE B CG  1 
ATOM   5690 C  CD1 . PHE B  1 200 ? 1.291   11.514  -44.383 1.00 36.02  ? 200  PHE B CD1 1 
ATOM   5691 C  CD2 . PHE B  1 200 ? 0.431   10.914  -42.238 1.00 33.95  ? 200  PHE B CD2 1 
ATOM   5692 C  CE1 . PHE B  1 200 ? 0.215   10.879  -44.991 1.00 38.99  ? 200  PHE B CE1 1 
ATOM   5693 C  CE2 . PHE B  1 200 ? -0.644  10.279  -42.833 1.00 37.48  ? 200  PHE B CE2 1 
ATOM   5694 C  CZ  . PHE B  1 200 ? -0.753  10.257  -44.214 1.00 40.81  ? 200  PHE B CZ  1 
ATOM   5695 N  N   . GLY B  1 201 ? 4.864   9.875   -41.928 1.00 34.14  ? 201  GLY B N   1 
ATOM   5696 C  CA  . GLY B  1 201 ? 5.256   8.479   -41.895 1.00 37.15  ? 201  GLY B CA  1 
ATOM   5697 C  C   . GLY B  1 201 ? 5.445   7.975   -40.478 1.00 42.68  ? 201  GLY B C   1 
ATOM   5698 O  O   . GLY B  1 201 ? 5.607   8.764   -39.542 1.00 41.34  ? 201  GLY B O   1 
ATOM   5699 N  N   . GLU B  1 202 ? 5.424   6.656   -40.318 1.00 38.79  ? 202  GLU B N   1 
ATOM   5700 C  CA  . GLU B  1 202 ? 5.550   6.043   -39.001 1.00 33.41  ? 202  GLU B CA  1 
ATOM   5701 C  C   . GLU B  1 202 ? 6.762   5.118   -38.950 1.00 39.86  ? 202  GLU B C   1 
ATOM   5702 O  O   . GLU B  1 202 ? 7.100   4.475   -39.946 1.00 44.68  ? 202  GLU B O   1 
ATOM   5703 C  CB  . GLU B  1 202 ? 4.268   5.282   -38.652 1.00 35.65  ? 202  GLU B CB  1 
ATOM   5704 C  CG  . GLU B  1 202 ? 4.202   4.758   -37.225 1.00 41.87  ? 202  GLU B CG  1 
ATOM   5705 C  CD  . GLU B  1 202 ? 4.748   3.357   -37.095 1.00 50.67  ? 202  GLU B CD  1 
ATOM   5706 O  OE1 . GLU B  1 202 ? 5.026   2.730   -38.139 1.00 46.12  ? 202  GLU B OE1 1 
ATOM   5707 O  OE2 . GLU B  1 202 ? 4.901   2.883   -35.950 1.00 51.53  ? 202  GLU B OE2 1 
ATOM   5708 N  N   . SER B  1 203 ? 7.415   5.068   -37.790 1.00 38.40  ? 203  SER B N   1 
ATOM   5709 C  CA  . SER B  1 203 ? 8.610   4.245   -37.586 1.00 35.42  ? 203  SER B CA  1 
ATOM   5710 C  C   . SER B  1 203 ? 9.704   4.566   -38.609 1.00 39.33  ? 203  SER B C   1 
ATOM   5711 O  O   . SER B  1 203 ? 10.180  5.700   -38.669 1.00 36.61  ? 203  SER B O   1 
ATOM   5712 C  CB  . SER B  1 203 ? 8.256   2.753   -37.612 1.00 36.98  ? 203  SER B CB  1 
ATOM   5713 O  OG  . SER B  1 203 ? 9.333   1.969   -37.131 1.00 46.50  ? 203  SER B OG  1 
ATOM   5714 N  N   . ALA B  1 204 ? 10.095  3.574   -39.408 1.00 39.15  ? 204  ALA B N   1 
ATOM   5715 C  CA  . ALA B  1 204 ? 11.105  3.782   -40.447 1.00 47.50  ? 204  ALA B CA  1 
ATOM   5716 C  C   . ALA B  1 204 ? 10.684  4.884   -41.412 1.00 39.42  ? 204  ALA B C   1 
ATOM   5717 O  O   . ALA B  1 204 ? 11.518  5.657   -41.893 1.00 35.57  ? 204  ALA B O   1 
ATOM   5718 C  CB  . ALA B  1 204 ? 11.375  2.491   -41.203 1.00 46.77  ? 204  ALA B CB  1 
ATOM   5719 N  N   . GLY B  1 205 ? 9.385   4.946   -41.692 1.00 38.68  ? 205  GLY B N   1 
ATOM   5720 C  CA  . GLY B  1 205 ? 8.827   6.006   -42.513 1.00 46.07  ? 205  GLY B CA  1 
ATOM   5721 C  C   . GLY B  1 205 ? 9.046   7.381   -41.907 1.00 44.29  ? 205  GLY B C   1 
ATOM   5722 O  O   . GLY B  1 205 ? 9.288   8.352   -42.625 1.00 39.11  ? 205  GLY B O   1 
ATOM   5723 N  N   . ALA B  1 206 ? 8.963   7.469   -40.582 1.00 36.31  ? 206  ALA B N   1 
ATOM   5724 C  CA  . ALA B  1 206 ? 9.210   8.731   -39.896 1.00 31.52  ? 206  ALA B CA  1 
ATOM   5725 C  C   . ALA B  1 206 ? 10.691  9.080   -39.964 1.00 29.48  ? 206  ALA B C   1 
ATOM   5726 O  O   . ALA B  1 206 ? 11.059  10.235  -40.178 1.00 37.16  ? 206  ALA B O   1 
ATOM   5727 C  CB  . ALA B  1 206 ? 8.737   8.661   -38.454 1.00 35.86  ? 206  ALA B CB  1 
ATOM   5728 N  N   . ALA B  1 207 ? 11.541  8.074   -39.778 1.00 24.69  ? 207  ALA B N   1 
ATOM   5729 C  CA  . ALA B  1 207 ? 12.978  8.249   -39.965 1.00 29.24  ? 207  ALA B CA  1 
ATOM   5730 C  C   . ALA B  1 207 ? 13.290  8.739   -41.376 1.00 37.07  ? 207  ALA B C   1 
ATOM   5731 O  O   . ALA B  1 207 ? 14.174  9.577   -41.567 1.00 38.01  ? 207  ALA B O   1 
ATOM   5732 C  CB  . ALA B  1 207 ? 13.703  6.952   -39.693 1.00 27.49  ? 207  ALA B CB  1 
ATOM   5733 N  N   . SER B  1 208 ? 12.576  8.197   -42.361 1.00 29.59  ? 208  SER B N   1 
ATOM   5734 C  CA  . SER B  1 208 ? 12.752  8.615   -43.749 1.00 37.33  ? 208  SER B CA  1 
ATOM   5735 C  C   . SER B  1 208 ? 12.373  10.081  -43.924 1.00 34.77  ? 208  SER B C   1 
ATOM   5736 O  O   . SER B  1 208 ? 13.153  10.865  -44.471 1.00 35.22  ? 208  SER B O   1 
ATOM   5737 C  CB  . SER B  1 208 ? 11.925  7.738   -44.692 1.00 34.96  ? 208  SER B CB  1 
ATOM   5738 O  OG  . SER B  1 208 ? 12.324  6.380   -44.610 1.00 34.34  ? 208  SER B OG  1 
ATOM   5739 N  N   . VAL B  1 209 ? 11.177  10.440  -43.458 1.00 32.57  ? 209  VAL B N   1 
ATOM   5740 C  CA  . VAL B  1 209 ? 10.732  11.833  -43.436 1.00 35.81  ? 209  VAL B CA  1 
ATOM   5741 C  C   . VAL B  1 209 ? 11.808  12.718  -42.813 1.00 41.46  ? 209  VAL B C   1 
ATOM   5742 O  O   . VAL B  1 209 ? 12.159  13.768  -43.359 1.00 41.90  ? 209  VAL B O   1 
ATOM   5743 C  CB  . VAL B  1 209 ? 9.415   11.985  -42.648 1.00 33.73  ? 209  VAL B CB  1 
ATOM   5744 C  CG1 . VAL B  1 209 ? 9.090   13.451  -42.421 1.00 29.86  ? 209  VAL B CG1 1 
ATOM   5745 C  CG2 . VAL B  1 209 ? 8.277   11.303  -43.385 1.00 27.25  ? 209  VAL B CG2 1 
ATOM   5746 N  N   . GLY B  1 210 ? 12.349  12.269  -41.683 1.00 31.84  ? 210  GLY B N   1 
ATOM   5747 C  CA  . GLY B  1 210 ? 13.433  12.973  -41.018 1.00 36.43  ? 210  GLY B CA  1 
ATOM   5748 C  C   . GLY B  1 210 ? 14.671  13.138  -41.883 1.00 40.88  ? 210  GLY B C   1 
ATOM   5749 O  O   . GLY B  1 210 ? 15.334  14.177  -41.835 1.00 43.59  ? 210  GLY B O   1 
ATOM   5750 N  N   . MET B  1 211 ? 14.990  12.122  -42.679 1.00 38.21  ? 211  MET B N   1 
ATOM   5751 C  CA  . MET B  1 211 ? 16.179  12.182  -43.524 1.00 41.75  ? 211  MET B CA  1 
ATOM   5752 C  C   . MET B  1 211 ? 15.980  13.098  -44.730 1.00 39.04  ? 211  MET B C   1 
ATOM   5753 O  O   . MET B  1 211 ? 16.930  13.715  -45.212 1.00 42.27  ? 211  MET B O   1 
ATOM   5754 C  CB  . MET B  1 211 ? 16.619  10.775  -43.945 1.00 34.95  ? 211  MET B CB  1 
ATOM   5755 C  CG  . MET B  1 211 ? 17.233  9.978   -42.805 1.00 38.84  ? 211  MET B CG  1 
ATOM   5756 S  SD  . MET B  1 211 ? 17.432  8.232   -43.185 1.00 53.67  ? 211  MET B SD  1 
ATOM   5757 C  CE  . MET B  1 211 ? 17.683  7.554   -41.545 1.00 43.68  ? 211  MET B CE  1 
ATOM   5758 N  N   . HIS B  1 212 ? 14.739  13.202  -45.200 1.00 34.86  ? 212  HIS B N   1 
ATOM   5759 C  CA  . HIS B  1 212 ? 14.405  14.143  -46.270 1.00 39.24  ? 212  HIS B CA  1 
ATOM   5760 C  C   . HIS B  1 212 ? 14.544  15.586  -45.776 1.00 44.76  ? 212  HIS B C   1 
ATOM   5761 O  O   . HIS B  1 212 ? 14.924  16.479  -46.533 1.00 53.56  ? 212  HIS B O   1 
ATOM   5762 C  CB  . HIS B  1 212 ? 12.994  13.879  -46.811 1.00 35.52  ? 212  HIS B CB  1 
ATOM   5763 C  CG  . HIS B  1 212 ? 12.885  12.628  -47.624 1.00 38.90  ? 212  HIS B CG  1 
ATOM   5764 N  ND1 . HIS B  1 212 ? 13.564  12.448  -48.812 1.00 40.28  ? 212  HIS B ND1 1 
ATOM   5765 C  CD2 . HIS B  1 212 ? 12.168  11.492  -47.432 1.00 34.41  ? 212  HIS B CD2 1 
ATOM   5766 C  CE1 . HIS B  1 212 ? 13.278  11.259  -49.309 1.00 37.56  ? 212  HIS B CE1 1 
ATOM   5767 N  NE2 . HIS B  1 212 ? 12.433  10.658  -48.486 1.00 38.81  ? 212  HIS B NE2 1 
ATOM   5768 N  N   . ILE B  1 213 ? 14.232  15.800  -44.500 1.00 43.17  ? 213  ILE B N   1 
ATOM   5769 C  CA  . ILE B  1 213 ? 14.458  17.084  -43.844 1.00 41.81  ? 213  ILE B CA  1 
ATOM   5770 C  C   . ILE B  1 213 ? 15.949  17.424  -43.829 1.00 43.60  ? 213  ILE B C   1 
ATOM   5771 O  O   . ILE B  1 213 ? 16.333  18.586  -43.986 1.00 40.38  ? 213  ILE B O   1 
ATOM   5772 C  CB  . ILE B  1 213 ? 13.913  17.055  -42.393 1.00 44.73  ? 213  ILE B CB  1 
ATOM   5773 C  CG1 . ILE B  1 213 ? 12.384  16.957  -42.399 1.00 43.70  ? 213  ILE B CG1 1 
ATOM   5774 C  CG2 . ILE B  1 213 ? 14.350  18.285  -41.612 1.00 41.18  ? 213  ILE B CG2 1 
ATOM   5775 C  CD1 . ILE B  1 213 ? 11.786  16.603  -41.054 1.00 39.56  ? 213  ILE B CD1 1 
ATOM   5776 N  N   . LEU B  1 214 ? 16.783  16.398  -43.664 1.00 45.79  ? 214  LEU B N   1 
ATOM   5777 C  CA  . LEU B  1 214 ? 18.227  16.579  -43.521 1.00 38.38  ? 214  LEU B CA  1 
ATOM   5778 C  C   . LEU B  1 214 ? 18.998  16.440  -44.837 1.00 44.01  ? 214  LEU B C   1 
ATOM   5779 O  O   . LEU B  1 214 ? 20.230  16.472  -44.841 1.00 49.59  ? 214  LEU B O   1 
ATOM   5780 C  CB  . LEU B  1 214 ? 18.782  15.597  -42.483 1.00 25.72  ? 214  LEU B CB  1 
ATOM   5781 C  CG  . LEU B  1 214 ? 18.161  15.682  -41.085 1.00 36.22  ? 214  LEU B CG  1 
ATOM   5782 C  CD1 . LEU B  1 214 ? 18.744  14.641  -40.143 1.00 31.76  ? 214  LEU B CD1 1 
ATOM   5783 C  CD2 . LEU B  1 214 ? 18.346  17.072  -40.509 1.00 30.47  ? 214  LEU B CD2 1 
ATOM   5784 N  N   . SER B  1 215 ? 18.281  16.292  -45.948 1.00 44.08  ? 215  SER B N   1 
ATOM   5785 C  CA  . SER B  1 215 ? 18.931  16.176  -47.255 1.00 45.67  ? 215  SER B CA  1 
ATOM   5786 C  C   . SER B  1 215 ? 18.484  17.290  -48.200 1.00 47.52  ? 215  SER B C   1 
ATOM   5787 O  O   . SER B  1 215 ? 17.317  17.346  -48.593 1.00 51.26  ? 215  SER B O   1 
ATOM   5788 C  CB  . SER B  1 215 ? 18.651  14.805  -47.881 1.00 42.04  ? 215  SER B CB  1 
ATOM   5789 O  OG  . SER B  1 215 ? 19.662  14.454  -48.811 1.00 47.25  ? 215  SER B OG  1 
ATOM   5790 N  N   . LEU B  1 216 ? 19.423  18.164  -48.561 1.00 49.65  ? 216  LEU B N   1 
ATOM   5791 C  CA  . LEU B  1 216 ? 19.139  19.357  -49.370 1.00 57.54  ? 216  LEU B CA  1 
ATOM   5792 C  C   . LEU B  1 216 ? 18.298  19.135  -50.642 1.00 54.31  ? 216  LEU B C   1 
ATOM   5793 O  O   . LEU B  1 216 ? 17.356  19.892  -50.891 1.00 56.27  ? 216  LEU B O   1 
ATOM   5794 C  CB  . LEU B  1 216 ? 20.435  20.128  -49.688 1.00 63.37  ? 216  LEU B CB  1 
ATOM   5795 C  CG  . LEU B  1 216 ? 20.314  21.429  -50.489 1.00 67.82  ? 216  LEU B CG  1 
ATOM   5796 C  CD1 . LEU B  1 216 ? 19.397  22.419  -49.785 1.00 61.30  ? 216  LEU B CD1 1 
ATOM   5797 C  CD2 . LEU B  1 216 ? 21.678  22.059  -50.748 1.00 72.66  ? 216  LEU B CD2 1 
ATOM   5798 N  N   . PRO B  1 217 ? 18.630  18.107  -51.451 1.00 48.23  ? 217  PRO B N   1 
ATOM   5799 C  CA  . PRO B  1 217 ? 17.815  17.901  -52.656 1.00 51.93  ? 217  PRO B CA  1 
ATOM   5800 C  C   . PRO B  1 217 ? 16.335  17.616  -52.371 1.00 51.60  ? 217  PRO B C   1 
ATOM   5801 O  O   . PRO B  1 217 ? 15.490  17.977  -53.190 1.00 49.54  ? 217  PRO B O   1 
ATOM   5802 C  CB  . PRO B  1 217 ? 18.472  16.683  -53.315 1.00 51.74  ? 217  PRO B CB  1 
ATOM   5803 C  CG  . PRO B  1 217 ? 19.891  16.732  -52.858 1.00 46.62  ? 217  PRO B CG  1 
ATOM   5804 C  CD  . PRO B  1 217 ? 19.815  17.225  -51.439 1.00 46.24  ? 217  PRO B CD  1 
ATOM   5805 N  N   . SER B  1 218 ? 16.028  16.993  -51.235 1.00 49.85  ? 218  SER B N   1 
ATOM   5806 C  CA  . SER B  1 218 ? 14.642  16.691  -50.880 1.00 39.21  ? 218  SER B CA  1 
ATOM   5807 C  C   . SER B  1 218 ? 13.860  17.918  -50.409 1.00 39.73  ? 218  SER B C   1 
ATOM   5808 O  O   . SER B  1 218 ? 12.628  17.951  -50.499 1.00 42.69  ? 218  SER B O   1 
ATOM   5809 C  CB  . SER B  1 218 ? 14.590  15.611  -49.794 1.00 39.05  ? 218  SER B CB  1 
ATOM   5810 O  OG  . SER B  1 218 ? 15.178  14.404  -50.240 1.00 44.37  ? 218  SER B OG  1 
ATOM   5811 N  N   . ARG B  1 219 ? 14.582  18.925  -49.924 1.00 41.01  ? 219  ARG B N   1 
ATOM   5812 C  CA  . ARG B  1 219 ? 13.972  20.066  -49.239 1.00 53.29  ? 219  ARG B CA  1 
ATOM   5813 C  C   . ARG B  1 219 ? 13.139  20.999  -50.124 1.00 52.43  ? 219  ARG B C   1 
ATOM   5814 O  O   . ARG B  1 219 ? 12.477  21.906  -49.619 1.00 55.48  ? 219  ARG B O   1 
ATOM   5815 C  CB  . ARG B  1 219 ? 15.037  20.859  -48.471 1.00 64.68  ? 219  ARG B CB  1 
ATOM   5816 C  CG  . ARG B  1 219 ? 15.576  20.135  -47.238 1.00 74.92  ? 219  ARG B CG  1 
ATOM   5817 C  CD  . ARG B  1 219 ? 16.431  21.055  -46.377 1.00 91.94  ? 219  ARG B CD  1 
ATOM   5818 N  NE  . ARG B  1 219 ? 17.843  20.679  -46.379 1.00 105.23 ? 219  ARG B NE  1 
ATOM   5819 C  CZ  . ARG B  1 219 ? 18.845  21.536  -46.199 1.00 112.74 ? 219  ARG B CZ  1 
ATOM   5820 N  NH1 . ARG B  1 219 ? 18.592  22.824  -46.011 1.00 113.61 ? 219  ARG B NH1 1 
ATOM   5821 N  NH2 . ARG B  1 219 ? 20.099  21.107  -46.216 1.00 113.96 ? 219  ARG B NH2 1 
ATOM   5822 N  N   . SER B  1 220 ? 13.169  20.776  -51.434 1.00 50.05  ? 220  SER B N   1 
ATOM   5823 C  CA  . SER B  1 220 ? 12.350  21.551  -52.359 1.00 50.28  ? 220  SER B CA  1 
ATOM   5824 C  C   . SER B  1 220 ? 11.135  20.748  -52.814 1.00 51.40  ? 220  SER B C   1 
ATOM   5825 O  O   . SER B  1 220 ? 10.373  21.190  -53.677 1.00 53.72  ? 220  SER B O   1 
ATOM   5826 C  CB  . SER B  1 220 ? 13.178  21.985  -53.571 1.00 54.67  ? 220  SER B CB  1 
ATOM   5827 O  OG  . SER B  1 220 ? 13.805  20.873  -54.188 1.00 61.53  ? 220  SER B OG  1 
ATOM   5828 N  N   . LEU B  1 221 ? 10.952  19.572  -52.221 1.00 45.02  ? 221  LEU B N   1 
ATOM   5829 C  CA  . LEU B  1 221 ? 9.900   18.653  -52.650 1.00 41.61  ? 221  LEU B CA  1 
ATOM   5830 C  C   . LEU B  1 221 ? 8.747   18.570  -51.648 1.00 40.69  ? 221  LEU B C   1 
ATOM   5831 O  O   . LEU B  1 221 ? 7.757   17.873  -51.887 1.00 46.00  ? 221  LEU B O   1 
ATOM   5832 C  CB  . LEU B  1 221 ? 10.488  17.262  -52.902 1.00 39.72  ? 221  LEU B CB  1 
ATOM   5833 C  CG  . LEU B  1 221 ? 11.698  17.226  -53.839 1.00 36.19  ? 221  LEU B CG  1 
ATOM   5834 C  CD1 . LEU B  1 221 ? 12.235  15.813  -54.027 1.00 31.30  ? 221  LEU B CD1 1 
ATOM   5835 C  CD2 . LEU B  1 221 ? 11.332  17.835  -55.176 1.00 36.11  ? 221  LEU B CD2 1 
ATOM   5836 N  N   . PHE B  1 222 ? 8.883   19.282  -50.531 1.00 42.79  ? 222  PHE B N   1 
ATOM   5837 C  CA  . PHE B  1 222 ? 7.841   19.326  -49.504 1.00 41.94  ? 222  PHE B CA  1 
ATOM   5838 C  C   . PHE B  1 222 ? 7.980   20.571  -48.628 1.00 38.93  ? 222  PHE B C   1 
ATOM   5839 O  O   . PHE B  1 222 ? 8.972   21.296  -48.722 1.00 41.94  ? 222  PHE B O   1 
ATOM   5840 C  CB  . PHE B  1 222 ? 7.847   18.050  -48.651 1.00 41.29  ? 222  PHE B CB  1 
ATOM   5841 C  CG  . PHE B  1 222 ? 9.073   17.886  -47.799 1.00 39.16  ? 222  PHE B CG  1 
ATOM   5842 C  CD1 . PHE B  1 222 ? 10.262  17.436  -48.354 1.00 35.63  ? 222  PHE B CD1 1 
ATOM   5843 C  CD2 . PHE B  1 222 ? 9.031   18.162  -46.438 1.00 38.84  ? 222  PHE B CD2 1 
ATOM   5844 C  CE1 . PHE B  1 222 ? 11.393  17.275  -47.573 1.00 43.03  ? 222  PHE B CE1 1 
ATOM   5845 C  CE2 . PHE B  1 222 ? 10.157  18.004  -45.646 1.00 36.02  ? 222  PHE B CE2 1 
ATOM   5846 C  CZ  . PHE B  1 222 ? 11.341  17.559  -46.215 1.00 41.15  ? 222  PHE B CZ  1 
ATOM   5847 N  N   . HIS B  1 223 ? 6.984   20.819  -47.781 1.00 43.03  ? 223  HIS B N   1 
ATOM   5848 C  CA  . HIS B  1 223 ? 6.948   22.047  -46.991 1.00 45.59  ? 223  HIS B CA  1 
ATOM   5849 C  C   . HIS B  1 223 ? 6.741   21.784  -45.507 1.00 47.21  ? 223  HIS B C   1 
ATOM   5850 O  O   . HIS B  1 223 ? 7.138   22.591  -44.667 1.00 52.78  ? 223  HIS B O   1 
ATOM   5851 C  CB  . HIS B  1 223 ? 5.854   22.977  -47.515 1.00 42.84  ? 223  HIS B CB  1 
ATOM   5852 C  CG  . HIS B  1 223 ? 5.837   23.096  -49.002 1.00 53.47  ? 223  HIS B CG  1 
ATOM   5853 N  ND1 . HIS B  1 223 ? 5.156   22.205  -49.811 1.00 50.77  ? 223  HIS B ND1 1 
ATOM   5854 C  CD2 . HIS B  1 223 ? 6.436   23.974  -49.838 1.00 51.88  ? 223  HIS B CD2 1 
ATOM   5855 C  CE1 . HIS B  1 223 ? 5.333   22.538  -51.072 1.00 44.69  ? 223  HIS B CE1 1 
ATOM   5856 N  NE2 . HIS B  1 223 ? 6.103   23.614  -51.119 1.00 48.12  ? 223  HIS B NE2 1 
ATOM   5857 N  N   . ARG B  1 224 ? 6.117   20.654  -45.189 1.00 50.46  ? 224  ARG B N   1 
ATOM   5858 C  CA  . ARG B  1 224 ? 5.889   20.268  -43.799 1.00 45.07  ? 224  ARG B CA  1 
ATOM   5859 C  C   . ARG B  1 224 ? 6.140   18.780  -43.582 1.00 46.45  ? 224  ARG B C   1 
ATOM   5860 O  O   . ARG B  1 224 ? 6.152   18.001  -44.539 1.00 46.14  ? 224  ARG B O   1 
ATOM   5861 C  CB  . ARG B  1 224 ? 4.469   20.638  -43.366 1.00 42.08  ? 224  ARG B CB  1 
ATOM   5862 C  CG  . ARG B  1 224 ? 4.305   22.111  -43.070 1.00 45.53  ? 224  ARG B CG  1 
ATOM   5863 C  CD  . ARG B  1 224 ? 2.853   22.498  -42.858 1.00 49.05  ? 224  ARG B CD  1 
ATOM   5864 N  NE  . ARG B  1 224 ? 2.091   22.517  -44.103 1.00 56.47  ? 224  ARG B NE  1 
ATOM   5865 C  CZ  . ARG B  1 224 ? 2.178   23.478  -45.018 1.00 63.68  ? 224  ARG B CZ  1 
ATOM   5866 N  NH1 . ARG B  1 224 ? 3.008   24.498  -44.845 1.00 56.26  ? 224  ARG B NH1 1 
ATOM   5867 N  NH2 . ARG B  1 224 ? 1.442   23.411  -46.118 1.00 73.18  ? 224  ARG B NH2 1 
ATOM   5868 N  N   . ALA B  1 225 ? 6.336   18.394  -42.322 1.00 40.60  ? 225  ALA B N   1 
ATOM   5869 C  CA  . ALA B  1 225 ? 6.699   17.019  -41.987 1.00 37.76  ? 225  ALA B CA  1 
ATOM   5870 C  C   . ALA B  1 225 ? 5.998   16.507  -40.732 1.00 44.08  ? 225  ALA B C   1 
ATOM   5871 O  O   . ALA B  1 225 ? 5.792   17.253  -39.772 1.00 39.93  ? 225  ALA B O   1 
ATOM   5872 C  CB  . ALA B  1 225 ? 8.206   16.902  -41.819 1.00 35.86  ? 225  ALA B CB  1 
ATOM   5873 N  N   . VAL B  1 226 ? 5.644   15.225  -40.743 1.00 41.08  ? 226  VAL B N   1 
ATOM   5874 C  CA  . VAL B  1 226 ? 5.092   14.561  -39.567 1.00 34.83  ? 226  VAL B CA  1 
ATOM   5875 C  C   . VAL B  1 226 ? 5.865   13.273  -39.312 1.00 39.98  ? 226  VAL B C   1 
ATOM   5876 O  O   . VAL B  1 226 ? 5.967   12.419  -40.195 1.00 38.68  ? 226  VAL B O   1 
ATOM   5877 C  CB  . VAL B  1 226 ? 3.597   14.227  -39.746 1.00 34.13  ? 226  VAL B CB  1 
ATOM   5878 C  CG1 . VAL B  1 226 ? 3.064   13.457  -38.537 1.00 38.50  ? 226  VAL B CG1 1 
ATOM   5879 C  CG2 . VAL B  1 226 ? 2.787   15.487  -39.975 1.00 30.90  ? 226  VAL B CG2 1 
ATOM   5880 N  N   . LEU B  1 227 ? 6.410   13.137  -38.106 1.00 37.79  ? 227  LEU B N   1 
ATOM   5881 C  CA  . LEU B  1 227 ? 7.206   11.966  -37.755 1.00 31.22  ? 227  LEU B CA  1 
ATOM   5882 C  C   . LEU B  1 227 ? 6.547   11.195  -36.618 1.00 39.17  ? 227  LEU B C   1 
ATOM   5883 O  O   . LEU B  1 227 ? 6.631   11.598  -35.450 1.00 35.92  ? 227  LEU B O   1 
ATOM   5884 C  CB  . LEU B  1 227 ? 8.637   12.365  -37.365 1.00 31.42  ? 227  LEU B CB  1 
ATOM   5885 C  CG  . LEU B  1 227 ? 9.530   12.977  -38.453 1.00 35.56  ? 227  LEU B CG  1 
ATOM   5886 C  CD1 . LEU B  1 227 ? 9.235   14.454  -38.657 1.00 30.97  ? 227  LEU B CD1 1 
ATOM   5887 C  CD2 . LEU B  1 227 ? 11.007  12.772  -38.138 1.00 25.14  ? 227  LEU B CD2 1 
ATOM   5888 N  N   . GLN B  1 228 ? 5.890   10.089  -36.956 1.00 34.35  ? 228  GLN B N   1 
ATOM   5889 C  CA  . GLN B  1 228 ? 5.211   9.275   -35.951 1.00 34.41  ? 228  GLN B CA  1 
ATOM   5890 C  C   . GLN B  1 228 ? 6.097   8.117   -35.491 1.00 39.09  ? 228  GLN B C   1 
ATOM   5891 O  O   . GLN B  1 228 ? 6.361   7.194   -36.259 1.00 41.89  ? 228  GLN B O   1 
ATOM   5892 C  CB  . GLN B  1 228 ? 3.889   8.732   -36.508 1.00 27.67  ? 228  GLN B CB  1 
ATOM   5893 C  CG  . GLN B  1 228 ? 2.973   9.789   -37.120 1.00 33.15  ? 228  GLN B CG  1 
ATOM   5894 C  CD  . GLN B  1 228 ? 1.787   9.187   -37.859 1.00 39.43  ? 228  GLN B CD  1 
ATOM   5895 O  OE1 . GLN B  1 228 ? 1.184   9.832   -38.716 1.00 41.68  ? 228  GLN B OE1 1 
ATOM   5896 N  NE2 . GLN B  1 228 ? 1.447   7.948   -37.528 1.00 39.68  ? 228  GLN B NE2 1 
ATOM   5897 N  N   . SER B  1 229 ? 6.567   8.186   -34.247 1.00 33.36  ? 229  SER B N   1 
ATOM   5898 C  CA  . SER B  1 229 ? 7.323   7.094   -33.629 1.00 33.93  ? 229  SER B CA  1 
ATOM   5899 C  C   . SER B  1 229 ? 8.572   6.679   -34.405 1.00 34.65  ? 229  SER B C   1 
ATOM   5900 O  O   . SER B  1 229 ? 8.841   5.484   -34.563 1.00 34.08  ? 229  SER B O   1 
ATOM   5901 C  CB  . SER B  1 229 ? 6.422   5.870   -33.425 1.00 35.92  ? 229  SER B CB  1 
ATOM   5902 O  OG  . SER B  1 229 ? 5.213   6.226   -32.777 1.00 37.76  ? 229  SER B OG  1 
ATOM   5903 N  N   . GLY B  1 230 ? 9.336   7.658   -34.882 1.00 37.50  ? 230  GLY B N   1 
ATOM   5904 C  CA  . GLY B  1 230 ? 10.542  7.370   -35.640 1.00 31.87  ? 230  GLY B CA  1 
ATOM   5905 C  C   . GLY B  1 230 ? 11.373  8.610   -35.913 1.00 36.37  ? 230  GLY B C   1 
ATOM   5906 O  O   . GLY B  1 230 ? 10.832  9.699   -36.114 1.00 43.68  ? 230  GLY B O   1 
ATOM   5907 N  N   . THR B  1 231 ? 12.693  8.444   -35.920 1.00 36.66  ? 231  THR B N   1 
ATOM   5908 C  CA  . THR B  1 231 ? 13.615  9.563   -36.089 1.00 33.55  ? 231  THR B CA  1 
ATOM   5909 C  C   . THR B  1 231 ? 14.805  9.154   -36.940 1.00 27.84  ? 231  THR B C   1 
ATOM   5910 O  O   . THR B  1 231 ? 15.194  7.985   -36.940 1.00 39.15  ? 231  THR B O   1 
ATOM   5911 C  CB  . THR B  1 231 ? 14.165  10.043  -34.728 1.00 37.77  ? 231  THR B CB  1 
ATOM   5912 O  OG1 . THR B  1 231 ? 14.741  8.933   -34.028 1.00 29.57  ? 231  THR B OG1 1 
ATOM   5913 C  CG2 . THR B  1 231 ? 13.070  10.668  -33.884 1.00 34.77  ? 231  THR B CG2 1 
ATOM   5914 N  N   . PRO B  1 232 ? 15.399  10.119  -37.663 1.00 35.42  ? 232  PRO B N   1 
ATOM   5915 C  CA  . PRO B  1 232 ? 16.620  9.823   -38.419 1.00 40.98  ? 232  PRO B CA  1 
ATOM   5916 C  C   . PRO B  1 232 ? 17.792  9.654   -37.465 1.00 40.16  ? 232  PRO B C   1 
ATOM   5917 O  O   . PRO B  1 232 ? 18.684  8.848   -37.718 1.00 45.64  ? 232  PRO B O   1 
ATOM   5918 C  CB  . PRO B  1 232 ? 16.807  11.070  -39.290 1.00 38.73  ? 232  PRO B CB  1 
ATOM   5919 C  CG  . PRO B  1 232 ? 16.123  12.165  -38.538 1.00 38.93  ? 232  PRO B CG  1 
ATOM   5920 C  CD  . PRO B  1 232 ? 14.946  11.509  -37.861 1.00 39.74  ? 232  PRO B CD  1 
ATOM   5921 N  N   . ASN B  1 233 ? 17.783  10.417  -36.378 1.00 44.49  ? 233  ASN B N   1 
ATOM   5922 C  CA  . ASN B  1 233 ? 18.733  10.210  -35.295 1.00 40.83  ? 233  ASN B CA  1 
ATOM   5923 C  C   . ASN B  1 233 ? 18.329  8.977   -34.491 1.00 44.70  ? 233  ASN B C   1 
ATOM   5924 O  O   . ASN B  1 233 ? 17.208  8.478   -34.630 1.00 41.74  ? 233  ASN B O   1 
ATOM   5925 C  CB  . ASN B  1 233 ? 18.795  11.449  -34.394 1.00 34.03  ? 233  ASN B CB  1 
ATOM   5926 C  CG  . ASN B  1 233 ? 17.461  11.757  -33.732 1.00 38.80  ? 233  ASN B CG  1 
ATOM   5927 O  OD1 . ASN B  1 233 ? 16.502  12.153  -34.396 1.00 37.36  ? 233  ASN B OD1 1 
ATOM   5928 N  ND2 . ASN B  1 233 ? 17.399  11.587  -32.416 1.00 42.10  ? 233  ASN B ND2 1 
ATOM   5929 N  N   . GLY B  1 234 ? 19.238  8.481   -33.658 1.00 42.11  ? 234  GLY B N   1 
ATOM   5930 C  CA  . GLY B  1 234 ? 18.960  7.296   -32.866 1.00 41.57  ? 234  GLY B CA  1 
ATOM   5931 C  C   . GLY B  1 234 ? 19.815  6.106   -33.255 1.00 47.48  ? 234  GLY B C   1 
ATOM   5932 O  O   . GLY B  1 234 ? 20.629  6.200   -34.174 1.00 49.78  ? 234  GLY B O   1 
ATOM   5933 N  N   . PRO B  1 235 ? 19.618  4.969   -32.566 1.00 48.32  ? 235  PRO B N   1 
ATOM   5934 C  CA  . PRO B  1 235 ? 20.489  3.792   -32.679 1.00 48.44  ? 235  PRO B CA  1 
ATOM   5935 C  C   . PRO B  1 235 ? 20.219  2.834   -33.849 1.00 46.12  ? 235  PRO B C   1 
ATOM   5936 O  O   . PRO B  1 235 ? 21.114  2.049   -34.163 1.00 49.27  ? 235  PRO B O   1 
ATOM   5937 C  CB  . PRO B  1 235 ? 20.260  3.069   -31.346 1.00 45.91  ? 235  PRO B CB  1 
ATOM   5938 C  CG  . PRO B  1 235 ? 18.870  3.439   -30.946 1.00 38.48  ? 235  PRO B CG  1 
ATOM   5939 C  CD  . PRO B  1 235 ? 18.599  4.812   -31.511 1.00 44.55  ? 235  PRO B CD  1 
ATOM   5940 N  N   . TRP B  1 236 ? 19.044  2.890   -34.478 1.00 38.08  ? 236  TRP B N   1 
ATOM   5941 C  CA  . TRP B  1 236 ? 18.669  1.874   -35.474 1.00 37.73  ? 236  TRP B CA  1 
ATOM   5942 C  C   . TRP B  1 236 ? 18.474  2.368   -36.914 1.00 42.77  ? 236  TRP B C   1 
ATOM   5943 O  O   . TRP B  1 236 ? 18.486  1.570   -37.853 1.00 46.39  ? 236  TRP B O   1 
ATOM   5944 C  CB  . TRP B  1 236 ? 17.396  1.145   -35.026 1.00 32.66  ? 236  TRP B CB  1 
ATOM   5945 C  CG  . TRP B  1 236 ? 16.240  2.066   -34.790 1.00 38.45  ? 236  TRP B CG  1 
ATOM   5946 C  CD1 . TRP B  1 236 ? 15.867  2.619   -33.603 1.00 39.42  ? 236  TRP B CD1 1 
ATOM   5947 C  CD2 . TRP B  1 236 ? 15.303  2.540   -35.766 1.00 43.43  ? 236  TRP B CD2 1 
ATOM   5948 N  NE1 . TRP B  1 236 ? 14.758  3.410   -33.777 1.00 43.75  ? 236  TRP B NE1 1 
ATOM   5949 C  CE2 . TRP B  1 236 ? 14.391  3.379   -35.096 1.00 44.11  ? 236  TRP B CE2 1 
ATOM   5950 C  CE3 . TRP B  1 236 ? 15.147  2.337   -37.140 1.00 46.49  ? 236  TRP B CE3 1 
ATOM   5951 C  CZ2 . TRP B  1 236 ? 13.337  4.014   -35.755 1.00 46.13  ? 236  TRP B CZ2 1 
ATOM   5952 C  CZ3 . TRP B  1 236 ? 14.103  2.970   -37.793 1.00 43.28  ? 236  TRP B CZ3 1 
ATOM   5953 C  CH2 . TRP B  1 236 ? 13.212  3.798   -37.101 1.00 48.72  ? 236  TRP B CH2 1 
ATOM   5954 N  N   . ALA B  1 237 ? 18.287  3.672   -37.086 1.00 43.86  ? 237  ALA B N   1 
ATOM   5955 C  CA  . ALA B  1 237 ? 17.860  4.217   -38.377 1.00 37.98  ? 237  ALA B CA  1 
ATOM   5956 C  C   . ALA B  1 237 ? 18.987  4.438   -39.389 1.00 44.28  ? 237  ALA B C   1 
ATOM   5957 O  O   . ALA B  1 237 ? 18.732  4.519   -40.590 1.00 46.05  ? 237  ALA B O   1 
ATOM   5958 C  CB  . ALA B  1 237 ? 17.066  5.499   -38.172 1.00 31.84  ? 237  ALA B CB  1 
ATOM   5959 N  N   . THR B  1 238 ? 20.222  4.551   -38.906 1.00 41.68  ? 238  THR B N   1 
ATOM   5960 C  CA  . THR B  1 238 ? 21.380  4.682   -39.792 1.00 36.00  ? 238  THR B CA  1 
ATOM   5961 C  C   . THR B  1 238 ? 22.501  3.730   -39.399 1.00 42.01  ? 238  THR B C   1 
ATOM   5962 O  O   . THR B  1 238 ? 22.533  3.217   -38.281 1.00 52.17  ? 238  THR B O   1 
ATOM   5963 C  CB  . THR B  1 238 ? 21.970  6.111   -39.781 1.00 39.65  ? 238  THR B CB  1 
ATOM   5964 O  OG1 . THR B  1 238 ? 22.400  6.448   -38.456 1.00 39.90  ? 238  THR B OG1 1 
ATOM   5965 C  CG2 . THR B  1 238 ? 20.954  7.126   -40.254 1.00 34.28  ? 238  THR B CG2 1 
ATOM   5966 N  N   . VAL B  1 239 ? 23.422  3.505   -40.330 1.00 36.15  ? 239  VAL B N   1 
ATOM   5967 C  CA  . VAL B  1 239 ? 24.680  2.826   -40.034 1.00 35.13  ? 239  VAL B CA  1 
ATOM   5968 C  C   . VAL B  1 239 ? 25.811  3.636   -40.659 1.00 46.92  ? 239  VAL B C   1 
ATOM   5969 O  O   . VAL B  1 239 ? 25.563  4.504   -41.499 1.00 50.39  ? 239  VAL B O   1 
ATOM   5970 C  CB  . VAL B  1 239 ? 24.714  1.388   -40.594 1.00 42.57  ? 239  VAL B CB  1 
ATOM   5971 C  CG1 . VAL B  1 239 ? 23.826  0.474   -39.772 1.00 42.57  ? 239  VAL B CG1 1 
ATOM   5972 C  CG2 . VAL B  1 239 ? 24.299  1.368   -42.067 1.00 33.04  ? 239  VAL B CG2 1 
ATOM   5973 N  N   . SER B  1 240 ? 27.047  3.365   -40.249 1.00 48.22  ? 240  SER B N   1 
ATOM   5974 C  CA  . SER B  1 240 ? 28.201  4.029   -40.847 1.00 49.13  ? 240  SER B CA  1 
ATOM   5975 C  C   . SER B  1 240 ? 28.588  3.325   -42.140 1.00 47.02  ? 240  SER B C   1 
ATOM   5976 O  O   . SER B  1 240 ? 28.112  2.223   -42.415 1.00 38.93  ? 240  SER B O   1 
ATOM   5977 C  CB  . SER B  1 240 ? 29.386  4.024   -39.885 1.00 46.83  ? 240  SER B CB  1 
ATOM   5978 O  OG  . SER B  1 240 ? 29.773  2.698   -39.573 1.00 52.94  ? 240  SER B OG  1 
ATOM   5979 N  N   . ALA B  1 241 ? 29.447  3.964   -42.929 1.00 50.15  ? 241  ALA B N   1 
ATOM   5980 C  CA  . ALA B  1 241 ? 29.927  3.378   -44.177 1.00 50.82  ? 241  ALA B CA  1 
ATOM   5981 C  C   . ALA B  1 241 ? 30.650  2.061   -43.918 1.00 57.52  ? 241  ALA B C   1 
ATOM   5982 O  O   . ALA B  1 241 ? 30.472  1.090   -44.655 1.00 56.10  ? 241  ALA B O   1 
ATOM   5983 C  CB  . ALA B  1 241 ? 30.842  4.350   -44.901 1.00 45.95  ? 241  ALA B CB  1 
ATOM   5984 N  N   . GLY B  1 242 ? 31.469  2.042   -42.869 1.00 51.13  ? 242  GLY B N   1 
ATOM   5985 C  CA  . GLY B  1 242 ? 32.223  0.857   -42.504 1.00 41.43  ? 242  GLY B CA  1 
ATOM   5986 C  C   . GLY B  1 242 ? 31.350  -0.322  -42.114 1.00 49.70  ? 242  GLY B C   1 
ATOM   5987 O  O   . GLY B  1 242 ? 31.611  -1.457  -42.520 1.00 57.57  ? 242  GLY B O   1 
ATOM   5988 N  N   . GLU B  1 243 ? 30.315  -0.060  -41.321 1.00 52.04  ? 243  GLU B N   1 
ATOM   5989 C  CA  . GLU B  1 243 ? 29.404  -1.119  -40.895 1.00 51.75  ? 243  GLU B CA  1 
ATOM   5990 C  C   . GLU B  1 243 ? 28.493  -1.577  -42.033 1.00 47.88  ? 243  GLU B C   1 
ATOM   5991 O  O   . GLU B  1 243 ? 28.146  -2.755  -42.124 1.00 53.06  ? 243  GLU B O   1 
ATOM   5992 C  CB  . GLU B  1 243 ? 28.580  -0.676  -39.680 1.00 47.90  ? 243  GLU B CB  1 
ATOM   5993 C  CG  . GLU B  1 243 ? 27.588  -1.720  -39.153 1.00 46.90  ? 243  GLU B CG  1 
ATOM   5994 C  CD  . GLU B  1 243 ? 28.255  -2.958  -38.573 1.00 49.29  ? 243  GLU B CD  1 
ATOM   5995 O  OE1 . GLU B  1 243 ? 29.503  -3.006  -38.499 1.00 50.62  ? 243  GLU B OE1 1 
ATOM   5996 O  OE2 . GLU B  1 243 ? 27.522  -3.893  -38.182 1.00 44.93  ? 243  GLU B OE2 1 
ATOM   5997 N  N   . ALA B  1 244 ? 28.114  -0.646  -42.903 1.00 44.34  ? 244  ALA B N   1 
ATOM   5998 C  CA  . ALA B  1 244 ? 27.305  -0.990  -44.066 1.00 39.51  ? 244  ALA B CA  1 
ATOM   5999 C  C   . ALA B  1 244 ? 28.109  -1.869  -45.015 1.00 44.47  ? 244  ALA B C   1 
ATOM   6000 O  O   . ALA B  1 244 ? 27.625  -2.904  -45.481 1.00 49.64  ? 244  ALA B O   1 
ATOM   6001 C  CB  . ALA B  1 244 ? 26.823  0.264   -44.778 1.00 31.21  ? 244  ALA B CB  1 
ATOM   6002 N  N   . ARG B  1 245 ? 29.334  -1.441  -45.304 1.00 40.63  ? 245  ARG B N   1 
ATOM   6003 C  CA  . ARG B  1 245 ? 30.257  -2.228  -46.113 1.00 51.27  ? 245  ARG B CA  1 
ATOM   6004 C  C   . ARG B  1 245 ? 30.439  -3.617  -45.515 1.00 54.03  ? 245  ARG B C   1 
ATOM   6005 O  O   . ARG B  1 245 ? 30.340  -4.616  -46.224 1.00 62.46  ? 245  ARG B O   1 
ATOM   6006 C  CB  . ARG B  1 245 ? 31.610  -1.517  -46.238 1.00 49.53  ? 245  ARG B CB  1 
ATOM   6007 C  CG  . ARG B  1 245 ? 32.714  -2.372  -46.850 1.00 46.14  ? 245  ARG B CG  1 
ATOM   6008 C  CD  . ARG B  1 245 ? 33.934  -1.538  -47.229 1.00 49.44  ? 245  ARG B CD  1 
ATOM   6009 N  NE  . ARG B  1 245 ? 33.616  -0.539  -48.247 1.00 53.49  ? 245  ARG B NE  1 
ATOM   6010 C  CZ  . ARG B  1 245 ? 33.544  -0.795  -49.551 1.00 55.37  ? 245  ARG B CZ  1 
ATOM   6011 N  NH1 . ARG B  1 245 ? 33.762  -2.022  -50.004 1.00 46.13  ? 245  ARG B NH1 1 
ATOM   6012 N  NH2 . ARG B  1 245 ? 33.248  0.174   -50.407 1.00 58.63  ? 245  ARG B NH2 1 
ATOM   6013 N  N   . ARG B  1 246 ? 30.680  -3.669  -44.208 1.00 47.45  ? 246  ARG B N   1 
ATOM   6014 C  CA  . ARG B  1 246 ? 30.886  -4.931  -43.500 1.00 48.12  ? 246  ARG B CA  1 
ATOM   6015 C  C   . ARG B  1 246 ? 29.719  -5.903  -43.675 1.00 44.69  ? 246  ARG B C   1 
ATOM   6016 O  O   . ARG B  1 246 ? 29.918  -7.060  -44.052 1.00 41.90  ? 246  ARG B O   1 
ATOM   6017 C  CB  . ARG B  1 246 ? 31.129  -4.680  -42.007 1.00 48.65  ? 246  ARG B CB  1 
ATOM   6018 C  CG  . ARG B  1 246 ? 31.316  -5.958  -41.200 1.00 50.51  ? 246  ARG B CG  1 
ATOM   6019 C  CD  . ARG B  1 246 ? 30.797  -5.829  -39.773 1.00 54.23  ? 246  ARG B CD  1 
ATOM   6020 N  NE  . ARG B  1 246 ? 30.193  -7.085  -39.332 1.00 53.99  ? 246  ARG B NE  1 
ATOM   6021 C  CZ  . ARG B  1 246 ? 28.945  -7.202  -38.891 1.00 53.39  ? 246  ARG B CZ  1 
ATOM   6022 N  NH1 . ARG B  1 246 ? 28.166  -6.135  -38.807 1.00 48.37  ? 246  ARG B NH1 1 
ATOM   6023 N  NH2 . ARG B  1 246 ? 28.479  -8.387  -38.522 1.00 58.28  ? 246  ARG B NH2 1 
ATOM   6024 N  N   . ARG B  1 247 ? 28.504  -5.433  -43.404 1.00 50.03  ? 247  ARG B N   1 
ATOM   6025 C  CA  . ARG B  1 247 ? 27.321  -6.283  -43.511 1.00 50.86  ? 247  ARG B CA  1 
ATOM   6026 C  C   . ARG B  1 247 ? 27.090  -6.736  -44.952 1.00 56.32  ? 247  ARG B C   1 
ATOM   6027 O  O   . ARG B  1 247 ? 26.543  -7.811  -45.193 1.00 58.49  ? 247  ARG B O   1 
ATOM   6028 C  CB  . ARG B  1 247 ? 26.077  -5.562  -42.979 1.00 47.86  ? 247  ARG B CB  1 
ATOM   6029 C  CG  . ARG B  1 247 ? 26.146  -5.147  -41.507 1.00 49.99  ? 247  ARG B CG  1 
ATOM   6030 C  CD  . ARG B  1 247 ? 24.856  -4.455  -41.074 1.00 46.47  ? 247  ARG B CD  1 
ATOM   6031 N  NE  . ARG B  1 247 ? 24.966  -3.819  -39.762 1.00 50.31  ? 247  ARG B NE  1 
ATOM   6032 C  CZ  . ARG B  1 247 ? 23.938  -3.298  -39.096 1.00 51.03  ? 247  ARG B CZ  1 
ATOM   6033 N  NH1 . ARG B  1 247 ? 22.718  -3.340  -39.614 1.00 42.44  ? 247  ARG B NH1 1 
ATOM   6034 N  NH2 . ARG B  1 247 ? 24.127  -2.738  -37.909 1.00 38.38  ? 247  ARG B NH2 1 
ATOM   6035 N  N   . ALA B  1 248 ? 27.520  -5.912  -45.902 1.00 55.48  ? 248  ALA B N   1 
ATOM   6036 C  CA  . ALA B  1 248 ? 27.343  -6.207  -47.319 1.00 47.42  ? 248  ALA B CA  1 
ATOM   6037 C  C   . ALA B  1 248 ? 28.206  -7.376  -47.796 1.00 51.38  ? 248  ALA B C   1 
ATOM   6038 O  O   . ALA B  1 248 ? 27.689  -8.325  -48.389 1.00 48.39  ? 248  ALA B O   1 
ATOM   6039 C  CB  . ALA B  1 248 ? 27.609  -4.967  -48.157 1.00 40.61  ? 248  ALA B CB  1 
ATOM   6040 N  N   . THR B  1 249 ? 29.513  -7.312  -47.546 1.00 53.14  ? 249  THR B N   1 
ATOM   6041 C  CA  . THR B  1 249 ? 30.400  -8.399  -47.964 1.00 62.40  ? 249  THR B CA  1 
ATOM   6042 C  C   . THR B  1 249 ? 30.174  -9.675  -47.154 1.00 57.72  ? 249  THR B C   1 
ATOM   6043 O  O   . THR B  1 249 ? 30.525  -10.770 -47.602 1.00 61.99  ? 249  THR B O   1 
ATOM   6044 C  CB  . THR B  1 249 ? 31.908  -8.016  -47.920 1.00 56.45  ? 249  THR B CB  1 
ATOM   6045 O  OG1 . THR B  1 249 ? 32.561  -8.720  -46.859 1.00 54.37  ? 249  THR B OG1 1 
ATOM   6046 C  CG2 . THR B  1 249 ? 32.096  -6.525  -47.735 1.00 49.93  ? 249  THR B CG2 1 
ATOM   6047 N  N   . LEU B  1 250 ? 29.594  -9.536  -45.964 1.00 53.31  ? 250  LEU B N   1 
ATOM   6048 C  CA  . LEU B  1 250 ? 29.253  -10.703 -45.155 1.00 55.43  ? 250  LEU B CA  1 
ATOM   6049 C  C   . LEU B  1 250 ? 28.074  -11.437 -45.785 1.00 52.44  ? 250  LEU B C   1 
ATOM   6050 O  O   . LEU B  1 250 ? 28.071  -12.667 -45.871 1.00 53.11  ? 250  LEU B O   1 
ATOM   6051 C  CB  . LEU B  1 250 ? 28.940  -10.312 -43.704 1.00 45.25  ? 250  LEU B CB  1 
ATOM   6052 C  CG  . LEU B  1 250 ? 28.549  -11.485 -42.794 1.00 46.81  ? 250  LEU B CG  1 
ATOM   6053 C  CD1 . LEU B  1 250 ? 29.596  -12.582 -42.867 1.00 43.45  ? 250  LEU B CD1 1 
ATOM   6054 C  CD2 . LEU B  1 250 ? 28.337  -11.057 -41.346 1.00 42.32  ? 250  LEU B CD2 1 
ATOM   6055 N  N   . LEU B  1 251 ? 27.075  -10.678 -46.229 1.00 44.65  ? 251  LEU B N   1 
ATOM   6056 C  CA  . LEU B  1 251 ? 25.934  -11.258 -46.933 1.00 48.19  ? 251  LEU B CA  1 
ATOM   6057 C  C   . LEU B  1 251 ? 26.397  -11.911 -48.228 1.00 54.88  ? 251  LEU B C   1 
ATOM   6058 O  O   . LEU B  1 251 ? 25.894  -12.964 -48.620 1.00 56.52  ? 251  LEU B O   1 
ATOM   6059 C  CB  . LEU B  1 251 ? 24.880  -10.195 -47.245 1.00 45.47  ? 251  LEU B CB  1 
ATOM   6060 C  CG  . LEU B  1 251 ? 23.616  -10.756 -47.905 1.00 49.28  ? 251  LEU B CG  1 
ATOM   6061 C  CD1 . LEU B  1 251 ? 22.572  -11.109 -46.856 1.00 37.18  ? 251  LEU B CD1 1 
ATOM   6062 C  CD2 . LEU B  1 251 ? 23.050  -9.804  -48.946 1.00 50.15  ? 251  LEU B CD2 1 
ATOM   6063 N  N   . ALA B  1 252 ? 27.360  -11.277 -48.888 1.00 56.78  ? 252  ALA B N   1 
ATOM   6064 C  CA  . ALA B  1 252 ? 27.933  -11.823 -50.111 1.00 61.02  ? 252  ALA B CA  1 
ATOM   6065 C  C   . ALA B  1 252 ? 28.595  -13.166 -49.835 1.00 62.19  ? 252  ALA B C   1 
ATOM   6066 O  O   . ALA B  1 252 ? 28.339  -14.148 -50.533 1.00 66.53  ? 252  ALA B O   1 
ATOM   6067 C  CB  . ALA B  1 252 ? 28.935  -10.851 -50.702 1.00 61.50  ? 252  ALA B CB  1 
ATOM   6068 N  N   . ARG B  1 253 ? 29.449  -13.197 -48.817 1.00 57.49  ? 253  ARG B N   1 
ATOM   6069 C  CA  . ARG B  1 253 ? 30.134  -14.422 -48.420 1.00 61.57  ? 253  ARG B CA  1 
ATOM   6070 C  C   . ARG B  1 253 ? 29.127  -15.528 -48.092 1.00 64.47  ? 253  ARG B C   1 
ATOM   6071 O  O   . ARG B  1 253 ? 29.372  -16.705 -48.366 1.00 67.13  ? 253  ARG B O   1 
ATOM   6072 C  CB  . ARG B  1 253 ? 31.060  -14.148 -47.226 1.00 66.03  ? 253  ARG B CB  1 
ATOM   6073 C  CG  . ARG B  1 253 ? 32.030  -15.279 -46.894 1.00 76.04  ? 253  ARG B CG  1 
ATOM   6074 C  CD  . ARG B  1 253 ? 31.564  -16.094 -45.690 1.00 82.32  ? 253  ARG B CD  1 
ATOM   6075 N  NE  . ARG B  1 253 ? 32.204  -15.672 -44.444 1.00 89.68  ? 253  ARG B NE  1 
ATOM   6076 C  CZ  . ARG B  1 253 ? 31.940  -16.199 -43.250 1.00 95.74  ? 253  ARG B CZ  1 
ATOM   6077 N  NH1 . ARG B  1 253 ? 31.041  -17.167 -43.133 1.00 92.33  ? 253  ARG B NH1 1 
ATOM   6078 N  NH2 . ARG B  1 253 ? 32.572  -15.756 -42.171 1.00 100.54 ? 253  ARG B NH2 1 
ATOM   6079 N  N   . LEU B  1 254 ? 27.986  -15.138 -47.529 1.00 62.86  ? 254  LEU B N   1 
ATOM   6080 C  CA  . LEU B  1 254 ? 26.937  -16.090 -47.160 1.00 64.66  ? 254  LEU B CA  1 
ATOM   6081 C  C   . LEU B  1 254 ? 26.209  -16.696 -48.366 1.00 64.01  ? 254  LEU B C   1 
ATOM   6082 O  O   . LEU B  1 254 ? 25.724  -17.827 -48.295 1.00 66.91  ? 254  LEU B O   1 
ATOM   6083 C  CB  . LEU B  1 254 ? 25.929  -15.442 -46.201 1.00 60.77  ? 254  LEU B CB  1 
ATOM   6084 C  CG  . LEU B  1 254 ? 26.378  -15.207 -44.755 1.00 61.40  ? 254  LEU B CG  1 
ATOM   6085 C  CD1 . LEU B  1 254 ? 25.308  -14.484 -43.948 1.00 62.66  ? 254  LEU B CD1 1 
ATOM   6086 C  CD2 . LEU B  1 254 ? 26.734  -16.525 -44.098 1.00 55.19  ? 254  LEU B CD2 1 
ATOM   6087 N  N   . VAL B  1 255 ? 26.125  -15.949 -49.464 1.00 57.25  ? 255  VAL B N   1 
ATOM   6088 C  CA  . VAL B  1 255 ? 25.456  -16.450 -50.664 1.00 55.63  ? 255  VAL B CA  1 
ATOM   6089 C  C   . VAL B  1 255 ? 26.437  -16.974 -51.718 1.00 57.39  ? 255  VAL B C   1 
ATOM   6090 O  O   . VAL B  1 255 ? 26.026  -17.437 -52.786 1.00 70.49  ? 255  VAL B O   1 
ATOM   6091 C  CB  . VAL B  1 255 ? 24.502  -15.397 -51.288 1.00 55.32  ? 255  VAL B CB  1 
ATOM   6092 C  CG1 . VAL B  1 255 ? 23.353  -15.099 -50.345 1.00 50.84  ? 255  VAL B CG1 1 
ATOM   6093 C  CG2 . VAL B  1 255 ? 25.251  -14.122 -51.636 1.00 48.20  ? 255  VAL B CG2 1 
ATOM   6094 N  N   . GLY B  1 256 ? 27.732  -16.900 -51.416 1.00 56.01  ? 256  GLY B N   1 
ATOM   6095 C  CA  . GLY B  1 256 ? 28.752  -17.474 -52.280 1.00 57.44  ? 256  GLY B CA  1 
ATOM   6096 C  C   . GLY B  1 256 ? 29.520  -16.488 -53.144 1.00 63.36  ? 256  GLY B C   1 
ATOM   6097 O  O   . GLY B  1 256 ? 30.255  -16.891 -54.047 1.00 70.47  ? 256  GLY B O   1 
ATOM   6098 N  N   . CYS B  1 257 ? 29.361  -15.198 -52.868 1.00 63.46  ? 257  CYS B N   1 
ATOM   6099 C  CA  . CYS B  1 257 ? 30.009  -14.162 -53.667 1.00 65.22  ? 257  CYS B CA  1 
ATOM   6100 C  C   . CYS B  1 257 ? 31.223  -13.582 -52.948 1.00 71.95  ? 257  CYS B C   1 
ATOM   6101 O  O   . CYS B  1 257 ? 32.337  -13.615 -53.469 1.00 76.14  ? 257  CYS B O   1 
ATOM   6102 C  CB  . CYS B  1 257 ? 29.015  -13.046 -53.995 1.00 60.76  ? 257  CYS B CB  1 
ATOM   6103 S  SG  . CYS B  1 257 ? 27.529  -13.601 -54.854 1.00 80.44  ? 257  CYS B SG  1 
ATOM   6104 N  N   . ASN B  1 265 ? 37.196  -6.898  -54.720 1.00 71.56  ? 265  ASN B N   1 
ATOM   6105 C  CA  . ASN B  1 265 ? 36.695  -5.936  -55.698 1.00 80.41  ? 265  ASN B CA  1 
ATOM   6106 C  C   . ASN B  1 265 ? 35.175  -5.762  -55.646 1.00 76.69  ? 265  ASN B C   1 
ATOM   6107 O  O   . ASN B  1 265 ? 34.427  -6.741  -55.688 1.00 79.48  ? 265  ASN B O   1 
ATOM   6108 C  CB  . ASN B  1 265 ? 37.137  -6.333  -57.108 1.00 89.25  ? 265  ASN B CB  1 
ATOM   6109 C  CG  . ASN B  1 265 ? 36.520  -5.460  -58.177 1.00 97.77  ? 265  ASN B CG  1 
ATOM   6110 O  OD1 . ASN B  1 265 ? 35.441  -5.757  -58.689 1.00 101.36 ? 265  ASN B OD1 1 
ATOM   6111 N  ND2 . ASN B  1 265 ? 37.204  -4.377  -58.525 1.00 100.95 ? 265  ASN B ND2 1 
ATOM   6112 N  N   . ASP B  1 266 ? 34.730  -4.509  -55.560 1.00 64.50  ? 266  ASP B N   1 
ATOM   6113 C  CA  . ASP B  1 266 ? 33.305  -4.192  -55.451 1.00 59.14  ? 266  ASP B CA  1 
ATOM   6114 C  C   . ASP B  1 266 ? 32.482  -4.626  -56.672 1.00 63.67  ? 266  ASP B C   1 
ATOM   6115 O  O   . ASP B  1 266 ? 31.462  -5.302  -56.525 1.00 57.59  ? 266  ASP B O   1 
ATOM   6116 C  CB  . ASP B  1 266 ? 33.102  -2.692  -55.175 1.00 56.70  ? 266  ASP B CB  1 
ATOM   6117 C  CG  . ASP B  1 266 ? 33.424  -2.305  -53.733 1.00 67.99  ? 266  ASP B CG  1 
ATOM   6118 O  OD1 . ASP B  1 266 ? 33.609  -3.208  -52.888 1.00 63.45  ? 266  ASP B OD1 1 
ATOM   6119 O  OD2 . ASP B  1 266 ? 33.477  -1.089  -53.440 1.00 68.45  ? 266  ASP B OD2 1 
ATOM   6120 N  N   . THR B  1 267 ? 32.933  -4.241  -57.866 1.00 64.87  ? 267  THR B N   1 
ATOM   6121 C  CA  . THR B  1 267 ? 32.212  -4.525  -59.110 1.00 61.11  ? 267  THR B CA  1 
ATOM   6122 C  C   . THR B  1 267 ? 31.930  -6.015  -59.288 1.00 59.12  ? 267  THR B C   1 
ATOM   6123 O  O   . THR B  1 267 ? 30.838  -6.406  -59.706 1.00 55.95  ? 267  THR B O   1 
ATOM   6124 C  CB  . THR B  1 267 ? 32.990  -4.011  -60.341 1.00 65.69  ? 267  THR B CB  1 
ATOM   6125 O  OG1 . THR B  1 267 ? 33.391  -2.652  -60.126 1.00 69.31  ? 267  THR B OG1 1 
ATOM   6126 C  CG2 . THR B  1 267 ? 32.132  -4.090  -61.596 1.00 61.25  ? 267  THR B CG2 1 
ATOM   6127 N  N   . GLU B  1 268 ? 32.918  -6.840  -58.961 1.00 63.28  ? 268  GLU B N   1 
ATOM   6128 C  CA  . GLU B  1 268 ? 32.764  -8.286  -59.045 1.00 67.33  ? 268  GLU B CA  1 
ATOM   6129 C  C   . GLU B  1 268 ? 31.774  -8.793  -58.000 1.00 64.80  ? 268  GLU B C   1 
ATOM   6130 O  O   . GLU B  1 268 ? 30.967  -9.681  -58.279 1.00 65.99  ? 268  GLU B O   1 
ATOM   6131 C  CB  . GLU B  1 268 ? 34.117  -8.977  -58.866 1.00 69.10  ? 268  GLU B CB  1 
ATOM   6132 N  N   . LEU B  1 269 ? 31.836  -8.218  -56.800 1.00 65.11  ? 269  LEU B N   1 
ATOM   6133 C  CA  . LEU B  1 269 ? 30.951  -8.614  -55.706 1.00 54.54  ? 269  LEU B CA  1 
ATOM   6134 C  C   . LEU B  1 269 ? 29.482  -8.316  -56.015 1.00 51.39  ? 269  LEU B C   1 
ATOM   6135 O  O   . LEU B  1 269 ? 28.616  -9.177  -55.842 1.00 54.27  ? 269  LEU B O   1 
ATOM   6136 C  CB  . LEU B  1 269 ? 31.359  -7.919  -54.404 1.00 59.57  ? 269  LEU B CB  1 
ATOM   6137 C  CG  . LEU B  1 269 ? 30.909  -8.610  -53.113 1.00 67.97  ? 269  LEU B CG  1 
ATOM   6138 C  CD1 . LEU B  1 269 ? 31.760  -9.842  -52.862 1.00 75.71  ? 269  LEU B CD1 1 
ATOM   6139 C  CD2 . LEU B  1 269 ? 30.974  -7.675  -51.925 1.00 71.21  ? 269  LEU B CD2 1 
ATOM   6140 N  N   . ILE B  1 270 ? 29.209  -7.094  -56.469 1.00 42.98  ? 270  ILE B N   1 
ATOM   6141 C  CA  . ILE B  1 270 ? 27.850  -6.678  -56.809 1.00 52.89  ? 270  ILE B CA  1 
ATOM   6142 C  C   . ILE B  1 270 ? 27.305  -7.490  -57.980 1.00 52.03  ? 270  ILE B C   1 
ATOM   6143 O  O   . ILE B  1 270 ? 26.116  -7.819  -58.028 1.00 51.68  ? 270  ILE B O   1 
ATOM   6144 C  CB  . ILE B  1 270 ? 27.794  -5.177  -57.167 1.00 52.54  ? 270  ILE B CB  1 
ATOM   6145 C  CG1 . ILE B  1 270 ? 28.464  -4.347  -56.075 1.00 55.00  ? 270  ILE B CG1 1 
ATOM   6146 C  CG2 . ILE B  1 270 ? 26.352  -4.719  -57.349 1.00 43.13  ? 270  ILE B CG2 1 
ATOM   6147 C  CD1 . ILE B  1 270 ? 27.711  -4.373  -54.776 1.00 52.15  ? 270  ILE B CD1 1 
ATOM   6148 N  N   . ALA B  1 271 ? 28.182  -7.810  -58.925 1.00 47.17  ? 271  ALA B N   1 
ATOM   6149 C  CA  . ALA B  1 271 ? 27.783  -8.585  -60.092 1.00 53.05  ? 271  ALA B CA  1 
ATOM   6150 C  C   . ALA B  1 271 ? 27.236  -9.951  -59.684 1.00 51.36  ? 271  ALA B C   1 
ATOM   6151 O  O   . ALA B  1 271 ? 26.149  -10.339 -60.112 1.00 45.30  ? 271  ALA B O   1 
ATOM   6152 C  CB  . ALA B  1 271 ? 28.947  -8.737  -61.052 1.00 53.04  ? 271  ALA B CB  1 
ATOM   6153 N  N   . CYS B  1 272 ? 27.988  -10.669 -58.854 1.00 47.87  ? 272  CYS B N   1 
ATOM   6154 C  CA  . CYS B  1 272 ? 27.565  -11.985 -58.378 1.00 49.71  ? 272  CYS B CA  1 
ATOM   6155 C  C   . CYS B  1 272 ? 26.275  -11.906 -57.559 1.00 55.89  ? 272  CYS B C   1 
ATOM   6156 O  O   . CYS B  1 272 ? 25.422  -12.796 -57.638 1.00 61.21  ? 272  CYS B O   1 
ATOM   6157 C  CB  . CYS B  1 272 ? 28.685  -12.647 -57.566 1.00 36.65  ? 272  CYS B CB  1 
ATOM   6158 S  SG  . CYS B  1 272 ? 28.205  -14.161 -56.694 1.00 98.28  ? 272  CYS B SG  1 
ATOM   6159 N  N   . LEU B  1 273 ? 26.135  -10.834 -56.780 1.00 48.74  ? 273  LEU B N   1 
ATOM   6160 C  CA  . LEU B  1 273 ? 24.915  -10.594 -56.008 1.00 48.45  ? 273  LEU B CA  1 
ATOM   6161 C  C   . LEU B  1 273 ? 23.698  -10.396 -56.916 1.00 51.17  ? 273  LEU B C   1 
ATOM   6162 O  O   . LEU B  1 273 ? 22.588  -10.810 -56.574 1.00 53.84  ? 273  LEU B O   1 
ATOM   6163 C  CB  . LEU B  1 273 ? 25.085  -9.388  -55.073 1.00 43.62  ? 273  LEU B CB  1 
ATOM   6164 C  CG  . LEU B  1 273 ? 25.809  -9.614  -53.741 1.00 43.70  ? 273  LEU B CG  1 
ATOM   6165 C  CD1 . LEU B  1 273 ? 25.986  -8.316  -52.963 1.00 42.58  ? 273  LEU B CD1 1 
ATOM   6166 C  CD2 . LEU B  1 273 ? 25.059  -10.626 -52.900 1.00 38.43  ? 273  LEU B CD2 1 
ATOM   6167 N  N   . ARG B  1 274 ? 23.912  -9.769  -58.071 1.00 50.58  ? 274  ARG B N   1 
ATOM   6168 C  CA  . ARG B  1 274 ? 22.831  -9.513  -59.026 1.00 53.13  ? 274  ARG B CA  1 
ATOM   6169 C  C   . ARG B  1 274 ? 22.377  -10.772 -59.767 1.00 50.07  ? 274  ARG B C   1 
ATOM   6170 O  O   . ARG B  1 274 ? 21.294  -10.794 -60.353 1.00 54.58  ? 274  ARG B O   1 
ATOM   6171 C  CB  . ARG B  1 274 ? 23.227  -8.422  -60.032 1.00 52.02  ? 274  ARG B CB  1 
ATOM   6172 C  CG  . ARG B  1 274 ? 23.086  -6.991  -59.514 1.00 57.25  ? 274  ARG B CG  1 
ATOM   6173 C  CD  . ARG B  1 274 ? 23.333  -5.974  -60.625 1.00 62.58  ? 274  ARG B CD  1 
ATOM   6174 N  NE  . ARG B  1 274 ? 24.692  -6.061  -61.158 1.00 72.33  ? 274  ARG B NE  1 
ATOM   6175 C  CZ  . ARG B  1 274 ? 25.588  -5.081  -61.091 1.00 81.98  ? 274  ARG B CZ  1 
ATOM   6176 N  NH1 . ARG B  1 274 ? 25.272  -3.924  -60.526 1.00 77.05  ? 274  ARG B NH1 1 
ATOM   6177 N  NH2 . ARG B  1 274 ? 26.801  -5.253  -61.597 1.00 87.58  ? 274  ARG B NH2 1 
ATOM   6178 N  N   . THR B  1 275 ? 23.203  -11.817 -59.736 1.00 47.90  ? 275  THR B N   1 
ATOM   6179 C  CA  . THR B  1 275 ? 22.837  -13.100 -60.338 1.00 51.00  ? 275  THR B CA  1 
ATOM   6180 C  C   . THR B  1 275 ? 22.011  -13.938 -59.369 1.00 58.44  ? 275  THR B C   1 
ATOM   6181 O  O   . THR B  1 275 ? 21.499  -14.999 -59.731 1.00 64.56  ? 275  THR B O   1 
ATOM   6182 C  CB  . THR B  1 275 ? 24.075  -13.933 -60.740 1.00 52.11  ? 275  THR B CB  1 
ATOM   6183 O  OG1 . THR B  1 275 ? 24.599  -14.617 -59.591 1.00 51.17  ? 275  THR B OG1 1 
ATOM   6184 C  CG2 . THR B  1 275 ? 25.150  -13.050 -61.351 1.00 55.78  ? 275  THR B CG2 1 
ATOM   6185 N  N   . ARG B  1 276 ? 21.889  -13.460 -58.135 1.00 55.54  ? 276  ARG B N   1 
ATOM   6186 C  CA  . ARG B  1 276 ? 21.202  -14.215 -57.094 1.00 53.29  ? 276  ARG B CA  1 
ATOM   6187 C  C   . ARG B  1 276 ? 19.703  -13.942 -57.067 1.00 47.58  ? 276  ARG B C   1 
ATOM   6188 O  O   . ARG B  1 276 ? 19.279  -12.784 -57.072 1.00 46.89  ? 276  ARG B O   1 
ATOM   6189 C  CB  . ARG B  1 276 ? 21.801  -13.907 -55.717 1.00 54.15  ? 276  ARG B CB  1 
ATOM   6190 C  CG  . ARG B  1 276 ? 23.222  -14.417 -55.516 1.00 53.92  ? 276  ARG B CG  1 
ATOM   6191 C  CD  . ARG B  1 276 ? 23.290  -15.927 -55.667 1.00 56.93  ? 276  ARG B CD  1 
ATOM   6192 N  NE  . ARG B  1 276 ? 24.612  -16.459 -55.346 1.00 68.33  ? 276  ARG B NE  1 
ATOM   6193 C  CZ  . ARG B  1 276 ? 25.590  -16.616 -56.233 1.00 69.58  ? 276  ARG B CZ  1 
ATOM   6194 N  NH1 . ARG B  1 276 ? 25.399  -16.274 -57.500 1.00 70.43  ? 276  ARG B NH1 1 
ATOM   6195 N  NH2 . ARG B  1 276 ? 26.761  -17.109 -55.856 1.00 68.02  ? 276  ARG B NH2 1 
ATOM   6196 N  N   . PRO B  1 277 ? 18.895  -15.017 -57.037 1.00 43.97  ? 277  PRO B N   1 
ATOM   6197 C  CA  . PRO B  1 277 ? 17.442  -14.897 -56.866 1.00 44.49  ? 277  PRO B CA  1 
ATOM   6198 C  C   . PRO B  1 277 ? 17.120  -14.079 -55.617 1.00 49.75  ? 277  PRO B C   1 
ATOM   6199 O  O   . PRO B  1 277 ? 17.889  -14.119 -54.654 1.00 45.35  ? 277  PRO B O   1 
ATOM   6200 C  CB  . PRO B  1 277 ? 16.997  -16.348 -56.671 1.00 39.27  ? 277  PRO B CB  1 
ATOM   6201 C  CG  . PRO B  1 277 ? 18.033  -17.162 -57.392 1.00 39.23  ? 277  PRO B CG  1 
ATOM   6202 C  CD  . PRO B  1 277 ? 19.328  -16.421 -57.192 1.00 38.90  ? 277  PRO B CD  1 
ATOM   6203 N  N   . ALA B  1 278 ? 16.003  -13.357 -55.632 1.00 44.95  ? 278  ALA B N   1 
ATOM   6204 C  CA  . ALA B  1 278 ? 15.657  -12.441 -54.546 1.00 46.66  ? 278  ALA B CA  1 
ATOM   6205 C  C   . ALA B  1 278 ? 15.623  -13.094 -53.162 1.00 52.69  ? 278  ALA B C   1 
ATOM   6206 O  O   . ALA B  1 278 ? 16.175  -12.553 -52.203 1.00 48.48  ? 278  ALA B O   1 
ATOM   6207 C  CB  . ALA B  1 278 ? 14.330  -11.743 -54.843 1.00 42.97  ? 278  ALA B CB  1 
ATOM   6208 N  N   . GLN B  1 279 ? 14.977  -14.251 -53.063 1.00 54.73  ? 279  GLN B N   1 
ATOM   6209 C  CA  . GLN B  1 279 ? 14.797  -14.925 -51.778 1.00 55.49  ? 279  GLN B CA  1 
ATOM   6210 C  C   . GLN B  1 279 ? 16.118  -15.428 -51.184 1.00 57.06  ? 279  GLN B C   1 
ATOM   6211 O  O   . GLN B  1 279 ? 16.232  -15.600 -49.968 1.00 56.18  ? 279  GLN B O   1 
ATOM   6212 C  CB  . GLN B  1 279 ? 13.791  -16.071 -51.922 1.00 54.29  ? 279  GLN B CB  1 
ATOM   6213 C  CG  . GLN B  1 279 ? 13.370  -16.714 -50.604 1.00 45.66  ? 279  GLN B CG  1 
ATOM   6214 C  CD  . GLN B  1 279 ? 12.722  -15.729 -49.646 1.00 48.85  ? 279  GLN B CD  1 
ATOM   6215 O  OE1 . GLN B  1 279 ? 11.904  -14.901 -50.047 1.00 49.79  ? 279  GLN B OE1 1 
ATOM   6216 N  NE2 . GLN B  1 279 ? 13.087  -15.815 -48.372 1.00 51.50  ? 279  GLN B NE2 1 
ATOM   6217 N  N   . ASP B  1 280 ? 17.113  -15.655 -52.038 1.00 55.49  ? 280  ASP B N   1 
ATOM   6218 C  CA  . ASP B  1 280 ? 18.438  -16.070 -51.573 1.00 55.06  ? 280  ASP B CA  1 
ATOM   6219 C  C   . ASP B  1 280 ? 19.104  -14.975 -50.732 1.00 55.51  ? 280  ASP B C   1 
ATOM   6220 O  O   . ASP B  1 280 ? 19.852  -15.263 -49.798 1.00 62.78  ? 280  ASP B O   1 
ATOM   6221 C  CB  . ASP B  1 280 ? 19.332  -16.450 -52.758 1.00 57.91  ? 280  ASP B CB  1 
ATOM   6222 C  CG  . ASP B  1 280 ? 18.974  -17.799 -53.352 1.00 67.29  ? 280  ASP B CG  1 
ATOM   6223 O  OD1 . ASP B  1 280 ? 17.914  -18.351 -52.989 1.00 76.40  ? 280  ASP B OD1 1 
ATOM   6224 O  OD2 . ASP B  1 280 ? 19.754  -18.303 -54.188 1.00 65.05  ? 280  ASP B OD2 1 
ATOM   6225 N  N   . LEU B  1 281 ? 18.821  -13.719 -51.067 1.00 50.88  ? 281  LEU B N   1 
ATOM   6226 C  CA  . LEU B  1 281 ? 19.346  -12.579 -50.317 1.00 53.02  ? 281  LEU B CA  1 
ATOM   6227 C  C   . LEU B  1 281 ? 18.575  -12.384 -49.011 1.00 50.13  ? 281  LEU B C   1 
ATOM   6228 O  O   . LEU B  1 281 ? 19.165  -12.109 -47.963 1.00 45.65  ? 281  LEU B O   1 
ATOM   6229 C  CB  . LEU B  1 281 ? 19.285  -11.304 -51.168 1.00 54.37  ? 281  LEU B CB  1 
ATOM   6230 C  CG  . LEU B  1 281 ? 20.502  -10.929 -52.022 1.00 50.15  ? 281  LEU B CG  1 
ATOM   6231 C  CD1 . LEU B  1 281 ? 21.212  -12.157 -52.542 1.00 41.40  ? 281  LEU B CD1 1 
ATOM   6232 C  CD2 . LEU B  1 281 ? 20.090  -10.034 -53.180 1.00 46.15  ? 281  LEU B CD2 1 
ATOM   6233 N  N   . VAL B  1 282 ? 17.255  -12.537 -49.083 1.00 41.69  ? 282  VAL B N   1 
ATOM   6234 C  CA  . VAL B  1 282 ? 16.387  -12.424 -47.912 1.00 42.77  ? 282  VAL B CA  1 
ATOM   6235 C  C   . VAL B  1 282 ? 16.666  -13.526 -46.874 1.00 50.30  ? 282  VAL B C   1 
ATOM   6236 O  O   . VAL B  1 282 ? 16.587  -13.286 -45.666 1.00 48.42  ? 282  VAL B O   1 
ATOM   6237 C  CB  . VAL B  1 282 ? 14.896  -12.403 -48.338 1.00 36.52  ? 282  VAL B CB  1 
ATOM   6238 C  CG1 . VAL B  1 282 ? 13.977  -12.575 -47.141 1.00 40.51  ? 282  VAL B CG1 1 
ATOM   6239 C  CG2 . VAL B  1 282 ? 14.575  -11.106 -49.061 1.00 32.83  ? 282  VAL B CG2 1 
ATOM   6240 N  N   . ASP B  1 283 ? 17.022  -14.719 -47.348 1.00 47.83  ? 283  ASP B N   1 
ATOM   6241 C  CA  . ASP B  1 283 ? 17.297  -15.858 -46.467 1.00 46.78  ? 283  ASP B CA  1 
ATOM   6242 C  C   . ASP B  1 283 ? 18.455  -15.625 -45.487 1.00 50.91  ? 283  ASP B C   1 
ATOM   6243 O  O   . ASP B  1 283 ? 18.507  -16.243 -44.422 1.00 53.49  ? 283  ASP B O   1 
ATOM   6244 C  CB  . ASP B  1 283 ? 17.571  -17.127 -47.289 1.00 50.46  ? 283  ASP B CB  1 
ATOM   6245 C  CG  . ASP B  1 283 ? 16.310  -17.737 -47.879 1.00 54.75  ? 283  ASP B CG  1 
ATOM   6246 O  OD1 . ASP B  1 283 ? 15.199  -17.277 -47.547 1.00 58.06  ? 283  ASP B OD1 1 
ATOM   6247 O  OD2 . ASP B  1 283 ? 16.437  -18.693 -48.674 1.00 59.09  ? 283  ASP B OD2 1 
ATOM   6248 N  N   . HIS B  1 284 ? 19.383  -14.743 -45.850 1.00 53.35  ? 284  HIS B N   1 
ATOM   6249 C  CA  . HIS B  1 284 ? 20.539  -14.459 -44.999 1.00 55.47  ? 284  HIS B CA  1 
ATOM   6250 C  C   . HIS B  1 284 ? 20.561  -13.013 -44.516 1.00 58.31  ? 284  HIS B C   1 
ATOM   6251 O  O   . HIS B  1 284 ? 21.568  -12.542 -43.989 1.00 58.52  ? 284  HIS B O   1 
ATOM   6252 C  CB  . HIS B  1 284 ? 21.843  -14.786 -45.730 1.00 59.19  ? 284  HIS B CB  1 
ATOM   6253 C  CG  . HIS B  1 284 ? 22.117  -16.252 -45.845 1.00 64.60  ? 284  HIS B CG  1 
ATOM   6254 N  ND1 . HIS B  1 284 ? 22.218  -17.079 -44.747 1.00 69.81  ? 284  HIS B ND1 1 
ATOM   6255 C  CD2 . HIS B  1 284 ? 22.320  -17.040 -46.929 1.00 57.89  ? 284  HIS B CD2 1 
ATOM   6256 C  CE1 . HIS B  1 284 ? 22.466  -18.313 -45.147 1.00 68.99  ? 284  HIS B CE1 1 
ATOM   6257 N  NE2 . HIS B  1 284 ? 22.534  -18.316 -46.468 1.00 67.48  ? 284  HIS B NE2 1 
ATOM   6258 N  N   . GLU B  1 285 ? 19.440  -12.321 -44.685 1.00 57.08  ? 285  GLU B N   1 
ATOM   6259 C  CA  . GLU B  1 285 ? 19.335  -10.913 -44.321 1.00 52.47  ? 285  GLU B CA  1 
ATOM   6260 C  C   . GLU B  1 285 ? 19.583  -10.673 -42.827 1.00 53.02  ? 285  GLU B C   1 
ATOM   6261 O  O   . GLU B  1 285 ? 20.275  -9.726  -42.455 1.00 42.64  ? 285  GLU B O   1 
ATOM   6262 C  CB  . GLU B  1 285 ? 17.959  -10.375 -44.730 1.00 44.96  ? 285  GLU B CB  1 
ATOM   6263 C  CG  . GLU B  1 285 ? 17.845  -8.861  -44.723 1.00 53.18  ? 285  GLU B CG  1 
ATOM   6264 C  CD  . GLU B  1 285 ? 16.452  -8.383  -45.081 1.00 66.92  ? 285  GLU B CD  1 
ATOM   6265 O  OE1 . GLU B  1 285 ? 15.763  -9.075  -45.861 1.00 66.41  ? 285  GLU B OE1 1 
ATOM   6266 O  OE2 . GLU B  1 285 ? 16.046  -7.316  -44.578 1.00 79.61  ? 285  GLU B OE2 1 
ATOM   6267 N  N   . TRP B  1 286 ? 19.032  -11.533 -41.975 1.00 54.35  ? 286  TRP B N   1 
ATOM   6268 C  CA  . TRP B  1 286 ? 19.137  -11.339 -40.525 1.00 51.80  ? 286  TRP B CA  1 
ATOM   6269 C  C   . TRP B  1 286 ? 20.450  -11.845 -39.922 1.00 58.00  ? 286  TRP B C   1 
ATOM   6270 O  O   . TRP B  1 286 ? 20.696  -11.674 -38.727 1.00 73.85  ? 286  TRP B O   1 
ATOM   6271 C  CB  . TRP B  1 286 ? 17.953  -12.007 -39.814 1.00 47.69  ? 286  TRP B CB  1 
ATOM   6272 C  CG  . TRP B  1 286 ? 16.627  -11.377 -40.121 1.00 54.11  ? 286  TRP B CG  1 
ATOM   6273 C  CD1 . TRP B  1 286 ? 15.690  -11.824 -41.007 1.00 53.46  ? 286  TRP B CD1 1 
ATOM   6274 C  CD2 . TRP B  1 286 ? 16.093  -10.178 -39.541 1.00 57.63  ? 286  TRP B CD2 1 
ATOM   6275 N  NE1 . TRP B  1 286 ? 14.604  -10.977 -41.012 1.00 49.74  ? 286  TRP B NE1 1 
ATOM   6276 C  CE2 . TRP B  1 286 ? 14.828  -9.960  -40.122 1.00 50.55  ? 286  TRP B CE2 1 
ATOM   6277 C  CE3 . TRP B  1 286 ? 16.561  -9.270  -38.585 1.00 55.41  ? 286  TRP B CE3 1 
ATOM   6278 C  CZ2 . TRP B  1 286 ? 14.027  -8.868  -39.778 1.00 49.24  ? 286  TRP B CZ2 1 
ATOM   6279 C  CZ3 . TRP B  1 286 ? 15.767  -8.188  -38.247 1.00 49.80  ? 286  TRP B CZ3 1 
ATOM   6280 C  CH2 . TRP B  1 286 ? 14.515  -7.997  -38.840 1.00 52.10  ? 286  TRP B CH2 1 
ATOM   6281 N  N   . HIS B  1 287 ? 21.294  -12.454 -40.748 1.00 54.24  ? 287  HIS B N   1 
ATOM   6282 C  CA  . HIS B  1 287 ? 22.497  -13.121 -40.250 1.00 52.16  ? 287  HIS B CA  1 
ATOM   6283 C  C   . HIS B  1 287 ? 23.744  -12.230 -40.227 1.00 47.97  ? 287  HIS B C   1 
ATOM   6284 O  O   . HIS B  1 287 ? 24.830  -12.692 -39.870 1.00 48.95  ? 287  HIS B O   1 
ATOM   6285 C  CB  . HIS B  1 287 ? 22.773  -14.386 -41.070 1.00 51.84  ? 287  HIS B CB  1 
ATOM   6286 C  CG  . HIS B  1 287 ? 21.670  -15.399 -41.008 1.00 57.83  ? 287  HIS B CG  1 
ATOM   6287 N  ND1 . HIS B  1 287 ? 21.697  -16.571 -41.736 1.00 63.55  ? 287  HIS B ND1 1 
ATOM   6288 C  CD2 . HIS B  1 287 ? 20.511  -15.419 -40.309 1.00 59.02  ? 287  HIS B CD2 1 
ATOM   6289 C  CE1 . HIS B  1 287 ? 20.602  -17.266 -41.486 1.00 64.85  ? 287  HIS B CE1 1 
ATOM   6290 N  NE2 . HIS B  1 287 ? 19.865  -16.590 -40.623 1.00 61.77  ? 287  HIS B NE2 1 
ATOM   6291 N  N   . VAL B  1 288 ? 23.588  -10.960 -40.596 1.00 47.30  ? 288  VAL B N   1 
ATOM   6292 C  CA  . VAL B  1 288 ? 24.729  -10.042 -40.676 1.00 52.22  ? 288  VAL B CA  1 
ATOM   6293 C  C   . VAL B  1 288 ? 24.773  -8.994  -39.557 1.00 50.80  ? 288  VAL B C   1 
ATOM   6294 O  O   . VAL B  1 288 ? 25.659  -8.136  -39.540 1.00 51.49  ? 288  VAL B O   1 
ATOM   6295 C  CB  . VAL B  1 288 ? 24.817  -9.345  -42.061 1.00 40.44  ? 288  VAL B CB  1 
ATOM   6296 C  CG1 . VAL B  1 288 ? 24.983  -10.373 -43.159 1.00 33.34  ? 288  VAL B CG1 1 
ATOM   6297 C  CG2 . VAL B  1 288 ? 23.587  -8.496  -42.319 1.00 34.60  ? 288  VAL B CG2 1 
ATOM   6298 N  N   . LEU B  1 289 ? 23.824  -9.067  -38.627 1.00 48.99  ? 289  LEU B N   1 
ATOM   6299 C  CA  . LEU B  1 289 ? 23.839  -8.196  -37.453 1.00 52.21  ? 289  LEU B CA  1 
ATOM   6300 C  C   . LEU B  1 289 ? 24.995  -8.581  -36.524 1.00 57.77  ? 289  LEU B C   1 
ATOM   6301 O  O   . LEU B  1 289 ? 25.228  -9.766  -36.273 1.00 64.53  ? 289  LEU B O   1 
ATOM   6302 C  CB  . LEU B  1 289 ? 22.494  -8.247  -36.714 1.00 46.35  ? 289  LEU B CB  1 
ATOM   6303 C  CG  . LEU B  1 289 ? 21.324  -7.532  -37.398 1.00 43.14  ? 289  LEU B CG  1 
ATOM   6304 C  CD1 . LEU B  1 289 ? 19.995  -7.858  -36.735 1.00 31.54  ? 289  LEU B CD1 1 
ATOM   6305 C  CD2 . LEU B  1 289 ? 21.555  -6.035  -37.400 1.00 39.71  ? 289  LEU B CD2 1 
ATOM   6306 N  N   . PRO B  1 290 ? 25.728  -7.573  -36.021 1.00 51.33  ? 290  PRO B N   1 
ATOM   6307 C  CA  . PRO B  1 290 ? 26.949  -7.795  -35.238 1.00 49.62  ? 290  PRO B CA  1 
ATOM   6308 C  C   . PRO B  1 290 ? 26.670  -8.311  -33.827 1.00 50.73  ? 290  PRO B C   1 
ATOM   6309 O  O   . PRO B  1 290 ? 27.529  -8.974  -33.249 1.00 56.47  ? 290  PRO B O   1 
ATOM   6310 C  CB  . PRO B  1 290 ? 27.576  -6.399  -35.178 1.00 46.47  ? 290  PRO B CB  1 
ATOM   6311 C  CG  . PRO B  1 290 ? 26.405  -5.472  -35.229 1.00 44.22  ? 290  PRO B CG  1 
ATOM   6312 C  CD  . PRO B  1 290 ? 25.412  -6.136  -36.153 1.00 44.50  ? 290  PRO B CD  1 
ATOM   6313 N  N   . GLN B  1 291 ? 25.496  -8.007  -33.279 1.00 49.87  ? 291  GLN B N   1 
ATOM   6314 C  CA  . GLN B  1 291 ? 25.125  -8.526  -31.965 1.00 55.36  ? 291  GLN B CA  1 
ATOM   6315 C  C   . GLN B  1 291 ? 23.730  -9.137  -31.969 1.00 56.54  ? 291  GLN B C   1 
ATOM   6316 O  O   . GLN B  1 291 ? 22.896  -8.795  -32.807 1.00 58.47  ? 291  GLN B O   1 
ATOM   6317 C  CB  . GLN B  1 291 ? 25.200  -7.427  -30.896 1.00 52.41  ? 291  GLN B CB  1 
ATOM   6318 C  CG  . GLN B  1 291 ? 26.585  -6.823  -30.696 1.00 52.23  ? 291  GLN B CG  1 
ATOM   6319 C  CD  . GLN B  1 291 ? 26.729  -5.458  -31.342 1.00 61.81  ? 291  GLN B CD  1 
ATOM   6320 O  OE1 . GLN B  1 291 ? 25.741  -4.763  -31.577 1.00 68.20  ? 291  GLN B OE1 1 
ATOM   6321 N  NE2 . GLN B  1 291 ? 27.965  -5.065  -31.629 1.00 63.72  ? 291  GLN B NE2 1 
ATOM   6322 N  N   . GLU B  1 292 ? 23.488  -10.050 -31.031 1.00 61.79  ? 292  GLU B N   1 
ATOM   6323 C  CA  . GLU B  1 292 ? 22.139  -10.533 -30.764 1.00 59.25  ? 292  GLU B CA  1 
ATOM   6324 C  C   . GLU B  1 292 ? 21.334  -9.350  -30.244 1.00 54.04  ? 292  GLU B C   1 
ATOM   6325 O  O   . GLU B  1 292 ? 21.746  -8.695  -29.284 1.00 63.26  ? 292  GLU B O   1 
ATOM   6326 C  CB  . GLU B  1 292 ? 22.169  -11.651 -29.718 1.00 65.48  ? 292  GLU B CB  1 
ATOM   6327 C  CG  . GLU B  1 292 ? 20.797  -12.154 -29.289 1.00 76.06  ? 292  GLU B CG  1 
ATOM   6328 C  CD  . GLU B  1 292 ? 20.881  -13.259 -28.253 1.00 91.46  ? 292  GLU B CD  1 
ATOM   6329 O  OE1 . GLU B  1 292 ? 22.002  -13.746 -27.994 1.00 96.90  ? 292  GLU B OE1 1 
ATOM   6330 O  OE2 . GLU B  1 292 ? 19.829  -13.639 -27.698 1.00 95.50  ? 292  GLU B OE2 1 
ATOM   6331 N  N   . SER B  1 293 ? 20.197  -9.069  -30.873 1.00 38.79  ? 293  SER B N   1 
ATOM   6332 C  CA  . SER B  1 293 ? 19.477  -7.833  -30.590 1.00 36.27  ? 293  SER B CA  1 
ATOM   6333 C  C   . SER B  1 293 ? 18.002  -7.849  -30.984 1.00 38.46  ? 293  SER B C   1 
ATOM   6334 O  O   . SER B  1 293 ? 17.527  -8.773  -31.643 1.00 40.60  ? 293  SER B O   1 
ATOM   6335 C  CB  . SER B  1 293 ? 20.176  -6.667  -31.293 1.00 41.40  ? 293  SER B CB  1 
ATOM   6336 O  OG  . SER B  1 293 ? 20.446  -6.971  -32.652 1.00 46.92  ? 293  SER B OG  1 
ATOM   6337 N  N   . ILE B  1 294 ? 17.287  -6.818  -30.541 1.00 44.07  ? 294  ILE B N   1 
ATOM   6338 C  CA  . ILE B  1 294 ? 15.957  -6.496  -31.040 1.00 43.90  ? 294  ILE B CA  1 
ATOM   6339 C  C   . ILE B  1 294 ? 15.954  -5.013  -31.403 1.00 42.55  ? 294  ILE B C   1 
ATOM   6340 O  O   . ILE B  1 294 ? 16.870  -4.285  -31.020 1.00 47.74  ? 294  ILE B O   1 
ATOM   6341 C  CB  . ILE B  1 294 ? 14.851  -6.790  -30.016 1.00 50.68  ? 294  ILE B CB  1 
ATOM   6342 C  CG1 . ILE B  1 294 ? 15.142  -6.079  -28.695 1.00 52.74  ? 294  ILE B CG1 1 
ATOM   6343 C  CG2 . ILE B  1 294 ? 14.700  -8.295  -29.806 1.00 54.53  ? 294  ILE B CG2 1 
ATOM   6344 C  CD1 . ILE B  1 294 ? 13.969  -6.088  -27.734 1.00 44.84  ? 294  ILE B CD1 1 
ATOM   6345 N  N   . PHE B  1 295 ? 14.932  -4.577  -32.134 1.00 43.14  ? 295  PHE B N   1 
ATOM   6346 C  CA  . PHE B  1 295 ? 14.868  -3.221  -32.682 1.00 43.87  ? 295  PHE B CA  1 
ATOM   6347 C  C   . PHE B  1 295 ? 16.159  -2.833  -33.410 1.00 44.07  ? 295  PHE B C   1 
ATOM   6348 O  O   . PHE B  1 295 ? 16.659  -1.714  -33.278 1.00 49.72  ? 295  PHE B O   1 
ATOM   6349 C  CB  . PHE B  1 295 ? 14.489  -2.204  -31.603 1.00 44.58  ? 295  PHE B CB  1 
ATOM   6350 C  CG  . PHE B  1 295 ? 13.591  -1.106  -32.101 1.00 43.50  ? 295  PHE B CG  1 
ATOM   6351 C  CD1 . PHE B  1 295 ? 13.806  -0.527  -33.347 1.00 35.37  ? 295  PHE B CD1 1 
ATOM   6352 C  CD2 . PHE B  1 295 ? 12.521  -0.666  -31.335 1.00 40.57  ? 295  PHE B CD2 1 
ATOM   6353 C  CE1 . PHE B  1 295 ? 12.982  0.485   -33.814 1.00 34.28  ? 295  PHE B CE1 1 
ATOM   6354 C  CE2 . PHE B  1 295 ? 11.691  0.348   -31.792 1.00 43.74  ? 295  PHE B CE2 1 
ATOM   6355 C  CZ  . PHE B  1 295 ? 11.921  0.925   -33.035 1.00 39.52  ? 295  PHE B CZ  1 
ATOM   6356 N  N   . ARG B  1 296 ? 16.690  -3.779  -34.180 1.00 38.47  ? 296  ARG B N   1 
ATOM   6357 C  CA  . ARG B  1 296 ? 17.900  -3.552  -34.961 1.00 43.23  ? 296  ARG B CA  1 
ATOM   6358 C  C   . ARG B  1 296 ? 17.774  -4.238  -36.321 1.00 50.30  ? 296  ARG B C   1 
ATOM   6359 O  O   . ARG B  1 296 ? 17.349  -5.393  -36.412 1.00 54.33  ? 296  ARG B O   1 
ATOM   6360 C  CB  . ARG B  1 296 ? 19.135  -4.050  -34.201 1.00 42.05  ? 296  ARG B CB  1 
ATOM   6361 C  CG  . ARG B  1 296 ? 20.339  -3.115  -34.282 1.00 45.94  ? 296  ARG B CG  1 
ATOM   6362 C  CD  . ARG B  1 296 ? 20.578  -2.369  -32.976 1.00 43.78  ? 296  ARG B CD  1 
ATOM   6363 N  NE  . ARG B  1 296 ? 19.442  -1.537  -32.588 1.00 49.72  ? 296  ARG B NE  1 
ATOM   6364 C  CZ  . ARG B  1 296 ? 19.464  -0.654  -31.593 1.00 49.69  ? 296  ARG B CZ  1 
ATOM   6365 N  NH1 . ARG B  1 296 ? 20.568  -0.473  -30.883 1.00 45.86  ? 296  ARG B NH1 1 
ATOM   6366 N  NH2 . ARG B  1 296 ? 18.381  0.055   -31.315 1.00 53.14  ? 296  ARG B NH2 1 
ATOM   6367 N  N   . PHE B  1 297 ? 18.128  -3.522  -37.382 1.00 47.95  ? 297  PHE B N   1 
ATOM   6368 C  CA  . PHE B  1 297 ? 17.890  -4.031  -38.730 1.00 50.40  ? 297  PHE B CA  1 
ATOM   6369 C  C   . PHE B  1 297 ? 19.145  -4.009  -39.605 1.00 50.19  ? 297  PHE B C   1 
ATOM   6370 O  O   . PHE B  1 297 ? 19.976  -3.104  -39.503 1.00 46.73  ? 297  PHE B O   1 
ATOM   6371 C  CB  . PHE B  1 297 ? 16.717  -3.280  -39.370 1.00 45.19  ? 297  PHE B CB  1 
ATOM   6372 C  CG  . PHE B  1 297 ? 15.575  -3.038  -38.415 1.00 45.31  ? 297  PHE B CG  1 
ATOM   6373 C  CD1 . PHE B  1 297 ? 14.735  -4.080  -38.032 1.00 44.12  ? 297  PHE B CD1 1 
ATOM   6374 C  CD2 . PHE B  1 297 ? 15.360  -1.777  -37.877 1.00 41.52  ? 297  PHE B CD2 1 
ATOM   6375 C  CE1 . PHE B  1 297 ? 13.689  -3.862  -37.142 1.00 35.33  ? 297  PHE B CE1 1 
ATOM   6376 C  CE2 . PHE B  1 297 ? 14.318  -1.548  -36.987 1.00 37.77  ? 297  PHE B CE2 1 
ATOM   6377 C  CZ  . PHE B  1 297 ? 13.480  -2.593  -36.619 1.00 34.05  ? 297  PHE B CZ  1 
ATOM   6378 N  N   . SER B  1 298 ? 19.273  -5.021  -40.457 1.00 45.21  ? 298  SER B N   1 
ATOM   6379 C  CA  . SER B  1 298 ? 20.512  -5.271  -41.186 1.00 51.20  ? 298  SER B CA  1 
ATOM   6380 C  C   . SER B  1 298 ? 20.821  -4.239  -42.266 1.00 47.60  ? 298  SER B C   1 
ATOM   6381 O  O   . SER B  1 298 ? 21.958  -3.782  -42.385 1.00 47.85  ? 298  SER B O   1 
ATOM   6382 C  CB  . SER B  1 298 ? 20.483  -6.670  -41.801 1.00 54.62  ? 298  SER B CB  1 
ATOM   6383 O  OG  . SER B  1 298 ? 20.201  -7.650  -40.819 1.00 57.68  ? 298  SER B OG  1 
ATOM   6384 N  N   . PHE B  1 299 ? 19.816  -3.873  -43.055 1.00 42.43  ? 299  PHE B N   1 
ATOM   6385 C  CA  . PHE B  1 299 ? 20.043  -2.934  -44.150 1.00 41.90  ? 299  PHE B CA  1 
ATOM   6386 C  C   . PHE B  1 299 ? 19.156  -1.693  -44.088 1.00 41.90  ? 299  PHE B C   1 
ATOM   6387 O  O   . PHE B  1 299 ? 17.996  -1.710  -44.503 1.00 42.68  ? 299  PHE B O   1 
ATOM   6388 C  CB  . PHE B  1 299 ? 19.936  -3.652  -45.494 1.00 34.66  ? 299  PHE B CB  1 
ATOM   6389 C  CG  . PHE B  1 299 ? 20.905  -4.791  -45.633 1.00 35.37  ? 299  PHE B CG  1 
ATOM   6390 C  CD1 . PHE B  1 299 ? 22.218  -4.557  -46.022 1.00 33.56  ? 299  PHE B CD1 1 
ATOM   6391 C  CD2 . PHE B  1 299 ? 20.513  -6.094  -45.348 1.00 37.51  ? 299  PHE B CD2 1 
ATOM   6392 C  CE1 . PHE B  1 299 ? 23.123  -5.605  -46.142 1.00 41.25  ? 299  PHE B CE1 1 
ATOM   6393 C  CE2 . PHE B  1 299 ? 21.409  -7.147  -45.459 1.00 37.75  ? 299  PHE B CE2 1 
ATOM   6394 C  CZ  . PHE B  1 299 ? 22.716  -6.904  -45.860 1.00 38.74  ? 299  PHE B CZ  1 
ATOM   6395 N  N   . VAL B  1 300 ? 19.742  -0.617  -43.570 1.00 37.68  ? 300  VAL B N   1 
ATOM   6396 C  CA  . VAL B  1 300 ? 19.055  0.645   -43.325 1.00 37.82  ? 300  VAL B CA  1 
ATOM   6397 C  C   . VAL B  1 300 ? 19.862  1.736   -44.020 1.00 37.15  ? 300  VAL B C   1 
ATOM   6398 O  O   . VAL B  1 300 ? 20.926  1.440   -44.565 1.00 34.14  ? 300  VAL B O   1 
ATOM   6399 C  CB  . VAL B  1 300 ? 18.986  0.936   -41.807 1.00 28.10  ? 300  VAL B CB  1 
ATOM   6400 C  CG1 . VAL B  1 300 ? 18.182  -0.131  -41.098 1.00 23.33  ? 300  VAL B CG1 1 
ATOM   6401 C  CG2 . VAL B  1 300 ? 20.383  1.025   -41.221 1.00 28.19  ? 300  VAL B CG2 1 
ATOM   6402 N  N   . PRO B  1 301 ? 19.358  2.989   -44.030 1.00 36.63  ? 301  PRO B N   1 
ATOM   6403 C  CA  . PRO B  1 301 ? 20.170  4.075   -44.594 1.00 35.69  ? 301  PRO B CA  1 
ATOM   6404 C  C   . PRO B  1 301 ? 21.587  4.135   -44.036 1.00 43.56  ? 301  PRO B C   1 
ATOM   6405 O  O   . PRO B  1 301 ? 21.811  3.766   -42.881 1.00 46.71  ? 301  PRO B O   1 
ATOM   6406 C  CB  . PRO B  1 301 ? 19.399  5.323   -44.168 1.00 29.90  ? 301  PRO B CB  1 
ATOM   6407 C  CG  . PRO B  1 301 ? 17.973  4.884   -44.223 1.00 35.01  ? 301  PRO B CG  1 
ATOM   6408 C  CD  . PRO B  1 301 ? 17.965  3.426   -43.797 1.00 36.09  ? 301  PRO B CD  1 
ATOM   6409 N  N   . VAL B  1 302 ? 22.524  4.596   -44.862 1.00 43.59  ? 302  VAL B N   1 
ATOM   6410 C  CA  . VAL B  1 302 ? 23.935  4.668   -44.492 1.00 40.45  ? 302  VAL B CA  1 
ATOM   6411 C  C   . VAL B  1 302 ? 24.426  6.114   -44.571 1.00 39.86  ? 302  VAL B C   1 
ATOM   6412 O  O   . VAL B  1 302 ? 24.052  6.843   -45.491 1.00 44.96  ? 302  VAL B O   1 
ATOM   6413 C  CB  . VAL B  1 302 ? 24.797  3.765   -45.421 1.00 32.64  ? 302  VAL B CB  1 
ATOM   6414 C  CG1 . VAL B  1 302 ? 24.531  4.084   -46.884 1.00 37.58  ? 302  VAL B CG1 1 
ATOM   6415 C  CG2 . VAL B  1 302 ? 26.280  3.910   -45.110 1.00 32.12  ? 302  VAL B CG2 1 
ATOM   6416 N  N   . VAL B  1 303 ? 25.238  6.539   -43.605 1.00 35.74  ? 303  VAL B N   1 
ATOM   6417 C  CA  . VAL B  1 303 ? 25.858  7.862   -43.681 1.00 44.42  ? 303  VAL B CA  1 
ATOM   6418 C  C   . VAL B  1 303 ? 26.925  7.825   -44.772 1.00 49.36  ? 303  VAL B C   1 
ATOM   6419 O  O   . VAL B  1 303 ? 28.045  7.366   -44.542 1.00 53.19  ? 303  VAL B O   1 
ATOM   6420 C  CB  . VAL B  1 303 ? 26.470  8.301   -42.330 1.00 47.93  ? 303  VAL B CB  1 
ATOM   6421 C  CG1 . VAL B  1 303 ? 27.033  9.709   -42.430 1.00 49.00  ? 303  VAL B CG1 1 
ATOM   6422 C  CG2 . VAL B  1 303 ? 25.421  8.247   -41.237 1.00 40.15  ? 303  VAL B CG2 1 
ATOM   6423 N  N   . ASP B  1 304 ? 26.561  8.302   -45.961 1.00 49.39  ? 304  ASP B N   1 
ATOM   6424 C  CA  . ASP B  1 304 ? 27.390  8.154   -47.157 1.00 51.75  ? 304  ASP B CA  1 
ATOM   6425 C  C   . ASP B  1 304 ? 28.190  9.404   -47.509 1.00 50.47  ? 304  ASP B C   1 
ATOM   6426 O  O   . ASP B  1 304 ? 29.087  9.361   -48.355 1.00 51.46  ? 304  ASP B O   1 
ATOM   6427 C  CB  . ASP B  1 304 ? 26.510  7.772   -48.353 1.00 53.38  ? 304  ASP B CB  1 
ATOM   6428 C  CG  . ASP B  1 304 ? 25.424  8.800   -48.632 1.00 54.16  ? 304  ASP B CG  1 
ATOM   6429 O  OD1 . ASP B  1 304 ? 25.207  9.694   -47.786 1.00 50.60  ? 304  ASP B OD1 1 
ATOM   6430 O  OD2 . ASP B  1 304 ? 24.773  8.710   -49.695 1.00 57.59  ? 304  ASP B OD2 1 
ATOM   6431 N  N   . GLY B  1 305 ? 27.853  10.522  -46.876 1.00 48.88  ? 305  GLY B N   1 
ATOM   6432 C  CA  . GLY B  1 305 ? 28.479  11.786  -47.214 1.00 48.02  ? 305  GLY B CA  1 
ATOM   6433 C  C   . GLY B  1 305 ? 27.831  12.419  -48.433 1.00 54.56  ? 305  GLY B C   1 
ATOM   6434 O  O   . GLY B  1 305 ? 28.315  13.429  -48.949 1.00 52.92  ? 305  GLY B O   1 
ATOM   6435 N  N   . ASP B  1 306 ? 26.733  11.823  -48.895 1.00 51.95  ? 306  ASP B N   1 
ATOM   6436 C  CA  . ASP B  1 306 ? 26.008  12.336  -50.055 1.00 54.67  ? 306  ASP B CA  1 
ATOM   6437 C  C   . ASP B  1 306 ? 24.555  12.666  -49.705 1.00 50.22  ? 306  ASP B C   1 
ATOM   6438 O  O   . ASP B  1 306 ? 24.206  13.835  -49.531 1.00 52.35  ? 306  ASP B O   1 
ATOM   6439 C  CB  . ASP B  1 306 ? 26.072  11.340  -51.217 1.00 56.51  ? 306  ASP B CB  1 
ATOM   6440 C  CG  . ASP B  1 306 ? 25.527  11.915  -52.508 1.00 62.53  ? 306  ASP B CG  1 
ATOM   6441 O  OD1 . ASP B  1 306 ? 25.529  13.158  -52.650 1.00 60.49  ? 306  ASP B OD1 1 
ATOM   6442 O  OD2 . ASP B  1 306 ? 25.104  11.128  -53.383 1.00 70.41  ? 306  ASP B OD2 1 
ATOM   6443 N  N   . PHE B  1 307 ? 23.709  11.640  -49.617 1.00 42.70  ? 307  PHE B N   1 
ATOM   6444 C  CA  . PHE B  1 307 ? 22.333  11.827  -49.166 1.00 45.82  ? 307  PHE B CA  1 
ATOM   6445 C  C   . PHE B  1 307 ? 22.384  12.364  -47.745 1.00 45.78  ? 307  PHE B C   1 
ATOM   6446 O  O   . PHE B  1 307 ? 21.648  13.284  -47.386 1.00 44.40  ? 307  PHE B O   1 
ATOM   6447 C  CB  . PHE B  1 307 ? 21.557  10.506  -49.198 1.00 44.09  ? 307  PHE B CB  1 
ATOM   6448 C  CG  . PHE B  1 307 ? 20.056  10.677  -49.192 1.00 43.92  ? 307  PHE B CG  1 
ATOM   6449 C  CD1 . PHE B  1 307 ? 19.385  11.066  -48.037 1.00 47.51  ? 307  PHE B CD1 1 
ATOM   6450 C  CD2 . PHE B  1 307 ? 19.317  10.441  -50.344 1.00 41.55  ? 307  PHE B CD2 1 
ATOM   6451 C  CE1 . PHE B  1 307 ? 18.002  11.224  -48.035 1.00 44.23  ? 307  PHE B CE1 1 
ATOM   6452 C  CE2 . PHE B  1 307 ? 17.938  10.594  -50.351 1.00 40.29  ? 307  PHE B CE2 1 
ATOM   6453 C  CZ  . PHE B  1 307 ? 17.279  10.986  -49.195 1.00 48.22  ? 307  PHE B CZ  1 
ATOM   6454 N  N   . LEU B  1 308 ? 23.265  11.777  -46.941 1.00 44.11  ? 308  LEU B N   1 
ATOM   6455 C  CA  . LEU B  1 308 ? 23.516  12.259  -45.591 1.00 42.08  ? 308  LEU B CA  1 
ATOM   6456 C  C   . LEU B  1 308 ? 24.955  12.759  -45.501 1.00 45.44  ? 308  LEU B C   1 
ATOM   6457 O  O   . LEU B  1 308 ? 25.892  11.965  -45.408 1.00 44.21  ? 308  LEU B O   1 
ATOM   6458 C  CB  . LEU B  1 308 ? 23.253  11.152  -44.565 1.00 32.56  ? 308  LEU B CB  1 
ATOM   6459 C  CG  . LEU B  1 308 ? 21.819  10.606  -44.550 1.00 36.18  ? 308  LEU B CG  1 
ATOM   6460 C  CD1 . LEU B  1 308 ? 21.681  9.407   -43.625 1.00 40.40  ? 308  LEU B CD1 1 
ATOM   6461 C  CD2 . LEU B  1 308 ? 20.827  11.686  -44.158 1.00 36.99  ? 308  LEU B CD2 1 
ATOM   6462 N  N   . SER B  1 309 ? 25.121  14.079  -45.544 1.00 48.26  ? 309  SER B N   1 
ATOM   6463 C  CA  . SER B  1 309 ? 26.443  14.698  -45.502 1.00 49.83  ? 309  SER B CA  1 
ATOM   6464 C  C   . SER B  1 309 ? 27.200  14.358  -44.217 1.00 55.24  ? 309  SER B C   1 
ATOM   6465 O  O   . SER B  1 309 ? 28.429  14.288  -44.213 1.00 62.23  ? 309  SER B O   1 
ATOM   6466 C  CB  . SER B  1 309 ? 26.330  16.214  -45.678 1.00 50.17  ? 309  SER B CB  1 
ATOM   6467 O  OG  . SER B  1 309 ? 25.328  16.758  -44.837 1.00 58.87  ? 309  SER B OG  1 
ATOM   6468 N  N   . ASP B  1 310 ? 26.458  14.142  -43.135 1.00 53.63  ? 310  ASP B N   1 
ATOM   6469 C  CA  . ASP B  1 310 ? 27.035  13.737  -41.855 1.00 55.58  ? 310  ASP B CA  1 
ATOM   6470 C  C   . ASP B  1 310 ? 26.021  12.858  -41.127 1.00 56.28  ? 310  ASP B C   1 
ATOM   6471 O  O   . ASP B  1 310 ? 24.984  12.514  -41.694 1.00 57.18  ? 310  ASP B O   1 
ATOM   6472 C  CB  . ASP B  1 310 ? 27.377  14.969  -41.014 1.00 53.35  ? 310  ASP B CB  1 
ATOM   6473 C  CG  . ASP B  1 310 ? 28.566  14.742  -40.102 1.00 58.23  ? 310  ASP B CG  1 
ATOM   6474 O  OD1 . ASP B  1 310 ? 28.775  13.588  -39.666 1.00 60.29  ? 310  ASP B OD1 1 
ATOM   6475 O  OD2 . ASP B  1 310 ? 29.291  15.720  -39.821 1.00 57.86  ? 310  ASP B OD2 1 
ATOM   6476 N  N   . THR B  1 311 ? 26.318  12.484  -39.885 1.00 52.41  ? 311  THR B N   1 
ATOM   6477 C  CA  . THR B  1 311 ? 25.351  11.757  -39.068 1.00 44.34  ? 311  THR B CA  1 
ATOM   6478 C  C   . THR B  1 311 ? 24.140  12.649  -38.832 1.00 43.45  ? 311  THR B C   1 
ATOM   6479 O  O   . THR B  1 311 ? 24.274  13.873  -38.788 1.00 48.79  ? 311  THR B O   1 
ATOM   6480 C  CB  . THR B  1 311 ? 25.942  11.320  -37.709 1.00 49.14  ? 311  THR B CB  1 
ATOM   6481 O  OG1 . THR B  1 311 ? 26.485  12.458  -37.028 1.00 52.82  ? 311  THR B OG1 1 
ATOM   6482 C  CG2 . THR B  1 311 ? 27.036  10.286  -37.908 1.00 45.68  ? 311  THR B CG2 1 
ATOM   6483 N  N   . PRO B  1 312 ? 22.948  12.042  -38.712 1.00 42.04  ? 312  PRO B N   1 
ATOM   6484 C  CA  . PRO B  1 312 ? 21.740  12.812  -38.403 1.00 47.36  ? 312  PRO B CA  1 
ATOM   6485 C  C   . PRO B  1 312 ? 21.899  13.625  -37.123 1.00 47.84  ? 312  PRO B C   1 
ATOM   6486 O  O   . PRO B  1 312 ? 21.380  14.738  -37.053 1.00 51.22  ? 312  PRO B O   1 
ATOM   6487 C  CB  . PRO B  1 312 ? 20.680  11.727  -38.215 1.00 44.94  ? 312  PRO B CB  1 
ATOM   6488 C  CG  . PRO B  1 312 ? 21.131  10.617  -39.115 1.00 40.44  ? 312  PRO B CG  1 
ATOM   6489 C  CD  . PRO B  1 312 ? 22.641  10.632  -39.024 1.00 39.61  ? 312  PRO B CD  1 
ATOM   6490 N  N   . GLU B  1 313 ? 22.606  13.081  -36.134 1.00 48.22  ? 313  GLU B N   1 
ATOM   6491 C  CA  . GLU B  1 313 ? 22.868  13.811  -34.894 1.00 55.76  ? 313  GLU B CA  1 
ATOM   6492 C  C   . GLU B  1 313 ? 23.676  15.080  -35.153 1.00 51.27  ? 313  GLU B C   1 
ATOM   6493 O  O   . GLU B  1 313 ? 23.383  16.136  -34.599 1.00 46.68  ? 313  GLU B O   1 
ATOM   6494 C  CB  . GLU B  1 313 ? 23.597  12.926  -33.875 1.00 61.37  ? 313  GLU B CB  1 
ATOM   6495 C  CG  . GLU B  1 313 ? 22.728  11.866  -33.204 1.00 71.87  ? 313  GLU B CG  1 
ATOM   6496 C  CD  . GLU B  1 313 ? 22.600  10.594  -34.024 1.00 80.79  ? 313  GLU B CD  1 
ATOM   6497 O  OE1 . GLU B  1 313 ? 23.065  10.574  -35.185 1.00 79.19  ? 313  GLU B OE1 1 
ATOM   6498 O  OE2 . GLU B  1 313 ? 22.037  9.607   -33.503 1.00 81.07  ? 313  GLU B OE2 1 
ATOM   6499 N  N   . ALA B  1 314 ? 24.691  14.970  -36.001 1.00 46.50  ? 314  ALA B N   1 
ATOM   6500 C  CA  . ALA B  1 314 ? 25.527  16.115  -36.339 1.00 46.74  ? 314  ALA B CA  1 
ATOM   6501 C  C   . ALA B  1 314 ? 24.746  17.155  -37.136 1.00 55.72  ? 314  ALA B C   1 
ATOM   6502 O  O   . ALA B  1 314 ? 25.012  18.354  -37.039 1.00 60.43  ? 314  ALA B O   1 
ATOM   6503 C  CB  . ALA B  1 314 ? 26.746  15.661  -37.121 1.00 42.13  ? 314  ALA B CB  1 
ATOM   6504 N  N   . LEU B  1 315 ? 23.787  16.685  -37.929 1.00 53.28  ? 315  LEU B N   1 
ATOM   6505 C  CA  . LEU B  1 315 ? 23.009  17.560  -38.802 1.00 47.76  ? 315  LEU B CA  1 
ATOM   6506 C  C   . LEU B  1 315 ? 21.882  18.296  -38.069 1.00 49.23  ? 315  LEU B C   1 
ATOM   6507 O  O   . LEU B  1 315 ? 21.565  19.437  -38.406 1.00 47.60  ? 315  LEU B O   1 
ATOM   6508 C  CB  . LEU B  1 315 ? 22.453  16.773  -39.992 1.00 45.73  ? 315  LEU B CB  1 
ATOM   6509 C  CG  . LEU B  1 315 ? 23.483  16.185  -40.962 1.00 45.85  ? 315  LEU B CG  1 
ATOM   6510 C  CD1 . LEU B  1 315 ? 22.808  15.426  -42.096 1.00 41.12  ? 315  LEU B CD1 1 
ATOM   6511 C  CD2 . LEU B  1 315 ? 24.368  17.283  -41.515 1.00 44.65  ? 315  LEU B CD2 1 
ATOM   6512 N  N   . ILE B  1 316 ? 21.279  17.651  -37.072 1.00 49.99  ? 316  ILE B N   1 
ATOM   6513 C  CA  . ILE B  1 316 ? 20.223  18.297  -36.292 1.00 55.51  ? 316  ILE B CA  1 
ATOM   6514 C  C   . ILE B  1 316 ? 20.803  19.243  -35.242 1.00 60.41  ? 316  ILE B C   1 
ATOM   6515 O  O   . ILE B  1 316 ? 20.137  20.184  -34.805 1.00 65.83  ? 316  ILE B O   1 
ATOM   6516 C  CB  . ILE B  1 316 ? 19.263  17.276  -35.621 1.00 45.33  ? 316  ILE B CB  1 
ATOM   6517 C  CG1 . ILE B  1 316 ? 19.991  16.433  -34.569 1.00 51.52  ? 316  ILE B CG1 1 
ATOM   6518 C  CG2 . ILE B  1 316 ? 18.607  16.387  -36.663 1.00 38.99  ? 316  ILE B CG2 1 
ATOM   6519 C  CD1 . ILE B  1 316 ? 19.072  15.492  -33.792 1.00 49.96  ? 316  ILE B CD1 1 
ATOM   6520 N  N   . ASN B  1 317 ? 22.047  18.990  -34.844 1.00 61.46  ? 317  ASN B N   1 
ATOM   6521 C  CA  . ASN B  1 317 ? 22.745  19.842  -33.883 1.00 67.37  ? 317  ASN B CA  1 
ATOM   6522 C  C   . ASN B  1 317 ? 23.143  21.186  -34.491 1.00 68.74  ? 317  ASN B C   1 
ATOM   6523 O  O   . ASN B  1 317 ? 23.207  22.199  -33.796 1.00 73.94  ? 317  ASN B O   1 
ATOM   6524 C  CB  . ASN B  1 317 ? 24.002  19.138  -33.352 1.00 65.09  ? 317  ASN B CB  1 
ATOM   6525 C  CG  . ASN B  1 317 ? 23.694  18.077  -32.301 1.00 59.38  ? 317  ASN B CG  1 
ATOM   6526 O  OD1 . ASN B  1 317 ? 22.535  17.774  -32.021 1.00 63.68  ? 317  ASN B OD1 1 
ATOM   6527 N  ND2 . ASN B  1 317 ? 24.742  17.500  -31.724 1.00 51.30  ? 317  ASN B ND2 1 
ATOM   6528 N  N   . THR B  1 318 ? 23.401  21.182  -35.797 1.00 65.86  ? 318  THR B N   1 
ATOM   6529 C  CA  . THR B  1 318 ? 23.987  22.335  -36.476 1.00 65.67  ? 318  THR B CA  1 
ATOM   6530 C  C   . THR B  1 318 ? 23.053  23.025  -37.473 1.00 61.55  ? 318  THR B C   1 
ATOM   6531 O  O   . THR B  1 318 ? 23.374  24.097  -37.987 1.00 66.53  ? 318  THR B O   1 
ATOM   6532 C  CB  . THR B  1 318 ? 25.269  21.930  -37.229 1.00 68.71  ? 318  THR B CB  1 
ATOM   6533 O  OG1 . THR B  1 318 ? 24.933  21.044  -38.304 1.00 67.52  ? 318  THR B OG1 1 
ATOM   6534 C  CG2 . THR B  1 318 ? 26.238  21.231  -36.288 1.00 69.08  ? 318  THR B CG2 1 
ATOM   6535 N  N   . GLY B  1 319 ? 21.904  22.418  -37.747 1.00 52.94  ? 319  GLY B N   1 
ATOM   6536 C  CA  . GLY B  1 319 ? 21.012  22.932  -38.773 1.00 56.72  ? 319  GLY B CA  1 
ATOM   6537 C  C   . GLY B  1 319 ? 20.182  24.143  -38.384 1.00 59.40  ? 319  GLY B C   1 
ATOM   6538 O  O   . GLY B  1 319 ? 19.937  24.388  -37.201 1.00 58.84  ? 319  GLY B O   1 
ATOM   6539 N  N   . ASP B  1 320 ? 19.759  24.905  -39.391 1.00 65.00  ? 320  ASP B N   1 
ATOM   6540 C  CA  . ASP B  1 320 ? 18.796  25.987  -39.198 1.00 65.86  ? 320  ASP B CA  1 
ATOM   6541 C  C   . ASP B  1 320 ? 17.435  25.552  -39.740 1.00 59.79  ? 320  ASP B C   1 
ATOM   6542 O  O   . ASP B  1 320 ? 17.264  25.366  -40.950 1.00 54.99  ? 320  ASP B O   1 
ATOM   6543 C  CB  . ASP B  1 320 ? 19.271  27.279  -39.877 1.00 66.05  ? 320  ASP B CB  1 
ATOM   6544 C  CG  . ASP B  1 320 ? 18.293  28.432  -39.701 1.00 72.45  ? 320  ASP B CG  1 
ATOM   6545 O  OD1 . ASP B  1 320 ? 17.409  28.353  -38.818 1.00 75.29  ? 320  ASP B OD1 1 
ATOM   6546 O  OD2 . ASP B  1 320 ? 18.414  29.429  -40.444 1.00 78.98  ? 320  ASP B OD2 1 
ATOM   6547 N  N   . PHE B  1 321 ? 16.472  25.389  -38.838 1.00 50.84  ? 321  PHE B N   1 
ATOM   6548 C  CA  . PHE B  1 321 ? 15.165  24.849  -39.201 1.00 53.40  ? 321  PHE B CA  1 
ATOM   6549 C  C   . PHE B  1 321 ? 14.065  25.904  -39.098 1.00 55.59  ? 321  PHE B C   1 
ATOM   6550 O  O   . PHE B  1 321 ? 12.885  25.583  -38.960 1.00 53.22  ? 321  PHE B O   1 
ATOM   6551 C  CB  . PHE B  1 321 ? 14.859  23.612  -38.351 1.00 49.50  ? 321  PHE B CB  1 
ATOM   6552 C  CG  . PHE B  1 321 ? 15.881  22.521  -38.502 1.00 51.01  ? 321  PHE B CG  1 
ATOM   6553 C  CD1 . PHE B  1 321 ? 15.829  21.650  -39.584 1.00 52.33  ? 321  PHE B CD1 1 
ATOM   6554 C  CD2 . PHE B  1 321 ? 16.908  22.380  -37.580 1.00 47.71  ? 321  PHE B CD2 1 
ATOM   6555 C  CE1 . PHE B  1 321 ? 16.775  20.649  -39.738 1.00 46.60  ? 321  PHE B CE1 1 
ATOM   6556 C  CE2 . PHE B  1 321 ? 17.858  21.381  -37.726 1.00 51.71  ? 321  PHE B CE2 1 
ATOM   6557 C  CZ  . PHE B  1 321 ? 17.791  20.513  -38.807 1.00 46.35  ? 321  PHE B CZ  1 
ATOM   6558 N  N   . GLN B  1 322 ? 14.487  27.161  -39.200 1.00 63.75  ? 322  GLN B N   1 
ATOM   6559 C  CA  . GLN B  1 322 ? 13.624  28.341  -39.161 1.00 69.21  ? 322  GLN B CA  1 
ATOM   6560 C  C   . GLN B  1 322 ? 12.378  28.238  -40.048 1.00 66.07  ? 322  GLN B C   1 
ATOM   6561 O  O   . GLN B  1 322 ? 11.301  28.713  -39.679 1.00 67.88  ? 322  GLN B O   1 
ATOM   6562 C  CB  . GLN B  1 322 ? 14.465  29.555  -39.573 1.00 78.48  ? 322  GLN B CB  1 
ATOM   6563 C  CG  . GLN B  1 322 ? 13.757  30.895  -39.584 1.00 88.22  ? 322  GLN B CG  1 
ATOM   6564 C  CD  . GLN B  1 322 ? 14.681  32.012  -40.036 1.00 94.58  ? 322  GLN B CD  1 
ATOM   6565 O  OE1 . GLN B  1 322 ? 15.890  31.814  -40.167 1.00 91.92  ? 322  GLN B OE1 1 
ATOM   6566 N  NE2 . GLN B  1 322 ? 14.117  33.188  -40.282 1.00 97.56  ? 322  GLN B NE2 1 
ATOM   6567 N  N   . ASP B  1 323 ? 12.527  27.609  -41.210 1.00 62.88  ? 323  ASP B N   1 
ATOM   6568 C  CA  . ASP B  1 323 ? 11.429  27.492  -42.168 1.00 70.24  ? 323  ASP B CA  1 
ATOM   6569 C  C   . ASP B  1 323 ? 10.596  26.225  -41.964 1.00 63.54  ? 323  ASP B C   1 
ATOM   6570 O  O   . ASP B  1 323 ? 9.594   26.017  -42.650 1.00 61.24  ? 323  ASP B O   1 
ATOM   6571 C  CB  . ASP B  1 323 ? 11.972  27.528  -43.602 1.00 80.20  ? 323  ASP B CB  1 
ATOM   6572 C  CG  . ASP B  1 323 ? 12.489  28.901  -43.998 1.00 92.34  ? 323  ASP B CG  1 
ATOM   6573 O  OD1 . ASP B  1 323 ? 11.761  29.897  -43.791 1.00 93.95  ? 323  ASP B OD1 1 
ATOM   6574 O  OD2 . ASP B  1 323 ? 13.624  28.983  -44.517 1.00 95.25  ? 323  ASP B OD2 1 
ATOM   6575 N  N   . LEU B  1 324 ? 11.003  25.388  -41.013 1.00 60.83  ? 324  LEU B N   1 
ATOM   6576 C  CA  . LEU B  1 324 ? 10.383  24.073  -40.832 1.00 53.64  ? 324  LEU B CA  1 
ATOM   6577 C  C   . LEU B  1 324 ? 9.178   24.074  -39.886 1.00 48.91  ? 324  LEU B C   1 
ATOM   6578 O  O   . LEU B  1 324 ? 9.122   24.846  -38.930 1.00 47.50  ? 324  LEU B O   1 
ATOM   6579 C  CB  . LEU B  1 324 ? 11.431  23.060  -40.349 1.00 50.26  ? 324  LEU B CB  1 
ATOM   6580 C  CG  . LEU B  1 324 ? 11.017  21.595  -40.185 1.00 50.51  ? 324  LEU B CG  1 
ATOM   6581 C  CD1 . LEU B  1 324 ? 10.542  21.031  -41.506 1.00 51.81  ? 324  LEU B CD1 1 
ATOM   6582 C  CD2 . LEU B  1 324 ? 12.158  20.757  -39.631 1.00 55.26  ? 324  LEU B CD2 1 
ATOM   6583 N  N   . GLN B  1 325 ? 8.209   23.210  -40.178 1.00 42.00  ? 325  GLN B N   1 
ATOM   6584 C  CA  . GLN B  1 325 ? 7.086   22.962  -39.283 1.00 36.56  ? 325  GLN B CA  1 
ATOM   6585 C  C   . GLN B  1 325 ? 6.898   21.456  -39.141 1.00 41.02  ? 325  GLN B C   1 
ATOM   6586 O  O   . GLN B  1 325 ? 6.630   20.762  -40.124 1.00 42.54  ? 325  GLN B O   1 
ATOM   6587 C  CB  . GLN B  1 325 ? 5.811   23.618  -39.819 1.00 42.89  ? 325  GLN B CB  1 
ATOM   6588 C  CG  . GLN B  1 325 ? 5.866   25.141  -39.856 1.00 53.74  ? 325  GLN B CG  1 
ATOM   6589 C  CD  . GLN B  1 325 ? 4.999   25.726  -40.954 1.00 56.58  ? 325  GLN B CD  1 
ATOM   6590 O  OE1 . GLN B  1 325 ? 4.553   25.013  -41.850 1.00 53.31  ? 325  GLN B OE1 1 
ATOM   6591 N  NE2 . GLN B  1 325 ? 4.758   27.029  -40.891 1.00 61.61  ? 325  GLN B NE2 1 
ATOM   6592 N  N   . VAL B  1 326 ? 7.048   20.955  -37.917 1.00 41.59  ? 326  VAL B N   1 
ATOM   6593 C  CA  . VAL B  1 326 ? 7.016   19.515  -37.673 1.00 40.99  ? 326  VAL B CA  1 
ATOM   6594 C  C   . VAL B  1 326 ? 5.965   19.090  -36.654 1.00 41.28  ? 326  VAL B C   1 
ATOM   6595 O  O   . VAL B  1 326 ? 5.628   19.837  -35.733 1.00 46.32  ? 326  VAL B O   1 
ATOM   6596 C  CB  . VAL B  1 326 ? 8.390   18.983  -37.209 1.00 51.17  ? 326  VAL B CB  1 
ATOM   6597 C  CG1 . VAL B  1 326 ? 9.057   18.194  -38.314 1.00 46.68  ? 326  VAL B CG1 1 
ATOM   6598 C  CG2 . VAL B  1 326 ? 9.282   20.126  -36.755 1.00 60.35  ? 326  VAL B CG2 1 
ATOM   6599 N  N   . LEU B  1 327 ? 5.451   17.878  -36.839 1.00 38.69  ? 327  LEU B N   1 
ATOM   6600 C  CA  . LEU B  1 327 ? 4.555   17.253  -35.880 1.00 34.19  ? 327  LEU B CA  1 
ATOM   6601 C  C   . LEU B  1 327 ? 5.149   15.896  -35.515 1.00 42.03  ? 327  LEU B C   1 
ATOM   6602 O  O   . LEU B  1 327 ? 5.243   15.002  -36.361 1.00 44.84  ? 327  LEU B O   1 
ATOM   6603 C  CB  . LEU B  1 327 ? 3.154   17.095  -36.479 1.00 36.54  ? 327  LEU B CB  1 
ATOM   6604 C  CG  . LEU B  1 327 ? 2.160   16.213  -35.718 1.00 46.04  ? 327  LEU B CG  1 
ATOM   6605 C  CD1 . LEU B  1 327 ? 1.938   16.737  -34.316 1.00 40.12  ? 327  LEU B CD1 1 
ATOM   6606 C  CD2 . LEU B  1 327 ? 0.840   16.119  -36.463 1.00 45.01  ? 327  LEU B CD2 1 
ATOM   6607 N  N   . VAL B  1 328 ? 5.574   15.756  -34.261 1.00 30.73  ? 328  VAL B N   1 
ATOM   6608 C  CA  . VAL B  1 328 ? 6.214   14.527  -33.800 1.00 33.56  ? 328  VAL B CA  1 
ATOM   6609 C  C   . VAL B  1 328 ? 5.481   13.934  -32.607 1.00 41.92  ? 328  VAL B C   1 
ATOM   6610 O  O   . VAL B  1 328 ? 4.772   14.638  -31.887 1.00 44.46  ? 328  VAL B O   1 
ATOM   6611 C  CB  . VAL B  1 328 ? 7.677   14.770  -33.385 1.00 28.53  ? 328  VAL B CB  1 
ATOM   6612 C  CG1 . VAL B  1 328 ? 8.506   15.185  -34.578 1.00 30.44  ? 328  VAL B CG1 1 
ATOM   6613 C  CG2 . VAL B  1 328 ? 7.751   15.829  -32.296 1.00 37.49  ? 328  VAL B CG2 1 
ATOM   6614 N  N   . GLY B  1 329 ? 5.660   12.636  -32.389 1.00 35.05  ? 329  GLY B N   1 
ATOM   6615 C  CA  . GLY B  1 329 ? 5.038   11.993  -31.250 1.00 33.27  ? 329  GLY B CA  1 
ATOM   6616 C  C   . GLY B  1 329 ? 5.308   10.510  -31.147 1.00 34.15  ? 329  GLY B C   1 
ATOM   6617 O  O   . GLY B  1 329 ? 5.983   9.924   -31.996 1.00 38.05  ? 329  GLY B O   1 
ATOM   6618 N  N   . VAL B  1 330 ? 4.766   9.905   -30.095 1.00 33.05  ? 330  VAL B N   1 
ATOM   6619 C  CA  . VAL B  1 330 ? 4.990   8.499   -29.799 1.00 35.60  ? 330  VAL B CA  1 
ATOM   6620 C  C   . VAL B  1 330 ? 3.697   7.867   -29.308 1.00 39.64  ? 330  VAL B C   1 
ATOM   6621 O  O   . VAL B  1 330 ? 2.752   8.574   -28.958 1.00 39.59  ? 330  VAL B O   1 
ATOM   6622 C  CB  . VAL B  1 330 ? 6.032   8.333   -28.675 1.00 36.54  ? 330  VAL B CB  1 
ATOM   6623 C  CG1 . VAL B  1 330 ? 7.400   8.805   -29.125 1.00 33.59  ? 330  VAL B CG1 1 
ATOM   6624 C  CG2 . VAL B  1 330 ? 5.592   9.096   -27.428 1.00 27.64  ? 330  VAL B CG2 1 
ATOM   6625 N  N   . VAL B  1 331 ? 3.660   6.538   -29.276 1.00 39.66  ? 331  VAL B N   1 
ATOM   6626 C  CA  . VAL B  1 331 ? 2.567   5.832   -28.615 1.00 42.63  ? 331  VAL B CA  1 
ATOM   6627 C  C   . VAL B  1 331 ? 2.976   5.490   -27.183 1.00 45.15  ? 331  VAL B C   1 
ATOM   6628 O  O   . VAL B  1 331 ? 4.147   5.616   -26.817 1.00 45.12  ? 331  VAL B O   1 
ATOM   6629 C  CB  . VAL B  1 331 ? 2.149   4.555   -29.374 1.00 37.46  ? 331  VAL B CB  1 
ATOM   6630 C  CG1 . VAL B  1 331 ? 1.592   4.909   -30.744 1.00 43.44  ? 331  VAL B CG1 1 
ATOM   6631 C  CG2 . VAL B  1 331 ? 3.323   3.597   -29.501 1.00 27.03  ? 331  VAL B CG2 1 
ATOM   6632 N  N   . LYS B  1 332 ? 2.010   5.056   -26.381 1.00 45.32  ? 332  LYS B N   1 
ATOM   6633 C  CA  . LYS B  1 332 ? 2.223   4.834   -24.954 1.00 48.38  ? 332  LYS B CA  1 
ATOM   6634 C  C   . LYS B  1 332 ? 3.220   3.711   -24.655 1.00 48.26  ? 332  LYS B C   1 
ATOM   6635 O  O   . LYS B  1 332 ? 3.975   3.787   -23.683 1.00 47.61  ? 332  LYS B O   1 
ATOM   6636 C  CB  . LYS B  1 332 ? 0.875   4.568   -24.270 1.00 51.38  ? 332  LYS B CB  1 
ATOM   6637 C  CG  . LYS B  1 332 ? 0.932   4.432   -22.756 1.00 49.21  ? 332  LYS B CG  1 
ATOM   6638 C  CD  . LYS B  1 332 ? -0.474  4.402   -22.173 1.00 56.78  ? 332  LYS B CD  1 
ATOM   6639 C  CE  . LYS B  1 332 ? -0.513  3.661   -20.850 1.00 68.81  ? 332  LYS B CE  1 
ATOM   6640 N  NZ  . LYS B  1 332 ? -0.179  2.218   -21.026 1.00 70.83  ? 332  LYS B NZ  1 
ATOM   6641 N  N   . ASP B  1 333 ? 3.232   2.680   -25.496 1.00 41.90  ? 333  ASP B N   1 
ATOM   6642 C  CA  . ASP B  1 333 ? 4.075   1.511   -25.248 1.00 41.31  ? 333  ASP B CA  1 
ATOM   6643 C  C   . ASP B  1 333 ? 4.907   1.120   -26.466 1.00 43.68  ? 333  ASP B C   1 
ATOM   6644 O  O   . ASP B  1 333 ? 4.708   0.056   -27.052 1.00 52.89  ? 333  ASP B O   1 
ATOM   6645 C  CB  . ASP B  1 333 ? 3.218   0.331   -24.780 1.00 44.97  ? 333  ASP B CB  1 
ATOM   6646 C  CG  . ASP B  1 333 ? 2.508   0.616   -23.473 1.00 54.30  ? 333  ASP B CG  1 
ATOM   6647 O  OD1 . ASP B  1 333 ? 3.112   0.384   -22.405 1.00 57.16  ? 333  ASP B OD1 1 
ATOM   6648 O  OD2 . ASP B  1 333 ? 1.346   1.071   -23.513 1.00 53.74  ? 333  ASP B OD2 1 
ATOM   6649 N  N   . GLU B  1 334 ? 5.855   1.982   -26.817 1.00 40.49  ? 334  GLU B N   1 
ATOM   6650 C  CA  . GLU B  1 334 ? 6.679   1.821   -28.015 1.00 40.93  ? 334  GLU B CA  1 
ATOM   6651 C  C   . GLU B  1 334 ? 7.432   0.492   -28.113 1.00 45.96  ? 334  GLU B C   1 
ATOM   6652 O  O   . GLU B  1 334 ? 7.506   -0.102  -29.191 1.00 49.09  ? 334  GLU B O   1 
ATOM   6653 C  CB  . GLU B  1 334 ? 7.668   2.987   -28.121 1.00 33.17  ? 334  GLU B CB  1 
ATOM   6654 C  CG  . GLU B  1 334 ? 7.022   4.321   -28.478 1.00 38.78  ? 334  GLU B CG  1 
ATOM   6655 C  CD  . GLU B  1 334 ? 6.661   4.411   -29.947 1.00 42.06  ? 334  GLU B CD  1 
ATOM   6656 O  OE1 . GLU B  1 334 ? 7.053   3.502   -30.707 1.00 38.39  ? 334  GLU B OE1 1 
ATOM   6657 O  OE2 . GLU B  1 334 ? 5.994   5.391   -30.347 1.00 34.92  ? 334  GLU B OE2 1 
ATOM   6658 N  N   . GLY B  1 335 ? 7.973   0.017   -26.995 1.00 39.15  ? 335  GLY B N   1 
ATOM   6659 C  CA  . GLY B  1 335 ? 8.868   -1.128  -27.026 1.00 35.84  ? 335  GLY B CA  1 
ATOM   6660 C  C   . GLY B  1 335 ? 8.271   -2.506  -26.783 1.00 42.85  ? 335  GLY B C   1 
ATOM   6661 O  O   . GLY B  1 335 ? 8.977   -3.508  -26.903 1.00 49.53  ? 335  GLY B O   1 
ATOM   6662 N  N   . SER B  1 336 ? 6.983   -2.568  -26.454 1.00 38.15  ? 336  SER B N   1 
ATOM   6663 C  CA  . SER B  1 336 ? 6.351   -3.827  -26.040 1.00 46.34  ? 336  SER B CA  1 
ATOM   6664 C  C   . SER B  1 336 ? 6.504   -4.977  -27.044 1.00 49.45  ? 336  SER B C   1 
ATOM   6665 O  O   . SER B  1 336 ? 6.959   -6.066  -26.689 1.00 47.49  ? 336  SER B O   1 
ATOM   6666 C  CB  . SER B  1 336 ? 4.869   -3.603  -25.717 1.00 50.79  ? 336  SER B CB  1 
ATOM   6667 O  OG  . SER B  1 336 ? 4.157   -3.158  -26.857 1.00 47.41  ? 336  SER B OG  1 
ATOM   6668 N  N   A TYR B  1 337 ? 6.127   -4.797  -28.303 0.57 54.87  ? 337  TYR B N   1 
ATOM   6669 N  N   B TYR B  1 337 ? 6.115   -4.656  -28.276 0.43 54.59  ? 337  TYR B N   1 
ATOM   6670 C  CA  A TYR B  1 337 ? 6.142   -5.986  -29.163 0.57 53.87  ? 337  TYR B CA  1 
ATOM   6671 C  CA  B TYR B  1 337 ? 6.148   -5.493  -29.471 0.43 53.86  ? 337  TYR B CA  1 
ATOM   6672 C  C   A TYR B  1 337 ? 7.492   -6.410  -29.759 0.57 49.67  ? 337  TYR B C   1 
ATOM   6673 C  C   B TYR B  1 337 ? 7.421   -6.308  -29.645 0.43 50.50  ? 337  TYR B C   1 
ATOM   6674 O  O   A TYR B  1 337 ? 7.588   -7.492  -30.333 0.57 51.35  ? 337  TYR B O   1 
ATOM   6675 O  O   B TYR B  1 337 ? 7.395   -7.527  -29.802 0.43 51.08  ? 337  TYR B O   1 
ATOM   6676 C  CB  A TYR B  1 337 ? 4.999   -6.012  -30.199 0.57 55.29  ? 337  TYR B CB  1 
ATOM   6677 C  CB  B TYR B  1 337 ? 6.049   -4.542  -30.670 0.43 57.55  ? 337  TYR B CB  1 
ATOM   6678 C  CG  A TYR B  1 337 ? 5.165   -5.139  -31.421 0.57 58.74  ? 337  TYR B CG  1 
ATOM   6679 C  CG  B TYR B  1 337 ? 5.322   -5.071  -31.880 0.43 59.27  ? 337  TYR B CG  1 
ATOM   6680 C  CD1 A TYR B  1 337 ? 6.173   -5.375  -32.351 0.57 59.76  ? 337  TYR B CD1 1 
ATOM   6681 C  CD1 B TYR B  1 337 ? 5.854   -6.099  -32.644 0.43 59.95  ? 337  TYR B CD1 1 
ATOM   6682 C  CD2 A TYR B  1 337 ? 4.273   -4.114  -31.675 0.57 58.76  ? 337  TYR B CD2 1 
ATOM   6683 C  CD2 B TYR B  1 337 ? 4.118   -4.511  -32.283 0.43 59.34  ? 337  TYR B CD2 1 
ATOM   6684 C  CE1 A TYR B  1 337 ? 6.310   -4.586  -33.465 0.57 61.02  ? 337  TYR B CE1 1 
ATOM   6685 C  CE1 B TYR B  1 337 ? 5.192   -6.576  -33.756 0.43 58.80  ? 337  TYR B CE1 1 
ATOM   6686 C  CE2 A TYR B  1 337 ? 4.398   -3.328  -32.786 0.57 59.72  ? 337  TYR B CE2 1 
ATOM   6687 C  CE2 B TYR B  1 337 ? 3.450   -4.978  -33.396 0.43 61.45  ? 337  TYR B CE2 1 
ATOM   6688 C  CZ  A TYR B  1 337 ? 5.417   -3.565  -33.681 0.57 64.15  ? 337  TYR B CZ  1 
ATOM   6689 C  CZ  B TYR B  1 337 ? 3.994   -6.010  -34.130 0.43 57.71  ? 337  TYR B CZ  1 
ATOM   6690 O  OH  A TYR B  1 337 ? 5.544   -2.775  -34.796 0.57 64.22  ? 337  TYR B OH  1 
ATOM   6691 O  OH  B TYR B  1 337 ? 3.338   -6.487  -35.241 0.43 52.10  ? 337  TYR B OH  1 
ATOM   6692 N  N   . PHE B  1 338 ? 8.534   -5.591  -29.629 1.00 44.26  ? 338  PHE B N   1 
ATOM   6693 C  CA  . PHE B  1 338 ? 9.837   -6.071  -30.073 1.00 43.62  ? 338  PHE B CA  1 
ATOM   6694 C  C   . PHE B  1 338 ? 10.415  -7.145  -29.151 1.00 49.63  ? 338  PHE B C   1 
ATOM   6695 O  O   . PHE B  1 338 ? 11.307  -7.899  -29.545 1.00 47.07  ? 338  PHE B O   1 
ATOM   6696 C  CB  . PHE B  1 338 ? 10.801  -4.892  -30.229 1.00 52.99  ? 338  PHE B CB  1 
ATOM   6697 C  CG  . PHE B  1 338 ? 10.349  -3.866  -31.241 1.00 59.50  ? 338  PHE B CG  1 
ATOM   6698 C  CD1 . PHE B  1 338 ? 9.462   -2.854  -30.885 1.00 56.36  ? 338  PHE B CD1 1 
ATOM   6699 C  CD2 . PHE B  1 338 ? 10.817  -3.911  -32.548 1.00 52.38  ? 338  PHE B CD2 1 
ATOM   6700 C  CE1 . PHE B  1 338 ? 9.048   -1.909  -31.816 1.00 51.40  ? 338  PHE B CE1 1 
ATOM   6701 C  CE2 . PHE B  1 338 ? 10.410  -2.969  -33.482 1.00 46.43  ? 338  PHE B CE2 1 
ATOM   6702 C  CZ  . PHE B  1 338 ? 9.523   -1.968  -33.115 1.00 50.17  ? 338  PHE B CZ  1 
ATOM   6703 N  N   . LEU B  1 339 ? 9.883   -7.216  -27.934 1.00 49.81  ? 339  LEU B N   1 
ATOM   6704 C  CA  . LEU B  1 339 ? 10.342  -8.164  -26.924 1.00 53.60  ? 339  LEU B CA  1 
ATOM   6705 C  C   . LEU B  1 339 ? 10.067  -9.615  -27.312 1.00 49.47  ? 339  LEU B C   1 
ATOM   6706 O  O   . LEU B  1 339 ? 10.889  -10.494 -27.057 1.00 55.97  ? 339  LEU B O   1 
ATOM   6707 C  CB  . LEU B  1 339 ? 9.694   -7.847  -25.573 1.00 50.42  ? 339  LEU B CB  1 
ATOM   6708 C  CG  . LEU B  1 339 ? 9.927   -6.413  -25.092 1.00 50.91  ? 339  LEU B CG  1 
ATOM   6709 C  CD1 . LEU B  1 339 ? 9.215   -6.140  -23.778 1.00 51.82  ? 339  LEU B CD1 1 
ATOM   6710 C  CD2 . LEU B  1 339 ? 11.414  -6.145  -24.963 1.00 45.28  ? 339  LEU B CD2 1 
ATOM   6711 N  N   . VAL B  1 340 ? 8.919   -9.865  -27.935 1.00 49.42  ? 340  VAL B N   1 
ATOM   6712 C  CA  . VAL B  1 340 ? 8.554   -11.226 -28.331 1.00 54.05  ? 340  VAL B CA  1 
ATOM   6713 C  C   . VAL B  1 340 ? 9.379   -11.720 -29.518 1.00 52.16  ? 340  VAL B C   1 
ATOM   6714 O  O   . VAL B  1 340 ? 9.268   -12.880 -29.918 1.00 54.86  ? 340  VAL B O   1 
ATOM   6715 C  CB  . VAL B  1 340 ? 7.048   -11.353 -28.670 1.00 56.19  ? 340  VAL B CB  1 
ATOM   6716 C  CG1 . VAL B  1 340 ? 6.204   -10.771 -27.561 1.00 53.62  ? 340  VAL B CG1 1 
ATOM   6717 C  CG2 . VAL B  1 340 ? 6.729   -10.667 -29.987 1.00 54.65  ? 340  VAL B CG2 1 
ATOM   6718 N  N   . TYR B  1 341 ? 10.205  -10.837 -30.073 1.00 52.74  ? 341  TYR B N   1 
ATOM   6719 C  CA  . TYR B  1 341 ? 11.016  -11.166 -31.243 1.00 53.72  ? 341  TYR B CA  1 
ATOM   6720 C  C   . TYR B  1 341 ? 12.484  -11.461 -30.910 1.00 59.58  ? 341  TYR B C   1 
ATOM   6721 O  O   . TYR B  1 341 ? 13.326  -11.506 -31.810 1.00 63.43  ? 341  TYR B O   1 
ATOM   6722 C  CB  . TYR B  1 341 ? 10.950  -10.034 -32.272 1.00 48.37  ? 341  TYR B CB  1 
ATOM   6723 C  CG  . TYR B  1 341 ? 9.691   -10.001 -33.114 1.00 50.46  ? 341  TYR B CG  1 
ATOM   6724 C  CD1 . TYR B  1 341 ? 9.555   -10.822 -34.223 1.00 50.68  ? 341  TYR B CD1 1 
ATOM   6725 C  CD2 . TYR B  1 341 ? 8.650   -9.131  -32.813 1.00 49.93  ? 341  TYR B CD2 1 
ATOM   6726 C  CE1 . TYR B  1 341 ? 8.413   -10.789 -35.003 1.00 52.86  ? 341  TYR B CE1 1 
ATOM   6727 C  CE2 . TYR B  1 341 ? 7.504   -9.091  -33.589 1.00 50.14  ? 341  TYR B CE2 1 
ATOM   6728 C  CZ  . TYR B  1 341 ? 7.394   -9.921  -34.684 1.00 54.56  ? 341  TYR B CZ  1 
ATOM   6729 O  OH  . TYR B  1 341 ? 6.261   -9.893  -35.466 1.00 52.48  ? 341  TYR B OH  1 
ATOM   6730 N  N   . GLY B  1 342 ? 12.794  -11.660 -29.631 1.00 61.38  ? 342  GLY B N   1 
ATOM   6731 C  CA  . GLY B  1 342 ? 14.163  -11.955 -29.241 1.00 61.56  ? 342  GLY B CA  1 
ATOM   6732 C  C   . GLY B  1 342 ? 14.445  -12.066 -27.753 1.00 65.61  ? 342  GLY B C   1 
ATOM   6733 O  O   . GLY B  1 342 ? 15.421  -12.702 -27.351 1.00 72.17  ? 342  GLY B O   1 
ATOM   6734 N  N   . VAL B  1 343 ? 13.604  -11.445 -26.930 1.00 60.55  ? 343  VAL B N   1 
ATOM   6735 C  CA  . VAL B  1 343 ? 13.820  -11.460 -25.484 1.00 56.99  ? 343  VAL B CA  1 
ATOM   6736 C  C   . VAL B  1 343 ? 13.146  -12.653 -24.811 1.00 53.32  ? 343  VAL B C   1 
ATOM   6737 O  O   . VAL B  1 343 ? 11.918  -12.766 -24.818 1.00 58.64  ? 343  VAL B O   1 
ATOM   6738 C  CB  . VAL B  1 343 ? 13.333  -10.162 -24.816 1.00 57.95  ? 343  VAL B CB  1 
ATOM   6739 C  CG1 . VAL B  1 343 ? 13.903  -10.054 -23.411 1.00 51.19  ? 343  VAL B CG1 1 
ATOM   6740 C  CG2 . VAL B  1 343 ? 13.759  -8.966  -25.633 1.00 58.06  ? 343  VAL B CG2 1 
ATOM   6741 N  N   . PRO B  1 344 ? 13.958  -13.546 -24.220 1.00 41.15  ? 344  PRO B N   1 
ATOM   6742 C  CA  . PRO B  1 344 ? 13.470  -14.746 -23.529 1.00 51.81  ? 344  PRO B CA  1 
ATOM   6743 C  C   . PRO B  1 344 ? 12.521  -14.391 -22.391 1.00 58.29  ? 344  PRO B C   1 
ATOM   6744 O  O   . PRO B  1 344 ? 12.823  -13.492 -21.603 1.00 52.78  ? 344  PRO B O   1 
ATOM   6745 C  CB  . PRO B  1 344 ? 14.752  -15.368 -22.962 1.00 49.29  ? 344  PRO B CB  1 
ATOM   6746 C  CG  . PRO B  1 344 ? 15.852  -14.851 -23.842 1.00 46.30  ? 344  PRO B CG  1 
ATOM   6747 C  CD  . PRO B  1 344 ? 15.431  -13.460 -24.215 1.00 38.64  ? 344  PRO B CD  1 
ATOM   6748 N  N   . GLY B  1 345 ? 11.391  -15.086 -22.310 1.00 63.23  ? 345  GLY B N   1 
ATOM   6749 C  CA  . GLY B  1 345 ? 10.412  -14.829 -21.268 1.00 65.75  ? 345  GLY B CA  1 
ATOM   6750 C  C   . GLY B  1 345 ? 9.180   -14.111 -21.785 1.00 67.51  ? 345  GLY B C   1 
ATOM   6751 O  O   . GLY B  1 345 ? 8.126   -14.123 -21.146 1.00 77.22  ? 345  GLY B O   1 
ATOM   6752 N  N   . PHE B  1 346 ? 9.311   -13.484 -22.949 1.00 59.63  ? 346  PHE B N   1 
ATOM   6753 C  CA  . PHE B  1 346 ? 8.208   -12.726 -23.525 1.00 58.63  ? 346  PHE B CA  1 
ATOM   6754 C  C   . PHE B  1 346 ? 7.490   -13.475 -24.643 1.00 68.31  ? 346  PHE B C   1 
ATOM   6755 O  O   . PHE B  1 346 ? 8.119   -14.049 -25.534 1.00 72.78  ? 346  PHE B O   1 
ATOM   6756 C  CB  . PHE B  1 346 ? 8.698   -11.365 -24.023 1.00 54.44  ? 346  PHE B CB  1 
ATOM   6757 C  CG  . PHE B  1 346 ? 9.222   -10.474 -22.930 1.00 53.17  ? 346  PHE B CG  1 
ATOM   6758 C  CD1 . PHE B  1 346 ? 10.534  -10.587 -22.489 1.00 44.21  ? 346  PHE B CD1 1 
ATOM   6759 C  CD2 . PHE B  1 346 ? 8.401   -9.520  -22.345 1.00 48.27  ? 346  PHE B CD2 1 
ATOM   6760 C  CE1 . PHE B  1 346 ? 11.017  -9.768  -21.483 1.00 45.74  ? 346  PHE B CE1 1 
ATOM   6761 C  CE2 . PHE B  1 346 ? 8.877   -8.698  -21.340 1.00 48.18  ? 346  PHE B CE2 1 
ATOM   6762 C  CZ  . PHE B  1 346 ? 10.188  -8.821  -20.909 1.00 49.11  ? 346  PHE B CZ  1 
ATOM   6763 N  N   . SER B  1 347 ? 6.163   -13.462 -24.570 1.00 68.58  ? 347  SER B N   1 
ATOM   6764 C  CA  . SER B  1 347 ? 5.296   -14.051 -25.584 1.00 64.58  ? 347  SER B CA  1 
ATOM   6765 C  C   . SER B  1 347 ? 3.979   -13.291 -25.585 1.00 60.10  ? 347  SER B C   1 
ATOM   6766 O  O   . SER B  1 347 ? 3.630   -12.655 -24.590 1.00 57.84  ? 347  SER B O   1 
ATOM   6767 C  CB  . SER B  1 347 ? 5.039   -15.531 -25.285 1.00 67.72  ? 347  SER B CB  1 
ATOM   6768 O  OG  . SER B  1 347 ? 3.831   -15.969 -25.889 1.00 69.34  ? 347  SER B OG  1 
ATOM   6769 N  N   . LYS B  1 348 ? 3.255   -13.349 -26.699 1.00 58.33  ? 348  LYS B N   1 
ATOM   6770 C  CA  . LYS B  1 348 ? 1.941   -12.720 -26.787 1.00 54.89  ? 348  LYS B CA  1 
ATOM   6771 C  C   . LYS B  1 348 ? 0.868   -13.652 -26.238 1.00 56.64  ? 348  LYS B C   1 
ATOM   6772 O  O   . LYS B  1 348 ? -0.301  -13.273 -26.137 1.00 57.44  ? 348  LYS B O   1 
ATOM   6773 C  CB  . LYS B  1 348 ? 1.602   -12.381 -28.239 1.00 55.09  ? 348  LYS B CB  1 
ATOM   6774 C  CG  . LYS B  1 348 ? 1.173   -13.596 -29.051 1.00 56.36  ? 348  LYS B CG  1 
ATOM   6775 C  CD  . LYS B  1 348 ? 0.478   -13.206 -30.348 1.00 62.22  ? 348  LYS B CD  1 
ATOM   6776 C  CE  . LYS B  1 348 ? -0.254  -14.398 -30.953 1.00 61.11  ? 348  LYS B CE  1 
ATOM   6777 N  NZ  . LYS B  1 348 ? -1.278  -14.939 -30.018 1.00 68.00  ? 348  LYS B NZ  1 
ATOM   6778 N  N   . ASP B  1 349 ? 1.271   -14.871 -25.889 1.00 58.03  ? 349  ASP B N   1 
ATOM   6779 C  CA  . ASP B  1 349 ? 0.321   -15.897 -25.469 1.00 62.19  ? 349  ASP B CA  1 
ATOM   6780 C  C   . ASP B  1 349 ? 0.205   -16.047 -23.948 1.00 69.03  ? 349  ASP B C   1 
ATOM   6781 O  O   . ASP B  1 349 ? -0.707  -16.713 -23.454 1.00 74.91  ? 349  ASP B O   1 
ATOM   6782 C  CB  . ASP B  1 349 ? 0.654   -17.239 -26.133 1.00 61.24  ? 349  ASP B CB  1 
ATOM   6783 C  CG  . ASP B  1 349 ? 0.424   -17.218 -27.634 1.00 66.35  ? 349  ASP B CG  1 
ATOM   6784 O  OD1 . ASP B  1 349 ? -0.550  -16.574 -28.078 1.00 65.67  ? 349  ASP B OD1 1 
ATOM   6785 O  OD2 . ASP B  1 349 ? 1.217   -17.842 -28.374 1.00 65.76  ? 349  ASP B OD2 1 
ATOM   6786 N  N   . ASN B  1 350 ? 1.130   -15.437 -23.211 1.00 68.87  ? 350  ASN B N   1 
ATOM   6787 C  CA  . ASN B  1 350 ? 0.987   -15.308 -21.760 1.00 70.10  ? 350  ASN B CA  1 
ATOM   6788 C  C   . ASN B  1 350 ? 1.186   -13.862 -21.309 1.00 68.97  ? 350  ASN B C   1 
ATOM   6789 O  O   . ASN B  1 350 ? 1.198   -12.949 -22.136 1.00 69.10  ? 350  ASN B O   1 
ATOM   6790 C  CB  . ASN B  1 350 ? 1.920   -16.268 -21.005 1.00 71.11  ? 350  ASN B CB  1 
ATOM   6791 C  CG  . ASN B  1 350 ? 3.386   -16.070 -21.351 1.00 84.58  ? 350  ASN B CG  1 
ATOM   6792 O  OD1 . ASN B  1 350 ? 3.862   -14.944 -21.498 1.00 81.29  ? 350  ASN B OD1 1 
ATOM   6793 N  ND2 . ASN B  1 350 ? 4.114   -17.174 -21.473 1.00 111.14 ? 350  ASN B ND2 1 
ATOM   6794 N  N   . GLU B  1 351 ? 1.342   -13.651 -20.006 1.00 68.50  ? 351  GLU B N   1 
ATOM   6795 C  CA  . GLU B  1 351 ? 1.487   -12.297 -19.478 1.00 65.88  ? 351  GLU B CA  1 
ATOM   6796 C  C   . GLU B  1 351 ? 2.947   -11.858 -19.367 1.00 56.07  ? 351  GLU B C   1 
ATOM   6797 O  O   . GLU B  1 351 ? 3.231   -10.727 -18.964 1.00 53.64  ? 351  GLU B O   1 
ATOM   6798 C  CB  . GLU B  1 351 ? 0.772   -12.163 -18.130 1.00 73.04  ? 351  GLU B CB  1 
ATOM   6799 C  CG  . GLU B  1 351 ? -0.745  -12.209 -18.240 1.00 83.75  ? 351  GLU B CG  1 
ATOM   6800 C  CD  . GLU B  1 351 ? -1.433  -12.118 -16.894 1.00 97.33  ? 351  GLU B CD  1 
ATOM   6801 O  OE1 . GLU B  1 351 ? -0.758  -12.329 -15.863 1.00 96.99  ? 351  GLU B OE1 1 
ATOM   6802 O  OE2 . GLU B  1 351 ? -2.650  -11.837 -16.869 1.00 104.29 ? 351  GLU B OE2 1 
ATOM   6803 N  N   . SER B  1 352 ? 3.861   -12.759 -19.723 1.00 51.55  ? 352  SER B N   1 
ATOM   6804 C  CA  . SER B  1 352 ? 5.287   -12.445 -19.806 1.00 56.86  ? 352  SER B CA  1 
ATOM   6805 C  C   . SER B  1 352 ? 5.866   -11.860 -18.517 1.00 61.44  ? 352  SER B C   1 
ATOM   6806 O  O   . SER B  1 352 ? 6.640   -10.901 -18.552 1.00 56.10  ? 352  SER B O   1 
ATOM   6807 C  CB  . SER B  1 352 ? 5.553   -11.499 -20.980 1.00 51.22  ? 352  SER B CB  1 
ATOM   6808 O  OG  . SER B  1 352 ? 4.956   -11.988 -22.168 1.00 49.48  ? 352  SER B OG  1 
ATOM   6809 N  N   . LEU B  1 353 ? 5.478   -12.435 -17.384 1.00 64.77  ? 353  LEU B N   1 
ATOM   6810 C  CA  . LEU B  1 353 ? 6.059   -12.059 -16.105 1.00 62.01  ? 353  LEU B CA  1 
ATOM   6811 C  C   . LEU B  1 353 ? 7.459   -12.660 -16.034 1.00 61.36  ? 353  LEU B C   1 
ATOM   6812 O  O   . LEU B  1 353 ? 7.625   -13.871 -16.163 1.00 67.57  ? 353  LEU B O   1 
ATOM   6813 C  CB  . LEU B  1 353 ? 5.185   -12.568 -14.959 1.00 61.28  ? 353  LEU B CB  1 
ATOM   6814 C  CG  . LEU B  1 353 ? 3.731   -12.091 -15.005 1.00 64.02  ? 353  LEU B CG  1 
ATOM   6815 C  CD1 . LEU B  1 353 ? 2.910   -12.724 -13.897 1.00 63.34  ? 353  LEU B CD1 1 
ATOM   6816 C  CD2 . LEU B  1 353 ? 3.660   -10.579 -14.915 1.00 63.76  ? 353  LEU B CD2 1 
ATOM   6817 N  N   . ILE B  1 354 ? 8.465   -11.813 -15.847 1.00 56.95  ? 354  ILE B N   1 
ATOM   6818 C  CA  . ILE B  1 354 ? 9.852   -12.261 -15.934 1.00 57.94  ? 354  ILE B CA  1 
ATOM   6819 C  C   . ILE B  1 354 ? 10.620  -12.148 -14.619 1.00 59.97  ? 354  ILE B C   1 
ATOM   6820 O  O   . ILE B  1 354 ? 10.251  -11.378 -13.733 1.00 55.11  ? 354  ILE B O   1 
ATOM   6821 C  CB  . ILE B  1 354 ? 10.621  -11.494 -17.028 1.00 54.20  ? 354  ILE B CB  1 
ATOM   6822 C  CG1 . ILE B  1 354 ? 10.452  -9.983  -16.840 1.00 50.12  ? 354  ILE B CG1 1 
ATOM   6823 C  CG2 . ILE B  1 354 ? 10.140  -11.912 -18.407 1.00 53.76  ? 354  ILE B CG2 1 
ATOM   6824 C  CD1 . ILE B  1 354 ? 11.432  -9.153  -17.646 1.00 41.51  ? 354  ILE B CD1 1 
ATOM   6825 N  N   . SER B  1 355 ? 11.697  -12.922 -14.506 1.00 66.70  ? 355  SER B N   1 
ATOM   6826 C  CA  . SER B  1 355 ? 12.581  -12.845 -13.347 1.00 66.21  ? 355  SER B CA  1 
ATOM   6827 C  C   . SER B  1 355 ? 13.421  -11.578 -13.424 1.00 69.94  ? 355  SER B C   1 
ATOM   6828 O  O   . SER B  1 355 ? 13.239  -10.753 -14.326 1.00 70.60  ? 355  SER B O   1 
ATOM   6829 C  CB  . SER B  1 355 ? 13.511  -14.058 -13.299 1.00 66.93  ? 355  SER B CB  1 
ATOM   6830 O  OG  . SER B  1 355 ? 14.617  -13.879 -14.169 1.00 69.23  ? 355  SER B OG  1 
ATOM   6831 N  N   . ARG B  1 356 ? 14.339  -11.424 -12.474 1.00 64.54  ? 356  ARG B N   1 
ATOM   6832 C  CA  . ARG B  1 356 ? 15.284  -10.312 -12.499 1.00 62.63  ? 356  ARG B CA  1 
ATOM   6833 C  C   . ARG B  1 356 ? 16.479  -10.633 -13.394 1.00 66.85  ? 356  ARG B C   1 
ATOM   6834 O  O   . ARG B  1 356 ? 16.960  -9.774  -14.133 1.00 69.46  ? 356  ARG B O   1 
ATOM   6835 C  CB  . ARG B  1 356 ? 15.746  -9.952  -11.084 1.00 59.66  ? 356  ARG B CB  1 
ATOM   6836 C  CG  . ARG B  1 356 ? 16.849  -8.904  -11.059 1.00 58.15  ? 356  ARG B CG  1 
ATOM   6837 C  CD  . ARG B  1 356 ? 16.685  -7.912  -9.920  1.00 59.20  ? 356  ARG B CD  1 
ATOM   6838 N  NE  . ARG B  1 356 ? 17.677  -6.844  -10.015 1.00 63.97  ? 356  ARG B NE  1 
ATOM   6839 C  CZ  . ARG B  1 356 ? 17.414  -5.612  -10.442 1.00 61.78  ? 356  ARG B CZ  1 
ATOM   6840 N  NH1 . ARG B  1 356 ? 16.180  -5.279  -10.797 1.00 54.87  ? 356  ARG B NH1 1 
ATOM   6841 N  NH2 . ARG B  1 356 ? 18.381  -4.707  -10.502 1.00 62.16  ? 356  ARG B NH2 1 
ATOM   6842 N  N   . ALA B  1 357 ? 16.947  -11.875 -13.330 1.00 67.98  ? 357  ALA B N   1 
ATOM   6843 C  CA  . ALA B  1 357 ? 18.031  -12.330 -14.193 1.00 64.30  ? 357  ALA B CA  1 
ATOM   6844 C  C   . ALA B  1 357 ? 17.649  -12.204 -15.661 1.00 57.60  ? 357  ALA B C   1 
ATOM   6845 O  O   . ALA B  1 357 ? 18.499  -11.920 -16.507 1.00 62.01  ? 357  ALA B O   1 
ATOM   6846 C  CB  . ALA B  1 357 ? 18.402  -13.765 -13.867 1.00 59.37  ? 357  ALA B CB  1 
ATOM   6847 N  N   . GLN B  1 358 ? 16.370  -12.426 -15.955 1.00 55.60  ? 358  GLN B N   1 
ATOM   6848 C  CA  . GLN B  1 358 ? 15.850  -12.280 -17.311 1.00 56.54  ? 358  GLN B CA  1 
ATOM   6849 C  C   . GLN B  1 358 ? 15.826  -10.815 -17.736 1.00 56.35  ? 358  GLN B C   1 
ATOM   6850 O  O   . GLN B  1 358 ? 16.018  -10.500 -18.908 1.00 53.59  ? 358  GLN B O   1 
ATOM   6851 C  CB  . GLN B  1 358 ? 14.441  -12.874 -17.420 1.00 53.73  ? 358  GLN B CB  1 
ATOM   6852 C  CG  . GLN B  1 358 ? 14.383  -14.397 -17.439 1.00 58.66  ? 358  GLN B CG  1 
ATOM   6853 C  CD  . GLN B  1 358 ? 12.957  -14.921 -17.474 1.00 66.65  ? 358  GLN B CD  1 
ATOM   6854 O  OE1 . GLN B  1 358 ? 12.092  -14.436 -16.745 1.00 73.40  ? 358  GLN B OE1 1 
ATOM   6855 N  NE2 . GLN B  1 358 ? 12.705  -15.912 -18.325 1.00 57.79  ? 358  GLN B NE2 1 
ATOM   6856 N  N   . PHE B  1 359 ? 15.585  -9.923  -16.779 1.00 56.59  ? 359  PHE B N   1 
ATOM   6857 C  CA  . PHE B  1 359 ? 15.532  -8.494  -17.070 1.00 55.64  ? 359  PHE B CA  1 
ATOM   6858 C  C   . PHE B  1 359 ? 16.914  -7.938  -17.408 1.00 57.63  ? 359  PHE B C   1 
ATOM   6859 O  O   . PHE B  1 359 ? 17.037  -7.037  -18.236 1.00 69.61  ? 359  PHE B O   1 
ATOM   6860 C  CB  . PHE B  1 359 ? 14.898  -7.722  -15.908 1.00 61.75  ? 359  PHE B CB  1 
ATOM   6861 C  CG  . PHE B  1 359 ? 15.085  -6.233  -15.994 1.00 62.91  ? 359  PHE B CG  1 
ATOM   6862 C  CD1 . PHE B  1 359 ? 14.427  -5.487  -16.962 1.00 62.39  ? 359  PHE B CD1 1 
ATOM   6863 C  CD2 . PHE B  1 359 ? 15.923  -5.578  -15.104 1.00 62.29  ? 359  PHE B CD2 1 
ATOM   6864 C  CE1 . PHE B  1 359 ? 14.605  -4.113  -17.042 1.00 60.42  ? 359  PHE B CE1 1 
ATOM   6865 C  CE2 . PHE B  1 359 ? 16.105  -4.207  -15.176 1.00 57.38  ? 359  PHE B CE2 1 
ATOM   6866 C  CZ  . PHE B  1 359 ? 15.445  -3.474  -16.146 1.00 56.07  ? 359  PHE B CZ  1 
ATOM   6867 N  N   . LEU B  1 360 ? 17.949  -8.483  -16.773 1.00 51.71  ? 360  LEU B N   1 
ATOM   6868 C  CA  . LEU B  1 360 ? 19.321  -8.081  -17.073 1.00 55.77  ? 360  LEU B CA  1 
ATOM   6869 C  C   . LEU B  1 360 ? 19.722  -8.656  -18.429 1.00 59.45  ? 360  LEU B C   1 
ATOM   6870 O  O   . LEU B  1 360 ? 20.398  -8.000  -19.223 1.00 57.01  ? 360  LEU B O   1 
ATOM   6871 C  CB  . LEU B  1 360 ? 20.303  -8.555  -15.992 1.00 61.33  ? 360  LEU B CB  1 
ATOM   6872 C  CG  . LEU B  1 360 ? 19.959  -8.475  -14.497 1.00 67.78  ? 360  LEU B CG  1 
ATOM   6873 C  CD1 . LEU B  1 360 ? 21.210  -8.585  -13.635 1.00 74.34  ? 360  LEU B CD1 1 
ATOM   6874 C  CD2 . LEU B  1 360 ? 19.200  -7.214  -14.150 1.00 64.98  ? 360  LEU B CD2 1 
ATOM   6875 N  N   . ALA B  1 361 ? 19.295  -9.888  -18.686 1.00 58.49  ? 361  ALA B N   1 
ATOM   6876 C  CA  . ALA B  1 361 ? 19.580  -10.552 -19.953 1.00 61.96  ? 361  ALA B CA  1 
ATOM   6877 C  C   . ALA B  1 361 ? 18.927  -9.818  -21.119 1.00 57.55  ? 361  ALA B C   1 
ATOM   6878 O  O   . ALA B  1 361 ? 19.543  -9.633  -22.170 1.00 55.58  ? 361  ALA B O   1 
ATOM   6879 C  CB  . ALA B  1 361 ? 19.113  -11.998 -19.906 1.00 62.61  ? 361  ALA B CB  1 
ATOM   6880 N  N   . GLY B  1 362 ? 17.678  -9.403  -20.928 1.00 53.97  ? 362  GLY B N   1 
ATOM   6881 C  CA  . GLY B  1 362 ? 16.946  -8.683  -21.956 1.00 49.31  ? 362  GLY B CA  1 
ATOM   6882 C  C   . GLY B  1 362 ? 17.512  -7.308  -22.266 1.00 52.98  ? 362  GLY B C   1 
ATOM   6883 O  O   . GLY B  1 362 ? 17.267  -6.761  -23.345 1.00 49.76  ? 362  GLY B O   1 
ATOM   6884 N  N   . VAL B  1 363 ? 18.264  -6.748  -21.320 1.00 51.65  ? 363  VAL B N   1 
ATOM   6885 C  CA  . VAL B  1 363 ? 18.872  -5.426  -21.491 1.00 50.11  ? 363  VAL B CA  1 
ATOM   6886 C  C   . VAL B  1 363 ? 20.096  -5.475  -22.415 1.00 47.65  ? 363  VAL B C   1 
ATOM   6887 O  O   . VAL B  1 363 ? 20.338  -4.543  -23.189 1.00 49.43  ? 363  VAL B O   1 
ATOM   6888 C  CB  . VAL B  1 363 ? 19.200  -4.774  -20.118 1.00 46.19  ? 363  VAL B CB  1 
ATOM   6889 C  CG1 . VAL B  1 363 ? 20.192  -3.625  -20.260 1.00 40.16  ? 363  VAL B CG1 1 
ATOM   6890 C  CG2 . VAL B  1 363 ? 17.927  -4.280  -19.465 1.00 47.88  ? 363  VAL B CG2 1 
ATOM   6891 N  N   . ARG B  1 364 ? 20.848  -6.574  -22.354 1.00 41.09  ? 364  ARG B N   1 
ATOM   6892 C  CA  . ARG B  1 364 ? 21.989  -6.765  -23.248 1.00 45.68  ? 364  ARG B CA  1 
ATOM   6893 C  C   . ARG B  1 364 ? 21.512  -6.950  -24.684 1.00 55.05  ? 364  ARG B C   1 
ATOM   6894 O  O   . ARG B  1 364 ? 22.263  -6.722  -25.630 1.00 61.05  ? 364  ARG B O   1 
ATOM   6895 C  CB  . ARG B  1 364 ? 22.822  -7.981  -22.832 1.00 47.53  ? 364  ARG B CB  1 
ATOM   6896 C  CG  . ARG B  1 364 ? 23.223  -8.017  -21.367 1.00 56.52  ? 364  ARG B CG  1 
ATOM   6897 C  CD  . ARG B  1 364 ? 23.787  -6.683  -20.904 1.00 61.11  ? 364  ARG B CD  1 
ATOM   6898 N  NE  . ARG B  1 364 ? 24.991  -6.292  -21.635 1.00 65.38  ? 364  ARG B NE  1 
ATOM   6899 C  CZ  . ARG B  1 364 ? 26.229  -6.565  -21.233 1.00 70.40  ? 364  ARG B CZ  1 
ATOM   6900 N  NH1 . ARG B  1 364 ? 26.428  -7.233  -20.104 1.00 70.11  ? 364  ARG B NH1 1 
ATOM   6901 N  NH2 . ARG B  1 364 ? 27.268  -6.174  -21.958 1.00 71.07  ? 364  ARG B NH2 1 
ATOM   6902 N  N   . ILE B  1 365 ? 20.260  -7.376  -24.834 1.00 56.30  ? 365  ILE B N   1 
ATOM   6903 C  CA  . ILE B  1 365 ? 19.651  -7.589  -26.144 1.00 55.54  ? 365  ILE B CA  1 
ATOM   6904 C  C   . ILE B  1 365 ? 18.898  -6.336  -26.596 1.00 49.70  ? 365  ILE B C   1 
ATOM   6905 O  O   . ILE B  1 365 ? 18.971  -5.946  -27.761 1.00 52.26  ? 365  ILE B O   1 
ATOM   6906 C  CB  . ILE B  1 365 ? 18.703  -8.814  -26.119 1.00 54.64  ? 365  ILE B CB  1 
ATOM   6907 C  CG1 . ILE B  1 365 ? 19.502  -10.091 -25.842 1.00 51.33  ? 365  ILE B CG1 1 
ATOM   6908 C  CG2 . ILE B  1 365 ? 17.931  -8.940  -27.424 1.00 50.71  ? 365  ILE B CG2 1 
ATOM   6909 C  CD1 . ILE B  1 365 ? 18.645  -11.311 -25.575 1.00 53.86  ? 365  ILE B CD1 1 
ATOM   6910 N  N   . GLY B  1 366 ? 18.189  -5.700  -25.666 1.00 41.93  ? 366  GLY B N   1 
ATOM   6911 C  CA  . GLY B  1 366 ? 17.482  -4.462  -25.952 1.00 39.82  ? 366  GLY B CA  1 
ATOM   6912 C  C   . GLY B  1 366 ? 18.420  -3.292  -26.190 1.00 43.54  ? 366  GLY B C   1 
ATOM   6913 O  O   . GLY B  1 366 ? 18.096  -2.366  -26.935 1.00 50.96  ? 366  GLY B O   1 
ATOM   6914 N  N   . VAL B  1 367 ? 19.582  -3.329  -25.543 1.00 36.44  ? 367  VAL B N   1 
ATOM   6915 C  CA  . VAL B  1 367 ? 20.621  -2.322  -25.750 1.00 40.68  ? 367  VAL B CA  1 
ATOM   6916 C  C   . VAL B  1 367 ? 21.927  -3.033  -26.118 1.00 43.79  ? 367  VAL B C   1 
ATOM   6917 O  O   . VAL B  1 367 ? 22.867  -3.056  -25.324 1.00 49.31  ? 367  VAL B O   1 
ATOM   6918 C  CB  . VAL B  1 367 ? 20.842  -1.458  -24.482 1.00 46.09  ? 367  VAL B CB  1 
ATOM   6919 C  CG1 . VAL B  1 367 ? 21.612  -0.192  -24.827 1.00 39.17  ? 367  VAL B CG1 1 
ATOM   6920 C  CG2 . VAL B  1 367 ? 19.518  -1.094  -23.833 1.00 40.41  ? 367  VAL B CG2 1 
ATOM   6921 N  N   . PRO B  1 368 ? 21.989  -3.607  -27.334 1.00 46.88  ? 368  PRO B N   1 
ATOM   6922 C  CA  . PRO B  1 368 ? 23.059  -4.530  -27.743 1.00 47.44  ? 368  PRO B CA  1 
ATOM   6923 C  C   . PRO B  1 368 ? 24.445  -3.904  -27.873 1.00 47.27  ? 368  PRO B C   1 
ATOM   6924 O  O   . PRO B  1 368 ? 25.439  -4.632  -27.939 1.00 51.64  ? 368  PRO B O   1 
ATOM   6925 C  CB  . PRO B  1 368 ? 22.585  -5.023  -29.115 1.00 48.52  ? 368  PRO B CB  1 
ATOM   6926 C  CG  . PRO B  1 368 ? 21.723  -3.927  -29.630 1.00 46.34  ? 368  PRO B CG  1 
ATOM   6927 C  CD  . PRO B  1 368 ? 21.024  -3.371  -28.425 1.00 42.34  ? 368  PRO B CD  1 
ATOM   6928 N  N   . GLN B  1 369 ? 24.508  -2.578  -27.920 1.00 48.16  ? 369  GLN B N   1 
ATOM   6929 C  CA  . GLN B  1 369 ? 25.779  -1.872  -28.064 1.00 55.66  ? 369  GLN B CA  1 
ATOM   6930 C  C   . GLN B  1 369 ? 26.344  -1.434  -26.713 1.00 58.93  ? 369  GLN B C   1 
ATOM   6931 O  O   . GLN B  1 369 ? 27.413  -0.826  -26.647 1.00 65.97  ? 369  GLN B O   1 
ATOM   6932 C  CB  . GLN B  1 369 ? 25.595  -0.641  -28.951 1.00 51.46  ? 369  GLN B CB  1 
ATOM   6933 C  CG  . GLN B  1 369 ? 24.870  0.518   -28.261 1.00 63.47  ? 369  GLN B CG  1 
ATOM   6934 C  CD  . GLN B  1 369 ? 23.359  0.332   -28.177 1.00 62.24  ? 369  GLN B CD  1 
ATOM   6935 O  OE1 . GLN B  1 369 ? 22.850  -0.789  -28.123 1.00 60.99  ? 369  GLN B OE1 1 
ATOM   6936 N  NE2 . GLN B  1 369 ? 22.637  1.441   -28.171 1.00 57.08  ? 369  GLN B NE2 1 
ATOM   6937 N  N   . ALA B  1 370 ? 25.625  -1.743  -25.639 1.00 54.22  ? 370  ALA B N   1 
ATOM   6938 C  CA  . ALA B  1 370 ? 26.024  -1.304  -24.303 1.00 57.93  ? 370  ALA B CA  1 
ATOM   6939 C  C   . ALA B  1 370 ? 27.140  -2.150  -23.710 1.00 53.53  ? 370  ALA B C   1 
ATOM   6940 O  O   . ALA B  1 370 ? 27.101  -3.379  -23.769 1.00 55.06  ? 370  ALA B O   1 
ATOM   6941 C  CB  . ALA B  1 370 ? 24.829  -1.307  -23.370 1.00 58.25  ? 370  ALA B CB  1 
ATOM   6942 N  N   . SER B  1 371 ? 28.127  -1.479  -23.123 1.00 54.18  ? 371  SER B N   1 
ATOM   6943 C  CA  . SER B  1 371 ? 29.166  -2.149  -22.351 1.00 60.52  ? 371  SER B CA  1 
ATOM   6944 C  C   . SER B  1 371 ? 28.564  -2.736  -21.080 1.00 63.60  ? 371  SER B C   1 
ATOM   6945 O  O   . SER B  1 371 ? 27.389  -2.505  -20.784 1.00 62.29  ? 371  SER B O   1 
ATOM   6946 C  CB  . SER B  1 371 ? 30.275  -1.160  -21.995 1.00 62.10  ? 371  SER B CB  1 
ATOM   6947 O  OG  . SER B  1 371 ? 29.752  -0.018  -21.337 1.00 64.71  ? 371  SER B OG  1 
ATOM   6948 N  N   . ASP B  1 372 ? 29.358  -3.501  -20.336 1.00 65.55  ? 372  ASP B N   1 
ATOM   6949 C  CA  . ASP B  1 372 ? 28.888  -4.076  -19.079 1.00 69.41  ? 372  ASP B CA  1 
ATOM   6950 C  C   . ASP B  1 372 ? 28.397  -2.977  -18.143 1.00 61.96  ? 372  ASP B C   1 
ATOM   6951 O  O   . ASP B  1 372 ? 27.304  -3.070  -17.579 1.00 56.70  ? 372  ASP B O   1 
ATOM   6952 C  CB  . ASP B  1 372 ? 29.998  -4.884  -18.398 1.00 82.93  ? 372  ASP B CB  1 
ATOM   6953 C  CG  . ASP B  1 372 ? 30.395  -6.117  -19.188 1.00 98.26  ? 372  ASP B CG  1 
ATOM   6954 O  OD1 . ASP B  1 372 ? 29.736  -7.166  -19.026 1.00 99.20  ? 372  ASP B OD1 1 
ATOM   6955 O  OD2 . ASP B  1 372 ? 31.370  -6.039  -19.964 1.00 106.88 ? 372  ASP B OD2 1 
ATOM   6956 N  N   . LEU B  1 373 ? 29.205  -1.928  -18.002 1.00 58.94  ? 373  LEU B N   1 
ATOM   6957 C  CA  . LEU B  1 373 ? 28.895  -0.820  -17.101 1.00 57.12  ? 373  LEU B CA  1 
ATOM   6958 C  C   . LEU B  1 373 ? 27.650  -0.051  -17.538 1.00 58.83  ? 373  LEU B C   1 
ATOM   6959 O  O   . LEU B  1 373 ? 26.831  0.341   -16.706 1.00 59.90  ? 373  LEU B O   1 
ATOM   6960 C  CB  . LEU B  1 373 ? 30.096  0.127   -16.993 1.00 54.42  ? 373  LEU B CB  1 
ATOM   6961 C  CG  . LEU B  1 373 ? 29.964  1.328   -16.053 1.00 53.83  ? 373  LEU B CG  1 
ATOM   6962 C  CD1 . LEU B  1 373 ? 29.502  0.884   -14.677 1.00 45.19  ? 373  LEU B CD1 1 
ATOM   6963 C  CD2 . LEU B  1 373 ? 31.281  2.074   -15.950 1.00 54.52  ? 373  LEU B CD2 1 
ATOM   6964 N  N   . ALA B  1 374 ? 27.513  0.157   -18.844 1.00 58.90  ? 374  ALA B N   1 
ATOM   6965 C  CA  . ALA B  1 374 ? 26.383  0.902   -19.393 1.00 55.40  ? 374  ALA B CA  1 
ATOM   6966 C  C   . ALA B  1 374 ? 25.069  0.145   -19.227 1.00 48.56  ? 374  ALA B C   1 
ATOM   6967 O  O   . ALA B  1 374 ? 24.026  0.738   -18.944 1.00 49.06  ? 374  ALA B O   1 
ATOM   6968 C  CB  . ALA B  1 374 ? 26.628  1.230   -20.858 1.00 55.53  ? 374  ALA B CB  1 
ATOM   6969 N  N   . ALA B  1 375 ? 25.124  -1.166  -19.421 1.00 40.10  ? 375  ALA B N   1 
ATOM   6970 C  CA  . ALA B  1 375 ? 23.963  -2.016  -19.198 1.00 46.11  ? 375  ALA B CA  1 
ATOM   6971 C  C   . ALA B  1 375 ? 23.585  -2.024  -17.721 1.00 54.45  ? 375  ALA B C   1 
ATOM   6972 O  O   . ALA B  1 375 ? 22.406  -2.082  -17.371 1.00 57.71  ? 375  ALA B O   1 
ATOM   6973 C  CB  . ALA B  1 375 ? 24.244  -3.417  -19.678 1.00 43.79  ? 375  ALA B CB  1 
ATOM   6974 N  N   . GLU B  1 376 ? 24.593  -1.981  -16.856 1.00 54.21  ? 376  GLU B N   1 
ATOM   6975 C  CA  . GLU B  1 376 ? 24.356  -1.903  -15.422 1.00 58.39  ? 376  GLU B CA  1 
ATOM   6976 C  C   . GLU B  1 376 ? 23.619  -0.607  -15.088 1.00 51.26  ? 376  GLU B C   1 
ATOM   6977 O  O   . GLU B  1 376 ? 22.639  -0.613  -14.343 1.00 44.25  ? 376  GLU B O   1 
ATOM   6978 C  CB  . GLU B  1 376 ? 25.681  -1.973  -14.661 1.00 70.39  ? 376  GLU B CB  1 
ATOM   6979 C  CG  . GLU B  1 376 ? 25.540  -2.427  -13.222 1.00 86.65  ? 376  GLU B CG  1 
ATOM   6980 C  CD  . GLU B  1 376 ? 24.991  -3.837  -13.115 1.00 100.27 ? 376  GLU B CD  1 
ATOM   6981 O  OE1 . GLU B  1 376 ? 25.626  -4.768  -13.654 1.00 105.07 ? 376  GLU B OE1 1 
ATOM   6982 O  OE2 . GLU B  1 376 ? 23.918  -4.012  -12.500 1.00 101.48 ? 376  GLU B OE2 1 
ATOM   6983 N  N   . ALA B  1 377 ? 24.091  0.500   -15.656 1.00 43.00  ? 377  ALA B N   1 
ATOM   6984 C  CA  . ALA B  1 377 ? 23.463  1.805   -15.457 1.00 43.00  ? 377  ALA B CA  1 
ATOM   6985 C  C   . ALA B  1 377 ? 21.991  1.801   -15.868 1.00 47.77  ? 377  ALA B C   1 
ATOM   6986 O  O   . ALA B  1 377 ? 21.151  2.426   -15.215 1.00 49.14  ? 377  ALA B O   1 
ATOM   6987 C  CB  . ALA B  1 377 ? 24.217  2.869   -16.232 1.00 37.70  ? 377  ALA B CB  1 
ATOM   6988 N  N   . VAL B  1 378 ? 21.693  1.107   -16.964 1.00 48.84  ? 378  VAL B N   1 
ATOM   6989 C  CA  . VAL B  1 378 ? 20.325  0.981   -17.456 1.00 43.72  ? 378  VAL B CA  1 
ATOM   6990 C  C   . VAL B  1 378 ? 19.444  0.191   -16.488 1.00 44.53  ? 378  VAL B C   1 
ATOM   6991 O  O   . VAL B  1 378 ? 18.333  0.614   -16.156 1.00 47.17  ? 378  VAL B O   1 
ATOM   6992 C  CB  . VAL B  1 378 ? 20.292  0.324   -18.851 1.00 36.79  ? 378  VAL B CB  1 
ATOM   6993 C  CG1 . VAL B  1 378 ? 18.887  -0.138  -19.195 1.00 30.24  ? 378  VAL B CG1 1 
ATOM   6994 C  CG2 . VAL B  1 378 ? 20.805  1.296   -19.902 1.00 37.05  ? 378  VAL B CG2 1 
ATOM   6995 N  N   . VAL B  1 379 ? 19.946  -0.955  -16.037 1.00 40.65  ? 379  VAL B N   1 
ATOM   6996 C  CA  . VAL B  1 379 ? 19.226  -1.791  -15.084 1.00 49.16  ? 379  VAL B CA  1 
ATOM   6997 C  C   . VAL B  1 379 ? 18.909  -1.040  -13.788 1.00 46.49  ? 379  VAL B C   1 
ATOM   6998 O  O   . VAL B  1 379 ? 17.782  -1.088  -13.289 1.00 44.79  ? 379  VAL B O   1 
ATOM   6999 C  CB  . VAL B  1 379 ? 20.029  -3.060  -14.749 1.00 50.01  ? 379  VAL B CB  1 
ATOM   7000 C  CG1 . VAL B  1 379 ? 19.428  -3.766  -13.548 1.00 41.32  ? 379  VAL B CG1 1 
ATOM   7001 C  CG2 . VAL B  1 379 ? 20.085  -3.992  -15.954 1.00 43.71  ? 379  VAL B CG2 1 
ATOM   7002 N  N   . LEU B  1 380 ? 19.906  -0.339  -13.259 1.00 41.28  ? 380  LEU B N   1 
ATOM   7003 C  CA  . LEU B  1 380 ? 19.763  0.381   -11.997 1.00 51.03  ? 380  LEU B CA  1 
ATOM   7004 C  C   . LEU B  1 380 ? 18.842  1.598   -12.126 1.00 52.55  ? 380  LEU B C   1 
ATOM   7005 O  O   . LEU B  1 380 ? 18.176  1.987   -11.166 1.00 49.77  ? 380  LEU B O   1 
ATOM   7006 C  CB  . LEU B  1 380 ? 21.140  0.783   -11.458 1.00 51.58  ? 380  LEU B CB  1 
ATOM   7007 C  CG  . LEU B  1 380 ? 22.101  -0.392  -11.241 1.00 57.50  ? 380  LEU B CG  1 
ATOM   7008 C  CD1 . LEU B  1 380 ? 23.412  0.054   -10.626 1.00 63.41  ? 380  LEU B CD1 1 
ATOM   7009 C  CD2 . LEU B  1 380 ? 21.463  -1.473  -10.389 1.00 55.94  ? 380  LEU B CD2 1 
ATOM   7010 N  N   . HIS B  1 381 ? 18.798  2.187   -13.317 1.00 44.75  ? 381  HIS B N   1 
ATOM   7011 C  CA  . HIS B  1 381 ? 17.902  3.311   -13.575 1.00 40.81  ? 381  HIS B CA  1 
ATOM   7012 C  C   . HIS B  1 381 ? 16.451  2.847   -13.712 1.00 39.21  ? 381  HIS B C   1 
ATOM   7013 O  O   . HIS B  1 381 ? 15.528  3.532   -13.272 1.00 46.92  ? 381  HIS B O   1 
ATOM   7014 C  CB  . HIS B  1 381 ? 18.328  4.055   -14.843 1.00 43.19  ? 381  HIS B CB  1 
ATOM   7015 C  CG  . HIS B  1 381 ? 17.477  5.247   -15.160 1.00 44.93  ? 381  HIS B CG  1 
ATOM   7016 N  ND1 . HIS B  1 381 ? 17.795  6.521   -14.734 1.00 49.17  ? 381  HIS B ND1 1 
ATOM   7017 C  CD2 . HIS B  1 381 ? 16.324  5.359   -15.857 1.00 47.15  ? 381  HIS B CD2 1 
ATOM   7018 C  CE1 . HIS B  1 381 ? 16.871  7.364   -15.156 1.00 51.11  ? 381  HIS B CE1 1 
ATOM   7019 N  NE2 . HIS B  1 381 ? 15.965  6.688   -15.839 1.00 54.77  ? 381  HIS B NE2 1 
ATOM   7020 N  N   . TYR B  1 382 ? 16.255  1.680   -14.319 1.00 30.40  ? 382  TYR B N   1 
ATOM   7021 C  CA  . TYR B  1 382 ? 14.907  1.191   -14.619 1.00 39.35  ? 382  TYR B CA  1 
ATOM   7022 C  C   . TYR B  1 382 ? 14.286  0.291   -13.550 1.00 39.27  ? 382  TYR B C   1 
ATOM   7023 O  O   . TYR B  1 382 ? 13.071  0.079   -13.542 1.00 38.66  ? 382  TYR B O   1 
ATOM   7024 C  CB  . TYR B  1 382 ? 14.870  0.506   -15.987 1.00 34.12  ? 382  TYR B CB  1 
ATOM   7025 C  CG  . TYR B  1 382 ? 14.714  1.479   -17.130 1.00 38.72  ? 382  TYR B CG  1 
ATOM   7026 C  CD1 . TYR B  1 382 ? 15.822  2.061   -17.730 1.00 41.44  ? 382  TYR B CD1 1 
ATOM   7027 C  CD2 . TYR B  1 382 ? 13.455  1.821   -17.605 1.00 43.67  ? 382  TYR B CD2 1 
ATOM   7028 C  CE1 . TYR B  1 382 ? 15.681  2.951   -18.776 1.00 47.72  ? 382  TYR B CE1 1 
ATOM   7029 C  CE2 . TYR B  1 382 ? 13.304  2.711   -18.648 1.00 43.42  ? 382  TYR B CE2 1 
ATOM   7030 C  CZ  . TYR B  1 382 ? 14.421  3.271   -19.230 1.00 46.90  ? 382  TYR B CZ  1 
ATOM   7031 O  OH  . TYR B  1 382 ? 14.274  4.159   -20.271 1.00 45.74  ? 382  TYR B OH  1 
ATOM   7032 N  N   . THR B  1 383 ? 15.110  -0.235  -12.653 1.00 43.28  ? 383  THR B N   1 
ATOM   7033 C  CA  . THR B  1 383 ? 14.593  -0.991  -11.520 1.00 48.67  ? 383  THR B CA  1 
ATOM   7034 C  C   . THR B  1 383 ? 13.787  -0.073  -10.596 1.00 43.63  ? 383  THR B C   1 
ATOM   7035 O  O   . THR B  1 383 ? 14.221  1.041   -10.288 1.00 45.78  ? 383  THR B O   1 
ATOM   7036 C  CB  . THR B  1 383 ? 15.739  -1.652  -10.726 1.00 51.09  ? 383  THR B CB  1 
ATOM   7037 O  OG1 . THR B  1 383 ? 16.363  -2.658  -11.535 1.00 44.69  ? 383  THR B OG1 1 
ATOM   7038 C  CG2 . THR B  1 383 ? 15.215  -2.290  -9.444  1.00 45.79  ? 383  THR B CG2 1 
ATOM   7039 N  N   . ASP B  1 384 ? 12.604  -0.524  -10.185 1.00 44.59  ? 384  ASP B N   1 
ATOM   7040 C  CA  . ASP B  1 384 ? 11.858  0.142   -9.121  1.00 56.50  ? 384  ASP B CA  1 
ATOM   7041 C  C   . ASP B  1 384 ? 12.374  -0.435  -7.809  1.00 53.95  ? 384  ASP B C   1 
ATOM   7042 O  O   . ASP B  1 384 ? 12.085  -1.579  -7.475  1.00 48.30  ? 384  ASP B O   1 
ATOM   7043 C  CB  . ASP B  1 384 ? 10.354  -0.119  -9.265  1.00 60.15  ? 384  ASP B CB  1 
ATOM   7044 C  CG  . ASP B  1 384 ? 9.511   0.717   -8.312  1.00 66.74  ? 384  ASP B CG  1 
ATOM   7045 O  OD1 . ASP B  1 384 ? 10.060  1.268   -7.331  1.00 69.86  ? 384  ASP B OD1 1 
ATOM   7046 O  OD2 . ASP B  1 384 ? 8.286   0.814   -8.538  1.00 68.02  ? 384  ASP B OD2 1 
ATOM   7047 N  N   . TRP B  1 385 ? 13.145  0.346   -7.065  1.00 48.99  ? 385  TRP B N   1 
ATOM   7048 C  CA  . TRP B  1 385 ? 13.782  -0.175  -5.858  1.00 57.61  ? 385  TRP B CA  1 
ATOM   7049 C  C   . TRP B  1 385 ? 12.817  -0.384  -4.693  1.00 62.42  ? 385  TRP B C   1 
ATOM   7050 O  O   . TRP B  1 385 ? 13.199  -0.898  -3.643  1.00 63.26  ? 385  TRP B O   1 
ATOM   7051 C  CB  . TRP B  1 385 ? 14.995  0.685   -5.491  1.00 55.16  ? 385  TRP B CB  1 
ATOM   7052 C  CG  . TRP B  1 385 ? 16.013  0.553   -6.561  1.00 57.15  ? 385  TRP B CG  1 
ATOM   7053 C  CD1 . TRP B  1 385 ? 16.274  1.433   -7.573  1.00 52.40  ? 385  TRP B CD1 1 
ATOM   7054 C  CD2 . TRP B  1 385 ? 16.855  -0.579  -6.785  1.00 53.66  ? 385  TRP B CD2 1 
ATOM   7055 N  NE1 . TRP B  1 385 ? 17.256  0.928   -8.394  1.00 40.95  ? 385  TRP B NE1 1 
ATOM   7056 C  CE2 . TRP B  1 385 ? 17.628  -0.308  -7.930  1.00 49.30  ? 385  TRP B CE2 1 
ATOM   7057 C  CE3 . TRP B  1 385 ? 17.041  -1.792  -6.116  1.00 46.26  ? 385  TRP B CE3 1 
ATOM   7058 C  CZ2 . TRP B  1 385 ? 18.575  -1.211  -8.418  1.00 49.83  ? 385  TRP B CZ2 1 
ATOM   7059 C  CZ3 . TRP B  1 385 ? 17.978  -2.682  -6.601  1.00 50.10  ? 385  TRP B CZ3 1 
ATOM   7060 C  CH2 . TRP B  1 385 ? 18.733  -2.390  -7.739  1.00 49.54  ? 385  TRP B CH2 1 
ATOM   7061 N  N   . LEU B  1 386 ? 11.560  -0.002  -4.896  1.00 69.88  ? 386  LEU B N   1 
ATOM   7062 C  CA  . LEU B  1 386 ? 10.500  -0.324  -3.946  1.00 74.49  ? 386  LEU B CA  1 
ATOM   7063 C  C   . LEU B  1 386 ? 10.010  -1.753  -4.193  1.00 70.55  ? 386  LEU B C   1 
ATOM   7064 O  O   . LEU B  1 386 ? 9.612   -2.456  -3.262  1.00 69.70  ? 386  LEU B O   1 
ATOM   7065 C  CB  . LEU B  1 386 ? 9.351   0.683   -4.071  1.00 77.34  ? 386  LEU B CB  1 
ATOM   7066 C  CG  . LEU B  1 386 ? 9.672   2.113   -3.625  1.00 78.17  ? 386  LEU B CG  1 
ATOM   7067 C  CD1 . LEU B  1 386 ? 8.687   3.128   -4.192  1.00 70.79  ? 386  LEU B CD1 1 
ATOM   7068 C  CD2 . LEU B  1 386 ? 9.684   2.182   -2.113  1.00 79.58  ? 386  LEU B CD2 1 
ATOM   7069 N  N   . HIS B  1 387 ? 10.057  -2.171  -5.456  1.00 68.85  ? 387  HIS B N   1 
ATOM   7070 C  CA  . HIS B  1 387 ? 9.682   -3.527  -5.853  1.00 68.73  ? 387  HIS B CA  1 
ATOM   7071 C  C   . HIS B  1 387 ? 10.690  -4.070  -6.872  1.00 65.90  ? 387  HIS B C   1 
ATOM   7072 O  O   . HIS B  1 387 ? 10.349  -4.265  -8.040  1.00 69.56  ? 387  HIS B O   1 
ATOM   7073 C  CB  . HIS B  1 387 ? 8.272   -3.532  -6.459  1.00 71.72  ? 387  HIS B CB  1 
ATOM   7074 C  CG  . HIS B  1 387 ? 7.299   -2.634  -5.751  1.00 76.94  ? 387  HIS B CG  1 
ATOM   7075 N  ND1 . HIS B  1 387 ? 7.209   -1.284  -6.010  1.00 78.78  ? 387  HIS B ND1 1 
ATOM   7076 C  CD2 . HIS B  1 387 ? 6.372   -2.897  -4.798  1.00 81.14  ? 387  HIS B CD2 1 
ATOM   7077 C  CE1 . HIS B  1 387 ? 6.271   -0.751  -5.245  1.00 77.27  ? 387  HIS B CE1 1 
ATOM   7078 N  NE2 . HIS B  1 387 ? 5.749   -1.709  -4.501  1.00 81.92  ? 387  HIS B NE2 1 
ATOM   7079 N  N   . PRO B  1 388 ? 11.937  -4.323  -6.431  1.00 60.52  ? 388  PRO B N   1 
ATOM   7080 C  CA  . PRO B  1 388 ? 13.033  -4.622  -7.365  1.00 56.78  ? 388  PRO B CA  1 
ATOM   7081 C  C   . PRO B  1 388 ? 12.956  -5.997  -8.025  1.00 59.88  ? 388  PRO B C   1 
ATOM   7082 O  O   . PRO B  1 388 ? 13.708  -6.254  -8.970  1.00 66.01  ? 388  PRO B O   1 
ATOM   7083 C  CB  . PRO B  1 388 ? 14.282  -4.535  -6.479  1.00 60.47  ? 388  PRO B CB  1 
ATOM   7084 C  CG  . PRO B  1 388 ? 13.798  -4.853  -5.107  1.00 53.96  ? 388  PRO B CG  1 
ATOM   7085 C  CD  . PRO B  1 388 ? 12.391  -4.319  -5.026  1.00 54.51  ? 388  PRO B CD  1 
ATOM   7086 N  N   . GLU B  1 389 ? 12.071  -6.863  -7.542  1.00 62.03  ? 389  GLU B N   1 
ATOM   7087 C  CA  . GLU B  1 389 ? 11.963  -8.210  -8.098  1.00 60.06  ? 389  GLU B CA  1 
ATOM   7088 C  C   . GLU B  1 389 ? 10.555  -8.567  -8.571  1.00 54.61  ? 389  GLU B C   1 
ATOM   7089 O  O   . GLU B  1 389 ? 10.308  -9.696  -9.006  1.00 56.18  ? 389  GLU B O   1 
ATOM   7090 C  CB  . GLU B  1 389 ? 12.478  -9.251  -7.098  1.00 60.46  ? 389  GLU B CB  1 
ATOM   7091 C  CG  . GLU B  1 389 ? 13.906  -8.997  -6.638  1.00 72.29  ? 389  GLU B CG  1 
ATOM   7092 C  CD  . GLU B  1 389 ? 14.701  -10.273 -6.436  1.00 87.15  ? 389  GLU B CD  1 
ATOM   7093 O  OE1 . GLU B  1 389 ? 14.683  -10.814 -5.311  1.00 94.23  ? 389  GLU B OE1 1 
ATOM   7094 O  OE2 . GLU B  1 389 ? 15.352  -10.729 -7.401  1.00 87.26  ? 389  GLU B OE2 1 
ATOM   7095 N  N   . ASP B  1 390 ? 9.639   -7.605  -8.488  1.00 41.97  ? 390  ASP B N   1 
ATOM   7096 C  CA  . ASP B  1 390 ? 8.278   -7.796  -8.982  1.00 47.37  ? 390  ASP B CA  1 
ATOM   7097 C  C   . ASP B  1 390 ? 8.276   -8.023  -10.491 1.00 55.91  ? 390  ASP B C   1 
ATOM   7098 O  O   . ASP B  1 390 ? 8.615   -7.119  -11.256 1.00 48.57  ? 390  ASP B O   1 
ATOM   7099 C  CB  . ASP B  1 390 ? 7.416   -6.579  -8.641  1.00 47.04  ? 390  ASP B CB  1 
ATOM   7100 C  CG  . ASP B  1 390 ? 6.001   -6.700  -9.166  1.00 63.46  ? 390  ASP B CG  1 
ATOM   7101 O  OD1 . ASP B  1 390 ? 5.425   -7.809  -9.099  1.00 73.84  ? 390  ASP B OD1 1 
ATOM   7102 O  OD2 . ASP B  1 390 ? 5.463   -5.684  -9.647  1.00 64.90  ? 390  ASP B OD2 1 
ATOM   7103 N  N   . PRO B  1 391 ? 7.889   -9.236  -10.920 1.00 63.15  ? 391  PRO B N   1 
ATOM   7104 C  CA  . PRO B  1 391 ? 7.891   -9.630  -12.334 1.00 63.46  ? 391  PRO B CA  1 
ATOM   7105 C  C   . PRO B  1 391 ? 7.055   -8.715  -13.227 1.00 65.50  ? 391  PRO B C   1 
ATOM   7106 O  O   . PRO B  1 391 ? 7.454   -8.464  -14.365 1.00 69.59  ? 391  PRO B O   1 
ATOM   7107 C  CB  . PRO B  1 391 ? 7.301   -11.049 -12.308 1.00 64.35  ? 391  PRO B CB  1 
ATOM   7108 C  CG  . PRO B  1 391 ? 6.600   -11.163 -10.991 1.00 65.65  ? 391  PRO B CG  1 
ATOM   7109 C  CD  . PRO B  1 391 ? 7.385   -10.313 -10.050 1.00 59.75  ? 391  PRO B CD  1 
ATOM   7110 N  N   . THR B  1 392 ? 5.923   -8.231  -12.725 1.00 61.15  ? 392  THR B N   1 
ATOM   7111 C  CA  . THR B  1 392 ? 5.083   -7.301  -13.481 1.00 59.09  ? 392  THR B CA  1 
ATOM   7112 C  C   . THR B  1 392 ? 5.850   -6.023  -13.821 1.00 61.21  ? 392  THR B C   1 
ATOM   7113 O  O   . THR B  1 392 ? 5.801   -5.540  -14.954 1.00 63.34  ? 392  THR B O   1 
ATOM   7114 C  CB  . THR B  1 392 ? 3.792   -6.952  -12.703 1.00 57.97  ? 392  THR B CB  1 
ATOM   7115 O  OG1 . THR B  1 392 ? 2.962   -8.117  -12.597 1.00 67.20  ? 392  THR B OG1 1 
ATOM   7116 C  CG2 . THR B  1 392 ? 3.014   -5.856  -13.409 1.00 47.45  ? 392  THR B CG2 1 
ATOM   7117 N  N   A HIS B  1 393 ? 6.560   -5.498  -12.825 0.59 62.83  ? 393  HIS B N   1 
ATOM   7118 N  N   B HIS B  1 393 ? 6.574   -5.477  -12.851 0.41 62.45  ? 393  HIS B N   1 
ATOM   7119 C  CA  A HIS B  1 393 ? 7.372   -4.293  -12.971 0.59 60.48  ? 393  HIS B CA  1 
ATOM   7120 C  CA  B HIS B  1 393 ? 7.332   -4.261  -13.116 0.41 59.55  ? 393  HIS B CA  1 
ATOM   7121 C  C   A HIS B  1 393 ? 8.578   -4.527  -13.873 0.59 54.67  ? 393  HIS B C   1 
ATOM   7122 C  C   B HIS B  1 393 ? 8.582   -4.535  -13.939 0.41 53.78  ? 393  HIS B C   1 
ATOM   7123 O  O   A HIS B  1 393 ? 8.953   -3.659  -14.659 0.59 52.86  ? 393  HIS B O   1 
ATOM   7124 O  O   B HIS B  1 393 ? 8.998   -3.694  -14.736 0.41 53.38  ? 393  HIS B O   1 
ATOM   7125 C  CB  A HIS B  1 393 ? 7.848   -3.802  -11.597 0.59 58.15  ? 393  HIS B CB  1 
ATOM   7126 C  CB  B HIS B  1 393 ? 7.706   -3.523  -11.833 0.41 60.57  ? 393  HIS B CB  1 
ATOM   7127 C  CG  A HIS B  1 393 ? 6.806   -3.065  -10.821 0.59 58.86  ? 393  HIS B CG  1 
ATOM   7128 C  CG  B HIS B  1 393 ? 8.545   -2.308  -12.077 0.41 66.66  ? 393  HIS B CG  1 
ATOM   7129 N  ND1 A HIS B  1 393 ? 5.572   -3.602  -10.518 0.59 59.79  ? 393  HIS B ND1 1 
ATOM   7130 N  ND1 B HIS B  1 393 ? 8.012   -1.110  -12.502 0.41 69.66  ? 393  HIS B ND1 1 
ATOM   7131 C  CD2 A HIS B  1 393 ? 6.809   -1.822  -10.273 0.59 58.04  ? 393  HIS B CD2 1 
ATOM   7132 C  CD2 B HIS B  1 393 ? 9.883   -2.119  -12.000 0.41 67.25  ? 393  HIS B CD2 1 
ATOM   7133 C  CE1 A HIS B  1 393 ? 4.863   -2.730  -9.829  0.59 55.47  ? 393  HIS B CE1 1 
ATOM   7134 C  CE1 B HIS B  1 393 ? 8.984   -0.229  -12.656 0.41 67.82  ? 393  HIS B CE1 1 
ATOM   7135 N  NE2 A HIS B  1 393 ? 5.597   -1.638  -9.665  0.59 55.82  ? 393  HIS B NE2 1 
ATOM   7136 N  NE2 B HIS B  1 393 ? 10.130  -0.816  -12.360 0.41 67.58  ? 393  HIS B NE2 1 
ATOM   7137 N  N   . LEU B  1 394 ? 9.188   -5.701  -13.742 1.00 49.85  ? 394  LEU B N   1 
ATOM   7138 C  CA  . LEU B  1 394 ? 10.345  -6.074  -14.547 1.00 55.20  ? 394  LEU B CA  1 
ATOM   7139 C  C   . LEU B  1 394 ? 9.952   -6.207  -16.017 1.00 52.76  ? 394  LEU B C   1 
ATOM   7140 O  O   . LEU B  1 394 ? 10.728  -5.857  -16.904 1.00 43.69  ? 394  LEU B O   1 
ATOM   7141 C  CB  . LEU B  1 394 ? 10.978  -7.364  -14.019 1.00 46.10  ? 394  LEU B CB  1 
ATOM   7142 C  CG  . LEU B  1 394 ? 11.636  -7.174  -12.651 1.00 48.41  ? 394  LEU B CG  1 
ATOM   7143 C  CD1 . LEU B  1 394 ? 12.193  -8.477  -12.103 1.00 48.87  ? 394  LEU B CD1 1 
ATOM   7144 C  CD2 . LEU B  1 394 ? 12.725  -6.123  -12.758 1.00 39.28  ? 394  LEU B CD2 1 
ATOM   7145 N  N   . ARG B  1 395 ? 8.734   -6.688  -16.258 1.00 53.33  ? 395  ARG B N   1 
ATOM   7146 C  CA  . ARG B  1 395 ? 8.185   -6.805  -17.608 1.00 58.73  ? 395  ARG B CA  1 
ATOM   7147 C  C   . ARG B  1 395 ? 7.949   -5.424  -18.219 1.00 58.07  ? 395  ARG B C   1 
ATOM   7148 O  O   . ARG B  1 395 ? 8.435   -5.126  -19.313 1.00 50.63  ? 395  ARG B O   1 
ATOM   7149 C  CB  . ARG B  1 395 ? 6.879   -7.614  -17.580 1.00 54.83  ? 395  ARG B CB  1 
ATOM   7150 C  CG  . ARG B  1 395 ? 6.184   -7.745  -18.930 1.00 51.74  ? 395  ARG B CG  1 
ATOM   7151 C  CD  . ARG B  1 395 ? 4.879   -6.970  -18.953 1.00 55.35  ? 395  ARG B CD  1 
ATOM   7152 N  NE  . ARG B  1 395 ? 3.763   -7.719  -18.378 1.00 50.13  ? 395  ARG B NE  1 
ATOM   7153 C  CZ  . ARG B  1 395 ? 2.700   -7.154  -17.810 1.00 51.86  ? 395  ARG B CZ  1 
ATOM   7154 N  NH1 . ARG B  1 395 ? 2.614   -5.834  -17.727 1.00 45.63  ? 395  ARG B NH1 1 
ATOM   7155 N  NH2 . ARG B  1 395 ? 1.726   -7.907  -17.320 1.00 53.65  ? 395  ARG B NH2 1 
ATOM   7156 N  N   . ASP B  1 396 ? 7.213   -4.583  -17.497 1.00 53.14  ? 396  ASP B N   1 
ATOM   7157 C  CA  . ASP B  1 396 ? 6.870   -3.242  -17.970 1.00 45.96  ? 396  ASP B CA  1 
ATOM   7158 C  C   . ASP B  1 396 ? 8.103   -2.360  -18.204 1.00 47.44  ? 396  ASP B C   1 
ATOM   7159 O  O   . ASP B  1 396 ? 8.087   -1.474  -19.061 1.00 51.99  ? 396  ASP B O   1 
ATOM   7160 C  CB  . ASP B  1 396 ? 5.909   -2.564  -16.981 1.00 47.20  ? 396  ASP B CB  1 
ATOM   7161 C  CG  . ASP B  1 396 ? 4.480   -3.081  -17.097 1.00 60.28  ? 396  ASP B CG  1 
ATOM   7162 O  OD1 . ASP B  1 396 ? 4.249   -4.057  -17.840 1.00 57.91  ? 396  ASP B OD1 1 
ATOM   7163 O  OD2 . ASP B  1 396 ? 3.590   -2.509  -16.431 1.00 64.53  ? 396  ASP B OD2 1 
ATOM   7164 N  N   . ALA B  1 397 ? 9.169   -2.607  -17.445 1.00 41.75  ? 397  ALA B N   1 
ATOM   7165 C  CA  . ALA B  1 397 ? 10.404  -1.832  -17.579 1.00 40.46  ? 397  ALA B CA  1 
ATOM   7166 C  C   . ALA B  1 397 ? 11.253  -2.283  -18.766 1.00 44.14  ? 397  ALA B C   1 
ATOM   7167 O  O   . ALA B  1 397 ? 11.927  -1.464  -19.394 1.00 44.25  ? 397  ALA B O   1 
ATOM   7168 C  CB  . ALA B  1 397 ? 11.219  -1.891  -16.292 1.00 26.14  ? 397  ALA B CB  1 
ATOM   7169 N  N   . MET B  1 398 ? 11.237  -3.580  -19.062 1.00 43.75  ? 398  MET B N   1 
ATOM   7170 C  CA  . MET B  1 398 ? 11.966  -4.088  -20.218 1.00 45.27  ? 398  MET B CA  1 
ATOM   7171 C  C   . MET B  1 398 ? 11.420  -3.424  -21.474 1.00 40.42  ? 398  MET B C   1 
ATOM   7172 O  O   . MET B  1 398 ? 12.176  -2.995  -22.349 1.00 33.28  ? 398  MET B O   1 
ATOM   7173 C  CB  . MET B  1 398 ? 11.833  -5.609  -20.326 1.00 46.81  ? 398  MET B CB  1 
ATOM   7174 C  CG  . MET B  1 398 ? 12.668  -6.227  -21.439 1.00 45.16  ? 398  MET B CG  1 
ATOM   7175 S  SD  . MET B  1 398 ? 14.434  -6.239  -21.064 1.00 58.28  ? 398  MET B SD  1 
ATOM   7176 C  CE  . MET B  1 398 ? 15.001  -4.771  -21.922 1.00 64.07  ? 398  MET B CE  1 
ATOM   7177 N  N   . SER B  1 399 ? 10.095  -3.335  -21.541 1.00 34.04  ? 399  SER B N   1 
ATOM   7178 C  CA  . SER B  1 399 ? 9.400   -2.659  -22.630 1.00 41.65  ? 399  SER B CA  1 
ATOM   7179 C  C   . SER B  1 399 ? 9.745   -1.174  -22.668 1.00 42.64  ? 399  SER B C   1 
ATOM   7180 O  O   . SER B  1 399 ? 9.901   -0.588  -23.741 1.00 42.02  ? 399  SER B O   1 
ATOM   7181 C  CB  . SER B  1 399 ? 7.894   -2.839  -22.450 1.00 46.87  ? 399  SER B CB  1 
ATOM   7182 O  OG  . SER B  1 399 ? 7.173   -1.936  -23.268 1.00 42.80  ? 399  SER B OG  1 
ATOM   7183 N  N   . ALA B  1 400 ? 9.866   -0.572  -21.488 1.00 43.89  ? 400  ALA B N   1 
ATOM   7184 C  CA  . ALA B  1 400 ? 10.209  0.843   -21.382 1.00 38.91  ? 400  ALA B CA  1 
ATOM   7185 C  C   . ALA B  1 400 ? 11.642  1.123   -21.833 1.00 36.15  ? 400  ALA B C   1 
ATOM   7186 O  O   . ALA B  1 400 ? 11.884  2.086   -22.564 1.00 44.49  ? 400  ALA B O   1 
ATOM   7187 C  CB  . ALA B  1 400 ? 9.989   1.340   -19.964 1.00 36.51  ? 400  ALA B CB  1 
ATOM   7188 N  N   . VAL B  1 401 ? 12.584  0.291   -21.387 1.00 35.81  ? 401  VAL B N   1 
ATOM   7189 C  CA  . VAL B  1 401 ? 13.975  0.383   -21.837 1.00 37.81  ? 401  VAL B CA  1 
ATOM   7190 C  C   . VAL B  1 401 ? 14.063  0.401   -23.362 1.00 42.55  ? 401  VAL B C   1 
ATOM   7191 O  O   . VAL B  1 401 ? 14.728  1.260   -23.948 1.00 35.94  ? 401  VAL B O   1 
ATOM   7192 C  CB  . VAL B  1 401 ? 14.831  -0.788  -21.307 1.00 37.98  ? 401  VAL B CB  1 
ATOM   7193 C  CG1 . VAL B  1 401 ? 16.155  -0.858  -22.055 1.00 32.51  ? 401  VAL B CG1 1 
ATOM   7194 C  CG2 . VAL B  1 401 ? 15.077  -0.641  -19.813 1.00 36.26  ? 401  VAL B CG2 1 
ATOM   7195 N  N   . VAL B  1 402 ? 13.376  -0.544  -23.997 1.00 42.07  ? 402  VAL B N   1 
ATOM   7196 C  CA  . VAL B  1 402 ? 13.400  -0.676  -25.451 1.00 43.02  ? 402  VAL B CA  1 
ATOM   7197 C  C   . VAL B  1 402 ? 12.731  0.509   -26.147 1.00 46.23  ? 402  VAL B C   1 
ATOM   7198 O  O   . VAL B  1 402 ? 13.280  1.066   -27.101 1.00 36.29  ? 402  VAL B O   1 
ATOM   7199 C  CB  . VAL B  1 402 ? 12.737  -1.999  -25.898 1.00 41.48  ? 402  VAL B CB  1 
ATOM   7200 C  CG1 . VAL B  1 402 ? 12.514  -2.014  -27.400 1.00 36.82  ? 402  VAL B CG1 1 
ATOM   7201 C  CG2 . VAL B  1 402 ? 13.591  -3.182  -25.476 1.00 36.17  ? 402  VAL B CG2 1 
ATOM   7202 N  N   . GLY B  1 403 ? 11.554  0.894   -25.659 1.00 45.31  ? 403  GLY B N   1 
ATOM   7203 C  CA  . GLY B  1 403 ? 10.796  1.991   -26.242 1.00 39.10  ? 403  GLY B CA  1 
ATOM   7204 C  C   . GLY B  1 403 ? 11.468  3.349   -26.120 1.00 46.16  ? 403  GLY B C   1 
ATOM   7205 O  O   . GLY B  1 403 ? 11.439  4.151   -27.062 1.00 44.72  ? 403  GLY B O   1 
ATOM   7206 N  N   . ASP B  1 404 ? 12.067  3.610   -24.960 1.00 39.68  ? 404  ASP B N   1 
ATOM   7207 C  CA  . ASP B  1 404 ? 12.737  4.882   -24.711 1.00 38.42  ? 404  ASP B CA  1 
ATOM   7208 C  C   . ASP B  1 404 ? 14.054  4.980   -25.481 1.00 35.96  ? 404  ASP B C   1 
ATOM   7209 O  O   . ASP B  1 404 ? 14.350  6.006   -26.090 1.00 40.86  ? 404  ASP B O   1 
ATOM   7210 C  CB  . ASP B  1 404 ? 13.008  5.072   -23.215 1.00 41.86  ? 404  ASP B CB  1 
ATOM   7211 C  CG  . ASP B  1 404 ? 11.741  5.114   -22.385 1.00 42.95  ? 404  ASP B CG  1 
ATOM   7212 O  OD1 . ASP B  1 404 ? 10.641  5.246   -22.963 1.00 42.58  ? 404  ASP B OD1 1 
ATOM   7213 O  OD2 . ASP B  1 404 ? 11.852  5.022   -21.143 1.00 46.49  ? 404  ASP B OD2 1 
ATOM   7214 N  N   . HIS B  1 405 ? 14.844  3.911   -25.440 1.00 37.91  ? 405  HIS B N   1 
ATOM   7215 C  CA  . HIS B  1 405 ? 16.132  3.872   -26.130 1.00 36.78  ? 405  HIS B CA  1 
ATOM   7216 C  C   . HIS B  1 405 ? 15.983  4.088   -27.635 1.00 34.83  ? 405  HIS B C   1 
ATOM   7217 O  O   . HIS B  1 405 ? 16.783  4.796   -28.251 1.00 37.24  ? 405  HIS B O   1 
ATOM   7218 C  CB  . HIS B  1 405 ? 16.827  2.532   -25.862 1.00 35.34  ? 405  HIS B CB  1 
ATOM   7219 C  CG  . HIS B  1 405 ? 18.085  2.324   -26.641 1.00 38.73  ? 405  HIS B CG  1 
ATOM   7220 N  ND1 . HIS B  1 405 ? 19.077  3.283   -26.732 1.00 42.48  ? 405  HIS B ND1 1 
ATOM   7221 C  CD2 . HIS B  1 405 ? 18.530  1.262   -27.353 1.00 41.34  ? 405  HIS B CD2 1 
ATOM   7222 C  CE1 . HIS B  1 405 ? 20.065  2.822   -27.469 1.00 45.97  ? 405  HIS B CE1 1 
ATOM   7223 N  NE2 . HIS B  1 405 ? 19.760  1.593   -27.861 1.00 46.35  ? 405  HIS B NE2 1 
ATOM   7224 N  N   . ASN B  1 406 ? 14.947  3.490   -28.217 1.00 27.88  ? 406  ASN B N   1 
ATOM   7225 C  CA  . ASN B  1 406 ? 14.782  3.462   -29.672 1.00 39.45  ? 406  ASN B CA  1 
ATOM   7226 C  C   . ASN B  1 406 ? 13.844  4.508   -30.277 1.00 41.65  ? 406  ASN B C   1 
ATOM   7227 O  O   . ASN B  1 406 ? 14.010  4.882   -31.439 1.00 47.50  ? 406  ASN B O   1 
ATOM   7228 C  CB  . ASN B  1 406 ? 14.344  2.064   -30.132 1.00 28.21  ? 406  ASN B CB  1 
ATOM   7229 C  CG  . ASN B  1 406 ? 15.479  1.061   -30.104 1.00 29.03  ? 406  ASN B CG  1 
ATOM   7230 O  OD1 . ASN B  1 406 ? 16.485  1.234   -30.792 1.00 38.80  ? 406  ASN B OD1 1 
ATOM   7231 N  ND2 . ASN B  1 406 ? 15.329  0.013   -29.303 1.00 34.26  ? 406  ASN B ND2 1 
ATOM   7232 N  N   . VAL B  1 407 ? 12.856  4.967   -29.510 1.00 37.96  ? 407  VAL B N   1 
ATOM   7233 C  CA  . VAL B  1 407 ? 11.873  5.921   -30.038 1.00 33.84  ? 407  VAL B CA  1 
ATOM   7234 C  C   . VAL B  1 407 ? 11.696  7.191   -29.198 1.00 39.68  ? 407  VAL B C   1 
ATOM   7235 O  O   . VAL B  1 407 ? 12.013  8.292   -29.658 1.00 35.96  ? 407  VAL B O   1 
ATOM   7236 C  CB  . VAL B  1 407 ? 10.489  5.264   -30.241 1.00 34.45  ? 407  VAL B CB  1 
ATOM   7237 C  CG1 . VAL B  1 407 ? 9.515   6.269   -30.825 1.00 32.43  ? 407  VAL B CG1 1 
ATOM   7238 C  CG2 . VAL B  1 407 ? 10.597  4.058   -31.152 1.00 32.09  ? 407  VAL B CG2 1 
ATOM   7239 N  N   . VAL B  1 408 ? 11.186  7.029   -27.977 1.00 32.92  ? 408  VAL B N   1 
ATOM   7240 C  CA  . VAL B  1 408 ? 10.782  8.160   -27.139 1.00 35.50  ? 408  VAL B CA  1 
ATOM   7241 C  C   . VAL B  1 408 ? 11.876  9.210   -26.939 1.00 35.69  ? 408  VAL B C   1 
ATOM   7242 O  O   . VAL B  1 408 ? 11.648  10.403  -27.148 1.00 40.53  ? 408  VAL B O   1 
ATOM   7243 C  CB  . VAL B  1 408 ? 10.257  7.695   -25.757 1.00 37.52  ? 408  VAL B CB  1 
ATOM   7244 C  CG1 . VAL B  1 408 ? 9.838   8.884   -24.920 1.00 24.31  ? 408  VAL B CG1 1 
ATOM   7245 C  CG2 . VAL B  1 408 ? 9.085   6.749   -25.927 1.00 31.43  ? 408  VAL B CG2 1 
ATOM   7246 N  N   . CYS B  1 409 ? 13.064  8.771   -26.549 1.00 27.50  ? 409  CYS B N   1 
ATOM   7247 C  CA  . CYS B  1 409 ? 14.158  9.709   -26.315 1.00 29.88  ? 409  CYS B CA  1 
ATOM   7248 C  C   . CYS B  1 409 ? 14.790  10.280  -27.601 1.00 39.39  ? 409  CYS B C   1 
ATOM   7249 O  O   . CYS B  1 409 ? 15.106  11.472  -27.649 1.00 42.32  ? 409  CYS B O   1 
ATOM   7250 C  CB  . CYS B  1 409 ? 15.198  9.109   -25.360 1.00 30.38  ? 409  CYS B CB  1 
ATOM   7251 S  SG  . CYS B  1 409 ? 14.540  8.780   -23.682 1.00 44.64  ? 409  CYS B SG  1 
ATOM   7252 N  N   . PRO B  1 410 ? 14.977  9.443   -28.644 1.00 42.43  ? 410  PRO B N   1 
ATOM   7253 C  CA  . PRO B  1 410 ? 15.397  10.039  -29.921 1.00 42.86  ? 410  PRO B CA  1 
ATOM   7254 C  C   . PRO B  1 410 ? 14.402  11.080  -30.443 1.00 34.51  ? 410  PRO B C   1 
ATOM   7255 O  O   . PRO B  1 410 ? 14.830  12.090  -31.008 1.00 31.43  ? 410  PRO B O   1 
ATOM   7256 C  CB  . PRO B  1 410 ? 15.451  8.835   -30.861 1.00 36.61  ? 410  PRO B CB  1 
ATOM   7257 C  CG  . PRO B  1 410 ? 15.819  7.695   -29.967 1.00 44.88  ? 410  PRO B CG  1 
ATOM   7258 C  CD  . PRO B  1 410 ? 15.110  7.972   -28.662 1.00 41.57  ? 410  PRO B CD  1 
ATOM   7259 N  N   . VAL B  1 411 ? 13.104  10.837  -30.254 1.00 26.12  ? 411  VAL B N   1 
ATOM   7260 C  CA  . VAL B  1 411 ? 12.069  11.831  -30.566 1.00 30.45  ? 411  VAL B CA  1 
ATOM   7261 C  C   . VAL B  1 411 ? 12.224  13.104  -29.723 1.00 42.10  ? 411  VAL B C   1 
ATOM   7262 O  O   . VAL B  1 411 ? 12.197  14.215  -30.255 1.00 42.15  ? 411  VAL B O   1 
ATOM   7263 C  CB  . VAL B  1 411 ? 10.646  11.251  -30.376 1.00 24.35  ? 411  VAL B CB  1 
ATOM   7264 C  CG1 . VAL B  1 411 ? 9.619   12.363  -30.238 1.00 23.09  ? 411  VAL B CG1 1 
ATOM   7265 C  CG2 . VAL B  1 411 ? 10.278  10.343  -31.537 1.00 22.51  ? 411  VAL B CG2 1 
ATOM   7266 N  N   . ALA B  1 412 ? 12.390  12.936  -28.413 1.00 41.28  ? 412  ALA B N   1 
ATOM   7267 C  CA  . ALA B  1 412 ? 12.591  14.073  -27.519 1.00 40.44  ? 412  ALA B CA  1 
ATOM   7268 C  C   . ALA B  1 412 ? 13.853  14.842  -27.892 1.00 38.09  ? 412  ALA B C   1 
ATOM   7269 O  O   . ALA B  1 412 ? 13.868  16.074  -27.867 1.00 41.16  ? 412  ALA B O   1 
ATOM   7270 C  CB  . ALA B  1 412 ? 12.656  13.611  -26.072 1.00 41.72  ? 412  ALA B CB  1 
ATOM   7271 N  N   . GLN B  1 413 ? 14.908  14.106  -28.235 1.00 36.32  ? 413  GLN B N   1 
ATOM   7272 C  CA  . GLN B  1 413 ? 16.159  14.701  -28.702 1.00 38.32  ? 413  GLN B CA  1 
ATOM   7273 C  C   . GLN B  1 413 ? 15.935  15.523  -29.975 1.00 36.18  ? 413  GLN B C   1 
ATOM   7274 O  O   . GLN B  1 413 ? 16.410  16.655  -30.087 1.00 36.91  ? 413  GLN B O   1 
ATOM   7275 C  CB  . GLN B  1 413 ? 17.203  13.603  -28.945 1.00 42.31  ? 413  GLN B CB  1 
ATOM   7276 C  CG  . GLN B  1 413 ? 18.410  14.026  -29.786 1.00 55.19  ? 413  GLN B CG  1 
ATOM   7277 C  CD  . GLN B  1 413 ? 19.482  14.749  -28.988 1.00 77.31  ? 413  GLN B CD  1 
ATOM   7278 O  OE1 . GLN B  1 413 ? 19.332  14.982  -27.788 1.00 82.06  ? 413  GLN B OE1 1 
ATOM   7279 N  NE2 . GLN B  1 413 ? 20.577  15.104  -29.655 1.00 88.79  ? 413  GLN B NE2 1 
ATOM   7280 N  N   . LEU B  1 414 ? 15.201  14.957  -30.927 1.00 33.87  ? 414  LEU B N   1 
ATOM   7281 C  CA  . LEU B  1 414 ? 14.914  15.653  -32.181 1.00 36.27  ? 414  LEU B CA  1 
ATOM   7282 C  C   . LEU B  1 414 ? 14.033  16.883  -31.952 1.00 41.03  ? 414  LEU B C   1 
ATOM   7283 O  O   . LEU B  1 414 ? 14.352  17.980  -32.415 1.00 36.20  ? 414  LEU B O   1 
ATOM   7284 C  CB  . LEU B  1 414 ? 14.257  14.700  -33.184 1.00 38.78  ? 414  LEU B CB  1 
ATOM   7285 C  CG  . LEU B  1 414 ? 13.863  15.300  -34.537 1.00 40.72  ? 414  LEU B CG  1 
ATOM   7286 C  CD1 . LEU B  1 414 ? 15.092  15.640  -35.362 1.00 36.94  ? 414  LEU B CD1 1 
ATOM   7287 C  CD2 . LEU B  1 414 ? 12.950  14.361  -35.301 1.00 38.48  ? 414  LEU B CD2 1 
ATOM   7288 N  N   . ALA B  1 415 ? 12.928  16.694  -31.235 1.00 42.68  ? 415  ALA B N   1 
ATOM   7289 C  CA  . ALA B  1 415 ? 12.017  17.791  -30.917 1.00 41.06  ? 415  ALA B CA  1 
ATOM   7290 C  C   . ALA B  1 415 ? 12.749  18.951  -30.255 1.00 47.83  ? 415  ALA B C   1 
ATOM   7291 O  O   . ALA B  1 415 ? 12.484  20.116  -30.554 1.00 50.39  ? 415  ALA B O   1 
ATOM   7292 C  CB  . ALA B  1 415 ? 10.899  17.302  -30.019 1.00 37.67  ? 415  ALA B CB  1 
ATOM   7293 N  N   . GLY B  1 416 ? 13.668  18.625  -29.353 1.00 49.93  ? 416  GLY B N   1 
ATOM   7294 C  CA  . GLY B  1 416 ? 14.440  19.635  -28.655 1.00 48.98  ? 416  GLY B CA  1 
ATOM   7295 C  C   . GLY B  1 416 ? 15.383  20.419  -29.550 1.00 47.05  ? 416  GLY B C   1 
ATOM   7296 O  O   . GLY B  1 416 ? 15.454  21.646  -29.453 1.00 50.01  ? 416  GLY B O   1 
ATOM   7297 N  N   . ARG B  1 417 ? 16.116  19.720  -30.413 1.00 45.08  ? 417  ARG B N   1 
ATOM   7298 C  CA  . ARG B  1 417 ? 17.062  20.384  -31.305 1.00 47.88  ? 417  ARG B CA  1 
ATOM   7299 C  C   . ARG B  1 417 ? 16.337  21.254  -32.332 1.00 39.63  ? 417  ARG B C   1 
ATOM   7300 O  O   . ARG B  1 417 ? 16.774  22.369  -32.629 1.00 43.59  ? 417  ARG B O   1 
ATOM   7301 C  CB  . ARG B  1 417 ? 17.965  19.369  -32.021 1.00 48.85  ? 417  ARG B CB  1 
ATOM   7302 C  CG  . ARG B  1 417 ? 18.754  18.423  -31.115 1.00 50.71  ? 417  ARG B CG  1 
ATOM   7303 C  CD  . ARG B  1 417 ? 19.495  19.152  -30.000 1.00 59.07  ? 417  ARG B CD  1 
ATOM   7304 N  NE  . ARG B  1 417 ? 20.258  20.297  -30.492 1.00 71.69  ? 417  ARG B NE  1 
ATOM   7305 C  CZ  . ARG B  1 417 ? 21.486  20.616  -30.091 1.00 77.72  ? 417  ARG B CZ  1 
ATOM   7306 N  NH1 . ARG B  1 417 ? 22.109  19.871  -29.186 1.00 76.30  ? 417  ARG B NH1 1 
ATOM   7307 N  NH2 . ARG B  1 417 ? 22.096  21.678  -30.599 1.00 77.24  ? 417  ARG B NH2 1 
ATOM   7308 N  N   . LEU B  1 418 ? 15.224  20.747  -32.857 1.00 35.60  ? 418  LEU B N   1 
ATOM   7309 C  CA  . LEU B  1 418 ? 14.445  21.476  -33.862 1.00 44.00  ? 418  LEU B CA  1 
ATOM   7310 C  C   . LEU B  1 418 ? 13.846  22.768  -33.300 1.00 46.31  ? 418  LEU B C   1 
ATOM   7311 O  O   . LEU B  1 418 ? 13.974  23.832  -33.905 1.00 48.86  ? 418  LEU B O   1 
ATOM   7312 C  CB  . LEU B  1 418 ? 13.345  20.586  -34.460 1.00 39.03  ? 418  LEU B CB  1 
ATOM   7313 C  CG  . LEU B  1 418 ? 13.785  19.375  -35.292 1.00 40.03  ? 418  LEU B CG  1 
ATOM   7314 C  CD1 . LEU B  1 418 ? 12.609  18.705  -35.981 1.00 33.71  ? 418  LEU B CD1 1 
ATOM   7315 C  CD2 . LEU B  1 418 ? 14.819  19.778  -36.313 1.00 40.60  ? 418  LEU B CD2 1 
ATOM   7316 N  N   . ALA B  1 419 ? 13.201  22.672  -32.142 1.00 42.90  ? 419  ALA B N   1 
ATOM   7317 C  CA  . ALA B  1 419 ? 12.624  23.846  -31.494 1.00 45.74  ? 419  ALA B CA  1 
ATOM   7318 C  C   . ALA B  1 419 ? 13.695  24.874  -31.135 1.00 48.98  ? 419  ALA B C   1 
ATOM   7319 O  O   . ALA B  1 419 ? 13.511  26.074  -31.335 1.00 53.19  ? 419  ALA B O   1 
ATOM   7320 C  CB  . ALA B  1 419 ? 11.843  23.438  -30.253 1.00 36.89  ? 419  ALA B CB  1 
ATOM   7321 N  N   . ALA B  1 420 ? 14.816  24.399  -30.604 1.00 50.09  ? 420  ALA B N   1 
ATOM   7322 C  CA  . ALA B  1 420 ? 15.905  25.287  -30.215 1.00 49.70  ? 420  ALA B CA  1 
ATOM   7323 C  C   . ALA B  1 420 ? 16.532  25.980  -31.418 1.00 57.72  ? 420  ALA B C   1 
ATOM   7324 O  O   . ALA B  1 420 ? 17.101  27.064  -31.289 1.00 65.57  ? 420  ALA B O   1 
ATOM   7325 C  CB  . ALA B  1 420 ? 16.962  24.519  -29.441 1.00 44.07  ? 420  ALA B CB  1 
ATOM   7326 N  N   . GLN B  1 421 ? 16.433  25.348  -32.584 1.00 56.28  ? 421  GLN B N   1 
ATOM   7327 C  CA  . GLN B  1 421 ? 17.064  25.880  -33.786 1.00 53.81  ? 421  GLN B CA  1 
ATOM   7328 C  C   . GLN B  1 421 ? 16.070  26.378  -34.842 1.00 53.12  ? 421  GLN B C   1 
ATOM   7329 O  O   . GLN B  1 421 ? 16.297  26.222  -36.043 1.00 52.13  ? 421  GLN B O   1 
ATOM   7330 C  CB  . GLN B  1 421 ? 18.056  24.860  -34.364 1.00 54.57  ? 421  GLN B CB  1 
ATOM   7331 C  CG  . GLN B  1 421 ? 19.303  24.693  -33.492 1.00 64.87  ? 421  GLN B CG  1 
ATOM   7332 C  CD  . GLN B  1 421 ? 19.937  23.317  -33.590 1.00 69.28  ? 421  GLN B CD  1 
ATOM   7333 O  OE1 . GLN B  1 421 ? 20.447  22.789  -32.603 1.00 68.77  ? 421  GLN B OE1 1 
ATOM   7334 N  NE2 . GLN B  1 421 ? 19.918  22.736  -34.782 1.00 71.60  ? 421  GLN B NE2 1 
ATOM   7335 N  N   . GLY B  1 422 ? 14.974  26.985  -34.386 1.00 56.50  ? 422  GLY B N   1 
ATOM   7336 C  CA  . GLY B  1 422 ? 14.088  27.725  -35.272 1.00 55.44  ? 422  GLY B CA  1 
ATOM   7337 C  C   . GLY B  1 422 ? 12.772  27.078  -35.671 1.00 50.90  ? 422  GLY B C   1 
ATOM   7338 O  O   . GLY B  1 422 ? 11.809  27.775  -35.997 1.00 49.39  ? 422  GLY B O   1 
ATOM   7339 N  N   . ALA B  1 423 ? 12.726  25.751  -35.654 1.00 44.73  ? 423  ALA B N   1 
ATOM   7340 C  CA  . ALA B  1 423 ? 11.553  25.023  -36.131 1.00 40.68  ? 423  ALA B CA  1 
ATOM   7341 C  C   . ALA B  1 423 ? 10.305  25.240  -35.285 1.00 46.70  ? 423  ALA B C   1 
ATOM   7342 O  O   . ALA B  1 423 ? 10.386  25.525  -34.090 1.00 51.98  ? 423  ALA B O   1 
ATOM   7343 C  CB  . ALA B  1 423 ? 11.860  23.541  -36.232 1.00 39.08  ? 423  ALA B CB  1 
ATOM   7344 N  N   . ARG B  1 424 ? 9.149   25.097  -35.924 1.00 44.81  ? 424  ARG B N   1 
ATOM   7345 C  CA  . ARG B  1 424 ? 7.869   25.099  -35.232 1.00 44.56  ? 424  ARG B CA  1 
ATOM   7346 C  C   . ARG B  1 424 ? 7.477   23.649  -34.986 1.00 47.67  ? 424  ARG B C   1 
ATOM   7347 O  O   . ARG B  1 424 ? 7.161   22.915  -35.926 1.00 39.85  ? 424  ARG B O   1 
ATOM   7348 C  CB  . ARG B  1 424 ? 6.817   25.797  -36.094 1.00 52.65  ? 424  ARG B CB  1 
ATOM   7349 C  CG  . ARG B  1 424 ? 5.424   25.856  -35.491 1.00 58.46  ? 424  ARG B CG  1 
ATOM   7350 C  CD  . ARG B  1 424 ? 4.556   26.833  -36.276 1.00 63.05  ? 424  ARG B CD  1 
ATOM   7351 N  NE  . ARG B  1 424 ? 3.618   27.549  -35.417 1.00 72.59  ? 424  ARG B NE  1 
ATOM   7352 C  CZ  . ARG B  1 424 ? 3.973   28.493  -34.551 1.00 70.41  ? 424  ARG B CZ  1 
ATOM   7353 N  NH1 . ARG B  1 424 ? 5.245   28.834  -34.408 1.00 78.10  ? 424  ARG B NH1 1 
ATOM   7354 N  NH2 . ARG B  1 424 ? 3.053   29.093  -33.821 1.00 68.01  ? 424  ARG B NH2 1 
ATOM   7355 N  N   . VAL B  1 425 ? 7.510   23.234  -33.722 1.00 38.80  ? 425  VAL B N   1 
ATOM   7356 C  CA  . VAL B  1 425 ? 7.313   21.831  -33.372 1.00 35.81  ? 425  VAL B CA  1 
ATOM   7357 C  C   . VAL B  1 425 ? 6.037   21.592  -32.567 1.00 35.82  ? 425  VAL B C   1 
ATOM   7358 O  O   . VAL B  1 425 ? 5.762   22.302  -31.599 1.00 35.52  ? 425  VAL B O   1 
ATOM   7359 C  CB  . VAL B  1 425 ? 8.509   21.300  -32.553 1.00 36.17  ? 425  VAL B CB  1 
ATOM   7360 C  CG1 . VAL B  1 425 ? 8.397   19.796  -32.349 1.00 27.05  ? 425  VAL B CG1 1 
ATOM   7361 C  CG2 . VAL B  1 425 ? 9.818   21.648  -33.241 1.00 24.50  ? 425  VAL B CG2 1 
ATOM   7362 N  N   . TYR B  1 426 ? 5.256   20.596  -32.975 1.00 40.11  ? 426  TYR B N   1 
ATOM   7363 C  CA  . TYR B  1 426 ? 4.128   20.135  -32.171 1.00 35.06  ? 426  TYR B CA  1 
ATOM   7364 C  C   . TYR B  1 426 ? 4.371   18.686  -31.765 1.00 42.71  ? 426  TYR B C   1 
ATOM   7365 O  O   . TYR B  1 426 ? 4.777   17.863  -32.592 1.00 43.51  ? 426  TYR B O   1 
ATOM   7366 C  CB  . TYR B  1 426 ? 2.813   20.269  -32.943 1.00 38.13  ? 426  TYR B CB  1 
ATOM   7367 C  CG  . TYR B  1 426 ? 2.408   21.701  -33.216 1.00 36.96  ? 426  TYR B CG  1 
ATOM   7368 C  CD1 . TYR B  1 426 ? 1.625   22.408  -32.309 1.00 28.90  ? 426  TYR B CD1 1 
ATOM   7369 C  CD2 . TYR B  1 426 ? 2.807   22.345  -34.380 1.00 29.31  ? 426  TYR B CD2 1 
ATOM   7370 C  CE1 . TYR B  1 426 ? 1.255   23.720  -32.555 1.00 39.53  ? 426  TYR B CE1 1 
ATOM   7371 C  CE2 . TYR B  1 426 ? 2.442   23.655  -34.635 1.00 29.98  ? 426  TYR B CE2 1 
ATOM   7372 C  CZ  . TYR B  1 426 ? 1.666   24.335  -33.722 1.00 43.06  ? 426  TYR B CZ  1 
ATOM   7373 O  OH  . TYR B  1 426 ? 1.305   25.637  -33.982 1.00 42.45  ? 426  TYR B OH  1 
ATOM   7374 N  N   . ALA B  1 427 ? 4.137   18.380  -30.491 1.00 37.44  ? 427  ALA B N   1 
ATOM   7375 C  CA  . ALA B  1 427 ? 4.412   17.044  -29.966 1.00 31.12  ? 427  ALA B CA  1 
ATOM   7376 C  C   . ALA B  1 427 ? 3.190   16.406  -29.308 1.00 36.73  ? 427  ALA B C   1 
ATOM   7377 O  O   . ALA B  1 427 ? 2.361   17.099  -28.710 1.00 34.64  ? 427  ALA B O   1 
ATOM   7378 C  CB  . ALA B  1 427 ? 5.582   17.083  -28.993 1.00 30.83  ? 427  ALA B CB  1 
ATOM   7379 N  N   . TYR B  1 428 ? 3.090   15.082  -29.420 1.00 35.70  ? 428  TYR B N   1 
ATOM   7380 C  CA  . TYR B  1 428 ? 1.984   14.337  -28.824 1.00 33.26  ? 428  TYR B CA  1 
ATOM   7381 C  C   . TYR B  1 428 ? 2.452   13.025  -28.221 1.00 38.85  ? 428  TYR B C   1 
ATOM   7382 O  O   . TYR B  1 428 ? 3.555   12.552  -28.504 1.00 34.09  ? 428  TYR B O   1 
ATOM   7383 C  CB  . TYR B  1 428 ? 0.898   14.030  -29.865 1.00 34.98  ? 428  TYR B CB  1 
ATOM   7384 C  CG  . TYR B  1 428 ? 1.321   13.036  -30.931 1.00 40.84  ? 428  TYR B CG  1 
ATOM   7385 C  CD1 . TYR B  1 428 ? 1.210   11.661  -30.727 1.00 42.39  ? 428  TYR B CD1 1 
ATOM   7386 C  CD2 . TYR B  1 428 ? 1.818   13.477  -32.146 1.00 36.46  ? 428  TYR B CD2 1 
ATOM   7387 C  CE1 . TYR B  1 428 ? 1.600   10.764  -31.700 1.00 46.11  ? 428  TYR B CE1 1 
ATOM   7388 C  CE2 . TYR B  1 428 ? 2.201   12.589  -33.124 1.00 42.11  ? 428  TYR B CE2 1 
ATOM   7389 C  CZ  . TYR B  1 428 ? 2.092   11.236  -32.897 1.00 47.96  ? 428  TYR B CZ  1 
ATOM   7390 O  OH  . TYR B  1 428 ? 2.481   10.355  -33.878 1.00 49.67  ? 428  TYR B OH  1 
ATOM   7391 N  N   . ILE B  1 429 ? 1.592   12.445  -27.391 1.00 40.16  ? 429  ILE B N   1 
ATOM   7392 C  CA  . ILE B  1 429 ? 1.692   11.040  -27.035 1.00 43.53  ? 429  ILE B CA  1 
ATOM   7393 C  C   . ILE B  1 429 ? 0.330   10.379  -27.267 1.00 41.85  ? 429  ILE B C   1 
ATOM   7394 O  O   . ILE B  1 429 ? -0.700  10.871  -26.800 1.00 43.61  ? 429  ILE B O   1 
ATOM   7395 C  CB  . ILE B  1 429 ? 2.192   10.836  -25.586 1.00 47.85  ? 429  ILE B CB  1 
ATOM   7396 C  CG1 . ILE B  1 429 ? 2.275   9.344   -25.265 1.00 50.70  ? 429  ILE B CG1 1 
ATOM   7397 C  CG2 . ILE B  1 429 ? 1.308   11.570  -24.579 1.00 46.06  ? 429  ILE B CG2 1 
ATOM   7398 C  CD1 . ILE B  1 429 ? 2.807   9.041   -23.880 1.00 51.59  ? 429  ILE B CD1 1 
ATOM   7399 N  N   . PHE B  1 430 ? 0.324   9.285   -28.024 1.00 36.85  ? 430  PHE B N   1 
ATOM   7400 C  CA  . PHE B  1 430 ? -0.910  8.571   -28.333 1.00 37.43  ? 430  PHE B CA  1 
ATOM   7401 C  C   . PHE B  1 430 ? -1.168  7.508   -27.272 1.00 36.96  ? 430  PHE B C   1 
ATOM   7402 O  O   . PHE B  1 430 ? -0.380  6.570   -27.119 1.00 36.09  ? 430  PHE B O   1 
ATOM   7403 C  CB  . PHE B  1 430 ? -0.811  7.928   -29.716 1.00 39.61  ? 430  PHE B CB  1 
ATOM   7404 C  CG  . PHE B  1 430 ? -2.116  7.398   -30.236 1.00 38.84  ? 430  PHE B CG  1 
ATOM   7405 C  CD1 . PHE B  1 430 ? -2.982  8.225   -30.939 1.00 36.87  ? 430  PHE B CD1 1 
ATOM   7406 C  CD2 . PHE B  1 430 ? -2.472  6.071   -30.034 1.00 38.04  ? 430  PHE B CD2 1 
ATOM   7407 C  CE1 . PHE B  1 430 ? -4.185  7.742   -31.427 1.00 43.37  ? 430  PHE B CE1 1 
ATOM   7408 C  CE2 . PHE B  1 430 ? -3.674  5.577   -30.521 1.00 40.45  ? 430  PHE B CE2 1 
ATOM   7409 C  CZ  . PHE B  1 430 ? -4.534  6.415   -31.217 1.00 40.45  ? 430  PHE B CZ  1 
ATOM   7410 N  N   . GLU B  1 431 ? -2.276  7.650   -26.547 1.00 38.46  ? 431  GLU B N   1 
ATOM   7411 C  CA  . GLU B  1 431 ? -2.540  6.798   -25.388 1.00 48.68  ? 431  GLU B CA  1 
ATOM   7412 C  C   . GLU B  1 431 ? -3.772  5.901   -25.501 1.00 50.19  ? 431  GLU B C   1 
ATOM   7413 O  O   . GLU B  1 431 ? -4.058  5.134   -24.582 1.00 51.58  ? 431  GLU B O   1 
ATOM   7414 C  CB  . GLU B  1 431 ? -2.658  7.644   -24.115 1.00 46.99  ? 431  GLU B CB  1 
ATOM   7415 C  CG  . GLU B  1 431 ? -1.345  8.216   -23.606 1.00 49.94  ? 431  GLU B CG  1 
ATOM   7416 C  CD  . GLU B  1 431 ? -1.528  9.066   -22.364 1.00 54.18  ? 431  GLU B CD  1 
ATOM   7417 O  OE1 . GLU B  1 431 ? -2.601  9.689   -22.219 1.00 56.43  ? 431  GLU B OE1 1 
ATOM   7418 O  OE2 . GLU B  1 431 ? -0.601  9.113   -21.529 1.00 53.81  ? 431  GLU B OE2 1 
ATOM   7419 N  N   . HIS B  1 432 ? -4.510  5.994   -26.603 1.00 48.95  ? 432  HIS B N   1 
ATOM   7420 C  CA  . HIS B  1 432 ? -5.668  5.119   -26.767 1.00 46.07  ? 432  HIS B CA  1 
ATOM   7421 C  C   . HIS B  1 432 ? -5.296  3.753   -27.333 1.00 45.13  ? 432  HIS B C   1 
ATOM   7422 O  O   . HIS B  1 432 ? -4.571  3.656   -28.324 1.00 47.58  ? 432  HIS B O   1 
ATOM   7423 C  CB  . HIS B  1 432 ? -6.743  5.756   -27.645 1.00 44.09  ? 432  HIS B CB  1 
ATOM   7424 C  CG  . HIS B  1 432 ? -7.948  4.887   -27.832 1.00 52.83  ? 432  HIS B CG  1 
ATOM   7425 N  ND1 . HIS B  1 432 ? -8.822  4.599   -26.804 1.00 58.01  ? 432  HIS B ND1 1 
ATOM   7426 C  CD2 . HIS B  1 432 ? -8.413  4.229   -28.918 1.00 56.15  ? 432  HIS B CD2 1 
ATOM   7427 C  CE1 . HIS B  1 432 ? -9.778  3.808   -27.254 1.00 61.16  ? 432  HIS B CE1 1 
ATOM   7428 N  NE2 . HIS B  1 432 ? -9.554  3.565   -28.533 1.00 61.64  ? 432  HIS B NE2 1 
ATOM   7429 N  N   . ARG B  1 433 ? -5.799  2.702   -26.695 1.00 44.87  ? 433  ARG B N   1 
ATOM   7430 C  CA  . ARG B  1 433 ? -5.635  1.342   -27.191 1.00 46.85  ? 433  ARG B CA  1 
ATOM   7431 C  C   . ARG B  1 433 ? -6.913  0.915   -27.902 1.00 48.83  ? 433  ARG B C   1 
ATOM   7432 O  O   . ARG B  1 433 ? -8.006  1.027   -27.347 1.00 47.01  ? 433  ARG B O   1 
ATOM   7433 C  CB  . ARG B  1 433 ? -5.336  0.389   -26.031 1.00 48.85  ? 433  ARG B CB  1 
ATOM   7434 C  CG  . ARG B  1 433 ? -5.257  -1.077  -26.430 1.00 50.08  ? 433  ARG B CG  1 
ATOM   7435 C  CD  . ARG B  1 433 ? -5.152  -1.983  -25.210 1.00 48.01  ? 433  ARG B CD  1 
ATOM   7436 N  NE  . ARG B  1 433 ? -5.468  -3.372  -25.538 1.00 50.89  ? 433  ARG B NE  1 
ATOM   7437 C  CZ  . ARG B  1 433 ? -4.560  -4.324  -25.733 1.00 49.08  ? 433  ARG B CZ  1 
ATOM   7438 N  NH1 . ARG B  1 433 ? -3.267  -4.046  -25.627 1.00 44.75  ? 433  ARG B NH1 1 
ATOM   7439 N  NH2 . ARG B  1 433 ? -4.944  -5.556  -26.030 1.00 47.63  ? 433  ARG B NH2 1 
ATOM   7440 N  N   . ALA B  1 434 ? -6.773  0.433   -29.132 1.00 54.49  ? 434  ALA B N   1 
ATOM   7441 C  CA  . ALA B  1 434 ? -7.921  0.013   -29.933 1.00 52.69  ? 434  ALA B CA  1 
ATOM   7442 C  C   . ALA B  1 434 ? -8.727  -1.099  -29.272 1.00 53.37  ? 434  ALA B C   1 
ATOM   7443 O  O   . ALA B  1 434 ? -8.163  -2.028  -28.697 1.00 60.48  ? 434  ALA B O   1 
ATOM   7444 C  CB  . ALA B  1 434 ? -7.469  -0.425  -31.313 1.00 49.43  ? 434  ALA B CB  1 
ATOM   7445 N  N   . SER B  1 435 ? -10.049 -1.000  -29.378 1.00 55.22  ? 435  SER B N   1 
ATOM   7446 C  CA  . SER B  1 435 ? -10.956 -2.023  -28.867 1.00 56.19  ? 435  SER B CA  1 
ATOM   7447 C  C   . SER B  1 435 ? -10.806 -3.320  -29.654 1.00 60.69  ? 435  SER B C   1 
ATOM   7448 O  O   . SER B  1 435 ? -11.189 -4.391  -29.182 1.00 61.99  ? 435  SER B O   1 
ATOM   7449 C  CB  . SER B  1 435 ? -12.404 -1.533  -28.948 1.00 57.69  ? 435  SER B CB  1 
ATOM   7450 O  OG  . SER B  1 435 ? -12.746 -1.150  -30.271 1.00 66.90  ? 435  SER B OG  1 
ATOM   7451 N  N   . THR B  1 436 ? -10.238 -3.209  -30.854 1.00 58.92  ? 436  THR B N   1 
ATOM   7452 C  CA  . THR B  1 436 ? -10.097 -4.342  -31.761 1.00 59.16  ? 436  THR B CA  1 
ATOM   7453 C  C   . THR B  1 436 ? -8.684  -4.922  -31.799 1.00 61.19  ? 436  THR B C   1 
ATOM   7454 O  O   . THR B  1 436 ? -8.390  -5.775  -32.640 1.00 63.85  ? 436  THR B O   1 
ATOM   7455 C  CB  . THR B  1 436 ? -10.494 -3.958  -33.201 1.00 65.26  ? 436  THR B CB  1 
ATOM   7456 O  OG1 . THR B  1 436 ? -9.602  -2.951  -33.696 1.00 68.32  ? 436  THR B OG1 1 
ATOM   7457 C  CG2 . THR B  1 436 ? -11.918 -3.434  -33.245 1.00 66.38  ? 436  THR B CG2 1 
ATOM   7458 N  N   . LEU B  1 437 ? -7.811  -4.464  -30.903 1.00 55.31  ? 437  LEU B N   1 
ATOM   7459 C  CA  . LEU B  1 437 ? -6.439  -4.974  -30.859 1.00 55.33  ? 437  LEU B CA  1 
ATOM   7460 C  C   . LEU B  1 437 ? -6.416  -6.465  -30.530 1.00 55.45  ? 437  LEU B C   1 
ATOM   7461 O  O   . LEU B  1 437 ? -7.258  -6.954  -29.780 1.00 65.35  ? 437  LEU B O   1 
ATOM   7462 C  CB  . LEU B  1 437 ? -5.583  -4.185  -29.861 1.00 60.78  ? 437  LEU B CB  1 
ATOM   7463 C  CG  . LEU B  1 437 ? -4.391  -3.442  -30.473 1.00 59.85  ? 437  LEU B CG  1 
ATOM   7464 C  CD1 . LEU B  1 437 ? -3.734  -2.508  -29.477 1.00 63.42  ? 437  LEU B CD1 1 
ATOM   7465 C  CD2 . LEU B  1 437 ? -3.380  -4.434  -30.994 1.00 61.39  ? 437  LEU B CD2 1 
ATOM   7466 N  N   . THR B  1 438 ? -5.457  -7.182  -31.108 1.00 56.05  ? 438  THR B N   1 
ATOM   7467 C  CA  . THR B  1 438 ? -5.378  -8.632  -30.946 1.00 56.31  ? 438  THR B CA  1 
ATOM   7468 C  C   . THR B  1 438 ? -4.136  -9.061  -30.167 1.00 54.84  ? 438  THR B C   1 
ATOM   7469 O  O   . THR B  1 438 ? -4.000  -10.227 -29.793 1.00 59.77  ? 438  THR B O   1 
ATOM   7470 C  CB  . THR B  1 438 ? -5.442  -9.356  -32.307 1.00 60.42  ? 438  THR B CB  1 
ATOM   7471 O  OG1 . THR B  1 438 ? -4.355  -8.929  -33.139 1.00 57.53  ? 438  THR B OG1 1 
ATOM   7472 C  CG2 . THR B  1 438 ? -6.754  -9.041  -32.999 1.00 59.78  ? 438  THR B CG2 1 
ATOM   7473 N  N   . TRP B  1 439 ? -3.235  -8.113  -29.929 1.00 53.99  ? 439  TRP B N   1 
ATOM   7474 C  CA  . TRP B  1 439 ? -2.106  -8.334  -29.031 1.00 51.20  ? 439  TRP B CA  1 
ATOM   7475 C  C   . TRP B  1 439 ? -2.612  -8.318  -27.587 1.00 48.55  ? 439  TRP B C   1 
ATOM   7476 O  O   . TRP B  1 439 ? -3.634  -7.691  -27.295 1.00 46.34  ? 439  TRP B O   1 
ATOM   7477 C  CB  . TRP B  1 439 ? -1.037  -7.253  -29.233 1.00 51.32  ? 439  TRP B CB  1 
ATOM   7478 C  CG  . TRP B  1 439 ? -0.404  -7.260  -30.599 1.00 51.24  ? 439  TRP B CG  1 
ATOM   7479 C  CD1 . TRP B  1 439 ? -0.723  -6.460  -31.657 1.00 50.43  ? 439  TRP B CD1 1 
ATOM   7480 C  CD2 . TRP B  1 439 ? 0.666   -8.105  -31.044 1.00 51.36  ? 439  TRP B CD2 1 
ATOM   7481 N  NE1 . TRP B  1 439 ? 0.079   -6.758  -32.734 1.00 50.86  ? 439  TRP B NE1 1 
ATOM   7482 C  CE2 . TRP B  1 439 ? 0.939   -7.766  -32.383 1.00 52.17  ? 439  TRP B CE2 1 
ATOM   7483 C  CE3 . TRP B  1 439 ? 1.416   -9.119  -30.440 1.00 49.42  ? 439  TRP B CE3 1 
ATOM   7484 C  CZ2 . TRP B  1 439 ? 1.932   -8.407  -33.129 1.00 51.55  ? 439  TRP B CZ2 1 
ATOM   7485 C  CZ3 . TRP B  1 439 ? 2.399   -9.749  -31.178 1.00 51.95  ? 439  TRP B CZ3 1 
ATOM   7486 C  CH2 . TRP B  1 439 ? 2.650   -9.392  -32.507 1.00 54.77  ? 439  TRP B CH2 1 
ATOM   7487 N  N   . PRO B  1 440 ? -1.907  -9.015  -26.677 1.00 49.29  ? 440  PRO B N   1 
ATOM   7488 C  CA  . PRO B  1 440 ? -2.337  -9.067  -25.272 1.00 48.43  ? 440  PRO B CA  1 
ATOM   7489 C  C   . PRO B  1 440 ? -2.381  -7.695  -24.599 1.00 47.15  ? 440  PRO B C   1 
ATOM   7490 O  O   . PRO B  1 440 ? -1.766  -6.745  -25.086 1.00 48.10  ? 440  PRO B O   1 
ATOM   7491 C  CB  . PRO B  1 440 ? -1.268  -9.945  -24.606 1.00 47.10  ? 440  PRO B CB  1 
ATOM   7492 C  CG  . PRO B  1 440 ? -0.096  -9.920  -25.540 1.00 52.34  ? 440  PRO B CG  1 
ATOM   7493 C  CD  . PRO B  1 440 ? -0.695  -9.822  -26.909 1.00 49.69  ? 440  PRO B CD  1 
ATOM   7494 N  N   . LEU B  1 441 ? -3.101  -7.608  -23.484 1.00 53.06  ? 441  LEU B N   1 
ATOM   7495 C  CA  . LEU B  1 441 ? -3.276  -6.352  -22.761 1.00 54.36  ? 441  LEU B CA  1 
ATOM   7496 C  C   . LEU B  1 441 ? -1.977  -5.808  -22.171 1.00 49.00  ? 441  LEU B C   1 
ATOM   7497 O  O   . LEU B  1 441 ? -1.834  -4.597  -21.987 1.00 49.36  ? 441  LEU B O   1 
ATOM   7498 C  CB  . LEU B  1 441 ? -4.326  -6.515  -21.657 1.00 60.27  ? 441  LEU B CB  1 
ATOM   7499 C  CG  . LEU B  1 441 ? -5.793  -6.537  -22.095 1.00 73.47  ? 441  LEU B CG  1 
ATOM   7500 C  CD1 . LEU B  1 441 ? -6.662  -7.253  -21.070 1.00 74.66  ? 441  LEU B CD1 1 
ATOM   7501 C  CD2 . LEU B  1 441 ? -6.298  -5.122  -22.316 1.00 75.13  ? 441  LEU B CD2 1 
ATOM   7502 N  N   . TRP B  1 442 ? -1.029  -6.694  -21.881 1.00 44.89  ? 442  TRP B N   1 
ATOM   7503 C  CA  . TRP B  1 442 ? 0.229   -6.263  -21.272 1.00 49.45  ? 442  TRP B CA  1 
ATOM   7504 C  C   . TRP B  1 442 ? 1.091   -5.429  -22.215 1.00 50.27  ? 442  TRP B C   1 
ATOM   7505 O  O   . TRP B  1 442 ? 2.025   -4.757  -21.776 1.00 49.13  ? 442  TRP B O   1 
ATOM   7506 C  CB  . TRP B  1 442 ? 1.018   -7.448  -20.690 1.00 53.78  ? 442  TRP B CB  1 
ATOM   7507 C  CG  . TRP B  1 442 ? 1.623   -8.395  -21.687 1.00 54.51  ? 442  TRP B CG  1 
ATOM   7508 C  CD1 . TRP B  1 442 ? 1.128   -9.605  -22.070 1.00 52.59  ? 442  TRP B CD1 1 
ATOM   7509 C  CD2 . TRP B  1 442 ? 2.861   -8.227  -22.392 1.00 57.63  ? 442  TRP B CD2 1 
ATOM   7510 N  NE1 . TRP B  1 442 ? 1.970   -10.193 -22.983 1.00 56.80  ? 442  TRP B NE1 1 
ATOM   7511 C  CE2 . TRP B  1 442 ? 3.040   -9.366  -23.199 1.00 54.85  ? 442  TRP B CE2 1 
ATOM   7512 C  CE3 . TRP B  1 442 ? 3.828   -7.218  -22.427 1.00 56.58  ? 442  TRP B CE3 1 
ATOM   7513 C  CZ2 . TRP B  1 442 ? 4.149   -9.523  -24.031 1.00 49.12  ? 442  TRP B CZ2 1 
ATOM   7514 C  CZ3 . TRP B  1 442 ? 4.925   -7.375  -23.254 1.00 50.33  ? 442  TRP B CZ3 1 
ATOM   7515 C  CH2 . TRP B  1 442 ? 5.078   -8.518  -24.043 1.00 47.59  ? 442  TRP B CH2 1 
ATOM   7516 N  N   . MET B  1 443 ? 0.770   -5.470  -23.506 1.00 53.78  ? 443  MET B N   1 
ATOM   7517 C  CA  . MET B  1 443 ? 1.477   -4.658  -24.486 1.00 48.76  ? 443  MET B CA  1 
ATOM   7518 C  C   . MET B  1 443 ? 0.898   -3.249  -24.577 1.00 49.31  ? 443  MET B C   1 
ATOM   7519 O  O   . MET B  1 443 ? 1.497   -2.371  -25.201 1.00 49.56  ? 443  MET B O   1 
ATOM   7520 C  CB  . MET B  1 443 ? 1.444   -5.322  -25.866 1.00 46.79  ? 443  MET B CB  1 
ATOM   7521 C  CG  . MET B  1 443 ? 2.256   -6.603  -25.978 1.00 49.86  ? 443  MET B CG  1 
ATOM   7522 S  SD  . MET B  1 443 ? 2.285   -7.233  -27.671 1.00 54.42  ? 443  MET B SD  1 
ATOM   7523 C  CE  . MET B  1 443 ? 3.406   -8.617  -27.495 1.00 41.49  ? 443  MET B CE  1 
ATOM   7524 N  N   . GLY B  1 444 ? -0.267  -3.039  -23.966 1.00 44.47  ? 444  GLY B N   1 
ATOM   7525 C  CA  . GLY B  1 444 ? -0.910  -1.733  -23.961 1.00 49.50  ? 444  GLY B CA  1 
ATOM   7526 C  C   . GLY B  1 444 ? -1.162  -1.146  -25.340 1.00 52.81  ? 444  GLY B C   1 
ATOM   7527 O  O   . GLY B  1 444 ? -1.937  -1.695  -26.122 1.00 49.77  ? 444  GLY B O   1 
ATOM   7528 N  N   . VAL B  1 445 ? -0.512  -0.021  -25.631 1.00 49.33  ? 445  VAL B N   1 
ATOM   7529 C  CA  . VAL B  1 445 ? -0.631  0.632   -26.932 1.00 43.24  ? 445  VAL B CA  1 
ATOM   7530 C  C   . VAL B  1 445 ? 0.675   0.469   -27.715 1.00 41.35  ? 445  VAL B C   1 
ATOM   7531 O  O   . VAL B  1 445 ? 1.587   1.287   -27.580 1.00 38.71  ? 445  VAL B O   1 
ATOM   7532 C  CB  . VAL B  1 445 ? -0.948  2.132   -26.768 1.00 45.85  ? 445  VAL B CB  1 
ATOM   7533 C  CG1 . VAL B  1 445 ? -1.296  2.749   -28.109 1.00 38.93  ? 445  VAL B CG1 1 
ATOM   7534 C  CG2 . VAL B  1 445 ? -2.093  2.332   -25.787 1.00 40.38  ? 445  VAL B CG2 1 
ATOM   7535 N  N   . PRO B  1 446 ? 0.765   -0.591  -28.541 1.00 40.51  ? 446  PRO B N   1 
ATOM   7536 C  CA  . PRO B  1 446 ? 2.031   -0.971  -29.184 1.00 35.91  ? 446  PRO B CA  1 
ATOM   7537 C  C   . PRO B  1 446 ? 2.415   -0.108  -30.382 1.00 41.40  ? 446  PRO B C   1 
ATOM   7538 O  O   . PRO B  1 446 ? 1.583   0.603   -30.945 1.00 35.77  ? 446  PRO B O   1 
ATOM   7539 C  CB  . PRO B  1 446 ? 1.771   -2.411  -29.666 1.00 33.71  ? 446  PRO B CB  1 
ATOM   7540 C  CG  . PRO B  1 446 ? 0.446   -2.827  -29.053 1.00 39.71  ? 446  PRO B CG  1 
ATOM   7541 C  CD  . PRO B  1 446 ? -0.308  -1.551  -28.846 1.00 39.09  ? 446  PRO B CD  1 
ATOM   7542 N  N   . HIS B  1 447 ? 3.688   -0.202  -30.753 1.00 44.43  ? 447  HIS B N   1 
ATOM   7543 C  CA  . HIS B  1 447 ? 4.266   0.479   -31.909 1.00 39.48  ? 447  HIS B CA  1 
ATOM   7544 C  C   . HIS B  1 447 ? 3.417   0.335   -33.177 1.00 44.21  ? 447  HIS B C   1 
ATOM   7545 O  O   . HIS B  1 447 ? 3.252   -0.764  -33.701 1.00 47.34  ? 447  HIS B O   1 
ATOM   7546 C  CB  . HIS B  1 447 ? 5.669   -0.095  -32.146 1.00 33.65  ? 447  HIS B CB  1 
ATOM   7547 C  CG  . HIS B  1 447 ? 6.489   0.655   -33.149 1.00 48.13  ? 447  HIS B CG  1 
ATOM   7548 N  ND1 . HIS B  1 447 ? 6.877   1.967   -32.963 1.00 52.47  ? 447  HIS B ND1 1 
ATOM   7549 C  CD2 . HIS B  1 447 ? 7.022   0.267   -34.327 1.00 49.49  ? 447  HIS B CD2 1 
ATOM   7550 C  CE1 . HIS B  1 447 ? 7.600   2.355   -33.996 1.00 46.94  ? 447  HIS B CE1 1 
ATOM   7551 N  NE2 . HIS B  1 447 ? 7.706   1.344   -34.840 1.00 47.33  ? 447  HIS B NE2 1 
ATOM   7552 N  N   . GLY B  1 448 ? 2.865   1.444   -33.659 1.00 43.18  ? 448  GLY B N   1 
ATOM   7553 C  CA  . GLY B  1 448 ? 2.168   1.450   -34.934 1.00 42.28  ? 448  GLY B CA  1 
ATOM   7554 C  C   . GLY B  1 448 ? 0.652   1.373   -34.882 1.00 46.50  ? 448  GLY B C   1 
ATOM   7555 O  O   . GLY B  1 448 ? 0.010   1.234   -35.922 1.00 51.35  ? 448  GLY B O   1 
ATOM   7556 N  N   . TYR B  1 449 ? 0.067   1.475   -33.692 1.00 42.59  ? 449  TYR B N   1 
ATOM   7557 C  CA  . TYR B  1 449 ? -1.387  1.352   -33.576 1.00 40.64  ? 449  TYR B CA  1 
ATOM   7558 C  C   . TYR B  1 449 ? -2.123  2.681   -33.386 1.00 36.67  ? 449  TYR B C   1 
ATOM   7559 O  O   . TYR B  1 449 ? -3.280  2.716   -32.963 1.00 38.12  ? 449  TYR B O   1 
ATOM   7560 C  CB  . TYR B  1 449 ? -1.764  0.293   -32.530 1.00 37.03  ? 449  TYR B CB  1 
ATOM   7561 C  CG  . TYR B  1 449 ? -1.476  -1.090  -33.054 1.00 39.08  ? 449  TYR B CG  1 
ATOM   7562 C  CD1 . TYR B  1 449 ? -2.408  -1.758  -33.833 1.00 44.98  ? 449  TYR B CD1 1 
ATOM   7563 C  CD2 . TYR B  1 449 ? -0.254  -1.702  -32.823 1.00 36.96  ? 449  TYR B CD2 1 
ATOM   7564 C  CE1 . TYR B  1 449 ? -2.148  -3.010  -34.340 1.00 46.33  ? 449  TYR B CE1 1 
ATOM   7565 C  CE2 . TYR B  1 449 ? 0.019   -2.957  -33.328 1.00 44.28  ? 449  TYR B CE2 1 
ATOM   7566 C  CZ  . TYR B  1 449 ? -0.933  -3.605  -34.088 1.00 48.05  ? 449  TYR B CZ  1 
ATOM   7567 O  OH  . TYR B  1 449 ? -0.676  -4.856  -34.601 1.00 44.96  ? 449  TYR B OH  1 
ATOM   7568 N  N   . GLU B  1 450 ? -1.438  3.767   -33.732 1.00 36.57  ? 450  GLU B N   1 
ATOM   7569 C  CA  . GLU B  1 450 ? -2.074  5.070   -33.874 1.00 38.24  ? 450  GLU B CA  1 
ATOM   7570 C  C   . GLU B  1 450 ? -2.497  5.259   -35.332 1.00 38.72  ? 450  GLU B C   1 
ATOM   7571 O  O   . GLU B  1 450 ? -3.416  6.024   -35.630 1.00 36.58  ? 450  GLU B O   1 
ATOM   7572 C  CB  . GLU B  1 450 ? -1.108  6.186   -33.452 1.00 36.25  ? 450  GLU B CB  1 
ATOM   7573 C  CG  . GLU B  1 450 ? -0.083  6.604   -34.515 1.00 33.19  ? 450  GLU B CG  1 
ATOM   7574 C  CD  . GLU B  1 450 ? 1.079   5.636   -34.648 1.00 34.28  ? 450  GLU B CD  1 
ATOM   7575 O  OE1 . GLU B  1 450 ? 0.939   4.453   -34.272 1.00 36.50  ? 450  GLU B OE1 1 
ATOM   7576 O  OE2 . GLU B  1 450 ? 2.148   6.064   -35.130 1.00 36.46  ? 450  GLU B OE2 1 
ATOM   7577 N  N   . ILE B  1 451 ? -1.835  4.528   -36.226 1.00 37.75  ? 451  ILE B N   1 
ATOM   7578 C  CA  . ILE B  1 451 ? -1.985  4.704   -37.672 1.00 36.62  ? 451  ILE B CA  1 
ATOM   7579 C  C   . ILE B  1 451 ? -3.420  4.549   -38.165 1.00 38.95  ? 451  ILE B C   1 
ATOM   7580 O  O   . ILE B  1 451 ? -3.933  5.417   -38.873 1.00 45.88  ? 451  ILE B O   1 
ATOM   7581 C  CB  . ILE B  1 451 ? -1.078  3.723   -38.449 1.00 39.17  ? 451  ILE B CB  1 
ATOM   7582 C  CG1 . ILE B  1 451 ? 0.391   3.929   -38.063 1.00 38.11  ? 451  ILE B CG1 1 
ATOM   7583 C  CG2 . ILE B  1 451 ? -1.249  3.903   -39.945 1.00 36.67  ? 451  ILE B CG2 1 
ATOM   7584 C  CD1 . ILE B  1 451 ? 1.348   2.974   -38.757 1.00 34.65  ? 451  ILE B CD1 1 
ATOM   7585 N  N   . GLU B  1 452 ? -4.066  3.450   -37.786 1.00 38.66  ? 452  GLU B N   1 
ATOM   7586 C  CA  . GLU B  1 452 ? -5.430  3.157   -38.226 1.00 43.74  ? 452  GLU B CA  1 
ATOM   7587 C  C   . GLU B  1 452 ? -6.431  4.245   -37.828 1.00 46.97  ? 452  GLU B C   1 
ATOM   7588 O  O   . GLU B  1 452 ? -7.504  4.360   -38.425 1.00 50.77  ? 452  GLU B O   1 
ATOM   7589 C  CB  . GLU B  1 452 ? -5.874  1.792   -37.684 1.00 49.40  ? 452  GLU B CB  1 
ATOM   7590 C  CG  . GLU B  1 452 ? -5.818  1.674   -36.164 1.00 51.31  ? 452  GLU B CG  1 
ATOM   7591 C  CD  . GLU B  1 452 ? -5.822  0.236   -35.677 1.00 57.24  ? 452  GLU B CD  1 
ATOM   7592 O  OE1 . GLU B  1 452 ? -4.853  -0.498  -35.971 1.00 56.22  ? 452  GLU B OE1 1 
ATOM   7593 O  OE2 . GLU B  1 452 ? -6.784  -0.157  -34.983 1.00 60.48  ? 452  GLU B OE2 1 
ATOM   7594 N  N   . PHE B  1 453 ? -6.072  5.039   -36.823 1.00 43.27  ? 453  PHE B N   1 
ATOM   7595 C  CA  . PHE B  1 453 ? -6.911  6.148   -36.375 1.00 41.57  ? 453  PHE B CA  1 
ATOM   7596 C  C   . PHE B  1 453 ? -6.663  7.427   -37.176 1.00 40.56  ? 453  PHE B C   1 
ATOM   7597 O  O   . PHE B  1 453 ? -7.602  8.162   -37.477 1.00 48.55  ? 453  PHE B O   1 
ATOM   7598 C  CB  . PHE B  1 453 ? -6.705  6.403   -34.881 1.00 43.96  ? 453  PHE B CB  1 
ATOM   7599 C  CG  . PHE B  1 453 ? -7.299  5.343   -34.001 1.00 40.09  ? 453  PHE B CG  1 
ATOM   7600 C  CD1 . PHE B  1 453 ? -8.646  5.377   -33.669 1.00 39.26  ? 453  PHE B CD1 1 
ATOM   7601 C  CD2 . PHE B  1 453 ? -6.512  4.312   -33.505 1.00 37.47  ? 453  PHE B CD2 1 
ATOM   7602 C  CE1 . PHE B  1 453 ? -9.201  4.401   -32.859 1.00 39.94  ? 453  PHE B CE1 1 
ATOM   7603 C  CE2 . PHE B  1 453 ? -7.057  3.330   -32.697 1.00 37.63  ? 453  PHE B CE2 1 
ATOM   7604 C  CZ  . PHE B  1 453 ? -8.405  3.375   -32.373 1.00 43.73  ? 453  PHE B CZ  1 
ATOM   7605 N  N   . ILE B  1 454 ? -5.400  7.692   -37.511 1.00 39.47  ? 454  ILE B N   1 
ATOM   7606 C  CA  . ILE B  1 454 ? -5.051  8.825   -38.369 1.00 39.24  ? 454  ILE B CA  1 
ATOM   7607 C  C   . ILE B  1 454 ? -5.679  8.662   -39.749 1.00 42.79  ? 454  ILE B C   1 
ATOM   7608 O  O   . ILE B  1 454 ? -6.129  9.633   -40.359 1.00 52.34  ? 454  ILE B O   1 
ATOM   7609 C  CB  . ILE B  1 454 ? -3.524  8.955   -38.564 1.00 43.71  ? 454  ILE B CB  1 
ATOM   7610 C  CG1 . ILE B  1 454 ? -2.769  8.678   -37.260 1.00 47.77  ? 454  ILE B CG1 1 
ATOM   7611 C  CG2 . ILE B  1 454 ? -3.166  10.330  -39.128 1.00 41.48  ? 454  ILE B CG2 1 
ATOM   7612 C  CD1 . ILE B  1 454 ? -2.798  9.828   -36.273 1.00 42.76  ? 454  ILE B CD1 1 
ATOM   7613 N  N   . PHE B  1 455 ? -5.697  7.426   -40.240 1.00 39.64  ? 455  PHE B N   1 
ATOM   7614 C  CA  . PHE B  1 455 ? -6.209  7.141   -41.578 1.00 45.03  ? 455  PHE B CA  1 
ATOM   7615 C  C   . PHE B  1 455 ? -7.734  7.047   -41.616 1.00 45.65  ? 455  PHE B C   1 
ATOM   7616 O  O   . PHE B  1 455 ? -8.325  7.030   -42.694 1.00 43.41  ? 455  PHE B O   1 
ATOM   7617 C  CB  . PHE B  1 455 ? -5.562  5.876   -42.149 1.00 39.77  ? 455  PHE B CB  1 
ATOM   7618 C  CG  . PHE B  1 455 ? -4.256  6.128   -42.861 1.00 43.85  ? 455  PHE B CG  1 
ATOM   7619 C  CD1 . PHE B  1 455 ? -4.241  6.454   -44.214 1.00 40.95  ? 455  PHE B CD1 1 
ATOM   7620 C  CD2 . PHE B  1 455 ? -3.046  6.035   -42.182 1.00 42.13  ? 455  PHE B CD2 1 
ATOM   7621 C  CE1 . PHE B  1 455 ? -3.042  6.686   -44.879 1.00 37.33  ? 455  PHE B CE1 1 
ATOM   7622 C  CE2 . PHE B  1 455 ? -1.843  6.263   -42.839 1.00 43.19  ? 455  PHE B CE2 1 
ATOM   7623 C  CZ  . PHE B  1 455 ? -1.841  6.590   -44.191 1.00 40.16  ? 455  PHE B CZ  1 
ATOM   7624 N  N   . GLY B  1 456 ? -8.366  6.989   -40.446 1.00 42.45  ? 456  GLY B N   1 
ATOM   7625 C  CA  . GLY B  1 456 ? -9.816  7.079   -40.361 1.00 44.29  ? 456  GLY B CA  1 
ATOM   7626 C  C   . GLY B  1 456 ? -10.584 5.775   -40.475 1.00 45.43  ? 456  GLY B C   1 
ATOM   7627 O  O   . GLY B  1 456 ? -11.803 5.787   -40.663 1.00 45.32  ? 456  GLY B O   1 
ATOM   7628 N  N   . LEU B  1 457 ? -9.876  4.654   -40.357 1.00 43.00  ? 457  LEU B N   1 
ATOM   7629 C  CA  . LEU B  1 457 ? -10.494 3.326   -40.443 1.00 41.39  ? 457  LEU B CA  1 
ATOM   7630 C  C   . LEU B  1 457 ? -11.758 3.096   -39.579 1.00 52.29  ? 457  LEU B C   1 
ATOM   7631 O  O   . LEU B  1 457 ? -12.706 2.456   -40.044 1.00 56.24  ? 457  LEU B O   1 
ATOM   7632 C  CB  . LEU B  1 457 ? -9.451  2.216   -40.214 1.00 41.67  ? 457  LEU B CB  1 
ATOM   7633 C  CG  . LEU B  1 457 ? -8.729  1.662   -41.452 1.00 46.71  ? 457  LEU B CG  1 
ATOM   7634 C  CD1 . LEU B  1 457 ? -7.817  2.702   -42.103 1.00 33.12  ? 457  LEU B CD1 1 
ATOM   7635 C  CD2 . LEU B  1 457 ? -7.947  0.398   -41.118 1.00 47.69  ? 457  LEU B CD2 1 
ATOM   7636 N  N   . PRO B  1 458 ? -11.785 3.615   -38.330 1.00 50.78  ? 458  PRO B N   1 
ATOM   7637 C  CA  . PRO B  1 458 ? -13.000 3.439   -37.520 1.00 52.53  ? 458  PRO B CA  1 
ATOM   7638 C  C   . PRO B  1 458 ? -14.292 3.997   -38.131 1.00 59.02  ? 458  PRO B C   1 
ATOM   7639 O  O   . PRO B  1 458 ? -15.372 3.702   -37.618 1.00 63.08  ? 458  PRO B O   1 
ATOM   7640 C  CB  . PRO B  1 458 ? -12.664 4.190   -36.231 1.00 49.04  ? 458  PRO B CB  1 
ATOM   7641 C  CG  . PRO B  1 458 ? -11.190 4.052   -36.105 1.00 47.80  ? 458  PRO B CG  1 
ATOM   7642 C  CD  . PRO B  1 458 ? -10.665 4.126   -37.513 1.00 43.37  ? 458  PRO B CD  1 
ATOM   7643 N  N   . LEU B  1 459 ? -14.184 4.783   -39.199 1.00 56.76  ? 459  LEU B N   1 
ATOM   7644 C  CA  . LEU B  1 459 ? -15.363 5.304   -39.887 1.00 59.10  ? 459  LEU B CA  1 
ATOM   7645 C  C   . LEU B  1 459 ? -16.060 4.231   -40.728 1.00 62.66  ? 459  LEU B C   1 
ATOM   7646 O  O   . LEU B  1 459 ? -17.176 4.436   -41.212 1.00 65.43  ? 459  LEU B O   1 
ATOM   7647 C  CB  . LEU B  1 459 ? -15.003 6.518   -40.752 1.00 57.91  ? 459  LEU B CB  1 
ATOM   7648 C  CG  . LEU B  1 459 ? -14.955 7.883   -40.057 1.00 58.71  ? 459  LEU B CG  1 
ATOM   7649 C  CD1 . LEU B  1 459 ? -13.760 7.998   -39.133 1.00 60.76  ? 459  LEU B CD1 1 
ATOM   7650 C  CD2 . LEU B  1 459 ? -14.941 9.007   -41.073 1.00 59.58  ? 459  LEU B CD2 1 
ATOM   7651 N  N   . ASP B  1 460 ? -15.394 3.091   -40.894 1.00 64.85  ? 460  ASP B N   1 
ATOM   7652 C  CA  . ASP B  1 460 ? -15.961 1.944   -41.596 1.00 70.03  ? 460  ASP B CA  1 
ATOM   7653 C  C   . ASP B  1 460 ? -16.621 1.003   -40.591 1.00 74.70  ? 460  ASP B C   1 
ATOM   7654 O  O   . ASP B  1 460 ? -15.933 0.301   -39.848 1.00 74.03  ? 460  ASP B O   1 
ATOM   7655 C  CB  . ASP B  1 460 ? -14.867 1.217   -42.379 1.00 70.11  ? 460  ASP B CB  1 
ATOM   7656 C  CG  . ASP B  1 460 ? -15.382 -0.003  -43.114 1.00 74.61  ? 460  ASP B CG  1 
ATOM   7657 O  OD1 . ASP B  1 460 ? -16.608 -0.103  -43.349 1.00 71.09  ? 460  ASP B OD1 1 
ATOM   7658 O  OD2 . ASP B  1 460 ? -14.551 -0.865  -43.466 1.00 80.31  ? 460  ASP B OD2 1 
ATOM   7659 N  N   . PRO B  1 461 ? -17.963 0.988   -40.574 1.00 81.54  ? 461  PRO B N   1 
ATOM   7660 C  CA  . PRO B  1 461 ? -18.778 0.248   -39.600 1.00 80.24  ? 461  PRO B CA  1 
ATOM   7661 C  C   . PRO B  1 461 ? -18.534 -1.261  -39.625 1.00 76.22  ? 461  PRO B C   1 
ATOM   7662 O  O   . PRO B  1 461 ? -18.825 -1.942  -38.640 1.00 82.54  ? 461  PRO B O   1 
ATOM   7663 C  CB  . PRO B  1 461 ? -20.216 0.558   -40.040 1.00 83.36  ? 461  PRO B CB  1 
ATOM   7664 C  CG  . PRO B  1 461 ? -20.114 1.828   -40.826 1.00 83.69  ? 461  PRO B CG  1 
ATOM   7665 C  CD  . PRO B  1 461 ? -18.797 1.735   -41.532 1.00 82.35  ? 461  PRO B CD  1 
ATOM   7666 N  N   . SER B  1 462 ? -18.007 -1.774  -40.733 1.00 71.79  ? 462  SER B N   1 
ATOM   7667 C  CA  . SER B  1 462 ? -17.714 -3.200  -40.854 1.00 70.92  ? 462  SER B CA  1 
ATOM   7668 C  C   . SER B  1 462 ? -16.481 -3.612  -40.044 1.00 71.25  ? 462  SER B C   1 
ATOM   7669 O  O   . SER B  1 462 ? -16.211 -4.803  -39.878 1.00 69.77  ? 462  SER B O   1 
ATOM   7670 C  CB  . SER B  1 462 ? -17.537 -3.589  -42.325 1.00 68.61  ? 462  SER B CB  1 
ATOM   7671 O  OG  . SER B  1 462 ? -16.496 -2.843  -42.931 1.00 68.95  ? 462  SER B OG  1 
ATOM   7672 N  N   . LEU B  1 463 ? -15.745 -2.626  -39.535 1.00 71.08  ? 463  LEU B N   1 
ATOM   7673 C  CA  . LEU B  1 463 ? -14.516 -2.888  -38.787 1.00 67.58  ? 463  LEU B CA  1 
ATOM   7674 C  C   . LEU B  1 463 ? -14.759 -3.045  -37.281 1.00 74.72  ? 463  LEU B C   1 
ATOM   7675 O  O   . LEU B  1 463 ? -13.841 -3.381  -36.529 1.00 80.34  ? 463  LEU B O   1 
ATOM   7676 C  CB  . LEU B  1 463 ? -13.472 -1.799  -39.063 1.00 66.01  ? 463  LEU B CB  1 
ATOM   7677 C  CG  . LEU B  1 463 ? -12.985 -1.715  -40.513 1.00 66.67  ? 463  LEU B CG  1 
ATOM   7678 C  CD1 . LEU B  1 463 ? -11.872 -0.688  -40.685 1.00 61.34  ? 463  LEU B CD1 1 
ATOM   7679 C  CD2 . LEU B  1 463 ? -12.526 -3.080  -40.977 1.00 67.34  ? 463  LEU B CD2 1 
ATOM   7680 N  N   . ASN B  1 464 ? -15.996 -2.795  -36.857 1.00 73.39  ? 464  ASN B N   1 
ATOM   7681 C  CA  . ASN B  1 464 ? -16.438 -3.034  -35.478 1.00 78.68  ? 464  ASN B CA  1 
ATOM   7682 C  C   . ASN B  1 464 ? -15.790 -2.173  -34.387 1.00 75.46  ? 464  ASN B C   1 
ATOM   7683 O  O   . ASN B  1 464 ? -15.785 -2.556  -33.216 1.00 83.77  ? 464  ASN B O   1 
ATOM   7684 C  CB  . ASN B  1 464 ? -16.324 -4.524  -35.116 1.00 86.20  ? 464  ASN B CB  1 
ATOM   7685 C  CG  . ASN B  1 464 ? -17.211 -5.405  -35.974 1.00 92.42  ? 464  ASN B CG  1 
ATOM   7686 O  OD1 . ASN B  1 464 ? -18.316 -5.014  -36.350 1.00 97.32  ? 464  ASN B OD1 1 
ATOM   7687 N  ND2 . ASN B  1 464 ? -16.732 -6.605  -36.286 1.00 91.37  ? 464  ASN B ND2 1 
ATOM   7688 N  N   . TYR B  1 465 ? -15.254 -1.014  -34.762 1.00 65.20  ? 465  TYR B N   1 
ATOM   7689 C  CA  . TYR B  1 465 ? -14.767 -0.057  -33.769 1.00 59.22  ? 465  TYR B CA  1 
ATOM   7690 C  C   . TYR B  1 465 ? -15.945 0.514   -32.976 1.00 61.19  ? 465  TYR B C   1 
ATOM   7691 O  O   . TYR B  1 465 ? -17.097 0.364   -33.380 1.00 68.77  ? 465  TYR B O   1 
ATOM   7692 C  CB  . TYR B  1 465 ? -13.998 1.084   -34.440 1.00 51.25  ? 465  TYR B CB  1 
ATOM   7693 C  CG  . TYR B  1 465 ? -12.632 0.713   -34.977 1.00 52.31  ? 465  TYR B CG  1 
ATOM   7694 C  CD1 . TYR B  1 465 ? -11.502 0.775   -34.170 1.00 54.48  ? 465  TYR B CD1 1 
ATOM   7695 C  CD2 . TYR B  1 465 ? -12.469 0.325   -36.298 1.00 55.46  ? 465  TYR B CD2 1 
ATOM   7696 C  CE1 . TYR B  1 465 ? -10.251 0.448   -34.665 1.00 54.04  ? 465  TYR B CE1 1 
ATOM   7697 C  CE2 . TYR B  1 465 ? -11.226 0.002   -36.802 1.00 57.33  ? 465  TYR B CE2 1 
ATOM   7698 C  CZ  . TYR B  1 465 ? -10.121 0.064   -35.983 1.00 57.42  ? 465  TYR B CZ  1 
ATOM   7699 O  OH  . TYR B  1 465 ? -8.884  -0.264  -36.491 1.00 50.46  ? 465  TYR B OH  1 
ATOM   7700 N  N   . THR B  1 466 ? -15.661 1.163   -31.850 1.00 57.50  ? 466  THR B N   1 
ATOM   7701 C  CA  . THR B  1 466 ? -16.715 1.794   -31.053 1.00 59.89  ? 466  THR B CA  1 
ATOM   7702 C  C   . THR B  1 466 ? -17.037 3.190   -31.580 1.00 66.58  ? 466  THR B C   1 
ATOM   7703 O  O   . THR B  1 466 ? -16.214 3.809   -32.254 1.00 72.30  ? 466  THR B O   1 
ATOM   7704 C  CB  . THR B  1 466 ? -16.345 1.885   -29.552 1.00 59.42  ? 466  THR B CB  1 
ATOM   7705 O  OG1 . THR B  1 466 ? -15.477 3.002   -29.323 1.00 59.94  ? 466  THR B OG1 1 
ATOM   7706 C  CG2 . THR B  1 466 ? -15.666 0.609   -29.087 1.00 56.02  ? 466  THR B CG2 1 
ATOM   7707 N  N   . THR B  1 467 ? -18.238 3.674   -31.274 1.00 67.50  ? 467  THR B N   1 
ATOM   7708 C  CA  . THR B  1 467 ? -18.683 4.996   -31.711 1.00 69.41  ? 467  THR B CA  1 
ATOM   7709 C  C   . THR B  1 467 ? -17.840 6.112   -31.095 1.00 69.55  ? 467  THR B C   1 
ATOM   7710 O  O   . THR B  1 467 ? -17.750 7.208   -31.649 1.00 74.12  ? 467  THR B O   1 
ATOM   7711 C  CB  . THR B  1 467 ? -20.182 5.220   -31.397 1.00 68.48  ? 467  THR B CB  1 
ATOM   7712 O  OG1 . THR B  1 467 ? -20.393 6.572   -30.972 1.00 67.41  ? 467  THR B OG1 1 
ATOM   7713 C  CG2 . THR B  1 467 ? -20.639 4.280   -30.296 1.00 65.26  ? 467  THR B CG2 1 
ATOM   7714 N  N   . GLU B  1 468 ? -17.219 5.829   -29.954 1.00 66.18  ? 468  GLU B N   1 
ATOM   7715 C  CA  . GLU B  1 468 ? -16.316 6.787   -29.327 1.00 67.38  ? 468  GLU B CA  1 
ATOM   7716 C  C   . GLU B  1 468 ? -14.979 6.817   -30.067 1.00 62.55  ? 468  GLU B C   1 
ATOM   7717 O  O   . GLU B  1 468 ? -14.348 7.869   -30.188 1.00 53.38  ? 468  GLU B O   1 
ATOM   7718 C  CB  . GLU B  1 468 ? -16.099 6.456   -27.845 1.00 74.12  ? 468  GLU B CB  1 
ATOM   7719 C  CG  . GLU B  1 468 ? -17.380 6.329   -27.028 1.00 86.21  ? 468  GLU B CG  1 
ATOM   7720 C  CD  . GLU B  1 468 ? -17.929 4.913   -27.008 1.00 94.08  ? 468  GLU B CD  1 
ATOM   7721 O  OE1 . GLU B  1 468 ? -17.225 4.009   -26.509 1.00 99.77  ? 468  GLU B OE1 1 
ATOM   7722 O  OE2 . GLU B  1 468 ? -19.067 4.703   -27.479 1.00 91.21  ? 468  GLU B OE2 1 
ATOM   7723 N  N   . GLU B  1 469 ? -14.555 5.657   -30.563 1.00 62.08  ? 469  GLU B N   1 
ATOM   7724 C  CA  . GLU B  1 469 ? -13.327 5.552   -31.345 1.00 56.75  ? 469  GLU B CA  1 
ATOM   7725 C  C   . GLU B  1 469 ? -13.485 6.240   -32.694 1.00 60.18  ? 469  GLU B C   1 
ATOM   7726 O  O   . GLU B  1 469 ? -12.526 6.787   -33.241 1.00 62.28  ? 469  GLU B O   1 
ATOM   7727 C  CB  . GLU B  1 469 ? -12.942 4.082   -31.548 1.00 53.01  ? 469  GLU B CB  1 
ATOM   7728 C  CG  . GLU B  1 469 ? -12.211 3.454   -30.370 1.00 53.02  ? 469  GLU B CG  1 
ATOM   7729 C  CD  . GLU B  1 469 ? -12.118 1.947   -30.479 1.00 57.68  ? 469  GLU B CD  1 
ATOM   7730 O  OE1 . GLU B  1 469 ? -13.006 1.346   -31.121 1.00 56.24  ? 469  GLU B OE1 1 
ATOM   7731 O  OE2 . GLU B  1 469 ? -11.164 1.364   -29.919 1.00 56.40  ? 469  GLU B OE2 1 
ATOM   7732 N  N   . ARG B  1 470 ? -14.701 6.206   -33.229 1.00 57.71  ? 470  ARG B N   1 
ATOM   7733 C  CA  . ARG B  1 470 ? -15.000 6.847   -34.506 1.00 53.93  ? 470  ARG B CA  1 
ATOM   7734 C  C   . ARG B  1 470 ? -14.887 8.367   -34.375 1.00 52.89  ? 470  ARG B C   1 
ATOM   7735 O  O   . ARG B  1 470 ? -14.285 9.031   -35.220 1.00 50.91  ? 470  ARG B O   1 
ATOM   7736 C  CB  . ARG B  1 470 ? -16.396 6.438   -34.987 1.00 59.96  ? 470  ARG B CB  1 
ATOM   7737 C  CG  . ARG B  1 470 ? -16.756 6.931   -36.379 1.00 69.88  ? 470  ARG B CG  1 
ATOM   7738 C  CD  . ARG B  1 470 ? -17.713 8.115   -36.325 1.00 76.09  ? 470  ARG B CD  1 
ATOM   7739 N  NE  . ARG B  1 470 ? -19.006 7.757   -35.745 1.00 85.45  ? 470  ARG B NE  1 
ATOM   7740 C  CZ  . ARG B  1 470 ? -19.996 8.620   -35.532 1.00 89.31  ? 470  ARG B CZ  1 
ATOM   7741 N  NH1 . ARG B  1 470 ? -19.845 9.898   -35.849 1.00 91.05  ? 470  ARG B NH1 1 
ATOM   7742 N  NH2 . ARG B  1 470 ? -21.138 8.206   -34.999 1.00 87.47  ? 470  ARG B NH2 1 
ATOM   7743 N  N   . ILE B  1 471 ? -15.461 8.903   -33.301 1.00 54.05  ? 471  ILE B N   1 
ATOM   7744 C  CA  . ILE B  1 471 ? -15.342 10.322  -32.970 1.00 57.58  ? 471  ILE B CA  1 
ATOM   7745 C  C   . ILE B  1 471 ? -13.877 10.708  -32.730 1.00 53.35  ? 471  ILE B C   1 
ATOM   7746 O  O   . ILE B  1 471 ? -13.441 11.798  -33.111 1.00 56.30  ? 471  ILE B O   1 
ATOM   7747 C  CB  . ILE B  1 471 ? -16.199 10.673  -31.726 1.00 51.85  ? 471  ILE B CB  1 
ATOM   7748 C  CG1 . ILE B  1 471 ? -17.682 10.413  -32.009 1.00 56.16  ? 471  ILE B CG1 1 
ATOM   7749 C  CG2 . ILE B  1 471 ? -15.994 12.118  -31.305 1.00 38.31  ? 471  ILE B CG2 1 
ATOM   7750 C  CD1 . ILE B  1 471 ? -18.576 10.588  -30.796 1.00 58.60  ? 471  ILE B CD1 1 
ATOM   7751 N  N   . PHE B  1 472 ? -13.124 9.804   -32.109 1.00 40.03  ? 472  PHE B N   1 
ATOM   7752 C  CA  . PHE B  1 472 ? -11.697 10.001  -31.875 1.00 39.10  ? 472  PHE B CA  1 
ATOM   7753 C  C   . PHE B  1 472 ? -10.921 10.079  -33.187 1.00 45.00  ? 472  PHE B C   1 
ATOM   7754 O  O   . PHE B  1 472 ? -10.059 10.940  -33.354 1.00 45.59  ? 472  PHE B O   1 
ATOM   7755 C  CB  . PHE B  1 472 ? -11.140 8.869   -31.009 1.00 37.99  ? 472  PHE B CB  1 
ATOM   7756 C  CG  . PHE B  1 472 ? -9.694  9.048   -30.630 1.00 37.27  ? 472  PHE B CG  1 
ATOM   7757 C  CD1 . PHE B  1 472 ? -9.226  10.281  -30.185 1.00 31.90  ? 472  PHE B CD1 1 
ATOM   7758 C  CD2 . PHE B  1 472 ? -8.805  7.982   -30.702 1.00 35.02  ? 472  PHE B CD2 1 
ATOM   7759 C  CE1 . PHE B  1 472 ? -7.892  10.450  -29.833 1.00 37.19  ? 472  PHE B CE1 1 
ATOM   7760 C  CE2 . PHE B  1 472 ? -7.471  8.142   -30.349 1.00 38.67  ? 472  PHE B CE2 1 
ATOM   7761 C  CZ  . PHE B  1 472 ? -7.013  9.379   -29.913 1.00 42.12  ? 472  PHE B CZ  1 
ATOM   7762 N  N   . ALA B  1 473 ? -11.226 9.174   -34.112 1.00 43.77  ? 473  ALA B N   1 
ATOM   7763 C  CA  . ALA B  1 473 ? -10.533 9.139   -35.396 1.00 44.70  ? 473  ALA B CA  1 
ATOM   7764 C  C   . ALA B  1 473 ? -10.740 10.434  -36.176 1.00 42.99  ? 473  ALA B C   1 
ATOM   7765 O  O   . ALA B  1 473 ? -9.801  10.967  -36.772 1.00 42.48  ? 473  ALA B O   1 
ATOM   7766 C  CB  . ALA B  1 473 ? -10.992 7.946   -36.214 1.00 39.69  ? 473  ALA B CB  1 
ATOM   7767 N  N   . GLN B  1 474 ? -11.974 10.932  -36.166 1.00 42.12  ? 474  GLN B N   1 
ATOM   7768 C  CA  . GLN B  1 474 ? -12.314 12.177  -36.848 1.00 46.78  ? 474  GLN B CA  1 
ATOM   7769 C  C   . GLN B  1 474 ? -11.532 13.362  -36.280 1.00 52.68  ? 474  GLN B C   1 
ATOM   7770 O  O   . GLN B  1 474 ? -11.174 14.287  -37.012 1.00 53.82  ? 474  GLN B O   1 
ATOM   7771 C  CB  . GLN B  1 474 ? -13.823 12.446  -36.758 1.00 48.85  ? 474  GLN B CB  1 
ATOM   7772 C  CG  . GLN B  1 474 ? -14.703 11.346  -37.347 1.00 61.31  ? 474  GLN B CG  1 
ATOM   7773 C  CD  . GLN B  1 474 ? -16.179 11.714  -37.371 1.00 71.52  ? 474  GLN B CD  1 
ATOM   7774 O  OE1 . GLN B  1 474 ? -16.967 11.227  -36.561 1.00 71.12  ? 474  GLN B OE1 1 
ATOM   7775 N  NE2 . GLN B  1 474 ? -16.560 12.569  -38.312 1.00 74.20  ? 474  GLN B NE2 1 
ATOM   7776 N  N   . ARG B  1 475 ? -11.272 13.329  -34.975 1.00 51.36  ? 475  ARG B N   1 
ATOM   7777 C  CA  . ARG B  1 475 ? -10.504 14.382  -34.320 1.00 45.04  ? 475  ARG B CA  1 
ATOM   7778 C  C   . ARG B  1 475 ? -9.066  14.383  -34.821 1.00 42.43  ? 475  ARG B C   1 
ATOM   7779 O  O   . ARG B  1 475 ? -8.501  15.439  -35.112 1.00 43.71  ? 475  ARG B O   1 
ATOM   7780 C  CB  . ARG B  1 475 ? -10.529 14.200  -32.798 1.00 54.50  ? 475  ARG B CB  1 
ATOM   7781 C  CG  . ARG B  1 475 ? -11.078 15.403  -32.035 1.00 63.92  ? 475  ARG B CG  1 
ATOM   7782 C  CD  . ARG B  1 475 ? -11.201 15.118  -30.546 1.00 60.29  ? 475  ARG B CD  1 
ATOM   7783 N  NE  . ARG B  1 475 ? -9.910  15.177  -29.869 1.00 60.77  ? 475  ARG B NE  1 
ATOM   7784 C  CZ  . ARG B  1 475 ? -9.536  14.350  -28.898 1.00 47.43  ? 475  ARG B CZ  1 
ATOM   7785 N  NH1 . ARG B  1 475 ? -10.354 13.392  -28.488 1.00 45.97  ? 475  ARG B NH1 1 
ATOM   7786 N  NH2 . ARG B  1 475 ? -8.341  14.478  -28.342 1.00 42.25  ? 475  ARG B NH2 1 
ATOM   7787 N  N   . LEU B  1 476 ? -8.485  13.193  -34.934 1.00 33.32  ? 476  LEU B N   1 
ATOM   7788 C  CA  . LEU B  1 476 ? -7.095  13.051  -35.357 1.00 40.63  ? 476  LEU B CA  1 
ATOM   7789 C  C   . LEU B  1 476 ? -6.891  13.436  -36.820 1.00 39.51  ? 476  LEU B C   1 
ATOM   7790 O  O   . LEU B  1 476 ? -5.866  14.024  -37.176 1.00 40.08  ? 476  LEU B O   1 
ATOM   7791 C  CB  . LEU B  1 476 ? -6.610  11.621  -35.108 1.00 45.83  ? 476  LEU B CB  1 
ATOM   7792 C  CG  . LEU B  1 476 ? -6.742  11.154  -33.655 1.00 46.93  ? 476  LEU B CG  1 
ATOM   7793 C  CD1 . LEU B  1 476 ? -6.402  9.685   -33.511 1.00 50.67  ? 476  LEU B CD1 1 
ATOM   7794 C  CD2 . LEU B  1 476 ? -5.856  11.987  -32.759 1.00 37.08  ? 476  LEU B CD2 1 
ATOM   7795 N  N   . MET B  1 477 ? -7.868  13.109  -37.663 1.00 38.80  ? 477  MET B N   1 
ATOM   7796 C  CA  . MET B  1 477 ? -7.797  13.459  -39.077 1.00 44.21  ? 477  MET B CA  1 
ATOM   7797 C  C   . MET B  1 477 ? -7.794  14.975  -39.237 1.00 47.07  ? 477  MET B C   1 
ATOM   7798 O  O   . MET B  1 477 ? -7.142  15.507  -40.134 1.00 48.36  ? 477  MET B O   1 
ATOM   7799 C  CB  . MET B  1 477 ? -8.963  12.833  -39.853 1.00 52.33  ? 477  MET B CB  1 
ATOM   7800 C  CG  . MET B  1 477 ? -8.904  11.311  -39.937 1.00 53.47  ? 477  MET B CG  1 
ATOM   7801 S  SD  . MET B  1 477 ? -10.487 10.531  -40.331 1.00 67.82  ? 477  MET B SD  1 
ATOM   7802 C  CE  . MET B  1 477 ? -10.662 10.922  -42.069 1.00 36.60  ? 477  MET B CE  1 
ATOM   7803 N  N   . LYS B  1 478 ? -8.508  15.669  -38.352 1.00 44.60  ? 478  LYS B N   1 
ATOM   7804 C  CA  . LYS B  1 478 ? -8.531  17.130  -38.379 1.00 43.95  ? 478  LYS B CA  1 
ATOM   7805 C  C   . LYS B  1 478 ? -7.190  17.731  -37.963 1.00 41.91  ? 478  LYS B C   1 
ATOM   7806 O  O   . LYS B  1 478 ? -6.688  18.626  -38.636 1.00 42.78  ? 478  LYS B O   1 
ATOM   7807 C  CB  . LYS B  1 478 ? -9.670  17.694  -37.520 1.00 46.22  ? 478  LYS B CB  1 
ATOM   7808 C  CG  . LYS B  1 478 ? -11.058 17.501  -38.118 1.00 62.45  ? 478  LYS B CG  1 
ATOM   7809 C  CD  . LYS B  1 478 ? -11.884 18.786  -38.071 1.00 73.96  ? 478  LYS B CD  1 
ATOM   7810 C  CE  . LYS B  1 478 ? -11.577 19.709  -39.247 1.00 82.23  ? 478  LYS B CE  1 
ATOM   7811 N  NZ  . LYS B  1 478 ? -12.150 19.223  -40.540 1.00 81.68  ? 478  LYS B NZ  1 
ATOM   7812 N  N   . TYR B  1 479 ? -6.618  17.235  -36.864 1.00 38.35  ? 479  TYR B N   1 
ATOM   7813 C  CA  . TYR B  1 479 ? -5.277  17.634  -36.428 1.00 36.15  ? 479  TYR B CA  1 
ATOM   7814 C  C   . TYR B  1 479 ? -4.279  17.492  -37.569 1.00 38.18  ? 479  TYR B C   1 
ATOM   7815 O  O   . TYR B  1 479 ? -3.590  18.447  -37.935 1.00 39.12  ? 479  TYR B O   1 
ATOM   7816 C  CB  . TYR B  1 479 ? -4.805  16.751  -35.267 1.00 44.27  ? 479  TYR B CB  1 
ATOM   7817 C  CG  . TYR B  1 479 ? -5.540  16.942  -33.961 1.00 42.58  ? 479  TYR B CG  1 
ATOM   7818 C  CD1 . TYR B  1 479 ? -6.006  18.191  -33.575 1.00 40.63  ? 479  TYR B CD1 1 
ATOM   7819 C  CD2 . TYR B  1 479 ? -5.759  15.869  -33.105 1.00 45.97  ? 479  TYR B CD2 1 
ATOM   7820 C  CE1 . TYR B  1 479 ? -6.675  18.363  -32.377 1.00 43.76  ? 479  TYR B CE1 1 
ATOM   7821 C  CE2 . TYR B  1 479 ? -6.428  16.032  -31.909 1.00 43.67  ? 479  TYR B CE2 1 
ATOM   7822 C  CZ  . TYR B  1 479 ? -6.882  17.282  -31.549 1.00 48.24  ? 479  TYR B CZ  1 
ATOM   7823 O  OH  . TYR B  1 479 ? -7.550  17.458  -30.356 1.00 52.92  ? 479  TYR B OH  1 
ATOM   7824 N  N   . TRP B  1 480 ? -4.210  16.287  -38.125 1.00 38.60  ? 480  TRP B N   1 
ATOM   7825 C  CA  . TRP B  1 480 ? -3.254  15.971  -39.182 1.00 38.96  ? 480  TRP B CA  1 
ATOM   7826 C  C   . TRP B  1 480 ? -3.463  16.800  -40.452 1.00 41.26  ? 480  TRP B C   1 
ATOM   7827 O  O   . TRP B  1 480 ? -2.503  17.321  -41.018 1.00 39.63  ? 480  TRP B O   1 
ATOM   7828 C  CB  . TRP B  1 480 ? -3.289  14.470  -39.494 1.00 35.89  ? 480  TRP B CB  1 
ATOM   7829 C  CG  . TRP B  1 480 ? -2.177  13.701  -38.841 1.00 36.93  ? 480  TRP B CG  1 
ATOM   7830 C  CD1 . TRP B  1 480 ? -1.139  13.073  -39.466 1.00 38.76  ? 480  TRP B CD1 1 
ATOM   7831 C  CD2 . TRP B  1 480 ? -1.981  13.494  -37.435 1.00 44.98  ? 480  TRP B CD2 1 
ATOM   7832 N  NE1 . TRP B  1 480 ? -0.316  12.481  -38.539 1.00 39.04  ? 480  TRP B NE1 1 
ATOM   7833 C  CE2 . TRP B  1 480 ? -0.809  12.726  -37.284 1.00 42.66  ? 480  TRP B CE2 1 
ATOM   7834 C  CE3 . TRP B  1 480 ? -2.684  13.881  -36.290 1.00 44.02  ? 480  TRP B CE3 1 
ATOM   7835 C  CZ2 . TRP B  1 480 ? -0.324  12.339  -36.034 1.00 40.38  ? 480  TRP B CZ2 1 
ATOM   7836 C  CZ3 . TRP B  1 480 ? -2.202  13.495  -35.050 1.00 39.15  ? 480  TRP B CZ3 1 
ATOM   7837 C  CH2 . TRP B  1 480 ? -1.035  12.733  -34.931 1.00 42.39  ? 480  TRP B CH2 1 
ATOM   7838 N  N   . THR B  1 481 ? -4.714  16.929  -40.890 1.00 38.73  ? 481  THR B N   1 
ATOM   7839 C  CA  . THR B  1 481 ? -5.030  17.715  -42.087 1.00 36.79  ? 481  THR B CA  1 
ATOM   7840 C  C   . THR B  1 481 ? -4.900  19.226  -41.874 1.00 41.04  ? 481  THR B C   1 
ATOM   7841 O  O   . THR B  1 481 ? -4.379  19.932  -42.741 1.00 48.69  ? 481  THR B O   1 
ATOM   7842 C  CB  . THR B  1 481 ? -6.426  17.379  -42.657 1.00 41.76  ? 481  THR B CB  1 
ATOM   7843 O  OG1 . THR B  1 481 ? -7.410  17.459  -41.618 1.00 51.71  ? 481  THR B OG1 1 
ATOM   7844 C  CG2 . THR B  1 481 ? -6.434  15.983  -43.255 1.00 37.04  ? 481  THR B CG2 1 
ATOM   7845 N  N   . ASN B  1 482 ? -5.379  19.725  -40.736 1.00 44.30  ? 482  ASN B N   1 
ATOM   7846 C  CA  . ASN B  1 482 ? -5.196  21.138  -40.408 1.00 45.40  ? 482  ASN B CA  1 
ATOM   7847 C  C   . ASN B  1 482 ? -3.715  21.493  -40.347 1.00 39.03  ? 482  ASN B C   1 
ATOM   7848 O  O   . ASN B  1 482 ? -3.305  22.554  -40.820 1.00 42.07  ? 482  ASN B O   1 
ATOM   7849 C  CB  . ASN B  1 482 ? -5.897  21.520  -39.098 1.00 45.34  ? 482  ASN B CB  1 
ATOM   7850 C  CG  . ASN B  1 482 ? -7.372  21.847  -39.293 1.00 54.41  ? 482  ASN B CG  1 
ATOM   7851 O  OD1 . ASN B  1 482 ? -7.744  22.586  -40.208 1.00 59.75  ? 482  ASN B OD1 1 
ATOM   7852 N  ND2 . ASN B  1 482 ? -8.218  21.299  -38.429 1.00 55.50  ? 482  ASN B ND2 1 
ATOM   7853 N  N   . PHE B  1 483 ? -2.913  20.598  -39.777 1.00 30.05  ? 483  PHE B N   1 
ATOM   7854 C  CA  . PHE B  1 483 ? -1.466  20.778  -39.786 1.00 36.32  ? 483  PHE B CA  1 
ATOM   7855 C  C   . PHE B  1 483 ? -0.923  20.853  -41.216 1.00 44.88  ? 483  PHE B C   1 
ATOM   7856 O  O   . PHE B  1 483 ? -0.059  21.676  -41.515 1.00 44.97  ? 483  PHE B O   1 
ATOM   7857 C  CB  . PHE B  1 483 ? -0.756  19.662  -39.014 1.00 32.82  ? 483  PHE B CB  1 
ATOM   7858 C  CG  . PHE B  1 483 ? 0.744   19.725  -39.117 1.00 37.64  ? 483  PHE B CG  1 
ATOM   7859 C  CD1 . PHE B  1 483 ? 1.467   20.637  -38.356 1.00 35.03  ? 483  PHE B CD1 1 
ATOM   7860 C  CD2 . PHE B  1 483 ? 1.432   18.887  -39.989 1.00 31.12  ? 483  PHE B CD2 1 
ATOM   7861 C  CE1 . PHE B  1 483 ? 2.850   20.708  -38.456 1.00 41.41  ? 483  PHE B CE1 1 
ATOM   7862 C  CE2 . PHE B  1 483 ? 2.813   18.954  -40.098 1.00 30.63  ? 483  PHE B CE2 1 
ATOM   7863 C  CZ  . PHE B  1 483 ? 3.524   19.865  -39.329 1.00 37.26  ? 483  PHE B CZ  1 
ATOM   7864 N  N   . ALA B  1 484 ? -1.425  19.993  -42.097 1.00 40.09  ? 484  ALA B N   1 
ATOM   7865 C  CA  . ALA B  1 484 ? -0.988  20.002  -43.493 1.00 41.23  ? 484  ALA B CA  1 
ATOM   7866 C  C   . ALA B  1 484 ? -1.328  21.322  -44.181 1.00 40.23  ? 484  ALA B C   1 
ATOM   7867 O  O   . ALA B  1 484 ? -0.521  21.864  -44.941 1.00 42.07  ? 484  ALA B O   1 
ATOM   7868 C  CB  . ALA B  1 484 ? -1.601  18.836  -44.252 1.00 31.06  ? 484  ALA B CB  1 
ATOM   7869 N  N   . ARG B  1 485 ? -2.528  21.830  -43.911 1.00 38.04  ? 485  ARG B N   1 
ATOM   7870 C  CA  . ARG B  1 485 ? -3.002  23.079  -44.503 1.00 43.31  ? 485  ARG B CA  1 
ATOM   7871 C  C   . ARG B  1 485 ? -2.260  24.300  -43.969 1.00 52.64  ? 485  ARG B C   1 
ATOM   7872 O  O   . ARG B  1 485 ? -2.051  25.272  -44.695 1.00 59.53  ? 485  ARG B O   1 
ATOM   7873 C  CB  . ARG B  1 485 ? -4.499  23.269  -44.216 1.00 43.04  ? 485  ARG B CB  1 
ATOM   7874 C  CG  . ARG B  1 485 ? -5.433  22.278  -44.896 1.00 53.10  ? 485  ARG B CG  1 
ATOM   7875 C  CD  . ARG B  1 485 ? -6.890  22.542  -44.512 1.00 57.56  ? 485  ARG B CD  1 
ATOM   7876 N  NE  . ARG B  1 485 ? -7.323  21.746  -43.364 1.00 64.79  ? 485  ARG B NE  1 
ATOM   7877 C  CZ  . ARG B  1 485 ? -8.123  20.686  -43.445 1.00 69.86  ? 485  ARG B CZ  1 
ATOM   7878 N  NH1 . ARG B  1 485 ? -8.593  20.290  -44.621 1.00 61.48  ? 485  ARG B NH1 1 
ATOM   7879 N  NH2 . ARG B  1 485 ? -8.461  20.025  -42.347 1.00 76.35  ? 485  ARG B NH2 1 
ATOM   7880 N  N   . THR B  1 486 ? -1.875  24.249  -42.696 1.00 49.08  ? 486  THR B N   1 
ATOM   7881 C  CA  . THR B  1 486 ? -1.430  25.450  -41.993 1.00 44.81  ? 486  THR B CA  1 
ATOM   7882 C  C   . THR B  1 486 ? -0.072  25.351  -41.290 1.00 49.30  ? 486  THR B C   1 
ATOM   7883 O  O   . THR B  1 486 ? 0.608   26.361  -41.108 1.00 57.40  ? 486  THR B O   1 
ATOM   7884 C  CB  . THR B  1 486 ? -2.491  25.903  -40.959 1.00 49.00  ? 486  THR B CB  1 
ATOM   7885 O  OG1 . THR B  1 486 ? -2.807  24.817  -40.077 1.00 50.07  ? 486  THR B OG1 1 
ATOM   7886 C  CG2 . THR B  1 486 ? -3.759  26.361  -41.661 1.00 39.91  ? 486  THR B CG2 1 
ATOM   7887 N  N   . GLY B  1 487 ? 0.321   24.148  -40.890 1.00 48.29  ? 487  GLY B N   1 
ATOM   7888 C  CA  . GLY B  1 487 ? 1.482   24.000  -40.029 1.00 43.83  ? 487  GLY B CA  1 
ATOM   7889 C  C   . GLY B  1 487 ? 1.054   24.097  -38.578 1.00 45.82  ? 487  GLY B C   1 
ATOM   7890 O  O   . GLY B  1 487 ? 1.886   24.140  -37.669 1.00 42.97  ? 487  GLY B O   1 
ATOM   7891 N  N   . ASP B  1 488 ? -0.263  24.137  -38.378 1.00 45.44  ? 488  ASP B N   1 
ATOM   7892 C  CA  . ASP B  1 488 ? -0.876  24.239  -37.059 1.00 43.26  ? 488  ASP B CA  1 
ATOM   7893 C  C   . ASP B  1 488 ? -2.068  23.286  -37.003 1.00 40.41  ? 488  ASP B C   1 
ATOM   7894 O  O   . ASP B  1 488 ? -3.051  23.473  -37.721 1.00 43.14  ? 488  ASP B O   1 
ATOM   7895 C  CB  . ASP B  1 488 ? -1.334  25.680  -36.803 1.00 48.01  ? 488  ASP B CB  1 
ATOM   7896 C  CG  . ASP B  1 488 ? -1.810  25.909  -35.376 1.00 51.42  ? 488  ASP B CG  1 
ATOM   7897 O  OD1 . ASP B  1 488 ? -2.123  24.929  -34.666 1.00 50.90  ? 488  ASP B OD1 1 
ATOM   7898 O  OD2 . ASP B  1 488 ? -1.886  27.085  -34.962 1.00 54.34  ? 488  ASP B OD2 1 
ATOM   7899 N  N   . PRO B  1 489 ? -1.985  22.263  -36.136 1.00 39.26  ? 489  PRO B N   1 
ATOM   7900 C  CA  . PRO B  1 489 ? -3.024  21.232  -36.016 1.00 38.30  ? 489  PRO B CA  1 
ATOM   7901 C  C   . PRO B  1 489 ? -4.286  21.721  -35.307 1.00 44.29  ? 489  PRO B C   1 
ATOM   7902 O  O   . PRO B  1 489 ? -5.251  20.962  -35.196 1.00 50.31  ? 489  PRO B O   1 
ATOM   7903 C  CB  . PRO B  1 489 ? -2.341  20.156  -35.164 1.00 39.54  ? 489  PRO B CB  1 
ATOM   7904 C  CG  . PRO B  1 489 ? -1.376  20.921  -34.312 1.00 41.16  ? 489  PRO B CG  1 
ATOM   7905 C  CD  . PRO B  1 489 ? -0.866  22.031  -35.201 1.00 39.25  ? 489  PRO B CD  1 
ATOM   7906 N  N   . ASN B  1 490 ? -4.278  22.962  -34.833 1.00 39.42  ? 490  ASN B N   1 
ATOM   7907 C  CA  . ASN B  1 490 ? -5.447  23.519  -34.159 1.00 45.55  ? 490  ASN B CA  1 
ATOM   7908 C  C   . ASN B  1 490 ? -6.559  23.943  -35.123 1.00 53.05  ? 490  ASN B C   1 
ATOM   7909 O  O   . ASN B  1 490 ? -6.335  24.755  -36.023 1.00 61.12  ? 490  ASN B O   1 
ATOM   7910 C  CB  . ASN B  1 490 ? -5.045  24.692  -33.259 1.00 45.20  ? 490  ASN B CB  1 
ATOM   7911 C  CG  . ASN B  1 490 ? -4.275  24.246  -32.025 1.00 49.31  ? 490  ASN B CG  1 
ATOM   7912 O  OD1 . ASN B  1 490 ? -4.845  23.658  -31.104 1.00 54.77  ? 490  ASN B OD1 1 
ATOM   7913 N  ND2 . ASN B  1 490 ? -2.979  24.534  -31.995 1.00 42.43  ? 490  ASN B ND2 1 
ATOM   7914 N  N   . ASP B  1 491 ? -7.752  23.385  -34.919 1.00 61.21  ? 491  ASP B N   1 
ATOM   7915 C  CA  . ASP B  1 491 ? -8.943  23.729  -35.697 1.00 69.17  ? 491  ASP B CA  1 
ATOM   7916 C  C   . ASP B  1 491 ? -9.258  25.216  -35.521 1.00 71.40  ? 491  ASP B C   1 
ATOM   7917 O  O   . ASP B  1 491 ? -9.482  25.674  -34.399 1.00 76.34  ? 491  ASP B O   1 
ATOM   7918 C  CB  . ASP B  1 491 ? -10.127 22.875  -35.222 1.00 73.06  ? 491  ASP B CB  1 
ATOM   7919 C  CG  . ASP B  1 491 ? -11.255 22.797  -36.239 1.00 78.41  ? 491  ASP B CG  1 
ATOM   7920 O  OD1 . ASP B  1 491 ? -11.391 23.715  -37.076 1.00 77.76  ? 491  ASP B OD1 1 
ATOM   7921 O  OD2 . ASP B  1 491 ? -12.019 21.809  -36.190 1.00 81.92  ? 491  ASP B OD2 1 
ATOM   7922 N  N   . PRO B  1 492 ? -9.259  25.979  -36.629 1.00 73.39  ? 492  PRO B N   1 
ATOM   7923 C  CA  . PRO B  1 492 ? -9.506  27.426  -36.564 1.00 76.39  ? 492  PRO B CA  1 
ATOM   7924 C  C   . PRO B  1 492 ? -10.981 27.771  -36.373 1.00 75.17  ? 492  PRO B C   1 
ATOM   7925 O  O   . PRO B  1 492 ? -11.324 28.948  -36.242 1.00 80.23  ? 492  PRO B O   1 
ATOM   7926 C  CB  . PRO B  1 492 ? -9.018  27.923  -37.928 1.00 77.90  ? 492  PRO B CB  1 
ATOM   7927 C  CG  . PRO B  1 492 ? -9.206  26.755  -38.835 1.00 74.84  ? 492  PRO B CG  1 
ATOM   7928 C  CD  . PRO B  1 492 ? -8.921  25.538  -37.995 1.00 74.54  ? 492  PRO B CD  1 
ATOM   7929 N  N   . ARG B  1 493 ? -11.840 26.755  -36.368 1.00 72.18  ? 493  ARG B N   1 
ATOM   7930 C  CA  . ARG B  1 493 ? -13.257 26.952  -36.076 1.00 77.54  ? 493  ARG B CA  1 
ATOM   7931 C  C   . ARG B  1 493 ? -13.527 26.782  -34.581 1.00 77.65  ? 493  ARG B C   1 
ATOM   7932 O  O   . ARG B  1 493 ? -14.296 27.543  -33.989 1.00 77.08  ? 493  ARG B O   1 
ATOM   7933 C  CB  . ARG B  1 493 ? -14.122 25.983  -36.887 1.00 72.95  ? 493  ARG B CB  1 
ATOM   7934 N  N   . ASP B  1 494 ? -12.890 25.782  -33.978 1.00 75.91  ? 494  ASP B N   1 
ATOM   7935 C  CA  . ASP B  1 494 ? -13.021 25.544  -32.545 1.00 80.55  ? 494  ASP B CA  1 
ATOM   7936 C  C   . ASP B  1 494 ? -12.260 26.600  -31.748 1.00 78.48  ? 494  ASP B C   1 
ATOM   7937 O  O   . ASP B  1 494 ? -11.051 26.772  -31.913 1.00 78.89  ? 494  ASP B O   1 
ATOM   7938 C  CB  . ASP B  1 494 ? -12.534 24.137  -32.180 1.00 84.78  ? 494  ASP B CB  1 
ATOM   7939 C  CG  . ASP B  1 494 ? -12.764 23.797  -30.714 1.00 95.33  ? 494  ASP B CG  1 
ATOM   7940 O  OD1 . ASP B  1 494 ? -13.933 23.591  -30.321 1.00 96.93  ? 494  ASP B OD1 1 
ATOM   7941 O  OD2 . ASP B  1 494 ? -11.773 23.721  -29.956 1.00 96.48  ? 494  ASP B OD2 1 
ATOM   7942 N  N   . SER B  1 495 ? -12.985 27.307  -30.889 1.00 73.27  ? 495  SER B N   1 
ATOM   7943 C  CA  . SER B  1 495 ? -12.415 28.362  -30.061 1.00 75.20  ? 495  SER B CA  1 
ATOM   7944 C  C   . SER B  1 495 ? -12.641 28.046  -28.583 1.00 75.36  ? 495  SER B C   1 
ATOM   7945 O  O   . SER B  1 495 ? -13.072 28.904  -27.807 1.00 68.79  ? 495  SER B O   1 
ATOM   7946 C  CB  . SER B  1 495 ? -13.043 29.708  -30.431 1.00 71.72  ? 495  SER B CB  1 
ATOM   7947 O  OG  . SER B  1 495 ? -14.439 29.578  -30.648 1.00 64.43  ? 495  SER B OG  1 
ATOM   7948 N  N   . LYS B  1 496 ? -12.322 26.812  -28.202 1.00 81.48  ? 496  LYS B N   1 
ATOM   7949 C  CA  . LYS B  1 496 ? -12.738 26.267  -26.912 1.00 87.27  ? 496  LYS B CA  1 
ATOM   7950 C  C   . LYS B  1 496 ? -11.738 26.431  -25.770 1.00 99.75  ? 496  LYS B C   1 
ATOM   7951 O  O   . LYS B  1 496 ? -12.134 26.767  -24.653 1.00 108.26 ? 496  LYS B O   1 
ATOM   7952 C  CB  . LYS B  1 496 ? -13.090 24.784  -27.066 1.00 81.24  ? 496  LYS B CB  1 
ATOM   7953 N  N   . SER B  1 497 ? -10.458 26.186  -26.054 1.00 94.83  ? 497  SER B N   1 
ATOM   7954 C  CA  . SER B  1 497 ? -9.430  26.027  -25.016 1.00 92.87  ? 497  SER B CA  1 
ATOM   7955 C  C   . SER B  1 497 ? -9.706  24.779  -24.167 1.00 93.72  ? 497  SER B C   1 
ATOM   7956 O  O   . SER B  1 497 ? -10.792 24.636  -23.597 1.00 85.69  ? 497  SER B O   1 
ATOM   7957 C  CB  . SER B  1 497 ? -9.297  27.282  -24.139 1.00 83.89  ? 497  SER B CB  1 
ATOM   7958 O  OG  . SER B  1 497 ? -8.559  27.012  -22.959 1.00 74.02  ? 497  SER B OG  1 
ATOM   7959 N  N   . PRO B  1 498 ? -8.712  23.879  -24.052 1.00 92.25  ? 498  PRO B N   1 
ATOM   7960 C  CA  . PRO B  1 498 ? -7.302  24.030  -24.439 1.00 83.94  ? 498  PRO B CA  1 
ATOM   7961 C  C   . PRO B  1 498 ? -6.999  23.909  -25.936 1.00 74.51  ? 498  PRO B C   1 
ATOM   7962 O  O   . PRO B  1 498 ? -7.674  23.182  -26.667 1.00 65.36  ? 498  PRO B O   1 
ATOM   7963 C  CB  . PRO B  1 498 ? -6.628  22.875  -23.695 1.00 79.00  ? 498  PRO B CB  1 
ATOM   7964 C  CG  . PRO B  1 498 ? -7.668  21.809  -23.682 1.00 81.67  ? 498  PRO B CG  1 
ATOM   7965 C  CD  . PRO B  1 498 ? -8.987  22.529  -23.523 1.00 89.81  ? 498  PRO B CD  1 
ATOM   7966 N  N   . GLN B  1 499 ? -5.976  24.641  -26.369 1.00 66.89  ? 499  GLN B N   1 
ATOM   7967 C  CA  . GLN B  1 499 ? -5.426  24.513  -27.711 1.00 54.85  ? 499  GLN B CA  1 
ATOM   7968 C  C   . GLN B  1 499 ? -4.160  23.669  -27.626 1.00 47.31  ? 499  GLN B C   1 
ATOM   7969 O  O   . GLN B  1 499 ? -3.607  23.484  -26.542 1.00 34.32  ? 499  GLN B O   1 
ATOM   7970 C  CB  . GLN B  1 499 ? -5.070  25.894  -28.273 1.00 54.98  ? 499  GLN B CB  1 
ATOM   7971 C  CG  . GLN B  1 499 ? -6.242  26.854  -28.430 1.00 56.24  ? 499  GLN B CG  1 
ATOM   7972 C  CD  . GLN B  1 499 ? -6.962  26.693  -29.757 1.00 62.00  ? 499  GLN B CD  1 
ATOM   7973 O  OE1 . GLN B  1 499 ? -8.095  26.216  -29.807 1.00 70.47  ? 499  GLN B OE1 1 
ATOM   7974 N  NE2 . GLN B  1 499 ? -6.309  27.101  -30.839 1.00 56.89  ? 499  GLN B NE2 1 
ATOM   7975 N  N   . TRP B  1 500 ? -3.702  23.164  -28.768 1.00 45.26  ? 500  TRP B N   1 
ATOM   7976 C  CA  . TRP B  1 500 ? -2.434  22.441  -28.845 1.00 47.18  ? 500  TRP B CA  1 
ATOM   7977 C  C   . TRP B  1 500 ? -1.280  23.441  -28.965 1.00 44.65  ? 500  TRP B C   1 
ATOM   7978 O  O   . TRP B  1 500 ? -1.147  24.115  -29.985 1.00 48.63  ? 500  TRP B O   1 
ATOM   7979 C  CB  . TRP B  1 500 ? -2.449  21.500  -30.056 1.00 45.92  ? 500  TRP B CB  1 
ATOM   7980 C  CG  . TRP B  1 500 ? -1.321  20.507  -30.106 1.00 39.84  ? 500  TRP B CG  1 
ATOM   7981 C  CD1 . TRP B  1 500 ? -0.103  20.607  -29.497 1.00 39.51  ? 500  TRP B CD1 1 
ATOM   7982 C  CD2 . TRP B  1 500 ? -1.317  19.252  -30.805 1.00 43.62  ? 500  TRP B CD2 1 
ATOM   7983 N  NE1 . TRP B  1 500 ? 0.658   19.497  -29.779 1.00 42.71  ? 500  TRP B NE1 1 
ATOM   7984 C  CE2 . TRP B  1 500 ? -0.064  18.651  -30.581 1.00 41.58  ? 500  TRP B CE2 1 
ATOM   7985 C  CE3 . TRP B  1 500 ? -2.253  18.583  -31.601 1.00 42.84  ? 500  TRP B CE3 1 
ATOM   7986 C  CZ2 . TRP B  1 500 ? 0.277   17.407  -31.122 1.00 44.79  ? 500  TRP B CZ2 1 
ATOM   7987 C  CZ3 . TRP B  1 500 ? -1.913  17.348  -32.139 1.00 44.15  ? 500  TRP B CZ3 1 
ATOM   7988 C  CH2 . TRP B  1 500 ? -0.660  16.774  -31.895 1.00 44.38  ? 500  TRP B CH2 1 
ATOM   7989 N  N   . PRO B  1 501 ? -0.443  23.543  -27.919 1.00 38.78  ? 501  PRO B N   1 
ATOM   7990 C  CA  . PRO B  1 501 ? 0.652   24.516  -27.955 1.00 39.63  ? 501  PRO B CA  1 
ATOM   7991 C  C   . PRO B  1 501 ? 1.904   23.921  -28.581 1.00 39.08  ? 501  PRO B C   1 
ATOM   7992 O  O   . PRO B  1 501 ? 2.098   22.707  -28.507 1.00 40.34  ? 501  PRO B O   1 
ATOM   7993 C  CB  . PRO B  1 501 ? 0.896   24.809  -26.471 1.00 34.05  ? 501  PRO B CB  1 
ATOM   7994 C  CG  . PRO B  1 501 ? 0.554   23.525  -25.783 1.00 35.22  ? 501  PRO B CG  1 
ATOM   7995 C  CD  . PRO B  1 501 ? -0.519  22.846  -26.621 1.00 43.12  ? 501  PRO B CD  1 
ATOM   7996 N  N   . PRO B  1 502 ? 2.739   24.763  -29.209 1.00 39.59  ? 502  PRO B N   1 
ATOM   7997 C  CA  . PRO B  1 502 ? 3.996   24.274  -29.790 1.00 42.70  ? 502  PRO B CA  1 
ATOM   7998 C  C   . PRO B  1 502 ? 5.005   23.813  -28.738 1.00 42.59  ? 502  PRO B C   1 
ATOM   7999 O  O   . PRO B  1 502 ? 5.084   24.411  -27.664 1.00 43.42  ? 502  PRO B O   1 
ATOM   8000 C  CB  . PRO B  1 502 ? 4.538   25.499  -30.541 1.00 38.20  ? 502  PRO B CB  1 
ATOM   8001 C  CG  . PRO B  1 502 ? 3.813   26.678  -29.965 1.00 40.67  ? 502  PRO B CG  1 
ATOM   8002 C  CD  . PRO B  1 502 ? 2.467   26.168  -29.563 1.00 40.94  ? 502  PRO B CD  1 
ATOM   8003 N  N   . TYR B  1 503 ? 5.761   22.761  -29.047 1.00 39.95  ? 503  TYR B N   1 
ATOM   8004 C  CA  . TYR B  1 503 ? 6.825   22.290  -28.163 1.00 39.19  ? 503  TYR B CA  1 
ATOM   8005 C  C   . TYR B  1 503 ? 7.977   23.288  -28.172 1.00 43.19  ? 503  TYR B C   1 
ATOM   8006 O  O   . TYR B  1 503 ? 8.481   23.653  -29.234 1.00 52.39  ? 503  TYR B O   1 
ATOM   8007 C  CB  . TYR B  1 503 ? 7.324   20.904  -28.598 1.00 40.04  ? 503  TYR B CB  1 
ATOM   8008 C  CG  . TYR B  1 503 ? 8.409   20.307  -27.713 1.00 43.54  ? 503  TYR B CG  1 
ATOM   8009 C  CD1 . TYR B  1 503 ? 9.756   20.567  -27.950 1.00 39.79  ? 503  TYR B CD1 1 
ATOM   8010 C  CD2 . TYR B  1 503 ? 8.084   19.472  -26.650 1.00 37.02  ? 503  TYR B CD2 1 
ATOM   8011 C  CE1 . TYR B  1 503 ? 10.744  20.020  -27.147 1.00 40.73  ? 503  TYR B CE1 1 
ATOM   8012 C  CE2 . TYR B  1 503 ? 9.066   18.920  -25.845 1.00 33.66  ? 503  TYR B CE2 1 
ATOM   8013 C  CZ  . TYR B  1 503 ? 10.393  19.199  -26.098 1.00 41.17  ? 503  TYR B CZ  1 
ATOM   8014 O  OH  . TYR B  1 503 ? 11.377  18.656  -25.302 1.00 43.04  ? 503  TYR B OH  1 
ATOM   8015 N  N   . THR B  1 504 ? 8.378   23.731  -26.985 1.00 50.35  ? 504  THR B N   1 
ATOM   8016 C  CA  . THR B  1 504 ? 9.510   24.639  -26.837 1.00 51.98  ? 504  THR B CA  1 
ATOM   8017 C  C   . THR B  1 504 ? 10.561  24.026  -25.923 1.00 53.36  ? 504  THR B C   1 
ATOM   8018 O  O   . THR B  1 504 ? 10.285  23.059  -25.218 1.00 56.21  ? 504  THR B O   1 
ATOM   8019 C  CB  . THR B  1 504 ? 9.077   26.009  -26.279 1.00 48.65  ? 504  THR B CB  1 
ATOM   8020 O  OG1 . THR B  1 504 ? 8.250   25.820  -25.123 1.00 57.19  ? 504  THR B OG1 1 
ATOM   8021 C  CG2 . THR B  1 504 ? 8.298   26.785  -27.325 1.00 41.95  ? 504  THR B CG2 1 
ATOM   8022 N  N   . THR B  1 505 ? 11.769  24.580  -25.940 1.00 54.58  ? 505  THR B N   1 
ATOM   8023 C  CA  . THR B  1 505 ? 12.835  24.084  -25.075 1.00 61.00  ? 505  THR B CA  1 
ATOM   8024 C  C   . THR B  1 505 ? 12.628  24.512  -23.623 1.00 57.16  ? 505  THR B C   1 
ATOM   8025 O  O   . THR B  1 505 ? 13.133  23.871  -22.702 1.00 58.79  ? 505  THR B O   1 
ATOM   8026 C  CB  . THR B  1 505 ? 14.231  24.509  -25.580 1.00 64.11  ? 505  THR B CB  1 
ATOM   8027 O  OG1 . THR B  1 505 ? 14.150  25.798  -26.204 1.00 71.92  ? 505  THR B OG1 1 
ATOM   8028 C  CG2 . THR B  1 505 ? 14.751  23.505  -26.596 1.00 53.46  ? 505  THR B CG2 1 
ATOM   8029 N  N   . ALA B  1 506 ? 11.863  25.581  -23.422 1.00 56.80  ? 506  ALA B N   1 
ATOM   8030 C  CA  . ALA B  1 506 ? 11.566  26.071  -22.076 1.00 63.73  ? 506  ALA B CA  1 
ATOM   8031 C  C   . ALA B  1 506 ? 10.442  25.286  -21.403 1.00 63.64  ? 506  ALA B C   1 
ATOM   8032 O  O   . ALA B  1 506 ? 10.663  24.589  -20.411 1.00 71.97  ? 506  ALA B O   1 
ATOM   8033 C  CB  . ALA B  1 506 ? 11.222  27.553  -22.115 1.00 63.80  ? 506  ALA B CB  1 
ATOM   8034 N  N   . ALA B  1 507 ? 9.234   25.412  -21.942 1.00 51.76  ? 507  ALA B N   1 
ATOM   8035 C  CA  . ALA B  1 507 ? 8.058   24.785  -21.344 1.00 45.43  ? 507  ALA B CA  1 
ATOM   8036 C  C   . ALA B  1 507 ? 7.940   23.294  -21.663 1.00 43.71  ? 507  ALA B C   1 
ATOM   8037 O  O   . ALA B  1 507 ? 7.347   22.539  -20.890 1.00 50.85  ? 507  ALA B O   1 
ATOM   8038 C  CB  . ALA B  1 507 ? 6.798   25.521  -21.767 1.00 41.09  ? 507  ALA B CB  1 
ATOM   8039 N  N   . GLN B  1 508 ? 8.491   22.885  -22.803 1.00 47.06  ? 508  GLN B N   1 
ATOM   8040 C  CA  . GLN B  1 508 ? 8.476   21.485  -23.221 1.00 52.37  ? 508  GLN B CA  1 
ATOM   8041 C  C   . GLN B  1 508 ? 7.063   20.905  -23.241 1.00 49.00  ? 508  GLN B C   1 
ATOM   8042 O  O   . GLN B  1 508 ? 6.834   19.781  -22.789 1.00 47.27  ? 508  GLN B O   1 
ATOM   8043 C  CB  . GLN B  1 508 ? 9.381   20.645  -22.312 1.00 49.32  ? 508  GLN B CB  1 
ATOM   8044 C  CG  . GLN B  1 508 ? 10.811  21.160  -22.171 1.00 55.81  ? 508  GLN B CG  1 
ATOM   8045 C  CD  . GLN B  1 508 ? 11.693  20.208  -21.377 1.00 61.36  ? 508  GLN B CD  1 
ATOM   8046 O  OE1 . GLN B  1 508 ? 11.594  18.988  -21.517 1.00 60.83  ? 508  GLN B OE1 1 
ATOM   8047 N  NE2 . GLN B  1 508 ? 12.559  20.762  -20.536 1.00 65.54  ? 508  GLN B NE2 1 
ATOM   8048 N  N   . GLN B  1 509 ? 6.120   21.679  -23.765 1.00 40.86  ? 509  GLN B N   1 
ATOM   8049 C  CA  . GLN B  1 509 ? 4.721   21.272  -23.771 1.00 38.38  ? 509  GLN B CA  1 
ATOM   8050 C  C   . GLN B  1 509 ? 4.386   20.307  -24.905 1.00 43.94  ? 509  GLN B C   1 
ATOM   8051 O  O   . GLN B  1 509 ? 4.869   20.449  -26.034 1.00 42.15  ? 509  GLN B O   1 
ATOM   8052 C  CB  . GLN B  1 509 ? 3.807   22.499  -23.841 1.00 34.43  ? 509  GLN B CB  1 
ATOM   8053 C  CG  . GLN B  1 509 ? 3.963   23.459  -22.675 1.00 39.70  ? 509  GLN B CG  1 
ATOM   8054 C  CD  . GLN B  1 509 ? 3.097   24.692  -22.823 1.00 46.48  ? 509  GLN B CD  1 
ATOM   8055 O  OE1 . GLN B  1 509 ? 2.049   24.806  -22.187 1.00 48.54  ? 509  GLN B OE1 1 
ATOM   8056 N  NE2 . GLN B  1 509 ? 3.531   25.626  -23.664 1.00 42.15  ? 509  GLN B NE2 1 
ATOM   8057 N  N   . TYR B  1 510 ? 3.561   19.318  -24.578 1.00 42.05  ? 510  TYR B N   1 
ATOM   8058 C  CA  . TYR B  1 510 ? 3.029   18.370  -25.550 1.00 41.00  ? 510  TYR B CA  1 
ATOM   8059 C  C   . TYR B  1 510 ? 1.648   17.946  -25.073 1.00 41.72  ? 510  TYR B C   1 
ATOM   8060 O  O   . TYR B  1 510 ? 1.287   18.192  -23.921 1.00 43.20  ? 510  TYR B O   1 
ATOM   8061 C  CB  . TYR B  1 510 ? 3.946   17.153  -25.685 1.00 35.48  ? 510  TYR B CB  1 
ATOM   8062 C  CG  . TYR B  1 510 ? 4.051   16.307  -24.438 1.00 39.31  ? 510  TYR B CG  1 
ATOM   8063 C  CD1 . TYR B  1 510 ? 4.883   16.682  -23.389 1.00 39.84  ? 510  TYR B CD1 1 
ATOM   8064 C  CD2 . TYR B  1 510 ? 3.329   15.126  -24.314 1.00 42.46  ? 510  TYR B CD2 1 
ATOM   8065 C  CE1 . TYR B  1 510 ? 4.987   15.910  -22.252 1.00 38.50  ? 510  TYR B CE1 1 
ATOM   8066 C  CE2 . TYR B  1 510 ? 3.427   14.347  -23.179 1.00 41.17  ? 510  TYR B CE2 1 
ATOM   8067 C  CZ  . TYR B  1 510 ? 4.258   14.744  -22.155 1.00 43.34  ? 510  TYR B CZ  1 
ATOM   8068 O  OH  . TYR B  1 510 ? 4.361   13.971  -21.024 1.00 43.38  ? 510  TYR B OH  1 
ATOM   8069 N  N   . VAL B  1 511 ? 0.870   17.319  -25.949 1.00 34.47  ? 511  VAL B N   1 
ATOM   8070 C  CA  . VAL B  1 511 ? -0.486  16.915  -25.584 1.00 36.82  ? 511  VAL B CA  1 
ATOM   8071 C  C   . VAL B  1 511 ? -0.661  15.401  -25.620 1.00 38.90  ? 511  VAL B C   1 
ATOM   8072 O  O   . VAL B  1 511 ? 0.104   14.696  -26.276 1.00 39.65  ? 511  VAL B O   1 
ATOM   8073 C  CB  . VAL B  1 511 ? -1.540  17.559  -26.505 1.00 35.56  ? 511  VAL B CB  1 
ATOM   8074 C  CG1 . VAL B  1 511 ? -1.389  19.064  -26.509 1.00 31.92  ? 511  VAL B CG1 1 
ATOM   8075 C  CG2 . VAL B  1 511 ? -1.419  17.012  -27.920 1.00 40.77  ? 511  VAL B CG2 1 
ATOM   8076 N  N   . SER B  1 512 ? -1.673  14.910  -24.909 1.00 37.45  ? 512  SER B N   1 
ATOM   8077 C  CA  . SER B  1 512 ? -2.015  13.493  -24.944 1.00 36.44  ? 512  SER B CA  1 
ATOM   8078 C  C   . SER B  1 512 ? -3.199  13.262  -25.875 1.00 44.28  ? 512  SER B C   1 
ATOM   8079 O  O   . SER B  1 512 ? -4.200  13.982  -25.811 1.00 36.72  ? 512  SER B O   1 
ATOM   8080 C  CB  . SER B  1 512 ? -2.358  12.987  -23.543 1.00 34.88  ? 512  SER B CB  1 
ATOM   8081 O  OG  . SER B  1 512 ? -3.491  13.659  -23.019 1.00 40.67  ? 512  SER B OG  1 
ATOM   8082 N  N   . LEU B  1 513 ? -3.085  12.258  -26.737 1.00 46.46  ? 513  LEU B N   1 
ATOM   8083 C  CA  . LEU B  1 513 ? -4.178  11.907  -27.634 1.00 42.31  ? 513  LEU B CA  1 
ATOM   8084 C  C   . LEU B  1 513 ? -4.900  10.655  -27.140 1.00 39.83  ? 513  LEU B C   1 
ATOM   8085 O  O   . LEU B  1 513 ? -4.331  9.559   -27.119 1.00 46.37  ? 513  LEU B O   1 
ATOM   8086 C  CB  . LEU B  1 513 ? -3.656  11.710  -29.056 1.00 40.10  ? 513  LEU B CB  1 
ATOM   8087 C  CG  . LEU B  1 513 ? -2.955  12.942  -29.634 1.00 43.18  ? 513  LEU B CG  1 
ATOM   8088 C  CD1 . LEU B  1 513 ? -2.300  12.641  -30.973 1.00 41.30  ? 513  LEU B CD1 1 
ATOM   8089 C  CD2 . LEU B  1 513 ? -3.947  14.077  -29.775 1.00 42.73  ? 513  LEU B CD2 1 
ATOM   8090 N  N   . ASN B  1 514 ? -6.152  10.836  -26.727 1.00 37.99  ? 514  ASN B N   1 
ATOM   8091 C  CA  . ASN B  1 514 ? -7.002  9.740   -26.266 1.00 45.75  ? 514  ASN B CA  1 
ATOM   8092 C  C   . ASN B  1 514 ? -8.472  10.136  -26.364 1.00 48.30  ? 514  ASN B C   1 
ATOM   8093 O  O   . ASN B  1 514 ? -8.800  11.155  -26.974 1.00 45.83  ? 514  ASN B O   1 
ATOM   8094 C  CB  . ASN B  1 514 ? -6.641  9.328   -24.832 1.00 44.85  ? 514  ASN B CB  1 
ATOM   8095 C  CG  . ASN B  1 514 ? -6.650  10.501  -23.862 1.00 45.86  ? 514  ASN B CG  1 
ATOM   8096 O  OD1 . ASN B  1 514 ? -7.620  11.255  -23.785 1.00 49.76  ? 514  ASN B OD1 1 
ATOM   8097 N  ND2 . ASN B  1 514 ? -5.561  10.659  -23.119 1.00 49.73  ? 514  ASN B ND2 1 
ATOM   8098 N  N   . LEU B  1 515 ? -9.352  9.351   -25.750 1.00 50.64  ? 515  LEU B N   1 
ATOM   8099 C  CA  . LEU B  1 515 ? -10.789 9.600   -25.863 1.00 49.93  ? 515  LEU B CA  1 
ATOM   8100 C  C   . LEU B  1 515 ? -11.238 10.888  -25.163 1.00 55.44  ? 515  LEU B C   1 
ATOM   8101 O  O   . LEU B  1 515 ? -12.256 11.479  -25.532 1.00 61.98  ? 515  LEU B O   1 
ATOM   8102 C  CB  . LEU B  1 515 ? -11.587 8.390   -25.365 1.00 48.41  ? 515  LEU B CB  1 
ATOM   8103 C  CG  . LEU B  1 515 ? -11.283 7.087   -26.110 1.00 53.99  ? 515  LEU B CG  1 
ATOM   8104 C  CD1 . LEU B  1 515 ? -12.163 5.943   -25.638 1.00 54.28  ? 515  LEU B CD1 1 
ATOM   8105 C  CD2 . LEU B  1 515 ? -11.433 7.287   -27.606 1.00 53.75  ? 515  LEU B CD2 1 
ATOM   8106 N  N   . LYS B  1 516 ? -10.463 11.324  -24.172 1.00 50.16  ? 516  LYS B N   1 
ATOM   8107 C  CA  . LYS B  1 516 ? -10.743 12.561  -23.443 1.00 52.50  ? 516  LYS B CA  1 
ATOM   8108 C  C   . LYS B  1 516 ? -10.188 13.757  -24.214 1.00 52.26  ? 516  LYS B C   1 
ATOM   8109 O  O   . LYS B  1 516 ? -9.315  13.589  -25.065 1.00 54.44  ? 516  LYS B O   1 
ATOM   8110 C  CB  . LYS B  1 516 ? -10.124 12.488  -22.041 1.00 51.33  ? 516  LYS B CB  1 
ATOM   8111 C  CG  . LYS B  1 516 ? -10.582 11.272  -21.245 1.00 61.61  ? 516  LYS B CG  1 
ATOM   8112 C  CD  . LYS B  1 516 ? -9.553  10.841  -20.208 1.00 76.02  ? 516  LYS B CD  1 
ATOM   8113 C  CE  . LYS B  1 516 ? -9.738  9.371   -19.841 1.00 86.17  ? 516  LYS B CE  1 
ATOM   8114 N  NZ  . LYS B  1 516 ? -9.679  8.485   -21.042 1.00 87.35  ? 516  LYS B NZ  1 
ATOM   8115 N  N   . PRO B  1 517 ? -10.707 14.968  -23.937 1.00 54.48  ? 517  PRO B N   1 
ATOM   8116 C  CA  . PRO B  1 517 ? -10.195 16.188  -24.576 1.00 55.28  ? 517  PRO B CA  1 
ATOM   8117 C  C   . PRO B  1 517 ? -8.692  16.360  -24.373 1.00 59.43  ? 517  PRO B C   1 
ATOM   8118 O  O   . PRO B  1 517 ? -8.150  15.798  -23.420 1.00 60.74  ? 517  PRO B O   1 
ATOM   8119 C  CB  . PRO B  1 517 ? -10.935 17.301  -23.831 1.00 53.28  ? 517  PRO B CB  1 
ATOM   8120 C  CG  . PRO B  1 517 ? -12.221 16.678  -23.412 1.00 48.78  ? 517  PRO B CG  1 
ATOM   8121 C  CD  . PRO B  1 517 ? -11.895 15.238  -23.103 1.00 48.99  ? 517  PRO B CD  1 
ATOM   8122 N  N   . LEU B  1 518 ? -8.039  17.120  -25.252 1.00 61.62  ? 518  LEU B N   1 
ATOM   8123 C  CA  . LEU B  1 518 ? -6.603  17.384  -25.143 1.00 54.34  ? 518  LEU B CA  1 
ATOM   8124 C  C   . LEU B  1 518 ? -6.190  17.804  -23.737 1.00 51.36  ? 518  LEU B C   1 
ATOM   8125 O  O   . LEU B  1 518 ? -6.826  18.660  -23.123 1.00 51.49  ? 518  LEU B O   1 
ATOM   8126 C  CB  . LEU B  1 518 ? -6.166  18.473  -26.130 1.00 48.80  ? 518  LEU B CB  1 
ATOM   8127 C  CG  . LEU B  1 518 ? -5.995  18.106  -27.603 1.00 51.82  ? 518  LEU B CG  1 
ATOM   8128 C  CD1 . LEU B  1 518 ? -5.408  19.267  -28.388 1.00 51.47  ? 518  LEU B CD1 1 
ATOM   8129 C  CD2 . LEU B  1 518 ? -5.112  16.890  -27.735 1.00 53.04  ? 518  LEU B CD2 1 
ATOM   8130 N  N   . GLU B  1 519 ? -5.126  17.187  -23.236 1.00 51.83  ? 519  GLU B N   1 
ATOM   8131 C  CA  . GLU B  1 519 ? -4.515  17.589  -21.977 1.00 54.21  ? 519  GLU B CA  1 
ATOM   8132 C  C   . GLU B  1 519 ? -3.078  18.006  -22.268 1.00 49.83  ? 519  GLU B C   1 
ATOM   8133 O  O   . GLU B  1 519 ? -2.335  17.266  -22.912 1.00 49.46  ? 519  GLU B O   1 
ATOM   8134 C  CB  . GLU B  1 519 ? -4.557  16.432  -20.974 1.00 57.36  ? 519  GLU B CB  1 
ATOM   8135 C  CG  . GLU B  1 519 ? -3.567  16.536  -19.821 1.00 62.33  ? 519  GLU B CG  1 
ATOM   8136 C  CD  . GLU B  1 519 ? -3.574  15.299  -18.935 1.00 70.77  ? 519  GLU B CD  1 
ATOM   8137 O  OE1 . GLU B  1 519 ? -4.672  14.766  -18.661 1.00 76.73  ? 519  GLU B OE1 1 
ATOM   8138 O  OE2 . GLU B  1 519 ? -2.483  14.859  -18.513 1.00 66.81  ? 519  GLU B OE2 1 
ATOM   8139 N  N   . VAL B  1 520 ? -2.694  19.196  -21.819 1.00 40.80  ? 520  VAL B N   1 
ATOM   8140 C  CA  . VAL B  1 520 ? -1.333  19.681  -22.027 1.00 33.84  ? 520  VAL B CA  1 
ATOM   8141 C  C   . VAL B  1 520 ? -0.399  19.199  -20.917 1.00 38.79  ? 520  VAL B C   1 
ATOM   8142 O  O   . VAL B  1 520 ? -0.677  19.395  -19.733 1.00 46.51  ? 520  VAL B O   1 
ATOM   8143 C  CB  . VAL B  1 520 ? -1.289  21.218  -22.113 1.00 34.33  ? 520  VAL B CB  1 
ATOM   8144 C  CG1 . VAL B  1 520 ? 0.144   21.702  -22.271 1.00 35.77  ? 520  VAL B CG1 1 
ATOM   8145 C  CG2 . VAL B  1 520 ? -2.135  21.700  -23.277 1.00 33.56  ? 520  VAL B CG2 1 
ATOM   8146 N  N   . ARG B  1 521 ? 0.699   18.557  -21.304 1.00 35.55  ? 521  ARG B N   1 
ATOM   8147 C  CA  . ARG B  1 521 ? 1.700   18.104  -20.343 1.00 39.07  ? 521  ARG B CA  1 
ATOM   8148 C  C   . ARG B  1 521 ? 3.044   18.755  -20.635 1.00 42.90  ? 521  ARG B C   1 
ATOM   8149 O  O   . ARG B  1 521 ? 3.231   19.358  -21.691 1.00 50.43  ? 521  ARG B O   1 
ATOM   8150 C  CB  . ARG B  1 521 ? 1.820   16.575  -20.362 1.00 41.04  ? 521  ARG B CB  1 
ATOM   8151 C  CG  . ARG B  1 521 ? 0.546   15.860  -19.923 1.00 40.23  ? 521  ARG B CG  1 
ATOM   8152 C  CD  . ARG B  1 521 ? 0.653   14.347  -20.033 1.00 40.37  ? 521  ARG B CD  1 
ATOM   8153 N  NE  . ARG B  1 521 ? -0.669  13.725  -19.951 1.00 44.27  ? 521  ARG B NE  1 
ATOM   8154 C  CZ  . ARG B  1 521 ? -0.937  12.472  -20.305 1.00 45.54  ? 521  ARG B CZ  1 
ATOM   8155 N  NH1 . ARG B  1 521 ? 0.025   11.685  -20.770 1.00 39.46  ? 521  ARG B NH1 1 
ATOM   8156 N  NH2 . ARG B  1 521 ? -2.174  12.006  -20.197 1.00 41.73  ? 521  ARG B NH2 1 
ATOM   8157 N  N   . ARG B  1 522 ? 3.969   18.646  -19.689 1.00 42.26  ? 522  ARG B N   1 
ATOM   8158 C  CA  . ARG B  1 522 ? 5.290   19.242  -19.839 1.00 43.12  ? 522  ARG B CA  1 
ATOM   8159 C  C   . ARG B  1 522 ? 6.378   18.221  -19.546 1.00 45.80  ? 522  ARG B C   1 
ATOM   8160 O  O   . ARG B  1 522 ? 6.263   17.426  -18.609 1.00 54.70  ? 522  ARG B O   1 
ATOM   8161 C  CB  . ARG B  1 522 ? 5.437   20.459  -18.918 1.00 37.50  ? 522  ARG B CB  1 
ATOM   8162 C  CG  . ARG B  1 522 ? 4.506   21.609  -19.278 1.00 43.66  ? 522  ARG B CG  1 
ATOM   8163 C  CD  . ARG B  1 522 ? 4.602   22.777  -18.297 1.00 48.86  ? 522  ARG B CD  1 
ATOM   8164 N  NE  . ARG B  1 522 ? 5.931   23.385  -18.278 1.00 53.20  ? 522  ARG B NE  1 
ATOM   8165 C  CZ  . ARG B  1 522 ? 6.202   24.578  -17.756 1.00 55.44  ? 522  ARG B CZ  1 
ATOM   8166 N  NH1 . ARG B  1 522 ? 5.235   25.304  -17.213 1.00 55.10  ? 522  ARG B NH1 1 
ATOM   8167 N  NH2 . ARG B  1 522 ? 7.441   25.049  -17.784 1.00 50.43  ? 522  ARG B NH2 1 
ATOM   8168 N  N   . GLY B  1 523 ? 7.428   18.242  -20.361 1.00 38.35  ? 523  GLY B N   1 
ATOM   8169 C  CA  . GLY B  1 523 ? 8.533   17.317  -20.202 1.00 40.41  ? 523  GLY B CA  1 
ATOM   8170 C  C   . GLY B  1 523 ? 8.227   15.967  -20.809 1.00 44.61  ? 523  GLY B C   1 
ATOM   8171 O  O   . GLY B  1 523 ? 7.348   15.249  -20.333 1.00 46.81  ? 523  GLY B O   1 
ATOM   8172 N  N   . LEU B  1 524 ? 8.958   15.621  -21.863 1.00 50.16  ? 524  LEU B N   1 
ATOM   8173 C  CA  . LEU B  1 524 ? 8.760   14.354  -22.552 1.00 44.60  ? 524  LEU B CA  1 
ATOM   8174 C  C   . LEU B  1 524 ? 9.765   13.327  -22.037 1.00 40.80  ? 524  LEU B C   1 
ATOM   8175 O  O   . LEU B  1 524 ? 10.843  13.183  -22.616 1.00 44.71  ? 524  LEU B O   1 
ATOM   8176 C  CB  . LEU B  1 524 ? 8.945   14.563  -24.056 1.00 53.60  ? 524  LEU B CB  1 
ATOM   8177 C  CG  . LEU B  1 524 ? 8.134   13.736  -25.057 1.00 61.29  ? 524  LEU B CG  1 
ATOM   8178 C  CD1 . LEU B  1 524 ? 8.465   12.262  -24.961 1.00 64.96  ? 524  LEU B CD1 1 
ATOM   8179 C  CD2 . LEU B  1 524 ? 6.654   13.951  -24.848 1.00 63.01  ? 524  LEU B CD2 1 
ATOM   8180 N  N   . ARG B  1 525 ? 9.404   12.612  -20.966 1.00 41.45  ? 525  ARG B N   1 
ATOM   8181 C  CA  . ARG B  1 525 ? 10.316  11.683  -20.286 1.00 43.15  ? 525  ARG B CA  1 
ATOM   8182 C  C   . ARG B  1 525 ? 11.624  12.385  -19.945 1.00 44.05  ? 525  ARG B C   1 
ATOM   8183 O  O   . ARG B  1 525 ? 12.708  11.862  -20.210 1.00 43.01  ? 525  ARG B O   1 
ATOM   8184 C  CB  . ARG B  1 525 ? 10.609  10.464  -21.162 1.00 47.70  ? 525  ARG B CB  1 
ATOM   8185 C  CG  . ARG B  1 525 ? 9.434   9.541   -21.375 1.00 52.12  ? 525  ARG B CG  1 
ATOM   8186 C  CD  . ARG B  1 525 ? 9.397   8.428   -20.341 1.00 60.31  ? 525  ARG B CD  1 
ATOM   8187 N  NE  . ARG B  1 525 ? 9.019   7.156   -20.955 1.00 68.37  ? 525  ARG B NE  1 
ATOM   8188 C  CZ  . ARG B  1 525 ? 7.779   6.834   -21.316 1.00 64.59  ? 525  ARG B CZ  1 
ATOM   8189 N  NH1 . ARG B  1 525 ? 6.779   7.687   -21.128 1.00 68.25  ? 525  ARG B NH1 1 
ATOM   8190 N  NH2 . ARG B  1 525 ? 7.538   5.655   -21.869 1.00 55.22  ? 525  ARG B NH2 1 
ATOM   8191 N  N   . ALA B  1 526 ? 11.512  13.573  -19.359 1.00 37.37  ? 526  ALA B N   1 
ATOM   8192 C  CA  . ALA B  1 526 ? 12.645  14.487  -19.227 1.00 39.69  ? 526  ALA B CA  1 
ATOM   8193 C  C   . ALA B  1 526 ? 13.833  13.905  -18.471 1.00 41.48  ? 526  ALA B C   1 
ATOM   8194 O  O   . ALA B  1 526 ? 14.966  13.952  -18.958 1.00 47.92  ? 526  ALA B O   1 
ATOM   8195 C  CB  . ALA B  1 526 ? 12.196  15.788  -18.587 1.00 47.12  ? 526  ALA B CB  1 
ATOM   8196 N  N   . GLN B  1 527 ? 13.576  13.375  -17.278 1.00 37.31  ? 527  GLN B N   1 
ATOM   8197 C  CA  . GLN B  1 527 ? 14.634  12.783  -16.459 1.00 43.56  ? 527  GLN B CA  1 
ATOM   8198 C  C   . GLN B  1 527 ? 15.278  11.577  -17.137 1.00 42.30  ? 527  GLN B C   1 
ATOM   8199 O  O   . GLN B  1 527 ? 16.502  11.484  -17.221 1.00 50.81  ? 527  GLN B O   1 
ATOM   8200 C  CB  . GLN B  1 527 ? 14.099  12.383  -15.079 1.00 50.63  ? 527  GLN B CB  1 
ATOM   8201 C  CG  . GLN B  1 527 ? 13.608  13.552  -14.242 1.00 54.73  ? 527  GLN B CG  1 
ATOM   8202 C  CD  . GLN B  1 527 ? 14.624  14.672  -14.168 1.00 63.17  ? 527  GLN B CD  1 
ATOM   8203 O  OE1 . GLN B  1 527 ? 14.351  15.803  -14.574 1.00 64.95  ? 527  GLN B OE1 1 
ATOM   8204 N  NE2 . GLN B  1 527 ? 15.807  14.364  -13.649 1.00 64.01  ? 527  GLN B NE2 1 
ATOM   8205 N  N   . THR B  1 528 ? 14.445  10.661  -17.621 1.00 34.43  ? 528  THR B N   1 
ATOM   8206 C  CA  . THR B  1 528 ? 14.918  9.424   -18.241 1.00 39.46  ? 528  THR B CA  1 
ATOM   8207 C  C   . THR B  1 528 ? 15.628  9.665   -19.579 1.00 44.00  ? 528  THR B C   1 
ATOM   8208 O  O   . THR B  1 528 ? 16.629  9.012   -19.890 1.00 45.71  ? 528  THR B O   1 
ATOM   8209 C  CB  . THR B  1 528 ? 13.752  8.421   -18.426 1.00 49.64  ? 528  THR B CB  1 
ATOM   8210 O  OG1 . THR B  1 528 ? 13.253  8.023   -17.140 1.00 50.09  ? 528  THR B OG1 1 
ATOM   8211 C  CG2 . THR B  1 528 ? 14.202  7.185   -19.196 1.00 45.78  ? 528  THR B CG2 1 
ATOM   8212 N  N   . CYS B  1 529 ? 15.119  10.602  -20.372 1.00 30.50  ? 529  CYS B N   1 
ATOM   8213 C  CA  . CYS B  1 529 ? 15.751  10.895  -21.659 1.00 40.95  ? 529  CYS B CA  1 
ATOM   8214 C  C   . CYS B  1 529 ? 17.052  11.679  -21.493 1.00 41.35  ? 529  CYS B C   1 
ATOM   8215 O  O   . CYS B  1 529 ? 17.952  11.576  -22.323 1.00 34.15  ? 529  CYS B O   1 
ATOM   8216 C  CB  . CYS B  1 529 ? 14.778  11.596  -22.609 1.00 33.39  ? 529  CYS B CB  1 
ATOM   8217 S  SG  . CYS B  1 529 ? 13.498  10.483  -23.267 1.00 48.55  ? 529  CYS B SG  1 
ATOM   8218 N  N   . ALA B  1 530 ? 17.155  12.444  -20.411 1.00 38.76  ? 530  ALA B N   1 
ATOM   8219 C  CA  . ALA B  1 530 ? 18.423  13.069  -20.055 1.00 45.42  ? 530  ALA B CA  1 
ATOM   8220 C  C   . ALA B  1 530 ? 19.474  11.993  -19.781 1.00 45.81  ? 530  ALA B C   1 
ATOM   8221 O  O   . ALA B  1 530 ? 20.644  12.155  -20.126 1.00 42.12  ? 530  ALA B O   1 
ATOM   8222 C  CB  . ALA B  1 530 ? 18.254  13.968  -18.843 1.00 42.47  ? 530  ALA B CB  1 
ATOM   8223 N  N   . PHE B  1 531 ? 19.049  10.897  -19.158 1.00 42.35  ? 531  PHE B N   1 
ATOM   8224 C  CA  . PHE B  1 531 ? 19.916  9.740   -18.951 1.00 38.42  ? 531  PHE B CA  1 
ATOM   8225 C  C   . PHE B  1 531 ? 20.408  9.152   -20.271 1.00 40.92  ? 531  PHE B C   1 
ATOM   8226 O  O   . PHE B  1 531 ? 21.589  8.834   -20.409 1.00 40.08  ? 531  PHE B O   1 
ATOM   8227 C  CB  . PHE B  1 531 ? 19.191  8.661   -18.143 1.00 37.99  ? 531  PHE B CB  1 
ATOM   8228 C  CG  . PHE B  1 531 ? 19.903  7.333   -18.125 1.00 42.50  ? 531  PHE B CG  1 
ATOM   8229 C  CD1 . PHE B  1 531 ? 21.091  7.173   -17.419 1.00 40.42  ? 531  PHE B CD1 1 
ATOM   8230 C  CD2 . PHE B  1 531 ? 19.378  6.240   -18.806 1.00 47.99  ? 531  PHE B CD2 1 
ATOM   8231 C  CE1 . PHE B  1 531 ? 21.746  5.948   -17.400 1.00 47.04  ? 531  PHE B CE1 1 
ATOM   8232 C  CE2 . PHE B  1 531 ? 20.025  5.014   -18.792 1.00 50.37  ? 531  PHE B CE2 1 
ATOM   8233 C  CZ  . PHE B  1 531 ? 21.209  4.866   -18.087 1.00 52.20  ? 531  PHE B CZ  1 
ATOM   8234 N  N   . TRP B  1 532 ? 19.502  9.000   -21.235 1.00 39.18  ? 532  TRP B N   1 
ATOM   8235 C  CA  . TRP B  1 532 ? 19.861  8.420   -22.526 1.00 43.85  ? 532  TRP B CA  1 
ATOM   8236 C  C   . TRP B  1 532 ? 20.622  9.403   -23.402 1.00 50.00  ? 532  TRP B C   1 
ATOM   8237 O  O   . TRP B  1 532 ? 21.621  9.046   -24.022 1.00 53.81  ? 532  TRP B O   1 
ATOM   8238 C  CB  . TRP B  1 532 ? 18.612  7.944   -23.277 1.00 46.09  ? 532  TRP B CB  1 
ATOM   8239 C  CG  . TRP B  1 532 ? 17.986  6.721   -22.689 1.00 43.28  ? 532  TRP B CG  1 
ATOM   8240 C  CD1 . TRP B  1 532 ? 16.894  6.668   -21.878 1.00 45.00  ? 532  TRP B CD1 1 
ATOM   8241 C  CD2 . TRP B  1 532 ? 18.421  5.368   -22.868 1.00 37.32  ? 532  TRP B CD2 1 
ATOM   8242 N  NE1 . TRP B  1 532 ? 16.622  5.363   -21.539 1.00 44.63  ? 532  TRP B NE1 1 
ATOM   8243 C  CE2 . TRP B  1 532 ? 17.547  4.546   -22.135 1.00 39.78  ? 532  TRP B CE2 1 
ATOM   8244 C  CE3 . TRP B  1 532 ? 19.466  4.773   -23.578 1.00 36.45  ? 532  TRP B CE3 1 
ATOM   8245 C  CZ2 . TRP B  1 532 ? 17.689  3.156   -22.092 1.00 45.71  ? 532  TRP B CZ2 1 
ATOM   8246 C  CZ3 . TRP B  1 532 ? 19.605  3.397   -23.535 1.00 35.13  ? 532  TRP B CZ3 1 
ATOM   8247 C  CH2 . TRP B  1 532 ? 18.724  2.605   -22.800 1.00 41.10  ? 532  TRP B CH2 1 
ATOM   8248 N  N   . ASN B  1 533 ? 20.139  10.641  -23.457 1.00 49.56  ? 533  ASN B N   1 
ATOM   8249 C  CA  . ASN B  1 533 ? 20.661  11.625  -24.407 1.00 50.00  ? 533  ASN B CA  1 
ATOM   8250 C  C   . ASN B  1 533 ? 21.901  12.391  -23.939 1.00 50.05  ? 533  ASN B C   1 
ATOM   8251 O  O   . ASN B  1 533 ? 22.689  12.865  -24.761 1.00 49.65  ? 533  ASN B O   1 
ATOM   8252 C  CB  . ASN B  1 533 ? 19.556  12.609  -24.812 1.00 51.25  ? 533  ASN B CB  1 
ATOM   8253 C  CG  . ASN B  1 533 ? 18.374  11.920  -25.470 1.00 47.20  ? 533  ASN B CG  1 
ATOM   8254 O  OD1 . ASN B  1 533 ? 18.490  10.798  -25.958 1.00 52.66  ? 533  ASN B OD1 1 
ATOM   8255 N  ND2 . ASN B  1 533 ? 17.228  12.593  -25.489 1.00 38.68  ? 533  ASN B ND2 1 
ATOM   8256 N  N   . ARG B  1 534 ? 22.069  12.509  -22.625 1.00 52.07  ? 534  ARG B N   1 
ATOM   8257 C  CA  . ARG B  1 534 ? 23.163  13.297  -22.061 1.00 53.72  ? 534  ARG B CA  1 
ATOM   8258 C  C   . ARG B  1 534 ? 24.227  12.474  -21.331 1.00 54.83  ? 534  ARG B C   1 
ATOM   8259 O  O   . ARG B  1 534 ? 25.414  12.792  -21.404 1.00 57.90  ? 534  ARG B O   1 
ATOM   8260 C  CB  . ARG B  1 534 ? 22.619  14.380  -21.119 1.00 50.96  ? 534  ARG B CB  1 
ATOM   8261 C  CG  . ARG B  1 534 ? 21.679  15.377  -21.778 1.00 53.04  ? 534  ARG B CG  1 
ATOM   8262 C  CD  . ARG B  1 534 ? 21.096  16.350  -20.762 1.00 57.73  ? 534  ARG B CD  1 
ATOM   8263 N  NE  . ARG B  1 534 ? 20.122  17.248  -21.378 1.00 62.87  ? 534  ARG B NE  1 
ATOM   8264 C  CZ  . ARG B  1 534 ? 20.404  18.477  -21.799 1.00 57.19  ? 534  ARG B CZ  1 
ATOM   8265 N  NH1 . ARG B  1 534 ? 21.632  18.960  -21.661 1.00 51.99  ? 534  ARG B NH1 1 
ATOM   8266 N  NH2 . ARG B  1 534 ? 19.460  19.224  -22.353 1.00 51.32  ? 534  ARG B NH2 1 
ATOM   8267 N  N   . PHE B  1 535 ? 23.814  11.424  -20.625 1.00 48.08  ? 535  PHE B N   1 
ATOM   8268 C  CA  . PHE B  1 535 ? 24.763  10.665  -19.814 1.00 44.04  ? 535  PHE B CA  1 
ATOM   8269 C  C   . PHE B  1 535 ? 25.380  9.442   -20.488 1.00 46.14  ? 535  PHE B C   1 
ATOM   8270 O  O   . PHE B  1 535 ? 26.601  9.290   -20.491 1.00 53.75  ? 535  PHE B O   1 
ATOM   8271 C  CB  . PHE B  1 535 ? 24.163  10.236  -18.480 1.00 38.28  ? 535  PHE B CB  1 
ATOM   8272 C  CG  . PHE B  1 535 ? 25.133  9.482   -17.630 1.00 38.64  ? 535  PHE B CG  1 
ATOM   8273 C  CD1 . PHE B  1 535 ? 26.244  10.128  -17.105 1.00 40.65  ? 535  PHE B CD1 1 
ATOM   8274 C  CD2 . PHE B  1 535 ? 24.974  8.123   -17.396 1.00 32.99  ? 535  PHE B CD2 1 
ATOM   8275 C  CE1 . PHE B  1 535 ? 27.168  9.442   -16.339 1.00 41.87  ? 535  PHE B CE1 1 
ATOM   8276 C  CE2 . PHE B  1 535 ? 25.894  7.426   -16.628 1.00 43.71  ? 535  PHE B CE2 1 
ATOM   8277 C  CZ  . PHE B  1 535 ? 26.992  8.088   -16.095 1.00 44.35  ? 535  PHE B CZ  1 
ATOM   8278 N  N   . LEU B  1 536 ? 24.543  8.553   -21.015 1.00 46.91  ? 536  LEU B N   1 
ATOM   8279 C  CA  . LEU B  1 536 ? 25.048  7.348   -21.677 1.00 56.03  ? 536  LEU B CA  1 
ATOM   8280 C  C   . LEU B  1 536 ? 26.107  7.588   -22.764 1.00 54.25  ? 536  LEU B C   1 
ATOM   8281 O  O   . LEU B  1 536 ? 27.079  6.828   -22.836 1.00 54.05  ? 536  LEU B O   1 
ATOM   8282 C  CB  . LEU B  1 536 ? 23.911  6.455   -22.197 1.00 60.21  ? 536  LEU B CB  1 
ATOM   8283 C  CG  . LEU B  1 536 ? 23.319  5.475   -21.178 1.00 71.57  ? 536  LEU B CG  1 
ATOM   8284 C  CD1 . LEU B  1 536 ? 22.523  4.385   -21.866 1.00 72.06  ? 536  LEU B CD1 1 
ATOM   8285 C  CD2 . LEU B  1 536 ? 24.417  4.867   -20.322 1.00 75.88  ? 536  LEU B CD2 1 
ATOM   8286 N  N   . PRO B  1 537 ? 25.934  8.631   -23.608 1.00 53.89  ? 537  PRO B N   1 
ATOM   8287 C  CA  . PRO B  1 537 ? 27.004  8.884   -24.581 1.00 57.78  ? 537  PRO B CA  1 
ATOM   8288 C  C   . PRO B  1 537 ? 28.358  9.141   -23.917 1.00 64.39  ? 537  PRO B C   1 
ATOM   8289 O  O   . PRO B  1 537 ? 29.365  8.640   -24.413 1.00 65.76  ? 537  PRO B O   1 
ATOM   8290 C  CB  . PRO B  1 537 ? 26.518  10.140  -25.310 1.00 49.27  ? 537  PRO B CB  1 
ATOM   8291 C  CG  . PRO B  1 537 ? 25.027  10.034  -25.259 1.00 37.81  ? 537  PRO B CG  1 
ATOM   8292 C  CD  . PRO B  1 537 ? 24.750  9.473   -23.879 1.00 49.62  ? 537  PRO B CD  1 
ATOM   8293 N  N   . LYS B  1 538 ? 28.377  9.888   -22.815 1.00 64.20  ? 538  LYS B N   1 
ATOM   8294 C  CA  . LYS B  1 538 ? 29.615  10.137  -22.079 1.00 57.30  ? 538  LYS B CA  1 
ATOM   8295 C  C   . LYS B  1 538 ? 30.205  8.856   -21.496 1.00 59.00  ? 538  LYS B C   1 
ATOM   8296 O  O   . LYS B  1 538 ? 31.421  8.748   -21.314 1.00 66.29  ? 538  LYS B O   1 
ATOM   8297 C  CB  . LYS B  1 538 ? 29.384  11.159  -20.958 1.00 54.36  ? 538  LYS B CB  1 
ATOM   8298 C  CG  . LYS B  1 538 ? 29.098  12.566  -21.454 1.00 72.46  ? 538  LYS B CG  1 
ATOM   8299 C  CD  . LYS B  1 538 ? 29.004  13.561  -20.304 1.00 87.82  ? 538  LYS B CD  1 
ATOM   8300 C  CE  . LYS B  1 538 ? 28.909  14.985  -20.828 1.00 97.06  ? 538  LYS B CE  1 
ATOM   8301 N  NZ  . LYS B  1 538 ? 30.019  15.293  -21.772 1.00 98.92  ? 538  LYS B NZ  1 
ATOM   8302 N  N   . LEU B  1 539 ? 29.342  7.887   -21.207 1.00 62.39  ? 539  LEU B N   1 
ATOM   8303 C  CA  . LEU B  1 539 ? 29.778  6.632   -20.604 1.00 68.55  ? 539  LEU B CA  1 
ATOM   8304 C  C   . LEU B  1 539 ? 30.469  5.742   -21.629 1.00 74.60  ? 539  LEU B C   1 
ATOM   8305 O  O   . LEU B  1 539 ? 31.639  5.394   -21.471 1.00 79.09  ? 539  LEU B O   1 
ATOM   8306 C  CB  . LEU B  1 539 ? 28.592  5.897   -19.975 1.00 63.26  ? 539  LEU B CB  1 
ATOM   8307 C  CG  . LEU B  1 539 ? 28.914  4.634   -19.181 1.00 64.40  ? 539  LEU B CG  1 
ATOM   8308 C  CD1 . LEU B  1 539 ? 29.997  4.930   -18.170 1.00 68.95  ? 539  LEU B CD1 1 
ATOM   8309 C  CD2 . LEU B  1 539 ? 27.675  4.119   -18.479 1.00 65.95  ? 539  LEU B CD2 1 
ATOM   8310 N  N   . LEU B  1 540 ? 29.736  5.386   -22.679 1.00 81.03  ? 540  LEU B N   1 
ATOM   8311 C  CA  . LEU B  1 540 ? 30.261  4.541   -23.746 1.00 89.04  ? 540  LEU B CA  1 
ATOM   8312 C  C   . LEU B  1 540 ? 31.495  5.146   -24.416 1.00 91.21  ? 540  LEU B C   1 
ATOM   8313 O  O   . LEU B  1 540 ? 32.384  4.420   -24.862 1.00 95.39  ? 540  LEU B O   1 
ATOM   8314 C  CB  . LEU B  1 540 ? 29.172  4.268   -24.786 1.00 91.70  ? 540  LEU B CB  1 
ATOM   8315 C  CG  . LEU B  1 540 ? 28.027  3.376   -24.302 1.00 90.58  ? 540  LEU B CG  1 
ATOM   8316 C  CD1 . LEU B  1 540 ? 26.818  3.479   -25.220 1.00 84.32  ? 540  LEU B CD1 1 
ATOM   8317 C  CD2 . LEU B  1 540 ? 28.501  1.937   -24.199 1.00 89.94  ? 540  LEU B CD2 1 
ATOM   8318 N  N   . SER B  1 541 ? 31.549  6.475   -24.473 1.00 88.01  ? 541  SER B N   1 
ATOM   8319 C  CA  . SER B  1 541 ? 32.710  7.177   -25.019 1.00 89.39  ? 541  SER B CA  1 
ATOM   8320 C  C   . SER B  1 541 ? 33.821  7.316   -23.978 1.00 96.91  ? 541  SER B C   1 
ATOM   8321 O  O   . SER B  1 541 ? 34.573  8.293   -23.984 1.00 98.20  ? 541  SER B O   1 
ATOM   8322 C  CB  . SER B  1 541 ? 32.310  8.554   -25.552 1.00 89.46  ? 541  SER B CB  1 
ATOM   8323 O  OG  . SER B  1 541 ? 31.602  9.296   -24.574 1.00 87.83  ? 541  SER B OG  1 
ATOM   8324 N  N   . ALA B  1 542 ? 33.909  6.326   -23.091 1.00 101.81 ? 542  ALA B N   1 
ATOM   8325 C  CA  . ALA B  1 542 ? 34.925  6.268   -22.045 1.00 99.90  ? 542  ALA B CA  1 
ATOM   8326 C  C   . ALA B  1 542 ? 35.002  4.849   -21.482 1.00 106.80 ? 542  ALA B C   1 
ATOM   8327 O  O   . ALA B  1 542 ? 35.946  4.501   -20.769 1.00 104.39 ? 542  ALA B O   1 
ATOM   8328 C  CB  . ALA B  1 542 ? 34.615  7.265   -20.940 1.00 92.08  ? 542  ALA B CB  1 
ATOM   8329 N  N   . THR B  1 543 ? 33.994  4.040   -21.801 1.00 116.45 ? 543  THR B N   1 
ATOM   8330 C  CA  . THR B  1 543 ? 33.990  2.623   -21.443 1.00 123.45 ? 543  THR B CA  1 
ATOM   8331 C  C   . THR B  1 543 ? 34.147  1.768   -22.699 1.00 127.82 ? 543  THR B C   1 
ATOM   8332 O  O   . THR B  1 543 ? 33.545  2.057   -23.734 1.00 125.47 ? 543  THR B O   1 
ATOM   8333 C  CB  . THR B  1 543 ? 32.690  2.216   -20.715 1.00 122.32 ? 543  THR B CB  1 
ATOM   8334 O  OG1 . THR B  1 543 ? 32.487  3.060   -19.575 1.00 123.18 ? 543  THR B OG1 1 
ATOM   8335 C  CG2 . THR B  1 543 ? 32.766  0.766   -20.256 1.00 120.41 ? 543  THR B CG2 1 
HETATM 8336 O  O16 A C56 C  2 .   ? 29.876  21.636  10.122  0.89 69.06  ? 600  C56 A O16 1 
HETATM 8337 O  O16 B C56 C  2 .   ? 29.879  21.593  9.881   0.11 68.91  ? 600  C56 A O16 1 
HETATM 8338 C  C15 A C56 C  2 .   ? 30.687  22.527  10.367  0.89 69.48  ? 600  C56 A C15 1 
HETATM 8339 C  C15 B C56 C  2 .   ? 30.666  22.471  10.227  0.11 67.92  ? 600  C56 A C15 1 
HETATM 8340 C  C2  A C56 C  2 .   ? 31.914  22.663  9.482   0.89 64.68  ? 600  C56 A C2  1 
HETATM 8341 C  C2  B C56 C  2 .   ? 31.924  22.658  9.403   0.11 64.68  ? 600  C56 A C2  1 
HETATM 8342 C  C3  A C56 C  2 .   ? 33.016  23.561  9.715   0.89 64.37  ? 600  C56 A C3  1 
HETATM 8343 C  C3  B C56 C  2 .   ? 33.015  23.560  9.672   0.11 64.05  ? 600  C56 A C3  1 
HETATM 8344 O  O13 A C56 C  2 .   ? 32.901  24.318  10.832  0.89 63.53  ? 600  C56 A O13 1 
HETATM 8345 O  O13 B C56 C  2 .   ? 32.874  24.312  10.788  0.11 62.92  ? 600  C56 A O13 1 
HETATM 8346 C  C14 A C56 C  2 .   ? 33.914  25.219  11.232  0.89 60.50  ? 600  C56 A C14 1 
HETATM 8347 C  C14 B C56 C  2 .   ? 33.888  25.194  11.227  0.11 61.87  ? 600  C56 A C14 1 
HETATM 8348 C  C4  A C56 C  2 .   ? 34.108  23.642  8.846   0.89 64.03  ? 600  C56 A C4  1 
HETATM 8349 C  C4  B C56 C  2 .   ? 34.126  23.643  8.824   0.11 64.06  ? 600  C56 A C4  1 
HETATM 8350 C  C5  A C56 C  2 .   ? 34.255  22.858  7.657   0.89 64.17  ? 600  C56 A C5  1 
HETATM 8351 C  C5  B C56 C  2 .   ? 34.302  22.862  7.635   0.11 64.12  ? 600  C56 A C5  1 
HETATM 8352 N  N10 A C56 C  2 .   ? 35.404  23.103  6.894   0.89 62.25  ? 600  C56 A N10 1 
HETATM 8353 N  N10 B C56 C  2 .   ? 35.463  23.109  6.895   0.11 62.42  ? 600  C56 A N10 1 
HETATM 8354 C  C12 A C56 C  2 .   ? 36.366  24.169  7.273   0.89 60.58  ? 600  C56 A C12 1 
HETATM 8355 C  C12 B C56 C  2 .   ? 36.399  24.197  7.269   0.11 61.40  ? 600  C56 A C12 1 
HETATM 8356 C  C11 A C56 C  2 .   ? 35.829  22.570  5.575   0.89 62.60  ? 600  C56 A C11 1 
HETATM 8357 C  C11 B C56 C  2 .   ? 35.909  22.576  5.585   0.11 62.39  ? 600  C56 A C11 1 
HETATM 8358 C  C6  A C56 C  2 .   ? 33.149  21.970  7.441   0.89 66.13  ? 600  C56 A C6  1 
HETATM 8359 C  C6  B C56 C  2 .   ? 33.203  21.971  7.390   0.11 66.09  ? 600  C56 A C6  1 
HETATM 8360 N  N7  A C56 C  2 .   ? 32.942  21.003  6.337   0.89 69.90  ? 600  C56 A N7  1 
HETATM 8361 N  N7  B C56 C  2 .   ? 33.001  20.997  6.290   0.11 69.82  ? 600  C56 A N7  1 
HETATM 8362 O  O9  A C56 C  2 .   ? 33.856  20.332  5.912   0.89 75.91  ? 600  C56 A O9  1 
HETATM 8363 O  O9  B C56 C  2 .   ? 33.919  20.352  5.837   0.11 72.66  ? 600  C56 A O9  1 
HETATM 8364 O  O8  A C56 C  2 .   ? 31.799  20.717  6.045   0.89 68.77  ? 600  C56 A O8  1 
HETATM 8365 O  O8  B C56 C  2 .   ? 31.859  20.669  6.040   0.11 69.32  ? 600  C56 A O8  1 
HETATM 8366 C  C1  A C56 C  2 .   ? 32.052  21.909  8.341   0.89 63.76  ? 600  C56 A C1  1 
HETATM 8367 C  C1  B C56 C  2 .   ? 32.092  21.909  8.266   0.11 64.81  ? 600  C56 A C1  1 
HETATM 8368 N  N17 A C56 C  2 .   ? 30.417  23.379  11.471  0.89 73.11  ? 600  C56 A N17 1 
HETATM 8369 N  N17 B C56 C  2 .   ? 30.326  23.211  11.387  0.11 70.75  ? 600  C56 A N17 1 
HETATM 8370 C  C18 A C56 C  2 .   ? 29.187  23.248  12.306  0.89 70.83  ? 600  C56 A C18 1 
HETATM 8371 C  C18 B C56 C  2 .   ? 29.067  22.908  12.130  0.11 71.51  ? 600  C56 A C18 1 
HETATM 8372 C  C05 A C56 C  2 .   ? 29.251  22.171  13.472  0.89 73.26  ? 600  C56 A C05 1 
HETATM 8373 C  C05 B C56 C  2 .   ? 29.213  22.355  13.613  0.11 72.27  ? 600  C56 A C05 1 
HETATM 8374 C  C06 A C56 C  2 .   ? 27.961  22.232  14.361  0.89 70.42  ? 600  C56 A C06 1 
HETATM 8375 C  C06 B C56 C  2 .   ? 27.834  22.439  14.357  0.11 70.11  ? 600  C56 A C06 1 
HETATM 8376 C  C07 A C56 C  2 .   ? 27.453  20.803  14.525  0.89 70.26  ? 600  C56 A C07 1 
HETATM 8377 C  C07 B C56 C  2 .   ? 27.279  21.017  14.480  0.11 70.46  ? 600  C56 A C07 1 
HETATM 8378 C  C08 A C56 C  2 .   ? 28.163  20.007  13.428  0.89 74.08  ? 600  C56 A C08 1 
HETATM 8379 C  C08 B C56 C  2 .   ? 28.227  20.162  13.638  0.11 72.54  ? 600  C56 A C08 1 
HETATM 8380 N  N09 A C56 C  2 .   ? 29.283  20.811  12.833  0.89 74.28  ? 600  C56 A N09 1 
HETATM 8381 N  N09 B C56 C  2 .   ? 29.532  20.889  13.608  0.11 73.38  ? 600  C56 A N09 1 
HETATM 8382 C  C10 A C56 C  2 .   ? 30.534  19.995  12.869  0.89 73.88  ? 600  C56 A C10 1 
HETATM 8383 C  C10 B C56 C  2 .   ? 30.559  20.225  12.750  0.11 73.79  ? 600  C56 A C10 1 
HETATM 8384 C  C13 A C56 C  2 .   ? 30.614  18.870  11.846  0.89 75.07  ? 600  C56 A C13 1 
HETATM 8385 C  C13 B C56 C  2 .   ? 30.079  19.029  11.938  0.11 74.28  ? 600  C56 A C13 1 
HETATM 8386 C  C1  . PEG D  3 .   ? 42.361  -6.061  6.361   1.00 76.48  ? 1544 PEG A C1  1 
HETATM 8387 O  O1  . PEG D  3 .   ? 41.470  -6.516  5.410   1.00 81.31  ? 1544 PEG A O1  1 
HETATM 8388 C  C2  . PEG D  3 .   ? 42.538  -4.588  6.508   1.00 70.37  ? 1544 PEG A C2  1 
HETATM 8389 O  O2  . PEG D  3 .   ? 43.437  -4.155  7.459   1.00 66.97  ? 1544 PEG A O2  1 
HETATM 8390 C  C3  . PEG D  3 .   ? 44.036  -2.921  7.320   1.00 59.57  ? 1544 PEG A C3  1 
HETATM 8391 C  C4  . PEG D  3 .   ? 45.173  -2.601  8.231   1.00 57.99  ? 1544 PEG A C4  1 
HETATM 8392 O  O4  . PEG D  3 .   ? 46.439  -2.994  7.841   1.00 61.57  ? 1544 PEG A O4  1 
HETATM 8393 C  C1  . EDO E  4 .   ? 34.703  4.293   2.019   1.00 79.49  ? 1545 EDO A C1  1 
HETATM 8394 O  O1  . EDO E  4 .   ? 34.557  3.185   1.209   1.00 80.62  ? 1545 EDO A O1  1 
HETATM 8395 C  C2  . EDO E  4 .   ? 36.032  4.509   2.658   1.00 74.59  ? 1545 EDO A C2  1 
HETATM 8396 O  O2  . EDO E  4 .   ? 36.458  5.812   2.814   1.00 69.78  ? 1545 EDO A O2  1 
HETATM 8397 C  C1  . PEG F  3 .   ? 25.403  -15.266 18.976  1.00 95.68  ? 1546 PEG A C1  1 
HETATM 8398 O  O1  . PEG F  3 .   ? 24.546  -15.243 20.059  1.00 91.83  ? 1546 PEG A O1  1 
HETATM 8399 C  C2  . PEG F  3 .   ? 26.764  -14.675 19.142  1.00 101.09 ? 1546 PEG A C2  1 
HETATM 8400 O  O2  . PEG F  3 .   ? 26.852  -13.398 19.654  1.00 106.38 ? 1546 PEG A O2  1 
HETATM 8401 C  C3  . PEG F  3 .   ? 27.748  -12.503 19.106  1.00 105.98 ? 1546 PEG A C3  1 
HETATM 8402 C  C4  . PEG F  3 .   ? 27.735  -11.107 19.634  1.00 105.53 ? 1546 PEG A C4  1 
HETATM 8403 O  O4  . PEG F  3 .   ? 26.554  -10.642 20.178  1.00 104.97 ? 1546 PEG A O4  1 
HETATM 8404 C  C1  . PEG G  3 .   ? 25.873  -7.354  17.134  1.00 95.60  ? 1547 PEG A C1  1 
HETATM 8405 O  O1  . PEG G  3 .   ? 26.896  -6.438  17.277  1.00 98.01  ? 1547 PEG A O1  1 
HETATM 8406 C  C2  . PEG G  3 .   ? 25.605  -8.269  18.280  1.00 95.15  ? 1547 PEG A C2  1 
HETATM 8407 O  O2  . PEG G  3 .   ? 26.134  -7.916  19.502  1.00 95.33  ? 1547 PEG A O2  1 
HETATM 8408 C  C3  . PEG G  3 .   ? 25.275  -7.597  20.532  1.00 93.66  ? 1547 PEG A C3  1 
HETATM 8409 C  C4  . PEG G  3 .   ? 24.980  -6.149  20.740  1.00 90.16  ? 1547 PEG A C4  1 
HETATM 8410 O  O4  . PEG G  3 .   ? 26.051  -5.283  20.842  1.00 89.28  ? 1547 PEG A O4  1 
HETATM 8411 C  C1  . EDO H  4 .   ? 31.723  -0.092  -1.026  1.00 81.23  ? 1548 EDO A C1  1 
HETATM 8412 O  O1  . EDO H  4 .   ? 32.727  -0.515  -0.174  1.00 86.39  ? 1548 EDO A O1  1 
HETATM 8413 C  C2  . EDO H  4 .   ? 32.016  1.043   -1.950  1.00 71.36  ? 1548 EDO A C2  1 
HETATM 8414 O  O2  . EDO H  4 .   ? 33.340  1.344   -2.205  1.00 69.45  ? 1548 EDO A O2  1 
HETATM 8415 C  C1  . NAG I  5 .   ? 24.913  35.632  -0.523  1.00 82.05  ? 1549 NAG A C1  1 
HETATM 8416 C  C2  . NAG I  5 .   ? 24.950  35.859  -2.017  1.00 89.20  ? 1549 NAG A C2  1 
HETATM 8417 C  C3  . NAG I  5 .   ? 26.201  35.289  -2.654  1.00 93.21  ? 1549 NAG A C3  1 
HETATM 8418 C  C4  . NAG I  5 .   ? 27.449  35.612  -1.875  1.00 95.28  ? 1549 NAG A C4  1 
HETATM 8419 C  C5  . NAG I  5 .   ? 27.268  35.305  -0.407  1.00 92.77  ? 1549 NAG A C5  1 
HETATM 8420 C  C6  . NAG I  5 .   ? 28.472  35.680  0.452   1.00 91.54  ? 1549 NAG A C6  1 
HETATM 8421 C  C7  . NAG I  5 .   ? 22.670  36.133  -3.146  1.00 90.00  ? 1549 NAG A C7  1 
HETATM 8422 C  C8  . NAG I  5 .   ? 21.493  35.506  -3.844  1.00 92.10  ? 1549 NAG A C8  1 
HETATM 8423 N  N2  . NAG I  5 .   ? 23.784  35.288  -2.697  1.00 90.15  ? 1549 NAG A N2  1 
HETATM 8424 O  O3  . NAG I  5 .   ? 26.332  35.764  -3.952  1.00 93.93  ? 1549 NAG A O3  1 
HETATM 8425 O  O4  . NAG I  5 .   ? 28.520  34.894  -2.378  1.00 99.11  ? 1549 NAG A O4  1 
HETATM 8426 O  O5  . NAG I  5 .   ? 26.130  35.946  0.102   1.00 91.82  ? 1549 NAG A O5  1 
HETATM 8427 O  O6  . NAG I  5 .   ? 28.382  37.027  0.850   1.00 88.90  ? 1549 NAG A O6  1 
HETATM 8428 O  O7  . NAG I  5 .   ? 22.691  37.344  -2.955  1.00 87.35  ? 1549 NAG A O7  1 
HETATM 8429 C  C1  . EDO J  4 .   ? 20.706  19.002  52.423  1.00 69.70  ? 1550 EDO A C1  1 
HETATM 8430 O  O1  . EDO J  4 .   ? 21.330  19.988  53.163  1.00 70.02  ? 1550 EDO A O1  1 
HETATM 8431 C  C2  . EDO J  4 .   ? 19.234  18.831  52.590  1.00 65.52  ? 1550 EDO A C2  1 
HETATM 8432 O  O2  . EDO J  4 .   ? 18.511  18.408  51.492  1.00 67.25  ? 1550 EDO A O2  1 
HETATM 8433 C  C1  . EDO K  4 .   ? 39.088  15.607  46.650  1.00 70.30  ? 1551 EDO A C1  1 
HETATM 8434 O  O1  . EDO K  4 .   ? 39.280  16.505  47.682  1.00 75.60  ? 1551 EDO A O1  1 
HETATM 8435 C  C2  . EDO K  4 .   ? 39.932  15.767  45.433  1.00 72.49  ? 1551 EDO A C2  1 
HETATM 8436 O  O2  . EDO K  4 .   ? 40.084  14.664  44.618  1.00 73.77  ? 1551 EDO A O2  1 
HETATM 8437 C  C1  . EDO L  4 .   ? 25.415  23.812  38.523  1.00 78.89  ? 1552 EDO A C1  1 
HETATM 8438 O  O1  . EDO L  4 .   ? 25.997  23.010  37.563  1.00 78.84  ? 1552 EDO A O1  1 
HETATM 8439 C  C2  . EDO L  4 .   ? 26.312  24.722  39.288  1.00 80.92  ? 1552 EDO A C2  1 
HETATM 8440 O  O2  . EDO L  4 .   ? 25.874  26.015  39.485  1.00 82.87  ? 1552 EDO A O2  1 
HETATM 8441 C  C1  . NAG M  5 .   ? 11.988  34.103  25.352  1.00 99.91  ? 1553 NAG A C1  1 
HETATM 8442 C  C2  . NAG M  5 .   ? 13.437  34.532  25.298  1.00 98.40  ? 1553 NAG A C2  1 
HETATM 8443 C  C3  . NAG M  5 .   ? 13.697  35.724  26.191  1.00 106.04 ? 1553 NAG A C3  1 
HETATM 8444 C  C4  . NAG M  5 .   ? 12.697  36.813  25.924  1.00 108.40 ? 1553 NAG A C4  1 
HETATM 8445 C  C5  . NAG M  5 .   ? 11.291  36.271  26.053  1.00 109.73 ? 1553 NAG A C5  1 
HETATM 8446 C  C6  . NAG M  5 .   ? 10.196  37.297  25.787  1.00 106.68 ? 1553 NAG A C6  1 
HETATM 8447 C  C7  . NAG M  5 .   ? 15.056  32.687  24.642  1.00 86.80  ? 1553 NAG A C7  1 
HETATM 8448 C  C8  . NAG M  5 .   ? 15.993  31.579  25.043  1.00 71.81  ? 1553 NAG A C8  1 
HETATM 8449 N  N2  . NAG M  5 .   ? 14.349  33.452  25.674  1.00 82.08  ? 1553 NAG A N2  1 
HETATM 8450 O  O3  . NAG M  5 .   ? 14.987  36.209  26.008  1.00 98.80  ? 1553 NAG A O3  1 
HETATM 8451 O  O4  . NAG M  5 .   ? 12.900  37.858  26.807  1.00 100.37 ? 1553 NAG A O4  1 
HETATM 8452 O  O5  . NAG M  5 .   ? 11.099  35.176  25.196  1.00 107.78 ? 1553 NAG A O5  1 
HETATM 8453 O  O6  . NAG M  5 .   ? 10.602  38.159  24.755  1.00 102.97 ? 1553 NAG A O6  1 
HETATM 8454 O  O7  . NAG M  5 .   ? 14.883  32.948  23.455  1.00 93.18  ? 1553 NAG A O7  1 
HETATM 8455 O  O16 A C56 N  2 .   ? 9.892   -5.467  -35.769 0.73 79.05  ? 600  C56 B O16 1 
HETATM 8456 O  O16 B C56 N  2 .   ? 10.110  -5.352  -35.743 0.27 78.94  ? 600  C56 B O16 1 
HETATM 8457 C  C15 A C56 N  2 .   ? 9.794   -6.686  -35.900 0.73 79.05  ? 600  C56 B C15 1 
HETATM 8458 C  C15 B C56 N  2 .   ? 9.897   -6.551  -35.898 0.27 78.93  ? 600  C56 B C15 1 
HETATM 8459 C  C2  A C56 N  2 .   ? 11.041  -7.542  -35.777 0.73 78.47  ? 600  C56 B C2  1 
HETATM 8460 C  C2  B C56 N  2 .   ? 11.076  -7.497  -35.777 0.27 78.53  ? 600  C56 B C2  1 
HETATM 8461 C  C3  A C56 N  2 .   ? 11.216  -8.846  -36.359 0.73 78.98  ? 600  C56 B C3  1 
HETATM 8462 C  C3  B C56 N  2 .   ? 11.207  -8.811  -36.354 0.27 78.62  ? 600  C56 B C3  1 
HETATM 8463 O  O13 A C56 N  2 .   ? 10.160  -9.284  -37.085 0.73 78.63  ? 600  C56 B O13 1 
HETATM 8464 O  O13 B C56 N  2 .   ? 10.142  -9.232  -37.076 0.27 78.02  ? 600  C56 B O13 1 
HETATM 8465 C  C14 A C56 N  2 .   ? 10.275  -10.368 -37.985 0.73 75.22  ? 600  C56 B C14 1 
HETATM 8466 C  C14 B C56 N  2 .   ? 10.236  -10.323 -37.971 0.27 76.31  ? 600  C56 B C14 1 
HETATM 8467 C  C4  A C56 N  2 .   ? 12.390  -9.585  -36.183 0.73 77.98  ? 600  C56 B C4  1 
HETATM 8468 C  C4  B C56 N  2 .   ? 12.360  -9.583  -36.169 0.27 78.10  ? 600  C56 B C4  1 
HETATM 8469 C  C5  A C56 N  2 .   ? 13.527  -9.146  -35.432 0.73 77.67  ? 600  C56 B C5  1 
HETATM 8470 C  C5  B C56 N  2 .   ? 13.513  -9.173  -35.422 0.27 77.99  ? 600  C56 B C5  1 
HETATM 8471 N  N10 A C56 N  2 .   ? 14.591  -10.056 -35.344 0.73 78.17  ? 600  C56 B N10 1 
HETATM 8472 N  N10 B C56 N  2 .   ? 14.559  -10.104 -35.335 0.27 77.90  ? 600  C56 B N10 1 
HETATM 8473 C  C12 A C56 N  2 .   ? 14.394  -11.490 -35.669 0.73 78.23  ? 600  C56 B C12 1 
HETATM 8474 C  C12 B C56 N  2 .   ? 14.342  -11.534 -35.663 0.27 78.04  ? 600  C56 B C12 1 
HETATM 8475 C  C11 A C56 N  2 .   ? 16.001  -9.909  -34.902 0.73 76.77  ? 600  C56 B C11 1 
HETATM 8476 C  C11 B C56 N  2 .   ? 15.980  -9.967  -34.933 0.27 77.22  ? 600  C56 B C11 1 
HETATM 8477 C  C6  A C56 N  2 .   ? 13.328  -7.843  -34.862 0.73 78.89  ? 600  C56 B C6  1 
HETATM 8478 C  C6  B C56 N  2 .   ? 13.356  -7.860  -34.864 0.27 79.20  ? 600  C56 B C6  1 
HETATM 8479 N  N7  A C56 N  2 .   ? 14.235  -7.017  -34.036 0.73 82.73  ? 600  C56 B N7  1 
HETATM 8480 N  N7  B C56 N  2 .   ? 14.280  -7.049  -34.042 0.27 82.58  ? 600  C56 B N7  1 
HETATM 8481 O  O9  A C56 N  2 .   ? 15.436  -7.142  -34.064 0.73 85.76  ? 600  C56 B O9  1 
HETATM 8482 O  O9  B C56 N  2 .   ? 15.478  -7.194  -34.069 0.27 84.61  ? 600  C56 B O9  1 
HETATM 8483 O  O8  A C56 N  2 .   ? 13.737  -6.061  -33.481 0.73 83.20  ? 600  C56 B O8  1 
HETATM 8484 O  O8  B C56 N  2 .   ? 13.799  -6.083  -33.489 0.27 83.01  ? 600  C56 B O8  1 
HETATM 8485 C  C1  A C56 N  2 .   ? 12.125  -7.116  -35.053 0.73 78.09  ? 600  C56 B C1  1 
HETATM 8486 C  C1  B C56 N  2 .   ? 12.176  -7.103  -35.062 0.27 78.35  ? 600  C56 B C1  1 
HETATM 8487 N  N17 A C56 N  2 .   ? 8.510   -7.237  -36.155 0.73 78.06  ? 600  C56 B N17 1 
HETATM 8488 N  N17 B C56 N  2 .   ? 8.560   -6.950  -36.144 0.27 78.48  ? 600  C56 B N17 1 
HETATM 8489 C  C18 A C56 N  2 .   ? 7.257   -6.429  -36.217 0.73 77.62  ? 600  C56 B C18 1 
HETATM 8490 C  C18 B C56 N  2 .   ? 7.448   -5.958  -36.243 0.27 78.26  ? 600  C56 B C18 1 
HETATM 8491 C  C05 A C56 N  2 .   ? 6.997   -5.614  -37.558 0.73 78.59  ? 600  C56 B C05 1 
HETATM 8492 C  C05 B C56 N  2 .   ? 6.931   -5.607  -37.707 0.27 78.20  ? 600  C56 B C05 1 
HETATM 8493 C  C06 A C56 N  2 .   ? 5.482   -5.668  -37.960 0.73 78.54  ? 600  C56 B C06 1 
HETATM 8494 C  C06 B C56 N  2 .   ? 5.366   -5.683  -37.780 0.27 77.76  ? 600  C56 B C06 1 
HETATM 8495 C  C07 A C56 N  2 .   ? 4.916   -4.253  -37.875 0.73 76.94  ? 600  C56 B C07 1 
HETATM 8496 C  C07 B C56 N  2 .   ? 4.831   -4.251  -37.668 0.27 77.00  ? 600  C56 B C07 1 
HETATM 8497 C  C08 A C56 N  2 .   ? 6.118   -3.353  -37.588 0.73 77.30  ? 600  C56 B C08 1 
HETATM 8498 C  C08 B C56 N  2 .   ? 6.079   -3.387  -37.470 0.27 77.30  ? 600  C56 B C08 1 
HETATM 8499 N  N09 A C56 N  2 .   ? 7.340   -4.174  -37.295 0.73 77.74  ? 600  C56 B N09 1 
HETATM 8500 N  N09 B C56 N  2 .   ? 7.227   -4.172  -38.020 0.27 76.81  ? 600  C56 B N09 1 
HETATM 8501 C  C10 A C56 N  2 .   ? 8.517   -3.537  -37.960 0.73 74.59  ? 600  C56 B C10 1 
HETATM 8502 C  C10 B C56 N  2 .   ? 8.550   -3.516  -37.794 0.27 74.97  ? 600  C56 B C10 1 
HETATM 8503 C  C13 A C56 N  2 .   ? 8.510   -2.013  -37.985 0.73 73.66  ? 600  C56 B C13 1 
HETATM 8504 C  C13 B C56 N  2 .   ? 8.550   -1.993  -37.818 0.27 73.93  ? 600  C56 B C13 1 
HETATM 8505 C  C1  . PEG O  3 .   ? -10.660 22.061  -46.724 1.00 89.57  ? 1545 PEG B C1  1 
HETATM 8506 O  O1  . PEG O  3 .   ? -11.607 21.103  -46.417 1.00 94.98  ? 1545 PEG B O1  1 
HETATM 8507 C  C2  . PEG O  3 .   ? -9.534  21.654  -47.612 1.00 85.35  ? 1545 PEG B C2  1 
HETATM 8508 O  O2  . PEG O  3 .   ? -8.976  20.416  -47.380 1.00 80.28  ? 1545 PEG B O2  1 
HETATM 8509 C  C3  . PEG O  3 .   ? -7.766  20.089  -47.948 1.00 72.77  ? 1545 PEG B C3  1 
HETATM 8510 C  C4  . PEG O  3 .   ? -7.078  18.877  -47.421 1.00 68.14  ? 1545 PEG B C4  1 
HETATM 8511 O  O4  . PEG O  3 .   ? -5.940  19.048  -46.660 1.00 68.15  ? 1545 PEG B O4  1 
HETATM 8512 O  OH2 . 1PE P  6 .   ? 20.931  11.198  -15.410 1.00 63.07  ? 1546 1PE B OH2 1 
HETATM 8513 C  C12 . 1PE P  6 .   ? 20.994  9.964   -14.750 1.00 64.64  ? 1546 1PE B C12 1 
HETATM 8514 C  C22 . 1PE P  6 .   ? 22.483  9.707   -14.414 1.00 57.74  ? 1546 1PE B C22 1 
HETATM 8515 O  OH3 . 1PE P  6 .   ? 22.479  8.442   -13.785 1.00 55.79  ? 1546 1PE B OH3 1 
HETATM 8516 C  C13 . 1PE P  6 .   ? 23.422  6.293   -13.463 1.00 38.83  ? 1546 1PE B C13 1 
HETATM 8517 C  C23 . 1PE P  6 .   ? 23.206  7.447   -14.467 1.00 45.40  ? 1546 1PE B C23 1 
HETATM 8518 O  OH4 . 1PE P  6 .   ? 22.129  5.957   -13.015 1.00 52.65  ? 1546 1PE B OH4 1 
HETATM 8519 C  C14 . 1PE P  6 .   ? 21.425  4.458   -11.351 1.00 61.54  ? 1546 1PE B C14 1 
HETATM 8520 C  C24 . 1PE P  6 .   ? 21.934  4.577   -12.805 1.00 60.73  ? 1546 1PE B C24 1 
HETATM 8521 O  OH5 . 1PE P  6 .   ? 20.233  5.207   -11.321 1.00 67.83  ? 1546 1PE B OH5 1 
HETATM 8522 C  C15 . 1PE P  6 .   ? 18.498  6.189   -10.108 1.00 62.39  ? 1546 1PE B C15 1 
HETATM 8523 C  C25 . 1PE P  6 .   ? 19.424  4.958   -10.194 1.00 62.90  ? 1546 1PE B C25 1 
HETATM 8524 O  OH6 . 1PE P  6 .   ? 17.329  5.828   -10.802 1.00 68.90  ? 1546 1PE B OH6 1 
HETATM 8525 C  C16 . 1PE P  6 .   ? 15.361  6.394   -11.946 1.00 70.44  ? 1546 1PE B C16 1 
HETATM 8526 C  C26 . 1PE P  6 .   ? 16.762  6.890   -11.530 1.00 68.32  ? 1546 1PE B C26 1 
HETATM 8527 O  OH7 . 1PE P  6 .   ? 14.673  7.538   -12.394 1.00 74.05  ? 1546 1PE B OH7 1 
HETATM 8528 C  C1  . PEG Q  3 .   ? 14.703  26.032  -46.756 1.00 96.33  ? 1547 PEG B C1  1 
HETATM 8529 O  O1  . PEG Q  3 .   ? 13.476  25.621  -47.238 1.00 90.26  ? 1547 PEG B O1  1 
HETATM 8530 C  C2  . PEG Q  3 .   ? 15.269  27.318  -47.253 1.00 98.47  ? 1547 PEG B C2  1 
HETATM 8531 O  O2  . PEG Q  3 .   ? 16.230  27.920  -46.468 1.00 97.10  ? 1547 PEG B O2  1 
HETATM 8532 C  C3  . PEG Q  3 .   ? 16.572  29.236  -46.692 1.00 92.47  ? 1547 PEG B C3  1 
HETATM 8533 C  C4  . PEG Q  3 .   ? 16.557  30.153  -45.517 1.00 88.00  ? 1547 PEG B C4  1 
HETATM 8534 O  O4  . PEG Q  3 .   ? 15.329  30.632  -45.107 1.00 82.72  ? 1547 PEG B O4  1 
HETATM 8535 C  C1  . PEG R  3 .   ? 12.326  3.820   -14.664 1.00 69.53  ? 1548 PEG B C1  1 
HETATM 8536 O  O1  . PEG R  3 .   ? 11.150  3.503   -15.316 1.00 67.70  ? 1548 PEG B O1  1 
HETATM 8537 C  C2  . PEG R  3 .   ? 12.247  4.381   -13.283 1.00 62.66  ? 1548 PEG B C2  1 
HETATM 8538 O  O2  . PEG R  3 .   ? 11.302  3.857   -12.427 1.00 62.92  ? 1548 PEG B O2  1 
HETATM 8539 C  C3  . PEG R  3 .   ? 11.453  4.014   -11.066 1.00 51.15  ? 1548 PEG B C3  1 
HETATM 8540 C  C4  . PEG R  3 .   ? 10.249  3.809   -10.210 1.00 56.24  ? 1548 PEG B C4  1 
HETATM 8541 O  O4  . PEG R  3 .   ? 9.377   4.871   -10.053 1.00 58.69  ? 1548 PEG B O4  1 
HETATM 8542 C  C1  . EDO S  4 .   ? 12.459  21.976  -45.188 1.00 83.98  ? 1549 EDO B C1  1 
HETATM 8543 O  O1  . EDO S  4 .   ? 11.863  22.746  -46.168 1.00 77.54  ? 1549 EDO B O1  1 
HETATM 8544 C  C2  . EDO S  4 .   ? 13.696  22.503  -44.541 1.00 85.89  ? 1549 EDO B C2  1 
HETATM 8545 O  O2  . EDO S  4 .   ? 13.912  23.866  -44.572 1.00 84.31  ? 1549 EDO B O2  1 
HETATM 8546 C  C1  . PEG T  3 .   ? 0.639   16.885  -69.044 1.00 80.91  ? 1550 PEG B C1  1 
HETATM 8547 O  O1  . PEG T  3 .   ? 1.785   17.009  -69.805 1.00 80.08  ? 1550 PEG B O1  1 
HETATM 8548 C  C2  . PEG T  3 .   ? 0.795   16.719  -67.570 1.00 80.96  ? 1550 PEG B C2  1 
HETATM 8549 O  O2  . PEG T  3 .   ? 0.676   17.844  -66.783 1.00 81.08  ? 1550 PEG B O2  1 
HETATM 8550 C  C3  . PEG T  3 .   ? 0.934   17.759  -65.431 1.00 72.89  ? 1550 PEG B C3  1 
HETATM 8551 C  C4  . PEG T  3 .   ? 0.211   18.700  -64.525 1.00 71.31  ? 1550 PEG B C4  1 
HETATM 8552 O  O4  . PEG T  3 .   ? 0.372   20.058  -64.724 1.00 65.98  ? 1550 PEG B O4  1 
HETATM 8553 C  C1  . PEG U  3 .   ? 2.842   0.988   -19.047 1.00 76.91  ? 1551 PEG B C1  1 
HETATM 8554 O  O1  . PEG U  3 .   ? 2.313   1.754   -20.070 1.00 73.12  ? 1551 PEG B O1  1 
HETATM 8555 C  C2  . PEG U  3 .   ? 2.516   -0.467  -19.028 1.00 74.78  ? 1551 PEG B C2  1 
HETATM 8556 O  O2  . PEG U  3 .   ? 1.222   -0.823  -19.337 1.00 72.89  ? 1551 PEG B O2  1 
HETATM 8557 C  C3  . PEG U  3 .   ? 0.882   -2.154  -19.432 1.00 61.05  ? 1551 PEG B C3  1 
HETATM 8558 C  C4  . PEG U  3 .   ? -0.572  -2.477  -19.500 1.00 58.94  ? 1551 PEG B C4  1 
HETATM 8559 O  O4  . PEG U  3 .   ? -1.363  -2.125  -18.424 1.00 58.29  ? 1551 PEG B O4  1 
HETATM 8560 C  C1  . NAG V  5 .   ? 5.394   -17.700 -21.959 1.00 91.26  ? 1552 NAG B C1  1 
HETATM 8561 C  C2  . NAG V  5 .   ? 6.260   -18.099 -20.789 1.00 100.56 ? 1552 NAG B C2  1 
HETATM 8562 C  C3  . NAG V  5 .   ? 7.709   -18.186 -21.208 1.00 94.26  ? 1552 NAG B C3  1 
HETATM 8563 C  C4  . NAG V  5 .   ? 7.857   -19.079 -22.410 1.00 104.25 ? 1552 NAG B C4  1 
HETATM 8564 C  C5  . NAG V  5 .   ? 6.904   -18.681 -23.519 1.00 101.61 ? 1552 NAG B C5  1 
HETATM 8565 C  C6  . NAG V  5 .   ? 6.903   -19.645 -24.701 1.00 80.47  ? 1552 NAG B C6  1 
HETATM 8566 C  C7  . NAG V  5 .   ? 5.511   -17.661 -18.407 1.00 104.20 ? 1552 NAG B C7  1 
HETATM 8567 C  C8  . NAG V  5 .   ? 5.371   -16.727 -17.235 1.00 97.13  ? 1552 NAG B C8  1 
HETATM 8568 N  N2  . NAG V  5 .   ? 6.126   -17.188 -19.652 1.00 101.44 ? 1552 NAG B N2  1 
HETATM 8569 O  O3  . NAG V  5 .   ? 8.495   -18.663 -20.165 1.00 98.51  ? 1552 NAG B O3  1 
HETATM 8570 O  O4  . NAG V  5 .   ? 9.163   -19.033 -22.864 1.00 97.47  ? 1552 NAG B O4  1 
HETATM 8571 O  O5  . NAG V  5 .   ? 5.586   -18.550 -23.057 1.00 104.49 ? 1552 NAG B O5  1 
HETATM 8572 O  O6  . NAG V  5 .   ? 5.591   -20.082 -24.951 1.00 68.13  ? 1552 NAG B O6  1 
HETATM 8573 O  O7  . NAG V  5 .   ? 5.111   -18.818 -18.322 1.00 104.21 ? 1552 NAG B O7  1 
HETATM 8574 C  C1  . EDO W  4 .   ? 26.424  11.542  -30.013 1.00 70.30  ? 1553 EDO B C1  1 
HETATM 8575 O  O1  . EDO W  4 .   ? 25.823  12.302  -31.000 1.00 72.55  ? 1553 EDO B O1  1 
HETATM 8576 C  C2  . EDO W  4 .   ? 26.141  10.078  -29.990 1.00 61.76  ? 1553 EDO B C2  1 
HETATM 8577 O  O2  . EDO W  4 .   ? 25.184  9.630   -29.100 1.00 49.68  ? 1553 EDO B O2  1 
HETATM 8578 C  C1  . PEG X  3 .   ? 31.814  9.065   -45.611 1.00 72.54  ? 1554 PEG B C1  1 
HETATM 8579 O  O1  . PEG X  3 .   ? 32.531  9.635   -46.645 1.00 71.55  ? 1554 PEG B O1  1 
HETATM 8580 C  C2  . PEG X  3 .   ? 30.991  9.974   -44.763 1.00 78.19  ? 1554 PEG B C2  1 
HETATM 8581 O  O2  . PEG X  3 .   ? 31.598  11.107  -44.263 1.00 84.50  ? 1554 PEG B O2  1 
HETATM 8582 C  C3  . PEG X  3 .   ? 30.941  11.869  -43.320 1.00 82.42  ? 1554 PEG B C3  1 
HETATM 8583 C  C4  . PEG X  3 .   ? 31.483  13.226  -43.015 1.00 79.65  ? 1554 PEG B C4  1 
HETATM 8584 O  O4  . PEG X  3 .   ? 32.367  13.357  -41.962 1.00 75.23  ? 1554 PEG B O4  1 
HETATM 8585 CL CL  . CL  Y  7 .   ? 30.314  1.299   -36.322 1.00 80.02  ? 1555 CL  B CL  1 
HETATM 8586 C  C1  . EDO Z  4 .   ? -13.826 7.230   -22.173 1.00 87.02  ? 1556 EDO B C1  1 
HETATM 8587 O  O1  . EDO Z  4 .   ? -12.586 7.107   -21.580 1.00 86.35  ? 1556 EDO B O1  1 
HETATM 8588 C  C2  . EDO Z  4 .   ? -14.610 8.461   -21.870 1.00 86.48  ? 1556 EDO B C2  1 
HETATM 8589 O  O2  . EDO Z  4 .   ? -15.301 9.047   -22.910 1.00 85.09  ? 1556 EDO B O2  1 
HETATM 8590 O  O   . HOH AA 8 .   ? 31.239  11.881  51.373  1.00 45.16  ? 2001 HOH A O   1 
HETATM 8591 O  O   . HOH AA 8 .   ? 25.857  10.916  54.863  1.00 43.09  ? 2002 HOH A O   1 
HETATM 8592 O  O   . HOH AA 8 .   ? 29.907  18.119  55.888  1.00 55.53  ? 2003 HOH A O   1 
HETATM 8593 O  O   . HOH AA 8 .   ? 25.162  13.365  55.595  1.00 44.22  ? 2004 HOH A O   1 
HETATM 8594 O  O   . HOH AA 8 .   ? 28.146  20.634  50.151  1.00 56.87  ? 2005 HOH A O   1 
HETATM 8595 O  O   . HOH AA 8 .   ? 31.384  14.669  51.939  1.00 52.63  ? 2006 HOH A O   1 
HETATM 8596 O  O   . HOH AA 8 .   ? 30.988  0.689   46.455  1.00 43.39  ? 2007 HOH A O   1 
HETATM 8597 O  O   . HOH AA 8 .   ? 23.740  19.954  50.496  1.00 61.61  ? 2008 HOH A O   1 
HETATM 8598 O  O   . HOH AA 8 .   ? 20.544  19.302  47.945  1.00 51.18  ? 2009 HOH A O   1 
HETATM 8599 O  O   . HOH AA 8 .   ? 23.803  8.724   48.225  1.00 33.95  ? 2010 HOH A O   1 
HETATM 8600 O  O   . HOH AA 8 .   ? 25.208  9.490   52.491  1.00 54.69  ? 2011 HOH A O   1 
HETATM 8601 O  O   . HOH AA 8 .   ? 19.406  9.356   46.420  1.00 57.54  ? 2012 HOH A O   1 
HETATM 8602 O  O   . HOH AA 8 .   ? 13.932  13.444  48.841  1.00 39.74  ? 2013 HOH A O   1 
HETATM 8603 O  O   . HOH AA 8 .   ? 14.227  40.594  25.941  1.00 66.92  ? 2014 HOH A O   1 
HETATM 8604 O  O   . HOH AA 8 .   ? 8.225   18.277  32.936  1.00 58.13  ? 2015 HOH A O   1 
HETATM 8605 O  O   . HOH AA 8 .   ? 27.897  4.186   47.065  1.00 38.36  ? 2016 HOH A O   1 
HETATM 8606 O  O   . HOH AA 8 .   ? 28.851  2.236   45.678  1.00 32.97  ? 2017 HOH A O   1 
HETATM 8607 O  O   . HOH AA 8 .   ? 35.985  2.378   45.763  1.00 41.82  ? 2018 HOH A O   1 
HETATM 8608 O  O   . HOH AA 8 .   ? 33.048  1.168   44.357  1.00 51.84  ? 2019 HOH A O   1 
HETATM 8609 O  O   . HOH AA 8 .   ? 39.600  15.317  39.115  1.00 40.69  ? 2020 HOH A O   1 
HETATM 8610 O  O   . HOH AA 8 .   ? 38.756  3.489   45.497  1.00 35.68  ? 2021 HOH A O   1 
HETATM 8611 O  O   . HOH AA 8 .   ? 38.082  3.875   38.020  1.00 62.57  ? 2022 HOH A O   1 
HETATM 8612 O  O   . HOH AA 8 .   ? 39.873  6.293   46.518  1.00 52.53  ? 2023 HOH A O   1 
HETATM 8613 O  O   . HOH AA 8 .   ? 37.873  8.944   47.607  1.00 45.78  ? 2024 HOH A O   1 
HETATM 8614 O  O   . HOH AA 8 .   ? 29.664  7.591   49.997  1.00 58.29  ? 2025 HOH A O   1 
HETATM 8615 O  O   . HOH AA 8 .   ? 50.335  5.889   27.899  1.00 44.02  ? 2026 HOH A O   1 
HETATM 8616 O  O   . HOH AA 8 .   ? 41.375  1.194   39.209  1.00 57.18  ? 2027 HOH A O   1 
HETATM 8617 O  O   . HOH AA 8 .   ? 26.352  20.281  46.037  1.00 45.35  ? 2028 HOH A O   1 
HETATM 8618 O  O   . HOH AA 8 .   ? 12.139  15.877  46.432  1.00 54.24  ? 2029 HOH A O   1 
HETATM 8619 O  O   . HOH AA 8 .   ? 19.048  23.900  38.953  1.00 43.83  ? 2030 HOH A O   1 
HETATM 8620 O  O   . HOH AA 8 .   ? 13.825  23.689  35.101  1.00 57.36  ? 2031 HOH A O   1 
HETATM 8621 O  O   . HOH AA 8 .   ? 10.618  17.916  34.179  1.00 49.88  ? 2032 HOH A O   1 
HETATM 8622 O  O   . HOH AA 8 .   ? 8.325   21.618  40.921  1.00 70.07  ? 2033 HOH A O   1 
HETATM 8623 O  O   . HOH AA 8 .   ? 33.595  17.914  38.676  1.00 41.64  ? 2034 HOH A O   1 
HETATM 8624 O  O   . HOH AA 8 .   ? 32.306  16.818  32.468  1.00 39.88  ? 2035 HOH A O   1 
HETATM 8625 O  O   . HOH AA 8 .   ? 36.562  16.534  38.581  1.00 38.29  ? 2036 HOH A O   1 
HETATM 8626 O  O   . HOH AA 8 .   ? 47.783  25.221  28.992  1.00 61.82  ? 2037 HOH A O   1 
HETATM 8627 O  O   . HOH AA 8 .   ? 36.126  6.397   38.305  1.00 50.77  ? 2038 HOH A O   1 
HETATM 8628 O  O   . HOH AA 8 .   ? 38.305  4.117   34.895  1.00 58.24  ? 2039 HOH A O   1 
HETATM 8629 O  O   . HOH AA 8 .   ? 40.313  12.371  33.351  1.00 37.70  ? 2040 HOH A O   1 
HETATM 8630 O  O   . HOH AA 8 .   ? 45.234  8.166   29.734  1.00 31.81  ? 2041 HOH A O   1 
HETATM 8631 O  O   . HOH AA 8 .   ? 45.113  10.739  38.257  1.00 49.79  ? 2042 HOH A O   1 
HETATM 8632 O  O   . HOH AA 8 .   ? 45.934  14.712  24.257  1.00 39.73  ? 2043 HOH A O   1 
HETATM 8633 O  O   . HOH AA 8 .   ? 50.274  17.603  26.165  1.00 45.85  ? 2044 HOH A O   1 
HETATM 8634 O  O   . HOH AA 8 .   ? 52.350  16.309  24.492  1.00 35.94  ? 2045 HOH A O   1 
HETATM 8635 O  O   . HOH AA 8 .   ? 56.505  14.998  25.934  1.00 52.94  ? 2046 HOH A O   1 
HETATM 8636 O  O   . HOH AA 8 .   ? 46.665  8.179   27.328  1.00 48.93  ? 2047 HOH A O   1 
HETATM 8637 O  O   . HOH AA 8 .   ? 46.176  12.464  22.453  1.00 44.52  ? 2048 HOH A O   1 
HETATM 8638 O  O   . HOH AA 8 .   ? 46.994  7.673   17.913  1.00 38.15  ? 2049 HOH A O   1 
HETATM 8639 O  O   . HOH AA 8 .   ? 48.678  4.362   27.197  1.00 65.09  ? 2050 HOH A O   1 
HETATM 8640 O  O   . HOH AA 8 .   ? 20.378  24.789  31.769  1.00 65.57  ? 2051 HOH A O   1 
HETATM 8641 O  O   . HOH AA 8 .   ? 43.328  2.220   38.002  1.00 43.51  ? 2052 HOH A O   1 
HETATM 8642 O  O   . HOH AA 8 .   ? 9.243   7.235   36.022  1.00 62.41  ? 2053 HOH A O   1 
HETATM 8643 O  O   . HOH AA 8 .   ? 44.539  10.039  41.187  1.00 66.02  ? 2054 HOH A O   1 
HETATM 8644 O  O   . HOH AA 8 .   ? 37.361  15.426  50.934  1.00 48.60  ? 2055 HOH A O   1 
HETATM 8645 O  O   . HOH AA 8 .   ? 37.120  17.455  44.089  1.00 61.70  ? 2056 HOH A O   1 
HETATM 8646 O  O   . HOH AA 8 .   ? 35.583  18.267  40.572  1.00 52.14  ? 2057 HOH A O   1 
HETATM 8647 O  O   . HOH AA 8 .   ? 33.035  19.780  40.412  1.00 51.15  ? 2058 HOH A O   1 
HETATM 8648 O  O   . HOH AA 8 .   ? 48.345  0.079   20.222  1.00 62.58  ? 2059 HOH A O   1 
HETATM 8649 O  O   . HOH AA 8 .   ? 52.113  -1.362  19.795  1.00 76.91  ? 2060 HOH A O   1 
HETATM 8650 O  O   . HOH AA 8 .   ? 46.024  0.517   20.676  1.00 49.49  ? 2061 HOH A O   1 
HETATM 8651 O  O   . HOH AA 8 .   ? 29.180  23.058  35.199  1.00 54.68  ? 2062 HOH A O   1 
HETATM 8652 O  O   . HOH AA 8 .   ? 33.056  24.634  35.092  1.00 64.90  ? 2063 HOH A O   1 
HETATM 8653 O  O   . HOH AA 8 .   ? 32.881  19.160  28.968  1.00 36.47  ? 2064 HOH A O   1 
HETATM 8654 O  O   . HOH AA 8 .   ? 41.044  17.999  37.675  1.00 54.15  ? 2065 HOH A O   1 
HETATM 8655 O  O   . HOH AA 8 .   ? 40.532  -5.771  23.909  1.00 73.88  ? 2066 HOH A O   1 
HETATM 8656 O  O   . HOH AA 8 .   ? 43.719  -4.681  24.852  1.00 71.86  ? 2067 HOH A O   1 
HETATM 8657 O  O   . HOH AA 8 .   ? 39.283  24.635  34.940  1.00 54.70  ? 2068 HOH A O   1 
HETATM 8658 O  O   . HOH AA 8 .   ? 42.057  23.149  34.152  1.00 62.76  ? 2069 HOH A O   1 
HETATM 8659 O  O   . HOH AA 8 .   ? 41.667  20.115  35.505  1.00 68.55  ? 2070 HOH A O   1 
HETATM 8660 O  O   . HOH AA 8 .   ? 32.087  -5.445  35.149  1.00 64.84  ? 2071 HOH A O   1 
HETATM 8661 O  O   . HOH AA 8 .   ? 35.228  17.260  24.624  1.00 30.94  ? 2072 HOH A O   1 
HETATM 8662 O  O   . HOH AA 8 .   ? 40.823  16.697  21.705  1.00 32.16  ? 2073 HOH A O   1 
HETATM 8663 O  O   . HOH AA 8 .   ? 42.206  17.321  23.863  1.00 39.83  ? 2074 HOH A O   1 
HETATM 8664 O  O   . HOH AA 8 .   ? 41.450  19.034  18.133  1.00 35.74  ? 2075 HOH A O   1 
HETATM 8665 O  O   . HOH AA 8 .   ? 48.286  25.526  23.552  1.00 60.89  ? 2076 HOH A O   1 
HETATM 8666 O  O   . HOH AA 8 .   ? 40.906  26.251  19.175  1.00 43.46  ? 2077 HOH A O   1 
HETATM 8667 O  O   . HOH AA 8 .   ? 32.179  21.969  21.715  1.00 44.16  ? 2078 HOH A O   1 
HETATM 8668 O  O   . HOH AA 8 .   ? 39.580  20.370  16.328  1.00 31.45  ? 2079 HOH A O   1 
HETATM 8669 O  O   . HOH AA 8 .   ? 34.936  28.213  10.309  1.00 86.48  ? 2080 HOH A O   1 
HETATM 8670 O  O   . HOH AA 8 .   ? 38.560  26.381  8.303   1.00 75.70  ? 2081 HOH A O   1 
HETATM 8671 O  O   . HOH AA 8 .   ? 40.110  27.517  16.945  1.00 47.13  ? 2082 HOH A O   1 
HETATM 8672 O  O   . HOH AA 8 .   ? 21.764  34.641  17.356  1.00 53.83  ? 2083 HOH A O   1 
HETATM 8673 O  O   . HOH AA 8 .   ? 22.000  29.539  21.967  1.00 70.62  ? 2084 HOH A O   1 
HETATM 8674 O  O   . HOH AA 8 .   ? 28.157  25.989  23.582  1.00 49.74  ? 2085 HOH A O   1 
HETATM 8675 O  O   . HOH AA 8 .   ? 23.823  23.953  23.531  1.00 47.41  ? 2086 HOH A O   1 
HETATM 8676 O  O   . HOH AA 8 .   ? 29.581  20.388  18.997  1.00 29.61  ? 2087 HOH A O   1 
HETATM 8677 O  O   . HOH AA 8 .   ? 31.650  23.756  16.528  1.00 44.31  ? 2088 HOH A O   1 
HETATM 8678 O  O   . HOH AA 8 .   ? 41.380  0.116   4.423   1.00 46.73  ? 2089 HOH A O   1 
HETATM 8679 O  O   . HOH AA 8 .   ? 52.371  4.628   3.320   1.00 61.00  ? 2090 HOH A O   1 
HETATM 8680 O  O   . HOH AA 8 .   ? 52.873  8.905   3.949   1.00 44.04  ? 2091 HOH A O   1 
HETATM 8681 O  O   . HOH AA 8 .   ? 43.662  10.423  -4.446  1.00 67.83  ? 2092 HOH A O   1 
HETATM 8682 O  O   . HOH AA 8 .   ? 45.655  9.328   -2.109  1.00 63.22  ? 2093 HOH A O   1 
HETATM 8683 O  O   . HOH AA 8 .   ? 48.436  9.299   -0.721  1.00 76.92  ? 2094 HOH A O   1 
HETATM 8684 O  O   . HOH AA 8 .   ? 50.468  3.088   4.637   1.00 56.39  ? 2095 HOH A O   1 
HETATM 8685 O  O   . HOH AA 8 .   ? 53.388  5.846   -0.076  1.00 55.51  ? 2096 HOH A O   1 
HETATM 8686 O  O   . HOH AA 8 .   ? 36.078  27.526  25.821  1.00 54.10  ? 2097 HOH A O   1 
HETATM 8687 O  O   . HOH AA 8 .   ? 53.443  11.102  2.607   1.00 41.56  ? 2098 HOH A O   1 
HETATM 8688 O  O   . HOH AA 8 .   ? 50.922  18.196  0.195   1.00 52.44  ? 2099 HOH A O   1 
HETATM 8689 O  O   . HOH AA 8 .   ? 35.416  28.153  31.070  1.00 47.85  ? 2100 HOH A O   1 
HETATM 8690 O  O   . HOH AA 8 .   ? 36.129  25.651  33.076  1.00 54.79  ? 2101 HOH A O   1 
HETATM 8691 O  O   . HOH AA 8 .   ? 55.002  8.833   -0.286  1.00 74.13  ? 2102 HOH A O   1 
HETATM 8692 O  O   . HOH AA 8 .   ? 39.801  27.671  26.746  1.00 44.88  ? 2103 HOH A O   1 
HETATM 8693 O  O   . HOH AA 8 .   ? 46.009  21.245  27.763  1.00 45.57  ? 2104 HOH A O   1 
HETATM 8694 O  O   . HOH AA 8 .   ? 43.428  15.432  24.717  1.00 35.70  ? 2105 HOH A O   1 
HETATM 8695 O  O   . HOH AA 8 .   ? 48.319  21.378  26.123  1.00 48.13  ? 2106 HOH A O   1 
HETATM 8696 O  O   . HOH AA 8 .   ? 41.781  13.676  31.367  1.00 45.28  ? 2107 HOH A O   1 
HETATM 8697 O  O   . HOH AA 8 .   ? 46.589  18.074  33.826  1.00 68.76  ? 2108 HOH A O   1 
HETATM 8698 O  O   . HOH AA 8 .   ? 53.094  20.728  25.222  1.00 51.61  ? 2109 HOH A O   1 
HETATM 8699 O  O   . HOH AA 8 .   ? 31.692  16.806  29.707  1.00 27.90  ? 2110 HOH A O   1 
HETATM 8700 O  O   . HOH AA 8 .   ? 49.838  25.575  25.464  1.00 67.24  ? 2111 HOH A O   1 
HETATM 8701 O  O   . HOH AA 8 .   ? 12.636  8.576   42.260  1.00 48.45  ? 2112 HOH A O   1 
HETATM 8702 O  O   . HOH AA 8 .   ? 21.777  4.472   44.103  1.00 46.64  ? 2113 HOH A O   1 
HETATM 8703 O  O   . HOH AA 8 .   ? 25.398  4.264   46.173  1.00 41.37  ? 2114 HOH A O   1 
HETATM 8704 O  O   . HOH AA 8 .   ? 49.768  -3.271  14.014  1.00 78.76  ? 2115 HOH A O   1 
HETATM 8705 O  O   . HOH AA 8 .   ? 44.303  -1.079  22.622  1.00 67.98  ? 2116 HOH A O   1 
HETATM 8706 O  O   . HOH AA 8 .   ? 16.835  -2.952  34.107  1.00 42.30  ? 2117 HOH A O   1 
HETATM 8707 O  O   . HOH AA 8 .   ? 18.981  0.933   28.000  1.00 39.15  ? 2118 HOH A O   1 
HETATM 8708 O  O   . HOH AA 8 .   ? 29.180  12.203  24.608  1.00 32.09  ? 2119 HOH A O   1 
HETATM 8709 O  O   . HOH AA 8 .   ? 25.949  15.479  18.453  1.00 26.72  ? 2120 HOH A O   1 
HETATM 8710 O  O   . HOH AA 8 .   ? 28.540  17.923  19.973  1.00 34.29  ? 2121 HOH A O   1 
HETATM 8711 O  O   . HOH AA 8 .   ? 33.003  14.537  17.178  1.00 23.17  ? 2122 HOH A O   1 
HETATM 8712 O  O   . HOH AA 8 .   ? 13.548  23.765  2.169   1.00 42.31  ? 2123 HOH A O   1 
HETATM 8713 O  O   . HOH AA 8 .   ? 38.006  15.239  12.511  1.00 39.58  ? 2124 HOH A O   1 
HETATM 8714 O  O   . HOH AA 8 .   ? 32.995  23.680  14.382  1.00 53.30  ? 2125 HOH A O   1 
HETATM 8715 O  O   . HOH AA 8 .   ? 30.752  21.087  16.613  1.00 34.88  ? 2126 HOH A O   1 
HETATM 8716 O  O   . HOH AA 8 .   ? 31.371  29.159  -7.959  1.00 46.08  ? 2127 HOH A O   1 
HETATM 8717 O  O   . HOH AA 8 .   ? 33.559  28.315  -8.325  1.00 61.34  ? 2128 HOH A O   1 
HETATM 8718 O  O   . HOH AA 8 .   ? 24.934  18.735  28.875  1.00 29.23  ? 2129 HOH A O   1 
HETATM 8719 O  O   . HOH AA 8 .   ? 17.864  35.179  4.690   1.00 66.30  ? 2130 HOH A O   1 
HETATM 8720 O  O   . HOH AA 8 .   ? 25.048  22.364  29.889  1.00 48.09  ? 2131 HOH A O   1 
HETATM 8721 O  O   . HOH AA 8 .   ? 18.394  35.218  -3.181  1.00 83.60  ? 2132 HOH A O   1 
HETATM 8722 O  O   . HOH AA 8 .   ? 11.836  28.260  2.023   1.00 56.27  ? 2133 HOH A O   1 
HETATM 8723 O  O   . HOH AA 8 .   ? 26.175  24.942  25.552  1.00 50.12  ? 2134 HOH A O   1 
HETATM 8724 O  O   . HOH AA 8 .   ? 19.914  23.125  29.209  1.00 53.81  ? 2135 HOH A O   1 
HETATM 8725 O  O   . HOH AA 8 .   ? 26.975  27.487  -16.998 1.00 63.31  ? 2136 HOH A O   1 
HETATM 8726 O  O   . HOH AA 8 .   ? 23.331  30.139  26.586  1.00 62.17  ? 2137 HOH A O   1 
HETATM 8727 O  O   . HOH AA 8 .   ? 35.296  24.827  -14.417 1.00 61.28  ? 2138 HOH A O   1 
HETATM 8728 O  O   . HOH AA 8 .   ? 34.996  24.176  -10.425 1.00 57.00  ? 2139 HOH A O   1 
HETATM 8729 O  O   . HOH AA 8 .   ? 17.402  15.380  28.821  1.00 50.17  ? 2140 HOH A O   1 
HETATM 8730 O  O   . HOH AA 8 .   ? 21.826  24.165  36.737  1.00 63.98  ? 2141 HOH A O   1 
HETATM 8731 O  O   . HOH AA 8 .   ? 13.676  16.578  -10.003 1.00 53.98  ? 2142 HOH A O   1 
HETATM 8732 O  O   . HOH AA 8 .   ? 16.173  14.063  -7.766  1.00 61.43  ? 2143 HOH A O   1 
HETATM 8733 O  O   . HOH AA 8 .   ? 8.626   9.431   36.456  1.00 61.61  ? 2144 HOH A O   1 
HETATM 8734 O  O   . HOH AA 8 .   ? 13.285  3.896   32.772  1.00 55.35  ? 2145 HOH A O   1 
HETATM 8735 O  O   . HOH AA 8 .   ? 8.095   11.698  27.686  1.00 37.16  ? 2146 HOH A O   1 
HETATM 8736 O  O   . HOH AA 8 .   ? 21.415  -3.616  0.192   1.00 64.53  ? 2147 HOH A O   1 
HETATM 8737 O  O   . HOH AA 8 .   ? 18.913  -13.650 9.020   1.00 67.99  ? 2148 HOH A O   1 
HETATM 8738 O  O   . HOH AA 8 .   ? 43.517  18.820  16.395  1.00 45.89  ? 2149 HOH A O   1 
HETATM 8739 O  O   . HOH AA 8 .   ? 4.802   -3.513  14.010  1.00 73.18  ? 2150 HOH A O   1 
HETATM 8740 O  O   . HOH AA 8 .   ? 42.540  7.570   14.044  1.00 42.00  ? 2151 HOH A O   1 
HETATM 8741 O  O   . HOH AA 8 .   ? 42.863  9.695   11.433  1.00 33.37  ? 2152 HOH A O   1 
HETATM 8742 O  O   . HOH AA 8 .   ? 46.331  10.728  10.830  1.00 35.38  ? 2153 HOH A O   1 
HETATM 8743 O  O   . HOH AA 8 .   ? 47.744  1.129   14.143  1.00 60.90  ? 2154 HOH A O   1 
HETATM 8744 O  O   . HOH AA 8 .   ? 54.053  -2.228  17.802  1.00 66.54  ? 2155 HOH A O   1 
HETATM 8745 O  O   . HOH AA 8 .   ? 14.091  33.250  10.115  1.00 61.73  ? 2156 HOH A O   1 
HETATM 8746 O  O   . HOH AA 8 .   ? 49.874  0.260   16.546  1.00 72.09  ? 2157 HOH A O   1 
HETATM 8747 O  O   . HOH AA 8 .   ? 50.051  1.764   21.553  1.00 60.65  ? 2158 HOH A O   1 
HETATM 8748 O  O   . HOH AA 8 .   ? 44.641  1.119   16.116  1.00 52.11  ? 2159 HOH A O   1 
HETATM 8749 O  O   . HOH AA 8 .   ? 43.984  1.641   18.560  1.00 39.32  ? 2160 HOH A O   1 
HETATM 8750 O  O   . HOH AA 8 .   ? 19.759  25.590  24.182  1.00 62.33  ? 2161 HOH A O   1 
HETATM 8751 O  O   . HOH AA 8 .   ? 39.817  1.467   26.119  1.00 52.50  ? 2162 HOH A O   1 
HETATM 8752 O  O   . HOH AA 8 .   ? 0.226   11.370  18.411  1.00 59.74  ? 2163 HOH A O   1 
HETATM 8753 O  O   . HOH AA 8 .   ? 40.104  -2.051  23.702  1.00 48.79  ? 2164 HOH A O   1 
HETATM 8754 O  O   . HOH AA 8 .   ? 28.560  -0.071  29.585  1.00 28.04  ? 2165 HOH A O   1 
HETATM 8755 O  O   . HOH AA 8 .   ? 35.370  -2.514  33.854  1.00 63.13  ? 2166 HOH A O   1 
HETATM 8756 O  O   . HOH AA 8 .   ? 36.829  -4.965  26.284  1.00 51.52  ? 2167 HOH A O   1 
HETATM 8757 O  O   . HOH AA 8 .   ? 36.607  1.520   34.122  1.00 54.15  ? 2168 HOH A O   1 
HETATM 8758 O  O   . HOH AA 8 .   ? 27.476  -1.214  37.251  1.00 35.33  ? 2169 HOH A O   1 
HETATM 8759 O  O   . HOH AA 8 .   ? 28.688  -6.128  35.509  1.00 55.69  ? 2170 HOH A O   1 
HETATM 8760 O  O   . HOH AA 8 .   ? 32.320  -5.964  31.086  1.00 62.31  ? 2171 HOH A O   1 
HETATM 8761 O  O   . HOH AA 8 .   ? 31.889  0.272   41.691  1.00 40.63  ? 2172 HOH A O   1 
HETATM 8762 O  O   . HOH AA 8 .   ? 36.249  1.859   37.092  1.00 40.00  ? 2173 HOH A O   1 
HETATM 8763 O  O   . HOH AA 8 .   ? 11.611  12.668  2.461   1.00 45.95  ? 2174 HOH A O   1 
HETATM 8764 O  O   . HOH AA 8 .   ? 5.741   8.240   1.021   1.00 55.98  ? 2175 HOH A O   1 
HETATM 8765 O  O   . HOH AA 8 .   ? 12.191  10.170  -0.605  1.00 67.00  ? 2176 HOH A O   1 
HETATM 8766 O  O   . HOH AA 8 .   ? 7.723   7.250   -2.746  1.00 64.55  ? 2177 HOH A O   1 
HETATM 8767 O  O   . HOH AA 8 .   ? 21.445  -2.237  39.411  1.00 55.35  ? 2178 HOH A O   1 
HETATM 8768 O  O   . HOH AA 8 .   ? 18.672  -5.707  28.365  1.00 57.66  ? 2179 HOH A O   1 
HETATM 8769 O  O   . HOH AA 8 .   ? 24.304  -6.916  36.869  1.00 63.38  ? 2180 HOH A O   1 
HETATM 8770 O  O   . HOH AA 8 .   ? 15.970  -3.592  29.863  1.00 51.44  ? 2181 HOH A O   1 
HETATM 8771 O  O   . HOH AA 8 .   ? 26.480  17.612  14.722  1.00 56.91  ? 2182 HOH A O   1 
HETATM 8772 O  O   . HOH AA 8 .   ? 20.871  15.254  12.945  1.00 35.66  ? 2183 HOH A O   1 
HETATM 8773 O  O   . HOH AA 8 .   ? 33.972  -8.103  13.418  1.00 62.13  ? 2184 HOH A O   1 
HETATM 8774 O  O   . HOH AA 8 .   ? 36.211  -4.768  13.824  1.00 46.68  ? 2185 HOH A O   1 
HETATM 8775 O  O   . HOH AA 8 .   ? 36.780  -6.329  16.189  1.00 48.27  ? 2186 HOH A O   1 
HETATM 8776 O  O   . HOH AA 8 .   ? 25.514  -7.972  25.151  1.00 68.38  ? 2187 HOH A O   1 
HETATM 8777 O  O   . HOH AA 8 .   ? 30.593  -7.921  13.508  1.00 65.68  ? 2188 HOH A O   1 
HETATM 8778 O  O   . HOH AA 8 .   ? 18.452  12.092  13.175  1.00 38.54  ? 2189 HOH A O   1 
HETATM 8779 O  O   . HOH AA 8 .   ? 26.639  8.840   7.740   1.00 33.52  ? 2190 HOH A O   1 
HETATM 8780 O  O   . HOH AA 8 .   ? 33.540  4.799   6.201   1.00 42.86  ? 2191 HOH A O   1 
HETATM 8781 O  O   . HOH AA 8 .   ? 30.592  8.298   6.621   1.00 34.66  ? 2192 HOH A O   1 
HETATM 8782 O  O   . HOH AA 8 .   ? 27.840  3.432   2.059   1.00 47.65  ? 2193 HOH A O   1 
HETATM 8783 O  O   . HOH AA 8 .   ? 31.287  6.050   0.529   1.00 49.35  ? 2194 HOH A O   1 
HETATM 8784 O  O   . HOH AA 8 .   ? 36.978  9.662   4.253   1.00 33.32  ? 2195 HOH A O   1 
HETATM 8785 O  O   . HOH AA 8 .   ? 36.564  12.937  7.029   1.00 39.09  ? 2196 HOH A O   1 
HETATM 8786 O  O   . HOH AA 8 .   ? 40.479  7.449   2.954   1.00 38.82  ? 2197 HOH A O   1 
HETATM 8787 O  O   . HOH AA 8 .   ? 42.705  6.669   -0.036  1.00 47.50  ? 2198 HOH A O   1 
HETATM 8788 O  O   . HOH AA 8 .   ? 43.357  0.684   5.809   1.00 46.78  ? 2199 HOH A O   1 
HETATM 8789 O  O   . HOH AA 8 .   ? 46.014  1.795   3.134   1.00 57.64  ? 2200 HOH A O   1 
HETATM 8790 O  O   . HOH AA 8 .   ? 50.910  7.128   2.966   1.00 51.84  ? 2201 HOH A O   1 
HETATM 8791 O  O   . HOH AA 8 .   ? 44.651  11.325  -1.314  1.00 54.12  ? 2202 HOH A O   1 
HETATM 8792 O  O   . HOH AA 8 .   ? 46.570  7.765   0.324   1.00 50.31  ? 2203 HOH A O   1 
HETATM 8793 O  O   . HOH AA 8 .   ? 50.819  3.152   7.312   1.00 55.46  ? 2204 HOH A O   1 
HETATM 8794 O  O   . HOH AA 8 .   ? 52.595  13.515  3.719   1.00 45.65  ? 2205 HOH A O   1 
HETATM 8795 O  O   . HOH AA 8 .   ? 46.645  13.548  -1.745  1.00 62.49  ? 2206 HOH A O   1 
HETATM 8796 O  O   . HOH AA 8 .   ? 50.808  14.582  1.542   1.00 49.42  ? 2207 HOH A O   1 
HETATM 8797 O  O   . HOH AA 8 .   ? 38.174  11.939  4.745   1.00 25.70  ? 2208 HOH A O   1 
HETATM 8798 O  O   . HOH AA 8 .   ? 56.627  10.928  3.354   1.00 63.38  ? 2209 HOH A O   1 
HETATM 8799 O  O   . HOH AA 8 .   ? 60.805  17.945  9.641   1.00 56.58  ? 2210 HOH A O   1 
HETATM 8800 O  O   . HOH AA 8 .   ? 60.235  14.820  9.965   1.00 62.91  ? 2211 HOH A O   1 
HETATM 8801 O  O   . HOH AA 8 .   ? 62.085  17.300  12.426  1.00 75.02  ? 2212 HOH A O   1 
HETATM 8802 O  O   . HOH AA 8 .   ? 63.055  3.380   15.867  1.00 76.50  ? 2213 HOH A O   1 
HETATM 8803 O  O   . HOH AA 8 .   ? 64.362  4.848   17.030  1.00 72.29  ? 2214 HOH A O   1 
HETATM 8804 O  O   . HOH AA 8 .   ? 59.115  3.935   10.914  1.00 65.32  ? 2215 HOH A O   1 
HETATM 8805 O  O   . HOH AA 8 .   ? 56.630  3.075   9.039   1.00 74.68  ? 2216 HOH A O   1 
HETATM 8806 O  O   . HOH AA 8 .   ? 62.443  13.991  17.804  1.00 55.19  ? 2217 HOH A O   1 
HETATM 8807 O  O   . HOH AA 8 .   ? 54.372  19.239  26.327  1.00 68.42  ? 2218 HOH A O   1 
HETATM 8808 O  O   . HOH AA 8 .   ? 57.105  11.207  22.705  1.00 55.96  ? 2219 HOH A O   1 
HETATM 8809 O  O   . HOH AA 8 .   ? 53.991  22.850  24.870  1.00 56.16  ? 2220 HOH A O   1 
HETATM 8810 O  O   . HOH AA 8 .   ? 49.805  23.011  24.977  1.00 46.33  ? 2221 HOH A O   1 
HETATM 8811 O  O   . HOH AA 8 .   ? 52.960  28.133  14.868  1.00 61.80  ? 2222 HOH A O   1 
HETATM 8812 O  O   . HOH AA 8 .   ? 40.013  16.551  12.497  1.00 45.53  ? 2223 HOH A O   1 
HETATM 8813 O  O   . HOH AA 8 .   ? 38.956  18.682  10.297  1.00 43.49  ? 2224 HOH A O   1 
HETATM 8814 O  O   . HOH AA 8 .   ? 44.660  23.413  1.880   1.00 65.00  ? 2225 HOH A O   1 
HETATM 8815 O  O   . HOH AA 8 .   ? 49.295  25.541  4.405   1.00 50.47  ? 2226 HOH A O   1 
HETATM 8816 O  O   . HOH AA 8 .   ? 48.359  28.951  5.442   1.00 67.97  ? 2227 HOH A O   1 
HETATM 8817 O  O   . HOH AA 8 .   ? 43.886  20.953  -1.298  1.00 61.57  ? 2228 HOH A O   1 
HETATM 8818 O  O   . HOH AA 8 .   ? 38.702  16.020  1.004   1.00 42.01  ? 2229 HOH A O   1 
HETATM 8819 O  O   . HOH AA 8 .   ? 37.861  12.863  -1.415  1.00 47.08  ? 2230 HOH A O   1 
HETATM 8820 O  O   . HOH AA 8 .   ? 41.021  11.958  -6.996  1.00 67.42  ? 2231 HOH A O   1 
HETATM 8821 O  O   . HOH AA 8 .   ? 41.008  20.935  -4.796  1.00 49.70  ? 2232 HOH A O   1 
HETATM 8822 O  O   . HOH AA 8 .   ? 37.077  19.591  -4.934  1.00 37.52  ? 2233 HOH A O   1 
HETATM 8823 O  O   . HOH AA 8 .   ? 40.468  26.544  -1.871  1.00 63.79  ? 2234 HOH A O   1 
HETATM 8824 O  O   . HOH AA 8 .   ? 35.925  24.166  1.833   1.00 54.24  ? 2235 HOH A O   1 
HETATM 8825 O  O   . HOH AA 8 .   ? 35.862  19.501  4.331   1.00 43.64  ? 2236 HOH A O   1 
HETATM 8826 O  O   . HOH AA 8 .   ? 38.031  22.044  3.252   1.00 93.77  ? 2237 HOH A O   1 
HETATM 8827 O  O   . HOH AA 8 .   ? 30.552  16.405  1.074   1.00 40.12  ? 2238 HOH A O   1 
HETATM 8828 O  O   . HOH AA 8 .   ? 36.146  12.331  0.156   1.00 45.29  ? 2239 HOH A O   1 
HETATM 8829 O  O   . HOH AA 8 .   ? 43.685  11.336  9.273   1.00 40.94  ? 2240 HOH A O   1 
HETATM 8830 O  O   . HOH AA 8 .   ? 47.511  -3.812  13.471  1.00 60.98  ? 2241 HOH A O   1 
HETATM 8831 O  O   . HOH AA 8 .   ? 47.349  -0.555  11.519  1.00 63.98  ? 2242 HOH A O   1 
HETATM 8832 O  O   . HOH AA 8 .   ? 46.044  -1.170  16.804  1.00 57.44  ? 2243 HOH A O   1 
HETATM 8833 O  O   . HOH AA 8 .   ? 42.334  -0.721  19.203  1.00 61.93  ? 2244 HOH A O   1 
HETATM 8834 O  O   . HOH AA 8 .   ? 32.679  -6.374  1.009   1.00 58.35  ? 2245 HOH A O   1 
HETATM 8835 O  O   . HOH AA 8 .   ? 24.876  -12.016 3.191   1.00 70.11  ? 2246 HOH A O   1 
HETATM 8836 O  O   . HOH AA 8 .   ? 21.930  -13.611 8.614   1.00 51.65  ? 2247 HOH A O   1 
HETATM 8837 O  O   . HOH AA 8 .   ? 21.687  -18.825 15.576  1.00 79.39  ? 2248 HOH A O   1 
HETATM 8838 O  O   . HOH AA 8 .   ? 14.766  -7.401  23.851  1.00 55.27  ? 2249 HOH A O   1 
HETATM 8839 O  O   . HOH AA 8 .   ? 18.095  14.935  4.009   1.00 35.62  ? 2250 HOH A O   1 
HETATM 8840 O  O   . HOH AA 8 .   ? 15.922  16.753  0.709   1.00 59.88  ? 2251 HOH A O   1 
HETATM 8841 O  O   . HOH AA 8 .   ? 13.624  16.725  1.473   1.00 47.27  ? 2252 HOH A O   1 
HETATM 8842 O  O   . HOH AA 8 .   ? 11.256  23.214  6.795   1.00 49.25  ? 2253 HOH A O   1 
HETATM 8843 O  O   . HOH AA 8 .   ? 21.960  20.343  7.420   1.00 45.25  ? 2254 HOH A O   1 
HETATM 8844 O  O   . HOH AA 8 .   ? 17.541  22.559  1.499   1.00 55.51  ? 2255 HOH A O   1 
HETATM 8845 O  O   . HOH AA 8 .   ? 13.764  22.016  0.734   1.00 51.44  ? 2256 HOH A O   1 
HETATM 8846 O  O   . HOH AA 8 .   ? 19.772  18.155  2.640   1.00 29.62  ? 2257 HOH A O   1 
HETATM 8847 O  O   . HOH AA 8 .   ? 24.644  19.492  14.166  1.00 73.18  ? 2258 HOH A O   1 
HETATM 8848 O  O   . HOH AA 8 .   ? 29.375  27.541  -6.017  1.00 54.94  ? 2259 HOH A O   1 
HETATM 8849 O  O   . HOH AA 8 .   ? 30.512  32.655  -0.745  1.00 65.32  ? 2260 HOH A O   1 
HETATM 8850 O  O   . HOH AA 8 .   ? 23.827  33.152  -4.242  1.00 54.14  ? 2261 HOH A O   1 
HETATM 8851 O  O   . HOH AA 8 .   ? 18.071  35.029  7.767   1.00 70.49  ? 2262 HOH A O   1 
HETATM 8852 O  O   . HOH AA 8 .   ? 20.454  33.249  10.268  1.00 49.04  ? 2263 HOH A O   1 
HETATM 8853 O  O   . HOH AA 8 .   ? 18.584  36.953  -1.108  1.00 62.17  ? 2264 HOH A O   1 
HETATM 8854 O  O   . HOH AA 8 .   ? 15.514  31.817  3.667   1.00 53.64  ? 2265 HOH A O   1 
HETATM 8855 O  O   . HOH AA 8 .   ? 13.528  30.785  1.293   1.00 59.83  ? 2266 HOH A O   1 
HETATM 8856 O  O   . HOH AA 8 .   ? 25.173  29.444  -15.023 1.00 44.39  ? 2267 HOH A O   1 
HETATM 8857 O  O   . HOH AA 8 .   ? 21.642  22.450  -19.982 1.00 52.73  ? 2268 HOH A O   1 
HETATM 8858 O  O   . HOH AA 8 .   ? 31.191  25.703  -12.856 1.00 42.67  ? 2269 HOH A O   1 
HETATM 8859 O  O   . HOH AA 8 .   ? 30.451  31.529  -7.239  1.00 42.47  ? 2270 HOH A O   1 
HETATM 8860 O  O   . HOH AA 8 .   ? 34.575  23.451  -7.482  1.00 42.32  ? 2271 HOH A O   1 
HETATM 8861 O  O   . HOH AA 8 .   ? 34.985  15.835  -7.571  1.00 42.60  ? 2272 HOH A O   1 
HETATM 8862 O  O   . HOH AA 8 .   ? 36.183  10.760  -15.555 1.00 41.20  ? 2273 HOH A O   1 
HETATM 8863 O  O   . HOH AA 8 .   ? 35.970  7.178   -14.269 1.00 63.02  ? 2274 HOH A O   1 
HETATM 8864 O  O   . HOH AA 8 .   ? 38.808  13.380  -14.042 1.00 79.55  ? 2275 HOH A O   1 
HETATM 8865 O  O   . HOH AA 8 .   ? 32.149  15.168  -18.074 1.00 66.36  ? 2276 HOH A O   1 
HETATM 8866 O  O   . HOH AA 8 .   ? 15.341  14.986  -9.723  1.00 40.51  ? 2277 HOH A O   1 
HETATM 8867 O  O   . HOH AA 8 .   ? 16.454  17.296  -6.031  1.00 83.71  ? 2278 HOH A O   1 
HETATM 8868 O  O   . HOH AA 8 .   ? 16.065  20.340  -20.537 1.00 56.91  ? 2279 HOH A O   1 
HETATM 8869 O  O   . HOH AA 8 .   ? 15.121  26.713  -16.295 1.00 47.44  ? 2280 HOH A O   1 
HETATM 8870 O  O   . HOH AA 8 .   ? 13.753  30.184  -8.596  1.00 42.88  ? 2281 HOH A O   1 
HETATM 8871 O  O   . HOH AA 8 .   ? 10.612  27.435  -7.495  1.00 58.83  ? 2282 HOH A O   1 
HETATM 8872 O  O   . HOH AA 8 .   ? 12.448  30.747  -3.677  1.00 48.25  ? 2283 HOH A O   1 
HETATM 8873 O  O   . HOH AA 8 .   ? 16.888  19.595  -0.628  1.00 48.40  ? 2284 HOH A O   1 
HETATM 8874 O  O   . HOH AA 8 .   ? 19.469  15.278  1.752   1.00 45.62  ? 2285 HOH A O   1 
HETATM 8875 O  O   . HOH AA 8 .   ? 27.200  8.120   -0.347  1.00 47.82  ? 2286 HOH A O   1 
HETATM 8876 O  O   . HOH AA 8 .   ? 29.213  7.572   -1.525  1.00 59.64  ? 2287 HOH A O   1 
HETATM 8877 O  O   . HOH AA 8 .   ? 26.388  5.617   0.579   1.00 50.84  ? 2288 HOH A O   1 
HETATM 8878 O  O   . HOH AA 8 .   ? 23.207  -2.736  -0.943  1.00 59.21  ? 2289 HOH A O   1 
HETATM 8879 O  O   . HOH AA 8 .   ? 21.339  1.116   -0.320  1.00 56.45  ? 2290 HOH A O   1 
HETATM 8880 O  O   . HOH AA 8 .   ? 20.008  -5.357  0.890   1.00 55.71  ? 2291 HOH A O   1 
HETATM 8881 O  O   . HOH AA 8 .   ? 26.590  -7.322  -1.931  1.00 57.72  ? 2292 HOH A O   1 
HETATM 8882 O  O   . HOH AA 8 .   ? 25.213  -3.458  -1.818  1.00 57.57  ? 2293 HOH A O   1 
HETATM 8883 O  O   . HOH AA 8 .   ? 16.351  -8.638  10.205  1.00 51.54  ? 2294 HOH A O   1 
HETATM 8884 O  O   . HOH AA 8 .   ? 16.937  -11.919 7.614   1.00 79.08  ? 2295 HOH A O   1 
HETATM 8885 O  O   . HOH AA 8 .   ? 14.880  -10.135 14.413  1.00 72.64  ? 2296 HOH A O   1 
HETATM 8886 O  O   . HOH AA 8 .   ? 14.075  -5.210  11.130  1.00 43.71  ? 2297 HOH A O   1 
HETATM 8887 O  O   . HOH AA 8 .   ? 9.809   -7.590  16.171  1.00 64.54  ? 2298 HOH A O   1 
HETATM 8888 O  O   . HOH AA 8 .   ? 7.582   -3.292  16.458  1.00 50.38  ? 2299 HOH A O   1 
HETATM 8889 O  O   . HOH AA 8 .   ? 11.152  1.677   10.732  1.00 46.06  ? 2300 HOH A O   1 
HETATM 8890 O  O   . HOH AA 8 .   ? 7.185   15.529  3.290   1.00 63.13  ? 2301 HOH A O   1 
HETATM 8891 O  O   . HOH AA 8 .   ? 6.280   19.647  8.044   1.00 61.47  ? 2302 HOH A O   1 
HETATM 8892 O  O   . HOH AA 8 .   ? 14.058  21.366  14.320  1.00 41.53  ? 2303 HOH A O   1 
HETATM 8893 O  O   . HOH AA 8 .   ? 8.089   22.005  10.714  1.00 49.16  ? 2304 HOH A O   1 
HETATM 8894 O  O   . HOH AA 8 .   ? 5.779   19.955  11.791  1.00 52.38  ? 2305 HOH A O   1 
HETATM 8895 O  O   . HOH AA 8 .   ? 16.913  25.481  18.096  1.00 52.01  ? 2306 HOH A O   1 
HETATM 8896 O  O   . HOH AA 8 .   ? 19.523  28.113  16.600  1.00 73.34  ? 2307 HOH A O   1 
HETATM 8897 O  O   . HOH AA 8 .   ? 14.925  33.204  6.475   1.00 58.36  ? 2308 HOH A O   1 
HETATM 8898 O  O   . HOH AA 8 .   ? 12.002  25.439  2.245   1.00 54.81  ? 2309 HOH A O   1 
HETATM 8899 O  O   . HOH AA 8 .   ? 19.143  20.420  18.566  1.00 37.03  ? 2310 HOH A O   1 
HETATM 8900 O  O   . HOH AA 8 .   ? 10.012  25.285  25.874  1.00 38.57  ? 2311 HOH A O   1 
HETATM 8901 O  O   . HOH AA 8 .   ? 6.205   25.584  26.995  1.00 64.90  ? 2312 HOH A O   1 
HETATM 8902 O  O   . HOH AA 8 .   ? 6.799   20.888  31.138  1.00 62.35  ? 2313 HOH A O   1 
HETATM 8903 O  O   . HOH AA 8 .   ? 17.369  25.378  22.418  1.00 44.48  ? 2314 HOH A O   1 
HETATM 8904 O  O   . HOH AA 8 .   ? 4.776   24.530  17.294  1.00 49.59  ? 2315 HOH A O   1 
HETATM 8905 O  O   . HOH AA 8 .   ? 3.175   13.341  24.556  1.00 58.07  ? 2316 HOH A O   1 
HETATM 8906 O  O   . HOH AA 8 .   ? 5.057   12.064  14.129  1.00 42.71  ? 2317 HOH A O   1 
HETATM 8907 O  O   . HOH AA 8 .   ? 1.755   9.116   16.903  1.00 46.89  ? 2318 HOH A O   1 
HETATM 8908 O  O   . HOH AA 8 .   ? 6.942   6.153   32.546  1.00 85.13  ? 2319 HOH A O   1 
HETATM 8909 O  O   . HOH AA 8 .   ? 3.097   6.974   17.995  1.00 45.73  ? 2320 HOH A O   1 
HETATM 8910 O  O   . HOH AA 8 .   ? 11.415  2.833   33.723  1.00 49.05  ? 2321 HOH A O   1 
HETATM 8911 O  O   . HOH AA 8 .   ? 14.906  4.177   31.121  1.00 67.04  ? 2322 HOH A O   1 
HETATM 8912 O  O   . HOH AA 8 .   ? 9.155   -2.706  6.761   1.00 38.11  ? 2323 HOH A O   1 
HETATM 8913 O  O   . HOH AA 8 .   ? 7.599   -4.957  9.735   1.00 58.89  ? 2324 HOH A O   1 
HETATM 8914 O  O   . HOH AA 8 .   ? 14.702  2.043   1.513   1.00 41.44  ? 2325 HOH A O   1 
HETATM 8915 O  O   . HOH AA 8 .   ? 13.262  -6.332  -1.983  1.00 48.65  ? 2326 HOH A O   1 
HETATM 8916 O  O   . HOH AA 8 .   ? 3.196   0.494   5.110   1.00 47.08  ? 2327 HOH A O   1 
HETATM 8917 O  O   . HOH AA 8 .   ? 9.637   10.924  3.370   1.00 46.07  ? 2328 HOH A O   1 
HETATM 8918 O  O   . HOH AA 8 .   ? 8.983   7.183   0.834   1.00 50.41  ? 2329 HOH A O   1 
HETATM 8919 O  O   . HOH AA 8 .   ? 12.523  9.515   1.575   1.00 72.54  ? 2330 HOH A O   1 
HETATM 8920 O  O   . HOH AA 8 .   ? 3.423   13.581  8.215   1.00 52.87  ? 2331 HOH A O   1 
HETATM 8921 O  O   . HOH AA 8 .   ? 3.616   12.606  11.159  1.00 44.55  ? 2332 HOH A O   1 
HETATM 8922 O  O   . HOH AA 8 .   ? 2.779   16.462  18.555  1.00 47.93  ? 2333 HOH A O   1 
HETATM 8923 O  O   . HOH AA 8 .   ? 2.377   7.473   2.785   1.00 72.53  ? 2334 HOH A O   1 
HETATM 8924 O  O   . HOH AA 8 .   ? 5.068   13.381  2.588   1.00 63.94  ? 2335 HOH A O   1 
HETATM 8925 O  O   . HOH AA 8 .   ? 5.299   5.898   0.978   1.00 52.42  ? 2336 HOH A O   1 
HETATM 8926 O  O   . HOH AA 8 .   ? 16.833  2.987   0.462   1.00 42.47  ? 2337 HOH A O   1 
HETATM 8927 O  O   . HOH AA 8 .   ? 13.195  12.548  -2.814  1.00 61.03  ? 2338 HOH A O   1 
HETATM 8928 O  O   . HOH AA 8 .   ? 14.345  8.435   -4.392  1.00 42.84  ? 2339 HOH A O   1 
HETATM 8929 O  O   . HOH AA 8 .   ? 14.633  9.817   -8.894  1.00 73.75  ? 2340 HOH A O   1 
HETATM 8930 O  O   . HOH AA 8 .   ? 19.427  0.989   -2.793  1.00 46.44  ? 2341 HOH A O   1 
HETATM 8931 O  O   . HOH AA 8 .   ? 31.316  5.115   -4.449  1.00 53.83  ? 2342 HOH A O   1 
HETATM 8932 O  O   . HOH AA 8 .   ? 33.089  -2.434  -8.690  1.00 68.83  ? 2343 HOH A O   1 
HETATM 8933 O  O   . HOH AA 8 .   ? 30.529  34.322  -3.342  1.00 76.86  ? 2344 HOH A O   1 
HETATM 8934 O  O   . HOH AA 8 .   ? 27.124  38.404  2.167   1.00 72.47  ? 2345 HOH A O   1 
HETATM 8935 O  O   . HOH AA 8 .   ? 40.496  18.445  48.025  1.00 55.16  ? 2346 HOH A O   1 
HETATM 8936 O  O   . HOH AA 8 .   ? 25.276  22.449  35.093  1.00 48.96  ? 2347 HOH A O   1 
HETATM 8937 O  O   . HOH AA 8 .   ? 26.815  28.920  40.874  1.00 71.57  ? 2348 HOH A O   1 
HETATM 8938 O  O   . HOH AA 8 .   ? 12.550  39.717  27.441  1.00 72.28  ? 2349 HOH A O   1 
HETATM 8939 O  O   . HOH BA 8 .   ? -18.211 12.050  -64.061 1.00 65.64  ? 2001 HOH B O   1 
HETATM 8940 O  O   . HOH BA 8 .   ? 7.005   10.020  -65.385 1.00 45.67  ? 2002 HOH B O   1 
HETATM 8941 O  O   . HOH BA 8 .   ? 16.269  10.826  -11.752 1.00 54.86  ? 2003 HOH B O   1 
HETATM 8942 O  O   . HOH BA 8 .   ? 11.636  10.221  -12.835 1.00 67.94  ? 2004 HOH B O   1 
HETATM 8943 O  O   . HOH BA 8 .   ? 9.407   9.182   -11.127 1.00 63.11  ? 2005 HOH B O   1 
HETATM 8944 O  O   . HOH BA 8 .   ? -9.373  14.297  -63.323 1.00 59.25  ? 2006 HOH B O   1 
HETATM 8945 O  O   . HOH BA 8 .   ? 7.308   13.201  -64.549 1.00 53.29  ? 2007 HOH B O   1 
HETATM 8946 O  O   . HOH BA 8 .   ? 15.719  5.020   -68.570 1.00 66.38  ? 2008 HOH B O   1 
HETATM 8947 O  O   . HOH BA 8 .   ? 4.326   10.662  -65.319 1.00 41.36  ? 2009 HOH B O   1 
HETATM 8948 O  O   . HOH BA 8 .   ? 2.961   9.297   -73.517 1.00 61.10  ? 2010 HOH B O   1 
HETATM 8949 O  O   . HOH BA 8 .   ? -0.668  7.390   -72.993 1.00 41.48  ? 2011 HOH B O   1 
HETATM 8950 O  O   . HOH BA 8 .   ? -11.697 5.811   -70.899 1.00 67.47  ? 2012 HOH B O   1 
HETATM 8951 O  O   . HOH BA 8 .   ? -12.545 2.718   -63.295 1.00 56.95  ? 2013 HOH B O   1 
HETATM 8952 O  O   . HOH BA 8 .   ? -2.669  4.196   -78.507 1.00 68.03  ? 2014 HOH B O   1 
HETATM 8953 O  O   . HOH BA 8 .   ? 2.106   7.136   -77.432 1.00 63.89  ? 2015 HOH B O   1 
HETATM 8954 O  O   . HOH BA 8 .   ? -5.169  -1.439  -69.962 1.00 49.40  ? 2016 HOH B O   1 
HETATM 8955 O  O   . HOH BA 8 .   ? -1.492  -2.195  -67.400 1.00 44.26  ? 2017 HOH B O   1 
HETATM 8956 O  O   . HOH BA 8 .   ? -18.778 2.113   -56.105 1.00 60.40  ? 2018 HOH B O   1 
HETATM 8957 O  O   . HOH BA 8 .   ? -8.769  -1.608  -52.741 1.00 67.25  ? 2019 HOH B O   1 
HETATM 8958 O  O   . HOH BA 8 .   ? -15.697 0.369   -53.246 1.00 59.95  ? 2020 HOH B O   1 
HETATM 8959 O  O   . HOH BA 8 .   ? -2.732  -0.770  -61.497 1.00 46.04  ? 2021 HOH B O   1 
HETATM 8960 O  O   . HOH BA 8 .   ? 0.441   0.456   -55.995 1.00 38.36  ? 2022 HOH B O   1 
HETATM 8961 O  O   . HOH BA 8 .   ? 0.697   -0.514  -63.881 1.00 67.87  ? 2023 HOH B O   1 
HETATM 8962 O  O   . HOH BA 8 .   ? 5.146   8.368   -64.278 1.00 34.03  ? 2024 HOH B O   1 
HETATM 8963 O  O   . HOH BA 8 .   ? 4.083   0.058   -65.559 1.00 63.85  ? 2025 HOH B O   1 
HETATM 8964 O  O   . HOH BA 8 .   ? 6.497   -0.057  -65.796 1.00 65.68  ? 2026 HOH B O   1 
HETATM 8965 O  O   . HOH BA 8 .   ? 7.928   1.247   -62.108 1.00 35.66  ? 2027 HOH B O   1 
HETATM 8966 O  O   . HOH BA 8 .   ? 14.988  2.623   -62.089 1.00 41.08  ? 2028 HOH B O   1 
HETATM 8967 O  O   . HOH BA 8 .   ? 9.127   1.466   -68.527 1.00 42.15  ? 2029 HOH B O   1 
HETATM 8968 O  O   . HOH BA 8 .   ? 12.342  -0.538  -68.292 1.00 38.68  ? 2030 HOH B O   1 
HETATM 8969 O  O   . HOH BA 8 .   ? 15.306  2.186   -68.481 1.00 63.49  ? 2031 HOH B O   1 
HETATM 8970 O  O   . HOH BA 8 .   ? 14.592  -0.981  -66.049 1.00 46.97  ? 2032 HOH B O   1 
HETATM 8971 O  O   . HOH BA 8 .   ? 15.730  -4.769  -57.005 1.00 35.41  ? 2033 HOH B O   1 
HETATM 8972 O  O   . HOH BA 8 .   ? 17.154  -3.394  -66.344 1.00 53.40  ? 2034 HOH B O   1 
HETATM 8973 O  O   . HOH BA 8 .   ? 16.859  -8.055  -60.354 1.00 43.04  ? 2035 HOH B O   1 
HETATM 8974 O  O   . HOH BA 8 .   ? 19.818  -5.453  -66.996 1.00 57.44  ? 2036 HOH B O   1 
HETATM 8975 O  O   . HOH BA 8 .   ? 23.714  -3.106  -59.225 1.00 52.09  ? 2037 HOH B O   1 
HETATM 8976 O  O   . HOH BA 8 .   ? 22.027  -1.291  -66.345 1.00 65.86  ? 2038 HOH B O   1 
HETATM 8977 O  O   . HOH BA 8 .   ? 17.332  1.531   -60.583 1.00 59.93  ? 2039 HOH B O   1 
HETATM 8978 O  O   . HOH BA 8 .   ? 23.478  4.362   -64.598 1.00 45.53  ? 2040 HOH B O   1 
HETATM 8979 O  O   . HOH BA 8 .   ? 17.686  -2.829  -55.962 1.00 33.20  ? 2041 HOH B O   1 
HETATM 8980 O  O   . HOH BA 8 .   ? 22.992  0.621   -53.036 1.00 48.34  ? 2042 HOH B O   1 
HETATM 8981 O  O   . HOH BA 8 .   ? 6.253   -7.665  -41.232 1.00 44.69  ? 2043 HOH B O   1 
HETATM 8982 O  O   . HOH BA 8 .   ? -10.899 -0.996  -44.327 1.00 60.24  ? 2044 HOH B O   1 
HETATM 8983 O  O   . HOH BA 8 .   ? -10.935 -2.536  -47.752 1.00 72.26  ? 2045 HOH B O   1 
HETATM 8984 O  O   . HOH BA 8 .   ? 16.551  0.453   -66.911 1.00 51.41  ? 2046 HOH B O   1 
HETATM 8985 O  O   . HOH BA 8 .   ? 14.871  7.002   -67.464 1.00 69.58  ? 2047 HOH B O   1 
HETATM 8986 O  O   . HOH BA 8 .   ? 10.694  9.895   -68.406 1.00 52.20  ? 2048 HOH B O   1 
HETATM 8987 O  O   . HOH BA 8 .   ? 4.506   1.504   -69.561 1.00 41.91  ? 2049 HOH B O   1 
HETATM 8988 O  O   . HOH BA 8 .   ? 5.949   2.056   -71.961 1.00 46.61  ? 2050 HOH B O   1 
HETATM 8989 O  O   . HOH BA 8 .   ? -1.300  6.925   -76.969 1.00 60.51  ? 2051 HOH B O   1 
HETATM 8990 O  O   . HOH BA 8 .   ? -2.677  -0.673  -68.939 1.00 40.41  ? 2052 HOH B O   1 
HETATM 8991 O  O   . HOH BA 8 .   ? 32.706  5.871   -48.780 1.00 79.30  ? 2053 HOH B O   1 
HETATM 8992 O  O   . HOH BA 8 .   ? 30.849  9.047   -52.790 1.00 56.19  ? 2054 HOH B O   1 
HETATM 8993 O  O   . HOH BA 8 .   ? -6.915  -3.066  -55.460 1.00 65.19  ? 2055 HOH B O   1 
HETATM 8994 O  O   . HOH BA 8 .   ? -1.310  -3.941  -60.696 1.00 53.10  ? 2056 HOH B O   1 
HETATM 8995 O  O   . HOH BA 8 .   ? 1.682   -2.229  -53.278 1.00 40.12  ? 2057 HOH B O   1 
HETATM 8996 O  O   . HOH BA 8 .   ? 5.080   -5.857  -60.705 1.00 43.55  ? 2058 HOH B O   1 
HETATM 8997 O  O   . HOH BA 8 .   ? 19.817  15.949  -56.651 1.00 51.10  ? 2059 HOH B O   1 
HETATM 8998 O  O   . HOH BA 8 .   ? 20.007  9.426   -58.197 1.00 69.58  ? 2060 HOH B O   1 
HETATM 8999 O  O   . HOH BA 8 .   ? 5.248   -11.039 -59.960 1.00 50.94  ? 2061 HOH B O   1 
HETATM 9000 O  O   . HOH BA 8 .   ? 2.182   21.665  -61.170 1.00 61.74  ? 2062 HOH B O   1 
HETATM 9001 O  O   . HOH BA 8 .   ? 14.738  17.013  -61.318 1.00 66.01  ? 2063 HOH B O   1 
HETATM 9002 O  O   . HOH BA 8 .   ? 6.555   -2.371  -50.766 1.00 36.33  ? 2064 HOH B O   1 
HETATM 9003 O  O   . HOH BA 8 .   ? 12.330  -5.231  -54.238 1.00 55.54  ? 2065 HOH B O   1 
HETATM 9004 O  O   . HOH BA 8 .   ? 12.615  -4.463  -51.561 1.00 38.65  ? 2066 HOH B O   1 
HETATM 9005 O  O   . HOH BA 8 .   ? 14.249  -7.386  -48.811 1.00 31.95  ? 2067 HOH B O   1 
HETATM 9006 O  O   . HOH BA 8 .   ? 9.866   -13.633 -48.587 1.00 39.70  ? 2068 HOH B O   1 
HETATM 9007 O  O   . HOH BA 8 .   ? 13.344  -7.828  -46.327 1.00 36.20  ? 2069 HOH B O   1 
HETATM 9008 O  O   . HOH BA 8 .   ? 10.735  -14.603 -45.959 1.00 45.96  ? 2070 HOH B O   1 
HETATM 9009 O  O   . HOH BA 8 .   ? 25.146  19.104  -48.605 1.00 63.57  ? 2071 HOH B O   1 
HETATM 9010 O  O   . HOH BA 8 .   ? -1.640  -7.182  -45.043 1.00 53.00  ? 2072 HOH B O   1 
HETATM 9011 O  O   . HOH BA 8 .   ? -1.718  -10.573 -45.498 1.00 57.07  ? 2073 HOH B O   1 
HETATM 9012 O  O   . HOH BA 8 .   ? -3.240  -3.603  -42.766 1.00 47.77  ? 2074 HOH B O   1 
HETATM 9013 O  O   . HOH BA 8 .   ? 4.664   -3.691  -42.874 1.00 35.66  ? 2075 HOH B O   1 
HETATM 9014 O  O   . HOH BA 8 .   ? 24.589  4.872   -34.992 1.00 64.15  ? 2076 HOH B O   1 
HETATM 9015 O  O   . HOH BA 8 .   ? 2.427   -12.035 -46.981 1.00 53.18  ? 2077 HOH B O   1 
HETATM 9016 O  O   . HOH BA 8 .   ? 32.713  7.392   -42.683 1.00 60.16  ? 2078 HOH B O   1 
HETATM 9017 O  O   . HOH BA 8 .   ? 29.748  8.647   -40.021 1.00 50.00  ? 2079 HOH B O   1 
HETATM 9018 O  O   . HOH BA 8 .   ? -0.863  -12.663 -50.063 1.00 68.25  ? 2080 HOH B O   1 
HETATM 9019 O  O   . HOH BA 8 .   ? -5.404  -2.339  -49.058 1.00 46.40  ? 2081 HOH B O   1 
HETATM 9020 O  O   . HOH BA 8 .   ? 31.348  -3.481  -32.526 1.00 66.53  ? 2082 HOH B O   1 
HETATM 9021 O  O   . HOH BA 8 .   ? 33.372  -2.560  -33.861 1.00 68.57  ? 2083 HOH B O   1 
HETATM 9022 O  O   . HOH BA 8 .   ? -1.884  -12.204 -53.254 1.00 72.07  ? 2084 HOH B O   1 
HETATM 9023 O  O   . HOH BA 8 .   ? 2.637   -11.723 -51.157 1.00 56.69  ? 2085 HOH B O   1 
HETATM 9024 O  O   . HOH BA 8 .   ? -7.321  -8.474  -54.249 1.00 63.56  ? 2086 HOH B O   1 
HETATM 9025 O  O   . HOH BA 8 .   ? 4.820   -13.597 -53.688 1.00 46.73  ? 2087 HOH B O   1 
HETATM 9026 O  O   . HOH BA 8 .   ? 13.488  -4.040  -55.946 1.00 44.80  ? 2088 HOH B O   1 
HETATM 9027 O  O   . HOH BA 8 .   ? 6.838   -0.317  -63.729 1.00 70.21  ? 2089 HOH B O   1 
HETATM 9028 O  O   . HOH BA 8 .   ? 9.040   -0.953  -60.987 1.00 45.23  ? 2090 HOH B O   1 
HETATM 9029 O  O   . HOH BA 8 .   ? 10.421  -5.546  -64.576 1.00 43.31  ? 2091 HOH B O   1 
HETATM 9030 O  O   . HOH BA 8 .   ? 37.321  -1.072  -52.276 1.00 61.45  ? 2092 HOH B O   1 
HETATM 9031 O  O   . HOH BA 8 .   ? 1.571   0.306   -53.261 1.00 39.61  ? 2093 HOH B O   1 
HETATM 9032 O  O   . HOH BA 8 .   ? -3.515  24.858  -51.706 1.00 54.50  ? 2094 HOH B O   1 
HETATM 9033 O  O   . HOH BA 8 .   ? -9.970  21.314  -51.621 1.00 48.57  ? 2095 HOH B O   1 
HETATM 9034 O  O   . HOH BA 8 .   ? -0.008  19.833  -47.364 1.00 28.90  ? 2096 HOH B O   1 
HETATM 9035 O  O   . HOH BA 8 .   ? 4.417   4.722   -48.415 1.00 31.20  ? 2097 HOH B O   1 
HETATM 9036 O  O   . HOH BA 8 .   ? 4.226   2.255   -40.829 1.00 41.91  ? 2098 HOH B O   1 
HETATM 9037 O  O   . HOH BA 8 .   ? 4.352   -0.722  -43.618 1.00 32.25  ? 2099 HOH B O   1 
HETATM 9038 O  O   . HOH BA 8 .   ? 10.448  0.280   -43.962 1.00 35.78  ? 2100 HOH B O   1 
HETATM 9039 O  O   . HOH BA 8 .   ? 16.394  -3.303  -42.790 1.00 37.76  ? 2101 HOH B O   1 
HETATM 9040 O  O   . HOH BA 8 .   ? 6.736   -4.901  -41.481 1.00 51.01  ? 2102 HOH B O   1 
HETATM 9041 O  O   . HOH BA 8 .   ? -3.582  0.978   -48.561 1.00 53.50  ? 2103 HOH B O   1 
HETATM 9042 O  O   . HOH BA 8 .   ? -1.256  3.743   -48.916 1.00 46.50  ? 2104 HOH B O   1 
HETATM 9043 O  O   . HOH BA 8 .   ? -3.386  -5.450  -45.146 1.00 55.25  ? 2105 HOH B O   1 
HETATM 9044 O  O   . HOH BA 8 .   ? -9.047  -0.259  -45.479 1.00 55.29  ? 2106 HOH B O   1 
HETATM 9045 O  O   . HOH BA 8 .   ? -7.768  7.565   -45.104 1.00 48.72  ? 2107 HOH B O   1 
HETATM 9046 O  O   . HOH BA 8 .   ? -12.673 -1.802  -52.303 1.00 58.54  ? 2108 HOH B O   1 
HETATM 9047 O  O   . HOH BA 8 .   ? -18.291 12.946  -45.475 1.00 65.89  ? 2109 HOH B O   1 
HETATM 9048 O  O   . HOH BA 8 .   ? 3.257   -12.581 -9.506  1.00 61.62  ? 2110 HOH B O   1 
HETATM 9049 O  O   . HOH BA 8 .   ? -14.072 19.079  -48.358 1.00 74.55  ? 2111 HOH B O   1 
HETATM 9050 O  O   . HOH BA 8 .   ? 16.776  -8.137  -48.539 1.00 45.67  ? 2112 HOH B O   1 
HETATM 9051 O  O   . HOH BA 8 .   ? 7.494   28.774  -31.496 1.00 67.44  ? 2113 HOH B O   1 
HETATM 9052 O  O   . HOH BA 8 .   ? 22.967  -0.385  -45.220 1.00 42.25  ? 2114 HOH B O   1 
HETATM 9053 O  O   . HOH BA 8 .   ? 21.742  2.199   -47.626 1.00 43.44  ? 2115 HOH B O   1 
HETATM 9054 O  O   . HOH BA 8 .   ? 25.048  -2.996  -46.625 1.00 34.78  ? 2116 HOH B O   1 
HETATM 9055 O  O   . HOH BA 8 .   ? 33.385  1.724   -47.360 1.00 57.73  ? 2117 HOH B O   1 
HETATM 9056 O  O   . HOH BA 8 .   ? 28.123  5.530   -51.652 1.00 53.06  ? 2118 HOH B O   1 
HETATM 9057 O  O   . HOH BA 8 .   ? 30.168  6.834   -49.540 1.00 56.22  ? 2119 HOH B O   1 
HETATM 9058 O  O   . HOH BA 8 .   ? 31.332  6.172   -58.211 1.00 52.85  ? 2120 HOH B O   1 
HETATM 9059 O  O   . HOH BA 8 .   ? -8.310  -9.223  -24.515 1.00 77.18  ? 2121 HOH B O   1 
HETATM 9060 O  O   . HOH BA 8 .   ? 33.297  7.302   -58.905 1.00 70.78  ? 2122 HOH B O   1 
HETATM 9061 O  O   . HOH BA 8 .   ? 32.878  1.067   -58.170 1.00 51.06  ? 2123 HOH B O   1 
HETATM 9062 O  O   . HOH BA 8 .   ? 22.955  6.944   -52.919 1.00 54.13  ? 2124 HOH B O   1 
HETATM 9063 O  O   . HOH BA 8 .   ? 16.046  10.354  -56.915 1.00 47.81  ? 2125 HOH B O   1 
HETATM 9064 O  O   . HOH BA 8 .   ? 19.146  12.716  -55.721 1.00 46.26  ? 2126 HOH B O   1 
HETATM 9065 O  O   . HOH BA 8 .   ? 21.168  13.254  -52.431 1.00 48.26  ? 2127 HOH B O   1 
HETATM 9066 O  O   . HOH BA 8 .   ? 6.343   16.748  -53.773 1.00 37.97  ? 2128 HOH B O   1 
HETATM 9067 O  O   . HOH BA 8 .   ? 16.097  16.850  -56.374 1.00 49.69  ? 2129 HOH B O   1 
HETATM 9068 O  O   . HOH BA 8 .   ? 1.926   19.330  -60.178 1.00 41.63  ? 2130 HOH B O   1 
HETATM 9069 O  O   . HOH BA 8 .   ? 11.465  17.330  -59.928 1.00 68.36  ? 2131 HOH B O   1 
HETATM 9070 O  O   . HOH BA 8 .   ? 2.209   11.580  -17.207 1.00 48.05  ? 2132 HOH B O   1 
HETATM 9071 O  O   . HOH BA 8 .   ? 6.914   10.122  -17.971 1.00 64.19  ? 2133 HOH B O   1 
HETATM 9072 O  O   . HOH BA 8 .   ? -3.824  27.891  -54.023 1.00 73.12  ? 2134 HOH B O   1 
HETATM 9073 O  O   . HOH BA 8 .   ? 5.035   27.498  -50.599 1.00 51.04  ? 2135 HOH B O   1 
HETATM 9074 O  O   . HOH BA 8 .   ? 2.779   25.444  -48.492 1.00 61.83  ? 2136 HOH B O   1 
HETATM 9075 O  O   . HOH BA 8 .   ? 5.236   -0.038  -37.860 1.00 38.50  ? 2137 HOH B O   1 
HETATM 9076 O  O   . HOH BA 8 .   ? 3.688   4.132   -33.863 1.00 36.08  ? 2138 HOH B O   1 
HETATM 9077 O  O   . HOH BA 8 .   ? 22.642  15.590  -45.978 1.00 48.46  ? 2139 HOH B O   1 
HETATM 9078 O  O   . HOH BA 8 .   ? 21.747  19.158  -44.122 1.00 54.78  ? 2140 HOH B O   1 
HETATM 9079 O  O   . HOH BA 8 .   ? 21.831  17.582  -48.131 1.00 58.36  ? 2141 HOH B O   1 
HETATM 9080 O  O   . HOH BA 8 .   ? 19.128  22.561  -42.648 1.00 72.57  ? 2142 HOH B O   1 
HETATM 9081 O  O   . HOH BA 8 .   ? 20.190  20.510  -42.675 1.00 61.49  ? 2143 HOH B O   1 
HETATM 9082 O  O   . HOH BA 8 .   ? 5.963   26.247  -45.348 1.00 72.96  ? 2144 HOH B O   1 
HETATM 9083 O  O   . HOH BA 8 .   ? 3.166   8.077   -33.081 1.00 31.85  ? 2145 HOH B O   1 
HETATM 9084 O  O   . HOH BA 8 .   ? 13.503  6.523   -33.563 1.00 36.89  ? 2146 HOH B O   1 
HETATM 9085 O  O   . HOH BA 8 .   ? 20.665  7.276   -36.730 1.00 51.81  ? 2147 HOH B O   1 
HETATM 9086 O  O   . HOH BA 8 .   ? 17.095  5.516   -34.953 1.00 34.06  ? 2148 HOH B O   1 
HETATM 9087 O  O   . HOH BA 8 .   ? 19.376  10.655  -30.388 1.00 54.31  ? 2149 HOH B O   1 
HETATM 9088 O  O   . HOH BA 8 .   ? 24.679  7.068   -34.267 1.00 74.70  ? 2150 HOH B O   1 
HETATM 9089 O  O   . HOH BA 8 .   ? 21.938  6.167   -30.400 1.00 52.21  ? 2151 HOH B O   1 
HETATM 9090 O  O   . HOH BA 8 .   ? 22.589  0.877   -36.392 1.00 36.91  ? 2152 HOH B O   1 
HETATM 9091 O  O   . HOH BA 8 .   ? 24.104  1.939   -32.768 1.00 49.83  ? 2153 HOH B O   1 
HETATM 9092 O  O   . HOH BA 8 .   ? 19.224  -1.042  -37.581 1.00 41.58  ? 2154 HOH B O   1 
HETATM 9093 O  O   . HOH BA 8 .   ? 24.854  6.728   -38.027 1.00 52.37  ? 2155 HOH B O   1 
HETATM 9094 O  O   . HOH BA 8 .   ? 27.097  1.974   -37.525 1.00 47.40  ? 2156 HOH B O   1 
HETATM 9095 O  O   . HOH BA 8 .   ? 32.927  2.618   -38.381 1.00 75.93  ? 2157 HOH B O   1 
HETATM 9096 O  O   . HOH BA 8 .   ? 30.004  6.653   -42.332 1.00 48.59  ? 2158 HOH B O   1 
HETATM 9097 O  O   . HOH BA 8 .   ? 32.912  4.162   -41.433 1.00 47.91  ? 2159 HOH B O   1 
HETATM 9098 O  O   . HOH BA 8 .   ? 34.180  -2.649  -43.321 1.00 62.34  ? 2160 HOH B O   1 
HETATM 9099 O  O   . HOH BA 8 .   ? 32.352  -2.194  -38.226 1.00 74.47  ? 2161 HOH B O   1 
HETATM 9100 O  O   . HOH BA 8 .   ? 31.694  -3.042  -36.048 1.00 64.12  ? 2162 HOH B O   1 
HETATM 9101 O  O   . HOH BA 8 .   ? 33.815  -7.654  -43.724 1.00 54.54  ? 2163 HOH B O   1 
HETATM 9102 O  O   . HOH BA 8 .   ? 38.928  -3.688  -60.662 1.00 81.20  ? 2164 HOH B O   1 
HETATM 9103 O  O   . HOH BA 8 .   ? 36.511  -2.118  -55.368 1.00 74.26  ? 2165 HOH B O   1 
HETATM 9104 O  O   . HOH BA 8 .   ? 34.292  0.501   -55.135 1.00 62.92  ? 2166 HOH B O   1 
HETATM 9105 O  O   . HOH BA 8 .   ? 25.501  -9.532  -63.321 1.00 54.70  ? 2167 HOH B O   1 
HETATM 9106 O  O   . HOH BA 8 .   ? 18.862  -20.552 -55.764 1.00 66.24  ? 2168 HOH B O   1 
HETATM 9107 O  O   . HOH BA 8 .   ? 17.191  -5.402  -43.637 1.00 51.35  ? 2169 HOH B O   1 
HETATM 9108 O  O   . HOH BA 8 .   ? 22.674  -15.317 -36.420 1.00 59.34  ? 2170 HOH B O   1 
HETATM 9109 O  O   . HOH BA 8 .   ? 22.326  -12.109 -34.638 1.00 58.20  ? 2171 HOH B O   1 
HETATM 9110 O  O   . HOH BA 8 .   ? 23.029  -5.501  -33.482 1.00 53.55  ? 2172 HOH B O   1 
HETATM 9111 O  O   . HOH BA 8 .   ? 24.174  -2.038  -31.507 1.00 38.37  ? 2173 HOH B O   1 
HETATM 9112 O  O   . HOH BA 8 .   ? 23.794  -8.729  -26.980 1.00 51.56  ? 2174 HOH B O   1 
HETATM 9113 O  O   . HOH BA 8 .   ? 17.207  -11.714 -31.684 1.00 61.75  ? 2175 HOH B O   1 
HETATM 9114 O  O   . HOH BA 8 .   ? 17.702  -6.955  -34.456 1.00 49.68  ? 2176 HOH B O   1 
HETATM 9115 O  O   . HOH BA 8 .   ? 16.548  -2.270  -28.665 1.00 47.91  ? 2177 HOH B O   1 
HETATM 9116 O  O   . HOH BA 8 .   ? 24.182  -2.230  -43.990 1.00 37.59  ? 2178 HOH B O   1 
HETATM 9117 O  O   . HOH BA 8 .   ? 30.832  10.925  -51.239 1.00 54.59  ? 2179 HOH B O   1 
HETATM 9118 O  O   . HOH BA 8 .   ? 29.512  12.843  -52.533 1.00 68.51  ? 2180 HOH B O   1 
HETATM 9119 O  O   . HOH BA 8 .   ? 22.545  9.975   -53.011 1.00 48.45  ? 2181 HOH B O   1 
HETATM 9120 O  O   . HOH BA 8 .   ? 26.456  8.833   -53.337 1.00 46.87  ? 2182 HOH B O   1 
HETATM 9121 O  O   . HOH BA 8 .   ? 23.675  19.902  -45.102 1.00 74.89  ? 2183 HOH B O   1 
HETATM 9122 O  O   . HOH BA 8 .   ? 20.776  24.113  -42.501 1.00 77.03  ? 2184 HOH B O   1 
HETATM 9123 O  O   . HOH BA 8 .   ? 2.848   28.436  -43.465 1.00 57.05  ? 2185 HOH B O   1 
HETATM 9124 O  O   . HOH BA 8 .   ? 6.503   4.584   -24.926 1.00 35.75  ? 2186 HOH B O   1 
HETATM 9125 O  O   . HOH BA 8 .   ? 6.364   3.523   -21.385 1.00 66.20  ? 2187 HOH B O   1 
HETATM 9126 O  O   . HOH BA 8 .   ? -3.165  0.706   -22.207 1.00 59.56  ? 2188 HOH B O   1 
HETATM 9127 O  O   . HOH BA 8 .   ? 5.255   -1.796  -29.204 1.00 42.96  ? 2189 HOH B O   1 
HETATM 9128 O  O   . HOH BA 8 .   ? 4.879   -1.695  -22.144 1.00 50.80  ? 2190 HOH B O   1 
HETATM 9129 O  O   . HOH BA 8 .   ? 7.435   1.011   -24.054 1.00 44.49  ? 2191 HOH B O   1 
HETATM 9130 O  O   . HOH BA 8 .   ? 11.549  -17.687 -24.371 1.00 68.83  ? 2192 HOH B O   1 
HETATM 9131 O  O   . HOH BA 8 .   ? -2.601  -15.744 -27.424 1.00 65.00  ? 2193 HOH B O   1 
HETATM 9132 O  O   . HOH BA 8 .   ? -4.099  -12.554 -25.772 1.00 62.00  ? 2194 HOH B O   1 
HETATM 9133 O  O   . HOH BA 8 .   ? 6.843   -15.424 -12.852 1.00 63.98  ? 2195 HOH B O   1 
HETATM 9134 O  O   . HOH BA 8 .   ? 13.498  -17.162 -14.400 1.00 61.50  ? 2196 HOH B O   1 
HETATM 9135 O  O   . HOH BA 8 .   ? 20.683  -5.759  -10.781 1.00 57.36  ? 2197 HOH B O   1 
HETATM 9136 O  O   . HOH BA 8 .   ? 19.315  -6.902  -6.716  1.00 60.11  ? 2198 HOH B O   1 
HETATM 9137 O  O   . HOH BA 8 .   ? 22.777  -6.835  -17.590 1.00 66.36  ? 2199 HOH B O   1 
HETATM 9138 O  O   . HOH BA 8 .   ? 21.231  -11.563 -22.724 1.00 53.90  ? 2200 HOH B O   1 
HETATM 9139 O  O   . HOH BA 8 .   ? 29.588  -6.504  -25.317 1.00 71.79  ? 2201 HOH B O   1 
HETATM 9140 O  O   . HOH BA 8 .   ? 32.377  -3.631  -16.190 1.00 59.40  ? 2202 HOH B O   1 
HETATM 9141 O  O   . HOH BA 8 .   ? 20.177  7.510   -12.731 1.00 47.57  ? 2203 HOH B O   1 
HETATM 9142 O  O   . HOH BA 8 .   ? 9.966   -7.150  -5.133  1.00 46.31  ? 2204 HOH B O   1 
HETATM 9143 O  O   . HOH BA 8 .   ? 9.568   -12.745 -6.941  1.00 56.26  ? 2205 HOH B O   1 
HETATM 9144 O  O   . HOH BA 8 .   ? 7.377   -13.320 -7.648  1.00 61.82  ? 2206 HOH B O   1 
HETATM 9145 O  O   . HOH BA 8 .   ? 4.055   -9.332  -10.130 1.00 45.21  ? 2207 HOH B O   1 
HETATM 9146 O  O   . HOH BA 8 .   ? 6.384   0.114   -19.720 1.00 46.30  ? 2208 HOH B O   1 
HETATM 9147 O  O   . HOH BA 8 .   ? 3.851   -3.791  -20.783 1.00 56.93  ? 2209 HOH B O   1 
HETATM 9148 O  O   . HOH BA 8 .   ? 8.531   3.459   -24.235 1.00 45.48  ? 2210 HOH B O   1 
HETATM 9149 O  O   . HOH BA 8 .   ? 18.793  6.641   -27.303 1.00 38.93  ? 2211 HOH B O   1 
HETATM 9150 O  O   . HOH BA 8 .   ? 17.024  15.445  -25.006 1.00 50.76  ? 2212 HOH B O   1 
HETATM 9151 O  O   . HOH BA 8 .   ? 17.859  18.436  -27.128 1.00 57.72  ? 2213 HOH B O   1 
HETATM 9152 O  O   . HOH BA 8 .   ? 22.043  16.935  -26.244 1.00 61.03  ? 2214 HOH B O   1 
HETATM 9153 O  O   . HOH BA 8 .   ? 20.140  18.237  -25.822 1.00 63.51  ? 2215 HOH B O   1 
HETATM 9154 O  O   . HOH BA 8 .   ? 18.297  21.191  -26.241 1.00 59.40  ? 2216 HOH B O   1 
HETATM 9155 O  O   . HOH BA 8 .   ? 25.014  20.844  -28.326 1.00 62.53  ? 2217 HOH B O   1 
HETATM 9156 O  O   . HOH BA 8 .   ? 11.802  27.226  -32.473 1.00 57.40  ? 2218 HOH B O   1 
HETATM 9157 O  O   . HOH BA 8 .   ? 12.047  26.865  -28.282 1.00 51.57  ? 2219 HOH B O   1 
HETATM 9158 O  O   . HOH BA 8 .   ? 8.258   25.258  -31.690 1.00 43.71  ? 2220 HOH B O   1 
HETATM 9159 O  O   . HOH BA 8 .   ? 8.194   28.948  -33.893 1.00 68.50  ? 2221 HOH B O   1 
HETATM 9160 O  O   . HOH BA 8 .   ? -0.247  27.138  -32.485 1.00 35.42  ? 2222 HOH B O   1 
HETATM 9161 O  O   . HOH BA 8 .   ? 3.233   20.461  -28.502 1.00 30.99  ? 2223 HOH B O   1 
HETATM 9162 O  O   . HOH BA 8 .   ? 1.215   7.933   -20.806 1.00 59.90  ? 2224 HOH B O   1 
HETATM 9163 O  O   . HOH BA 8 .   ? -4.126  1.324   -30.433 1.00 43.04  ? 2225 HOH B O   1 
HETATM 9164 O  O   . HOH BA 8 .   ? -8.444  6.468   -23.770 1.00 50.56  ? 2226 HOH B O   1 
HETATM 9165 O  O   . HOH BA 8 .   ? -6.375  -3.282  -34.695 1.00 71.63  ? 2227 HOH B O   1 
HETATM 9166 O  O   . HOH BA 8 .   ? -10.379 -8.468  -30.652 1.00 67.02  ? 2228 HOH B O   1 
HETATM 9167 O  O   . HOH BA 8 .   ? -4.355  -6.717  -34.066 1.00 64.13  ? 2229 HOH B O   1 
HETATM 9168 O  O   . HOH BA 8 .   ? -4.752  -9.842  -23.190 1.00 70.14  ? 2230 HOH B O   1 
HETATM 9169 O  O   . HOH BA 8 .   ? -1.637  -9.732  -20.859 1.00 64.51  ? 2231 HOH B O   1 
HETATM 9170 O  O   . HOH BA 8 .   ? -2.694  0.935   -36.871 1.00 48.05  ? 2232 HOH B O   1 
HETATM 9171 O  O   . HOH BA 8 .   ? -15.667 -7.725  -38.123 1.00 76.74  ? 2233 HOH B O   1 
HETATM 9172 O  O   . HOH BA 8 .   ? -18.215 -8.860  -36.952 1.00 73.56  ? 2234 HOH B O   1 
HETATM 9173 O  O   . HOH BA 8 .   ? -20.779 -0.423  -32.346 1.00 68.22  ? 2235 HOH B O   1 
HETATM 9174 O  O   . HOH BA 8 .   ? -19.299 4.795   -23.318 1.00 79.76  ? 2236 HOH B O   1 
HETATM 9175 O  O   . HOH BA 8 .   ? -20.377 6.855   -23.060 1.00 69.26  ? 2237 HOH B O   1 
HETATM 9176 O  O   . HOH BA 8 .   ? -13.596 16.467  -34.910 1.00 77.65  ? 2238 HOH B O   1 
HETATM 9177 O  O   . HOH BA 8 .   ? -9.624  18.202  -34.017 1.00 50.65  ? 2239 HOH B O   1 
HETATM 9178 O  O   . HOH BA 8 .   ? -6.878  13.708  -26.513 1.00 34.56  ? 2240 HOH B O   1 
HETATM 9179 O  O   . HOH BA 8 .   ? -5.155  26.127  -38.241 1.00 59.73  ? 2241 HOH B O   1 
HETATM 9180 O  O   . HOH BA 8 .   ? -6.449  27.715  -34.793 1.00 75.51  ? 2242 HOH B O   1 
HETATM 9181 O  O   . HOH BA 8 .   ? -2.068  26.977  -29.994 1.00 58.43  ? 2243 HOH B O   1 
HETATM 9182 O  O   . HOH BA 8 .   ? -15.932 30.017  -34.638 1.00 65.70  ? 2244 HOH B O   1 
HETATM 9183 O  O   . HOH BA 8 .   ? -13.774 27.887  -23.622 1.00 58.48  ? 2245 HOH B O   1 
HETATM 9184 O  O   . HOH BA 8 .   ? -12.707 22.043  -25.345 1.00 69.94  ? 2246 HOH B O   1 
HETATM 9185 O  O   . HOH BA 8 .   ? 6.252   24.307  -24.971 1.00 42.27  ? 2247 HOH B O   1 
HETATM 9186 O  O   . HOH BA 8 .   ? 10.974  17.054  -23.113 1.00 40.01  ? 2248 HOH B O   1 
HETATM 9187 O  O   . HOH BA 8 .   ? 11.935  28.548  -25.405 1.00 63.44  ? 2249 HOH B O   1 
HETATM 9188 O  O   . HOH BA 8 .   ? 2.532   11.723  -20.477 1.00 50.17  ? 2250 HOH B O   1 
HETATM 9189 O  O   . HOH BA 8 .   ? 5.402   14.957  -18.679 1.00 36.64  ? 2251 HOH B O   1 
HETATM 9190 O  O   . HOH BA 8 .   ? 6.130   10.989  -20.070 1.00 70.14  ? 2252 HOH B O   1 
HETATM 9191 O  O   . HOH BA 8 .   ? -6.590  14.047  -23.113 1.00 54.59  ? 2253 HOH B O   1 
HETATM 9192 O  O   . HOH BA 8 .   ? -10.133 18.445  -27.376 1.00 49.59  ? 2254 HOH B O   1 
HETATM 9193 O  O   . HOH BA 8 .   ? 3.008   17.406  -16.638 1.00 54.85  ? 2255 HOH B O   1 
HETATM 9194 O  O   . HOH BA 8 .   ? 8.462   14.100  -17.977 1.00 48.78  ? 2256 HOH B O   1 
HETATM 9195 O  O   . HOH BA 8 .   ? 12.764  15.261  -22.797 1.00 29.95  ? 2257 HOH B O   1 
HETATM 9196 O  O   . HOH BA 8 .   ? 11.031  12.987  -16.345 1.00 46.46  ? 2258 HOH B O   1 
HETATM 9197 O  O   . HOH BA 8 .   ? 15.622  16.094  -21.251 1.00 45.37  ? 2259 HOH B O   1 
HETATM 9198 O  O   . HOH BA 8 .   ? 11.234  10.555  -16.938 1.00 56.59  ? 2260 HOH B O   1 
HETATM 9199 O  O   . HOH BA 8 .   ? 26.557  15.289  -24.213 1.00 59.27  ? 2261 HOH B O   1 
HETATM 9200 O  O   . HOH BA 8 .   ? 21.983  22.414  -22.970 1.00 73.59  ? 2262 HOH B O   1 
HETATM 9201 O  O   . HOH BA 8 .   ? 24.764  21.986  -23.007 1.00 55.87  ? 2263 HOH B O   1 
HETATM 9202 O  O   . HOH BA 8 .   ? -14.441 21.922  -49.871 1.00 58.97  ? 2264 HOH B O   1 
HETATM 9203 O  O   . HOH BA 8 .   ? 17.963  10.613  -13.826 1.00 65.78  ? 2265 HOH B O   1 
HETATM 9204 O  O   . HOH BA 8 .   ? 13.034  8.551   -13.340 1.00 58.43  ? 2266 HOH B O   1 
HETATM 9205 O  O   . HOH BA 8 .   ? 8.665   1.859   -16.301 1.00 55.66  ? 2267 HOH B O   1 
HETATM 9206 O  O   . HOH BA 8 .   ? 8.529   7.014   -9.693  1.00 60.80  ? 2268 HOH B O   1 
HETATM 9207 O  O   . HOH BA 8 .   ? 4.522   16.521  -70.841 1.00 70.80  ? 2269 HOH B O   1 
HETATM 9208 O  O   . HOH BA 8 .   ? 10.161  -20.917 -24.134 1.00 77.32  ? 2270 HOH B O   1 
HETATM 9209 O  O   . HOH BA 8 .   ? 30.085  12.730  -31.598 1.00 67.23  ? 2271 HOH B O   1 
HETATM 9210 O  O   . HOH BA 8 .   ? 44.441  11.245  -7.198  1.00 63.20  ? 2272 HOH B O   1 
HETATM 9211 O  O   . HOH BA 8 .   ? 34.294  31.853  -10.755 1.00 73.72  ? 2273 HOH B O   1 
HETATM 9212 O  O   . HOH BA 8 .   ? 44.590  6.825   -4.940  1.00 55.81  ? 2274 HOH B O   1 
HETATM 9213 O  O   . HOH BA 8 .   ? -24.320 12.270  -32.791 1.00 60.71  ? 2275 HOH B O   1 
HETATM 9214 O  O   . HOH BA 8 .   ? -19.968 14.565  -32.454 1.00 77.27  ? 2276 HOH B O   1 
HETATM 9215 O  O   . HOH BA 8 .   ? 19.054  -7.642  0.226   1.00 73.32  ? 2277 HOH B O   1 
HETATM 9216 O  O   . HOH BA 8 .   ? 41.435  5.234   -2.591  1.00 67.49  ? 2278 HOH B O   1 
HETATM 9217 O  O   . HOH BA 8 .   ? 34.675  34.590  -8.784  1.00 66.70  ? 2279 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.1558 1.1127 1.0380 0.0429  -0.0391 0.0107  1   GLU A N   
2    C CA  . GLU A 1   ? 1.0959 1.0490 0.9760 0.0434  -0.0347 0.0102  1   GLU A CA  
3    C C   . GLU A 1   ? 1.0527 1.0032 0.9223 0.0468  -0.0342 0.0089  1   GLU A C   
4    O O   . GLU A 1   ? 1.1327 1.0833 0.9963 0.0486  -0.0374 0.0083  1   GLU A O   
5    C CB  . GLU A 1   ? 0.9876 0.9423 0.8723 0.0432  -0.0295 0.0140  1   GLU A CB  
6    C CG  . GLU A 1   ? 0.9055 0.8606 0.7849 0.0459  -0.0274 0.0174  1   GLU A CG  
7    C CD  . GLU A 1   ? 0.7860 0.7413 0.6691 0.0448  -0.0226 0.0211  1   GLU A CD  
8    O OE1 . GLU A 1   ? 0.7616 0.7183 0.6514 0.0436  -0.0232 0.0226  1   GLU A OE1 
9    O OE2 . GLU A 1   ? 0.6869 0.6409 0.5656 0.0452  -0.0183 0.0225  1   GLU A OE2 
10   N N   . GLY A 2   ? 0.9448 0.8935 0.8118 0.0480  -0.0302 0.0085  2   GLY A N   
11   C CA  . GLY A 2   ? 0.8916 0.8389 0.7485 0.0516  -0.0289 0.0076  2   GLY A CA  
12   C C   . GLY A 2   ? 0.8843 0.8288 0.7374 0.0532  -0.0275 0.0046  2   GLY A C   
13   O O   . GLY A 2   ? 0.8534 0.7995 0.7013 0.0560  -0.0239 0.0052  2   GLY A O   
14   N N   . ARG A 3   ? 0.9702 0.9107 0.8251 0.0516  -0.0304 0.0015  3   ARG A N   
15   C CA  . ARG A 3   ? 0.9880 0.9241 0.8376 0.0540  -0.0296 -0.0017 3   ARG A CA  
16   C C   . ARG A 3   ? 0.9806 0.9173 0.8375 0.0524  -0.0267 -0.0014 3   ARG A C   
17   O O   . ARG A 3   ? 1.0360 0.9684 0.8892 0.0543  -0.0265 -0.0041 3   ARG A O   
18   C CB  . ARG A 3   ? 0.8935 0.8220 0.7363 0.0538  -0.0351 -0.0060 3   ARG A CB  
19   N N   . GLU A 4   ? 0.8708 0.8124 0.7372 0.0493  -0.0245 0.0019  4   GLU A N   
20   C CA  . GLU A 4   ? 0.9312 0.8739 0.8054 0.0473  -0.0221 0.0024  4   GLU A CA  
21   C C   . GLU A 4   ? 0.8627 0.8118 0.7402 0.0476  -0.0163 0.0057  4   GLU A C   
22   O O   . GLU A 4   ? 0.8838 0.8362 0.7578 0.0487  -0.0143 0.0078  4   GLU A O   
23   C CB  . GLU A 4   ? 1.0361 0.9784 0.9190 0.0427  -0.0248 0.0031  4   GLU A CB  
24   C CG  . GLU A 4   ? 1.1193 1.0658 1.0057 0.0413  -0.0255 0.0062  4   GLU A CG  
25   C CD  . GLU A 4   ? 1.2019 1.1486 1.0944 0.0378  -0.0297 0.0059  4   GLU A CD  
26   O OE1 . GLU A 4   ? 1.1559 1.1002 1.0522 0.0352  -0.0310 0.0042  4   GLU A OE1 
27   O OE2 . GLU A 4   ? 1.2523 1.2021 1.1455 0.0377  -0.0316 0.0076  4   GLU A OE2 
28   N N   . ASP A 5   ? 0.7356 0.6865 0.6193 0.0462  -0.0137 0.0060  5   ASP A N   
29   C CA  . ASP A 5   ? 0.6898 0.6472 0.5769 0.0456  -0.0084 0.0089  5   ASP A CA  
30   C C   . ASP A 5   ? 0.7605 0.7203 0.6519 0.0424  -0.0071 0.0127  5   ASP A C   
31   O O   . ASP A 5   ? 0.7589 0.7176 0.6574 0.0394  -0.0085 0.0136  5   ASP A O   
32   C CB  . ASP A 5   ? 0.6636 0.6222 0.5568 0.0447  -0.0066 0.0082  5   ASP A CB  
33   C CG  . ASP A 5   ? 0.7136 0.6800 0.6089 0.0444  -0.0011 0.0104  5   ASP A CG  
34   O OD1 . ASP A 5   ? 0.6891 0.6596 0.5833 0.0431  0.0014  0.0132  5   ASP A OD1 
35   O OD2 . ASP A 5   ? 0.7788 0.7474 0.6766 0.0453  0.0007  0.0094  5   ASP A OD2 
36   N N   . PRO A 6   ? 0.7500 0.7128 0.6365 0.0431  -0.0044 0.0149  6   PRO A N   
37   C CA  . PRO A 6   ? 0.7527 0.7156 0.6403 0.0407  -0.0031 0.0186  6   PRO A CA  
38   C C   . PRO A 6   ? 0.7127 0.6780 0.6072 0.0369  0.0005  0.0211  6   PRO A C   
39   O O   . PRO A 6   ? 0.7108 0.6743 0.6068 0.0348  0.0011  0.0240  6   PRO A O   
40   C CB  . PRO A 6   ? 0.7252 0.6903 0.6040 0.0424  -0.0006 0.0199  6   PRO A CB  
41   C CG  . PRO A 6   ? 0.6765 0.6459 0.5527 0.0448  0.0013  0.0177  6   PRO A CG  
42   C CD  . PRO A 6   ? 0.6845 0.6502 0.5630 0.0465  -0.0024 0.0140  6   PRO A CD  
43   N N   . GLN A 7   ? 0.6486 0.6175 0.5466 0.0364  0.0027  0.0200  7   GLN A N   
44   C CA  . GLN A 7   ? 0.7368 0.7086 0.6410 0.0328  0.0063  0.0221  7   GLN A CA  
45   C C   . GLN A 7   ? 0.6739 0.6431 0.5866 0.0310  0.0041  0.0215  7   GLN A C   
46   O O   . GLN A 7   ? 0.7167 0.6877 0.6350 0.0281  0.0066  0.0229  7   GLN A O   
47   C CB  . GLN A 7   ? 0.8372 0.8161 0.7410 0.0332  0.0100  0.0214  7   GLN A CB  
48   C CG  . GLN A 7   ? 0.9674 0.9501 0.8628 0.0363  0.0113  0.0208  7   GLN A CG  
49   C CD  . GLN A 7   ? 1.0281 1.0182 0.9212 0.0335  0.0164  0.0236  7   GLN A CD  
50   O OE1 . GLN A 7   ? 1.0946 1.0828 0.9870 0.0295  0.0181  0.0267  7   GLN A OE1 
51   N NE2 . GLN A 7   ? 0.9586 0.9569 0.8497 0.0357  0.0189  0.0224  7   GLN A NE2 
52   N N   . LEU A 8   ? 0.6440 0.6092 0.5573 0.0325  -0.0005 0.0194  8   LEU A N   
53   C CA  . LEU A 8   ? 0.6071 0.5703 0.5281 0.0307  -0.0028 0.0186  8   LEU A CA  
54   C C   . LEU A 8   ? 0.6225 0.5833 0.5452 0.0300  -0.0059 0.0199  8   LEU A C   
55   O O   . LEU A 8   ? 0.6135 0.5736 0.5422 0.0286  -0.0085 0.0192  8   LEU A O   
56   C CB  . LEU A 8   ? 0.5261 0.4869 0.4465 0.0324  -0.0056 0.0149  8   LEU A CB  
57   C CG  . LEU A 8   ? 0.5278 0.4910 0.4464 0.0343  -0.0028 0.0134  8   LEU A CG  
58   C CD1 . LEU A 8   ? 0.5117 0.4699 0.4272 0.0365  -0.0059 0.0097  8   LEU A CD1 
59   C CD2 . LEU A 8   ? 0.4865 0.4536 0.4124 0.0317  0.0007  0.0150  8   LEU A CD2 
60   N N   . LEU A 9   ? 0.5710 0.5313 0.4883 0.0311  -0.0056 0.0219  9   LEU A N   
61   C CA  . LEU A 9   ? 0.5606 0.5195 0.4784 0.0315  -0.0085 0.0233  9   LEU A CA  
62   C C   . LEU A 9   ? 0.5393 0.4971 0.4580 0.0303  -0.0055 0.0270  9   LEU A C   
63   O O   . LEU A 9   ? 0.5683 0.5250 0.4813 0.0301  -0.0021 0.0290  9   LEU A O   
64   C CB  . LEU A 9   ? 0.6404 0.5981 0.5502 0.0344  -0.0110 0.0227  9   LEU A CB  
65   C CG  . LEU A 9   ? 0.7658 0.7229 0.6727 0.0357  -0.0141 0.0188  9   LEU A CG  
66   C CD1 . LEU A 9   ? 0.7673 0.7234 0.6651 0.0387  -0.0158 0.0183  9   LEU A CD1 
67   C CD2 . LEU A 9   ? 0.7731 0.7301 0.6858 0.0341  -0.0185 0.0168  9   LEU A CD2 
68   N N   . VAL A 10  ? 0.4649 0.4229 0.3901 0.0293  -0.0067 0.0279  10  VAL A N   
69   C CA  . VAL A 10  ? 0.4416 0.3975 0.3676 0.0285  -0.0040 0.0312  10  VAL A CA  
70   C C   . VAL A 10  ? 0.5785 0.5346 0.5069 0.0304  -0.0072 0.0323  10  VAL A C   
71   O O   . VAL A 10  ? 0.6577 0.6174 0.5916 0.0304  -0.0109 0.0303  10  VAL A O   
72   C CB  . VAL A 10  ? 0.6510 0.6079 0.5836 0.0252  -0.0010 0.0313  10  VAL A CB  
73   C CG1 . VAL A 10  ? 0.6347 0.5883 0.5677 0.0243  0.0014  0.0344  10  VAL A CG1 
74   C CG2 . VAL A 10  ? 0.6032 0.5615 0.5334 0.0237  0.0024  0.0305  10  VAL A CG2 
75   N N   . ARG A 11  ? 0.5429 0.4953 0.4665 0.0320  -0.0058 0.0354  11  ARG A N   
76   C CA  . ARG A 11  ? 0.4825 0.4357 0.4083 0.0347  -0.0082 0.0368  11  ARG A CA  
77   C C   . ARG A 11  ? 0.5584 0.5094 0.4881 0.0336  -0.0056 0.0387  11  ARG A C   
78   O O   . ARG A 11  ? 0.5723 0.5178 0.4978 0.0318  -0.0015 0.0405  11  ARG A O   
79   C CB  . ARG A 11  ? 0.3997 0.3494 0.3161 0.0387  -0.0090 0.0389  11  ARG A CB  
80   C CG  . ARG A 11  ? 0.4566 0.4068 0.3736 0.0426  -0.0108 0.0410  11  ARG A CG  
81   C CD  . ARG A 11  ? 0.6057 0.5535 0.5132 0.0474  -0.0123 0.0427  11  ARG A CD  
82   N NE  . ARG A 11  ? 0.6000 0.5539 0.5080 0.0484  -0.0166 0.0402  11  ARG A NE  
83   C CZ  . ARG A 11  ? 0.6371 0.5986 0.5492 0.0507  -0.0211 0.0393  11  ARG A CZ  
84   N NH1 . ARG A 11  ? 0.6668 0.6316 0.5835 0.0528  -0.0219 0.0408  11  ARG A NH1 
85   N NH2 . ARG A 11  ? 0.5514 0.5176 0.4629 0.0508  -0.0250 0.0369  11  ARG A NH2 
86   N N   . VAL A 12  ? 0.4861 0.4418 0.4235 0.0342  -0.0080 0.0383  12  VAL A N   
87   C CA  . VAL A 12  ? 0.4965 0.4503 0.4369 0.0344  -0.0060 0.0404  12  VAL A CA  
88   C C   . VAL A 12  ? 0.5445 0.5005 0.4842 0.0393  -0.0087 0.0421  12  VAL A C   
89   O O   . VAL A 12  ? 0.6237 0.5839 0.5617 0.0420  -0.0122 0.0414  12  VAL A O   
90   C CB  . VAL A 12  ? 0.4867 0.4449 0.4375 0.0308  -0.0058 0.0387  12  VAL A CB  
91   C CG1 . VAL A 12  ? 0.4440 0.4003 0.3949 0.0268  -0.0029 0.0373  12  VAL A CG1 
92   C CG2 . VAL A 12  ? 0.5604 0.5268 0.5184 0.0306  -0.0104 0.0364  12  VAL A CG2 
93   N N   . ARG A 13  ? 0.4932 0.4468 0.4338 0.0409  -0.0070 0.0441  13  ARG A N   
94   C CA  . ARG A 13  ? 0.5118 0.4674 0.4507 0.0467  -0.0089 0.0461  13  ARG A CA  
95   C C   . ARG A 13  ? 0.4517 0.4195 0.3977 0.0481  -0.0139 0.0445  13  ARG A C   
96   O O   . ARG A 13  ? 0.4259 0.3970 0.3683 0.0532  -0.0165 0.0456  13  ARG A O   
97   C CB  . ARG A 13  ? 0.4914 0.4442 0.4325 0.0476  -0.0065 0.0478  13  ARG A CB  
98   C CG  . ARG A 13  ? 0.4916 0.4474 0.4316 0.0544  -0.0082 0.0499  13  ARG A CG  
99   C CD  . ARG A 13  ? 0.5334 0.4824 0.4608 0.0602  -0.0084 0.0521  13  ARG A CD  
100  N NE  . ARG A 13  ? 0.6172 0.5770 0.5468 0.0648  -0.0129 0.0518  13  ARG A NE  
101  C CZ  . ARG A 13  ? 0.6232 0.5858 0.5499 0.0722  -0.0143 0.0539  13  ARG A CZ  
102  N NH1 . ARG A 13  ? 0.6093 0.5626 0.5296 0.0761  -0.0113 0.0564  13  ARG A NH1 
103  N NH2 . ARG A 13  ? 0.6409 0.6153 0.5703 0.0758  -0.0187 0.0534  13  ARG A NH2 
104  N N   . GLY A 14  ? 0.4810 0.4555 0.4363 0.0435  -0.0155 0.0418  14  GLY A N   
105  C CA  . GLY A 14  ? 0.4887 0.4746 0.4506 0.0433  -0.0202 0.0401  14  GLY A CA  
106  C C   . GLY A 14  ? 0.5763 0.5640 0.5350 0.0423  -0.0234 0.0379  14  GLY A C   
107  O O   . GLY A 14  ? 0.5833 0.5801 0.5454 0.0424  -0.0277 0.0367  14  GLY A O   
108  N N   . GLY A 15  ? 0.5196 0.4994 0.4717 0.0411  -0.0213 0.0373  15  GLY A N   
109  C CA  . GLY A 15  ? 0.5579 0.5386 0.5059 0.0406  -0.0240 0.0352  15  GLY A CA  
110  C C   . GLY A 15  ? 0.5986 0.5730 0.5435 0.0374  -0.0217 0.0335  15  GLY A C   
111  O O   . GLY A 15  ? 0.5770 0.5456 0.5207 0.0361  -0.0174 0.0346  15  GLY A O   
112  N N   . GLN A 16  ? 0.6136 0.5895 0.5567 0.0361  -0.0245 0.0307  16  GLN A N   
113  C CA  . GLN A 16  ? 0.5730 0.5438 0.5121 0.0342  -0.0226 0.0289  16  GLN A CA  
114  C C   . GLN A 16  ? 0.5005 0.4720 0.4456 0.0300  -0.0229 0.0261  16  GLN A C   
115  O O   . GLN A 16  ? 0.6277 0.6035 0.5779 0.0280  -0.0265 0.0244  16  GLN A O   
116  C CB  . GLN A 16  ? 0.5588 0.5290 0.4902 0.0361  -0.0252 0.0276  16  GLN A CB  
117  C CG  . GLN A 16  ? 0.5627 0.5286 0.4851 0.0397  -0.0229 0.0302  16  GLN A CG  
118  C CD  . GLN A 16  ? 0.7139 0.6805 0.6291 0.0421  -0.0261 0.0290  16  GLN A CD  
119  O OE1 . GLN A 16  ? 0.7980 0.7699 0.7144 0.0434  -0.0304 0.0284  16  GLN A OE1 
120  N NE2 . GLN A 16  ? 0.6401 0.6022 0.5478 0.0426  -0.0239 0.0288  16  GLN A NE2 
121  N N   . LEU A 17  ? 0.4339 0.4013 0.3779 0.0287  -0.0192 0.0258  17  LEU A N   
122  C CA  . LEU A 17  ? 0.5742 0.5412 0.5226 0.0256  -0.0189 0.0234  17  LEU A CA  
123  C C   . LEU A 17  ? 0.5610 0.5247 0.5031 0.0261  -0.0183 0.0211  17  LEU A C   
124  O O   . LEU A 17  ? 0.5828 0.5446 0.5187 0.0280  -0.0158 0.0221  17  LEU A O   
125  C CB  . LEU A 17  ? 0.5877 0.5540 0.5412 0.0240  -0.0148 0.0250  17  LEU A CB  
126  C CG  . LEU A 17  ? 0.5942 0.5629 0.5534 0.0240  -0.0145 0.0274  17  LEU A CG  
127  C CD1 . LEU A 17  ? 0.6165 0.5829 0.5777 0.0228  -0.0098 0.0291  17  LEU A CD1 
128  C CD2 . LEU A 17  ? 0.6189 0.5922 0.5856 0.0219  -0.0179 0.0260  17  LEU A CD2 
129  N N   . ARG A 18  ? 0.6232 0.5857 0.5659 0.0246  -0.0206 0.0180  18  ARG A N   
130  C CA  . ARG A 18  ? 0.6373 0.5963 0.5743 0.0256  -0.0195 0.0157  18  ARG A CA  
131  C C   . ARG A 18  ? 0.6169 0.5747 0.5583 0.0239  -0.0174 0.0148  18  ARG A C   
132  O O   . ARG A 18  ? 0.5354 0.4923 0.4809 0.0215  -0.0198 0.0133  18  ARG A O   
133  C CB  . ARG A 18  ? 0.6003 0.5566 0.5313 0.0262  -0.0239 0.0126  18  ARG A CB  
134  C CG  . ARG A 18  ? 0.6204 0.5724 0.5443 0.0283  -0.0227 0.0101  18  ARG A CG  
135  C CD  . ARG A 18  ? 0.7460 0.6941 0.6624 0.0291  -0.0270 0.0070  18  ARG A CD  
136  N NE  . ARG A 18  ? 0.8267 0.7737 0.7463 0.0254  -0.0315 0.0054  18  ARG A NE  
137  C CZ  . ARG A 18  ? 0.8569 0.8069 0.7768 0.0240  -0.0354 0.0055  18  ARG A CZ  
138  N NH1 . ARG A 18  ? 0.7758 0.7288 0.6924 0.0267  -0.0355 0.0070  18  ARG A NH1 
139  N NH2 . ARG A 18  ? 0.8772 0.8274 0.8003 0.0199  -0.0393 0.0041  18  ARG A NH2 
140  N N   . GLY A 19  ? 0.5639 0.5223 0.5044 0.0249  -0.0130 0.0157  19  GLY A N   
141  C CA  . GLY A 19  ? 0.4968 0.4550 0.4410 0.0239  -0.0108 0.0149  19  GLY A CA  
142  C C   . GLY A 19  ? 0.6264 0.5814 0.5645 0.0262  -0.0111 0.0119  19  GLY A C   
143  O O   . GLY A 19  ? 0.6540 0.6061 0.5853 0.0280  -0.0137 0.0100  19  GLY A O   
144  N N   . ILE A 20  ? 0.6015 0.5572 0.5416 0.0265  -0.0084 0.0115  20  ILE A N   
145  C CA  . ILE A 20  ? 0.4929 0.4454 0.4269 0.0296  -0.0084 0.0086  20  ILE A CA  
146  C C   . ILE A 20  ? 0.5279 0.4857 0.4614 0.0318  -0.0037 0.0093  20  ILE A C   
147  O O   . ILE A 20  ? 0.6662 0.6287 0.6060 0.0297  -0.0007 0.0115  20  ILE A O   
148  C CB  . ILE A 20  ? 0.5449 0.4914 0.4805 0.0281  -0.0111 0.0065  20  ILE A CB  
149  C CG1 . ILE A 20  ? 0.5102 0.4509 0.4372 0.0321  -0.0115 0.0034  20  ILE A CG1 
150  C CG2 . ILE A 20  ? 0.4984 0.4479 0.4430 0.0255  -0.0088 0.0082  20  ILE A CG2 
151  C CD1 . ILE A 20  ? 0.5228 0.4550 0.4487 0.0305  -0.0144 0.0012  20  ILE A CD1 
152  N N   . ARG A 21  ? 0.5634 0.5210 0.4890 0.0361  -0.0031 0.0076  21  ARG A N   
153  C CA  . ARG A 21  ? 0.5996 0.5639 0.5240 0.0388  0.0011  0.0079  21  ARG A CA  
154  C C   . ARG A 21  ? 0.6164 0.5785 0.5414 0.0408  0.0014  0.0061  21  ARG A C   
155  O O   . ARG A 21  ? 0.7293 0.6841 0.6477 0.0441  -0.0010 0.0033  21  ARG A O   
156  C CB  . ARG A 21  ? 0.6108 0.5767 0.5260 0.0432  0.0016  0.0068  21  ARG A CB  
157  C CG  . ARG A 21  ? 0.7209 0.6969 0.6350 0.0454  0.0064  0.0079  21  ARG A CG  
158  C CD  . ARG A 21  ? 0.7701 0.7471 0.6743 0.0508  0.0065  0.0062  21  ARG A CD  
159  N NE  . ARG A 21  ? 0.9092 0.8880 0.8092 0.0565  0.0077  0.0041  21  ARG A NE  
160  C CZ  . ARG A 21  ? 1.0001 0.9890 0.8967 0.0603  0.0113  0.0043  21  ARG A CZ  
161  N NH1 . ARG A 21  ? 1.0068 1.0045 0.9036 0.0581  0.0140  0.0067  21  ARG A NH1 
162  N NH2 . ARG A 21  ? 0.9861 0.9766 0.8786 0.0663  0.0121  0.0023  21  ARG A NH2 
163  N N   . LEU A 22  ? 0.5648 0.5324 0.4969 0.0388  0.0043  0.0078  22  LEU A N   
164  C CA  . LEU A 22  ? 0.6098 0.5756 0.5430 0.0407  0.0047  0.0064  22  LEU A CA  
165  C C   . LEU A 22  ? 0.5948 0.5694 0.5258 0.0449  0.0085  0.0063  22  LEU A C   
166  O O   . LEU A 22  ? 0.6422 0.6267 0.5755 0.0436  0.0118  0.0084  22  LEU A O   
167  C CB  . LEU A 22  ? 0.5316 0.4976 0.4744 0.0358  0.0049  0.0081  22  LEU A CB  
168  C CG  . LEU A 22  ? 0.5358 0.4940 0.4814 0.0320  0.0010  0.0079  22  LEU A CG  
169  C CD1 . LEU A 22  ? 0.4424 0.4014 0.3968 0.0283  0.0016  0.0093  22  LEU A CD1 
170  C CD2 . LEU A 22  ? 0.5228 0.4709 0.4608 0.0343  -0.0027 0.0048  22  LEU A CD2 
171  N N   . LYS A 23  ? 0.5331 0.5041 0.4593 0.0499  0.0081  0.0041  23  LYS A N   
172  C CA  . LYS A 23  ? 0.5740 0.5545 0.4982 0.0549  0.0117  0.0039  23  LYS A CA  
173  C C   . LYS A 23  ? 0.6080 0.5947 0.5403 0.0529  0.0141  0.0053  23  LYS A C   
174  O O   . LYS A 23  ? 0.6329 0.6122 0.5669 0.0525  0.0125  0.0045  23  LYS A O   
175  C CB  . LYS A 23  ? 0.5650 0.5385 0.4785 0.0627  0.0103  0.0007  23  LYS A CB  
176  N N   . ALA A 24  ? 0.5834 0.5836 0.5202 0.0510  0.0179  0.0074  24  ALA A N   
177  C CA  . ALA A 24  ? 0.6071 0.6155 0.5501 0.0502  0.0206  0.0085  24  ALA A CA  
178  C C   . ALA A 24  ? 0.6846 0.7029 0.6223 0.0573  0.0230  0.0074  24  ALA A C   
179  O O   . ALA A 24  ? 0.7343 0.7543 0.6648 0.0615  0.0230  0.0063  24  ALA A O   
180  C CB  . ALA A 24  ? 0.5204 0.5372 0.4710 0.0430  0.0231  0.0114  24  ALA A CB  
181  N N   . PRO A 25  ? 0.7285 0.7540 0.6695 0.0591  0.0250  0.0075  25  PRO A N   
182  C CA  . PRO A 25  ? 0.6531 0.6892 0.5888 0.0669  0.0272  0.0064  25  PRO A CA  
183  C C   . PRO A 25  ? 0.6284 0.6799 0.5630 0.0667  0.0302  0.0076  25  PRO A C   
184  O O   . PRO A 25  ? 0.5952 0.6517 0.5222 0.0742  0.0309  0.0062  25  PRO A O   
185  C CB  . PRO A 25  ? 0.6725 0.7160 0.6142 0.0667  0.0290  0.0072  25  PRO A CB  
186  C CG  . PRO A 25  ? 0.7140 0.7439 0.6604 0.0619  0.0265  0.0074  25  PRO A CG  
187  C CD  . PRO A 25  ? 0.6914 0.7148 0.6400 0.0553  0.0249  0.0084  25  PRO A CD  
188  N N   . GLY A 26  ? 0.5921 0.6503 0.5330 0.0585  0.0319  0.0101  26  GLY A N   
189  C CA  . GLY A 26  ? 0.6262 0.6991 0.5660 0.0569  0.0351  0.0116  26  GLY A CA  
190  C C   . GLY A 26  ? 0.7681 0.8356 0.7044 0.0537  0.0342  0.0123  26  GLY A C   
191  O O   . GLY A 26  ? 0.7811 0.8595 0.7171 0.0502  0.0368  0.0141  26  GLY A O   
192  N N   . GLY A 27  ? 0.7246 0.7758 0.6579 0.0548  0.0304  0.0110  27  GLY A N   
193  C CA  . GLY A 27  ? 0.7001 0.7453 0.6297 0.0525  0.0291  0.0115  27  GLY A CA  
194  C C   . GLY A 27  ? 0.7226 0.7514 0.6537 0.0495  0.0252  0.0111  27  GLY A C   
195  O O   . GLY A 27  ? 0.7168 0.7390 0.6520 0.0488  0.0236  0.0105  27  GLY A O   
196  N N   . PRO A 28  ? 0.6923 0.7154 0.6201 0.0476  0.0236  0.0116  28  PRO A N   
197  C CA  . PRO A 28  ? 0.6332 0.6427 0.5624 0.0448  0.0198  0.0114  28  PRO A CA  
198  C C   . PRO A 28  ? 0.6033 0.6124 0.5397 0.0374  0.0204  0.0142  28  PRO A C   
199  O O   . PRO A 28  ? 0.5549 0.5720 0.4926 0.0337  0.0237  0.0165  28  PRO A O   
200  C CB  . PRO A 28  ? 0.5827 0.5883 0.5041 0.0472  0.0180  0.0106  28  PRO A CB  
201  C CG  . PRO A 28  ? 0.5503 0.5684 0.4692 0.0472  0.0219  0.0122  28  PRO A CG  
202  C CD  . PRO A 28  ? 0.5755 0.6050 0.4972 0.0490  0.0252  0.0122  28  PRO A CD  
203  N N   . VAL A 29  ? 0.5007 0.5003 0.4411 0.0352  0.0175  0.0140  29  VAL A N   
204  C CA  . VAL A 29  ? 0.5101 0.5075 0.4560 0.0292  0.0176  0.0165  29  VAL A CA  
205  C C   . VAL A 29  ? 0.4441 0.4320 0.3889 0.0287  0.0137  0.0162  29  VAL A C   
206  O O   . VAL A 29  ? 0.5101 0.4920 0.4512 0.0319  0.0105  0.0138  29  VAL A O   
207  C CB  . VAL A 29  ? 0.4906 0.4885 0.4445 0.0264  0.0183  0.0171  29  VAL A CB  
208  C CG1 . VAL A 29  ? 0.4351 0.4439 0.3911 0.0255  0.0225  0.0181  29  VAL A CG1 
209  C CG2 . VAL A 29  ? 0.4261 0.4173 0.3809 0.0293  0.0154  0.0147  29  VAL A CG2 
210  N N   . SER A 30  ? 0.4407 0.4270 0.3877 0.0247  0.0138  0.0186  30  SER A N   
211  C CA  . SER A 30  ? 0.4996 0.4786 0.4462 0.0243  0.0101  0.0186  30  SER A CA  
212  C C   . SER A 30  ? 0.5766 0.5520 0.5306 0.0219  0.0084  0.0188  30  SER A C   
213  O O   . SER A 30  ? 0.5231 0.5009 0.4823 0.0190  0.0107  0.0206  30  SER A O   
214  C CB  . SER A 30  ? 0.5779 0.5567 0.5216 0.0223  0.0111  0.0212  30  SER A CB  
215  O OG  . SER A 30  ? 0.7970 0.7796 0.7338 0.0240  0.0130  0.0213  30  SER A OG  
216  N N   . ALA A 31  ? 0.5909 0.5609 0.5450 0.0228  0.0043  0.0170  31  ALA A N   
217  C CA  . ALA A 31  ? 0.5867 0.5542 0.5476 0.0203  0.0025  0.0173  31  ALA A CA  
218  C C   . ALA A 31  ? 0.6101 0.5746 0.5712 0.0195  -0.0011 0.0176  31  ALA A C   
219  O O   . ALA A 31  ? 0.6219 0.5837 0.5778 0.0211  -0.0040 0.0160  31  ALA A O   
220  C CB  . ALA A 31  ? 0.5852 0.5498 0.5469 0.0213  0.0011  0.0148  31  ALA A CB  
221  N N   . PHE A 32  ? 0.5747 0.5401 0.5416 0.0171  -0.0010 0.0197  32  PHE A N   
222  C CA  . PHE A 32  ? 0.5181 0.4825 0.4864 0.0166  -0.0044 0.0203  32  PHE A CA  
223  C C   . PHE A 32  ? 0.5554 0.5204 0.5314 0.0142  -0.0058 0.0203  32  PHE A C   
224  O O   . PHE A 32  ? 0.5376 0.5044 0.5186 0.0129  -0.0037 0.0223  32  PHE A O   
225  C CB  . PHE A 32  ? 0.5009 0.4661 0.4674 0.0170  -0.0029 0.0231  32  PHE A CB  
226  C CG  . PHE A 32  ? 0.5557 0.5203 0.5142 0.0189  -0.0017 0.0233  32  PHE A CG  
227  C CD1 . PHE A 32  ? 0.5194 0.4856 0.4755 0.0185  0.0025  0.0242  32  PHE A CD1 
228  C CD2 . PHE A 32  ? 0.5549 0.5184 0.5083 0.0209  -0.0047 0.0227  32  PHE A CD2 
229  C CE1 . PHE A 32  ? 0.5367 0.5032 0.4853 0.0199  0.0038  0.0245  32  PHE A CE1 
230  C CE2 . PHE A 32  ? 0.5747 0.5376 0.5204 0.0227  -0.0034 0.0230  32  PHE A CE2 
231  C CZ  . PHE A 32  ? 0.5664 0.5309 0.5097 0.0222  0.0009  0.0240  32  PHE A CZ  
232  N N   . LEU A 33  ? 0.5282 0.4911 0.5042 0.0134  -0.0092 0.0180  33  LEU A N   
233  C CA  . LEU A 33  ? 0.5326 0.4957 0.5151 0.0107  -0.0104 0.0177  33  LEU A CA  
234  C C   . LEU A 33  ? 0.5428 0.5081 0.5281 0.0088  -0.0143 0.0180  33  LEU A C   
235  O O   . LEU A 33  ? 0.5450 0.5098 0.5260 0.0094  -0.0173 0.0169  33  LEU A O   
236  C CB  . LEU A 33  ? 0.5217 0.4800 0.5015 0.0105  -0.0110 0.0151  33  LEU A CB  
237  C CG  . LEU A 33  ? 0.4670 0.4244 0.4428 0.0133  -0.0075 0.0145  33  LEU A CG  
238  C CD1 . LEU A 33  ? 0.5028 0.4544 0.4741 0.0142  -0.0086 0.0117  33  LEU A CD1 
239  C CD2 . LEU A 33  ? 0.3835 0.3451 0.3649 0.0127  -0.0034 0.0166  33  LEU A CD2 
240  N N   . GLY A 34  ? 0.4718 0.4405 0.4645 0.0067  -0.0142 0.0194  34  GLY A N   
241  C CA  . GLY A 34  ? 0.3988 0.3720 0.3953 0.0048  -0.0177 0.0198  34  GLY A CA  
242  C C   . GLY A 34  ? 0.4750 0.4526 0.4707 0.0074  -0.0184 0.0217  34  GLY A C   
243  O O   . GLY A 34  ? 0.5276 0.5082 0.5222 0.0070  -0.0221 0.0211  34  GLY A O   
244  N N   . ILE A 35  ? 0.5061 0.4836 0.5016 0.0098  -0.0149 0.0240  35  ILE A N   
245  C CA  . ILE A 35  ? 0.4854 0.4655 0.4794 0.0127  -0.0151 0.0262  35  ILE A CA  
246  C C   . ILE A 35  ? 0.5883 0.5743 0.5892 0.0126  -0.0156 0.0281  35  ILE A C   
247  O O   . ILE A 35  ? 0.6271 0.6127 0.6320 0.0121  -0.0128 0.0293  35  ILE A O   
248  C CB  . ILE A 35  ? 0.4438 0.4197 0.4331 0.0150  -0.0110 0.0280  35  ILE A CB  
249  C CG1 . ILE A 35  ? 0.4608 0.4325 0.4438 0.0151  -0.0099 0.0263  35  ILE A CG1 
250  C CG2 . ILE A 35  ? 0.3795 0.3561 0.3651 0.0185  -0.0113 0.0303  35  ILE A CG2 
251  C CD1 . ILE A 35  ? 0.3899 0.3585 0.3685 0.0161  -0.0056 0.0280  35  ILE A CD1 
252  N N   . PRO A 36  ? 0.6153 0.6075 0.6175 0.0133  -0.0192 0.0283  36  PRO A N   
253  C CA  . PRO A 36  ? 0.5190 0.5187 0.5276 0.0140  -0.0198 0.0302  36  PRO A CA  
254  C C   . PRO A 36  ? 0.5314 0.5292 0.5377 0.0186  -0.0168 0.0331  36  PRO A C   
255  O O   . PRO A 36  ? 0.6625 0.6569 0.6618 0.0220  -0.0164 0.0339  36  PRO A O   
256  C CB  . PRO A 36  ? 0.5619 0.5694 0.5707 0.0141  -0.0246 0.0296  36  PRO A CB  
257  C CG  . PRO A 36  ? 0.5082 0.5106 0.5087 0.0157  -0.0256 0.0284  36  PRO A CG  
258  C CD  . PRO A 36  ? 0.4959 0.4894 0.4935 0.0137  -0.0230 0.0268  36  PRO A CD  
259  N N   . PHE A 37  ? 0.5301 0.5291 0.5411 0.0188  -0.0145 0.0346  37  PHE A N   
260  C CA  . PHE A 37  ? 0.4571 0.4529 0.4649 0.0231  -0.0116 0.0373  37  PHE A CA  
261  C C   . PHE A 37  ? 0.4698 0.4739 0.4823 0.0261  -0.0128 0.0390  37  PHE A C   
262  O O   . PHE A 37  ? 0.5605 0.5621 0.5695 0.0307  -0.0109 0.0413  37  PHE A O   
263  C CB  . PHE A 37  ? 0.4416 0.4299 0.4489 0.0214  -0.0072 0.0377  37  PHE A CB  
264  C CG  . PHE A 37  ? 0.5263 0.5178 0.5417 0.0181  -0.0065 0.0370  37  PHE A CG  
265  C CD1 . PHE A 37  ? 0.4980 0.4928 0.5176 0.0198  -0.0054 0.0388  37  PHE A CD1 
266  C CD2 . PHE A 37  ? 0.5161 0.5069 0.5343 0.0138  -0.0068 0.0348  37  PHE A CD2 
267  C CE1 . PHE A 37  ? 0.4571 0.4550 0.4839 0.0167  -0.0047 0.0383  37  PHE A CE1 
268  C CE2 . PHE A 37  ? 0.4897 0.4827 0.5146 0.0109  -0.0061 0.0343  37  PHE A CE2 
269  C CZ  . PHE A 37  ? 0.4005 0.3974 0.4300 0.0121  -0.0051 0.0361  37  PHE A CZ  
270  N N   . ALA A 38  ? 0.4535 0.4675 0.4732 0.0234  -0.0160 0.0379  38  ALA A N   
271  C CA  . ALA A 38  ? 0.4409 0.4656 0.4661 0.0257  -0.0174 0.0395  38  ALA A CA  
272  C C   . ALA A 38  ? 0.4637 0.5002 0.4931 0.0234  -0.0222 0.0382  38  ALA A C   
273  O O   . ALA A 38  ? 0.4375 0.4726 0.4667 0.0185  -0.0243 0.0359  38  ALA A O   
274  C CB  . ALA A 38  ? 0.5234 0.5494 0.5554 0.0233  -0.0152 0.0398  38  ALA A CB  
275  N N   . GLU A 39  ? 0.4049 0.4529 0.4372 0.0270  -0.0240 0.0399  39  GLU A N   
276  C CA  . GLU A 39  ? 0.4557 0.5175 0.4934 0.0238  -0.0285 0.0389  39  GLU A CA  
277  C C   . GLU A 39  ? 0.5321 0.5972 0.5776 0.0168  -0.0286 0.0377  39  GLU A C   
278  O O   . GLU A 39  ? 0.5670 0.6302 0.6159 0.0171  -0.0254 0.0388  39  GLU A O   
279  C CB  . GLU A 39  ? 0.4704 0.5457 0.5101 0.0299  -0.0300 0.0412  39  GLU A CB  
280  C CG  . GLU A 39  ? 0.5945 0.6689 0.6262 0.0365  -0.0313 0.0421  39  GLU A CG  
281  C CD  . GLU A 39  ? 0.6258 0.7031 0.6557 0.0327  -0.0354 0.0399  39  GLU A CD  
282  O OE1 . GLU A 39  ? 0.6940 0.7853 0.7296 0.0291  -0.0393 0.0390  39  GLU A OE1 
283  O OE2 . GLU A 39  ? 0.5866 0.6523 0.6089 0.0331  -0.0349 0.0389  39  GLU A OE2 
284  N N   . PRO A 40  ? 0.5235 0.5924 0.5709 0.0101  -0.0321 0.0355  40  PRO A N   
285  C CA  . PRO A 40  ? 0.4824 0.5536 0.5360 0.0028  -0.0324 0.0344  40  PRO A CA  
286  C C   . PRO A 40  ? 0.5099 0.5940 0.5715 0.0036  -0.0318 0.0365  40  PRO A C   
287  O O   . PRO A 40  ? 0.5470 0.6459 0.6118 0.0052  -0.0344 0.0376  40  PRO A O   
288  C CB  . PRO A 40  ? 0.5376 0.6135 0.5904 -0.0033 -0.0372 0.0321  40  PRO A CB  
289  C CG  . PRO A 40  ? 0.4421 0.5109 0.4867 0.0000  -0.0382 0.0311  40  PRO A CG  
290  C CD  . PRO A 40  ? 0.4503 0.5199 0.4928 0.0089  -0.0358 0.0338  40  PRO A CD  
291  N N   . PRO A 41  ? 0.5584 0.6379 0.6233 0.0027  -0.0283 0.0372  41  PRO A N   
292  C CA  . PRO A 41  ? 0.5080 0.5987 0.5802 0.0038  -0.0272 0.0393  41  PRO A CA  
293  C C   . PRO A 41  ? 0.5039 0.6057 0.5827 -0.0042 -0.0300 0.0385  41  PRO A C   
294  O O   . PRO A 41  ? 0.5044 0.6052 0.5875 -0.0082 -0.0282 0.0387  41  PRO A O   
295  C CB  . PRO A 41  ? 0.4152 0.4942 0.4870 0.0048  -0.0226 0.0397  41  PRO A CB  
296  C CG  . PRO A 41  ? 0.4761 0.5417 0.5437 0.0000  -0.0224 0.0372  41  PRO A CG  
297  C CD  . PRO A 41  ? 0.5053 0.5691 0.5668 0.0009  -0.0253 0.0360  41  PRO A CD  
298  N N   . VAL A 42  ? 0.4174 0.5296 0.4966 -0.0069 -0.0343 0.0378  42  VAL A N   
299  C CA  . VAL A 42  ? 0.4380 0.5606 0.5222 -0.0158 -0.0374 0.0369  42  VAL A CA  
300  C C   . VAL A 42  ? 0.5000 0.6449 0.5907 -0.0141 -0.0395 0.0389  42  VAL A C   
301  O O   . VAL A 42  ? 0.5167 0.6681 0.6068 -0.0054 -0.0390 0.0406  42  VAL A O   
302  C CB  . VAL A 42  ? 0.4752 0.5921 0.5539 -0.0222 -0.0412 0.0341  42  VAL A CB  
303  C CG1 . VAL A 42  ? 0.4785 0.5743 0.5504 -0.0232 -0.0392 0.0321  42  VAL A CG1 
304  C CG2 . VAL A 42  ? 0.3527 0.4763 0.4280 -0.0177 -0.0441 0.0340  42  VAL A CG2 
305  N N   . GLY A 43  ? 0.4929 0.6495 0.5892 -0.0224 -0.0417 0.0387  43  GLY A N   
306  C CA  . GLY A 43  ? 0.4771 0.6576 0.5803 -0.0219 -0.0439 0.0405  43  GLY A CA  
307  C C   . GLY A 43  ? 0.5505 0.7393 0.6582 -0.0128 -0.0405 0.0435  43  GLY A C   
308  O O   . GLY A 43  ? 0.5761 0.7595 0.6863 -0.0131 -0.0370 0.0443  43  GLY A O   
309  N N   . SER A 44  ? 0.5836 0.7848 0.6912 -0.0043 -0.0415 0.0451  44  SER A N   
310  C CA  . SER A 44  ? 0.6098 0.8191 0.7201 0.0056  -0.0385 0.0479  44  SER A CA  
311  C C   . SER A 44  ? 0.5820 0.7708 0.6860 0.0131  -0.0340 0.0484  44  SER A C   
312  O O   . SER A 44  ? 0.5436 0.7347 0.6478 0.0216  -0.0312 0.0505  44  SER A O   
313  C CB  . SER A 44  ? 0.5841 0.8116 0.6946 0.0134  -0.0410 0.0495  44  SER A CB  
314  O OG  . SER A 44  ? 0.6468 0.8633 0.7488 0.0186  -0.0420 0.0487  44  SER A OG  
315  N N   . ARG A 45  ? 0.5372 0.7060 0.6351 0.0099  -0.0334 0.0463  45  ARG A N   
316  C CA  . ARG A 45  ? 0.5512 0.7008 0.6430 0.0155  -0.0292 0.0466  45  ARG A CA  
317  C C   . ARG A 45  ? 0.4740 0.6119 0.5676 0.0101  -0.0261 0.0458  45  ARG A C   
318  O O   . ARG A 45  ? 0.3797 0.5023 0.4687 0.0136  -0.0227 0.0460  45  ARG A O   
319  C CB  . ARG A 45  ? 0.5860 0.7219 0.6690 0.0173  -0.0300 0.0452  45  ARG A CB  
320  C CG  . ARG A 45  ? 0.7043 0.8464 0.7828 0.0262  -0.0314 0.0466  45  ARG A CG  
321  C CD  . ARG A 45  ? 0.9420 1.0659 1.0105 0.0304  -0.0299 0.0461  45  ARG A CD  
322  N NE  . ARG A 45  ? 1.0238 1.1475 1.0887 0.0276  -0.0335 0.0443  45  ARG A NE  
323  C CZ  . ARG A 45  ? 1.1313 1.2615 1.1922 0.0334  -0.0358 0.0450  45  ARG A CZ  
324  N NH1 . ARG A 45  ? 1.1410 1.2782 1.2008 0.0428  -0.0349 0.0476  45  ARG A NH1 
325  N NH2 . ARG A 45  ? 1.1947 1.3241 1.2522 0.0304  -0.0391 0.0432  45  ARG A NH2 
326  N N   . ARG A 46  ? 0.5083 0.6532 0.6081 0.0015  -0.0275 0.0451  46  ARG A N   
327  C CA  . ARG A 46  ? 0.4768 0.6123 0.5787 -0.0031 -0.0246 0.0448  46  ARG A CA  
328  C C   . ARG A 46  ? 0.4564 0.5941 0.5605 0.0040  -0.0208 0.0471  46  ARG A C   
329  O O   . ARG A 46  ? 0.4718 0.6245 0.5790 0.0093  -0.0212 0.0490  46  ARG A O   
330  C CB  . ARG A 46  ? 0.4601 0.6042 0.5677 -0.0134 -0.0268 0.0440  46  ARG A CB  
331  C CG  . ARG A 46  ? 0.4089 0.5423 0.5177 -0.0186 -0.0241 0.0435  46  ARG A CG  
332  C CD  . ARG A 46  ? 0.3588 0.5018 0.4728 -0.0285 -0.0261 0.0433  46  ARG A CD  
333  N NE  . ARG A 46  ? 0.3853 0.5221 0.4951 -0.0366 -0.0296 0.0409  46  ARG A NE  
334  C CZ  . ARG A 46  ? 0.4024 0.5450 0.5143 -0.0465 -0.0320 0.0403  46  ARG A CZ  
335  N NH1 . ARG A 46  ? 0.4057 0.5616 0.5248 -0.0496 -0.0313 0.0422  46  ARG A NH1 
336  N NH2 . ARG A 46  ? 0.2942 0.4288 0.4005 -0.0535 -0.0352 0.0379  46  ARG A NH2 
337  N N   . PHE A 47  ? 0.4118 0.5346 0.5135 0.0044  -0.0171 0.0468  47  PHE A N   
338  C CA  . PHE A 47  ? 0.3761 0.4973 0.4783 0.0108  -0.0132 0.0487  47  PHE A CA  
339  C C   . PHE A 47  ? 0.4462 0.5628 0.5416 0.0209  -0.0119 0.0499  47  PHE A C   
340  O O   . PHE A 47  ? 0.5134 0.6243 0.6066 0.0263  -0.0085 0.0512  47  PHE A O   
341  C CB  . PHE A 47  ? 0.3507 0.4892 0.4611 0.0102  -0.0132 0.0504  47  PHE A CB  
342  C CG  . PHE A 47  ? 0.3603 0.5040 0.4766 -0.0001 -0.0146 0.0495  47  PHE A CG  
343  C CD1 . PHE A 47  ? 0.3765 0.5059 0.4915 -0.0059 -0.0131 0.0481  47  PHE A CD1 
344  C CD2 . PHE A 47  ? 0.3378 0.5008 0.4604 -0.0042 -0.0176 0.0502  47  PHE A CD2 
345  C CE1 . PHE A 47  ? 0.3950 0.5274 0.5139 -0.0152 -0.0144 0.0474  47  PHE A CE1 
346  C CE2 . PHE A 47  ? 0.3231 0.4896 0.4499 -0.0145 -0.0190 0.0495  47  PHE A CE2 
347  C CZ  . PHE A 47  ? 0.3707 0.5209 0.4952 -0.0199 -0.0173 0.0481  47  PHE A CZ  
348  N N   . MET A 48  ? 0.4579 0.5760 0.5493 0.0232  -0.0145 0.0496  48  MET A N   
349  C CA  . MET A 48  ? 0.4355 0.5492 0.5195 0.0328  -0.0136 0.0509  48  MET A CA  
350  C C   . MET A 48  ? 0.3777 0.4707 0.4528 0.0338  -0.0113 0.0500  48  MET A C   
351  O O   . MET A 48  ? 0.3825 0.4670 0.4570 0.0272  -0.0116 0.0479  48  MET A O   
352  C CB  . MET A 48  ? 0.4120 0.5378 0.4952 0.0356  -0.0175 0.0512  48  MET A CB  
353  C CG  . MET A 48  ? 0.5292 0.6779 0.6205 0.0361  -0.0197 0.0525  48  MET A CG  
354  S SD  . MET A 48  ? 0.7159 0.8704 0.8083 0.0454  -0.0162 0.0553  48  MET A SD  
355  C CE  . MET A 48  ? 0.6152 0.7595 0.6953 0.0579  -0.0152 0.0566  48  MET A CE  
356  N N   . PRO A 49  ? 0.4290 0.5138 0.4965 0.0419  -0.0089 0.0515  49  PRO A N   
357  C CA  . PRO A 49  ? 0.4437 0.5100 0.5017 0.0428  -0.0069 0.0509  49  PRO A CA  
358  C C   . PRO A 49  ? 0.4267 0.4920 0.4814 0.0409  -0.0099 0.0496  49  PRO A C   
359  O O   . PRO A 49  ? 0.3794 0.4573 0.4363 0.0426  -0.0132 0.0499  49  PRO A O   
360  C CB  . PRO A 49  ? 0.4009 0.4619 0.4508 0.0524  -0.0048 0.0531  49  PRO A CB  
361  C CG  . PRO A 49  ? 0.4794 0.5522 0.5352 0.0557  -0.0041 0.0546  49  PRO A CG  
362  C CD  . PRO A 49  ? 0.4605 0.5518 0.5272 0.0504  -0.0075 0.0538  49  PRO A CD  
363  N N   . PRO A 50  ? 0.4371 0.4885 0.4867 0.0376  -0.0087 0.0482  50  PRO A N   
364  C CA  . PRO A 50  ? 0.5200 0.5698 0.5660 0.0357  -0.0114 0.0468  50  PRO A CA  
365  C C   . PRO A 50  ? 0.5983 0.6456 0.6357 0.0432  -0.0119 0.0483  50  PRO A C   
366  O O   . PRO A 50  ? 0.6143 0.6520 0.6445 0.0485  -0.0090 0.0499  50  PRO A O   
367  C CB  . PRO A 50  ? 0.5016 0.5372 0.5441 0.0311  -0.0091 0.0452  50  PRO A CB  
368  C CG  . PRO A 50  ? 0.4850 0.5116 0.5245 0.0337  -0.0049 0.0465  50  PRO A CG  
369  C CD  . PRO A 50  ? 0.4104 0.4478 0.4568 0.0355  -0.0048 0.0478  50  PRO A CD  
370  N N   . GLU A 51  ? 0.6265 0.6816 0.6638 0.0434  -0.0157 0.0477  51  GLU A N   
371  C CA  . GLU A 51  ? 0.6386 0.6900 0.6668 0.0499  -0.0164 0.0488  51  GLU A CA  
372  C C   . GLU A 51  ? 0.5971 0.6375 0.6198 0.0460  -0.0165 0.0470  51  GLU A C   
373  O O   . GLU A 51  ? 0.5783 0.6213 0.6054 0.0393  -0.0185 0.0448  51  GLU A O   
374  C CB  . GLU A 51  ? 0.7517 0.8199 0.7830 0.0531  -0.0206 0.0493  51  GLU A CB  
375  C CG  . GLU A 51  ? 0.9475 1.0290 0.9836 0.0585  -0.0207 0.0513  51  GLU A CG  
376  C CD  . GLU A 51  ? 1.1177 1.2194 1.1593 0.0592  -0.0252 0.0514  51  GLU A CD  
377  O OE1 . GLU A 51  ? 1.1726 1.2794 1.2179 0.0522  -0.0284 0.0493  51  GLU A OE1 
378  O OE2 . GLU A 51  ? 1.1681 1.2808 1.2099 0.0669  -0.0257 0.0535  51  GLU A OE2 
379  N N   . PRO A 52  ? 0.6210 0.6487 0.6332 0.0502  -0.0144 0.0481  52  PRO A N   
380  C CA  . PRO A 52  ? 0.6403 0.6582 0.6465 0.0471  -0.0143 0.0467  52  PRO A CA  
381  C C   . PRO A 52  ? 0.5238 0.5500 0.5316 0.0451  -0.0187 0.0451  52  PRO A C   
382  O O   . PRO A 52  ? 0.4186 0.4561 0.4280 0.0487  -0.0218 0.0458  52  PRO A O   
383  C CB  . PRO A 52  ? 0.6761 0.6821 0.6702 0.0533  -0.0119 0.0489  52  PRO A CB  
384  C CG  . PRO A 52  ? 0.6554 0.6666 0.6488 0.0608  -0.0119 0.0513  52  PRO A CG  
385  C CD  . PRO A 52  ? 0.5765 0.5975 0.5809 0.0579  -0.0119 0.0508  52  PRO A CD  
386  N N   . LYS A 53  ? 0.4470 0.4677 0.4539 0.0397  -0.0190 0.0428  53  LYS A N   
387  C CA  . LYS A 53  ? 0.5037 0.5303 0.5112 0.0370  -0.0230 0.0408  53  LYS A CA  
388  C C   . LYS A 53  ? 0.6444 0.6719 0.6445 0.0427  -0.0249 0.0419  53  LYS A C   
389  O O   . LYS A 53  ? 0.6606 0.6775 0.6518 0.0464  -0.0225 0.0432  53  LYS A O   
390  C CB  . LYS A 53  ? 0.5358 0.5537 0.5416 0.0314  -0.0222 0.0383  53  LYS A CB  
391  C CG  . LYS A 53  ? 0.5150 0.5358 0.5190 0.0289  -0.0262 0.0360  53  LYS A CG  
392  C CD  . LYS A 53  ? 0.5499 0.5828 0.5617 0.0249  -0.0302 0.0346  53  LYS A CD  
393  C CE  . LYS A 53  ? 0.5110 0.5440 0.5202 0.0209  -0.0338 0.0318  53  LYS A CE  
394  N NZ  . LYS A 53  ? 0.5309 0.5747 0.5468 0.0156  -0.0377 0.0304  53  LYS A NZ  
395  N N   . ARG A 54  ? 0.6017 0.6419 0.6049 0.0432  -0.0293 0.0413  54  ARG A N   
396  C CA  . ARG A 54  ? 0.6560 0.6984 0.6524 0.0484  -0.0317 0.0421  54  ARG A CA  
397  C C   . ARG A 54  ? 0.6277 0.6624 0.6183 0.0453  -0.0326 0.0400  54  ARG A C   
398  O O   . ARG A 54  ? 0.6459 0.6812 0.6403 0.0387  -0.0340 0.0373  54  ARG A O   
399  C CB  . ARG A 54  ? 0.6194 0.6798 0.6215 0.0495  -0.0363 0.0421  54  ARG A CB  
400  C CG  . ARG A 54  ? 0.6858 0.7559 0.6922 0.0548  -0.0356 0.0446  54  ARG A CG  
401  C CD  . ARG A 54  ? 0.8621 0.9514 0.8726 0.0569  -0.0403 0.0448  54  ARG A CD  
402  N NE  . ARG A 54  ? 1.0325 1.1306 1.0493 0.0482  -0.0442 0.0419  54  ARG A NE  
403  C CZ  . ARG A 54  ? 1.1070 1.2187 1.1336 0.0431  -0.0460 0.0413  54  ARG A CZ  
404  N NH1 . ARG A 54  ? 1.1223 1.2420 1.1542 0.0464  -0.0443 0.0434  54  ARG A NH1 
405  N NH2 . ARG A 54  ? 1.0480 1.1651 1.0783 0.0345  -0.0495 0.0386  54  ARG A NH2 
406  N N   . PRO A 55  ? 0.5182 0.5452 0.4989 0.0502  -0.0317 0.0412  55  PRO A N   
407  C CA  . PRO A 55  ? 0.5291 0.5489 0.5032 0.0483  -0.0322 0.0396  55  PRO A CA  
408  C C   . PRO A 55  ? 0.5561 0.5845 0.5335 0.0440  -0.0371 0.0366  55  PRO A C   
409  O O   . PRO A 55  ? 0.4963 0.5377 0.4781 0.0448  -0.0408 0.0367  55  PRO A O   
410  C CB  . PRO A 55  ? 0.4591 0.4748 0.4231 0.0557  -0.0318 0.0420  55  PRO A CB  
411  C CG  . PRO A 55  ? 0.5781 0.5910 0.5410 0.0607  -0.0288 0.0450  55  PRO A CG  
412  C CD  . PRO A 55  ? 0.4414 0.4658 0.4158 0.0584  -0.0300 0.0445  55  PRO A CD  
413  N N   . TRP A 56  ? 0.5386 0.5602 0.5136 0.0395  -0.0370 0.0341  56  TRP A N   
414  C CA  . TRP A 56  ? 0.5607 0.5874 0.5367 0.0351  -0.0415 0.0311  56  TRP A CA  
415  C C   . TRP A 56  ? 0.6870 0.7097 0.6536 0.0378  -0.0430 0.0304  56  TRP A C   
416  O O   . TRP A 56  ? 0.6512 0.6663 0.6107 0.0423  -0.0401 0.0324  56  TRP A O   
417  C CB  . TRP A 56  ? 0.5499 0.5712 0.5290 0.0284  -0.0407 0.0284  56  TRP A CB  
418  C CG  . TRP A 56  ? 0.6427 0.6514 0.6167 0.0287  -0.0364 0.0283  56  TRP A CG  
419  C CD1 . TRP A 56  ? 0.6257 0.6271 0.5924 0.0285  -0.0362 0.0266  56  TRP A CD1 
420  C CD2 . TRP A 56  ? 0.6651 0.6680 0.6409 0.0291  -0.0316 0.0300  56  TRP A CD2 
421  N NE1 . TRP A 56  ? 0.7011 0.6936 0.6652 0.0287  -0.0315 0.0273  56  TRP A NE1 
422  C CE2 . TRP A 56  ? 0.6727 0.6658 0.6423 0.0288  -0.0287 0.0293  56  TRP A CE2 
423  C CE3 . TRP A 56  ? 0.6701 0.6755 0.6518 0.0297  -0.0294 0.0320  56  TRP A CE3 
424  C CZ2 . TRP A 56  ? 0.6820 0.6687 0.6516 0.0285  -0.0239 0.0305  56  TRP A CZ2 
425  C CZ3 . TRP A 56  ? 0.6472 0.6447 0.6283 0.0296  -0.0247 0.0331  56  TRP A CZ3 
426  C CH2 . TRP A 56  ? 0.6605 0.6492 0.6358 0.0287  -0.0221 0.0323  56  TRP A CH2 
427  N N   . SER A 57  ? 0.7079 0.7353 0.6739 0.0347  -0.0474 0.0278  57  SER A N   
428  C CA  . SER A 57  ? 0.7581 0.7817 0.7151 0.0368  -0.0491 0.0268  57  SER A CA  
429  C C   . SER A 57  ? 0.7257 0.7403 0.6791 0.0322  -0.0488 0.0235  57  SER A C   
430  O O   . SER A 57  ? 0.7907 0.8054 0.7488 0.0265  -0.0499 0.0213  57  SER A O   
431  C CB  . SER A 57  ? 0.7845 0.8201 0.7414 0.0377  -0.0545 0.0262  57  SER A CB  
432  O OG  . SER A 57  ? 0.8410 0.8843 0.8042 0.0310  -0.0583 0.0236  57  SER A OG  
433  N N   . GLY A 58  ? 0.6804 0.6869 0.6251 0.0349  -0.0473 0.0234  58  GLY A N   
434  C CA  . GLY A 58  ? 0.6513 0.6496 0.5914 0.0318  -0.0470 0.0204  58  GLY A CA  
435  C C   . GLY A 58  ? 0.6307 0.6209 0.5719 0.0308  -0.0419 0.0207  58  GLY A C   
436  O O   . GLY A 58  ? 0.5327 0.5219 0.4763 0.0327  -0.0382 0.0235  58  GLY A O   
437  N N   . VAL A 59  ? 0.6535 0.6377 0.5921 0.0279  -0.0417 0.0178  59  VAL A N   
438  C CA  . VAL A 59  ? 0.6713 0.6490 0.6108 0.0271  -0.0372 0.0179  59  VAL A CA  
439  C C   . VAL A 59  ? 0.6654 0.6437 0.6122 0.0224  -0.0377 0.0164  59  VAL A C   
440  O O   . VAL A 59  ? 0.6912 0.6678 0.6367 0.0192  -0.0408 0.0133  59  VAL A O   
441  C CB  . VAL A 59  ? 0.7240 0.6947 0.6551 0.0282  -0.0359 0.0159  59  VAL A CB  
442  C CG1 . VAL A 59  ? 0.7173 0.6837 0.6491 0.0283  -0.0306 0.0168  59  VAL A CG1 
443  C CG2 . VAL A 59  ? 0.5979 0.5684 0.5210 0.0322  -0.0363 0.0169  59  VAL A CG2 
444  N N   . LEU A 60  ? 0.6424 0.6224 0.5960 0.0220  -0.0347 0.0186  60  LEU A N   
445  C CA  . LEU A 60  ? 0.6164 0.5966 0.5768 0.0178  -0.0346 0.0175  60  LEU A CA  
446  C C   . LEU A 60  ? 0.5886 0.5609 0.5456 0.0169  -0.0322 0.0155  60  LEU A C   
447  O O   . LEU A 60  ? 0.6199 0.5889 0.5743 0.0193  -0.0282 0.0166  60  LEU A O   
448  C CB  . LEU A 60  ? 0.6753 0.6591 0.6431 0.0183  -0.0317 0.0205  60  LEU A CB  
449  C CG  . LEU A 60  ? 0.6421 0.6283 0.6180 0.0141  -0.0319 0.0200  60  LEU A CG  
450  C CD1 . LEU A 60  ? 0.6330 0.6279 0.6159 0.0147  -0.0325 0.0225  60  LEU A CD1 
451  C CD2 . LEU A 60  ? 0.5779 0.5585 0.5553 0.0136  -0.0275 0.0202  60  LEU A CD2 
452  N N   . ASP A 61  ? 0.5095 0.4787 0.4657 0.0135  -0.0348 0.0126  61  ASP A N   
453  C CA  . ASP A 61  ? 0.6016 0.5633 0.5544 0.0134  -0.0327 0.0106  61  ASP A CA  
454  C C   . ASP A 61  ? 0.5308 0.4931 0.4907 0.0125  -0.0289 0.0122  61  ASP A C   
455  O O   . ASP A 61  ? 0.5388 0.5043 0.5056 0.0093  -0.0299 0.0128  61  ASP A O   
456  C CB  . ASP A 61  ? 0.7163 0.6726 0.6650 0.0101  -0.0365 0.0071  61  ASP A CB  
457  C CG  . ASP A 61  ? 0.8711 0.8186 0.8144 0.0113  -0.0344 0.0050  61  ASP A CG  
458  O OD1 . ASP A 61  ? 0.9108 0.8543 0.8460 0.0148  -0.0338 0.0037  61  ASP A OD1 
459  O OD2 . ASP A 61  ? 0.9147 0.8598 0.8616 0.0090  -0.0334 0.0047  61  ASP A OD2 
460  N N   . ALA A 62  ? 0.5255 0.4857 0.4837 0.0150  -0.0246 0.0131  62  ALA A N   
461  C CA  . ALA A 62  ? 0.5384 0.4995 0.5028 0.0142  -0.0208 0.0146  62  ALA A CA  
462  C C   . ALA A 62  ? 0.5435 0.4997 0.5047 0.0150  -0.0188 0.0127  62  ALA A C   
463  O O   . ALA A 62  ? 0.4785 0.4356 0.4401 0.0165  -0.0147 0.0139  62  ALA A O   
464  C CB  . ALA A 62  ? 0.4562 0.4203 0.4219 0.0162  -0.0173 0.0177  62  ALA A CB  
465  N N   . THR A 63  ? 0.5826 0.5335 0.5400 0.0138  -0.0216 0.0098  63  THR A N   
466  C CA  . THR A 63  ? 0.5624 0.5075 0.5144 0.0157  -0.0202 0.0077  63  THR A CA  
467  C C   . THR A 63  ? 0.6266 0.5680 0.5816 0.0132  -0.0204 0.0068  63  THR A C   
468  O O   . THR A 63  ? 0.6192 0.5560 0.5703 0.0153  -0.0188 0.0054  63  THR A O   
469  C CB  . THR A 63  ? 0.5490 0.4881 0.4906 0.0177  -0.0230 0.0048  63  THR A CB  
470  O OG1 . THR A 63  ? 0.5833 0.5188 0.5239 0.0139  -0.0277 0.0031  63  THR A OG1 
471  C CG2 . THR A 63  ? 0.4016 0.3442 0.3395 0.0204  -0.0226 0.0057  63  THR A CG2 
472  N N   . THR A 64  ? 0.6770 0.6206 0.6386 0.0089  -0.0225 0.0076  64  THR A N   
473  C CA  . THR A 64  ? 0.6276 0.5679 0.5923 0.0059  -0.0227 0.0071  64  THR A CA  
474  C C   . THR A 64  ? 0.5690 0.5164 0.5443 0.0037  -0.0209 0.0099  64  THR A C   
475  O O   . THR A 64  ? 0.5654 0.5197 0.5454 0.0035  -0.0210 0.0119  64  THR A O   
476  C CB  . THR A 64  ? 0.6589 0.5936 0.6199 0.0016  -0.0274 0.0048  64  THR A CB  
477  O OG1 . THR A 64  ? 0.6903 0.6321 0.6557 -0.0012 -0.0303 0.0059  64  THR A OG1 
478  C CG2 . THR A 64  ? 0.6518 0.5772 0.6008 0.0039  -0.0293 0.0017  64  THR A CG2 
479  N N   . PHE A 65  ? 0.5963 0.5417 0.5748 0.0024  -0.0193 0.0100  65  PHE A N   
480  C CA  . PHE A 65  ? 0.5143 0.4657 0.5024 0.0000  -0.0179 0.0123  65  PHE A CA  
481  C C   . PHE A 65  ? 0.5312 0.4858 0.5230 -0.0046 -0.0218 0.0125  65  PHE A C   
482  O O   . PHE A 65  ? 0.5592 0.5088 0.5460 -0.0073 -0.0252 0.0104  65  PHE A O   
483  C CB  . PHE A 65  ? 0.3438 0.2920 0.3338 -0.0004 -0.0156 0.0122  65  PHE A CB  
484  C CG  . PHE A 65  ? 0.4846 0.4337 0.4739 0.0036  -0.0114 0.0128  65  PHE A CG  
485  C CD1 . PHE A 65  ? 0.4599 0.4159 0.4543 0.0046  -0.0084 0.0152  65  PHE A CD1 
486  C CD2 . PHE A 65  ? 0.4962 0.4396 0.4792 0.0063  -0.0103 0.0109  65  PHE A CD2 
487  C CE1 . PHE A 65  ? 0.5042 0.4619 0.4978 0.0072  -0.0046 0.0157  65  PHE A CE1 
488  C CE2 . PHE A 65  ? 0.4682 0.4146 0.4510 0.0099  -0.0064 0.0115  65  PHE A CE2 
489  C CZ  . PHE A 65  ? 0.5314 0.4854 0.5198 0.0098  -0.0036 0.0139  65  PHE A CZ  
490  N N   . GLN A 66  ? 0.4447 0.4076 0.4444 -0.0053 -0.0211 0.0150  66  GLN A N   
491  C CA  . GLN A 66  ? 0.4464 0.4153 0.4506 -0.0093 -0.0245 0.0155  66  GLN A CA  
492  C C   . GLN A 66  ? 0.5260 0.4955 0.5356 -0.0135 -0.0244 0.0160  66  GLN A C   
493  O O   . GLN A 66  ? 0.4918 0.4562 0.5013 -0.0130 -0.0218 0.0158  66  GLN A O   
494  C CB  . GLN A 66  ? 0.5410 0.5192 0.5499 -0.0070 -0.0242 0.0180  66  GLN A CB  
495  C CG  . GLN A 66  ? 0.6032 0.5833 0.6074 -0.0056 -0.0271 0.0174  66  GLN A CG  
496  C CD  . GLN A 66  ? 0.6994 0.6835 0.7041 -0.0101 -0.0319 0.0163  66  GLN A CD  
497  O OE1 . GLN A 66  ? 0.6797 0.6652 0.6884 -0.0148 -0.0330 0.0160  66  GLN A OE1 
498  N NE2 . GLN A 66  ? 0.7152 0.7017 0.7159 -0.0091 -0.0348 0.0156  66  GLN A NE2 
499  N N   . ASN A 67  ? 0.5403 0.5170 0.5548 -0.0174 -0.0271 0.0166  67  ASN A N   
500  C CA  . ASN A 67  ? 0.4975 0.4757 0.5171 -0.0222 -0.0273 0.0172  67  ASN A CA  
501  C C   . ASN A 67  ? 0.5024 0.4825 0.5281 -0.0201 -0.0231 0.0192  67  ASN A C   
502  O O   . ASN A 67  ? 0.4629 0.4474 0.4916 -0.0159 -0.0205 0.0210  67  ASN A O   
503  C CB  . ASN A 67  ? 0.4430 0.4321 0.4678 -0.0264 -0.0307 0.0181  67  ASN A CB  
504  C CG  . ASN A 67  ? 0.4579 0.4448 0.4764 -0.0303 -0.0353 0.0157  67  ASN A CG  
505  O OD1 . ASN A 67  ? 0.5314 0.5066 0.5417 -0.0320 -0.0363 0.0133  67  ASN A OD1 
506  N ND2 . ASN A 67  ? 0.4996 0.4978 0.5213 -0.0315 -0.0382 0.0165  67  ASN A ND2 
507  N N   . VAL A 68  ? 0.4392 0.4151 0.4659 -0.0232 -0.0223 0.0189  68  VAL A N   
508  C CA  . VAL A 68  ? 0.4086 0.3866 0.4414 -0.0221 -0.0187 0.0207  68  VAL A CA  
509  C C   . VAL A 68  ? 0.3977 0.3866 0.4389 -0.0249 -0.0194 0.0228  68  VAL A C   
510  O O   . VAL A 68  ? 0.4332 0.4254 0.4752 -0.0300 -0.0226 0.0224  68  VAL A O   
511  C CB  . VAL A 68  ? 0.4758 0.4443 0.5051 -0.0237 -0.0176 0.0195  68  VAL A CB  
512  C CG1 . VAL A 68  ? 0.3795 0.3513 0.4157 -0.0237 -0.0144 0.0214  68  VAL A CG1 
513  C CG2 . VAL A 68  ? 0.4004 0.3599 0.4218 -0.0195 -0.0162 0.0178  68  VAL A CG2 
514  N N   . CYS A 69  ? 0.4099 0.4048 0.4571 -0.0217 -0.0164 0.0251  69  CYS A N   
515  C CA  . CYS A 69  ? 0.3707 0.3766 0.4258 -0.0231 -0.0167 0.0272  69  CYS A CA  
516  C C   . CYS A 69  ? 0.4235 0.4295 0.4813 -0.0289 -0.0174 0.0271  69  CYS A C   
517  O O   . CYS A 69  ? 0.4010 0.3984 0.4564 -0.0298 -0.0157 0.0263  69  CYS A O   
518  C CB  . CYS A 69  ? 0.3340 0.3435 0.3931 -0.0182 -0.0131 0.0294  69  CYS A CB  
519  S SG  . CYS A 69  ? 0.5083 0.5191 0.5640 -0.0122 -0.0127 0.0301  69  CYS A SG  
520  N N   . TYR A 70  ? 0.3339 0.3501 0.3965 -0.0327 -0.0198 0.0280  70  TYR A N   
521  C CA  . TYR A 70  ? 0.4148 0.4314 0.4792 -0.0395 -0.0209 0.0280  70  TYR A CA  
522  C C   . TYR A 70  ? 0.4458 0.4606 0.5141 -0.0386 -0.0172 0.0293  70  TYR A C   
523  O O   . TYR A 70  ? 0.4362 0.4583 0.5103 -0.0347 -0.0147 0.0313  70  TYR A O   
524  C CB  . TYR A 70  ? 0.4198 0.4508 0.4897 -0.0437 -0.0238 0.0291  70  TYR A CB  
525  C CG  . TYR A 70  ? 0.5288 0.5571 0.5955 -0.0525 -0.0270 0.0277  70  TYR A CG  
526  C CD1 . TYR A 70  ? 0.5183 0.5428 0.5858 -0.0575 -0.0260 0.0282  70  TYR A CD1 
527  C CD2 . TYR A 70  ? 0.4819 0.5103 0.5438 -0.0561 -0.0311 0.0260  70  TYR A CD2 
528  C CE1 . TYR A 70  ? 0.5694 0.5896 0.6325 -0.0661 -0.0289 0.0270  70  TYR A CE1 
529  C CE2 . TYR A 70  ? 0.4805 0.5048 0.5381 -0.0649 -0.0342 0.0246  70  TYR A CE2 
530  C CZ  . TYR A 70  ? 0.6428 0.6627 0.7008 -0.0700 -0.0330 0.0252  70  TYR A CZ  
531  O OH  . TYR A 70  ? 0.7716 0.7860 0.8240 -0.0794 -0.0360 0.0239  70  TYR A OH  
532  N N   . GLN A 71  ? 0.4219 0.4265 0.4861 -0.0420 -0.0168 0.0282  71  GLN A N   
533  C CA  . GLN A 71  ? 0.4129 0.4143 0.4795 -0.0407 -0.0133 0.0292  71  GLN A CA  
534  C C   . GLN A 71  ? 0.4577 0.4504 0.5206 -0.0461 -0.0137 0.0285  71  GLN A C   
535  O O   . GLN A 71  ? 0.4611 0.4473 0.5177 -0.0509 -0.0166 0.0269  71  GLN A O   
536  C CB  . GLN A 71  ? 0.3715 0.3658 0.4349 -0.0342 -0.0103 0.0286  71  GLN A CB  
537  C CG  . GLN A 71  ? 0.2998 0.2816 0.3538 -0.0337 -0.0113 0.0261  71  GLN A CG  
538  C CD  . GLN A 71  ? 0.3583 0.3366 0.4098 -0.0275 -0.0086 0.0256  71  GLN A CD  
539  O OE1 . GLN A 71  ? 0.4003 0.3719 0.4489 -0.0255 -0.0064 0.0250  71  GLN A OE1 
540  N NE2 . GLN A 71  ? 0.3704 0.3536 0.4227 -0.0244 -0.0088 0.0260  71  GLN A NE2 
541  N N   . TYR A 72  ? 0.5438 0.5356 0.6098 -0.0452 -0.0106 0.0297  72  TYR A N   
542  C CA  . TYR A 72  ? 0.5556 0.5382 0.6175 -0.0492 -0.0103 0.0294  72  TYR A CA  
543  C C   . TYR A 72  ? 0.5357 0.5031 0.5877 -0.0465 -0.0101 0.0271  72  TYR A C   
544  O O   . TYR A 72  ? 0.5379 0.5036 0.5889 -0.0404 -0.0082 0.0265  72  TYR A O   
545  C CB  . TYR A 72  ? 0.6468 0.6338 0.7152 -0.0477 -0.0069 0.0314  72  TYR A CB  
546  C CG  . TYR A 72  ? 0.6775 0.6554 0.7419 -0.0513 -0.0062 0.0315  72  TYR A CG  
547  C CD1 . TYR A 72  ? 0.6485 0.6287 0.7139 -0.0587 -0.0078 0.0324  72  TYR A CD1 
548  C CD2 . TYR A 72  ? 0.6983 0.6658 0.7579 -0.0472 -0.0039 0.0307  72  TYR A CD2 
549  C CE1 . TYR A 72  ? 0.6702 0.6409 0.7310 -0.0621 -0.0071 0.0326  72  TYR A CE1 
550  C CE2 . TYR A 72  ? 0.7127 0.6712 0.7678 -0.0498 -0.0032 0.0308  72  TYR A CE2 
551  C CZ  . TYR A 72  ? 0.7423 0.7016 0.7977 -0.0573 -0.0048 0.0318  72  TYR A CZ  
552  O OH  . TYR A 72  ? 0.8052 0.7544 0.8551 -0.0600 -0.0041 0.0321  72  TYR A OH  
553  N N   . VAL A 73  ? 0.5617 0.5180 0.6057 -0.0512 -0.0120 0.0259  73  VAL A N   
554  C CA  . VAL A 73  ? 0.6778 0.6188 0.7110 -0.0480 -0.0117 0.0237  73  VAL A CA  
555  C C   . VAL A 73  ? 0.7093 0.6416 0.7393 -0.0479 -0.0096 0.0242  73  VAL A C   
556  O O   . VAL A 73  ? 0.6738 0.6030 0.7024 -0.0541 -0.0105 0.0249  73  VAL A O   
557  C CB  . VAL A 73  ? 0.6221 0.5534 0.6453 -0.0517 -0.0156 0.0214  73  VAL A CB  
558  C CG1 . VAL A 73  ? 0.6226 0.5377 0.6339 -0.0474 -0.0151 0.0192  73  VAL A CG1 
559  C CG2 . VAL A 73  ? 0.4981 0.4379 0.5241 -0.0508 -0.0176 0.0208  73  VAL A CG2 
560  N N   . ASP A 74  ? 0.7613 0.6902 0.7897 -0.0411 -0.0068 0.0238  74  ASP A N   
561  C CA  . ASP A 74  ? 0.6944 0.6161 0.7198 -0.0395 -0.0045 0.0243  74  ASP A CA  
562  C C   . ASP A 74  ? 0.7262 0.6310 0.7387 -0.0421 -0.0064 0.0228  74  ASP A C   
563  O O   . ASP A 74  ? 0.6726 0.5676 0.6754 -0.0395 -0.0078 0.0206  74  ASP A O   
564  C CB  . ASP A 74  ? 0.6944 0.6172 0.7201 -0.0313 -0.0014 0.0239  74  ASP A CB  
565  C CG  . ASP A 74  ? 0.7595 0.6801 0.7857 -0.0292 0.0014  0.0249  74  ASP A CG  
566  O OD1 . ASP A 74  ? 0.7656 0.6772 0.7864 -0.0323 0.0009  0.0252  74  ASP A OD1 
567  O OD2 . ASP A 74  ? 0.7663 0.6941 0.7977 -0.0245 0.0043  0.0255  74  ASP A OD2 
568  N N   . THR A 75  ? 0.8396 0.7405 0.8512 -0.0473 -0.0064 0.0241  75  THR A N   
569  C CA  . THR A 75  ? 0.9037 0.7869 0.9019 -0.0508 -0.0082 0.0230  75  THR A CA  
570  C C   . THR A 75  ? 0.9042 0.7789 0.8981 -0.0480 -0.0056 0.0239  75  THR A C   
571  O O   . THR A 75  ? 0.8869 0.7467 0.8698 -0.0514 -0.0067 0.0236  75  THR A O   
572  C CB  . THR A 75  ? 0.9201 0.8035 0.9181 -0.0615 -0.0111 0.0237  75  THR A CB  
573  O OG1 . THR A 75  ? 0.8612 0.7615 0.8730 -0.0648 -0.0099 0.0263  75  THR A OG1 
574  C CG2 . THR A 75  ? 0.8454 0.7290 0.8404 -0.0644 -0.0146 0.0219  75  THR A CG2 
575  N N   . LEU A 76  ? 0.8441 0.7278 0.8457 -0.0419 -0.0023 0.0249  76  LEU A N   
576  C CA  . LEU A 76  ? 0.8812 0.7591 0.8798 -0.0388 0.0002  0.0259  76  LEU A CA  
577  C C   . LEU A 76  ? 0.9458 0.8060 0.9290 -0.0335 0.0000  0.0239  76  LEU A C   
578  O O   . LEU A 76  ? 1.0161 0.8640 0.9908 -0.0342 0.0003  0.0244  76  LEU A O   
579  C CB  . LEU A 76  ? 0.8444 0.7359 0.8539 -0.0332 0.0037  0.0271  76  LEU A CB  
580  C CG  . LEU A 76  ? 0.9079 0.7955 0.9156 -0.0304 0.0062  0.0283  76  LEU A CG  
581  C CD1 . LEU A 76  ? 0.9062 0.7904 0.9138 -0.0380 0.0057  0.0301  76  LEU A CD1 
582  C CD2 . LEU A 76  ? 0.8094 0.7108 0.8275 -0.0256 0.0094  0.0293  76  LEU A CD2 
583  N N   . TYR A 77  ? 0.8960 0.7548 0.8751 -0.0279 -0.0006 0.0218  77  TYR A N   
584  C CA  . TYR A 77  ? 0.8679 0.7108 0.8319 -0.0217 -0.0009 0.0198  77  TYR A CA  
585  C C   . TYR A 77  ? 0.9447 0.7800 0.9002 -0.0219 -0.0038 0.0173  77  TYR A C   
586  O O   . TYR A 77  ? 0.9077 0.7480 0.8637 -0.0157 -0.0034 0.0160  77  TYR A O   
587  C CB  . TYR A 77  ? 0.7550 0.6044 0.7211 -0.0119 0.0023  0.0197  77  TYR A CB  
588  C CG  . TYR A 77  ? 0.7198 0.5754 0.6927 -0.0109 0.0051  0.0219  77  TYR A CG  
589  C CD1 . TYR A 77  ? 0.7199 0.5631 0.6846 -0.0118 0.0054  0.0227  77  TYR A CD1 
590  C CD2 . TYR A 77  ? 0.7377 0.6109 0.7242 -0.0091 0.0076  0.0230  77  TYR A CD2 
591  C CE1 . TYR A 77  ? 0.7740 0.6229 0.7445 -0.0107 0.0080  0.0247  77  TYR A CE1 
592  C CE2 . TYR A 77  ? 0.7647 0.6434 0.7568 -0.0083 0.0101  0.0249  77  TYR A CE2 
593  C CZ  . TYR A 77  ? 0.8415 0.7085 0.8260 -0.0089 0.0103  0.0257  77  TYR A CZ  
594  O OH  . TYR A 77  ? 0.8549 0.7273 0.8446 -0.0080 0.0128  0.0275  77  TYR A OH  
595  N N   . PRO A 78  ? 1.0319 0.8551 0.9791 -0.0294 -0.0069 0.0168  78  PRO A N   
596  C CA  . PRO A 78  ? 1.0407 0.8558 0.9792 -0.0309 -0.0101 0.0143  78  PRO A CA  
597  C C   . PRO A 78  ? 1.0181 0.8195 0.9419 -0.0217 -0.0100 0.0119  78  PRO A C   
598  O O   . PRO A 78  ? 0.9869 0.7716 0.8974 -0.0191 -0.0098 0.0114  78  PRO A O   
599  C CB  . PRO A 78  ? 1.0731 0.8758 1.0038 -0.0413 -0.0130 0.0145  78  PRO A CB  
600  C CG  . PRO A 78  ? 1.0569 0.8702 0.9993 -0.0469 -0.0114 0.0175  78  PRO A CG  
601  C CD  . PRO A 78  ? 0.9849 0.8035 0.9319 -0.0382 -0.0076 0.0186  78  PRO A CD  
602  N N   . GLY A 79  ? 0.9912 0.7997 0.9170 -0.0167 -0.0102 0.0104  79  GLY A N   
603  C CA  . GLY A 79  ? 0.9425 0.7408 0.8555 -0.0074 -0.0099 0.0080  79  GLY A CA  
604  C C   . GLY A 79  ? 0.8607 0.6709 0.7796 0.0025  -0.0063 0.0085  79  GLY A C   
605  O O   . GLY A 79  ? 0.7630 0.5709 0.6746 0.0107  -0.0058 0.0067  79  GLY A O   
606  N N   . PHE A 80  ? 0.7821 0.6056 0.7141 0.0014  -0.0038 0.0109  80  PHE A N   
607  C CA  . PHE A 80  ? 0.6527 0.4881 0.5908 0.0094  -0.0003 0.0116  80  PHE A CA  
608  C C   . PHE A 80  ? 0.6087 0.4613 0.5576 0.0109  0.0007  0.0115  80  PHE A C   
609  O O   . PHE A 80  ? 0.5397 0.4030 0.5002 0.0048  0.0003  0.0128  80  PHE A O   
610  C CB  . PHE A 80  ? 0.5531 0.3947 0.4999 0.0069  0.0019  0.0141  80  PHE A CB  
611  C CG  . PHE A 80  ? 0.5922 0.4469 0.5459 0.0138  0.0053  0.0149  80  PHE A CG  
612  C CD1 . PHE A 80  ? 0.6240 0.4747 0.5684 0.0233  0.0067  0.0137  80  PHE A CD1 
613  C CD2 . PHE A 80  ? 0.6415 0.5126 0.6104 0.0108  0.0072  0.0169  80  PHE A CD2 
614  C CE1 . PHE A 80  ? 0.6380 0.5023 0.5889 0.0291  0.0098  0.0145  80  PHE A CE1 
615  C CE2 . PHE A 80  ? 0.6022 0.4850 0.5768 0.0162  0.0103  0.0175  80  PHE A CE2 
616  C CZ  . PHE A 80  ? 0.6517 0.5318 0.6177 0.0251  0.0116  0.0163  80  PHE A CZ  
617  N N   . GLU A 81  ? 0.6027 0.4581 0.5472 0.0193  0.0020  0.0102  81  GLU A N   
618  C CA  . GLU A 81  ? 0.6145 0.4849 0.5673 0.0210  0.0030  0.0101  81  GLU A CA  
619  C C   . GLU A 81  ? 0.5964 0.4838 0.5649 0.0180  0.0054  0.0124  81  GLU A C   
620  O O   . GLU A 81  ? 0.5409 0.4383 0.5175 0.0151  0.0053  0.0129  81  GLU A O   
621  C CB  . GLU A 81  ? 0.6121 0.4839 0.5575 0.0308  0.0046  0.0086  81  GLU A CB  
622  N N   . GLY A 82  ? 0.5139 0.4036 0.4856 0.0189  0.0075  0.0138  82  GLY A N   
623  C CA  . GLY A 82  ? 0.4180 0.3226 0.4032 0.0167  0.0098  0.0158  82  GLY A CA  
624  C C   . GLY A 82  ? 0.4603 0.3694 0.4551 0.0086  0.0087  0.0172  82  GLY A C   
625  O O   . GLY A 82  ? 0.4051 0.3265 0.4101 0.0070  0.0103  0.0185  82  GLY A O   
626  N N   . THR A 83  ? 0.4694 0.3684 0.4602 0.0035  0.0059  0.0170  83  THR A N   
627  C CA  . THR A 83  ? 0.5406 0.4445 0.5396 -0.0039 0.0044  0.0182  83  THR A CA  
628  C C   . THR A 83  ? 0.5822 0.4854 0.5793 -0.0059 0.0017  0.0170  83  THR A C   
629  O O   . THR A 83  ? 0.6321 0.5452 0.6376 -0.0088 0.0014  0.0179  83  THR A O   
630  C CB  . THR A 83  ? 0.5342 0.4305 0.5320 -0.0097 0.0031  0.0192  83  THR A CB  
631  O OG1 . THR A 83  ? 0.6614 0.5411 0.6454 -0.0093 0.0011  0.0176  83  THR A OG1 
632  C CG2 . THR A 83  ? 0.5214 0.4213 0.5239 -0.0087 0.0059  0.0210  83  THR A CG2 
633  N N   . GLU A 84  ? 0.5037 0.3949 0.4889 -0.0040 -0.0003 0.0148  84  GLU A N   
634  C CA  . GLU A 84  ? 0.5898 0.4787 0.5715 -0.0059 -0.0031 0.0134  84  GLU A CA  
635  C C   . GLU A 84  ? 0.5724 0.4728 0.5594 -0.0026 -0.0020 0.0133  84  GLU A C   
636  O O   . GLU A 84  ? 0.5554 0.4596 0.5451 -0.0057 -0.0039 0.0132  84  GLU A O   
637  C CB  . GLU A 84  ? 0.5943 0.4665 0.5604 -0.0036 -0.0052 0.0109  84  GLU A CB  
638  C CG  . GLU A 84  ? 0.7577 0.6155 0.7159 -0.0080 -0.0069 0.0109  84  GLU A CG  
639  C CD  . GLU A 84  ? 0.9015 0.7596 0.8634 -0.0178 -0.0097 0.0116  84  GLU A CD  
640  O OE1 . GLU A 84  ? 0.8939 0.7621 0.8630 -0.0206 -0.0109 0.0117  84  GLU A OE1 
641  O OE2 . GLU A 84  ? 0.9679 0.8165 0.9252 -0.0229 -0.0108 0.0120  84  GLU A OE2 
642  N N   . MET A 85  ? 0.5443 0.4504 0.5324 0.0034  0.0010  0.0134  85  MET A N   
643  C CA  . MET A 85  ? 0.4590 0.3754 0.4509 0.0064  0.0024  0.0135  85  MET A CA  
644  C C   . MET A 85  ? 0.5334 0.4610 0.5367 0.0021  0.0029  0.0154  85  MET A C   
645  O O   . MET A 85  ? 0.6611 0.5954 0.6667 0.0031  0.0034  0.0155  85  MET A O   
646  C CB  . MET A 85  ? 0.4648 0.3867 0.4562 0.0127  0.0058  0.0135  85  MET A CB  
647  C CG  . MET A 85  ? 0.5548 0.4827 0.5538 0.0118  0.0083  0.0153  85  MET A CG  
648  S SD  . MET A 85  ? 0.6771 0.6182 0.6802 0.0166  0.0124  0.0159  85  MET A SD  
649  C CE  . MET A 85  ? 0.5489 0.4836 0.5399 0.0248  0.0127  0.0139  85  MET A CE  
650  N N   . TRP A 86  ? 0.4489 0.3780 0.4587 -0.0025 0.0028  0.0170  86  TRP A N   
651  C CA  . TRP A 86  ? 0.4135 0.3524 0.4333 -0.0059 0.0032  0.0189  86  TRP A CA  
652  C C   . TRP A 86  ? 0.4078 0.3454 0.4287 -0.0112 -0.0002 0.0191  86  TRP A C   
653  O O   . TRP A 86  ? 0.4117 0.3574 0.4395 -0.0134 -0.0005 0.0204  86  TRP A O   
654  C CB  . TRP A 86  ? 0.3890 0.3329 0.4159 -0.0069 0.0057  0.0208  86  TRP A CB  
655  C CG  . TRP A 86  ? 0.3906 0.3368 0.4167 -0.0022 0.0088  0.0207  86  TRP A CG  
656  C CD1 . TRP A 86  ? 0.4913 0.4327 0.5137 0.0000  0.0098  0.0204  86  TRP A CD1 
657  C CD2 . TRP A 86  ? 0.4345 0.3888 0.4631 0.0005  0.0113  0.0210  86  TRP A CD2 
658  N NE1 . TRP A 86  ? 0.5205 0.4679 0.5436 0.0042  0.0127  0.0204  86  TRP A NE1 
659  C CE2 . TRP A 86  ? 0.4797 0.4352 0.5066 0.0041  0.0136  0.0208  86  TRP A CE2 
660  C CE3 . TRP A 86  ? 0.4197 0.3801 0.4511 0.0001  0.0117  0.0216  86  TRP A CE3 
661  C CZ2 . TRP A 86  ? 0.4786 0.4423 0.5070 0.0066  0.0163  0.0210  86  TRP A CZ2 
662  C CZ3 . TRP A 86  ? 0.4327 0.3996 0.4650 0.0024  0.0144  0.0218  86  TRP A CZ3 
663  C CH2 . TRP A 86  ? 0.4393 0.4084 0.4703 0.0052  0.0167  0.0215  86  TRP A CH2 
664  N N   . ASN A 87  ? 0.3786 0.3060 0.3920 -0.0134 -0.0027 0.0177  87  ASN A N   
665  C CA  . ASN A 87  ? 0.4466 0.3728 0.4601 -0.0193 -0.0062 0.0176  87  ASN A CA  
666  C C   . ASN A 87  ? 0.5428 0.4712 0.5543 -0.0189 -0.0083 0.0165  87  ASN A C   
667  O O   . ASN A 87  ? 0.5297 0.4560 0.5362 -0.0140 -0.0076 0.0152  87  ASN A O   
668  C CB  . ASN A 87  ? 0.4824 0.3955 0.4870 -0.0225 -0.0083 0.0163  87  ASN A CB  
669  C CG  . ASN A 87  ? 0.5419 0.4548 0.5504 -0.0258 -0.0071 0.0180  87  ASN A CG  
670  O OD1 . ASN A 87  ? 0.5247 0.4483 0.5435 -0.0273 -0.0056 0.0201  87  ASN A OD1 
671  N ND2 . ASN A 87  ? 0.5837 0.4834 0.5830 -0.0267 -0.0077 0.0171  87  ASN A ND2 
672  N N   . PRO A 88  ? 0.5632 0.4968 0.5788 -0.0237 -0.0109 0.0171  88  PRO A N   
673  C CA  . PRO A 88  ? 0.5106 0.4471 0.5246 -0.0235 -0.0132 0.0163  88  PRO A CA  
674  C C   . PRO A 88  ? 0.5189 0.4439 0.5210 -0.0219 -0.0152 0.0135  88  PRO A C   
675  O O   . PRO A 88  ? 0.4879 0.4021 0.4825 -0.0249 -0.0171 0.0121  88  PRO A O   
676  C CB  . PRO A 88  ? 0.3857 0.3281 0.4045 -0.0300 -0.0162 0.0172  88  PRO A CB  
677  C CG  . PRO A 88  ? 0.4768 0.4249 0.5037 -0.0320 -0.0141 0.0194  88  PRO A CG  
678  C CD  . PRO A 88  ? 0.5078 0.4466 0.5302 -0.0295 -0.0117 0.0189  88  PRO A CD  
679  N N   . ASN A 89  ? 0.5307 0.4571 0.5301 -0.0174 -0.0149 0.0127  89  ASN A N   
680  C CA  . ASN A 89  ? 0.4701 0.3863 0.4579 -0.0149 -0.0165 0.0100  89  ASN A CA  
681  C C   . ASN A 89  ? 0.5434 0.4611 0.5289 -0.0171 -0.0200 0.0090  89  ASN A C   
682  O O   . ASN A 89  ? 0.6877 0.5982 0.6639 -0.0148 -0.0215 0.0068  89  ASN A O   
683  C CB  . ASN A 89  ? 0.4208 0.3372 0.4058 -0.0076 -0.0133 0.0095  89  ASN A CB  
684  C CG  . ASN A 89  ? 0.4888 0.4168 0.4807 -0.0054 -0.0115 0.0111  89  ASN A CG  
685  O OD1 . ASN A 89  ? 0.4950 0.4313 0.4954 -0.0083 -0.0115 0.0131  89  ASN A OD1 
686  N ND2 . ASN A 89  ? 0.5099 0.4382 0.4974 -0.0002 -0.0098 0.0103  89  ASN A ND2 
687  N N   . ARG A 90  ? 0.5517 0.4796 0.5458 -0.0210 -0.0212 0.0107  90  ARG A N   
688  C CA  . ARG A 90  ? 0.5902 0.5211 0.5830 -0.0239 -0.0249 0.0100  90  ARG A CA  
689  C C   . ARG A 90  ? 0.5842 0.5207 0.5828 -0.0311 -0.0273 0.0111  90  ARG A C   
690  O O   . ARG A 90  ? 0.6041 0.5425 0.6080 -0.0333 -0.0258 0.0125  90  ARG A O   
691  C CB  . ARG A 90  ? 0.5577 0.4984 0.5550 -0.0198 -0.0238 0.0112  90  ARG A CB  
692  C CG  . ARG A 90  ? 0.6495 0.5859 0.6404 -0.0136 -0.0219 0.0101  90  ARG A CG  
693  C CD  . ARG A 90  ? 0.8395 0.7668 0.8193 -0.0136 -0.0251 0.0072  90  ARG A CD  
694  N NE  . ARG A 90  ? 1.0009 0.9244 0.9741 -0.0073 -0.0231 0.0061  90  ARG A NE  
695  C CZ  . ARG A 90  ? 1.0920 1.0063 1.0576 -0.0040 -0.0219 0.0044  90  ARG A CZ  
696  N NH1 . ARG A 90  ? 1.1299 1.0360 1.0927 -0.0065 -0.0225 0.0037  90  ARG A NH1 
697  N NH2 . ARG A 90  ? 1.0529 0.9662 1.0132 0.0019  -0.0200 0.0036  90  ARG A NH2 
698  N N   . GLU A 91  ? 0.5326 0.4728 0.5302 -0.0348 -0.0311 0.0104  91  GLU A N   
699  C CA  . GLU A 91  ? 0.5209 0.4685 0.5238 -0.0420 -0.0337 0.0114  91  GLU A CA  
700  C C   . GLU A 91  ? 0.5356 0.4979 0.5512 -0.0411 -0.0314 0.0145  91  GLU A C   
701  O O   . GLU A 91  ? 0.4613 0.4301 0.4811 -0.0354 -0.0293 0.0158  91  GLU A O   
702  C CB  . GLU A 91  ? 0.5172 0.4682 0.5170 -0.0454 -0.0382 0.0100  91  GLU A CB  
703  C CG  . GLU A 91  ? 0.6236 0.5839 0.6284 -0.0536 -0.0413 0.0108  91  GLU A CG  
704  C CD  . GLU A 91  ? 0.8157 0.7790 0.8162 -0.0573 -0.0459 0.0092  91  GLU A CD  
705  O OE1 . GLU A 91  ? 0.8232 0.7757 0.8136 -0.0554 -0.0473 0.0067  91  GLU A OE1 
706  O OE2 . GLU A 91  ? 0.8532 0.8305 0.8604 -0.0618 -0.0482 0.0104  91  GLU A OE2 
707  N N   . LEU A 92  ? 0.5004 0.4672 0.5212 -0.0467 -0.0319 0.0158  92  LEU A N   
708  C CA  . LEU A 92  ? 0.5304 0.5114 0.5627 -0.0461 -0.0301 0.0187  92  LEU A CA  
709  C C   . LEU A 92  ? 0.5563 0.5516 0.5935 -0.0479 -0.0330 0.0196  92  LEU A C   
710  O O   . LEU A 92  ? 0.4982 0.4944 0.5323 -0.0539 -0.0369 0.0183  92  LEU A O   
711  C CB  . LEU A 92  ? 0.5262 0.5069 0.5619 -0.0511 -0.0291 0.0198  92  LEU A CB  
712  C CG  . LEU A 92  ? 0.5044 0.4733 0.5366 -0.0486 -0.0258 0.0194  92  LEU A CG  
713  C CD1 . LEU A 92  ? 0.4792 0.4474 0.5139 -0.0542 -0.0253 0.0205  92  LEU A CD1 
714  C CD2 . LEU A 92  ? 0.5407 0.5134 0.5778 -0.0411 -0.0218 0.0208  92  LEU A CD2 
715  N N   . SER A 93  ? 0.5035 0.5095 0.5476 -0.0425 -0.0312 0.0217  93  SER A N   
716  C CA  . SER A 93  ? 0.5031 0.5237 0.5520 -0.0424 -0.0336 0.0228  93  SER A CA  
717  C C   . SER A 93  ? 0.4393 0.4696 0.4958 -0.0362 -0.0305 0.0256  93  SER A C   
718  O O   . SER A 93  ? 0.4146 0.4387 0.4707 -0.0313 -0.0268 0.0262  93  SER A O   
719  C CB  . SER A 93  ? 0.3934 0.4113 0.4356 -0.0403 -0.0362 0.0211  93  SER A CB  
720  O OG  . SER A 93  ? 0.4129 0.4452 0.4593 -0.0394 -0.0385 0.0223  93  SER A OG  
721  N N   . GLU A 94  ? 0.4406 0.4862 0.5032 -0.0364 -0.0321 0.0273  94  GLU A N   
722  C CA  . GLU A 94  ? 0.4693 0.5235 0.5373 -0.0295 -0.0295 0.0299  94  GLU A CA  
723  C C   . GLU A 94  ? 0.4977 0.5498 0.5610 -0.0230 -0.0296 0.0298  94  GLU A C   
724  O O   . GLU A 94  ? 0.5024 0.5556 0.5667 -0.0165 -0.0269 0.0316  94  GLU A O   
725  C CB  . GLU A 94  ? 0.4809 0.5531 0.5568 -0.0311 -0.0310 0.0319  94  GLU A CB  
726  C CG  . GLU A 94  ? 0.4633 0.5389 0.5444 -0.0373 -0.0304 0.0325  94  GLU A CG  
727  C CD  . GLU A 94  ? 0.5380 0.6334 0.6271 -0.0388 -0.0319 0.0346  94  GLU A CD  
728  O OE1 . GLU A 94  ? 0.4703 0.5743 0.5640 -0.0322 -0.0297 0.0368  94  GLU A OE1 
729  O OE2 . GLU A 94  ? 0.5762 0.6787 0.6664 -0.0467 -0.0352 0.0339  94  GLU A OE2 
730  N N   . ASP A 95  ? 0.4235 0.4716 0.4808 -0.0251 -0.0327 0.0277  95  ASP A N   
731  C CA  . ASP A 95  ? 0.4125 0.4559 0.4637 -0.0197 -0.0328 0.0272  95  ASP A CA  
732  C C   . ASP A 95  ? 0.4110 0.4390 0.4564 -0.0181 -0.0299 0.0259  95  ASP A C   
733  O O   . ASP A 95  ? 0.5164 0.5356 0.5558 -0.0210 -0.0314 0.0234  95  ASP A O   
734  C CB  . ASP A 95  ? 0.4822 0.5285 0.5293 -0.0227 -0.0375 0.0254  95  ASP A CB  
735  C CG  . ASP A 95  ? 0.4990 0.5407 0.5394 -0.0171 -0.0377 0.0249  95  ASP A CG  
736  O OD1 . ASP A 95  ? 0.4689 0.5073 0.5084 -0.0108 -0.0344 0.0264  95  ASP A OD1 
737  O OD2 . ASP A 95  ? 0.6292 0.6702 0.6647 -0.0194 -0.0413 0.0230  95  ASP A OD2 
738  N N   . CYS A 96  ? 0.3065 0.3317 0.3533 -0.0134 -0.0257 0.0275  96  CYS A N   
739  C CA  . CYS A 96  ? 0.2945 0.3076 0.3374 -0.0126 -0.0226 0.0266  96  CYS A CA  
740  C C   . CYS A 96  ? 0.2689 0.2792 0.3103 -0.0067 -0.0189 0.0281  96  CYS A C   
741  O O   . CYS A 96  ? 0.3547 0.3572 0.3937 -0.0059 -0.0159 0.0277  96  CYS A O   
742  C CB  . CYS A 96  ? 0.3256 0.3372 0.3728 -0.0161 -0.0210 0.0267  96  CYS A CB  
743  S SG  . CYS A 96  ? 0.4256 0.4466 0.4815 -0.0139 -0.0182 0.0298  96  CYS A SG  
744  N N   . LEU A 97  ? 0.3001 0.3166 0.3421 -0.0027 -0.0191 0.0300  97  LEU A N   
745  C CA  . LEU A 97  ? 0.4212 0.4335 0.4602 0.0024  -0.0157 0.0316  97  LEU A CA  
746  C C   . LEU A 97  ? 0.4937 0.4991 0.5247 0.0044  -0.0157 0.0306  97  LEU A C   
747  O O   . LEU A 97  ? 0.4428 0.4502 0.4703 0.0077  -0.0170 0.0313  97  LEU A O   
748  C CB  . LEU A 97  ? 0.4296 0.4496 0.4711 0.0066  -0.0155 0.0341  97  LEU A CB  
749  C CG  . LEU A 97  ? 0.4018 0.4288 0.4512 0.0053  -0.0148 0.0353  97  LEU A CG  
750  C CD1 . LEU A 97  ? 0.3090 0.3433 0.3599 0.0106  -0.0143 0.0379  97  LEU A CD1 
751  C CD2 . LEU A 97  ? 0.3973 0.4171 0.4478 0.0037  -0.0111 0.0352  97  LEU A CD2 
752  N N   . TYR A 98  ? 0.4568 0.4545 0.4847 0.0028  -0.0142 0.0289  98  TYR A N   
753  C CA  . TYR A 98  ? 0.4309 0.4225 0.4512 0.0046  -0.0137 0.0279  98  TYR A CA  
754  C C   . TYR A 98  ? 0.4486 0.4342 0.4670 0.0053  -0.0094 0.0282  98  TYR A C   
755  O O   . TYR A 98  ? 0.4887 0.4739 0.5113 0.0035  -0.0076 0.0282  98  TYR A O   
756  C CB  . TYR A 98  ? 0.4501 0.4391 0.4670 0.0020  -0.0169 0.0251  98  TYR A CB  
757  C CG  . TYR A 98  ? 0.4691 0.4644 0.4875 0.0000  -0.0214 0.0245  98  TYR A CG  
758  C CD1 . TYR A 98  ? 0.4490 0.4491 0.4733 -0.0041 -0.0233 0.0243  98  TYR A CD1 
759  C CD2 . TYR A 98  ? 0.3931 0.3901 0.4069 0.0020  -0.0239 0.0242  98  TYR A CD2 
760  C CE1 . TYR A 98  ? 0.5258 0.5331 0.5516 -0.0067 -0.0275 0.0238  98  TYR A CE1 
761  C CE2 . TYR A 98  ? 0.4085 0.4125 0.4238 0.0000  -0.0283 0.0237  98  TYR A CE2 
762  C CZ  . TYR A 98  ? 0.5566 0.5661 0.5779 -0.0047 -0.0300 0.0234  98  TYR A CZ  
763  O OH  . TYR A 98  ? 0.5818 0.5996 0.6046 -0.0075 -0.0344 0.0229  98  TYR A OH  
764  N N   . LEU A 99  ? 0.4679 0.4496 0.4801 0.0076  -0.0078 0.0285  99  LEU A N   
765  C CA  . LEU A 99  ? 0.4671 0.4445 0.4770 0.0076  -0.0038 0.0286  99  LEU A CA  
766  C C   . LEU A 99  ? 0.5160 0.4900 0.5197 0.0081  -0.0038 0.0268  99  LEU A C   
767  O O   . LEU A 99  ? 0.5657 0.5395 0.5656 0.0089  -0.0066 0.0256  99  LEU A O   
768  C CB  . LEU A 99  ? 0.3804 0.3564 0.3883 0.0095  -0.0008 0.0312  99  LEU A CB  
769  C CG  . LEU A 99  ? 0.4162 0.3910 0.4182 0.0125  -0.0015 0.0326  99  LEU A CG  
770  C CD1 . LEU A 99  ? 0.3307 0.3016 0.3252 0.0129  -0.0003 0.0320  99  LEU A CD1 
771  C CD2 . LEU A 99  ? 0.3313 0.3042 0.3323 0.0143  0.0008  0.0353  99  LEU A CD2 
772  N N   . ASN A 100 ? 0.4512 0.4233 0.4536 0.0077  -0.0005 0.0265  100 ASN A N   
773  C CA  . ASN A 100 ? 0.3839 0.3541 0.3806 0.0086  0.0000  0.0248  100 ASN A CA  
774  C C   . ASN A 100 ? 0.4675 0.4375 0.4603 0.0091  0.0038  0.0261  100 ASN A C   
775  O O   . ASN A 100 ? 0.4944 0.4649 0.4897 0.0079  0.0066  0.0278  100 ASN A O   
776  C CB  . ASN A 100 ? 0.4134 0.3825 0.4115 0.0078  -0.0001 0.0226  100 ASN A CB  
777  C CG  . ASN A 100 ? 0.4729 0.4416 0.4753 0.0059  -0.0033 0.0218  100 ASN A CG  
778  O OD1 . ASN A 100 ? 0.4801 0.4478 0.4804 0.0056  -0.0068 0.0205  100 ASN A OD1 
779  N ND2 . ASN A 100 ? 0.4878 0.4577 0.4962 0.0042  -0.0021 0.0224  100 ASN A ND2 
780  N N   . VAL A 101 ? 0.5074 0.4766 0.4937 0.0106  0.0040  0.0254  101 VAL A N   
781  C CA  . VAL A 101 ? 0.4568 0.4266 0.4387 0.0105  0.0076  0.0267  101 VAL A CA  
782  C C   . VAL A 101 ? 0.4927 0.4644 0.4705 0.0117  0.0087  0.0249  101 VAL A C   
783  O O   . VAL A 101 ? 0.5472 0.5177 0.5211 0.0138  0.0063  0.0231  101 VAL A O   
784  C CB  . VAL A 101 ? 0.4896 0.4571 0.4659 0.0115  0.0073  0.0285  101 VAL A CB  
785  C CG1 . VAL A 101 ? 0.4903 0.4579 0.4612 0.0103  0.0112  0.0300  101 VAL A CG1 
786  C CG2 . VAL A 101 ? 0.4293 0.3952 0.4086 0.0114  0.0064  0.0304  101 VAL A CG2 
787  N N   . TRP A 102 ? 0.4784 0.4535 0.4569 0.0105  0.0122  0.0253  102 TRP A N   
788  C CA  . TRP A 102 ? 0.4127 0.3916 0.3869 0.0120  0.0139  0.0240  102 TRP A CA  
789  C C   . TRP A 102 ? 0.5226 0.5044 0.4926 0.0101  0.0173  0.0260  102 TRP A C   
790  O O   . TRP A 102 ? 0.5075 0.4896 0.4793 0.0068  0.0197  0.0279  102 TRP A O   
791  C CB  . TRP A 102 ? 0.5250 0.5076 0.5030 0.0122  0.0153  0.0227  102 TRP A CB  
792  C CG  . TRP A 102 ? 0.5068 0.4859 0.4867 0.0142  0.0123  0.0205  102 TRP A CG  
793  C CD1 . TRP A 102 ? 0.5464 0.5238 0.5218 0.0177  0.0107  0.0181  102 TRP A CD1 
794  C CD2 . TRP A 102 ? 0.4511 0.4272 0.4370 0.0125  0.0106  0.0206  102 TRP A CD2 
795  N NE1 . TRP A 102 ? 0.4730 0.4455 0.4507 0.0178  0.0080  0.0166  102 TRP A NE1 
796  C CE2 . TRP A 102 ? 0.5146 0.4869 0.4992 0.0145  0.0080  0.0182  102 TRP A CE2 
797  C CE3 . TRP A 102 ? 0.5655 0.5414 0.5571 0.0097  0.0111  0.0225  102 TRP A CE3 
798  C CZ2 . TRP A 102 ? 0.5978 0.5667 0.5870 0.0129  0.0059  0.0178  102 TRP A CZ2 
799  C CZ3 . TRP A 102 ? 0.5240 0.4977 0.5208 0.0087  0.0091  0.0221  102 TRP A CZ3 
800  C CH2 . TRP A 102 ? 0.4987 0.4691 0.4943 0.0100  0.0066  0.0198  102 TRP A CH2 
801  N N   . THR A 103 ? 0.5326 0.5161 0.4962 0.0119  0.0176  0.0255  103 THR A N   
802  C CA  . THR A 103 ? 0.4371 0.4240 0.3958 0.0097  0.0210  0.0274  103 THR A CA  
803  C C   . THR A 103 ? 0.5493 0.5433 0.5043 0.0121  0.0223  0.0259  103 THR A C   
804  O O   . THR A 103 ? 0.5681 0.5617 0.5226 0.0163  0.0201  0.0234  103 THR A O   
805  C CB  . THR A 103 ? 0.6089 0.5903 0.5620 0.0094  0.0202  0.0292  103 THR A CB  
806  O OG1 . THR A 103 ? 0.5694 0.5495 0.5183 0.0132  0.0175  0.0276  103 THR A OG1 
807  C CG2 . THR A 103 ? 0.5711 0.5458 0.5271 0.0084  0.0186  0.0306  103 THR A CG2 
808  N N   . PRO A 104 ? 0.5794 0.5798 0.5313 0.0095  0.0260  0.0273  104 PRO A N   
809  C CA  . PRO A 104 ? 0.6341 0.6426 0.5816 0.0122  0.0275  0.0262  104 PRO A CA  
810  C C   . PRO A 104 ? 0.5685 0.5730 0.5097 0.0162  0.0250  0.0252  104 PRO A C   
811  O O   . PRO A 104 ? 0.6000 0.5966 0.5396 0.0157  0.0229  0.0260  104 PRO A O   
812  C CB  . PRO A 104 ? 0.6093 0.6240 0.5539 0.0070  0.0316  0.0287  104 PRO A CB  
813  C CG  . PRO A 104 ? 0.4640 0.4765 0.4138 0.0021  0.0328  0.0302  104 PRO A CG  
814  C CD  . PRO A 104 ? 0.4847 0.4863 0.4375 0.0038  0.0292  0.0298  104 PRO A CD  
815  N N   . TYR A 105 ? 0.5300 0.5402 0.4676 0.0205  0.0253  0.0233  105 TYR A N   
816  C CA  . TYR A 105 ? 0.6180 0.6252 0.5487 0.0244  0.0233  0.0222  105 TYR A CA  
817  C C   . TYR A 105 ? 0.6981 0.7150 0.6231 0.0252  0.0265  0.0228  105 TYR A C   
818  O O   . TYR A 105 ? 0.7050 0.7311 0.6302 0.0278  0.0284  0.0216  105 TYR A O   
819  C CB  . TYR A 105 ? 0.5803 0.5828 0.5104 0.0299  0.0197  0.0188  105 TYR A CB  
820  C CG  . TYR A 105 ? 0.6136 0.6114 0.5363 0.0338  0.0170  0.0173  105 TYR A CG  
821  C CD1 . TYR A 105 ? 0.6106 0.6143 0.5264 0.0376  0.0186  0.0165  105 TYR A CD1 
822  C CD2 . TYR A 105 ? 0.6821 0.6703 0.6044 0.0338  0.0129  0.0167  105 TYR A CD2 
823  C CE1 . TYR A 105 ? 0.5668 0.5658 0.4754 0.0413  0.0161  0.0150  105 TYR A CE1 
824  C CE2 . TYR A 105 ? 0.6276 0.6117 0.5428 0.0371  0.0103  0.0152  105 TYR A CE2 
825  C CZ  . TYR A 105 ? 0.5905 0.5795 0.4988 0.0409  0.0119  0.0143  105 TYR A CZ  
826  O OH  . TYR A 105 ? 0.5597 0.5444 0.4604 0.0444  0.0093  0.0127  105 TYR A OH  
827  N N   . PRO A 106 ? 0.6834 0.6989 0.6029 0.0231  0.0273  0.0247  106 PRO A N   
828  C CA  . PRO A 106 ? 0.6172 0.6224 0.5353 0.0209  0.0253  0.0264  106 PRO A CA  
829  C C   . PRO A 106 ? 0.5892 0.5917 0.5115 0.0149  0.0269  0.0289  106 PRO A C   
830  O O   . PRO A 106 ? 0.6554 0.6647 0.5810 0.0117  0.0300  0.0296  106 PRO A O   
831  C CB  . PRO A 106 ? 0.6509 0.6575 0.5606 0.0208  0.0267  0.0278  106 PRO A CB  
832  C CG  . PRO A 106 ? 0.6875 0.7067 0.5959 0.0195  0.0309  0.0283  106 PRO A CG  
833  C CD  . PRO A 106 ? 0.7126 0.7375 0.6260 0.0234  0.0304  0.0255  106 PRO A CD  
834  N N   . ARG A 107 ? 0.5455 0.5384 0.4674 0.0139  0.0248  0.0302  107 ARG A N   
835  C CA  . ARG A 107 ? 0.6327 0.6208 0.5576 0.0094  0.0259  0.0325  107 ARG A CA  
836  C C   . ARG A 107 ? 0.6734 0.6643 0.5941 0.0036  0.0304  0.0353  107 ARG A C   
837  O O   . ARG A 107 ? 0.8228 0.8171 0.7368 0.0029  0.0322  0.0362  107 ARG A O   
838  C CB  . ARG A 107 ? 0.6529 0.6308 0.5765 0.0107  0.0227  0.0334  107 ARG A CB  
839  C CG  . ARG A 107 ? 0.6732 0.6488 0.6020 0.0146  0.0183  0.0308  107 ARG A CG  
840  C CD  . ARG A 107 ? 0.6643 0.6324 0.5941 0.0151  0.0156  0.0320  107 ARG A CD  
841  N NE  . ARG A 107 ? 0.6835 0.6472 0.6053 0.0162  0.0151  0.0337  107 ARG A NE  
842  C CZ  . ARG A 107 ? 0.6226 0.5855 0.5407 0.0198  0.0121  0.0325  107 ARG A CZ  
843  N NH1 . ARG A 107 ? 0.5588 0.5242 0.4799 0.0224  0.0093  0.0293  107 ARG A NH1 
844  N NH2 . ARG A 107 ? 0.7463 0.7052 0.6569 0.0209  0.0119  0.0343  107 ARG A NH2 
845  N N   . PRO A 108 ? 0.7557 0.7450 0.6799 -0.0009 0.0321  0.0366  108 PRO A N   
846  C CA  . PRO A 108 ? 0.8008 0.7925 0.7211 -0.0075 0.0364  0.0390  108 PRO A CA  
847  C C   . PRO A 108 ? 0.7879 0.7731 0.6978 -0.0103 0.0378  0.0418  108 PRO A C   
848  O O   . PRO A 108 ? 0.8309 0.8060 0.7371 -0.0076 0.0355  0.0426  108 PRO A O   
849  C CB  . PRO A 108 ? 0.6899 0.6762 0.6149 -0.0106 0.0366  0.0398  108 PRO A CB  
850  C CG  . PRO A 108 ? 0.5988 0.5869 0.5328 -0.0059 0.0335  0.0371  108 PRO A CG  
851  C CD  . PRO A 108 ? 0.6342 0.6200 0.5664 -0.0001 0.0302  0.0357  108 PRO A CD  
852  N N   . ALA A 109 ? 0.8254 0.8167 0.7303 -0.0156 0.0416  0.0433  109 ALA A N   
853  C CA  . ALA A 109 ? 0.9175 0.9024 0.8114 -0.0194 0.0436  0.0463  109 ALA A CA  
854  C C   . ALA A 109 ? 0.9585 0.9305 0.8479 -0.0244 0.0446  0.0488  109 ALA A C   
855  O O   . ALA A 109 ? 1.0046 0.9640 0.8870 -0.0229 0.0435  0.0505  109 ALA A O   
856  C CB  . ALA A 109 ? 0.8512 0.8482 0.7413 -0.0241 0.0474  0.0471  109 ALA A CB  
857  N N   . SER A 110 ? 0.9220 0.8972 0.8150 -0.0298 0.0468  0.0490  110 SER A N   
858  C CA  . SER A 110 ? 0.8764 0.8390 0.7650 -0.0345 0.0479  0.0511  110 SER A CA  
859  C C   . SER A 110 ? 0.8044 0.7621 0.7014 -0.0302 0.0450  0.0496  110 SER A C   
860  O O   . SER A 110 ? 0.7102 0.6763 0.6171 -0.0256 0.0429  0.0470  110 SER A O   
861  C CB  . SER A 110 ? 0.9403 0.9090 0.8271 -0.0438 0.0519  0.0521  110 SER A CB  
862  O OG  . SER A 110 ? 1.0307 1.0167 0.9274 -0.0434 0.0524  0.0498  110 SER A OG  
863  N N   . PRO A 111 ? 0.7924 0.7359 0.6845 -0.0313 0.0449  0.0514  111 PRO A N   
864  C CA  . PRO A 111 ? 0.8173 0.7571 0.7172 -0.0276 0.0426  0.0503  111 PRO A CA  
865  C C   . PRO A 111 ? 0.8248 0.7752 0.7348 -0.0300 0.0434  0.0484  111 PRO A C   
866  O O   . PRO A 111 ? 0.7874 0.7409 0.6953 -0.0369 0.0465  0.0491  111 PRO A O   
867  C CB  . PRO A 111 ? 0.8593 0.7829 0.7496 -0.0302 0.0437  0.0529  111 PRO A CB  
868  C CG  . PRO A 111 ? 0.7924 0.7084 0.6698 -0.0313 0.0448  0.0552  111 PRO A CG  
869  C CD  . PRO A 111 ? 0.7700 0.6994 0.6482 -0.0349 0.0467  0.0546  111 PRO A CD  
870  N N   . THR A 112 ? 0.7505 0.7065 0.6711 -0.0245 0.0406  0.0460  112 THR A N   
871  C CA  . THR A 112 ? 0.6934 0.6600 0.6235 -0.0255 0.0411  0.0440  112 THR A CA  
872  C C   . THR A 112 ? 0.5959 0.5577 0.5323 -0.0244 0.0398  0.0436  112 THR A C   
873  O O   . THR A 112 ? 0.6125 0.5684 0.5511 -0.0194 0.0369  0.0434  112 THR A O   
874  C CB  . THR A 112 ? 0.6761 0.6536 0.6127 -0.0203 0.0391  0.0414  112 THR A CB  
875  O OG1 . THR A 112 ? 0.7214 0.7049 0.6524 -0.0213 0.0407  0.0418  112 THR A OG1 
876  C CG2 . THR A 112 ? 0.5962 0.5837 0.5418 -0.0205 0.0396  0.0395  112 THR A CG2 
877  N N   . PRO A 113 ? 0.5611 0.5262 0.5001 -0.0292 0.0421  0.0436  113 PRO A N   
878  C CA  . PRO A 113 ? 0.5925 0.5541 0.5375 -0.0285 0.0412  0.0432  113 PRO A CA  
879  C C   . PRO A 113 ? 0.5656 0.5311 0.5202 -0.0220 0.0379  0.0411  113 PRO A C   
880  O O   . PRO A 113 ? 0.5925 0.5672 0.5513 -0.0196 0.0370  0.0393  113 PRO A O   
881  C CB  . PRO A 113 ? 0.5432 0.5132 0.4908 -0.0343 0.0440  0.0427  113 PRO A CB  
882  C CG  . PRO A 113 ? 0.5841 0.5560 0.5229 -0.0403 0.0469  0.0442  113 PRO A CG  
883  C CD  . PRO A 113 ? 0.5309 0.5038 0.4668 -0.0361 0.0456  0.0441  113 PRO A CD  
884  N N   . VAL A 114 ? 0.5740 0.5325 0.5314 -0.0193 0.0360  0.0413  114 VAL A N   
885  C CA  . VAL A 114 ? 0.5326 0.4936 0.4981 -0.0139 0.0327  0.0396  114 VAL A CA  
886  C C   . VAL A 114 ? 0.5963 0.5609 0.5702 -0.0143 0.0327  0.0386  114 VAL A C   
887  O O   . VAL A 114 ? 0.5320 0.4925 0.5052 -0.0171 0.0343  0.0397  114 VAL A O   
888  C CB  . VAL A 114 ? 0.5003 0.4529 0.4635 -0.0098 0.0301  0.0407  114 VAL A CB  
889  C CG1 . VAL A 114 ? 0.4188 0.3752 0.3899 -0.0052 0.0265  0.0389  114 VAL A CG1 
890  C CG2 . VAL A 114 ? 0.5242 0.4722 0.4779 -0.0093 0.0302  0.0420  114 VAL A CG2 
891  N N   . LEU A 115 ? 0.5578 0.5293 0.5389 -0.0115 0.0309  0.0365  115 LEU A N   
892  C CA  . LEU A 115 ? 0.4563 0.4304 0.4453 -0.0111 0.0304  0.0356  115 LEU A CA  
893  C C   . LEU A 115 ? 0.4524 0.4240 0.4460 -0.0070 0.0269  0.0350  115 LEU A C   
894  O O   . LEU A 115 ? 0.4938 0.4666 0.4875 -0.0042 0.0245  0.0338  115 LEU A O   
895  C CB  . LEU A 115 ? 0.5159 0.4994 0.5089 -0.0112 0.0312  0.0337  115 LEU A CB  
896  C CG  . LEU A 115 ? 0.6526 0.6419 0.6436 -0.0158 0.0347  0.0341  115 LEU A CG  
897  C CD1 . LEU A 115 ? 0.6704 0.6700 0.6655 -0.0144 0.0351  0.0323  115 LEU A CD1 
898  C CD2 . LEU A 115 ? 0.7061 0.6914 0.6978 -0.0194 0.0363  0.0353  115 LEU A CD2 
899  N N   . ILE A 116 ? 0.4317 0.3999 0.4287 -0.0069 0.0266  0.0358  116 ILE A N   
900  C CA  . ILE A 116 ? 0.4835 0.4514 0.4857 -0.0037 0.0234  0.0353  116 ILE A CA  
901  C C   . ILE A 116 ? 0.4862 0.4579 0.4962 -0.0041 0.0232  0.0342  116 ILE A C   
902  O O   . ILE A 116 ? 0.4575 0.4286 0.4693 -0.0059 0.0251  0.0350  116 ILE A O   
903  C CB  . ILE A 116 ? 0.4590 0.4210 0.4590 -0.0022 0.0228  0.0372  116 ILE A CB  
904  C CG1 . ILE A 116 ? 0.4359 0.3928 0.4270 -0.0015 0.0230  0.0385  116 ILE A CG1 
905  C CG2 . ILE A 116 ? 0.4067 0.3708 0.4126 0.0008  0.0194  0.0367  116 ILE A CG2 
906  C CD1 . ILE A 116 ? 0.4454 0.3961 0.4328 0.0013  0.0222  0.0404  116 ILE A CD1 
907  N N   . TRP A 117 ? 0.4589 0.4338 0.4726 -0.0025 0.0209  0.0325  117 TRP A N   
908  C CA  . TRP A 117 ? 0.4210 0.3986 0.4411 -0.0028 0.0206  0.0314  117 TRP A CA  
909  C C   . TRP A 117 ? 0.4978 0.4744 0.5228 -0.0019 0.0183  0.0319  117 TRP A C   
910  O O   . TRP A 117 ? 0.4803 0.4562 0.5049 -0.0004 0.0155  0.0318  117 TRP A O   
911  C CB  . TRP A 117 ? 0.4014 0.3817 0.4214 -0.0016 0.0196  0.0293  117 TRP A CB  
912  C CG  . TRP A 117 ? 0.4577 0.4391 0.4828 -0.0014 0.0188  0.0283  117 TRP A CG  
913  C CD1 . TRP A 117 ? 0.3930 0.3727 0.4202 -0.0005 0.0159  0.0272  117 TRP A CD1 
914  C CD2 . TRP A 117 ? 0.4396 0.4238 0.4678 -0.0025 0.0211  0.0282  117 TRP A CD2 
915  N NE1 . TRP A 117 ? 0.4431 0.4234 0.4740 -0.0009 0.0162  0.0267  117 TRP A NE1 
916  C CE2 . TRP A 117 ? 0.4822 0.4655 0.5139 -0.0018 0.0194  0.0273  117 TRP A CE2 
917  C CE3 . TRP A 117 ? 0.3874 0.3747 0.4152 -0.0043 0.0243  0.0289  117 TRP A CE3 
918  C CZ2 . TRP A 117 ? 0.4803 0.4657 0.5152 -0.0021 0.0209  0.0271  117 TRP A CZ2 
919  C CZ3 . TRP A 117 ? 0.4344 0.4247 0.4658 -0.0048 0.0257  0.0286  117 TRP A CZ3 
920  C CH2 . TRP A 117 ? 0.4195 0.4088 0.4545 -0.0034 0.0240  0.0277  117 TRP A CH2 
921  N N   . ILE A 118 ? 0.4581 0.4356 0.4878 -0.0030 0.0194  0.0324  118 ILE A N   
922  C CA  . ILE A 118 ? 0.4030 0.3813 0.4381 -0.0024 0.0175  0.0329  118 ILE A CA  
923  C C   . ILE A 118 ? 0.4389 0.4194 0.4789 -0.0034 0.0173  0.0317  118 ILE A C   
924  O O   . ILE A 118 ? 0.4417 0.4232 0.4836 -0.0045 0.0196  0.0319  118 ILE A O   
925  C CB  . ILE A 118 ? 0.3961 0.3730 0.4320 -0.0023 0.0192  0.0348  118 ILE A CB  
926  C CG1 . ILE A 118 ? 0.4331 0.4057 0.4620 -0.0013 0.0200  0.0362  118 ILE A CG1 
927  C CG2 . ILE A 118 ? 0.3646 0.3441 0.4060 -0.0013 0.0172  0.0355  118 ILE A CG2 
928  C CD1 . ILE A 118 ? 0.4273 0.3965 0.4548 -0.0003 0.0214  0.0381  118 ILE A CD1 
929  N N   . TYR A 119 ? 0.3346 0.3154 0.3759 -0.0032 0.0144  0.0305  119 TYR A N   
930  C CA  . TYR A 119 ? 0.3930 0.3740 0.4371 -0.0041 0.0140  0.0293  119 TYR A CA  
931  C C   . TYR A 119 ? 0.4021 0.3848 0.4521 -0.0053 0.0147  0.0304  119 TYR A C   
932  O O   . TYR A 119 ? 0.3575 0.3418 0.4099 -0.0052 0.0146  0.0320  119 TYR A O   
933  C CB  . TYR A 119 ? 0.3909 0.3697 0.4333 -0.0041 0.0106  0.0278  119 TYR A CB  
934  C CG  . TYR A 119 ? 0.4576 0.4379 0.5023 -0.0051 0.0077  0.0284  119 TYR A CG  
935  C CD1 . TYR A 119 ? 0.3879 0.3708 0.4382 -0.0069 0.0069  0.0293  119 TYR A CD1 
936  C CD2 . TYR A 119 ? 0.4320 0.4119 0.4731 -0.0041 0.0056  0.0280  119 TYR A CD2 
937  C CE1 . TYR A 119 ? 0.4664 0.4527 0.5191 -0.0078 0.0041  0.0298  119 TYR A CE1 
938  C CE2 . TYR A 119 ? 0.4711 0.4539 0.5144 -0.0049 0.0027  0.0285  119 TYR A CE2 
939  C CZ  . TYR A 119 ? 0.5412 0.5276 0.5903 -0.0068 0.0020  0.0295  119 TYR A CZ  
940  O OH  . TYR A 119 ? 0.3945 0.3858 0.4460 -0.0076 -0.0009 0.0300  119 TYR A OH  
941  N N   . GLY A 120 ? 0.3898 0.3722 0.4415 -0.0060 0.0154  0.0297  120 GLY A N   
942  C CA  . GLY A 120 ? 0.4286 0.4127 0.4857 -0.0072 0.0160  0.0307  120 GLY A CA  
943  C C   . GLY A 120 ? 0.4419 0.4249 0.5007 -0.0088 0.0133  0.0301  120 GLY A C   
944  O O   . GLY A 120 ? 0.5133 0.4944 0.5693 -0.0091 0.0107  0.0291  120 GLY A O   
945  N N   . GLY A 121 ? 0.5422 0.5263 0.6052 -0.0101 0.0140  0.0308  121 GLY A N   
946  C CA  . GLY A 121 ? 0.4176 0.4006 0.4820 -0.0126 0.0117  0.0306  121 GLY A CA  
947  C C   . GLY A 121 ? 0.4202 0.4083 0.4909 -0.0143 0.0118  0.0324  121 GLY A C   
948  O O   . GLY A 121 ? 0.4313 0.4214 0.5040 -0.0168 0.0094  0.0327  121 GLY A O   
949  N N   . GLY A 122 ? 0.3751 0.3658 0.4487 -0.0130 0.0145  0.0336  122 GLY A N   
950  C CA  . GLY A 122 ? 0.4137 0.4094 0.4928 -0.0138 0.0152  0.0353  122 GLY A CA  
951  C C   . GLY A 122 ? 0.4691 0.4704 0.5510 -0.0137 0.0134  0.0365  122 GLY A C   
952  O O   . GLY A 122 ? 0.3914 0.3981 0.4781 -0.0148 0.0131  0.0378  122 GLY A O   
953  N N   . PHE A 123 ? 0.4143 0.4150 0.4930 -0.0121 0.0122  0.0361  123 PHE A N   
954  C CA  . PHE A 123 ? 0.3484 0.3550 0.4289 -0.0112 0.0103  0.0371  123 PHE A CA  
955  C C   . PHE A 123 ? 0.3063 0.3173 0.3894 -0.0147 0.0071  0.0370  123 PHE A C   
956  O O   . PHE A 123 ? 0.4315 0.4497 0.5171 -0.0143 0.0053  0.0379  123 PHE A O   
957  C CB  . PHE A 123 ? 0.2969 0.3080 0.3804 -0.0085 0.0122  0.0391  123 PHE A CB  
958  C CG  . PHE A 123 ? 0.3445 0.3506 0.4238 -0.0054 0.0150  0.0394  123 PHE A CG  
959  C CD1 . PHE A 123 ? 0.3448 0.3483 0.4192 -0.0030 0.0147  0.0394  123 PHE A CD1 
960  C CD2 . PHE A 123 ? 0.3789 0.3826 0.4587 -0.0054 0.0179  0.0397  123 PHE A CD2 
961  C CE1 . PHE A 123 ? 0.3588 0.3567 0.4283 -0.0010 0.0173  0.0398  123 PHE A CE1 
962  C CE2 . PHE A 123 ? 0.3321 0.3310 0.4074 -0.0035 0.0204  0.0399  123 PHE A CE2 
963  C CZ  . PHE A 123 ? 0.4091 0.4047 0.4790 -0.0016 0.0201  0.0399  123 PHE A CZ  
964  N N   . TYR A 124 ? 0.2773 0.2840 0.3593 -0.0182 0.0062  0.0358  124 TYR A N   
965  C CA  . TYR A 124 ? 0.4151 0.4242 0.4981 -0.0227 0.0031  0.0354  124 TYR A CA  
966  C C   . TYR A 124 ? 0.4261 0.4275 0.5025 -0.0243 0.0008  0.0332  124 TYR A C   
967  O O   . TYR A 124 ? 0.4365 0.4379 0.5118 -0.0285 -0.0022 0.0325  124 TYR A O   
968  C CB  . TYR A 124 ? 0.3882 0.3977 0.4743 -0.0263 0.0038  0.0361  124 TYR A CB  
969  C CG  . TYR A 124 ? 0.4368 0.4360 0.5181 -0.0272 0.0047  0.0347  124 TYR A CG  
970  C CD1 . TYR A 124 ? 0.4171 0.4096 0.4934 -0.0309 0.0023  0.0332  124 TYR A CD1 
971  C CD2 . TYR A 124 ? 0.4252 0.4215 0.5065 -0.0242 0.0079  0.0349  124 TYR A CD2 
972  C CE1 . TYR A 124 ? 0.4411 0.4236 0.5119 -0.0306 0.0032  0.0320  124 TYR A CE1 
973  C CE2 . TYR A 124 ? 0.4477 0.4357 0.5244 -0.0243 0.0088  0.0337  124 TYR A CE2 
974  C CZ  . TYR A 124 ? 0.5116 0.4926 0.5830 -0.0270 0.0064  0.0323  124 TYR A CZ  
975  O OH  . TYR A 124 ? 0.6128 0.5850 0.6786 -0.0261 0.0072  0.0312  124 TYR A OH  
976  N N   . SER A 125 ? 0.3345 0.3294 0.4061 -0.0210 0.0022  0.0320  125 SER A N   
977  C CA  . SER A 125 ? 0.3551 0.3421 0.4197 -0.0215 0.0005  0.0299  125 SER A CA  
978  C C   . SER A 125 ? 0.3744 0.3585 0.4348 -0.0172 0.0019  0.0291  125 SER A C   
979  O O   . SER A 125 ? 0.3226 0.3094 0.3851 -0.0145 0.0045  0.0302  125 SER A O   
980  C CB  . SER A 125 ? 0.3629 0.3424 0.4245 -0.0233 0.0009  0.0289  125 SER A CB  
981  O OG  . SER A 125 ? 0.3544 0.3328 0.4169 -0.0204 0.0044  0.0293  125 SER A OG  
982  N N   . GLY A 126 ? 0.3375 0.3157 0.3914 -0.0168 0.0003  0.0271  126 GLY A N   
983  C CA  . GLY A 126 ? 0.4429 0.4187 0.4924 -0.0131 0.0017  0.0263  126 GLY A CA  
984  C C   . GLY A 126 ? 0.4443 0.4194 0.4895 -0.0126 -0.0009 0.0253  126 GLY A C   
985  O O   . GLY A 126 ? 0.4327 0.4111 0.4797 -0.0148 -0.0036 0.0256  126 GLY A O   
986  N N   . ALA A 127 ? 0.4203 0.3919 0.4599 -0.0097 0.0000  0.0242  127 ALA A N   
987  C CA  . ALA A 127 ? 0.4622 0.4331 0.4973 -0.0086 -0.0021 0.0233  127 ALA A CA  
988  C C   . ALA A 127 ? 0.5047 0.4744 0.5354 -0.0051 0.0002  0.0229  127 ALA A C   
989  O O   . ALA A 127 ? 0.5014 0.4693 0.5306 -0.0036 0.0026  0.0224  127 ALA A O   
990  C CB  . ALA A 127 ? 0.4408 0.4057 0.4705 -0.0106 -0.0055 0.0211  127 ALA A CB  
991  N N   . ALA A 128 ? 0.4763 0.4476 0.5047 -0.0036 -0.0004 0.0232  128 ALA A N   
992  C CA  . ALA A 128 ? 0.4478 0.4186 0.4717 -0.0008 0.0019  0.0230  128 ALA A CA  
993  C C   . ALA A 128 ? 0.4203 0.3864 0.4370 0.0008  0.0005  0.0206  128 ALA A C   
994  O O   . ALA A 128 ? 0.4623 0.4286 0.4748 0.0032  0.0023  0.0202  128 ALA A O   
995  C CB  . ALA A 128 ? 0.3549 0.3285 0.3783 0.0002  0.0020  0.0246  128 ALA A CB  
996  N N   . SER A 129 ? 0.4063 0.3681 0.4211 -0.0008 -0.0025 0.0191  129 SER A N   
997  C CA  . SER A 129 ? 0.4404 0.3961 0.4470 0.0009  -0.0043 0.0166  129 SER A CA  
998  C C   . SER A 129 ? 0.4922 0.4428 0.4951 0.0026  -0.0030 0.0152  129 SER A C   
999  O O   . SER A 129 ? 0.5398 0.4844 0.5348 0.0049  -0.0041 0.0131  129 SER A O   
1000 C CB  . SER A 129 ? 0.4093 0.3619 0.4140 -0.0020 -0.0087 0.0155  129 SER A CB  
1001 O OG  . SER A 129 ? 0.4651 0.4161 0.4732 -0.0058 -0.0099 0.0157  129 SER A OG  
1002 N N   . LEU A 130 ? 0.4354 0.3883 0.4435 0.0020  -0.0007 0.0164  130 LEU A N   
1003 C CA  . LEU A 130 ? 0.4372 0.3858 0.4422 0.0040  0.0006  0.0153  130 LEU A CA  
1004 C C   . LEU A 130 ? 0.4357 0.3860 0.4356 0.0089  0.0030  0.0145  130 LEU A C   
1005 O O   . LEU A 130 ? 0.4100 0.3668 0.4115 0.0098  0.0049  0.0154  130 LEU A O   
1006 C CB  . LEU A 130 ? 0.4961 0.4479 0.5082 0.0022  0.0026  0.0170  130 LEU A CB  
1007 C CG  . LEU A 130 ? 0.4839 0.4355 0.5014 -0.0026 0.0006  0.0180  130 LEU A CG  
1008 C CD1 . LEU A 130 ? 0.3994 0.3548 0.4238 -0.0037 0.0030  0.0197  130 LEU A CD1 
1009 C CD2 . LEU A 130 ? 0.5369 0.4795 0.5486 -0.0046 -0.0026 0.0163  130 LEU A CD2 
1010 N N   . ASP A 131 ? 0.4288 0.3732 0.4221 0.0122  0.0030  0.0127  131 ASP A N   
1011 C CA  . ASP A 131 ? 0.4853 0.4321 0.4730 0.0177  0.0050  0.0117  131 ASP A CA  
1012 C C   . ASP A 131 ? 0.5280 0.4854 0.5214 0.0185  0.0090  0.0133  131 ASP A C   
1013 O O   . ASP A 131 ? 0.6316 0.5952 0.6229 0.0211  0.0109  0.0132  131 ASP A O   
1014 C CB  . ASP A 131 ? 0.5043 0.4420 0.4833 0.0217  0.0042  0.0096  131 ASP A CB  
1015 C CG  . ASP A 131 ? 0.6380 0.5646 0.6081 0.0217  0.0006  0.0075  131 ASP A CG  
1016 O OD1 . ASP A 131 ? 0.6817 0.6086 0.6537 0.0180  -0.0016 0.0077  131 ASP A OD1 
1017 O OD2 . ASP A 131 ? 0.7066 0.6239 0.6672 0.0256  -0.0002 0.0056  131 ASP A OD2 
1018 N N   . VAL A 132 ? 0.4579 0.4178 0.4581 0.0159  0.0102  0.0148  132 VAL A N   
1019 C CA  . VAL A 132 ? 0.4496 0.4190 0.4548 0.0160  0.0138  0.0162  132 VAL A CA  
1020 C C   . VAL A 132 ? 0.4200 0.3956 0.4297 0.0128  0.0150  0.0179  132 VAL A C   
1021 O O   . VAL A 132 ? 0.4591 0.4421 0.4717 0.0120  0.0179  0.0191  132 VAL A O   
1022 C CB  . VAL A 132 ? 0.4682 0.4378 0.4786 0.0145  0.0148  0.0171  132 VAL A CB  
1023 C CG1 . VAL A 132 ? 0.5240 0.4881 0.5287 0.0187  0.0145  0.0155  132 VAL A CG1 
1024 C CG2 . VAL A 132 ? 0.4052 0.3708 0.4207 0.0099  0.0129  0.0181  132 VAL A CG2 
1025 N N   . TYR A 133 ? 0.4706 0.4427 0.4799 0.0109  0.0127  0.0181  133 TYR A N   
1026 C CA  . TYR A 133 ? 0.4631 0.4391 0.4747 0.0086  0.0136  0.0198  133 TYR A CA  
1027 C C   . TYR A 133 ? 0.4539 0.4300 0.4594 0.0106  0.0130  0.0190  133 TYR A C   
1028 O O   . TYR A 133 ? 0.4748 0.4514 0.4802 0.0091  0.0126  0.0201  133 TYR A O   
1029 C CB  . TYR A 133 ? 0.4225 0.3961 0.4388 0.0054  0.0116  0.0210  133 TYR A CB  
1030 C CG  . TYR A 133 ? 0.5054 0.4789 0.5276 0.0035  0.0120  0.0218  133 TYR A CG  
1031 C CD1 . TYR A 133 ? 0.4856 0.4627 0.5102 0.0037  0.0149  0.0223  133 TYR A CD1 
1032 C CD2 . TYR A 133 ? 0.5054 0.4761 0.5308 0.0013  0.0094  0.0221  133 TYR A CD2 
1033 C CE1 . TYR A 133 ? 0.4337 0.4106 0.4635 0.0020  0.0152  0.0230  133 TYR A CE1 
1034 C CE2 . TYR A 133 ? 0.4707 0.4417 0.5013 -0.0005 0.0099  0.0229  133 TYR A CE2 
1035 C CZ  . TYR A 133 ? 0.4720 0.4458 0.5047 0.0000  0.0128  0.0234  133 TYR A CZ  
1036 O OH  . TYR A 133 ? 0.3929 0.3670 0.4306 -0.0017 0.0133  0.0242  133 TYR A OH  
1037 N N   . ASP A 134 ? 0.4793 0.4548 0.4790 0.0144  0.0130  0.0172  134 ASP A N   
1038 C CA  . ASP A 134 ? 0.5096 0.4852 0.5027 0.0169  0.0125  0.0162  134 ASP A CA  
1039 C C   . ASP A 134 ? 0.5423 0.5261 0.5357 0.0160  0.0157  0.0177  134 ASP A C   
1040 O O   . ASP A 134 ? 0.4858 0.4764 0.4799 0.0167  0.0186  0.0180  134 ASP A O   
1041 C CB  . ASP A 134 ? 0.4928 0.4658 0.4790 0.0219  0.0120  0.0138  134 ASP A CB  
1042 C CG  . ASP A 134 ? 0.6268 0.5977 0.6053 0.0248  0.0106  0.0125  134 ASP A CG  
1043 O OD1 . ASP A 134 ? 0.5859 0.5597 0.5646 0.0231  0.0109  0.0136  134 ASP A OD1 
1044 O OD2 . ASP A 134 ? 0.6702 0.6358 0.6417 0.0290  0.0093  0.0103  134 ASP A OD2 
1045 N N   . GLY A 135 ? 0.5255 0.5086 0.5177 0.0144  0.0151  0.0188  135 GLY A N   
1046 C CA  . GLY A 135 ? 0.5086 0.4975 0.5002 0.0125  0.0180  0.0205  135 GLY A CA  
1047 C C   . GLY A 135 ? 0.4706 0.4641 0.4559 0.0151  0.0193  0.0198  135 GLY A C   
1048 O O   . GLY A 135 ? 0.3931 0.3916 0.3770 0.0130  0.0218  0.0213  135 GLY A O   
1049 N N   . ARG A 136 ? 0.4892 0.4809 0.4700 0.0196  0.0178  0.0175  136 ARG A N   
1050 C CA  . ARG A 136 ? 0.5240 0.5198 0.4981 0.0230  0.0187  0.0167  136 ARG A CA  
1051 C C   . ARG A 136 ? 0.5956 0.6029 0.5697 0.0234  0.0226  0.0173  136 ARG A C   
1052 O O   . ARG A 136 ? 0.6130 0.6263 0.5831 0.0237  0.0244  0.0178  136 ARG A O   
1053 C CB  . ARG A 136 ? 0.4643 0.4539 0.4323 0.0282  0.0159  0.0139  136 ARG A CB  
1054 C CG  . ARG A 136 ? 0.5266 0.5175 0.4934 0.0324  0.0167  0.0123  136 ARG A CG  
1055 C CD  . ARG A 136 ? 0.4748 0.4572 0.4333 0.0377  0.0139  0.0095  136 ARG A CD  
1056 N NE  . ARG A 136 ? 0.5808 0.5517 0.5394 0.0353  0.0100  0.0088  136 ARG A NE  
1057 C CZ  . ARG A 136 ? 0.6618 0.6236 0.6129 0.0375  0.0068  0.0067  136 ARG A CZ  
1058 N NH1 . ARG A 136 ? 0.6294 0.5914 0.5720 0.0430  0.0071  0.0050  136 ARG A NH1 
1059 N NH2 . ARG A 136 ? 0.6527 0.6057 0.6046 0.0341  0.0033  0.0062  136 ARG A NH2 
1060 N N   . PHE A 137 ? 0.5774 0.5886 0.5560 0.0232  0.0240  0.0173  137 PHE A N   
1061 C CA  . PHE A 137 ? 0.4748 0.4984 0.4538 0.0237  0.0276  0.0177  137 PHE A CA  
1062 C C   . PHE A 137 ? 0.4057 0.4355 0.3873 0.0173  0.0304  0.0202  137 PHE A C   
1063 O O   . PHE A 137 ? 0.4468 0.4862 0.4257 0.0165  0.0329  0.0209  137 PHE A O   
1064 C CB  . PHE A 137 ? 0.4265 0.4521 0.4087 0.0261  0.0280  0.0169  137 PHE A CB  
1065 C CG  . PHE A 137 ? 0.5303 0.5471 0.5085 0.0319  0.0252  0.0145  137 PHE A CG  
1066 C CD1 . PHE A 137 ? 0.5355 0.5544 0.5064 0.0386  0.0251  0.0127  137 PHE A CD1 
1067 C CD2 . PHE A 137 ? 0.4826 0.4887 0.4635 0.0306  0.0226  0.0142  137 PHE A CD2 
1068 C CE1 . PHE A 137 ? 0.5270 0.5356 0.4925 0.0439  0.0225  0.0105  137 PHE A CE1 
1069 C CE2 . PHE A 137 ? 0.4363 0.4330 0.4123 0.0351  0.0200  0.0121  137 PHE A CE2 
1070 C CZ  . PHE A 137 ? 0.4969 0.4939 0.4647 0.0417  0.0199  0.0102  137 PHE A CZ  
1071 N N   . LEU A 138 ? 0.4057 0.4299 0.3920 0.0126  0.0300  0.0216  138 LEU A N   
1072 C CA  . LEU A 138 ? 0.4559 0.4823 0.4430 0.0063  0.0323  0.0240  138 LEU A CA  
1073 C C   . LEU A 138 ? 0.5000 0.5249 0.4813 0.0052  0.0325  0.0250  138 LEU A C   
1074 O O   . LEU A 138 ? 0.5202 0.5511 0.4990 0.0012  0.0353  0.0265  138 LEU A O   
1075 C CB  . LEU A 138 ? 0.4522 0.4705 0.4441 0.0029  0.0313  0.0251  138 LEU A CB  
1076 C CG  . LEU A 138 ? 0.5157 0.5375 0.5132 0.0017  0.0324  0.0250  138 LEU A CG  
1077 C CD1 . LEU A 138 ? 0.4449 0.4578 0.4470 0.0007  0.0305  0.0254  138 LEU A CD1 
1078 C CD2 . LEU A 138 ? 0.5279 0.5575 0.5255 -0.0035 0.0359  0.0266  138 LEU A CD2 
1079 N N   . ALA A 139 ? 0.4563 0.4732 0.4349 0.0082  0.0295  0.0241  139 ALA A N   
1080 C CA  . ALA A 139 ? 0.5466 0.5614 0.5193 0.0078  0.0293  0.0250  139 ALA A CA  
1081 C C   . ALA A 139 ? 0.6321 0.6563 0.5997 0.0101  0.0312  0.0243  139 ALA A C   
1082 O O   . ALA A 139 ? 0.6913 0.7184 0.6546 0.0073  0.0332  0.0259  139 ALA A O   
1083 C CB  . ALA A 139 ? 0.4398 0.4447 0.4110 0.0107  0.0254  0.0240  139 ALA A CB  
1084 N N   . GLN A 140 ? 0.6280 0.6567 0.5956 0.0153  0.0308  0.0221  140 GLN A N   
1085 C CA  . GLN A 140 ? 0.6830 0.7216 0.6457 0.0188  0.0325  0.0213  140 GLN A CA  
1086 C C   . GLN A 140 ? 0.6755 0.7281 0.6398 0.0154  0.0366  0.0227  140 GLN A C   
1087 O O   . GLN A 140 ? 0.7044 0.7646 0.6650 0.0129  0.0389  0.0239  140 GLN A O   
1088 C CB  . GLN A 140 ? 0.6855 0.7229 0.6462 0.0265  0.0306  0.0185  140 GLN A CB  
1089 C CG  . GLN A 140 ? 0.6518 0.6943 0.6050 0.0319  0.0310  0.0172  140 GLN A CG  
1090 C CD  . GLN A 140 ? 0.7009 0.7603 0.6536 0.0324  0.0349  0.0178  140 GLN A CD  
1091 O OE1 . GLN A 140 ? 0.6504 0.7175 0.6072 0.0325  0.0365  0.0178  140 GLN A OE1 
1092 N NE2 . GLN A 140 ? 0.5900 0.6560 0.5376 0.0326  0.0365  0.0185  140 GLN A NE2 
1093 N N   . VAL A 141 ? 0.6737 0.7303 0.6435 0.0149  0.0373  0.0224  141 VAL A N   
1094 C CA  . VAL A 141 ? 0.6057 0.6773 0.5774 0.0122  0.0408  0.0232  141 VAL A CA  
1095 C C   . VAL A 141 ? 0.5753 0.6481 0.5479 0.0030  0.0432  0.0259  141 VAL A C   
1096 O O   . VAL A 141 ? 0.5365 0.6211 0.5070 -0.0008 0.0462  0.0270  141 VAL A O   
1097 C CB  . VAL A 141 ? 0.5213 0.5969 0.4980 0.0153  0.0407  0.0220  141 VAL A CB  
1098 C CG1 . VAL A 141 ? 0.5944 0.6876 0.5729 0.0130  0.0442  0.0227  141 VAL A CG1 
1099 C CG2 . VAL A 141 ? 0.4263 0.4985 0.4000 0.0244  0.0385  0.0194  141 VAL A CG2 
1100 N N   . GLU A 142 ? 0.4491 0.5098 0.4242 -0.0007 0.0418  0.0268  142 GLU A N   
1101 C CA  . GLU A 142 ? 0.4609 0.5198 0.4354 -0.0090 0.0438  0.0292  142 GLU A CA  
1102 C C   . GLU A 142 ? 0.5105 0.5593 0.4792 -0.0115 0.0433  0.0308  142 GLU A C   
1103 O O   . GLU A 142 ? 0.5474 0.5931 0.5132 -0.0182 0.0451  0.0329  142 GLU A O   
1104 C CB  . GLU A 142 ? 0.4853 0.5378 0.4654 -0.0114 0.0432  0.0295  142 GLU A CB  
1105 C CG  . GLU A 142 ? 0.5638 0.6268 0.5492 -0.0105 0.0443  0.0284  142 GLU A CG  
1106 C CD  . GLU A 142 ? 0.7162 0.7946 0.7003 -0.0152 0.0478  0.0293  142 GLU A CD  
1107 O OE1 . GLU A 142 ? 0.7232 0.8011 0.7030 -0.0220 0.0497  0.0311  142 GLU A OE1 
1108 O OE2 . GLU A 142 ? 0.7834 0.8745 0.7704 -0.0121 0.0487  0.0281  142 GLU A OE2 
1109 N N   . GLY A 143 ? 0.5355 0.5731 0.5538 -0.0087 0.0649  0.0359  143 GLY A N   
1110 C CA  . GLY A 143 ? 0.5366 0.5623 0.5372 -0.0119 0.0661  0.0381  143 GLY A CA  
1111 C C   . GLY A 143 ? 0.5729 0.5807 0.5639 -0.0122 0.0603  0.0424  143 GLY A C   
1112 O O   . GLY A 143 ? 0.6229 0.6201 0.5994 -0.0174 0.0604  0.0458  143 GLY A O   
1113 N N   . ALA A 144 ? 0.5929 0.5972 0.5916 -0.0067 0.0550  0.0421  144 ALA A N   
1114 C CA  . ALA A 144 ? 0.5890 0.5783 0.5807 -0.0064 0.0495  0.0456  144 ALA A CA  
1115 C C   . ALA A 144 ? 0.5066 0.4852 0.4900 -0.0012 0.0466  0.0446  144 ALA A C   
1116 O O   . ALA A 144 ? 0.4277 0.4105 0.4142 0.0039  0.0472  0.0410  144 ALA A O   
1117 C CB  . ALA A 144 ? 0.5000 0.4910 0.5034 -0.0041 0.0455  0.0458  144 ALA A CB  
1118 N N   . VAL A 145 ? 0.3998 0.3644 0.3725 -0.0023 0.0430  0.0478  145 VAL A N   
1119 C CA  . VAL A 145 ? 0.4331 0.3876 0.4002 0.0031  0.0388  0.0471  145 VAL A CA  
1120 C C   . VAL A 145 ? 0.5746 0.5276 0.5505 0.0072  0.0340  0.0470  145 VAL A C   
1121 O O   . VAL A 145 ? 0.5133 0.4623 0.4896 0.0047  0.0322  0.0496  145 VAL A O   
1122 C CB  . VAL A 145 ? 0.4913 0.4313 0.4418 0.0002  0.0370  0.0501  145 VAL A CB  
1123 C CG1 . VAL A 145 ? 0.4086 0.3395 0.3551 0.0062  0.0321  0.0492  145 VAL A CG1 
1124 C CG2 . VAL A 145 ? 0.4410 0.3817 0.3811 -0.0049 0.0418  0.0504  145 VAL A CG2 
1125 N N   . LEU A 146 ? 0.5953 0.5512 0.5778 0.0131  0.0321  0.0440  146 LEU A N   
1126 C CA  . LEU A 146 ? 0.5075 0.4628 0.4983 0.0163  0.0279  0.0436  146 LEU A CA  
1127 C C   . LEU A 146 ? 0.5319 0.4792 0.5185 0.0208  0.0237  0.0430  146 LEU A C   
1128 O O   . LEU A 146 ? 0.5518 0.4984 0.5348 0.0237  0.0236  0.0411  146 LEU A O   
1129 C CB  . LEU A 146 ? 0.4967 0.4629 0.5004 0.0187  0.0284  0.0407  146 LEU A CB  
1130 C CG  . LEU A 146 ? 0.5256 0.4921 0.5380 0.0196  0.0247  0.0409  146 LEU A CG  
1131 C CD1 . LEU A 146 ? 0.6049 0.5815 0.6284 0.0186  0.0260  0.0396  146 LEU A CD1 
1132 C CD2 . LEU A 146 ? 0.4788 0.4422 0.4927 0.0245  0.0207  0.0389  146 LEU A CD2 
1133 N N   . VAL A 147 ? 0.4899 0.4316 0.4770 0.0212  0.0201  0.0444  147 VAL A N   
1134 C CA  . VAL A 147 ? 0.4893 0.4249 0.4739 0.0253  0.0160  0.0438  147 VAL A CA  
1135 C C   . VAL A 147 ? 0.4973 0.4359 0.4914 0.0271  0.0132  0.0427  147 VAL A C   
1136 O O   . VAL A 147 ? 0.4777 0.4171 0.4759 0.0248  0.0132  0.0440  147 VAL A O   
1137 C CB  . VAL A 147 ? 0.5599 0.4848 0.5344 0.0244  0.0139  0.0462  147 VAL A CB  
1138 C CG1 . VAL A 147 ? 0.5113 0.4313 0.4843 0.0290  0.0095  0.0450  147 VAL A CG1 
1139 C CG2 . VAL A 147 ? 0.5624 0.4827 0.5256 0.0213  0.0164  0.0476  147 VAL A CG2 
1140 N N   . SER A 148 ? 0.5338 0.4738 0.5310 0.0309  0.0107  0.0405  148 SER A N   
1141 C CA  . SER A 148 ? 0.5083 0.4502 0.5129 0.0321  0.0077  0.0396  148 SER A CA  
1142 C C   . SER A 148 ? 0.5353 0.4732 0.5371 0.0352  0.0042  0.0388  148 SER A C   
1143 O O   . SER A 148 ? 0.4956 0.4317 0.4929 0.0374  0.0034  0.0379  148 SER A O   
1144 C CB  . SER A 148 ? 0.5449 0.4935 0.5572 0.0328  0.0076  0.0375  148 SER A CB  
1145 O OG  . SER A 148 ? 0.6292 0.5785 0.6393 0.0358  0.0072  0.0355  148 SER A OG  
1146 N N   . MET A 149 ? 0.4888 0.4256 0.4933 0.0353  0.0020  0.0390  149 MET A N   
1147 C CA  . MET A 149 ? 0.4292 0.3640 0.4326 0.0382  -0.0014 0.0380  149 MET A CA  
1148 C C   . MET A 149 ? 0.5514 0.4909 0.5623 0.0383  -0.0036 0.0364  149 MET A C   
1149 O O   . MET A 149 ? 0.4958 0.4381 0.5118 0.0358  -0.0028 0.0364  149 MET A O   
1150 C CB  . MET A 149 ? 0.4048 0.3337 0.4034 0.0388  -0.0023 0.0391  149 MET A CB  
1151 C CG  . MET A 149 ? 0.3950 0.3252 0.3986 0.0381  -0.0030 0.0389  149 MET A CG  
1152 S SD  . MET A 149 ? 0.5033 0.4347 0.5098 0.0336  0.0000  0.0405  149 MET A SD  
1153 C CE  . MET A 149 ? 0.3293 0.2522 0.3260 0.0325  0.0013  0.0431  149 MET A CE  
1154 N N   . ASN A 150 ? 0.4557 0.3957 0.4666 0.0406  -0.0065 0.0350  150 ASN A N   
1155 C CA  . ASN A 150 ? 0.4820 0.4261 0.4987 0.0401  -0.0089 0.0336  150 ASN A CA  
1156 C C   . ASN A 150 ? 0.5140 0.4579 0.5319 0.0407  -0.0095 0.0334  150 ASN A C   
1157 O O   . ASN A 150 ? 0.4876 0.4277 0.5011 0.0431  -0.0102 0.0338  150 ASN A O   
1158 C CB  . ASN A 150 ? 0.3796 0.3248 0.3957 0.0420  -0.0120 0.0322  150 ASN A CB  
1159 C CG  . ASN A 150 ? 0.4117 0.3578 0.4283 0.0414  -0.0121 0.0315  150 ASN A CG  
1160 O OD1 . ASN A 150 ? 0.3552 0.3021 0.3735 0.0399  -0.0099 0.0319  150 ASN A OD1 
1161 N ND2 . ASN A 150 ? 0.4407 0.3866 0.4558 0.0427  -0.0151 0.0304  150 ASN A ND2 
1162 N N   . TYR A 151 ? 0.4846 0.4323 0.5079 0.0384  -0.0095 0.0327  151 TYR A N   
1163 C CA  . TYR A 151 ? 0.4385 0.3874 0.4637 0.0392  -0.0099 0.0318  151 TYR A CA  
1164 C C   . TYR A 151 ? 0.4739 0.4294 0.5050 0.0373  -0.0114 0.0299  151 TYR A C   
1165 O O   . TYR A 151 ? 0.4925 0.4497 0.5255 0.0341  -0.0115 0.0299  151 TYR A O   
1166 C CB  . TYR A 151 ? 0.3868 0.3325 0.4108 0.0377  -0.0075 0.0329  151 TYR A CB  
1167 C CG  . TYR A 151 ? 0.4779 0.4249 0.5049 0.0334  -0.0058 0.0336  151 TYR A CG  
1168 C CD1 . TYR A 151 ? 0.4624 0.4075 0.4879 0.0317  -0.0043 0.0353  151 TYR A CD1 
1169 C CD2 . TYR A 151 ? 0.4361 0.3862 0.4671 0.0308  -0.0056 0.0325  151 TYR A CD2 
1170 C CE1 . TYR A 151 ? 0.5142 0.4603 0.5428 0.0280  -0.0035 0.0359  151 TYR A CE1 
1171 C CE2 . TYR A 151 ? 0.4433 0.3933 0.4761 0.0266  -0.0047 0.0333  151 TYR A CE2 
1172 C CZ  . TYR A 151 ? 0.5051 0.4530 0.5369 0.0254  -0.0040 0.0350  151 TYR A CZ  
1173 O OH  . TYR A 151 ? 0.5457 0.4934 0.5798 0.0215  -0.0037 0.0357  151 TYR A OH  
1174 N N   . ARG A 152 ? 0.4150 0.3740 0.4485 0.0392  -0.0127 0.0281  152 ARG A N   
1175 C CA  . ARG A 152 ? 0.4710 0.4374 0.5099 0.0368  -0.0138 0.0262  152 ARG A CA  
1176 C C   . ARG A 152 ? 0.5106 0.4786 0.5519 0.0321  -0.0117 0.0260  152 ARG A C   
1177 O O   . ARG A 152 ? 0.4250 0.3906 0.4656 0.0321  -0.0094 0.0263  152 ARG A O   
1178 C CB  . ARG A 152 ? 0.4323 0.4036 0.4744 0.0400  -0.0153 0.0240  152 ARG A CB  
1179 C CG  . ARG A 152 ? 0.4233 0.3952 0.4644 0.0432  -0.0187 0.0237  152 ARG A CG  
1180 C CD  . ARG A 152 ? 0.3991 0.3753 0.4437 0.0473  -0.0204 0.0214  152 ARG A CD  
1181 N NE  . ARG A 152 ? 0.4075 0.3771 0.4482 0.0514  -0.0199 0.0219  152 ARG A NE  
1182 C CZ  . ARG A 152 ? 0.3976 0.3689 0.4404 0.0558  -0.0213 0.0198  152 ARG A CZ  
1183 N NH1 . ARG A 152 ? 0.3424 0.3238 0.3927 0.0567  -0.0229 0.0169  152 ARG A NH1 
1184 N NH2 . ARG A 152 ? 0.3640 0.3271 0.4015 0.0593  -0.0214 0.0204  152 ARG A NH2 
1185 N N   . VAL A 153 ? 0.4533 0.4243 0.4964 0.0279  -0.0128 0.0257  153 VAL A N   
1186 C CA  . VAL A 153 ? 0.4627 0.4340 0.5069 0.0228  -0.0115 0.0257  153 VAL A CA  
1187 C C   . VAL A 153 ? 0.5463 0.5248 0.5939 0.0192  -0.0123 0.0236  153 VAL A C   
1188 O O   . VAL A 153 ? 0.5237 0.5071 0.5732 0.0204  -0.0142 0.0223  153 VAL A O   
1189 C CB  . VAL A 153 ? 0.4231 0.3898 0.4652 0.0200  -0.0125 0.0273  153 VAL A CB  
1190 C CG1 . VAL A 153 ? 0.3635 0.3249 0.4032 0.0227  -0.0109 0.0292  153 VAL A CG1 
1191 C CG2 . VAL A 153 ? 0.3366 0.3041 0.3780 0.0199  -0.0159 0.0270  153 VAL A CG2 
1192 N N   . GLY A 154 ? 0.4452 0.4244 0.4933 0.0143  -0.0107 0.0231  154 GLY A N   
1193 C CA  . GLY A 154 ? 0.3163 0.3025 0.3668 0.0097  -0.0108 0.0211  154 GLY A CA  
1194 C C   . GLY A 154 ? 0.3825 0.3770 0.4375 0.0128  -0.0093 0.0183  154 GLY A C   
1195 O O   . GLY A 154 ? 0.4347 0.4279 0.4901 0.0174  -0.0073 0.0179  154 GLY A O   
1196 N N   . THR A 155 ? 0.3864 0.3894 0.4448 0.0102  -0.0105 0.0164  155 THR A N   
1197 C CA  . THR A 155 ? 0.4776 0.4907 0.5418 0.0132  -0.0095 0.0133  155 THR A CA  
1198 C C   . THR A 155 ? 0.4553 0.4671 0.5206 0.0214  -0.0109 0.0133  155 THR A C   
1199 O O   . THR A 155 ? 0.5535 0.5677 0.6215 0.0262  -0.0093 0.0113  155 THR A O   
1200 C CB  . THR A 155 ? 0.4737 0.4968 0.5414 0.0084  -0.0112 0.0116  155 THR A CB  
1201 O OG1 . THR A 155 ? 0.4424 0.4615 0.5070 0.0075  -0.0153 0.0138  155 THR A OG1 
1202 C CG2 . THR A 155 ? 0.3967 0.4225 0.4632 0.0000  -0.0091 0.0108  155 THR A CG2 
1203 N N   . PHE A 156 ? 0.4393 0.4464 0.5018 0.0232  -0.0140 0.0153  156 PHE A N   
1204 C CA  . PHE A 156 ? 0.4963 0.5012 0.5586 0.0302  -0.0160 0.0155  156 PHE A CA  
1205 C C   . PHE A 156 ? 0.4174 0.4144 0.4763 0.0347  -0.0141 0.0165  156 PHE A C   
1206 O O   . PHE A 156 ? 0.3993 0.3951 0.4582 0.0405  -0.0153 0.0158  156 PHE A O   
1207 C CB  . PHE A 156 ? 0.4680 0.4679 0.5263 0.0303  -0.0193 0.0177  156 PHE A CB  
1208 C CG  . PHE A 156 ? 0.4265 0.4310 0.4857 0.0247  -0.0215 0.0175  156 PHE A CG  
1209 C CD1 . PHE A 156 ? 0.3771 0.3900 0.4404 0.0247  -0.0241 0.0158  156 PHE A CD1 
1210 C CD2 . PHE A 156 ? 0.3550 0.3552 0.4107 0.0192  -0.0215 0.0189  156 PHE A CD2 
1211 C CE1 . PHE A 156 ? 0.4535 0.4700 0.5167 0.0187  -0.0265 0.0159  156 PHE A CE1 
1212 C CE2 . PHE A 156 ? 0.3876 0.3904 0.4426 0.0137  -0.0242 0.0188  156 PHE A CE2 
1213 C CZ  . PHE A 156 ? 0.4445 0.4554 0.5029 0.0131  -0.0266 0.0174  156 PHE A CZ  
1214 N N   . GLY A 157 ? 0.4602 0.4513 0.5157 0.0317  -0.0116 0.0181  157 GLY A N   
1215 C CA  . GLY A 157 ? 0.4028 0.3860 0.4543 0.0348  -0.0100 0.0194  157 GLY A CA  
1216 C C   . GLY A 157 ? 0.4252 0.4091 0.4777 0.0347  -0.0071 0.0178  157 GLY A C   
1217 O O   . GLY A 157 ? 0.4501 0.4283 0.4996 0.0386  -0.0066 0.0180  157 GLY A O   
1218 N N   . PHE A 158 ? 0.4257 0.4159 0.4815 0.0299  -0.0054 0.0161  158 PHE A N   
1219 C CA  . PHE A 158 ? 0.3176 0.3072 0.3729 0.0287  -0.0023 0.0147  158 PHE A CA  
1220 C C   . PHE A 158 ? 0.3749 0.3754 0.4357 0.0267  -0.0004 0.0108  158 PHE A C   
1221 O O   . PHE A 158 ? 0.4812 0.4814 0.5413 0.0257  0.0025  0.0092  158 PHE A O   
1222 C CB  . PHE A 158 ? 0.3005 0.2825 0.3512 0.0234  -0.0009 0.0175  158 PHE A CB  
1223 C CG  . PHE A 158 ? 0.4233 0.3958 0.4693 0.0255  -0.0019 0.0209  158 PHE A CG  
1224 C CD1 . PHE A 158 ? 0.3959 0.3616 0.4380 0.0291  -0.0010 0.0217  158 PHE A CD1 
1225 C CD2 . PHE A 158 ? 0.4331 0.4035 0.4780 0.0237  -0.0037 0.0232  158 PHE A CD2 
1226 C CE1 . PHE A 158 ? 0.4693 0.4271 0.5067 0.0301  -0.0016 0.0248  158 PHE A CE1 
1227 C CE2 . PHE A 158 ? 0.3902 0.3534 0.4312 0.0254  -0.0040 0.0259  158 PHE A CE2 
1228 C CZ  . PHE A 158 ? 0.3856 0.3429 0.4229 0.0283  -0.0028 0.0269  158 PHE A CZ  
1229 N N   . LEU A 159 ? 0.3607 0.3709 0.4267 0.0258  -0.0020 0.0090  159 LEU A N   
1230 C CA  . LEU A 159 ? 0.3903 0.4129 0.4625 0.0244  0.0001  0.0048  159 LEU A CA  
1231 C C   . LEU A 159 ? 0.3915 0.4165 0.4667 0.0320  0.0010  0.0016  159 LEU A C   
1232 O O   . LEU A 159 ? 0.5294 0.5525 0.6053 0.0388  -0.0019 0.0016  159 LEU A O   
1233 C CB  . LEU A 159 ? 0.4257 0.4588 0.5030 0.0221  -0.0022 0.0037  159 LEU A CB  
1234 C CG  . LEU A 159 ? 0.4935 0.5414 0.5777 0.0190  0.0002  -0.0007 159 LEU A CG  
1235 C CD1 . LEU A 159 ? 0.4748 0.5288 0.5596 0.0108  -0.0012 -0.0001 159 LEU A CD1 
1236 C CD2 . LEU A 159 ? 0.3688 0.4264 0.4608 0.0266  -0.0007 -0.0045 159 LEU A CD2 
1237 N N   . ALA A 160 ? 0.4755 0.5040 0.5517 0.0310  0.0047  -0.0014 160 ALA A N   
1238 C CA  . ALA A 160 ? 0.4331 0.4624 0.5112 0.0388  0.0054  -0.0048 160 ALA A CA  
1239 C C   . ALA A 160 ? 0.5040 0.5473 0.5892 0.0387  0.0087  -0.0106 160 ALA A C   
1240 O O   . ALA A 160 ? 0.5116 0.5594 0.5966 0.0316  0.0123  -0.0116 160 ALA A O   
1241 C CB  . ALA A 160 ? 0.3962 0.4113 0.4661 0.0403  0.0064  -0.0027 160 ALA A CB  
1242 N N   . LEU A 161 ? 0.5155 0.5657 0.6070 0.0468  0.0072  -0.0145 161 LEU A N   
1243 C CA  . LEU A 161 ? 0.5004 0.5622 0.5982 0.0494  0.0105  -0.0206 161 LEU A CA  
1244 C C   . LEU A 161 ? 0.4657 0.5177 0.5599 0.0587  0.0094  -0.0221 161 LEU A C   
1245 O O   . LEU A 161 ? 0.4560 0.5100 0.5543 0.0672  0.0058  -0.0244 161 LEU A O   
1246 C CB  . LEU A 161 ? 0.4566 0.5367 0.5662 0.0511  0.0094  -0.0247 161 LEU A CB  
1247 C CG  . LEU A 161 ? 0.5317 0.6219 0.6442 0.0409  0.0107  -0.0237 161 LEU A CG  
1248 C CD1 . LEU A 161 ? 0.6604 0.7682 0.7842 0.0423  0.0088  -0.0271 161 LEU A CD1 
1249 C CD2 . LEU A 161 ? 0.4012 0.4954 0.5117 0.0330  0.0166  -0.0255 161 LEU A CD2 
1250 N N   . PRO A 162 ? 0.4684 0.5085 0.5539 0.0567  0.0120  -0.0206 162 PRO A N   
1251 C CA  . PRO A 162 ? 0.5108 0.5377 0.5896 0.0640  0.0105  -0.0208 162 PRO A CA  
1252 C C   . PRO A 162 ? 0.6195 0.6538 0.7047 0.0738  0.0096  -0.0273 162 PRO A C   
1253 O O   . PRO A 162 ? 0.6290 0.6771 0.7213 0.0736  0.0133  -0.0328 162 PRO A O   
1254 C CB  . PRO A 162 ? 0.4317 0.4514 0.5032 0.0583  0.0149  -0.0200 162 PRO A CB  
1255 C CG  . PRO A 162 ? 0.3446 0.3664 0.4154 0.0479  0.0166  -0.0163 162 PRO A CG  
1256 C CD  . PRO A 162 ? 0.3796 0.4178 0.4605 0.0467  0.0160  -0.0185 162 PRO A CD  
1257 N N   . GLY A 163 ? 0.6512 0.6761 0.7333 0.0822  0.0044  -0.0267 163 GLY A N   
1258 C CA  . GLY A 163 ? 0.6106 0.6407 0.6984 0.0926  0.0021  -0.0328 163 GLY A CA  
1259 C C   . GLY A 163 ? 0.6402 0.6809 0.7374 0.0971  -0.0024 -0.0344 163 GLY A C   
1260 O O   . GLY A 163 ? 0.7898 0.8290 0.8891 0.1068  -0.0071 -0.0375 163 GLY A O   
1261 N N   . SER A 164 ? 0.4900 0.5407 0.5926 0.0901  -0.0015 -0.0322 164 SER A N   
1262 C CA  . SER A 164 ? 0.5483 0.6088 0.6595 0.0931  -0.0060 -0.0330 164 SER A CA  
1263 C C   . SER A 164 ? 0.5696 0.6145 0.6728 0.0962  -0.0121 -0.0279 164 SER A C   
1264 O O   . SER A 164 ? 0.6208 0.6491 0.7124 0.0940  -0.0121 -0.0231 164 SER A O   
1265 C CB  . SER A 164 ? 0.5469 0.6215 0.6646 0.0839  -0.0033 -0.0320 164 SER A CB  
1266 O OG  . SER A 164 ? 0.5401 0.6037 0.6496 0.0771  -0.0041 -0.0252 164 SER A OG  
1267 N N   . ARG A 165 ? 0.5733 0.6236 0.6824 0.1010  -0.0173 -0.0290 165 ARG A N   
1268 C CA  . ARG A 165 ? 0.6880 0.7238 0.7892 0.1037  -0.0232 -0.0244 165 ARG A CA  
1269 C C   . ARG A 165 ? 0.5948 0.6332 0.6963 0.0968  -0.0240 -0.0200 165 ARG A C   
1270 O O   . ARG A 165 ? 0.6404 0.6659 0.7334 0.0966  -0.0273 -0.0153 165 ARG A O   
1271 C CB  . ARG A 165 ? 0.8449 0.8807 0.9497 0.1143  -0.0298 -0.0281 165 ARG A CB  
1272 C CG  . ARG A 165 ? 0.9893 1.0406 1.1058 0.1154  -0.0331 -0.0301 165 ARG A CG  
1273 C CD  . ARG A 165 ? 1.0881 1.1309 1.2024 0.1239  -0.0416 -0.0302 165 ARG A CD  
1274 N NE  . ARG A 165 ? 1.1642 1.2197 1.2882 0.1240  -0.0453 -0.0311 165 ARG A NE  
1275 C CZ  . ARG A 165 ? 1.1687 1.2203 1.2887 0.1188  -0.0473 -0.0261 165 ARG A CZ  
1276 N NH1 . ARG A 165 ? 1.1380 1.1744 1.2453 0.1134  -0.0456 -0.0202 165 ARG A NH1 
1277 N NH2 . ARG A 165 ? 1.1709 1.2342 1.2997 0.1191  -0.0510 -0.0272 165 ARG A NH2 
1278 N N   . GLU A 166 ? 0.4164 0.4713 0.5270 0.0911  -0.0209 -0.0217 166 GLU A N   
1279 C CA  . GLU A 166 ? 0.4693 0.5271 0.5803 0.0845  -0.0219 -0.0180 166 GLU A CA  
1280 C C   . GLU A 166 ? 0.5234 0.5739 0.6267 0.0755  -0.0177 -0.0134 166 GLU A C   
1281 O O   . GLU A 166 ? 0.5980 0.6463 0.6985 0.0705  -0.0189 -0.0097 166 GLU A O   
1282 C CB  . GLU A 166 ? 0.5876 0.6661 0.7115 0.0822  -0.0215 -0.0218 166 GLU A CB  
1283 C CG  . GLU A 166 ? 0.7509 0.8400 0.8850 0.0911  -0.0254 -0.0272 166 GLU A CG  
1284 C CD  . GLU A 166 ? 0.8940 0.9923 1.0347 0.0952  -0.0215 -0.0334 166 GLU A CD  
1285 O OE1 . GLU A 166 ? 0.8810 0.9699 1.0144 0.0945  -0.0178 -0.0329 166 GLU A OE1 
1286 O OE2 . GLU A 166 ? 0.9434 1.0587 1.0966 0.0991  -0.0223 -0.0390 166 GLU A OE2 
1287 N N   . ALA A 167 ? 0.5388 0.5853 0.6385 0.0738  -0.0133 -0.0140 167 ALA A N   
1288 C CA  . ALA A 167 ? 0.5833 0.6219 0.6755 0.0659  -0.0098 -0.0098 167 ALA A CA  
1289 C C   . ALA A 167 ? 0.6061 0.6344 0.6917 0.0671  -0.0070 -0.0097 167 ALA A C   
1290 O O   . ALA A 167 ? 0.5280 0.5606 0.6146 0.0629  -0.0024 -0.0114 167 ALA A O   
1291 C CB  . ALA A 167 ? 0.5446 0.5955 0.6420 0.0574  -0.0063 -0.0107 167 ALA A CB  
1292 N N   . PRO A 168 ? 0.5876 0.6015 0.6653 0.0722  -0.0098 -0.0075 168 PRO A N   
1293 C CA  . PRO A 168 ? 0.5235 0.5261 0.5938 0.0738  -0.0080 -0.0072 168 PRO A CA  
1294 C C   . PRO A 168 ? 0.5294 0.5249 0.5932 0.0658  -0.0046 -0.0030 168 PRO A C   
1295 O O   . PRO A 168 ? 0.5510 0.5394 0.6096 0.0652  -0.0022 -0.0030 168 PRO A O   
1296 C CB  . PRO A 168 ? 0.5352 0.5243 0.5981 0.0801  -0.0130 -0.0051 168 PRO A CB  
1297 C CG  . PRO A 168 ? 0.4882 0.4775 0.5511 0.0781  -0.0158 -0.0018 168 PRO A CG  
1298 C CD  . PRO A 168 ? 0.4901 0.4965 0.5640 0.0756  -0.0149 -0.0046 168 PRO A CD  
1299 N N   . GLY A 169 ? 0.5527 0.5495 0.6166 0.0600  -0.0046 0.0003  169 GLY A N   
1300 C CA  . GLY A 169 ? 0.4951 0.4853 0.5535 0.0528  -0.0022 0.0042  169 GLY A CA  
1301 C C   . GLY A 169 ? 0.5119 0.4879 0.5615 0.0536  -0.0040 0.0088  169 GLY A C   
1302 O O   . GLY A 169 ? 0.5413 0.5106 0.5873 0.0596  -0.0068 0.0088  169 GLY A O   
1303 N N   . ASN A 170 ? 0.4862 0.4576 0.5322 0.0475  -0.0025 0.0124  170 ASN A N   
1304 C CA  . ASN A 170 ? 0.5286 0.4881 0.5670 0.0470  -0.0033 0.0167  170 ASN A CA  
1305 C C   . ASN A 170 ? 0.5271 0.4838 0.5635 0.0501  -0.0065 0.0185  170 ASN A C   
1306 O O   . ASN A 170 ? 0.5914 0.5382 0.6207 0.0507  -0.0073 0.0214  170 ASN A O   
1307 C CB  . ASN A 170 ? 0.5091 0.4585 0.5407 0.0494  -0.0029 0.0170  170 ASN A CB  
1308 C CG  . ASN A 170 ? 0.5785 0.5275 0.6096 0.0451  0.0004  0.0164  170 ASN A CG  
1309 O OD1 . ASN A 170 ? 0.6096 0.5615 0.6424 0.0390  0.0022  0.0177  170 ASN A OD1 
1310 N ND2 . ASN A 170 ? 0.4577 0.4019 0.4854 0.0484  0.0009  0.0144  170 ASN A ND2 
1311 N N   . VAL A 171 ? 0.4344 0.3993 0.4762 0.0517  -0.0084 0.0168  171 VAL A N   
1312 C CA  . VAL A 171 ? 0.4915 0.4530 0.5306 0.0548  -0.0118 0.0182  171 VAL A CA  
1313 C C   . VAL A 171 ? 0.5220 0.4789 0.5571 0.0508  -0.0112 0.0220  171 VAL A C   
1314 O O   . VAL A 171 ? 0.4543 0.4049 0.4841 0.0528  -0.0131 0.0239  171 VAL A O   
1315 C CB  . VAL A 171 ? 0.4258 0.3971 0.4718 0.0575  -0.0144 0.0155  171 VAL A CB  
1316 C CG1 . VAL A 171 ? 0.3979 0.3757 0.4494 0.0618  -0.0148 0.0112  171 VAL A CG1 
1317 C CG2 . VAL A 171 ? 0.4217 0.4015 0.4726 0.0519  -0.0135 0.0156  171 VAL A CG2 
1318 N N   . GLY A 172 ? 0.5239 0.4836 0.5610 0.0453  -0.0089 0.0228  172 GLY A N   
1319 C CA  . GLY A 172 ? 0.4462 0.4019 0.4801 0.0419  -0.0083 0.0259  172 GLY A CA  
1320 C C   . GLY A 172 ? 0.5218 0.4679 0.5489 0.0420  -0.0071 0.0285  172 GLY A C   
1321 O O   . GLY A 172 ? 0.4893 0.4313 0.5125 0.0414  -0.0071 0.0308  172 GLY A O   
1322 N N   . LEU A 173 ? 0.4905 0.4333 0.5159 0.0424  -0.0059 0.0280  173 LEU A N   
1323 C CA  . LEU A 173 ? 0.4883 0.4214 0.5064 0.0421  -0.0052 0.0305  173 LEU A CA  
1324 C C   . LEU A 173 ? 0.4974 0.4238 0.5093 0.0469  -0.0078 0.0309  173 LEU A C   
1325 O O   . LEU A 173 ? 0.5157 0.4340 0.5203 0.0459  -0.0077 0.0337  173 LEU A O   
1326 C CB  . LEU A 173 ? 0.4283 0.3587 0.4454 0.0411  -0.0037 0.0298  173 LEU A CB  
1327 C CG  . LEU A 173 ? 0.5216 0.4547 0.5418 0.0353  -0.0012 0.0304  173 LEU A CG  
1328 C CD1 . LEU A 173 ? 0.4824 0.4129 0.5012 0.0348  0.0001  0.0290  173 LEU A CD1 
1329 C CD2 . LEU A 173 ? 0.4428 0.3715 0.4599 0.0314  -0.0004 0.0340  173 LEU A CD2 
1330 N N   . LEU A 174 ? 0.4449 0.3747 0.4595 0.0516  -0.0103 0.0282  174 LEU A N   
1331 C CA  . LEU A 174 ? 0.4854 0.4083 0.4940 0.0563  -0.0138 0.0284  174 LEU A CA  
1332 C C   . LEU A 174 ? 0.4952 0.4172 0.5011 0.0555  -0.0147 0.0303  174 LEU A C   
1333 O O   . LEU A 174 ? 0.5074 0.4207 0.5050 0.0570  -0.0166 0.0320  174 LEU A O   
1334 C CB  . LEU A 174 ? 0.4505 0.3780 0.4638 0.0621  -0.0167 0.0245  174 LEU A CB  
1335 C CG  . LEU A 174 ? 0.5038 0.4308 0.5182 0.0645  -0.0162 0.0219  174 LEU A CG  
1336 C CD1 . LEU A 174 ? 0.4605 0.3946 0.4815 0.0705  -0.0190 0.0175  174 LEU A CD1 
1337 C CD2 . LEU A 174 ? 0.4581 0.3711 0.4618 0.0656  -0.0173 0.0239  174 LEU A CD2 
1338 N N   . ASP A 175 ? 0.4346 0.3647 0.4465 0.0530  -0.0135 0.0301  175 ASP A N   
1339 C CA  . ASP A 175 ? 0.4089 0.3383 0.4182 0.0521  -0.0140 0.0316  175 ASP A CA  
1340 C C   . ASP A 175 ? 0.5194 0.4423 0.5222 0.0487  -0.0115 0.0347  175 ASP A C   
1341 O O   . ASP A 175 ? 0.5362 0.4532 0.5317 0.0492  -0.0121 0.0363  175 ASP A O   
1342 C CB  . ASP A 175 ? 0.3649 0.3033 0.3814 0.0497  -0.0134 0.0306  175 ASP A CB  
1343 C CG  . ASP A 175 ? 0.5077 0.4539 0.5310 0.0519  -0.0158 0.0277  175 ASP A CG  
1344 O OD1 . ASP A 175 ? 0.5796 0.5246 0.6022 0.0563  -0.0184 0.0263  175 ASP A OD1 
1345 O OD2 . ASP A 175 ? 0.4606 0.4142 0.4897 0.0491  -0.0152 0.0267  175 ASP A OD2 
1346 N N   . GLN A 176 ? 0.4866 0.4108 0.4916 0.0450  -0.0086 0.0355  176 GLN A N   
1347 C CA  . GLN A 176 ? 0.5095 0.4290 0.5097 0.0414  -0.0061 0.0383  176 GLN A CA  
1348 C C   . GLN A 176 ? 0.5278 0.4370 0.5181 0.0424  -0.0071 0.0400  176 GLN A C   
1349 O O   . GLN A 176 ? 0.5442 0.4490 0.5280 0.0407  -0.0063 0.0421  176 GLN A O   
1350 C CB  . GLN A 176 ? 0.4124 0.3344 0.4168 0.0376  -0.0037 0.0387  176 GLN A CB  
1351 C CG  . GLN A 176 ? 0.4037 0.3343 0.4166 0.0356  -0.0032 0.0374  176 GLN A CG  
1352 C CD  . GLN A 176 ? 0.5295 0.4609 0.5453 0.0317  -0.0015 0.0378  176 GLN A CD  
1353 O OE1 . GLN A 176 ? 0.4729 0.3988 0.4848 0.0305  -0.0006 0.0392  176 GLN A OE1 
1354 N NE2 . GLN A 176 ? 0.4284 0.3656 0.4503 0.0296  -0.0016 0.0366  176 GLN A NE2 
1355 N N   . ARG A 177 ? 0.5295 0.4346 0.5182 0.0451  -0.0090 0.0389  177 ARG A N   
1356 C CA  . ARG A 177 ? 0.5220 0.4154 0.5001 0.0464  -0.0110 0.0403  177 ARG A CA  
1357 C C   . ARG A 177 ? 0.5592 0.4475 0.5306 0.0490  -0.0139 0.0407  177 ARG A C   
1358 O O   . ARG A 177 ? 0.5362 0.4149 0.4971 0.0473  -0.0145 0.0431  177 ARG A O   
1359 C CB  . ARG A 177 ? 0.5054 0.3957 0.4836 0.0501  -0.0131 0.0382  177 ARG A CB  
1360 C CG  . ARG A 177 ? 0.5401 0.4166 0.5065 0.0522  -0.0164 0.0393  177 ARG A CG  
1361 C CD  . ARG A 177 ? 0.5381 0.4120 0.5053 0.0571  -0.0189 0.0364  177 ARG A CD  
1362 N NE  . ARG A 177 ? 0.7049 0.5780 0.6727 0.0543  -0.0163 0.0367  177 ARG A NE  
1363 C CZ  . ARG A 177 ? 0.6617 0.5362 0.6330 0.0576  -0.0166 0.0336  177 ARG A CZ  
1364 N NH1 . ARG A 177 ? 0.5909 0.4690 0.5665 0.0641  -0.0195 0.0297  177 ARG A NH1 
1365 N NH2 . ARG A 177 ? 0.4859 0.3586 0.4566 0.0543  -0.0142 0.0342  177 ARG A NH2 
1366 N N   . LEU A 178 ? 0.5176 0.4120 0.4945 0.0524  -0.0158 0.0384  178 LEU A N   
1367 C CA  . LEU A 178 ? 0.5539 0.4434 0.5246 0.0549  -0.0190 0.0387  178 LEU A CA  
1368 C C   . LEU A 178 ? 0.5898 0.4780 0.5554 0.0507  -0.0163 0.0411  178 LEU A C   
1369 O O   . LEU A 178 ? 0.6155 0.4950 0.5707 0.0504  -0.0178 0.0427  178 LEU A O   
1370 C CB  . LEU A 178 ? 0.4972 0.3946 0.4759 0.0589  -0.0216 0.0358  178 LEU A CB  
1371 C CG  . LEU A 178 ? 0.5090 0.4017 0.4820 0.0617  -0.0256 0.0358  178 LEU A CG  
1372 C CD1 . LEU A 178 ? 0.5098 0.3897 0.4724 0.0645  -0.0298 0.0364  178 LEU A CD1 
1373 C CD2 . LEU A 178 ? 0.4547 0.3565 0.4369 0.0651  -0.0282 0.0330  178 LEU A CD2 
1374 N N   . ALA A 179 ? 0.5003 0.3971 0.4729 0.0474  -0.0124 0.0412  179 ALA A N   
1375 C CA  . ALA A 179 ? 0.4443 0.3418 0.4137 0.0438  -0.0093 0.0429  179 ALA A CA  
1376 C C   . ALA A 179 ? 0.6053 0.4961 0.5666 0.0396  -0.0070 0.0457  179 ALA A C   
1377 O O   . ALA A 179 ? 0.7212 0.6092 0.6756 0.0370  -0.0053 0.0472  179 ALA A O   
1378 C CB  . ALA A 179 ? 0.3891 0.2973 0.3686 0.0421  -0.0065 0.0418  179 ALA A CB  
1379 N N   . LEU A 180 ? 0.5056 0.3940 0.4675 0.0386  -0.0069 0.0463  180 LEU A N   
1380 C CA  . LEU A 180 ? 0.5779 0.4586 0.5310 0.0343  -0.0056 0.0492  180 LEU A CA  
1381 C C   . LEU A 180 ? 0.5677 0.4356 0.5072 0.0353  -0.0091 0.0505  180 LEU A C   
1382 O O   . LEU A 180 ? 0.5300 0.3918 0.4598 0.0308  -0.0077 0.0530  180 LEU A O   
1383 C CB  . LEU A 180 ? 0.4791 0.3588 0.4349 0.0332  -0.0054 0.0495  180 LEU A CB  
1384 C CG  . LEU A 180 ? 0.5131 0.4033 0.4809 0.0318  -0.0027 0.0484  180 LEU A CG  
1385 C CD1 . LEU A 180 ? 0.5582 0.4448 0.5257 0.0301  -0.0027 0.0492  180 LEU A CD1 
1386 C CD2 . LEU A 180 ? 0.5111 0.4084 0.4826 0.0277  0.0009  0.0495  180 LEU A CD2 
1387 N N   . GLN A 181 ? 0.5071 0.3711 0.4459 0.0409  -0.0137 0.0486  181 GLN A N   
1388 C CA  . GLN A 181 ? 0.6044 0.4553 0.5303 0.0426  -0.0182 0.0494  181 GLN A CA  
1389 C C   . GLN A 181 ? 0.6816 0.5317 0.6020 0.0412  -0.0177 0.0501  181 GLN A C   
1390 O O   . GLN A 181 ? 0.6336 0.4727 0.5406 0.0388  -0.0191 0.0522  181 GLN A O   
1391 C CB  . GLN A 181 ? 0.6463 0.4948 0.5748 0.0497  -0.0236 0.0466  181 GLN A CB  
1392 C CG  . GLN A 181 ? 0.8292 0.6773 0.7617 0.0516  -0.0243 0.0454  181 GLN A CG  
1393 C CD  . GLN A 181 ? 0.8911 0.7398 0.8283 0.0591  -0.0290 0.0418  181 GLN A CD  
1394 O OE1 . GLN A 181 ? 0.8863 0.7431 0.8311 0.0623  -0.0301 0.0396  181 GLN A OE1 
1395 N NE2 . GLN A 181 ? 0.8804 0.7209 0.8132 0.0619  -0.0320 0.0410  181 GLN A NE2 
1396 N N   . TRP A 182 ? 0.6582 0.5193 0.5882 0.0426  -0.0158 0.0483  182 TRP A N   
1397 C CA  . TRP A 182 ? 0.5874 0.4487 0.5129 0.0415  -0.0149 0.0486  182 TRP A CA  
1398 C C   . TRP A 182 ? 0.6597 0.5203 0.5787 0.0350  -0.0100 0.0510  182 TRP A C   
1399 O O   . TRP A 182 ? 0.6440 0.4982 0.5521 0.0328  -0.0099 0.0521  182 TRP A O   
1400 C CB  . TRP A 182 ? 0.4855 0.3589 0.4228 0.0438  -0.0137 0.0462  182 TRP A CB  
1401 C CG  . TRP A 182 ? 0.5283 0.4008 0.4604 0.0436  -0.0135 0.0460  182 TRP A CG  
1402 C CD1 . TRP A 182 ? 0.4371 0.3052 0.3654 0.0472  -0.0179 0.0451  182 TRP A CD1 
1403 C CD2 . TRP A 182 ? 0.5214 0.3974 0.4513 0.0397  -0.0085 0.0466  182 TRP A CD2 
1404 N NE1 . TRP A 182 ? 0.5620 0.4297 0.4850 0.0456  -0.0160 0.0452  182 TRP A NE1 
1405 C CE2 . TRP A 182 ? 0.5289 0.4018 0.4529 0.0412  -0.0100 0.0459  182 TRP A CE2 
1406 C CE3 . TRP A 182 ? 0.5207 0.4027 0.4534 0.0353  -0.0030 0.0474  182 TRP A CE3 
1407 C CZ2 . TRP A 182 ? 0.5768 0.4523 0.4973 0.0385  -0.0059 0.0458  182 TRP A CZ2 
1408 C CZ3 . TRP A 182 ? 0.5899 0.4755 0.5203 0.0329  0.0010  0.0471  182 TRP A CZ3 
1409 C CH2 . TRP A 182 ? 0.5821 0.4644 0.5061 0.0346  -0.0002 0.0462  182 TRP A CH2 
1410 N N   . VAL A 183 ? 0.5206 0.3881 0.4463 0.0317  -0.0059 0.0516  183 VAL A N   
1411 C CA  . VAL A 183 ? 0.5204 0.3892 0.4418 0.0254  -0.0011 0.0536  183 VAL A CA  
1412 C C   . VAL A 183 ? 0.6224 0.4778 0.5288 0.0215  -0.0027 0.0566  183 VAL A C   
1413 O O   . VAL A 183 ? 0.5816 0.4338 0.4784 0.0167  -0.0003 0.0583  183 VAL A O   
1414 C CB  . VAL A 183 ? 0.5063 0.3857 0.4393 0.0231  0.0027  0.0536  183 VAL A CB  
1415 C CG1 . VAL A 183 ? 0.4254 0.3066 0.3545 0.0163  0.0073  0.0558  183 VAL A CG1 
1416 C CG2 . VAL A 183 ? 0.4372 0.3286 0.3831 0.0260  0.0042  0.0508  183 VAL A CG2 
1417 N N   . GLN A 184 ? 0.6020 0.4491 0.5056 0.0235  -0.0068 0.0571  184 GLN A N   
1418 C CA  . GLN A 184 ? 0.6377 0.4697 0.5256 0.0203  -0.0097 0.0599  184 GLN A CA  
1419 C C   . GLN A 184 ? 0.6675 0.4887 0.5416 0.0203  -0.0127 0.0605  184 GLN A C   
1420 O O   . GLN A 184 ? 0.7126 0.5239 0.5724 0.0145  -0.0127 0.0633  184 GLN A O   
1421 C CB  . GLN A 184 ? 0.5973 0.4216 0.4848 0.0244  -0.0146 0.0594  184 GLN A CB  
1422 C CG  . GLN A 184 ? 0.7320 0.5604 0.6258 0.0218  -0.0121 0.0602  184 GLN A CG  
1423 C CD  . GLN A 184 ? 0.7546 0.5780 0.6387 0.0135  -0.0096 0.0639  184 GLN A CD  
1424 O OE1 . GLN A 184 ? 0.8796 0.6882 0.7489 0.0112  -0.0131 0.0661  184 GLN A OE1 
1425 N NE2 . GLN A 184 ? 0.5987 0.4342 0.4908 0.0089  -0.0038 0.0645  184 GLN A NE2 
1426 N N   . GLU A 185 ? 0.5783 0.4011 0.4560 0.0261  -0.0156 0.0581  185 GLU A N   
1427 C CA  . GLU A 185 ? 0.6612 0.4725 0.5254 0.0265  -0.0194 0.0587  185 GLU A CA  
1428 C C   . GLU A 185 ? 0.6522 0.4683 0.5134 0.0227  -0.0148 0.0588  185 GLU A C   
1429 O O   . GLU A 185 ? 0.7300 0.5355 0.5759 0.0189  -0.0157 0.0606  185 GLU A O   
1430 C CB  . GLU A 185 ? 0.6511 0.4601 0.5194 0.0346  -0.0258 0.0561  185 GLU A CB  
1431 C CG  . GLU A 185 ? 0.7859 0.5795 0.6385 0.0356  -0.0318 0.0569  185 GLU A CG  
1432 C CD  . GLU A 185 ? 0.8628 0.6561 0.7209 0.0436  -0.0381 0.0542  185 GLU A CD  
1433 O OE1 . GLU A 185 ? 0.8930 0.6993 0.7672 0.0479  -0.0371 0.0516  185 GLU A OE1 
1434 O OE2 . GLU A 185 ? 0.8877 0.6676 0.7337 0.0452  -0.0443 0.0547  185 GLU A OE2 
1435 N N   . ASN A 186 ? 0.5977 0.4292 0.4726 0.0235  -0.0099 0.0569  186 ASN A N   
1436 C CA  . ASN A 186 ? 0.5147 0.3514 0.3883 0.0221  -0.0063 0.0560  186 ASN A CA  
1437 C C   . ASN A 186 ? 0.5989 0.4463 0.4760 0.0165  0.0015  0.0562  186 ASN A C   
1438 O O   . ASN A 186 ? 0.6930 0.5424 0.5654 0.0144  0.0048  0.0556  186 ASN A O   
1439 C CB  . ASN A 186 ? 0.4353 0.2795 0.3199 0.0285  -0.0081 0.0530  186 ASN A CB  
1440 C CG  . ASN A 186 ? 0.5967 0.4316 0.4781 0.0341  -0.0157 0.0524  186 ASN A CG  
1441 O OD1 . ASN A 186 ? 0.6973 0.5208 0.5659 0.0340  -0.0194 0.0531  186 ASN A OD1 
1442 N ND2 . ASN A 186 ? 0.5330 0.3733 0.4262 0.0388  -0.0183 0.0508  186 ASN A ND2 
1443 N N   . ILE A 187 ? 0.5407 0.3951 0.4259 0.0141  0.0044  0.0569  187 ILE A N   
1444 C CA  . ILE A 187 ? 0.5367 0.4037 0.4287 0.0099  0.0113  0.0566  187 ILE A CA  
1445 C C   . ILE A 187 ? 0.5899 0.4537 0.4690 0.0024  0.0153  0.0585  187 ILE A C   
1446 O O   . ILE A 187 ? 0.5759 0.4507 0.4594 -0.0004 0.0213  0.0573  187 ILE A O   
1447 C CB  . ILE A 187 ? 0.4262 0.3012 0.3301 0.0090  0.0128  0.0570  187 ILE A CB  
1448 C CG1 . ILE A 187 ? 0.4444 0.3354 0.3615 0.0085  0.0182  0.0549  187 ILE A CG1 
1449 C CG2 . ILE A 187 ? 0.4315 0.2992 0.3263 0.0025  0.0132  0.0604  187 ILE A CG2 
1450 C CD1 . ILE A 187 ? 0.4119 0.3092 0.3376 0.0147  0.0173  0.0516  187 ILE A CD1 
1451 N N   . ALA A 188 ? 0.5896 0.4382 0.4527 -0.0009 0.0119  0.0612  188 ALA A N   
1452 C CA  . ALA A 188 ? 0.6847 0.5284 0.5330 -0.0089 0.0152  0.0632  188 ALA A CA  
1453 C C   . ALA A 188 ? 0.6452 0.4910 0.4890 -0.0085 0.0179  0.0612  188 ALA A C   
1454 O O   . ALA A 188 ? 0.6838 0.5328 0.5208 -0.0148 0.0234  0.0615  188 ALA A O   
1455 C CB  . ALA A 188 ? 0.7123 0.5367 0.5428 -0.0121 0.0096  0.0665  188 ALA A CB  
1456 N N   . ALA A 189 ? 0.5809 0.4250 0.4281 -0.0013 0.0141  0.0590  189 ALA A N   
1457 C CA  . ALA A 189 ? 0.5669 0.4114 0.4089 -0.0003 0.0158  0.0570  189 ALA A CA  
1458 C C   . ALA A 189 ? 0.6545 0.5166 0.5093 0.0003  0.0228  0.0539  189 ALA A C   
1459 O O   . ALA A 189 ? 0.7735 0.6376 0.6245 0.0007  0.0255  0.0519  189 ALA A O   
1460 C CB  . ALA A 189 ? 0.4774 0.3147 0.3195 0.0070  0.0090  0.0558  189 ALA A CB  
1461 N N   . PHE A 190 ? 0.6696 0.5438 0.5391 0.0006  0.0254  0.0535  190 PHE A N   
1462 C CA  . PHE A 190 ? 0.5957 0.4867 0.4785 0.0015  0.0313  0.0505  190 PHE A CA  
1463 C C   . PHE A 190 ? 0.6126 0.5120 0.4963 -0.0058 0.0375  0.0515  190 PHE A C   
1464 O O   . PHE A 190 ? 0.6583 0.5722 0.5518 -0.0060 0.0430  0.0490  190 PHE A O   
1465 C CB  . PHE A 190 ? 0.5373 0.4362 0.4372 0.0079  0.0288  0.0487  190 PHE A CB  
1466 C CG  . PHE A 190 ? 0.5406 0.4337 0.4413 0.0146  0.0231  0.0474  190 PHE A CG  
1467 C CD1 . PHE A 190 ? 0.5724 0.4548 0.4694 0.0168  0.0168  0.0492  190 PHE A CD1 
1468 C CD2 . PHE A 190 ? 0.5929 0.4916 0.4981 0.0189  0.0239  0.0442  190 PHE A CD2 
1469 C CE1 . PHE A 190 ? 0.4997 0.3783 0.3983 0.0227  0.0116  0.0478  190 PHE A CE1 
1470 C CE2 . PHE A 190 ? 0.5447 0.4384 0.4505 0.0244  0.0185  0.0432  190 PHE A CE2 
1471 C CZ  . PHE A 190 ? 0.4310 0.3153 0.3339 0.0262  0.0124  0.0450  190 PHE A CZ  
1472 N N   . GLY A 191 ? 0.5780 0.4681 0.4513 -0.0118 0.0362  0.0553  191 GLY A N   
1473 C CA  . GLY A 191 ? 0.5171 0.4144 0.3906 -0.0197 0.0414  0.0569  191 GLY A CA  
1474 C C   . GLY A 191 ? 0.6047 0.5050 0.4884 -0.0198 0.0395  0.0586  191 GLY A C   
1475 O O   . GLY A 191 ? 0.6624 0.5698 0.5489 -0.0259 0.0432  0.0600  191 GLY A O   
1476 N N   . GLY A 192 ? 0.4911 0.3859 0.3802 -0.0133 0.0337  0.0585  192 GLY A N   
1477 C CA  . GLY A 192 ? 0.6126 0.5089 0.5104 -0.0130 0.0316  0.0599  192 GLY A CA  
1478 C C   . GLY A 192 ? 0.6950 0.5766 0.5798 -0.0175 0.0278  0.0639  192 GLY A C   
1479 O O   . GLY A 192 ? 0.7816 0.6487 0.6518 -0.0176 0.0240  0.0652  192 GLY A O   
1480 N N   . ASP A 193 ? 0.6449 0.5294 0.5344 -0.0213 0.0285  0.0658  193 ASP A N   
1481 C CA  . ASP A 193 ? 0.6171 0.4873 0.4944 -0.0255 0.0246  0.0696  193 ASP A CA  
1482 C C   . ASP A 193 ? 0.6025 0.4666 0.4851 -0.0190 0.0189  0.0693  193 ASP A C   
1483 O O   . ASP A 193 ? 0.5694 0.4419 0.4650 -0.0175 0.0197  0.0686  193 ASP A O   
1484 C CB  . ASP A 193 ? 0.6429 0.5188 0.5206 -0.0342 0.0284  0.0722  193 ASP A CB  
1485 C CG  . ASP A 193 ? 0.7156 0.5750 0.5779 -0.0397 0.0243  0.0764  193 ASP A CG  
1486 O OD1 . ASP A 193 ? 0.7583 0.6012 0.6084 -0.0369 0.0185  0.0772  193 ASP A OD1 
1487 O OD2 . ASP A 193 ? 0.6707 0.5333 0.5329 -0.0470 0.0264  0.0789  193 ASP A OD2 
1488 N N   . PRO A 194 ? 0.6124 0.4616 0.4845 -0.0152 0.0131  0.0696  194 PRO A N   
1489 C CA  . PRO A 194 ? 0.5983 0.4420 0.4749 -0.0087 0.0079  0.0687  194 PRO A CA  
1490 C C   . PRO A 194 ? 0.7490 0.5855 0.6215 -0.0125 0.0060  0.0715  194 PRO A C   
1491 O O   . PRO A 194 ? 0.8549 0.6866 0.7305 -0.0077 0.0021  0.0708  194 PRO A O   
1492 C CB  . PRO A 194 ? 0.6175 0.4473 0.4825 -0.0045 0.0022  0.0683  194 PRO A CB  
1493 C CG  . PRO A 194 ? 0.5529 0.3744 0.4012 -0.0114 0.0033  0.0707  194 PRO A CG  
1494 C CD  . PRO A 194 ? 0.5390 0.3760 0.3943 -0.0169 0.0111  0.0705  194 PRO A CD  
1495 N N   . MET A 195 ? 0.7159 0.5517 0.5812 -0.0212 0.0089  0.0745  195 MET A N   
1496 C CA  . MET A 195 ? 0.7471 0.5764 0.6081 -0.0259 0.0074  0.0775  195 MET A CA  
1497 C C   . MET A 195 ? 0.7116 0.5563 0.5875 -0.0288 0.0121  0.0774  195 MET A C   
1498 O O   . MET A 195 ? 0.7323 0.5736 0.6063 -0.0333 0.0114  0.0799  195 MET A O   
1499 C CB  . MET A 195 ? 0.7624 0.5788 0.6039 -0.0346 0.0065  0.0814  195 MET A CB  
1500 C CG  . MET A 195 ? 0.7501 0.5454 0.5743 -0.0320 -0.0007 0.0823  195 MET A CG  
1501 S SD  . MET A 195 ? 1.2288 1.0064 1.0283 -0.0434 -0.0028 0.0874  195 MET A SD  
1502 C CE  . MET A 195 ? 1.5381 1.2907 1.3219 -0.0368 -0.0133 0.0874  195 MET A CE  
1503 N N   . SER A 196 ? 0.6241 0.4852 0.5145 -0.0262 0.0164  0.0746  196 SER A N   
1504 C CA  . SER A 196 ? 0.5842 0.4602 0.4901 -0.0276 0.0199  0.0739  196 SER A CA  
1505 C C   . SER A 196 ? 0.6270 0.5130 0.5480 -0.0196 0.0201  0.0699  196 SER A C   
1506 O O   . SER A 196 ? 0.5991 0.4975 0.5286 -0.0185 0.0238  0.0676  196 SER A O   
1507 C CB  . SER A 196 ? 0.6640 0.5515 0.5715 -0.0348 0.0257  0.0747  196 SER A CB  
1508 O OG  . SER A 196 ? 0.6356 0.5352 0.5562 -0.0373 0.0281  0.0748  196 SER A OG  
1509 N N   . VAL A 197 ? 0.5786 0.4589 0.5023 -0.0142 0.0161  0.0690  197 VAL A N   
1510 C CA  . VAL A 197 ? 0.6002 0.4887 0.5370 -0.0073 0.0156  0.0655  197 VAL A CA  
1511 C C   . VAL A 197 ? 0.6192 0.5132 0.5670 -0.0074 0.0155  0.0653  197 VAL A C   
1512 O O   . VAL A 197 ? 0.6095 0.4950 0.5536 -0.0078 0.0128  0.0667  197 VAL A O   
1513 C CB  . VAL A 197 ? 0.6183 0.4977 0.5505 -0.0006 0.0112  0.0639  197 VAL A CB  
1514 C CG1 . VAL A 197 ? 0.5003 0.3880 0.4457 0.0054  0.0106  0.0606  197 VAL A CG1 
1515 C CG2 . VAL A 197 ? 0.6324 0.5067 0.5546 -0.0001 0.0108  0.0638  197 VAL A CG2 
1516 N N   . THR A 198 ? 0.5647 0.4720 0.5253 -0.0069 0.0182  0.0635  198 THR A N   
1517 C CA  . THR A 198 ? 0.5355 0.4481 0.5068 -0.0071 0.0178  0.0631  198 THR A CA  
1518 C C   . THR A 198 ? 0.5294 0.4469 0.5101 -0.0009 0.0164  0.0597  198 THR A C   
1519 O O   . THR A 198 ? 0.5629 0.4877 0.5485 0.0019  0.0176  0.0574  198 THR A O   
1520 C CB  . THR A 198 ? 0.5254 0.4493 0.5045 -0.0120 0.0211  0.0638  198 THR A CB  
1521 O OG1 . THR A 198 ? 0.4997 0.4193 0.4701 -0.0188 0.0223  0.0673  198 THR A OG1 
1522 C CG2 . THR A 198 ? 0.5215 0.4502 0.5116 -0.0118 0.0199  0.0632  198 THR A CG2 
1523 N N   . LEU A 199 ? 0.4880 0.4012 0.4704 0.0010  0.0137  0.0594  199 LEU A N   
1524 C CA  . LEU A 199 ? 0.4715 0.3894 0.4626 0.0055  0.0123  0.0564  199 LEU A CA  
1525 C C   . LEU A 199 ? 0.4671 0.3934 0.4689 0.0033  0.0131  0.0560  199 LEU A C   
1526 O O   . LEU A 199 ? 0.5644 0.4899 0.5666 -0.0011 0.0135  0.0581  199 LEU A O   
1527 C CB  . LEU A 199 ? 0.4376 0.3479 0.4259 0.0081  0.0095  0.0559  199 LEU A CB  
1528 C CG  . LEU A 199 ? 0.5670 0.4678 0.5451 0.0110  0.0076  0.0560  199 LEU A CG  
1529 C CD1 . LEU A 199 ? 0.4595 0.3557 0.4377 0.0143  0.0050  0.0544  199 LEU A CD1 
1530 C CD2 . LEU A 199 ? 0.6353 0.5387 0.6127 0.0146  0.0075  0.0544  199 LEU A CD2 
1531 N N   . PHE A 200 ? 0.4230 0.3566 0.4328 0.0064  0.0128  0.0534  200 PHE A N   
1532 C CA  . PHE A 200 ? 0.3864 0.3260 0.4057 0.0052  0.0121  0.0526  200 PHE A CA  
1533 C C   . PHE A 200 ? 0.4584 0.4006 0.4830 0.0091  0.0100  0.0496  200 PHE A C   
1534 O O   . PHE A 200 ? 0.3748 0.3179 0.3980 0.0127  0.0099  0.0479  200 PHE A O   
1535 C CB  . PHE A 200 ? 0.4217 0.3696 0.4466 0.0027  0.0143  0.0528  200 PHE A CB  
1536 C CG  . PHE A 200 ? 0.4606 0.4157 0.4887 0.0060  0.0157  0.0503  200 PHE A CG  
1537 C CD1 . PHE A 200 ? 0.5104 0.4628 0.5317 0.0087  0.0166  0.0497  200 PHE A CD1 
1538 C CD2 . PHE A 200 ? 0.4235 0.3874 0.4610 0.0067  0.0157  0.0484  200 PHE A CD2 
1539 C CE1 . PHE A 200 ? 0.4973 0.4555 0.5205 0.0116  0.0179  0.0472  200 PHE A CE1 
1540 C CE2 . PHE A 200 ? 0.4885 0.4585 0.5284 0.0101  0.0169  0.0457  200 PHE A CE2 
1541 C CZ  . PHE A 200 ? 0.4256 0.3926 0.4581 0.0125  0.0183  0.0451  200 PHE A CZ  
1542 N N   . GLY A 201 ? 0.3912 0.3337 0.4207 0.0077  0.0081  0.0493  201 GLY A N   
1543 C CA  . GLY A 201 ? 0.3357 0.2797 0.3691 0.0101  0.0057  0.0468  201 GLY A CA  
1544 C C   . GLY A 201 ? 0.4204 0.3646 0.4589 0.0072  0.0036  0.0468  201 GLY A C   
1545 O O   . GLY A 201 ? 0.3915 0.3341 0.4303 0.0036  0.0039  0.0488  201 GLY A O   
1546 N N   . GLU A 202 ? 0.4082 0.3538 0.4499 0.0085  0.0012  0.0447  202 GLU A N   
1547 C CA  . GLU A 202 ? 0.4022 0.3474 0.4480 0.0056  -0.0015 0.0445  202 GLU A CA  
1548 C C   . GLU A 202 ? 0.4589 0.4008 0.5028 0.0049  -0.0034 0.0433  202 GLU A C   
1549 O O   . GLU A 202 ? 0.3623 0.3052 0.4047 0.0076  -0.0035 0.0418  202 GLU A O   
1550 C CB  . GLU A 202 ? 0.4318 0.3819 0.4834 0.0072  -0.0034 0.0429  202 GLU A CB  
1551 C CG  . GLU A 202 ? 0.5032 0.4523 0.5591 0.0043  -0.0070 0.0428  202 GLU A CG  
1552 C CD  . GLU A 202 ? 0.5803 0.5263 0.6352 0.0039  -0.0106 0.0412  202 GLU A CD  
1553 O OE1 . GLU A 202 ? 0.5680 0.5143 0.6203 0.0064  -0.0103 0.0398  202 GLU A OE1 
1554 O OE2 . GLU A 202 ? 0.5169 0.4597 0.5731 0.0007  -0.0140 0.0413  202 GLU A OE2 
1555 N N   . SER A 203 ? 0.5018 0.4399 0.5455 0.0008  -0.0048 0.0441  203 SER A N   
1556 C CA  . SER A 203 ? 0.3814 0.3168 0.4229 -0.0011 -0.0062 0.0429  203 SER A CA  
1557 C C   . SER A 203 ? 0.3844 0.3191 0.4219 0.0009  -0.0037 0.0423  203 SER A C   
1558 O O   . SER A 203 ? 0.3923 0.3237 0.4264 0.0006  -0.0016 0.0437  203 SER A O   
1559 C CB  . SER A 203 ? 0.3727 0.3102 0.4165 -0.0005 -0.0093 0.0409  203 SER A CB  
1560 O OG  . SER A 203 ? 0.5863 0.5215 0.6278 -0.0036 -0.0106 0.0399  203 SER A OG  
1561 N N   . ALA A 204 ? 0.2757 0.2132 0.3134 0.0031  -0.0042 0.0402  204 ALA A N   
1562 C CA  . ALA A 204 ? 0.3650 0.3029 0.4000 0.0057  -0.0024 0.0392  204 ALA A CA  
1563 C C   . ALA A 204 ? 0.4667 0.4041 0.4996 0.0096  -0.0007 0.0402  204 ALA A C   
1564 O O   . ALA A 204 ? 0.5191 0.4541 0.5485 0.0114  0.0006  0.0401  204 ALA A O   
1565 C CB  . ALA A 204 ? 0.3463 0.2884 0.3828 0.0069  -0.0038 0.0368  204 ALA A CB  
1566 N N   . GLY A 205 ? 0.4115 0.3508 0.4459 0.0109  -0.0008 0.0409  205 GLY A N   
1567 C CA  . GLY A 205 ? 0.4149 0.3533 0.4463 0.0134  0.0009  0.0421  205 GLY A CA  
1568 C C   . GLY A 205 ? 0.4251 0.3589 0.4531 0.0109  0.0025  0.0445  205 GLY A C   
1569 O O   . GLY A 205 ? 0.4011 0.3312 0.4240 0.0123  0.0036  0.0455  205 GLY A O   
1570 N N   . ALA A 206 ? 0.4168 0.3500 0.4473 0.0069  0.0020  0.0456  206 ALA A N   
1571 C CA  . ALA A 206 ? 0.5191 0.4473 0.5462 0.0038  0.0030  0.0481  206 ALA A CA  
1572 C C   . ALA A 206 ? 0.5223 0.4447 0.5442 0.0040  0.0032  0.0478  206 ALA A C   
1573 O O   . ALA A 206 ? 0.5521 0.4690 0.5681 0.0040  0.0041  0.0493  206 ALA A O   
1574 C CB  . ALA A 206 ? 0.4787 0.4075 0.5099 -0.0005 0.0017  0.0491  206 ALA A CB  
1575 N N   . ALA A 207 ? 0.4535 0.3769 0.4771 0.0039  0.0024  0.0457  207 ALA A N   
1576 C CA  . ALA A 207 ? 0.4206 0.3401 0.4401 0.0048  0.0030  0.0444  207 ALA A CA  
1577 C C   . ALA A 207 ? 0.5197 0.4385 0.5359 0.0099  0.0035  0.0436  207 ALA A C   
1578 O O   . ALA A 207 ? 0.4996 0.4124 0.5103 0.0112  0.0039  0.0437  207 ALA A O   
1579 C CB  . ALA A 207 ? 0.3205 0.2434 0.3430 0.0038  0.0024  0.0419  207 ALA A CB  
1580 N N   . SER A 208 ? 0.4633 0.3870 0.4821 0.0130  0.0030  0.0426  208 SER A N   
1581 C CA  . SER A 208 ? 0.4868 0.4091 0.5021 0.0177  0.0028  0.0420  208 SER A CA  
1582 C C   . SER A 208 ? 0.4413 0.3566 0.4498 0.0173  0.0033  0.0447  208 SER A C   
1583 O O   . SER A 208 ? 0.4515 0.3609 0.4541 0.0199  0.0027  0.0446  208 SER A O   
1584 C CB  . SER A 208 ? 0.4767 0.4047 0.4953 0.0202  0.0020  0.0411  208 SER A CB  
1585 O OG  . SER A 208 ? 0.4832 0.4170 0.5070 0.0204  0.0010  0.0386  208 SER A OG  
1586 N N   . VAL A 209 ? 0.3851 0.3010 0.3942 0.0139  0.0042  0.0471  209 VAL A N   
1587 C CA  . VAL A 209 ? 0.4551 0.3650 0.4576 0.0119  0.0049  0.0500  209 VAL A CA  
1588 C C   . VAL A 209 ? 0.5190 0.4204 0.5155 0.0104  0.0044  0.0510  209 VAL A C   
1589 O O   . VAL A 209 ? 0.5676 0.4612 0.5559 0.0114  0.0038  0.0521  209 VAL A O   
1590 C CB  . VAL A 209 ? 0.4854 0.3995 0.4914 0.0078  0.0061  0.0520  209 VAL A CB  
1591 C CG1 . VAL A 209 ? 0.4262 0.3343 0.4252 0.0044  0.0069  0.0552  209 VAL A CG1 
1592 C CG2 . VAL A 209 ? 0.5579 0.4791 0.5680 0.0099  0.0067  0.0509  209 VAL A CG2 
1593 N N   . GLY A 210 ? 0.5058 0.4079 0.5057 0.0080  0.0044  0.0505  210 GLY A N   
1594 C CA  . GLY A 210 ? 0.4239 0.3179 0.4181 0.0064  0.0041  0.0511  210 GLY A CA  
1595 C C   . GLY A 210 ? 0.4475 0.3370 0.4370 0.0115  0.0034  0.0487  210 GLY A C   
1596 O O   . GLY A 210 ? 0.5403 0.4204 0.5218 0.0117  0.0026  0.0495  210 GLY A O   
1597 N N   . MET A 211 ? 0.3919 0.2879 0.3864 0.0156  0.0032  0.0455  211 MET A N   
1598 C CA  . MET A 211 ? 0.4779 0.3718 0.4700 0.0210  0.0023  0.0426  211 MET A CA  
1599 C C   . MET A 211 ? 0.5149 0.4022 0.4999 0.0246  0.0005  0.0435  211 MET A C   
1600 O O   . MET A 211 ? 0.5367 0.4176 0.5163 0.0286  -0.0011 0.0420  211 MET A O   
1601 C CB  . MET A 211 ? 0.5052 0.4090 0.5054 0.0235  0.0025  0.0390  211 MET A CB  
1602 C CG  . MET A 211 ? 0.6088 0.5173 0.6139 0.0195  0.0039  0.0379  211 MET A CG  
1603 S SD  . MET A 211 ? 0.7275 0.6478 0.7412 0.0209  0.0040  0.0341  211 MET A SD  
1604 C CE  . MET A 211 ? 0.3807 0.3027 0.3970 0.0137  0.0051  0.0345  211 MET A CE  
1605 N N   . HIS A 212 ? 0.4578 0.3464 0.4423 0.0232  0.0006  0.0458  212 HIS A N   
1606 C CA  . HIS A 212 ? 0.4750 0.3562 0.4510 0.0253  -0.0012 0.0472  212 HIS A CA  
1607 C C   . HIS A 212 ? 0.5323 0.4018 0.4981 0.0223  -0.0019 0.0501  212 HIS A C   
1608 O O   . HIS A 212 ? 0.6137 0.4734 0.5702 0.0248  -0.0043 0.0504  212 HIS A O   
1609 C CB  . HIS A 212 ? 0.4873 0.3735 0.4651 0.0240  -0.0003 0.0486  212 HIS A CB  
1610 C CG  . HIS A 212 ? 0.4854 0.3800 0.4701 0.0278  -0.0007 0.0459  212 HIS A CG  
1611 N ND1 . HIS A 212 ? 0.4768 0.3699 0.4600 0.0334  -0.0031 0.0436  212 HIS A ND1 
1612 C CD2 . HIS A 212 ? 0.4330 0.3372 0.4259 0.0269  0.0005  0.0451  212 HIS A CD2 
1613 C CE1 . HIS A 212 ? 0.5204 0.4221 0.5106 0.0352  -0.0032 0.0417  212 HIS A CE1 
1614 N NE2 . HIS A 212 ? 0.5486 0.4565 0.5442 0.0313  -0.0010 0.0426  212 HIS A NE2 
1615 N N   . ILE A 213 ? 0.5075 0.3774 0.4746 0.0167  -0.0002 0.0523  213 ILE A N   
1616 C CA  . ILE A 213 ? 0.5657 0.4246 0.5234 0.0130  -0.0010 0.0551  213 ILE A CA  
1617 C C   . ILE A 213 ? 0.6297 0.4802 0.5821 0.0168  -0.0028 0.0529  213 ILE A C   
1618 O O   . ILE A 213 ? 0.6407 0.4788 0.5820 0.0171  -0.0051 0.0542  213 ILE A O   
1619 C CB  . ILE A 213 ? 0.5603 0.4226 0.5221 0.0064  0.0009  0.0575  213 ILE A CB  
1620 C CG1 . ILE A 213 ? 0.5580 0.4293 0.5257 0.0033  0.0027  0.0592  213 ILE A CG1 
1621 C CG2 . ILE A 213 ? 0.5734 0.4240 0.5253 0.0021  -0.0002 0.0606  213 ILE A CG2 
1622 C CD1 . ILE A 213 ? 0.4472 0.3229 0.4202 -0.0027 0.0039  0.0613  213 ILE A CD1 
1623 N N   . LEU A 214 ? 0.6250 0.4823 0.5851 0.0196  -0.0019 0.0493  214 LEU A N   
1624 C CA  . LEU A 214 ? 0.6184 0.4702 0.5752 0.0231  -0.0028 0.0464  214 LEU A CA  
1625 C C   . LEU A 214 ? 0.6235 0.4743 0.5792 0.0310  -0.0050 0.0428  214 LEU A C   
1626 O O   . LEU A 214 ? 0.6383 0.4836 0.5903 0.0351  -0.0062 0.0400  214 LEU A O   
1627 C CB  . LEU A 214 ? 0.5402 0.3998 0.5051 0.0213  -0.0003 0.0442  214 LEU A CB  
1628 C CG  . LEU A 214 ? 0.5656 0.4248 0.5312 0.0137  0.0011  0.0475  214 LEU A CG  
1629 C CD1 . LEU A 214 ? 0.5396 0.4061 0.5126 0.0116  0.0030  0.0454  214 LEU A CD1 
1630 C CD2 . LEU A 214 ? 0.5781 0.4239 0.5327 0.0110  -0.0002 0.0502  214 LEU A CD2 
1631 N N   . SER A 215 ? 0.5719 0.4279 0.5308 0.0334  -0.0058 0.0426  215 SER A N   
1632 C CA  . SER A 215 ? 0.4992 0.3541 0.4571 0.0409  -0.0086 0.0394  215 SER A CA  
1633 C C   . SER A 215 ? 0.6349 0.4775 0.5811 0.0419  -0.0122 0.0420  215 SER A C   
1634 O O   . SER A 215 ? 0.6730 0.5162 0.6175 0.0384  -0.0117 0.0450  215 SER A O   
1635 C CB  . SER A 215 ? 0.5457 0.4142 0.5146 0.0432  -0.0078 0.0370  215 SER A CB  
1636 O OG  . SER A 215 ? 0.6100 0.4798 0.5806 0.0506  -0.0103 0.0330  215 SER A OG  
1637 N N   . LEU A 216 ? 0.7449 0.5761 0.6825 0.0466  -0.0158 0.0405  216 LEU A N   
1638 C CA  . LEU A 216 ? 0.8254 0.6418 0.7492 0.0469  -0.0200 0.0431  216 LEU A CA  
1639 C C   . LEU A 216 ? 0.7989 0.6166 0.7217 0.0481  -0.0218 0.0440  216 LEU A C   
1640 O O   . LEU A 216 ? 0.8183 0.6291 0.7324 0.0433  -0.0223 0.0480  216 LEU A O   
1641 C CB  . LEU A 216 ? 0.9297 0.7333 0.8447 0.0530  -0.0244 0.0405  216 LEU A CB  
1642 C CG  . LEU A 216 ? 1.0400 0.8252 0.9383 0.0530  -0.0298 0.0433  216 LEU A CG  
1643 C CD1 . LEU A 216 ? 1.0273 0.8040 0.9159 0.0439  -0.0285 0.0488  216 LEU A CD1 
1644 C CD2 . LEU A 216 ? 1.0419 0.8152 0.9329 0.0608  -0.0349 0.0396  216 LEU A CD2 
1645 N N   . PRO A 217 ? 0.7409 0.5674 0.6722 0.0542  -0.0228 0.0402  217 PRO A N   
1646 C CA  . PRO A 217 ? 0.6792 0.5052 0.6083 0.0553  -0.0250 0.0412  217 PRO A CA  
1647 C C   . PRO A 217 ? 0.6770 0.5112 0.6098 0.0490  -0.0210 0.0442  217 PRO A C   
1648 O O   . PRO A 217 ? 0.8432 0.6775 0.7741 0.0496  -0.0223 0.0449  217 PRO A O   
1649 C CB  . PRO A 217 ? 0.6179 0.4533 0.5570 0.0629  -0.0267 0.0362  217 PRO A CB  
1650 C CG  . PRO A 217 ? 0.5635 0.3992 0.5057 0.0670  -0.0269 0.0325  217 PRO A CG  
1651 C CD  . PRO A 217 ? 0.6429 0.4786 0.5846 0.0603  -0.0225 0.0350  217 PRO A CD  
1652 N N   . SER A 218 ? 0.6401 0.4806 0.5780 0.0433  -0.0165 0.0458  218 SER A N   
1653 C CA  . SER A 218 ? 0.5458 0.3940 0.4877 0.0377  -0.0129 0.0483  218 SER A CA  
1654 C C   . SER A 218 ? 0.6059 0.4466 0.5386 0.0308  -0.0117 0.0528  218 SER A C   
1655 O O   . SER A 218 ? 0.6542 0.4993 0.5874 0.0265  -0.0093 0.0549  218 SER A O   
1656 C CB  . SER A 218 ? 0.4610 0.3230 0.4163 0.0362  -0.0091 0.0468  218 SER A CB  
1657 O OG  . SER A 218 ? 0.5889 0.4593 0.5530 0.0414  -0.0099 0.0429  218 SER A OG  
1658 N N   . ARG A 219 ? 0.6123 0.4419 0.5365 0.0296  -0.0134 0.0540  219 ARG A N   
1659 C CA  . ARG A 219 ? 0.7271 0.5498 0.6427 0.0222  -0.0124 0.0584  219 ARG A CA  
1660 C C   . ARG A 219 ? 0.8038 0.6171 0.7067 0.0194  -0.0143 0.0613  219 ARG A C   
1661 O O   . ARG A 219 ? 0.9459 0.7560 0.8426 0.0123  -0.0128 0.0650  219 ARG A O   
1662 C CB  . ARG A 219 ? 0.7803 0.5924 0.6893 0.0215  -0.0142 0.0589  219 ARG A CB  
1663 C CG  . ARG A 219 ? 0.7667 0.5872 0.6864 0.0215  -0.0115 0.0570  219 ARG A CG  
1664 C CD  . ARG A 219 ? 0.9783 0.7870 0.8896 0.0201  -0.0132 0.0579  219 ARG A CD  
1665 N NE  . ARG A 219 ? 1.1611 0.9745 1.0800 0.0237  -0.0122 0.0542  219 ARG A NE  
1666 C CZ  . ARG A 219 ? 1.2673 1.0709 1.1797 0.0271  -0.0145 0.0524  219 ARG A CZ  
1667 N NH1 . ARG A 219 ? 1.2787 1.0661 1.1766 0.0276  -0.0186 0.0540  219 ARG A NH1 
1668 N NH2 . ARG A 219 ? 1.2379 1.0472 1.1576 0.0299  -0.0128 0.0487  219 ARG A NH2 
1669 N N   . SER A 220 ? 0.8186 0.6277 0.7176 0.0247  -0.0176 0.0596  220 SER A N   
1670 C CA  . SER A 220 ? 0.8707 0.6706 0.7570 0.0220  -0.0196 0.0621  220 SER A CA  
1671 C C   . SER A 220 ? 0.7975 0.6092 0.6903 0.0201  -0.0159 0.0622  220 SER A C   
1672 O O   . SER A 220 ? 0.8070 0.6133 0.6902 0.0171  -0.0164 0.0641  220 SER A O   
1673 C CB  . SER A 220 ? 0.8945 0.6815 0.7714 0.0286  -0.0261 0.0603  220 SER A CB  
1674 O OG  . SER A 220 ? 0.9378 0.7323 0.8259 0.0368  -0.0272 0.0558  220 SER A OG  
1675 N N   . LEU A 221 ? 0.5792 0.4062 0.4873 0.0214  -0.0122 0.0601  221 LEU A N   
1676 C CA  . LEU A 221 ? 0.5158 0.3540 0.4310 0.0214  -0.0093 0.0592  221 LEU A CA  
1677 C C   . LEU A 221 ? 0.5441 0.3928 0.4657 0.0151  -0.0040 0.0609  221 LEU A C   
1678 O O   . LEU A 221 ? 0.6185 0.4756 0.5445 0.0144  -0.0013 0.0604  221 LEU A O   
1679 C CB  . LEU A 221 ? 0.4970 0.3444 0.4243 0.0280  -0.0100 0.0553  221 LEU A CB  
1680 C CG  . LEU A 221 ? 0.5926 0.4327 0.5167 0.0351  -0.0152 0.0528  221 LEU A CG  
1681 C CD1 . LEU A 221 ? 0.6209 0.4726 0.5582 0.0404  -0.0152 0.0490  221 LEU A CD1 
1682 C CD2 . LEU A 221 ? 0.6044 0.4335 0.5159 0.0360  -0.0190 0.0539  221 LEU A CD2 
1683 N N   . PHE A 222 ? 0.5038 0.3518 0.4260 0.0109  -0.0026 0.0627  222 PHE A N   
1684 C CA  . PHE A 222 ? 0.5438 0.4016 0.4723 0.0048  0.0018  0.0644  222 PHE A CA  
1685 C C   . PHE A 222 ? 0.5632 0.4139 0.4844 -0.0016 0.0019  0.0678  222 PHE A C   
1686 O O   . PHE A 222 ? 0.6306 0.4684 0.5422 -0.0010 -0.0016 0.0688  222 PHE A O   
1687 C CB  . PHE A 222 ? 0.4680 0.3389 0.4121 0.0069  0.0039  0.0619  222 PHE A CB  
1688 C CG  . PHE A 222 ? 0.4961 0.3650 0.4439 0.0083  0.0025  0.0611  222 PHE A CG  
1689 C CD1 . PHE A 222 ? 0.4872 0.3522 0.4350 0.0143  -0.0004 0.0585  222 PHE A CD1 
1690 C CD2 . PHE A 222 ? 0.5360 0.4075 0.4877 0.0035  0.0041  0.0627  222 PHE A CD2 
1691 C CE1 . PHE A 222 ? 0.5021 0.3658 0.4530 0.0155  -0.0012 0.0573  222 PHE A CE1 
1692 C CE2 . PHE A 222 ? 0.4656 0.3345 0.4197 0.0044  0.0029  0.0619  222 PHE A CE2 
1693 C CZ  . PHE A 222 ? 0.4760 0.3411 0.4294 0.0104  0.0005  0.0591  222 PHE A CZ  
1694 N N   . HIS A 223 ? 0.6063 0.4653 0.5320 -0.0077 0.0056  0.0696  223 HIS A N   
1695 C CA  . HIS A 223 ? 0.6683 0.5215 0.5868 -0.0150 0.0058  0.0733  223 HIS A CA  
1696 C C   . HIS A 223 ? 0.6819 0.5447 0.6118 -0.0182 0.0080  0.0738  223 HIS A C   
1697 O O   . HIS A 223 ? 0.7362 0.5929 0.6617 -0.0227 0.0069  0.0764  223 HIS A O   
1698 C CB  . HIS A 223 ? 0.6737 0.5258 0.5831 -0.0211 0.0077  0.0759  223 HIS A CB  
1699 C CG  . HIS A 223 ? 0.7410 0.5827 0.6382 -0.0185 0.0051  0.0756  223 HIS A CG  
1700 N ND1 . HIS A 223 ? 0.7352 0.5829 0.6363 -0.0139 0.0062  0.0730  223 HIS A ND1 
1701 C CD2 . HIS A 223 ? 0.6666 0.4913 0.5472 -0.0196 0.0009  0.0776  223 HIS A CD2 
1702 C CE1 . HIS A 223 ? 0.6966 0.5317 0.5843 -0.0125 0.0028  0.0734  223 HIS A CE1 
1703 N NE2 . HIS A 223 ? 0.7367 0.5575 0.6117 -0.0158 -0.0006 0.0762  223 HIS A NE2 
1704 N N   . ARG A 224 ? 0.5815 0.4669 0.5385 -0.0341 0.0052  0.0346  224 ARG A N   
1705 C CA  . ARG A 224 ? 0.6405 0.5331 0.5972 -0.0370 0.0064  0.0339  224 ARG A CA  
1706 C C   . ARG A 224 ? 0.6448 0.5449 0.6150 -0.0272 0.0107  0.0298  224 ARG A C   
1707 O O   . ARG A 224 ? 0.6138 0.5185 0.5946 -0.0192 0.0124  0.0277  224 ARG A O   
1708 C CB  . ARG A 224 ? 0.6641 0.5778 0.6213 -0.0451 0.0033  0.0381  224 ARG A CB  
1709 C CG  . ARG A 224 ? 0.6788 0.5846 0.6193 -0.0579 -0.0013 0.0430  224 ARG A CG  
1710 C CD  . ARG A 224 ? 0.7366 0.6669 0.6785 -0.0655 -0.0047 0.0479  224 ARG A CD  
1711 N NE  . ARG A 224 ? 0.8751 0.8189 0.8258 -0.0624 -0.0060 0.0487  224 ARG A NE  
1712 C CZ  . ARG A 224 ? 0.9208 0.8572 0.8648 -0.0672 -0.0098 0.0517  224 ARG A CZ  
1713 N NH1 . ARG A 224 ? 0.9594 0.8729 0.8874 -0.0748 -0.0129 0.0541  224 ARG A NH1 
1714 N NH2 . ARG A 224 ? 0.9237 0.8753 0.8769 -0.0645 -0.0107 0.0524  224 ARG A NH2 
1715 N N   . ALA A 225 ? 0.5635 0.4653 0.5329 -0.0287 0.0122  0.0290  225 ALA A N   
1716 C CA  . ALA A 225 ? 0.5526 0.4588 0.5332 -0.0205 0.0158  0.0256  225 ALA A CA  
1717 C C   . ALA A 225 ? 0.5297 0.4507 0.5149 -0.0231 0.0161  0.0269  225 ALA A C   
1718 O O   . ALA A 225 ? 0.5403 0.4613 0.5163 -0.0317 0.0147  0.0296  225 ALA A O   
1719 C CB  . ALA A 225 ? 0.5125 0.3992 0.4871 -0.0170 0.0182  0.0226  225 ALA A CB  
1720 N N   . VAL A 226 ? 0.4574 0.3906 0.4565 -0.0158 0.0179  0.0252  226 VAL A N   
1721 C CA  . VAL A 226 ? 0.5340 0.4802 0.5394 -0.0162 0.0184  0.0264  226 VAL A CA  
1722 C C   . VAL A 226 ? 0.5138 0.4562 0.5270 -0.0094 0.0209  0.0236  226 VAL A C   
1723 O O   . VAL A 226 ? 0.4572 0.3987 0.4783 -0.0020 0.0219  0.0209  226 VAL A O   
1724 C CB  . VAL A 226 ? 0.5638 0.5304 0.5791 -0.0139 0.0175  0.0277  226 VAL A CB  
1725 C CG1 . VAL A 226 ? 0.5073 0.4867 0.5290 -0.0136 0.0180  0.0296  226 VAL A CG1 
1726 C CG2 . VAL A 226 ? 0.4568 0.4304 0.4650 -0.0208 0.0148  0.0309  226 VAL A CG2 
1727 N N   . LEU A 227 ? 0.4799 0.4212 0.4906 -0.0126 0.0216  0.0246  227 LEU A N   
1728 C CA  . LEU A 227 ? 0.4583 0.3973 0.4757 -0.0076 0.0235  0.0226  227 LEU A CA  
1729 C C   . LEU A 227 ? 0.4475 0.4007 0.4737 -0.0079 0.0232  0.0252  227 LEU A C   
1730 O O   . LEU A 227 ? 0.4520 0.4087 0.4733 -0.0146 0.0229  0.0281  227 LEU A O   
1731 C CB  . LEU A 227 ? 0.4866 0.4105 0.4934 -0.0104 0.0248  0.0210  227 LEU A CB  
1732 C CG  . LEU A 227 ? 0.5079 0.4155 0.5074 -0.0072 0.0257  0.0181  227 LEU A CG  
1733 C CD1 . LEU A 227 ? 0.4404 0.3403 0.4283 -0.0131 0.0239  0.0193  227 LEU A CD1 
1734 C CD2 . LEU A 227 ? 0.4452 0.3413 0.4386