data_4ASQ
# 
_entry.id   4ASQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ASQ         
PDBE  EBI-52366    
WWPDB D_1290052366 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1J36 unspecified 'CRYSTAL STRUCTURE OF DROSOPHILA ANCE'                                        
PDB 1J37 unspecified 'CRYSTAL STRUCTURE OF DROSOPHILA ANCE'                                        
PDB 1J38 unspecified 'CRYSTAL STRUCTURE OF DROSOPHILA ANCE'                                        
PDB 2X8Y unspecified 'CRYSTAL STRUCTURE OF ANCE'                                                   
PDB 2X8Z unspecified 'CRYSTAL STRUCTURE OF ANCE-CAPTOPRIL COMPLEX'                                 
PDB 2X90 unspecified 'CRYSTAL STRUCTURE OF ANCE-ENALAPRILAT COMPLEX'                               
PDB 2X91 unspecified 'CRYSTAL STRUCTURE OF ANCE-LISINOPRIL COMPLEX'                                
PDB 2X92 unspecified 'CRYSTAL STRUCTURE OF ANCE-RAMIPRILAT COMPLEX'                                
PDB 2X93 unspecified 'CRYSTAL STRUCTURE OF ANCE-TRANDOLAPRILAT COMPLEX'                            
PDB 2X94 unspecified 'CRYSTAL STRUCTURE OF ANCE-PERINDOPRILAT COMPLEX'                             
PDB 2X95 unspecified 'CRYSTAL STRUCTURE OF ANCE-LISINOPRIL-TRYPTOPHAN ANALOGUE , LISW-S COMPLEX'   
PDB 2X96 unspecified 'CRYSTAL STRUCTURE OF ANCE-RXPA380 COMPLEX'                                   
PDB 2X97 unspecified 'CRYSTAL STRUCTURE OF ANCE-RXP407 COMPLEX'                                    
PDB 2XHM unspecified 'CRYSTAL STRUCTURE OF ANCE-K26 COMPLEX'                                       
PDB 3ZQZ unspecified 'CRYSTAL STRUCTURE OF ANCE IN COMPLEX WITH A SELENIUM ANALOGUE OF CAPTOPRIL'  
PDB 4AA1 unspecified 'CRYSTAL STRUCTURE OF ANCE IN COMPLEX WITH ANGIOTENSIN- II'                   
PDB 4AA2 unspecified 'CRYSTAL STRUCTURE OF ANCE IN COMPLEX WITH BRADYKININ POTENTIATING PEPTIDE B' 
PDB 4ASR unspecified 'CRYSTAL STRUCTURE OF ANCE IN COMPLEX WITH THR6- BRADYKININ'                  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4ASQ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-02 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Akif, M.'       1 
'Masuyer, G.'    2 
'Sturrock, E.D.' 3 
'Isaac, R.E.'    4 
'Acharya, K.R.'  5 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis of Peptide Recognition by the Angiotensin-I Converting Enzyme Homologue Ance from Drosophila Melanogaster' 
_citation.journal_abbrev            'FEBS J.' 
_citation.journal_volume            279 
_citation.page_first                4525 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1742-464X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23082758 
_citation.pdbx_database_id_DOI      10.1111/FEBS.12038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Akif, M.'       1 ? 
primary 'Masuyer, G.'    2 ? 
primary 'Bingham, R.J.'  3 ? 
primary 'Sturrock, E.D.' 4 ? 
primary 'Isaac, R.E.'    5 ? 
primary 'Acharya, K.R.'  6 ? 
# 
_cell.entry_id           4ASQ 
_cell.length_a           173.125 
_cell.length_b           173.125 
_cell.length_c           101.673 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4ASQ 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ANGIOTENSIN-CONVERTING ENZYME' 69152.602 1   3.4.15.1 ? 'RESIDUES 17-614' ? 
2 polymer     syn BRADYKININ 1062.224  1   ?        ? ?                 ? 
3 branched    man 
;beta-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1072.964  1   ?        ? ?                 ? 
4 non-polymer syn 'ZINC ION' 65.409    1   ?        ? ?                 ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?        ? ?                 ? 
6 non-polymer syn 'CITRATE ANION' 189.100   1   ?        ? ?                 ? 
7 water       nat water 18.015    500 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DIPEPTIDYL CARBOXYPEPTIDASE I, KININASE II' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQ
FKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTA
VRSQFERYVELNTKAAKLNNFTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM
HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVC
HASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGL
LKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY
HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERI
MSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS
;
;ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQ
FKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTA
VRSQFERYVELNTKAAKLNNFTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM
HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVC
HASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGL
LKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY
HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERI
MSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS
;
A ? 
2 'polypeptide(L)' no no RPPGFSPFR RPPGFSPFR P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   VAL n 
1 4   LYS n 
1 5   GLU n 
1 6   GLU n 
1 7   ILE n 
1 8   GLN n 
1 9   ALA n 
1 10  LYS n 
1 11  GLU n 
1 12  TYR n 
1 13  LEU n 
1 14  GLU n 
1 15  ASN n 
1 16  LEU n 
1 17  ASN n 
1 18  LYS n 
1 19  GLU n 
1 20  LEU n 
1 21  ALA n 
1 22  LYS n 
1 23  ARG n 
1 24  THR n 
1 25  ASN n 
1 26  VAL n 
1 27  GLU n 
1 28  THR n 
1 29  GLU n 
1 30  ALA n 
1 31  ALA n 
1 32  TRP n 
1 33  ALA n 
1 34  TYR n 
1 35  GLY n 
1 36  SER n 
1 37  ASN n 
1 38  ILE n 
1 39  THR n 
1 40  ASP n 
1 41  GLU n 
1 42  ASN n 
1 43  GLU n 
1 44  LYS n 
1 45  LYS n 
1 46  LYS n 
1 47  ASN n 
1 48  GLU n 
1 49  ILE n 
1 50  SER n 
1 51  ALA n 
1 52  GLU n 
1 53  LEU n 
1 54  ALA n 
1 55  LYS n 
1 56  PHE n 
1 57  MET n 
1 58  LYS n 
1 59  GLU n 
1 60  VAL n 
1 61  ALA n 
1 62  SER n 
1 63  ASP n 
1 64  THR n 
1 65  THR n 
1 66  LYS n 
1 67  PHE n 
1 68  GLN n 
1 69  TRP n 
1 70  ARG n 
1 71  SER n 
1 72  TYR n 
1 73  GLN n 
1 74  SER n 
1 75  GLU n 
1 76  ASP n 
1 77  LEU n 
1 78  LYS n 
1 79  ARG n 
1 80  GLN n 
1 81  PHE n 
1 82  LYS n 
1 83  ALA n 
1 84  LEU n 
1 85  THR n 
1 86  LYS n 
1 87  LEU n 
1 88  GLY n 
1 89  TYR n 
1 90  ALA n 
1 91  ALA n 
1 92  LEU n 
1 93  PRO n 
1 94  GLU n 
1 95  ASP n 
1 96  ASP n 
1 97  TYR n 
1 98  ALA n 
1 99  GLU n 
1 100 LEU n 
1 101 LEU n 
1 102 ASP n 
1 103 THR n 
1 104 LEU n 
1 105 SER n 
1 106 ALA n 
1 107 MET n 
1 108 GLU n 
1 109 SER n 
1 110 ASN n 
1 111 PHE n 
1 112 ALA n 
1 113 LYS n 
1 114 VAL n 
1 115 LYS n 
1 116 VAL n 
1 117 CYS n 
1 118 ASP n 
1 119 TYR n 
1 120 LYS n 
1 121 ASP n 
1 122 SER n 
1 123 THR n 
1 124 LYS n 
1 125 CYS n 
1 126 ASP n 
1 127 LEU n 
1 128 ALA n 
1 129 LEU n 
1 130 ASP n 
1 131 PRO n 
1 132 GLU n 
1 133 ILE n 
1 134 GLU n 
1 135 GLU n 
1 136 VAL n 
1 137 ILE n 
1 138 SER n 
1 139 LYS n 
1 140 SER n 
1 141 ARG n 
1 142 ASP n 
1 143 HIS n 
1 144 GLU n 
1 145 GLU n 
1 146 LEU n 
1 147 ALA n 
1 148 TYR n 
1 149 TYR n 
1 150 TRP n 
1 151 ARG n 
1 152 GLU n 
1 153 PHE n 
1 154 TYR n 
1 155 ASP n 
1 156 LYS n 
1 157 ALA n 
1 158 GLY n 
1 159 THR n 
1 160 ALA n 
1 161 VAL n 
1 162 ARG n 
1 163 SER n 
1 164 GLN n 
1 165 PHE n 
1 166 GLU n 
1 167 ARG n 
1 168 TYR n 
1 169 VAL n 
1 170 GLU n 
1 171 LEU n 
1 172 ASN n 
1 173 THR n 
1 174 LYS n 
1 175 ALA n 
1 176 ALA n 
1 177 LYS n 
1 178 LEU n 
1 179 ASN n 
1 180 ASN n 
1 181 PHE n 
1 182 THR n 
1 183 SER n 
1 184 GLY n 
1 185 ALA n 
1 186 GLU n 
1 187 ALA n 
1 188 TRP n 
1 189 LEU n 
1 190 ASP n 
1 191 GLU n 
1 192 TYR n 
1 193 GLU n 
1 194 ASP n 
1 195 ASP n 
1 196 THR n 
1 197 PHE n 
1 198 GLU n 
1 199 GLN n 
1 200 GLN n 
1 201 LEU n 
1 202 GLU n 
1 203 ASP n 
1 204 ILE n 
1 205 PHE n 
1 206 ALA n 
1 207 ASP n 
1 208 ILE n 
1 209 ARG n 
1 210 PRO n 
1 211 LEU n 
1 212 TYR n 
1 213 GLN n 
1 214 GLN n 
1 215 ILE n 
1 216 HIS n 
1 217 GLY n 
1 218 TYR n 
1 219 VAL n 
1 220 ARG n 
1 221 PHE n 
1 222 ARG n 
1 223 LEU n 
1 224 ARG n 
1 225 LYS n 
1 226 HIS n 
1 227 TYR n 
1 228 GLY n 
1 229 ASP n 
1 230 ALA n 
1 231 VAL n 
1 232 VAL n 
1 233 SER n 
1 234 GLU n 
1 235 THR n 
1 236 GLY n 
1 237 PRO n 
1 238 ILE n 
1 239 PRO n 
1 240 MET n 
1 241 HIS n 
1 242 LEU n 
1 243 LEU n 
1 244 GLY n 
1 245 ASN n 
1 246 MET n 
1 247 TRP n 
1 248 ALA n 
1 249 GLN n 
1 250 GLN n 
1 251 TRP n 
1 252 SER n 
1 253 GLU n 
1 254 ILE n 
1 255 ALA n 
1 256 ASP n 
1 257 ILE n 
1 258 VAL n 
1 259 SER n 
1 260 PRO n 
1 261 PHE n 
1 262 PRO n 
1 263 GLU n 
1 264 LYS n 
1 265 PRO n 
1 266 LEU n 
1 267 VAL n 
1 268 ASP n 
1 269 VAL n 
1 270 SER n 
1 271 ALA n 
1 272 GLU n 
1 273 MET n 
1 274 GLU n 
1 275 LYS n 
1 276 GLN n 
1 277 GLY n 
1 278 TYR n 
1 279 THR n 
1 280 PRO n 
1 281 LEU n 
1 282 LYS n 
1 283 MET n 
1 284 PHE n 
1 285 GLN n 
1 286 MET n 
1 287 GLY n 
1 288 ASP n 
1 289 ASP n 
1 290 PHE n 
1 291 PHE n 
1 292 THR n 
1 293 SER n 
1 294 MET n 
1 295 ASN n 
1 296 LEU n 
1 297 THR n 
1 298 LYS n 
1 299 LEU n 
1 300 PRO n 
1 301 GLN n 
1 302 ASP n 
1 303 PHE n 
1 304 TRP n 
1 305 ASP n 
1 306 LYS n 
1 307 SER n 
1 308 ILE n 
1 309 ILE n 
1 310 GLU n 
1 311 LYS n 
1 312 PRO n 
1 313 THR n 
1 314 ASP n 
1 315 GLY n 
1 316 ARG n 
1 317 ASP n 
1 318 LEU n 
1 319 VAL n 
1 320 CYS n 
1 321 HIS n 
1 322 ALA n 
1 323 SER n 
1 324 ALA n 
1 325 TRP n 
1 326 ASP n 
1 327 PHE n 
1 328 TYR n 
1 329 LEU n 
1 330 THR n 
1 331 ASP n 
1 332 ASP n 
1 333 VAL n 
1 334 ARG n 
1 335 ILE n 
1 336 LYS n 
1 337 GLN n 
1 338 CYS n 
1 339 THR n 
1 340 ARG n 
1 341 VAL n 
1 342 THR n 
1 343 GLN n 
1 344 ASP n 
1 345 GLN n 
1 346 LEU n 
1 347 PHE n 
1 348 THR n 
1 349 VAL n 
1 350 HIS n 
1 351 HIS n 
1 352 GLU n 
1 353 LEU n 
1 354 GLY n 
1 355 HIS n 
1 356 ILE n 
1 357 GLN n 
1 358 TYR n 
1 359 PHE n 
1 360 LEU n 
1 361 GLN n 
1 362 TYR n 
1 363 GLN n 
1 364 HIS n 
1 365 GLN n 
1 366 PRO n 
1 367 PHE n 
1 368 VAL n 
1 369 TYR n 
1 370 ARG n 
1 371 THR n 
1 372 GLY n 
1 373 ALA n 
1 374 ASN n 
1 375 PRO n 
1 376 GLY n 
1 377 PHE n 
1 378 HIS n 
1 379 GLU n 
1 380 ALA n 
1 381 VAL n 
1 382 GLY n 
1 383 ASP n 
1 384 VAL n 
1 385 LEU n 
1 386 SER n 
1 387 LEU n 
1 388 SER n 
1 389 VAL n 
1 390 SER n 
1 391 THR n 
1 392 PRO n 
1 393 LYS n 
1 394 HIS n 
1 395 LEU n 
1 396 GLU n 
1 397 LYS n 
1 398 ILE n 
1 399 GLY n 
1 400 LEU n 
1 401 LEU n 
1 402 LYS n 
1 403 ASP n 
1 404 TYR n 
1 405 VAL n 
1 406 ARG n 
1 407 ASP n 
1 408 ASP n 
1 409 GLU n 
1 410 ALA n 
1 411 ARG n 
1 412 ILE n 
1 413 ASN n 
1 414 GLN n 
1 415 LEU n 
1 416 PHE n 
1 417 LEU n 
1 418 THR n 
1 419 ALA n 
1 420 LEU n 
1 421 ASP n 
1 422 LYS n 
1 423 ILE n 
1 424 VAL n 
1 425 PHE n 
1 426 LEU n 
1 427 PRO n 
1 428 PHE n 
1 429 ALA n 
1 430 PHE n 
1 431 THR n 
1 432 MET n 
1 433 ASP n 
1 434 LYS n 
1 435 TYR n 
1 436 ARG n 
1 437 TRP n 
1 438 SER n 
1 439 LEU n 
1 440 PHE n 
1 441 ARG n 
1 442 GLY n 
1 443 GLU n 
1 444 VAL n 
1 445 ASP n 
1 446 LYS n 
1 447 ALA n 
1 448 ASN n 
1 449 TRP n 
1 450 ASN n 
1 451 CYS n 
1 452 ALA n 
1 453 PHE n 
1 454 TRP n 
1 455 LYS n 
1 456 LEU n 
1 457 ARG n 
1 458 ASP n 
1 459 GLU n 
1 460 TYR n 
1 461 SER n 
1 462 GLY n 
1 463 ILE n 
1 464 GLU n 
1 465 PRO n 
1 466 PRO n 
1 467 VAL n 
1 468 VAL n 
1 469 ARG n 
1 470 SER n 
1 471 GLU n 
1 472 LYS n 
1 473 ASP n 
1 474 PHE n 
1 475 ASP n 
1 476 ALA n 
1 477 PRO n 
1 478 ALA n 
1 479 LYS n 
1 480 TYR n 
1 481 HIS n 
1 482 ILE n 
1 483 SER n 
1 484 ALA n 
1 485 ASP n 
1 486 VAL n 
1 487 GLU n 
1 488 TYR n 
1 489 LEU n 
1 490 ARG n 
1 491 TYR n 
1 492 LEU n 
1 493 VAL n 
1 494 SER n 
1 495 PHE n 
1 496 ILE n 
1 497 ILE n 
1 498 GLN n 
1 499 PHE n 
1 500 GLN n 
1 501 PHE n 
1 502 TYR n 
1 503 LYS n 
1 504 SER n 
1 505 ALA n 
1 506 CYS n 
1 507 ILE n 
1 508 LYS n 
1 509 ALA n 
1 510 GLY n 
1 511 GLN n 
1 512 TYR n 
1 513 ASP n 
1 514 PRO n 
1 515 ASP n 
1 516 ASN n 
1 517 VAL n 
1 518 GLU n 
1 519 LEU n 
1 520 PRO n 
1 521 LEU n 
1 522 ASP n 
1 523 ASN n 
1 524 CYS n 
1 525 ASP n 
1 526 ILE n 
1 527 TYR n 
1 528 GLY n 
1 529 SER n 
1 530 ALA n 
1 531 ALA n 
1 532 ALA n 
1 533 GLY n 
1 534 ALA n 
1 535 ALA n 
1 536 PHE n 
1 537 HIS n 
1 538 ASN n 
1 539 MET n 
1 540 LEU n 
1 541 SER n 
1 542 MET n 
1 543 GLY n 
1 544 ALA n 
1 545 SER n 
1 546 LYS n 
1 547 PRO n 
1 548 TRP n 
1 549 PRO n 
1 550 ASP n 
1 551 ALA n 
1 552 LEU n 
1 553 GLU n 
1 554 ALA n 
1 555 PHE n 
1 556 ASN n 
1 557 GLY n 
1 558 GLU n 
1 559 ARG n 
1 560 ILE n 
1 561 MET n 
1 562 SER n 
1 563 GLY n 
1 564 LYS n 
1 565 ALA n 
1 566 ILE n 
1 567 ALA n 
1 568 GLU n 
1 569 TYR n 
1 570 PHE n 
1 571 GLU n 
1 572 PRO n 
1 573 LEU n 
1 574 ARG n 
1 575 VAL n 
1 576 TRP n 
1 577 LEU n 
1 578 GLU n 
1 579 ALA n 
1 580 GLU n 
1 581 ASN n 
1 582 ILE n 
1 583 LYS n 
1 584 ASN n 
1 585 ASN n 
1 586 VAL n 
1 587 HIS n 
1 588 ILE n 
1 589 GLY n 
1 590 TRP n 
1 591 THR n 
1 592 THR n 
1 593 SER n 
1 594 ASN n 
1 595 LYS n 
1 596 CYS n 
1 597 VAL n 
1 598 SER n 
2 1   ARG n 
2 2   PRO n 
2 3   PRO n 
2 4   GLY n 
2 5   PHE n 
2 6   SER n 
2 7   PRO n 
2 8   PHE n 
2 9   ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'FRUIT FLY' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'KOMAGATAELLA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     644223 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               GS115 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPIC9 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACE_DROME 1 ? ? Q10714 ? 
2 UNP KNG1_HUMA 2 ? ? P01042 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ASQ A 1 ? 598 ? Q10714 17  ? 614 ? 17 614 
2 2 4ASQ P 1 ? 9   ? P01042 381 ? 389 ? 1  9   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FLC non-polymer                   . 'CITRATE ANION'                          ? 'C6 H5 O7 -3'    189.100 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
ZN  non-polymer                   . 'ZINC ION'                               ? 'Zn 2'           65.409  
# 
_exptl.entry_id          4ASQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.2 
_exptl_crystal.density_percent_sol   71 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '100 MM HEPES 1.3 M SODIUM CITRATE, pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-12-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_wavelength             0.9763 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4ASQ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.97 
_reflns.number_obs                   89919 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.0 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.3 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   83.2 
_reflns_shell.Rmerge_I_obs           0.42 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.30 
_reflns_shell.pdbx_redundancy        1.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4ASQ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     72831 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             86.56 
_refine.ls_d_res_high                            1.99 
_refine.ls_percent_reflns_obs                    98.41 
_refine.ls_R_factor_obs                          0.18132 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18035 
_refine.ls_R_factor_R_free                       0.19987 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3847 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.947 
_refine.B_iso_mean                               29.318 
_refine.aniso_B[1][1]                            -2.43 
_refine.aniso_B[2][2]                            -2.43 
_refine.aniso_B[3][3]                            3.65 
_refine.aniso_B[1][2]                            -1.22 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ONLY RESIDUES 1-3 OF BRADYKININ ARE VISIBLE' 
_refine.pdbx_starting_model                      'PDB ENTRY 2X8Y' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.121 
_refine.pdbx_overall_ESU_R_Free                  0.112 
_refine.overall_SU_ML                            0.077 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             5.865 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4903 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         114 
_refine_hist.number_atoms_solvent             500 
_refine_hist.number_atoms_total               5517 
_refine_hist.d_res_high                       1.99 
_refine_hist.d_res_low                        86.56 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.022  ? 5178 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.914  1.969  ? 7034 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.618  5.000  ? 605  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.289 24.621 ? 264  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.022 15.000 ? 864  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.816 15.000 ? 26   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.067  0.200  ? 756  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 3972 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.223  1.500  ? 3018 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.454  2.000  ? 4867 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.760  3.000  ? 2160 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.335  4.500  ? 2165 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.990 
_refine_ls_shell.d_res_low                        2.042 
_refine_ls_shell.number_reflns_R_work             5379 
_refine_ls_shell.R_factor_R_work                  0.226 
_refine_ls_shell.percent_reflns_obs               98.51 
_refine_ls_shell.R_factor_R_free                  0.262 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             258 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4ASQ 
_struct.title                     'Crystal structure of ANCE in complex with Bradykinin' 
_struct.pdbx_descriptor           'ANGIOTENSIN-CONVERTING ENZYME (E.C.3.4.15.1), BRADYKININ' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ASQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, ZINC METALLOPROTEASE, SUBSTRATE RECOGNITION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 1   ? ASN A 37  ? ALA A 17  ASN A 53  1 ? 37 
HELX_P HELX_P2  2  THR A 39  ? THR A 64  ? THR A 55  THR A 80  1 ? 26 
HELX_P HELX_P3  3  THR A 65  ? PHE A 67  ? THR A 81  PHE A 83  5 ? 3  
HELX_P HELX_P4  4  GLN A 68  ? TYR A 72  ? GLN A 84  TYR A 88  5 ? 5  
HELX_P HELX_P5  5  SER A 74  ? LYS A 86  ? SER A 90  LYS A 102 1 ? 13 
HELX_P HELX_P6  6  LEU A 87  ? LEU A 92  ? LEU A 103 LEU A 108 5 ? 6  
HELX_P HELX_P7  7  PRO A 93  ? VAL A 114 ? PRO A 109 VAL A 130 1 ? 22 
HELX_P HELX_P8  8  PRO A 131 ? SER A 140 ? PRO A 147 SER A 156 1 ? 10 
HELX_P HELX_P9  9  ASP A 142 ? GLY A 158 ? ASP A 158 GLY A 174 1 ? 17 
HELX_P HELX_P10 10 VAL A 161 ? ASN A 179 ? VAL A 177 ASN A 195 1 ? 19 
HELX_P HELX_P11 11 SER A 183 ? ASP A 190 ? SER A 199 ASP A 206 1 ? 8  
HELX_P HELX_P12 12 GLU A 191 ? GLU A 193 ? GLU A 207 GLU A 209 5 ? 3  
HELX_P HELX_P13 13 THR A 196 ? GLY A 228 ? THR A 212 GLY A 244 1 ? 33 
HELX_P HELX_P14 14 HIS A 241 ? LEU A 243 ? HIS A 257 LEU A 259 5 ? 3  
HELX_P HELX_P15 15 TRP A 251 ? GLU A 253 ? TRP A 267 GLU A 269 5 ? 3  
HELX_P HELX_P16 16 ILE A 254 ? SER A 259 ? ILE A 270 SER A 275 1 ? 6  
HELX_P HELX_P17 17 VAL A 269 ? GLN A 276 ? VAL A 285 GLN A 292 1 ? 8  
HELX_P HELX_P18 18 THR A 279 ? MET A 294 ? THR A 295 MET A 310 1 ? 16 
HELX_P HELX_P19 19 PRO A 300 ? SER A 307 ? PRO A 316 SER A 323 1 ? 8  
HELX_P HELX_P20 20 THR A 342 ? GLN A 363 ? THR A 358 GLN A 379 1 ? 22 
HELX_P HELX_P21 21 PRO A 366 ? ARG A 370 ? PRO A 382 ARG A 386 5 ? 5  
HELX_P HELX_P22 22 ASN A 374 ? SER A 390 ? ASN A 390 SER A 406 1 ? 17 
HELX_P HELX_P23 23 THR A 391 ? ILE A 398 ? THR A 407 ILE A 414 1 ? 8  
HELX_P HELX_P24 24 ASP A 407 ? ILE A 423 ? ASP A 423 ILE A 439 1 ? 17 
HELX_P HELX_P25 25 VAL A 424 ? ARG A 441 ? VAL A 440 ARG A 457 1 ? 18 
HELX_P HELX_P26 26 ASP A 445 ? ALA A 447 ? ASP A 461 ALA A 463 5 ? 3  
HELX_P HELX_P27 27 ASN A 448 ? GLY A 462 ? ASN A 464 GLY A 478 1 ? 15 
HELX_P HELX_P28 28 ASP A 475 ? ALA A 478 ? ASP A 491 ALA A 494 5 ? 4  
HELX_P HELX_P29 29 LYS A 479 ? ALA A 484 ? LYS A 495 ALA A 500 1 ? 6  
HELX_P HELX_P30 30 TYR A 488 ? ALA A 509 ? TYR A 504 ALA A 525 1 ? 22 
HELX_P HELX_P31 31 PRO A 520 ? CYS A 524 ? PRO A 536 CYS A 540 5 ? 5  
HELX_P HELX_P32 32 SER A 529 ? SER A 541 ? SER A 545 SER A 557 1 ? 13 
HELX_P HELX_P33 33 PRO A 547 ? GLY A 557 ? PRO A 563 GLY A 573 1 ? 11 
HELX_P HELX_P34 34 GLY A 563 ? ASN A 584 ? GLY A 579 ASN A 600 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 117 SG  ? ? ? 1_555 A CYS 125 SG ? ? A CYS 133  A CYS 141  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf2 disulf ?    ? A CYS 320 SG  ? ? ? 1_555 A CYS 338 SG ? ? A CYS 336  A CYS 354  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf3 disulf ?    ? A CYS 451 SG  ? ? ? 1_555 A CYS 596 SG ? ? A CYS 467  A CYS 612  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf4 disulf ?    ? A CYS 506 SG  ? ? ? 1_555 A CYS 524 SG ? ? A CYS 522  A CYS 540  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
covale1 covale one  ? A ASN 180 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 196  B NAG 1    1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale2 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? B NAG 1    B NAG 2    1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale3 covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? B NAG 2    B BMA 3    1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale4 covale both ? C BMA .   O3  ? ? ? 1_555 C MAN .   C1 ? ? B BMA 3    B MAN 4    1_555 ? ? ? ? ? ? ? 1.446 ? ?               
covale5 covale both ? C BMA .   O6  ? ? ? 1_555 C MAN .   C1 ? ? B BMA 3    B MAN 6    1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale6 covale both ? C MAN .   O6  ? ? ? 1_555 C BMA .   C1 ? ? B MAN 4    B BMA 5    1_555 ? ? ? ? ? ? ? 1.441 ? ?               
metalc1 metalc ?    ? A HIS 351 NE2 ? ? ? 1_555 D ZN  .   ZN ? ? A HIS 367  A ZN  1615 1_555 ? ? ? ? ? ? ? 2.067 ? ?               
metalc2 metalc ?    ? A HIS 355 NE2 ? ? ? 1_555 D ZN  .   ZN ? ? A HIS 371  A ZN  1615 1_555 ? ? ? ? ? ? ? 2.072 ? ?               
metalc3 metalc ?    ? A GLU 379 OE1 ? ? ? 1_555 D ZN  .   ZN ? ? A GLU 395  A ZN  1615 1_555 ? ? ? ? ? ? ? 2.009 ? ?               
metalc4 metalc ?    ? D ZN  .   ZN  ? ? ? 1_555 B ARG 1   O  ? ? A ZN  1615 P ARG 1    1_555 ? ? ? ? ? ? ? 2.493 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           130 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            146 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    131 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     147 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LYS A 115 ? VAL A 116 ? LYS A 131 VAL A 132 
AA 2 LEU A 127 ? ALA A 128 ? LEU A 143 ALA A 144 
AB 1 ILE A 238 ? PRO A 239 ? ILE A 254 PRO A 255 
AB 2 ILE A 463 ? GLU A 464 ? ILE A 479 GLU A 480 
AC 1 SER A 323 ? ASP A 326 ? SER A 339 ASP A 342 
AC 2 VAL A 333 ? LYS A 336 ? VAL A 349 LYS A 352 
AD 1 ARG A 469 ? SER A 470 ? ARG A 485 SER A 486 
AD 2 CYS A 596 ? VAL A 597 ? CYS A 612 VAL A 613 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 116 ? N VAL A 132 O LEU A 127 ? O LEU A 143 
AB 1 2 O ILE A 238 ? O ILE A 254 N GLU A 464 ? N GLU A 480 
AC 1 2 N TRP A 325 ? N TRP A 341 O ARG A 334 ? O ARG A 350 
AD 1 2 O ARG A 469 ? O ARG A 485 N VAL A 597 ? N VAL A 613 
# 
_database_PDB_matrix.entry_id          4ASQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4ASQ 
_atom_sites.fract_transf_matrix[1][1]   0.005776 
_atom_sites.fract_transf_matrix[1][2]   0.003335 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006670 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009835 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? 15.427  38.215 -43.651 1.00 42.50 ? 17   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? 14.412  37.446 -44.428 1.00 42.44 ? 17   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? 13.360  36.844 -43.504 1.00 41.93 ? 17   ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? 13.692  36.223 -42.489 1.00 41.70 ? 17   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? 15.083  36.356 -45.256 1.00 42.91 ? 17   ALA A CB  1 
ATOM   6    N  N   . LEU A 1 2   ? 12.093  37.032 -43.869 1.00 41.63 ? 18   LEU A N   1 
ATOM   7    C  CA  . LEU A 1 2   ? 10.967  36.525 -43.085 1.00 41.16 ? 18   LEU A CA  1 
ATOM   8    C  C   . LEU A 1 2   ? 10.816  35.011 -43.197 1.00 41.08 ? 18   LEU A C   1 
ATOM   9    O  O   . LEU A 1 2   ? 10.372  34.358 -42.250 1.00 40.79 ? 18   LEU A O   1 
ATOM   10   C  CB  . LEU A 1 2   ? 9.664   37.217 -43.500 1.00 41.06 ? 18   LEU A CB  1 
ATOM   11   C  CG  . LEU A 1 2   ? 9.453   38.653 -43.012 1.00 40.97 ? 18   LEU A CG  1 
ATOM   12   C  CD1 . LEU A 1 2   ? 8.447   39.379 -43.893 1.00 41.00 ? 18   LEU A CD1 1 
ATOM   13   C  CD2 . LEU A 1 2   ? 9.012   38.677 -41.554 1.00 40.63 ? 18   LEU A CD2 1 
ATOM   14   N  N   . VAL A 1 3   ? 11.183  34.464 -44.356 1.00 41.32 ? 19   VAL A N   1 
ATOM   15   C  CA  . VAL A 1 3   ? 11.128  33.020 -44.596 1.00 41.31 ? 19   VAL A CA  1 
ATOM   16   C  C   . VAL A 1 3   ? 12.089  32.277 -43.660 1.00 41.04 ? 19   VAL A C   1 
ATOM   17   O  O   . VAL A 1 3   ? 11.721  31.263 -43.063 1.00 40.96 ? 19   VAL A O   1 
ATOM   18   C  CB  . VAL A 1 3   ? 11.421  32.672 -46.084 1.00 41.87 ? 19   VAL A CB  1 
ATOM   19   C  CG1 . VAL A 1 3   ? 11.422  31.160 -46.306 1.00 42.19 ? 19   VAL A CG1 1 
ATOM   20   C  CG2 . VAL A 1 3   ? 10.399  33.336 -47.001 1.00 41.97 ? 19   VAL A CG2 1 
ATOM   21   N  N   . LYS A 1 4   ? 13.306  32.801 -43.527 1.00 40.90 ? 20   LYS A N   1 
ATOM   22   C  CA  . LYS A 1 4   ? 14.313  32.222 -42.637 1.00 40.66 ? 20   LYS A CA  1 
ATOM   23   C  C   . LYS A 1 4   ? 13.913  32.366 -41.165 1.00 39.66 ? 20   LYS A C   1 
ATOM   24   O  O   . LYS A 1 4   ? 14.093  31.437 -40.375 1.00 39.46 ? 20   LYS A O   1 
ATOM   25   C  CB  . LYS A 1 4   ? 15.684  32.866 -42.881 1.00 41.10 ? 20   LYS A CB  1 
ATOM   26   C  CG  . LYS A 1 4   ? 16.830  32.184 -42.142 1.00 42.26 ? 20   LYS A CG  1 
ATOM   27   C  CD  . LYS A 1 4   ? 18.166  32.869 -42.399 1.00 43.97 ? 20   LYS A CD  1 
ATOM   28   C  CE  . LYS A 1 4   ? 19.282  32.187 -41.614 1.00 44.83 ? 20   LYS A CE  1 
ATOM   29   N  NZ  . LYS A 1 4   ? 20.606  32.839 -41.830 1.00 45.81 ? 20   LYS A NZ  1 
ATOM   30   N  N   . GLU A 1 5   ? 13.369  33.530 -40.812 1.00 38.77 ? 21   GLU A N   1 
ATOM   31   C  CA  . GLU A 1 5   ? 12.978  33.822 -39.433 1.00 37.87 ? 21   GLU A CA  1 
ATOM   32   C  C   . GLU A 1 5   ? 11.813  32.952 -38.960 1.00 37.19 ? 21   GLU A C   1 
ATOM   33   O  O   . GLU A 1 5   ? 11.796  32.513 -37.807 1.00 36.85 ? 21   GLU A O   1 
ATOM   34   C  CB  . GLU A 1 5   ? 12.643  35.308 -39.260 1.00 37.71 ? 21   GLU A CB  1 
ATOM   35   C  CG  . GLU A 1 5   ? 12.525  35.747 -37.804 1.00 37.48 ? 21   GLU A CG  1 
ATOM   36   C  CD  . GLU A 1 5   ? 11.930  37.130 -37.654 1.00 37.56 ? 21   GLU A CD  1 
ATOM   37   O  OE1 . GLU A 1 5   ? 12.656  38.121 -37.878 1.00 37.79 ? 21   GLU A OE1 1 
ATOM   38   O  OE2 . GLU A 1 5   ? 10.735  37.226 -37.299 1.00 37.24 ? 21   GLU A OE2 1 
ATOM   39   N  N   . GLU A 1 6   ? 10.852  32.698 -39.850 1.00 36.76 ? 22   GLU A N   1 
ATOM   40   C  CA  . GLU A 1 6   ? 9.702   31.850 -39.524 1.00 36.18 ? 22   GLU A CA  1 
ATOM   41   C  C   . GLU A 1 6   ? 10.124  30.409 -39.212 1.00 36.15 ? 22   GLU A C   1 
ATOM   42   O  O   . GLU A 1 6   ? 9.519   29.751 -38.362 1.00 35.74 ? 22   GLU A O   1 
ATOM   43   C  CB  . GLU A 1 6   ? 8.645   31.887 -40.636 1.00 36.20 ? 22   GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 6   ? 7.269   31.422 -40.167 1.00 35.78 ? 22   GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 6   ? 6.155   31.623 -41.184 1.00 35.71 ? 22   GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 6   ? 6.251   32.524 -42.045 1.00 35.43 ? 22   GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 6   ? 5.156   30.881 -41.102 1.00 35.33 ? 22   GLU A OE2 1 
ATOM   48   N  N   . ILE A 1 7   ? 11.165  29.934 -39.897 1.00 36.36 ? 23   ILE A N   1 
ATOM   49   C  CA  . ILE A 1 7   ? 11.766  28.629 -39.605 1.00 36.52 ? 23   ILE A CA  1 
ATOM   50   C  C   . ILE A 1 7   ? 12.380  28.628 -38.199 1.00 36.29 ? 23   ILE A C   1 
ATOM   51   O  O   . ILE A 1 7   ? 12.147  27.704 -37.416 1.00 36.18 ? 23   ILE A O   1 
ATOM   52   C  CB  . ILE A 1 7   ? 12.818  28.221 -40.678 1.00 37.09 ? 23   ILE A CB  1 
ATOM   53   C  CG1 . ILE A 1 7   ? 12.142  28.037 -42.043 1.00 37.36 ? 23   ILE A CG1 1 
ATOM   54   C  CG2 . ILE A 1 7   ? 13.558  26.940 -40.266 1.00 37.28 ? 23   ILE A CG2 1 
ATOM   55   C  CD1 . ILE A 1 7   ? 13.103  28.003 -43.227 1.00 38.22 ? 23   ILE A CD1 1 
ATOM   56   N  N   . GLN A 1 8   ? 13.140  29.677 -37.885 1.00 36.23 ? 24   GLN A N   1 
ATOM   57   C  CA  . GLN A 1 8   ? 13.753  29.843 -36.562 1.00 36.21 ? 24   GLN A CA  1 
ATOM   58   C  C   . GLN A 1 8   ? 12.707  30.006 -35.457 1.00 35.57 ? 24   GLN A C   1 
ATOM   59   O  O   . GLN A 1 8   ? 12.895  29.520 -34.340 1.00 35.38 ? 24   GLN A O   1 
ATOM   60   C  CB  . GLN A 1 8   ? 14.702  31.043 -36.553 1.00 36.38 ? 24   GLN A CB  1 
ATOM   61   C  CG  . GLN A 1 8   ? 15.943  30.873 -37.423 1.00 37.99 ? 24   GLN A CG  1 
ATOM   62   C  CD  . GLN A 1 8   ? 16.723  32.166 -37.602 1.00 39.38 ? 24   GLN A CD  1 
ATOM   63   O  OE1 . GLN A 1 8   ? 16.161  33.263 -37.547 1.00 39.91 ? 24   GLN A OE1 1 
ATOM   64   N  NE2 . GLN A 1 8   ? 18.027  32.040 -37.827 1.00 40.57 ? 24   GLN A NE2 1 
ATOM   65   N  N   . ALA A 1 9   ? 11.612  30.692 -35.781 1.00 35.07 ? 25   ALA A N   1 
ATOM   66   C  CA  . ALA A 1 9   ? 10.512  30.911 -34.844 1.00 34.52 ? 25   ALA A CA  1 
ATOM   67   C  C   . ALA A 1 9   ? 9.831   29.603 -34.445 1.00 34.41 ? 25   ALA A C   1 
ATOM   68   O  O   . ALA A 1 9   ? 9.451   29.428 -33.287 1.00 34.17 ? 25   ALA A O   1 
ATOM   69   C  CB  . ALA A 1 9   ? 9.502   31.879 -35.431 1.00 34.29 ? 25   ALA A CB  1 
ATOM   70   N  N   . LYS A 1 10  ? 9.688   28.693 -35.408 1.00 34.62 ? 26   LYS A N   1 
ATOM   71   C  CA  . LYS A 1 10  ? 9.106   27.374 -35.166 1.00 34.81 ? 26   LYS A CA  1 
ATOM   72   C  C   . LYS A 1 10  ? 9.949   26.579 -34.166 1.00 34.81 ? 26   LYS A C   1 
ATOM   73   O  O   . LYS A 1 10  ? 9.409   25.934 -33.261 1.00 34.41 ? 26   LYS A O   1 
ATOM   74   C  CB  . LYS A 1 10  ? 8.966   26.605 -36.484 1.00 35.31 ? 26   LYS A CB  1 
ATOM   75   C  CG  . LYS A 1 10  ? 8.114   25.346 -36.396 1.00 36.07 ? 26   LYS A CG  1 
ATOM   76   C  CD  . LYS A 1 10  ? 7.994   24.680 -37.756 1.00 37.92 ? 26   LYS A CD  1 
ATOM   77   C  CE  . LYS A 1 10  ? 7.031   23.507 -37.716 1.00 39.18 ? 26   LYS A CE  1 
ATOM   78   N  NZ  . LYS A 1 10  ? 6.896   22.880 -39.061 1.00 40.66 ? 26   LYS A NZ  1 
ATOM   79   N  N   . GLU A 1 11  ? 11.269  26.640 -34.338 1.00 34.97 ? 27   GLU A N   1 
ATOM   80   C  CA  . GLU A 1 11  ? 12.219  25.993 -33.430 1.00 35.17 ? 27   GLU A CA  1 
ATOM   81   C  C   . GLU A 1 11  ? 12.212  26.668 -32.059 1.00 34.43 ? 27   GLU A C   1 
ATOM   82   O  O   . GLU A 1 11  ? 12.326  25.998 -31.032 1.00 34.27 ? 27   GLU A O   1 
ATOM   83   C  CB  . GLU A 1 11  ? 13.634  26.008 -34.021 1.00 35.85 ? 27   GLU A CB  1 
ATOM   84   C  CG  . GLU A 1 11  ? 13.777  25.238 -35.335 1.00 37.60 ? 27   GLU A CG  1 
ATOM   85   C  CD  . GLU A 1 11  ? 15.192  25.278 -35.901 1.00 39.97 ? 27   GLU A CD  1 
ATOM   86   O  OE1 . GLU A 1 11  ? 16.146  24.951 -35.161 1.00 41.03 ? 27   GLU A OE1 1 
ATOM   87   O  OE2 . GLU A 1 11  ? 15.348  25.629 -37.092 1.00 40.78 ? 27   GLU A OE2 1 
ATOM   88   N  N   . TYR A 1 12  ? 12.077  27.994 -32.056 1.00 33.82 ? 28   TYR A N   1 
ATOM   89   C  CA  . TYR A 1 12  ? 11.963  28.769 -30.822 1.00 33.35 ? 28   TYR A CA  1 
ATOM   90   C  C   . TYR A 1 12  ? 10.737  28.339 -30.013 1.00 32.79 ? 28   TYR A C   1 
ATOM   91   O  O   . TYR A 1 12  ? 10.831  28.134 -28.802 1.00 32.47 ? 28   TYR A O   1 
ATOM   92   C  CB  . TYR A 1 12  ? 11.909  30.275 -31.123 1.00 33.23 ? 28   TYR A CB  1 
ATOM   93   C  CG  . TYR A 1 12  ? 11.573  31.138 -29.922 1.00 33.21 ? 28   TYR A CG  1 
ATOM   94   C  CD1 . TYR A 1 12  ? 12.567  31.551 -29.032 1.00 33.92 ? 28   TYR A CD1 1 
ATOM   95   C  CD2 . TYR A 1 12  ? 10.259  31.542 -29.675 1.00 33.20 ? 28   TYR A CD2 1 
ATOM   96   C  CE1 . TYR A 1 12  ? 12.261  32.342 -27.924 1.00 34.05 ? 28   TYR A CE1 1 
ATOM   97   C  CE2 . TYR A 1 12  ? 9.943   32.329 -28.573 1.00 33.52 ? 28   TYR A CE2 1 
ATOM   98   C  CZ  . TYR A 1 12  ? 10.946  32.725 -27.703 1.00 34.14 ? 28   TYR A CZ  1 
ATOM   99   O  OH  . TYR A 1 12  ? 10.630  33.506 -26.614 1.00 34.72 ? 28   TYR A OH  1 
ATOM   100  N  N   . LEU A 1 13  ? 9.600   28.204 -30.695 1.00 32.44 ? 29   LEU A N   1 
ATOM   101  C  CA  . LEU A 1 13  ? 8.338   27.832 -30.053 1.00 32.20 ? 29   LEU A CA  1 
ATOM   102  C  C   . LEU A 1 13  ? 8.362   26.427 -29.465 1.00 32.50 ? 29   LEU A C   1 
ATOM   103  O  O   . LEU A 1 13  ? 7.874   26.213 -28.352 1.00 32.19 ? 29   LEU A O   1 
ATOM   104  C  CB  . LEU A 1 13  ? 7.160   27.962 -31.026 1.00 31.93 ? 29   LEU A CB  1 
ATOM   105  C  CG  . LEU A 1 13  ? 6.686   29.359 -31.442 1.00 31.70 ? 29   LEU A CG  1 
ATOM   106  C  CD1 . LEU A 1 13  ? 5.662   29.247 -32.559 1.00 31.52 ? 29   LEU A CD1 1 
ATOM   107  C  CD2 . LEU A 1 13  ? 6.106   30.135 -30.265 1.00 31.17 ? 29   LEU A CD2 1 
ATOM   108  N  N   . GLU A 1 14  ? 8.925   25.473 -30.205 1.00 32.99 ? 30   GLU A N   1 
ATOM   109  C  CA  . GLU A 1 14  ? 8.951   24.087 -29.739 1.00 33.59 ? 30   GLU A CA  1 
ATOM   110  C  C   . GLU A 1 14  ? 9.764   23.942 -28.452 1.00 33.35 ? 30   GLU A C   1 
ATOM   111  O  O   . GLU A 1 14  ? 9.347   23.231 -27.536 1.00 33.38 ? 30   GLU A O   1 
ATOM   112  C  CB  . GLU A 1 14  ? 9.445   23.123 -30.822 1.00 34.25 ? 30   GLU A CB  1 
ATOM   113  C  CG  . GLU A 1 14  ? 8.929   21.696 -30.611 1.00 36.33 ? 30   GLU A CG  1 
ATOM   114  C  CD  . GLU A 1 14  ? 9.495   20.683 -31.593 1.00 38.97 ? 30   GLU A CD  1 
ATOM   115  O  OE1 . GLU A 1 14  ? 9.928   21.080 -32.699 1.00 40.24 ? 30   GLU A OE1 1 
ATOM   116  O  OE2 . GLU A 1 14  ? 9.496   19.478 -31.255 1.00 40.24 ? 30   GLU A OE2 1 
ATOM   117  N  N   . ASN A 1 15  ? 10.905  24.632 -28.390 1.00 33.31 ? 31   ASN A N   1 
ATOM   118  C  CA  A ASN A 1 15  ? 11.747  24.629 -27.196 0.50 33.33 ? 31   ASN A CA  1 
ATOM   119  C  CA  B ASN A 1 15  ? 11.756  24.640 -27.198 0.50 33.37 ? 31   ASN A CA  1 
ATOM   120  C  C   . ASN A 1 15  ? 11.091  25.354 -26.020 1.00 32.92 ? 31   ASN A C   1 
ATOM   121  O  O   . ASN A 1 15  ? 11.122  24.866 -24.888 1.00 32.84 ? 31   ASN A O   1 
ATOM   122  C  CB  A ASN A 1 15  ? 13.119  25.234 -27.502 0.50 33.58 ? 31   ASN A CB  1 
ATOM   123  C  CB  B ASN A 1 15  ? 13.110  25.287 -27.512 0.50 33.65 ? 31   ASN A CB  1 
ATOM   124  C  CG  A ASN A 1 15  ? 13.958  24.348 -28.400 0.50 34.02 ? 31   ASN A CG  1 
ATOM   125  C  CG  B ASN A 1 15  ? 14.028  25.343 -26.301 0.50 33.97 ? 31   ASN A CG  1 
ATOM   126  O  OD1 A ASN A 1 15  ? 13.822  23.123 -28.387 0.50 34.27 ? 31   ASN A OD1 1 
ATOM   127  O  OD1 B ASN A 1 15  ? 14.242  24.341 -25.620 0.50 34.51 ? 31   ASN A OD1 1 
ATOM   128  N  ND2 A ASN A 1 15  ? 14.834  24.962 -29.185 0.50 34.09 ? 31   ASN A ND2 1 
ATOM   129  N  ND2 B ASN A 1 15  ? 14.580  26.520 -26.033 0.50 34.30 ? 31   ASN A ND2 1 
ATOM   130  N  N   . LEU A 1 16  ? 10.490  26.510 -26.298 1.00 32.41 ? 32   LEU A N   1 
ATOM   131  C  CA  . LEU A 1 16  ? 9.834   27.317 -25.269 1.00 32.03 ? 32   LEU A CA  1 
ATOM   132  C  C   . LEU A 1 16  ? 8.601   26.639 -24.671 1.00 31.63 ? 32   LEU A C   1 
ATOM   133  O  O   . LEU A 1 16  ? 8.417   26.659 -23.454 1.00 31.48 ? 32   LEU A O   1 
ATOM   134  C  CB  . LEU A 1 16  ? 9.470   28.707 -25.809 1.00 31.74 ? 32   LEU A CB  1 
ATOM   135  C  CG  . LEU A 1 16  ? 8.854   29.701 -24.817 1.00 31.76 ? 32   LEU A CG  1 
ATOM   136  C  CD1 . LEU A 1 16  ? 9.827   30.051 -23.696 1.00 32.00 ? 32   LEU A CD1 1 
ATOM   137  C  CD2 . LEU A 1 16  ? 8.411   30.951 -25.545 1.00 31.92 ? 32   LEU A CD2 1 
ATOM   138  N  N   . ASN A 1 17  ? 7.765   26.047 -25.525 1.00 31.43 ? 33   ASN A N   1 
ATOM   139  C  CA  . ASN A 1 17  ? 6.603   25.285 -25.060 1.00 31.31 ? 33   ASN A CA  1 
ATOM   140  C  C   . ASN A 1 17  ? 7.001   24.194 -24.067 1.00 31.56 ? 33   ASN A C   1 
ATOM   141  O  O   . ASN A 1 17  ? 6.368   24.035 -23.024 1.00 31.46 ? 33   ASN A O   1 
ATOM   142  C  CB  . ASN A 1 17  ? 5.826   24.682 -26.237 1.00 31.19 ? 33   ASN A CB  1 
ATOM   143  C  CG  . ASN A 1 17  ? 4.850   25.664 -26.864 1.00 30.79 ? 33   ASN A CG  1 
ATOM   144  O  OD1 . ASN A 1 17  ? 4.936   25.963 -28.055 1.00 31.43 ? 33   ASN A OD1 1 
ATOM   145  N  ND2 . ASN A 1 17  ? 3.916   26.169 -26.066 1.00 29.60 ? 33   ASN A ND2 1 
ATOM   146  N  N   . LYS A 1 18  ? 8.065   23.463 -24.389 1.00 31.93 ? 34   LYS A N   1 
ATOM   147  C  CA  . LYS A 1 18  ? 8.578   22.412 -23.509 1.00 32.29 ? 34   LYS A CA  1 
ATOM   148  C  C   . LYS A 1 18  ? 9.124   22.981 -22.198 1.00 32.04 ? 34   LYS A C   1 
ATOM   149  O  O   . LYS A 1 18  ? 8.941   22.386 -21.134 1.00 32.16 ? 34   LYS A O   1 
ATOM   150  C  CB  . LYS A 1 18  ? 9.635   21.566 -24.229 1.00 32.99 ? 34   LYS A CB  1 
ATOM   151  C  CG  . LYS A 1 18  ? 9.059   20.700 -25.356 1.00 33.93 ? 34   LYS A CG  1 
ATOM   152  C  CD  . LYS A 1 18  ? 10.095  19.766 -25.976 1.00 35.76 ? 34   LYS A CD  1 
ATOM   153  C  CE  . LYS A 1 18  ? 10.974  20.476 -27.000 1.00 36.64 ? 34   LYS A CE  1 
ATOM   154  N  NZ  . LYS A 1 18  ? 11.639  19.514 -27.925 1.00 37.72 ? 34   LYS A NZ  1 
ATOM   155  N  N   . GLU A 1 19  ? 9.781   24.137 -22.280 1.00 31.63 ? 35   GLU A N   1 
ATOM   156  C  CA  . GLU A 1 19  ? 10.270  24.835 -21.093 1.00 31.37 ? 35   GLU A CA  1 
ATOM   157  C  C   . GLU A 1 19  ? 9.122   25.323 -20.200 1.00 30.72 ? 35   GLU A C   1 
ATOM   158  O  O   . GLU A 1 19  ? 9.178   25.187 -18.977 1.00 30.61 ? 35   GLU A O   1 
ATOM   159  C  CB  . GLU A 1 19  ? 11.180  26.001 -21.487 1.00 31.53 ? 35   GLU A CB  1 
ATOM   160  C  CG  . GLU A 1 19  ? 11.530  26.924 -20.329 1.00 32.14 ? 35   GLU A CG  1 
ATOM   161  C  CD  . GLU A 1 19  ? 12.867  27.611 -20.491 1.00 33.43 ? 35   GLU A CD  1 
ATOM   162  O  OE1 . GLU A 1 19  ? 13.301  27.830 -21.643 1.00 34.16 ? 35   GLU A OE1 1 
ATOM   163  O  OE2 . GLU A 1 19  ? 13.480  27.938 -19.453 1.00 34.30 ? 35   GLU A OE2 1 
ATOM   164  N  N   . LEU A 1 20  ? 8.091   25.891 -20.820 1.00 30.00 ? 36   LEU A N   1 
ATOM   165  C  CA  . LEU A 1 20  ? 6.922   26.378 -20.090 1.00 29.59 ? 36   LEU A CA  1 
ATOM   166  C  C   . LEU A 1 20  ? 6.167   25.254 -19.387 1.00 29.56 ? 36   LEU A C   1 
ATOM   167  O  O   . LEU A 1 20  ? 5.687   25.431 -18.270 1.00 29.38 ? 36   LEU A O   1 
ATOM   168  C  CB  . LEU A 1 20  ? 5.982   27.148 -21.021 1.00 29.19 ? 36   LEU A CB  1 
ATOM   169  C  CG  . LEU A 1 20  ? 6.445   28.533 -21.475 1.00 29.20 ? 36   LEU A CG  1 
ATOM   170  C  CD1 . LEU A 1 20  ? 5.573   29.034 -22.609 1.00 28.81 ? 36   LEU A CD1 1 
ATOM   171  C  CD2 . LEU A 1 20  ? 6.441   29.516 -20.314 1.00 29.21 ? 36   LEU A CD2 1 
ATOM   172  N  N   . ALA A 1 21  ? 6.068   24.101 -20.046 1.00 29.74 ? 37   ALA A N   1 
ATOM   173  C  CA  . ALA A 1 21  ? 5.420   22.927 -19.460 1.00 29.98 ? 37   ALA A CA  1 
ATOM   174  C  C   . ALA A 1 21  ? 6.145   22.480 -18.191 1.00 30.35 ? 37   ALA A C   1 
ATOM   175  O  O   . ALA A 1 21  ? 5.515   22.199 -17.169 1.00 30.27 ? 37   ALA A O   1 
ATOM   176  C  CB  . ALA A 1 21  ? 5.357   21.791 -20.476 1.00 30.18 ? 37   ALA A CB  1 
ATOM   177  N  N   . LYS A 1 22  ? 7.474   22.446 -18.264 1.00 30.79 ? 38   LYS A N   1 
ATOM   178  C  CA  . LYS A 1 22  ? 8.313   22.009 -17.154 1.00 31.37 ? 38   LYS A CA  1 
ATOM   179  C  C   . LYS A 1 22  ? 8.270   22.984 -15.970 1.00 31.38 ? 38   LYS A C   1 
ATOM   180  O  O   . LYS A 1 22  ? 8.214   22.561 -14.812 1.00 31.56 ? 38   LYS A O   1 
ATOM   181  C  CB  . LYS A 1 22  ? 9.751   21.798 -17.645 1.00 31.74 ? 38   LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 22  ? 10.633  20.977 -16.725 1.00 32.31 ? 38   LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 22  ? 10.135  19.547 -16.570 1.00 31.90 ? 38   LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 22  ? 11.269  18.644 -16.124 1.00 32.53 ? 38   LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 22  ? 10.783  17.475 -15.362 1.00 32.28 ? 38   LYS A NZ  1 
ATOM   186  N  N   . ARG A 1 23  ? 8.289   24.281 -16.270 1.00 31.26 ? 39   ARG A N   1 
ATOM   187  C  CA  . ARG A 1 23  ? 8.191   25.326 -15.248 1.00 31.43 ? 39   ARG A CA  1 
ATOM   188  C  C   . ARG A 1 23  ? 6.809   25.366 -14.590 1.00 31.32 ? 39   ARG A C   1 
ATOM   189  O  O   . ARG A 1 23  ? 6.700   25.622 -13.389 1.00 31.43 ? 39   ARG A O   1 
ATOM   190  C  CB  . ARG A 1 23  ? 8.524   26.697 -15.841 1.00 31.26 ? 39   ARG A CB  1 
ATOM   191  C  CG  . ARG A 1 23  ? 9.998   26.908 -16.133 1.00 31.60 ? 39   ARG A CG  1 
ATOM   192  C  CD  . ARG A 1 23  ? 10.220  28.200 -16.893 1.00 31.63 ? 39   ARG A CD  1 
ATOM   193  N  NE  . ARG A 1 23  ? 11.634  28.425 -17.183 1.00 31.77 ? 39   ARG A NE  1 
ATOM   194  C  CZ  . ARG A 1 23  ? 12.467  29.109 -16.402 1.00 32.20 ? 39   ARG A CZ  1 
ATOM   195  N  NH1 . ARG A 1 23  ? 12.037  29.649 -15.267 1.00 31.87 ? 39   ARG A NH1 1 
ATOM   196  N  NH2 . ARG A 1 23  ? 13.736  29.254 -16.760 1.00 32.78 ? 39   ARG A NH2 1 
ATOM   197  N  N   . THR A 1 24  ? 5.766   25.111 -15.378 1.00 31.26 ? 40   THR A N   1 
ATOM   198  C  CA  . THR A 1 24  ? 4.390   25.087 -14.868 1.00 31.32 ? 40   THR A CA  1 
ATOM   199  C  C   . THR A 1 24  ? 4.161   23.858 -13.983 1.00 31.68 ? 40   THR A C   1 
ATOM   200  O  O   . THR A 1 24  ? 3.416   23.925 -13.004 1.00 31.83 ? 40   THR A O   1 
ATOM   201  C  CB  . THR A 1 24  ? 3.345   25.152 -16.009 1.00 30.97 ? 40   THR A CB  1 
ATOM   202  O  OG1 . THR A 1 24  ? 3.646   26.259 -16.869 1.00 30.87 ? 40   THR A OG1 1 
ATOM   203  C  CG2 . THR A 1 24  ? 1.931   25.334 -15.455 1.00 30.96 ? 40   THR A CG2 1 
ATOM   204  N  N   . ASN A 1 25  ? 4.815   22.749 -14.327 1.00 32.04 ? 41   ASN A N   1 
ATOM   205  C  CA  . ASN A 1 25  ? 4.806   21.548 -13.492 1.00 32.34 ? 41   ASN A CA  1 
ATOM   206  C  C   . ASN A 1 25  ? 5.195   21.859 -12.045 1.00 32.63 ? 41   ASN A C   1 
ATOM   207  O  O   . ASN A 1 25  ? 4.514   21.430 -11.111 1.00 32.58 ? 41   ASN A O   1 
ATOM   208  C  CB  . ASN A 1 25  ? 5.728   20.473 -14.076 1.00 32.65 ? 41   ASN A CB  1 
ATOM   209  C  CG  . ASN A 1 25  ? 5.866   19.264 -13.165 1.00 32.99 ? 41   ASN A CG  1 
ATOM   210  O  OD1 . ASN A 1 25  ? 4.965   18.427 -13.078 1.00 33.05 ? 41   ASN A OD1 1 
ATOM   211  N  ND2 . ASN A 1 25  ? 6.995   19.174 -12.477 1.00 32.88 ? 41   ASN A ND2 1 
ATOM   212  N  N   . VAL A 1 26  ? 6.281   22.616 -11.879 1.00 32.84 ? 42   VAL A N   1 
ATOM   213  C  CA  . VAL A 1 26  ? 6.794   23.006 -10.562 1.00 33.23 ? 42   VAL A CA  1 
ATOM   214  C  C   . VAL A 1 26  ? 5.788   23.873 -9.797  1.00 32.84 ? 42   VAL A C   1 
ATOM   215  O  O   . VAL A 1 26  ? 5.538   23.636 -8.610  1.00 32.71 ? 42   VAL A O   1 
ATOM   216  C  CB  . VAL A 1 26  ? 8.168   23.730 -10.668 1.00 33.65 ? 42   VAL A CB  1 
ATOM   217  C  CG1 . VAL A 1 26  ? 8.676   24.145 -9.290  1.00 34.25 ? 42   VAL A CG1 1 
ATOM   218  C  CG2 . VAL A 1 26  ? 9.194   22.841 -11.362 1.00 34.11 ? 42   VAL A CG2 1 
ATOM   219  N  N   . GLU A 1 27  ? 5.217   24.867 -10.480 1.00 32.35 ? 43   GLU A N   1 
ATOM   220  C  CA  . GLU A 1 27  ? 4.187   25.724 -9.888  1.00 32.07 ? 43   GLU A CA  1 
ATOM   221  C  C   . GLU A 1 27  ? 2.959   24.908 -9.482  1.00 31.75 ? 43   GLU A C   1 
ATOM   222  O  O   . GLU A 1 27  ? 2.416   25.101 -8.393  1.00 31.65 ? 43   GLU A O   1 
ATOM   223  C  CB  . GLU A 1 27  ? 3.781   26.850 -10.851 1.00 31.88 ? 43   GLU A CB  1 
ATOM   224  C  CG  . GLU A 1 27  ? 2.804   27.862 -10.245 1.00 32.53 ? 43   GLU A CG  1 
ATOM   225  C  CD  . GLU A 1 27  ? 2.104   28.729 -11.285 1.00 33.72 ? 43   GLU A CD  1 
ATOM   226  O  OE1 . GLU A 1 27  ? 1.725   28.206 -12.356 1.00 33.94 ? 43   GLU A OE1 1 
ATOM   227  O  OE2 . GLU A 1 27  ? 1.927   29.940 -11.023 1.00 33.95 ? 43   GLU A OE2 1 
ATOM   228  N  N   . THR A 1 28  ? 2.541   23.998 -10.362 1.00 31.48 ? 44   THR A N   1 
ATOM   229  C  CA  . THR A 1 28  ? 1.367   23.153 -10.129 1.00 31.41 ? 44   THR A CA  1 
ATOM   230  C  C   . THR A 1 28  ? 1.561   22.235 -8.917  1.00 31.79 ? 44   THR A C   1 
ATOM   231  O  O   . THR A 1 28  ? 0.638   22.052 -8.122  1.00 31.63 ? 44   THR A O   1 
ATOM   232  C  CB  . THR A 1 28  ? 0.998   22.332 -11.390 1.00 31.18 ? 44   THR A CB  1 
ATOM   233  O  OG1 . THR A 1 28  ? 0.907   23.211 -12.515 1.00 30.89 ? 44   THR A OG1 1 
ATOM   234  C  CG2 . THR A 1 28  ? -0.341  21.619 -11.219 1.00 31.29 ? 44   THR A CG2 1 
ATOM   235  N  N   . GLU A 1 29  ? 2.762   21.678 -8.773  1.00 32.25 ? 45   GLU A N   1 
ATOM   236  C  CA  . GLU A 1 29  ? 3.084   20.826 -7.626  1.00 32.79 ? 45   GLU A CA  1 
ATOM   237  C  C   . GLU A 1 29  ? 2.964   21.577 -6.299  1.00 32.65 ? 45   GLU A C   1 
ATOM   238  O  O   . GLU A 1 29  ? 2.416   21.048 -5.328  1.00 32.73 ? 45   GLU A O   1 
ATOM   239  C  CB  . GLU A 1 29  ? 4.477   20.200 -7.773  1.00 33.54 ? 45   GLU A CB  1 
ATOM   240  C  CG  . GLU A 1 29  ? 4.543   19.001 -8.726  1.00 34.68 ? 45   GLU A CG  1 
ATOM   241  C  CD  . GLU A 1 29  ? 3.901   17.728 -8.167  1.00 36.75 ? 45   GLU A CD  1 
ATOM   242  O  OE1 . GLU A 1 29  ? 3.322   17.757 -7.056  1.00 37.37 ? 45   GLU A OE1 1 
ATOM   243  O  OE2 . GLU A 1 29  ? 3.978   16.684 -8.850  1.00 37.57 ? 45   GLU A OE2 1 
ATOM   244  N  N   . ALA A 1 30  ? 3.463   22.812 -6.273  1.00 32.25 ? 46   ALA A N   1 
ATOM   245  C  CA  . ALA A 1 30  ? 3.371   23.670 -5.092  1.00 32.14 ? 46   ALA A CA  1 
ATOM   246  C  C   . ALA A 1 30  ? 1.931   24.094 -4.798  1.00 31.66 ? 46   ALA A C   1 
ATOM   247  O  O   . ALA A 1 30  ? 1.535   24.195 -3.633  1.00 31.58 ? 46   ALA A O   1 
ATOM   248  C  CB  . ALA A 1 30  ? 4.263   24.889 -5.250  1.00 32.17 ? 46   ALA A CB  1 
ATOM   249  N  N   . ALA A 1 31  ? 1.161   24.347 -5.856  1.00 31.04 ? 47   ALA A N   1 
ATOM   250  C  CA  . ALA A 1 31  ? -0.255  24.695 -5.725  1.00 30.80 ? 47   ALA A CA  1 
ATOM   251  C  C   . ALA A 1 31  ? -1.059  23.502 -5.206  1.00 30.83 ? 47   ALA A C   1 
ATOM   252  O  O   . ALA A 1 31  ? -1.955  23.664 -4.374  1.00 30.74 ? 47   ALA A O   1 
ATOM   253  C  CB  . ALA A 1 31  ? -0.817  25.191 -7.056  1.00 30.21 ? 47   ALA A CB  1 
ATOM   254  N  N   . TRP A 1 32  ? -0.723  22.312 -5.701  1.00 31.07 ? 48   TRP A N   1 
ATOM   255  C  CA  . TRP A 1 32  ? -1.328  21.062 -5.240  1.00 31.44 ? 48   TRP A CA  1 
ATOM   256  C  C   . TRP A 1 32  ? -1.060  20.830 -3.752  1.00 31.98 ? 48   TRP A C   1 
ATOM   257  O  O   . TRP A 1 32  ? -1.973  20.476 -3.003  1.00 31.97 ? 48   TRP A O   1 
ATOM   258  C  CB  . TRP A 1 32  ? -0.818  19.874 -6.067  1.00 31.57 ? 48   TRP A CB  1 
ATOM   259  C  CG  . TRP A 1 32  ? -1.123  18.532 -5.449  1.00 31.85 ? 48   TRP A CG  1 
ATOM   260  C  CD1 . TRP A 1 32  ? -0.316  17.809 -4.613  1.00 32.42 ? 48   TRP A CD1 1 
ATOM   261  C  CD2 . TRP A 1 32  ? -2.322  17.764 -5.611  1.00 31.68 ? 48   TRP A CD2 1 
ATOM   262  N  NE1 . TRP A 1 32  ? -0.940  16.640 -4.246  1.00 32.69 ? 48   TRP A NE1 1 
ATOM   263  C  CE2 . TRP A 1 32  ? -2.170  16.586 -4.846  1.00 32.17 ? 48   TRP A CE2 1 
ATOM   264  C  CE3 . TRP A 1 32  ? -3.510  17.955 -6.333  1.00 31.19 ? 48   TRP A CE3 1 
ATOM   265  C  CZ2 . TRP A 1 32  ? -3.163  15.601 -4.781  1.00 32.16 ? 48   TRP A CZ2 1 
ATOM   266  C  CZ3 . TRP A 1 32  ? -4.495  16.976 -6.268  1.00 31.34 ? 48   TRP A CZ3 1 
ATOM   267  C  CH2 . TRP A 1 32  ? -4.315  15.814 -5.495  1.00 31.69 ? 48   TRP A CH2 1 
ATOM   268  N  N   . ALA A 1 33  ? 0.191   21.036 -3.341  1.00 32.49 ? 49   ALA A N   1 
ATOM   269  C  CA  . ALA A 1 33  ? 0.611   20.833 -1.953  1.00 33.13 ? 49   ALA A CA  1 
ATOM   270  C  C   . ALA A 1 33  ? -0.133  21.760 -0.993  1.00 33.16 ? 49   ALA A C   1 
ATOM   271  O  O   . ALA A 1 33  ? -0.487  21.360 0.119   1.00 33.41 ? 49   ALA A O   1 
ATOM   272  C  CB  . ALA A 1 33  ? 2.116   21.023 -1.821  1.00 33.54 ? 49   ALA A CB  1 
ATOM   273  N  N   . TYR A 1 34  ? -0.372  22.992 -1.437  1.00 32.91 ? 50   TYR A N   1 
ATOM   274  C  CA  . TYR A 1 34  ? -1.087  23.977 -0.634  1.00 33.02 ? 50   TYR A CA  1 
ATOM   275  C  C   . TYR A 1 34  ? -2.580  23.668 -0.517  1.00 32.73 ? 50   TYR A C   1 
ATOM   276  O  O   . TYR A 1 34  ? -3.141  23.721 0.579   1.00 32.67 ? 50   TYR A O   1 
ATOM   277  C  CB  . TYR A 1 34  ? -0.881  25.387 -1.197  1.00 32.88 ? 50   TYR A CB  1 
ATOM   278  C  CG  . TYR A 1 34  ? -1.695  26.444 -0.485  1.00 33.36 ? 50   TYR A CG  1 
ATOM   279  C  CD1 . TYR A 1 34  ? -1.362  26.848 0.808   1.00 34.50 ? 50   TYR A CD1 1 
ATOM   280  C  CD2 . TYR A 1 34  ? -2.803  27.033 -1.096  1.00 33.69 ? 50   TYR A CD2 1 
ATOM   281  C  CE1 . TYR A 1 34  ? -2.105  27.813 1.473   1.00 35.28 ? 50   TYR A CE1 1 
ATOM   282  C  CE2 . TYR A 1 34  ? -3.553  28.005 -0.438  1.00 34.33 ? 50   TYR A CE2 1 
ATOM   283  C  CZ  . TYR A 1 34  ? -3.196  28.388 0.848   1.00 35.17 ? 50   TYR A CZ  1 
ATOM   284  O  OH  . TYR A 1 34  ? -3.923  29.345 1.515   1.00 36.20 ? 50   TYR A OH  1 
ATOM   285  N  N   . GLY A 1 35  ? -3.212  23.357 -1.647  1.00 32.40 ? 51   GLY A N   1 
ATOM   286  C  CA  . GLY A 1 35  ? -4.647  23.067 -1.692  1.00 32.39 ? 51   GLY A CA  1 
ATOM   287  C  C   . GLY A 1 35  ? -5.040  21.824 -0.913  1.00 32.95 ? 51   GLY A C   1 
ATOM   288  O  O   . GLY A 1 35  ? -6.154  21.734 -0.395  1.00 32.72 ? 51   GLY A O   1 
ATOM   289  N  N   . SER A 1 36  ? -4.118  20.868 -0.830  1.00 33.62 ? 52   SER A N   1 
ATOM   290  C  CA  . SER A 1 36  ? -4.352  19.618 -0.117  1.00 34.42 ? 52   SER A CA  1 
ATOM   291  C  C   . SER A 1 36  ? -3.931  19.702 1.351   1.00 35.08 ? 52   SER A C   1 
ATOM   292  O  O   . SER A 1 36  ? -4.258  18.819 2.147   1.00 35.48 ? 52   SER A O   1 
ATOM   293  C  CB  . SER A 1 36  ? -3.617  18.473 -0.814  1.00 34.57 ? 52   SER A CB  1 
ATOM   294  O  OG  . SER A 1 36  ? -2.215  18.657 -0.759  1.00 35.51 ? 52   SER A OG  1 
ATOM   295  N  N   . ASN A 1 37  ? -3.214  20.769 1.698   1.00 35.48 ? 53   ASN A N   1 
ATOM   296  C  CA  . ASN A 1 37  ? -2.644  20.949 3.033   1.00 36.38 ? 53   ASN A CA  1 
ATOM   297  C  C   . ASN A 1 37  ? -2.324  22.433 3.275   1.00 36.12 ? 53   ASN A C   1 
ATOM   298  O  O   . ASN A 1 37  ? -1.199  22.884 3.046   1.00 36.08 ? 53   ASN A O   1 
ATOM   299  C  CB  . ASN A 1 37  ? -1.394  20.059 3.185   1.00 37.26 ? 53   ASN A CB  1 
ATOM   300  C  CG  . ASN A 1 37  ? -0.754  20.144 4.568   1.00 39.46 ? 53   ASN A CG  1 
ATOM   301  O  OD1 . ASN A 1 37  ? -1.417  20.434 5.566   1.00 39.77 ? 53   ASN A OD1 1 
ATOM   302  N  ND2 . ASN A 1 37  ? 0.557   19.879 4.620   1.00 42.74 ? 53   ASN A ND2 1 
ATOM   303  N  N   . ILE A 1 38  ? -3.330  23.187 3.720   1.00 35.78 ? 54   ILE A N   1 
ATOM   304  C  CA  . ILE A 1 38  ? -3.192  24.635 3.907   1.00 35.64 ? 54   ILE A CA  1 
ATOM   305  C  C   . ILE A 1 38  ? -2.380  24.984 5.155   1.00 36.52 ? 54   ILE A C   1 
ATOM   306  O  O   . ILE A 1 38  ? -2.840  24.798 6.286   1.00 36.74 ? 54   ILE A O   1 
ATOM   307  C  CB  . ILE A 1 38  ? -4.568  25.359 3.939   1.00 35.19 ? 54   ILE A CB  1 
ATOM   308  C  CG1 . ILE A 1 38  ? -5.305  25.174 2.608   1.00 34.31 ? 54   ILE A CG1 1 
ATOM   309  C  CG2 . ILE A 1 38  ? -4.394  26.852 4.253   1.00 34.83 ? 54   ILE A CG2 1 
ATOM   310  C  CD1 . ILE A 1 38  ? -6.744  25.647 2.620   1.00 34.04 ? 54   ILE A CD1 1 
ATOM   311  N  N   . THR A 1 39  ? -1.164  25.478 4.927   1.00 36.98 ? 55   THR A N   1 
ATOM   312  C  CA  . THR A 1 39  ? -0.293  25.987 5.988   1.00 37.91 ? 55   THR A CA  1 
ATOM   313  C  C   . THR A 1 39  ? 0.389   27.270 5.510   1.00 38.21 ? 55   THR A C   1 
ATOM   314  O  O   . THR A 1 39  ? 0.440   27.539 4.304   1.00 37.69 ? 55   THR A O   1 
ATOM   315  C  CB  . THR A 1 39  ? 0.805   24.968 6.393   1.00 38.43 ? 55   THR A CB  1 
ATOM   316  O  OG1 . THR A 1 39  ? 1.641   24.680 5.266   1.00 38.09 ? 55   THR A OG1 1 
ATOM   317  C  CG2 . THR A 1 39  ? 0.201   23.670 6.929   1.00 38.56 ? 55   THR A CG2 1 
ATOM   318  N  N   . ASP A 1 40  ? 0.915   28.050 6.452   1.00 39.12 ? 56   ASP A N   1 
ATOM   319  C  CA  . ASP A 1 40  ? 1.673   29.260 6.124   1.00 39.66 ? 56   ASP A CA  1 
ATOM   320  C  C   . ASP A 1 40  ? 2.919   28.947 5.294   1.00 39.89 ? 56   ASP A C   1 
ATOM   321  O  O   . ASP A 1 40  ? 3.270   29.706 4.386   1.00 39.69 ? 56   ASP A O   1 
ATOM   322  C  CB  . ASP A 1 40  ? 2.055   30.029 7.395   1.00 40.33 ? 56   ASP A CB  1 
ATOM   323  C  CG  . ASP A 1 40  ? 0.867   30.730 8.039   1.00 40.88 ? 56   ASP A CG  1 
ATOM   324  O  OD1 . ASP A 1 40  ? -0.228  30.750 7.437   1.00 40.79 ? 56   ASP A OD1 1 
ATOM   325  O  OD2 . ASP A 1 40  ? 1.031   31.271 9.153   1.00 42.32 ? 56   ASP A OD2 1 
ATOM   326  N  N   . GLU A 1 41  ? 3.567   27.823 5.606   1.00 40.54 ? 57   GLU A N   1 
ATOM   327  C  CA  . GLU A 1 41  ? 4.753   27.363 4.880   1.00 41.04 ? 57   GLU A CA  1 
ATOM   328  C  C   . GLU A 1 41  ? 4.436   27.012 3.424   1.00 40.29 ? 57   GLU A C   1 
ATOM   329  O  O   . GLU A 1 41  ? 5.167   27.408 2.515   1.00 40.12 ? 57   GLU A O   1 
ATOM   330  C  CB  . GLU A 1 41  ? 5.393   26.162 5.589   1.00 41.80 ? 57   GLU A CB  1 
ATOM   331  C  CG  . GLU A 1 41  ? 6.759   25.752 5.028   1.00 43.55 ? 57   GLU A CG  1 
ATOM   332  C  CD  . GLU A 1 41  ? 7.320   24.481 5.660   1.00 45.82 ? 57   GLU A CD  1 
ATOM   333  O  OE1 . GLU A 1 41  ? 6.945   24.150 6.806   1.00 47.02 ? 57   GLU A OE1 1 
ATOM   334  O  OE2 . GLU A 1 41  ? 8.152   23.814 5.006   1.00 46.90 ? 57   GLU A OE2 1 
ATOM   335  N  N   . ASN A 1 42  ? 3.349   26.270 3.215   1.00 39.89 ? 58   ASN A N   1 
ATOM   336  C  CA  . ASN A 1 42  ? 2.930   25.862 1.873   1.00 39.32 ? 58   ASN A CA  1 
ATOM   337  C  C   . ASN A 1 42  ? 2.414   27.023 1.025   1.00 38.82 ? 58   ASN A C   1 
ATOM   338  O  O   . ASN A 1 42  ? 2.578   27.023 -0.197  1.00 38.42 ? 58   ASN A O   1 
ATOM   339  C  CB  . ASN A 1 42  ? 1.885   24.743 1.941   1.00 39.11 ? 58   ASN A CB  1 
ATOM   340  C  CG  . ASN A 1 42  ? 2.476   23.409 2.378   1.00 39.65 ? 58   ASN A CG  1 
ATOM   341  O  OD1 . ASN A 1 42  ? 3.695   23.232 2.414   1.00 39.83 ? 58   ASN A OD1 1 
ATOM   342  N  ND2 . ASN A 1 42  ? 1.606   22.461 2.709   1.00 39.53 ? 58   ASN A ND2 1 
ATOM   343  N  N   . GLU A 1 43  ? 1.792   28.002 1.682   1.00 38.89 ? 59   GLU A N   1 
ATOM   344  C  CA  . GLU A 1 43  ? 1.350   29.235 1.029   1.00 38.76 ? 59   GLU A CA  1 
ATOM   345  C  C   . GLU A 1 43  ? 2.554   30.003 0.488   1.00 38.82 ? 59   GLU A C   1 
ATOM   346  O  O   . GLU A 1 43  ? 2.559   30.437 -0.668  1.00 38.26 ? 59   GLU A O   1 
ATOM   347  C  CB  . GLU A 1 43  ? 0.564   30.113 2.007   1.00 38.93 ? 59   GLU A CB  1 
ATOM   348  C  CG  . GLU A 1 43  ? -0.070  31.349 1.366   1.00 39.86 ? 59   GLU A CG  1 
ATOM   349  C  CD  . GLU A 1 43  ? -0.664  32.319 2.379   1.00 41.72 ? 59   GLU A CD  1 
ATOM   350  O  OE1 . GLU A 1 43  ? -0.887  31.928 3.545   1.00 43.09 ? 59   GLU A OE1 1 
ATOM   351  O  OE2 . GLU A 1 43  ? -0.915  33.484 2.003   1.00 42.73 ? 59   GLU A OE2 1 
ATOM   352  N  N   . LYS A 1 44  ? 3.569   30.148 1.340   1.00 39.30 ? 60   LYS A N   1 
ATOM   353  C  CA  . LYS A 1 44  ? 4.809   30.841 1.002   1.00 39.56 ? 60   LYS A CA  1 
ATOM   354  C  C   . LYS A 1 44  ? 5.504   30.193 -0.195  1.00 39.27 ? 60   LYS A C   1 
ATOM   355  O  O   . LYS A 1 44  ? 5.942   30.891 -1.110  1.00 39.10 ? 60   LYS A O   1 
ATOM   356  C  CB  . LYS A 1 44  ? 5.741   30.869 2.218   1.00 40.37 ? 60   LYS A CB  1 
ATOM   357  C  CG  . LYS A 1 44  ? 6.861   31.896 2.139   1.00 41.33 ? 60   LYS A CG  1 
ATOM   358  C  CD  . LYS A 1 44  ? 7.677   31.908 3.427   1.00 42.93 ? 60   LYS A CD  1 
ATOM   359  C  CE  . LYS A 1 44  ? 8.769   32.972 3.394   1.00 43.99 ? 60   LYS A CE  1 
ATOM   360  N  NZ  . LYS A 1 44  ? 9.846   32.661 2.409   1.00 44.52 ? 60   LYS A NZ  1 
ATOM   361  N  N   . LYS A 1 45  ? 5.584   28.862 -0.185  1.00 39.14 ? 61   LYS A N   1 
ATOM   362  C  CA  . LYS A 1 45  ? 6.208   28.099 -1.268  1.00 38.90 ? 61   LYS A CA  1 
ATOM   363  C  C   . LYS A 1 45  ? 5.457   28.256 -2.589  1.00 38.03 ? 61   LYS A C   1 
ATOM   364  O  O   . LYS A 1 45  ? 6.069   28.511 -3.628  1.00 37.80 ? 61   LYS A O   1 
ATOM   365  C  CB  . LYS A 1 45  ? 6.311   26.616 -0.902  1.00 39.22 ? 61   LYS A CB  1 
ATOM   366  C  CG  . LYS A 1 45  ? 7.348   26.296 0.162   1.00 40.54 ? 61   LYS A CG  1 
ATOM   367  C  CD  . LYS A 1 45  ? 7.321   24.816 0.507   1.00 41.84 ? 61   LYS A CD  1 
ATOM   368  C  CE  . LYS A 1 45  ? 8.216   24.509 1.691   1.00 43.22 ? 61   LYS A CE  1 
ATOM   369  N  NZ  . LYS A 1 45  ? 8.288   23.042 1.953   1.00 44.16 ? 61   LYS A NZ  1 
ATOM   370  N  N   . LYS A 1 46  ? 4.134   28.099 -2.532  1.00 37.30 ? 62   LYS A N   1 
ATOM   371  C  CA  . LYS A 1 46  ? 3.258   28.243 -3.696  1.00 36.59 ? 62   LYS A CA  1 
ATOM   372  C  C   . LYS A 1 46  ? 3.395   29.622 -4.343  1.00 36.02 ? 62   LYS A C   1 
ATOM   373  O  O   . LYS A 1 46  ? 3.555   29.727 -5.561  1.00 35.74 ? 62   LYS A O   1 
ATOM   374  C  CB  . LYS A 1 46  ? 1.801   27.967 -3.293  1.00 36.43 ? 62   LYS A CB  1 
ATOM   375  C  CG  . LYS A 1 46  ? 0.737   28.457 -4.270  1.00 36.74 ? 62   LYS A CG  1 
ATOM   376  C  CD  . LYS A 1 46  ? -0.643  28.416 -3.619  1.00 37.66 ? 62   LYS A CD  1 
ATOM   377  C  CE  . LYS A 1 46  ? -1.617  29.386 -4.275  1.00 38.59 ? 62   LYS A CE  1 
ATOM   378  N  NZ  . LYS A 1 46  ? -2.071  28.933 -5.623  1.00 38.88 ? 62   LYS A NZ  1 
ATOM   379  N  N   . ASN A 1 47  ? 3.345   30.666 -3.519  1.00 35.82 ? 63   ASN A N   1 
ATOM   380  C  CA  . ASN A 1 47  ? 3.399   32.046 -4.001  1.00 35.43 ? 63   ASN A CA  1 
ATOM   381  C  C   . ASN A 1 47  ? 4.779   32.490 -4.489  1.00 35.67 ? 63   ASN A C   1 
ATOM   382  O  O   . ASN A 1 47  ? 4.878   33.320 -5.392  1.00 35.42 ? 63   ASN A O   1 
ATOM   383  C  CB  . ASN A 1 47  ? 2.861   33.010 -2.938  1.00 35.37 ? 63   ASN A CB  1 
ATOM   384  C  CG  . ASN A 1 47  ? 1.355   32.884 -2.738  1.00 34.61 ? 63   ASN A CG  1 
ATOM   385  O  OD1 . ASN A 1 47  ? 0.652   32.294 -3.560  1.00 33.54 ? 63   ASN A OD1 1 
ATOM   386  N  ND2 . ASN A 1 47  ? 0.856   33.447 -1.644  1.00 34.29 ? 63   ASN A ND2 1 
ATOM   387  N  N   . GLU A 1 48  ? 5.836   31.939 -3.894  1.00 36.14 ? 64   GLU A N   1 
ATOM   388  C  CA  . GLU A 1 48  ? 7.203   32.257 -4.312  1.00 36.46 ? 64   GLU A CA  1 
ATOM   389  C  C   . GLU A 1 48  ? 7.552   31.642 -5.667  1.00 35.82 ? 64   GLU A C   1 
ATOM   390  O  O   . GLU A 1 48  ? 8.235   32.269 -6.479  1.00 35.84 ? 64   GLU A O   1 
ATOM   391  C  CB  . GLU A 1 48  ? 8.224   31.853 -3.241  1.00 37.30 ? 64   GLU A CB  1 
ATOM   392  C  CG  . GLU A 1 48  ? 8.338   32.866 -2.099  1.00 39.14 ? 64   GLU A CG  1 
ATOM   393  C  CD  . GLU A 1 48  ? 9.466   32.566 -1.119  1.00 41.94 ? 64   GLU A CD  1 
ATOM   394  O  OE1 . GLU A 1 48  ? 9.958   31.414 -1.075  1.00 42.98 ? 64   GLU A OE1 1 
ATOM   395  O  OE2 . GLU A 1 48  ? 9.861   33.496 -0.381  1.00 43.35 ? 64   GLU A OE2 1 
ATOM   396  N  N   . ILE A 1 49  ? 7.071   30.425 -5.909  1.00 35.23 ? 65   ILE A N   1 
ATOM   397  C  CA  . ILE A 1 49  ? 7.287   29.751 -7.189  1.00 34.68 ? 65   ILE A CA  1 
ATOM   398  C  C   . ILE A 1 49  ? 6.461   30.412 -8.303  1.00 33.86 ? 65   ILE A C   1 
ATOM   399  O  O   . ILE A 1 49  ? 6.926   30.531 -9.441  1.00 33.56 ? 65   ILE A O   1 
ATOM   400  C  CB  . ILE A 1 49  ? 7.030   28.224 -7.085  1.00 34.89 ? 65   ILE A CB  1 
ATOM   401  C  CG1 . ILE A 1 49  ? 8.053   27.595 -6.128  1.00 35.73 ? 65   ILE A CG1 1 
ATOM   402  C  CG2 . ILE A 1 49  ? 7.126   27.558 -8.455  1.00 34.57 ? 65   ILE A CG2 1 
ATOM   403  C  CD1 . ILE A 1 49  ? 7.670   26.232 -5.575  1.00 36.61 ? 65   ILE A CD1 1 
ATOM   404  N  N   . SER A 1 50  ? 5.252   30.858 -7.963  1.00 33.17 ? 66   SER A N   1 
ATOM   405  C  CA  . SER A 1 50  ? 4.402   31.595 -8.905  1.00 32.42 ? 66   SER A CA  1 
ATOM   406  C  C   . SER A 1 50  ? 5.051   32.909 -9.334  1.00 32.24 ? 66   SER A C   1 
ATOM   407  O  O   . SER A 1 50  ? 5.011   33.271 -10.513 1.00 31.81 ? 66   SER A O   1 
ATOM   408  C  CB  . SER A 1 50  ? 3.019   31.860 -8.303  1.00 32.11 ? 66   SER A CB  1 
ATOM   409  O  OG  . SER A 1 50  ? 2.255   30.670 -8.253  1.00 32.14 ? 66   SER A OG  1 
ATOM   410  N  N   . ALA A 1 51  ? 5.648   33.609 -8.368  1.00 32.38 ? 67   ALA A N   1 
ATOM   411  C  CA  . ALA A 1 51  ? 6.380   34.849 -8.624  1.00 32.41 ? 67   ALA A CA  1 
ATOM   412  C  C   . ALA A 1 51  ? 7.556   34.610 -9.573  1.00 32.50 ? 67   ALA A C   1 
ATOM   413  O  O   . ALA A 1 51  ? 7.838   35.436 -10.443 1.00 32.55 ? 67   ALA A O   1 
ATOM   414  C  CB  . ALA A 1 51  ? 6.860   35.460 -7.314  1.00 32.90 ? 67   ALA A CB  1 
ATOM   415  N  N   . GLU A 1 52  ? 8.222   33.469 -9.403  1.00 32.57 ? 68   GLU A N   1 
ATOM   416  C  CA  . GLU A 1 52  ? 9.332   33.060 -10.262 1.00 32.58 ? 68   GLU A CA  1 
ATOM   417  C  C   . GLU A 1 52  ? 8.870   32.792 -11.698 1.00 32.04 ? 68   GLU A C   1 
ATOM   418  O  O   . GLU A 1 52  ? 9.520   33.228 -12.650 1.00 31.97 ? 68   GLU A O   1 
ATOM   419  C  CB  . GLU A 1 52  ? 10.029  31.827 -9.675  0.50 32.84 ? 68   GLU A CB  1 
ATOM   420  C  CG  . GLU A 1 52  ? 11.305  31.410 -10.389 0.50 33.21 ? 68   GLU A CG  1 
ATOM   421  C  CD  . GLU A 1 52  ? 12.021  30.287 -9.672  0.50 33.69 ? 68   GLU A CD  1 
ATOM   422  O  OE1 . GLU A 1 52  ? 11.711  30.051 -8.486  0.50 33.73 ? 68   GLU A OE1 1 
ATOM   423  O  OE2 . GLU A 1 52  ? 12.893  29.642 -10.290 0.50 33.93 ? 68   GLU A OE2 1 
ATOM   424  N  N   . LEU A 1 53  ? 7.752   32.080 -11.850 1.00 31.59 ? 69   LEU A N   1 
ATOM   425  C  CA  . LEU A 1 53  ? 7.197   31.798 -13.176 1.00 31.25 ? 69   LEU A CA  1 
ATOM   426  C  C   . LEU A 1 53  ? 6.695   33.071 -13.863 1.00 30.95 ? 69   LEU A C   1 
ATOM   427  O  O   . LEU A 1 53  ? 6.895   33.244 -15.066 1.00 30.74 ? 69   LEU A O   1 
ATOM   428  C  CB  . LEU A 1 53  ? 6.090   30.735 -13.112 1.00 31.12 ? 69   LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 53  ? 5.376   30.345 -14.419 1.00 31.06 ? 69   LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 53  ? 6.337   29.796 -15.476 1.00 31.37 ? 69   LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 53  ? 4.262   29.351 -14.152 1.00 31.38 ? 69   LEU A CD2 1 
ATOM   432  N  N   . ALA A 1 54  ? 6.056   33.955 -13.097 1.00 30.84 ? 70   ALA A N   1 
ATOM   433  C  CA  . ALA A 1 54  ? 5.588   35.243 -13.619 1.00 30.84 ? 70   ALA A CA  1 
ATOM   434  C  C   . ALA A 1 54  ? 6.745   36.055 -14.201 1.00 31.18 ? 70   ALA A C   1 
ATOM   435  O  O   . ALA A 1 54  ? 6.613   36.666 -15.265 1.00 30.90 ? 70   ALA A O   1 
ATOM   436  C  CB  . ALA A 1 54  ? 4.879   36.032 -12.537 1.00 30.69 ? 70   ALA A CB  1 
ATOM   437  N  N   . LYS A 1 55  ? 7.874   36.045 -13.493 1.00 31.78 ? 71   LYS A N   1 
ATOM   438  C  CA  . LYS A 1 55  ? 9.092   36.722 -13.925 1.00 32.40 ? 71   LYS A CA  1 
ATOM   439  C  C   . LYS A 1 55  ? 9.566   36.180 -15.274 1.00 32.30 ? 71   LYS A C   1 
ATOM   440  O  O   . LYS A 1 55  ? 9.941   36.950 -16.162 1.00 32.33 ? 71   LYS A O   1 
ATOM   441  C  CB  . LYS A 1 55  ? 10.185  36.553 -12.867 1.00 33.02 ? 71   LYS A CB  1 
ATOM   442  C  CG  . LYS A 1 55  ? 11.297  37.579 -12.932 1.00 34.43 ? 71   LYS A CG  1 
ATOM   443  C  CD  . LYS A 1 55  ? 12.179  37.483 -11.692 1.00 36.48 ? 71   LYS A CD  1 
ATOM   444  C  CE  . LYS A 1 55  ? 13.038  38.726 -11.519 1.00 38.05 ? 71   LYS A CE  1 
ATOM   445  N  NZ  . LYS A 1 55  ? 14.126  38.815 -12.532 1.00 39.11 ? 71   LYS A NZ  1 
ATOM   446  N  N   . PHE A 1 56  ? 9.536   34.856 -15.421 1.00 32.23 ? 72   PHE A N   1 
ATOM   447  C  CA  . PHE A 1 56  ? 9.913   34.207 -16.673 1.00 32.29 ? 72   PHE A CA  1 
ATOM   448  C  C   . PHE A 1 56  ? 8.939   34.551 -17.803 1.00 32.05 ? 72   PHE A C   1 
ATOM   449  O  O   . PHE A 1 56  ? 9.364   34.784 -18.936 1.00 31.91 ? 72   PHE A O   1 
ATOM   450  C  CB  . PHE A 1 56  ? 10.020  32.688 -16.496 1.00 32.24 ? 72   PHE A CB  1 
ATOM   451  C  CG  . PHE A 1 56  ? 10.435  31.961 -17.745 1.00 32.15 ? 72   PHE A CG  1 
ATOM   452  C  CD1 . PHE A 1 56  ? 11.759  31.990 -18.176 1.00 32.49 ? 72   PHE A CD1 1 
ATOM   453  C  CD2 . PHE A 1 56  ? 9.501   31.257 -18.499 1.00 31.42 ? 72   PHE A CD2 1 
ATOM   454  C  CE1 . PHE A 1 56  ? 12.147  31.325 -19.336 1.00 32.59 ? 72   PHE A CE1 1 
ATOM   455  C  CE2 . PHE A 1 56  ? 9.881   30.588 -19.657 1.00 31.45 ? 72   PHE A CE2 1 
ATOM   456  C  CZ  . PHE A 1 56  ? 11.206  30.625 -20.077 1.00 32.01 ? 72   PHE A CZ  1 
ATOM   457  N  N   . MET A 1 57  ? 7.643   34.580 -17.486 1.00 31.95 ? 73   MET A N   1 
ATOM   458  C  CA  . MET A 1 57  ? 6.604   34.946 -18.457 1.00 32.17 ? 73   MET A CA  1 
ATOM   459  C  C   . MET A 1 57  ? 6.836   36.341 -19.035 1.00 31.95 ? 73   MET A C   1 
ATOM   460  O  O   . MET A 1 57  ? 6.671   36.552 -20.239 1.00 31.84 ? 73   MET A O   1 
ATOM   461  C  CB  . MET A 1 57  ? 5.201   34.869 -17.837 1.00 32.08 ? 73   MET A CB  1 
ATOM   462  C  CG  . MET A 1 57  ? 4.737   33.475 -17.423 1.00 33.80 ? 73   MET A CG  1 
ATOM   463  S  SD  . MET A 1 57  ? 5.067   32.176 -18.629 1.00 37.91 ? 73   MET A SD  1 
ATOM   464  C  CE  . MET A 1 57  ? 4.035   32.675 -20.013 1.00 36.99 ? 73   MET A CE  1 
ATOM   465  N  N   . LYS A 1 58  ? 7.214   37.282 -18.168 1.00 32.05 ? 74   LYS A N   1 
ATOM   466  C  CA  . LYS A 1 58  ? 7.565   38.646 -18.578 1.00 32.16 ? 74   LYS A CA  1 
ATOM   467  C  C   . LYS A 1 58  ? 8.661   38.655 -19.638 1.00 32.18 ? 74   LYS A C   1 
ATOM   468  O  O   . LYS A 1 58  ? 8.564   39.380 -20.631 1.00 32.09 ? 74   LYS A O   1 
ATOM   469  C  CB  . LYS A 1 58  ? 8.030   39.471 -17.377 1.00 32.48 ? 74   LYS A CB  1 
ATOM   470  C  CG  . LYS A 1 58  ? 6.926   40.152 -16.604 1.00 33.02 ? 74   LYS A CG  1 
ATOM   471  C  CD  . LYS A 1 58  ? 7.504   41.269 -15.746 1.00 34.13 ? 74   LYS A CD  1 
ATOM   472  C  CE  . LYS A 1 58  ? 6.462   41.865 -14.822 1.00 34.53 ? 74   LYS A CE  1 
ATOM   473  N  NZ  . LYS A 1 58  ? 5.972   40.866 -13.825 1.00 35.01 ? 74   LYS A NZ  1 
ATOM   474  N  N   . GLU A 1 59  ? 9.700   37.850 -19.413 1.00 32.21 ? 75   GLU A N   1 
ATOM   475  C  CA  . GLU A 1 59  ? 10.814  37.720 -20.350 1.00 32.54 ? 75   GLU A CA  1 
ATOM   476  C  C   . GLU A 1 59  ? 10.360  37.120 -21.681 1.00 32.29 ? 75   GLU A C   1 
ATOM   477  O  O   . GLU A 1 59  ? 10.806  37.554 -22.744 1.00 32.32 ? 75   GLU A O   1 
ATOM   478  C  CB  . GLU A 1 59  ? 11.949  36.890 -19.737 0.50 32.84 ? 75   GLU A CB  1 
ATOM   479  C  CG  . GLU A 1 59  ? 12.656  37.577 -18.577 0.50 33.61 ? 75   GLU A CG  1 
ATOM   480  C  CD  . GLU A 1 59  ? 13.734  36.714 -17.948 0.50 34.64 ? 75   GLU A CD  1 
ATOM   481  O  OE1 . GLU A 1 59  ? 14.293  35.846 -18.651 0.50 35.00 ? 75   GLU A OE1 1 
ATOM   482  O  OE2 . GLU A 1 59  ? 14.019  36.905 -16.746 0.50 34.94 ? 75   GLU A OE2 1 
ATOM   483  N  N   . VAL A 1 60  ? 9.465   36.133 -21.609 1.00 32.11 ? 76   VAL A N   1 
ATOM   484  C  CA  . VAL A 1 60  ? 8.880   35.506 -22.799 1.00 32.09 ? 76   VAL A CA  1 
ATOM   485  C  C   . VAL A 1 60  ? 8.113   36.529 -23.646 1.00 32.04 ? 76   VAL A C   1 
ATOM   486  O  O   . VAL A 1 60  ? 8.354   36.651 -24.851 1.00 31.98 ? 76   VAL A O   1 
ATOM   487  C  CB  . VAL A 1 60  ? 7.959   34.309 -22.423 1.00 31.89 ? 76   VAL A CB  1 
ATOM   488  C  CG1 . VAL A 1 60  ? 7.157   33.827 -23.629 1.00 31.90 ? 76   VAL A CG1 1 
ATOM   489  C  CG2 . VAL A 1 60  ? 8.776   33.170 -21.838 1.00 31.96 ? 76   VAL A CG2 1 
ATOM   490  N  N   . ALA A 1 61  ? 7.206   37.265 -23.004 1.00 32.05 ? 77   ALA A N   1 
ATOM   491  C  CA  . ALA A 1 61  ? 6.407   38.290 -23.675 1.00 32.28 ? 77   ALA A CA  1 
ATOM   492  C  C   . ALA A 1 61  ? 7.287   39.349 -24.335 1.00 32.76 ? 77   ALA A C   1 
ATOM   493  O  O   . ALA A 1 61  ? 6.983   39.816 -25.432 1.00 32.88 ? 77   ALA A O   1 
ATOM   494  C  CB  . ALA A 1 61  ? 5.433   38.932 -22.701 1.00 32.03 ? 77   ALA A CB  1 
ATOM   495  N  N   . SER A 1 62  ? 8.377   39.711 -23.660 1.00 33.37 ? 78   SER A N   1 
ATOM   496  C  CA  . SER A 1 62  ? 9.365   40.642 -24.195 1.00 34.16 ? 78   SER A CA  1 
ATOM   497  C  C   . SER A 1 62  ? 10.085  40.049 -25.406 1.00 34.44 ? 78   SER A C   1 
ATOM   498  O  O   . SER A 1 62  ? 10.318  40.747 -26.393 1.00 34.70 ? 78   SER A O   1 
ATOM   499  C  CB  . SER A 1 62  ? 10.376  41.028 -23.110 1.00 34.55 ? 78   SER A CB  1 
ATOM   500  O  OG  . SER A 1 62  ? 11.354  41.926 -23.610 1.00 35.53 ? 78   SER A OG  1 
ATOM   501  N  N   . ASP A 1 63  ? 10.422  38.763 -25.326 1.00 34.61 ? 79   ASP A N   1 
ATOM   502  C  CA  . ASP A 1 63  ? 11.117  38.065 -26.412 1.00 34.99 ? 79   ASP A CA  1 
ATOM   503  C  C   . ASP A 1 63  ? 10.293  37.918 -27.693 1.00 34.71 ? 79   ASP A C   1 
ATOM   504  O  O   . ASP A 1 63  ? 10.864  37.817 -28.778 1.00 34.94 ? 79   ASP A O   1 
ATOM   505  C  CB  . ASP A 1 63  ? 11.621  36.691 -25.952 1.00 35.24 ? 79   ASP A CB  1 
ATOM   506  C  CG  . ASP A 1 63  ? 12.864  36.780 -25.076 1.00 36.28 ? 79   ASP A CG  1 
ATOM   507  O  OD1 . ASP A 1 63  ? 13.443  37.881 -24.941 1.00 37.51 ? 79   ASP A OD1 1 
ATOM   508  O  OD2 . ASP A 1 63  ? 13.263  35.737 -24.519 1.00 37.34 ? 79   ASP A OD2 1 
ATOM   509  N  N   . THR A 1 64  ? 8.964   37.903 -27.573 1.00 34.31 ? 80   THR A N   1 
ATOM   510  C  CA  . THR A 1 64  ? 8.089   37.792 -28.751 1.00 34.07 ? 80   THR A CA  1 
ATOM   511  C  C   . THR A 1 64  ? 8.217   38.991 -29.695 1.00 34.11 ? 80   THR A C   1 
ATOM   512  O  O   . THR A 1 64  ? 7.952   38.868 -30.894 1.00 34.19 ? 80   THR A O   1 
ATOM   513  C  CB  . THR A 1 64  ? 6.590   37.582 -28.390 1.00 33.78 ? 80   THR A CB  1 
ATOM   514  O  OG1 . THR A 1 64  ? 6.074   38.740 -27.723 1.00 33.52 ? 80   THR A OG1 1 
ATOM   515  C  CG2 . THR A 1 64  ? 6.398   36.340 -27.518 1.00 33.50 ? 80   THR A CG2 1 
ATOM   516  N  N   . THR A 1 65  ? 8.633   40.137 -29.153 1.00 34.06 ? 81   THR A N   1 
ATOM   517  C  CA  . THR A 1 65  ? 8.837   41.353 -29.953 1.00 34.09 ? 81   THR A CA  1 
ATOM   518  C  C   . THR A 1 65  ? 10.064  41.246 -30.864 1.00 34.20 ? 81   THR A C   1 
ATOM   519  O  O   . THR A 1 65  ? 10.215  42.025 -31.805 1.00 34.60 ? 81   THR A O   1 
ATOM   520  C  CB  . THR A 1 65  ? 8.958   42.627 -29.076 1.00 34.19 ? 81   THR A CB  1 
ATOM   521  O  OG1 . THR A 1 65  ? 10.158  42.568 -28.295 1.00 34.71 ? 81   THR A OG1 1 
ATOM   522  C  CG2 . THR A 1 65  ? 7.750   42.780 -28.154 1.00 33.79 ? 81   THR A CG2 1 
ATOM   523  N  N   . LYS A 1 66  ? 10.931  40.278 -30.580 1.00 33.96 ? 82   LYS A N   1 
ATOM   524  C  CA  . LYS A 1 66  ? 12.103  40.009 -31.415 1.00 33.87 ? 82   LYS A CA  1 
ATOM   525  C  C   . LYS A 1 66  ? 11.719  39.252 -32.690 1.00 33.28 ? 82   LYS A C   1 
ATOM   526  O  O   . LYS A 1 66  ? 12.509  39.169 -33.635 1.00 33.45 ? 82   LYS A O   1 
ATOM   527  C  CB  . LYS A 1 66  ? 13.155  39.218 -30.632 1.00 34.22 ? 82   LYS A CB  1 
ATOM   528  C  CG  . LYS A 1 66  ? 13.671  39.913 -29.376 1.00 35.41 ? 82   LYS A CG  1 
ATOM   529  C  CD  . LYS A 1 66  ? 14.651  39.020 -28.616 1.00 37.54 ? 82   LYS A CD  1 
ATOM   530  C  CE  . LYS A 1 66  ? 15.062  39.631 -27.278 1.00 38.55 ? 82   LYS A CE  1 
ATOM   531  N  NZ  . LYS A 1 66  ? 15.886  40.865 -27.428 1.00 39.86 ? 82   LYS A NZ  1 
ATOM   532  N  N   . PHE A 1 67  ? 10.508  38.695 -32.704 1.00 32.14 ? 83   PHE A N   1 
ATOM   533  C  CA  . PHE A 1 67  ? 9.993   37.971 -33.863 1.00 31.43 ? 83   PHE A CA  1 
ATOM   534  C  C   . PHE A 1 67  ? 8.895   38.770 -34.554 1.00 30.89 ? 83   PHE A C   1 
ATOM   535  O  O   . PHE A 1 67  ? 8.005   39.316 -33.893 1.00 30.44 ? 83   PHE A O   1 
ATOM   536  C  CB  . PHE A 1 67  ? 9.448   36.600 -33.450 1.00 31.30 ? 83   PHE A CB  1 
ATOM   537  C  CG  . PHE A 1 67  ? 10.499  35.650 -32.948 1.00 31.37 ? 83   PHE A CG  1 
ATOM   538  C  CD1 . PHE A 1 67  ? 11.215  34.850 -33.837 1.00 31.73 ? 83   PHE A CD1 1 
ATOM   539  C  CD2 . PHE A 1 67  ? 10.770  35.548 -31.588 1.00 31.12 ? 83   PHE A CD2 1 
ATOM   540  C  CE1 . PHE A 1 67  ? 12.190  33.965 -33.378 1.00 32.19 ? 83   PHE A CE1 1 
ATOM   541  C  CE2 . PHE A 1 67  ? 11.744  34.663 -31.116 1.00 31.26 ? 83   PHE A CE2 1 
ATOM   542  C  CZ  . PHE A 1 67  ? 12.453  33.871 -32.012 1.00 31.79 ? 83   PHE A CZ  1 
ATOM   543  N  N   . GLN A 1 68  ? 8.964   38.833 -35.882 1.00 30.41 ? 84   GLN A N   1 
ATOM   544  C  CA  . GLN A 1 68  ? 7.942   39.495 -36.694 1.00 29.95 ? 84   GLN A CA  1 
ATOM   545  C  C   . GLN A 1 68  ? 6.734   38.579 -36.884 1.00 29.05 ? 84   GLN A C   1 
ATOM   546  O  O   . GLN A 1 68  ? 6.299   38.339 -38.013 1.00 29.10 ? 84   GLN A O   1 
ATOM   547  C  CB  . GLN A 1 68  ? 8.515   39.886 -38.063 1.00 30.54 ? 84   GLN A CB  1 
ATOM   548  C  CG  . GLN A 1 68  ? 9.695   40.844 -38.019 1.00 31.69 ? 84   GLN A CG  1 
ATOM   549  C  CD  . GLN A 1 68  ? 9.359   42.151 -37.336 1.00 33.41 ? 84   GLN A CD  1 
ATOM   550  O  OE1 . GLN A 1 68  ? 8.300   42.736 -37.575 1.00 34.31 ? 84   GLN A OE1 1 
ATOM   551  N  NE2 . GLN A 1 68  ? 10.258  42.617 -36.479 1.00 34.21 ? 84   GLN A NE2 1 
ATOM   552  N  N   . TRP A 1 69  ? 6.186   38.083 -35.777 1.00 27.94 ? 85   TRP A N   1 
ATOM   553  C  CA  . TRP A 1 69  ? 5.210   36.993 -35.833 1.00 27.18 ? 85   TRP A CA  1 
ATOM   554  C  C   . TRP A 1 69  ? 3.903   37.313 -36.561 1.00 26.70 ? 85   TRP A C   1 
ATOM   555  O  O   . TRP A 1 69  ? 3.319   36.429 -37.184 1.00 26.63 ? 85   TRP A O   1 
ATOM   556  C  CB  . TRP A 1 69  ? 4.958   36.382 -34.447 1.00 26.92 ? 85   TRP A CB  1 
ATOM   557  C  CG  . TRP A 1 69  ? 4.289   37.279 -33.445 1.00 26.35 ? 85   TRP A CG  1 
ATOM   558  C  CD1 . TRP A 1 69  ? 4.901   38.048 -32.496 1.00 26.01 ? 85   TRP A CD1 1 
ATOM   559  C  CD2 . TRP A 1 69  ? 2.878   37.468 -33.265 1.00 25.95 ? 85   TRP A CD2 1 
ATOM   560  N  NE1 . TRP A 1 69  ? 3.963   38.715 -31.748 1.00 25.84 ? 85   TRP A NE1 1 
ATOM   561  C  CE2 . TRP A 1 69  ? 2.713   38.379 -32.198 1.00 25.74 ? 85   TRP A CE2 1 
ATOM   562  C  CE3 . TRP A 1 69  ? 1.738   36.964 -33.908 1.00 25.72 ? 85   TRP A CE3 1 
ATOM   563  C  CZ2 . TRP A 1 69  ? 1.451   38.798 -31.757 1.00 25.27 ? 85   TRP A CZ2 1 
ATOM   564  C  CZ3 . TRP A 1 69  ? 0.482   37.380 -33.466 1.00 25.47 ? 85   TRP A CZ3 1 
ATOM   565  C  CH2 . TRP A 1 69  ? 0.352   38.290 -32.403 1.00 25.22 ? 85   TRP A CH2 1 
ATOM   566  N  N   . ARG A 1 70  ? 3.464   38.569 -36.504 1.00 26.13 ? 86   ARG A N   1 
ATOM   567  C  CA  . ARG A 1 70  ? 2.248   38.995 -37.204 1.00 25.91 ? 86   ARG A CA  1 
ATOM   568  C  C   . ARG A 1 70  ? 2.400   38.935 -38.728 1.00 26.25 ? 86   ARG A C   1 
ATOM   569  O  O   . ARG A 1 70  ? 1.405   38.945 -39.454 1.00 26.44 ? 86   ARG A O   1 
ATOM   570  C  CB  . ARG A 1 70  ? 1.831   40.404 -36.770 1.00 25.70 ? 86   ARG A CB  1 
ATOM   571  C  CG  . ARG A 1 70  ? 1.284   40.476 -35.355 1.00 24.59 ? 86   ARG A CG  1 
ATOM   572  C  CD  . ARG A 1 70  ? 0.888   41.896 -34.973 1.00 23.94 ? 86   ARG A CD  1 
ATOM   573  N  NE  . ARG A 1 70  ? 0.512   41.985 -33.560 1.00 23.49 ? 86   ARG A NE  1 
ATOM   574  C  CZ  . ARG A 1 70  ? 1.374   42.136 -32.556 1.00 23.71 ? 86   ARG A CZ  1 
ATOM   575  N  NH1 . ARG A 1 70  ? 2.677   42.217 -32.791 1.00 23.85 ? 86   ARG A NH1 1 
ATOM   576  N  NH2 . ARG A 1 70  ? 0.930   42.201 -31.307 1.00 23.48 ? 86   ARG A NH2 1 
ATOM   577  N  N   . SER A 1 71  ? 3.645   38.864 -39.196 1.00 26.50 ? 87   SER A N   1 
ATOM   578  C  CA  . SER A 1 71  ? 3.956   38.833 -40.626 1.00 27.01 ? 87   SER A CA  1 
ATOM   579  C  C   . SER A 1 71  ? 4.056   37.416 -41.199 1.00 27.34 ? 87   SER A C   1 
ATOM   580  O  O   . SER A 1 71  ? 4.222   37.244 -42.410 1.00 27.74 ? 87   SER A O   1 
ATOM   581  C  CB  . SER A 1 71  ? 5.265   39.584 -40.897 1.00 27.11 ? 87   SER A CB  1 
ATOM   582  O  OG  . SER A 1 71  ? 5.191   40.929 -40.464 1.00 27.02 ? 87   SER A OG  1 
ATOM   583  N  N   . TYR A 1 72  ? 3.952   36.412 -40.331 1.00 27.32 ? 88   TYR A N   1 
ATOM   584  C  CA  . TYR A 1 72  ? 4.190   35.018 -40.720 1.00 27.76 ? 88   TYR A CA  1 
ATOM   585  C  C   . TYR A 1 72  ? 3.065   34.413 -41.555 1.00 28.07 ? 88   TYR A C   1 
ATOM   586  O  O   . TYR A 1 72  ? 1.914   34.849 -41.479 1.00 27.94 ? 88   TYR A O   1 
ATOM   587  C  CB  . TYR A 1 72  ? 4.444   34.142 -39.485 1.00 27.50 ? 88   TYR A CB  1 
ATOM   588  C  CG  . TYR A 1 72  ? 5.741   34.414 -38.748 1.00 27.47 ? 88   TYR A CG  1 
ATOM   589  C  CD1 . TYR A 1 72  ? 6.775   35.149 -39.335 1.00 27.93 ? 88   TYR A CD1 1 
ATOM   590  C  CD2 . TYR A 1 72  ? 5.946   33.898 -37.470 1.00 27.64 ? 88   TYR A CD2 1 
ATOM   591  C  CE1 . TYR A 1 72  ? 7.963   35.390 -38.650 1.00 28.15 ? 88   TYR A CE1 1 
ATOM   592  C  CE2 . TYR A 1 72  ? 7.127   34.130 -36.781 1.00 27.30 ? 88   TYR A CE2 1 
ATOM   593  C  CZ  . TYR A 1 72  ? 8.129   34.871 -37.374 1.00 27.73 ? 88   TYR A CZ  1 
ATOM   594  O  OH  . TYR A 1 72  ? 9.298   35.093 -36.687 1.00 28.31 ? 88   TYR A OH  1 
ATOM   595  N  N   . GLN A 1 73  ? 3.416   33.398 -42.342 1.00 28.65 ? 89   GLN A N   1 
ATOM   596  C  CA  . GLN A 1 73  ? 2.455   32.662 -43.165 1.00 29.19 ? 89   GLN A CA  1 
ATOM   597  C  C   . GLN A 1 73  ? 1.610   31.685 -42.347 1.00 29.11 ? 89   GLN A C   1 
ATOM   598  O  O   . GLN A 1 73  ? 0.410   31.544 -42.588 1.00 29.27 ? 89   GLN A O   1 
ATOM   599  C  CB  . GLN A 1 73  ? 3.177   31.905 -44.285 1.00 29.70 ? 89   GLN A CB  1 
ATOM   600  C  CG  . GLN A 1 73  ? 3.826   32.798 -45.339 1.00 30.35 ? 89   GLN A CG  1 
ATOM   601  C  CD  . GLN A 1 73  ? 2.812   33.513 -46.216 1.00 30.88 ? 89   GLN A CD  1 
ATOM   602  O  OE1 . GLN A 1 73  ? 1.870   32.903 -46.724 1.00 31.35 ? 89   GLN A OE1 1 
ATOM   603  N  NE2 . GLN A 1 73  ? 3.006   34.815 -46.402 1.00 30.36 ? 89   GLN A NE2 1 
ATOM   604  N  N   . SER A 1 74  ? 2.239   31.009 -41.387 1.00 29.14 ? 90   SER A N   1 
ATOM   605  C  CA  . SER A 1 74  ? 1.565   29.972 -40.606 1.00 29.14 ? 90   SER A CA  1 
ATOM   606  C  C   . SER A 1 74  ? 0.590   30.541 -39.578 1.00 28.91 ? 90   SER A C   1 
ATOM   607  O  O   . SER A 1 74  ? 0.993   31.239 -38.644 1.00 28.70 ? 90   SER A O   1 
ATOM   608  C  CB  . SER A 1 74  ? 2.583   29.059 -39.918 1.00 29.15 ? 90   SER A CB  1 
ATOM   609  O  OG  . SER A 1 74  ? 1.934   28.149 -39.046 1.00 28.62 ? 90   SER A OG  1 
ATOM   610  N  N   . GLU A 1 75  ? -0.691  30.227 -39.759 1.00 29.14 ? 91   GLU A N   1 
ATOM   611  C  CA  . GLU A 1 75  ? -1.732  30.603 -38.806 1.00 29.14 ? 91   GLU A CA  1 
ATOM   612  C  C   . GLU A 1 75  ? -1.463  29.961 -37.449 1.00 28.51 ? 91   GLU A C   1 
ATOM   613  O  O   . GLU A 1 75  ? -1.717  30.570 -36.410 1.00 28.17 ? 91   GLU A O   1 
ATOM   614  C  CB  . GLU A 1 75  ? -3.117  30.189 -39.319 1.00 29.61 ? 91   GLU A CB  1 
ATOM   615  C  CG  . GLU A 1 75  ? -3.601  30.965 -40.547 1.00 31.80 ? 91   GLU A CG  1 
ATOM   616  C  CD  . GLU A 1 75  ? -3.767  32.456 -40.287 1.00 34.13 ? 91   GLU A CD  1 
ATOM   617  O  OE1 . GLU A 1 75  ? -4.369  32.827 -39.255 1.00 35.20 ? 91   GLU A OE1 1 
ATOM   618  O  OE2 . GLU A 1 75  ? -3.286  33.259 -41.117 1.00 35.92 ? 91   GLU A OE2 1 
ATOM   619  N  N   . ASP A 1 76  ? -0.934  28.737 -37.476 1.00 28.42 ? 92   ASP A N   1 
ATOM   620  C  CA  . ASP A 1 76  ? -0.586  27.993 -36.265 1.00 28.05 ? 92   ASP A CA  1 
ATOM   621  C  C   . ASP A 1 76  ? 0.502   28.691 -35.448 1.00 27.50 ? 92   ASP A C   1 
ATOM   622  O  O   . ASP A 1 76  ? 0.362   28.858 -34.234 1.00 27.20 ? 92   ASP A O   1 
ATOM   623  C  CB  . ASP A 1 76  ? -0.151  26.564 -36.618 1.00 28.59 ? 92   ASP A CB  1 
ATOM   624  C  CG  . ASP A 1 76  ? 0.161   25.724 -35.388 1.00 29.22 ? 92   ASP A CG  1 
ATOM   625  O  OD1 . ASP A 1 76  ? -0.582  25.816 -34.394 1.00 30.28 ? 92   ASP A OD1 1 
ATOM   626  O  OD2 . ASP A 1 76  ? 1.147   24.963 -35.416 1.00 30.97 ? 92   ASP A OD2 1 
ATOM   627  N  N   . LEU A 1 77  ? 1.582   29.094 -36.117 1.00 27.25 ? 93   LEU A N   1 
ATOM   628  C  CA  . LEU A 1 77  ? 2.685   29.795 -35.456 1.00 26.72 ? 93   LEU A CA  1 
ATOM   629  C  C   . LEU A 1 77  ? 2.240   31.129 -34.859 1.00 26.01 ? 93   LEU A C   1 
ATOM   630  O  O   . LEU A 1 77  ? 2.588   31.449 -33.718 1.00 25.47 ? 93   LEU A O   1 
ATOM   631  C  CB  . LEU A 1 77  ? 3.864   29.991 -36.420 1.00 27.30 ? 93   LEU A CB  1 
ATOM   632  C  CG  . LEU A 1 77  ? 5.020   28.978 -36.404 1.00 28.13 ? 93   LEU A CG  1 
ATOM   633  C  CD1 . LEU A 1 77  ? 4.567   27.521 -36.341 1.00 29.17 ? 93   LEU A CD1 1 
ATOM   634  C  CD2 . LEU A 1 77  ? 5.934   29.198 -37.601 1.00 29.21 ? 93   LEU A CD2 1 
ATOM   635  N  N   . LYS A 1 78  ? 1.460   31.889 -35.627 1.00 25.55 ? 94   LYS A N   1 
ATOM   636  C  CA  . LYS A 1 78  ? 0.916   33.169 -35.171 1.00 25.11 ? 94   LYS A CA  1 
ATOM   637  C  C   . LYS A 1 78  ? 0.029   33.008 -33.935 1.00 24.74 ? 94   LYS A C   1 
ATOM   638  O  O   . LYS A 1 78  ? 0.086   33.826 -33.016 1.00 24.35 ? 94   LYS A O   1 
ATOM   639  C  CB  . LYS A 1 78  ? 0.135   33.860 -36.293 1.00 25.16 ? 94   LYS A CB  1 
ATOM   640  C  CG  . LYS A 1 78  ? 1.009   34.350 -37.445 1.00 25.30 ? 94   LYS A CG  1 
ATOM   641  C  CD  . LYS A 1 78  ? 0.242   35.244 -38.411 1.00 25.38 ? 94   LYS A CD  1 
ATOM   642  C  CE  . LYS A 1 78  ? -0.655  34.435 -39.336 1.00 25.75 ? 94   LYS A CE  1 
ATOM   643  N  NZ  . LYS A 1 78  ? -1.479  35.324 -40.201 1.00 25.66 ? 94   LYS A NZ  1 
ATOM   644  N  N   . ARG A 1 79  ? -0.777  31.948 -33.920 1.00 24.78 ? 95   ARG A N   1 
ATOM   645  C  CA  . ARG A 1 79  ? -1.673  31.665 -32.798 1.00 24.84 ? 95   ARG A CA  1 
ATOM   646  C  C   . ARG A 1 79  ? -0.888  31.376 -31.515 1.00 24.86 ? 95   ARG A C   1 
ATOM   647  O  O   . ARG A 1 79  ? -1.259  31.843 -30.437 1.00 24.73 ? 95   ARG A O   1 
ATOM   648  C  CB  . ARG A 1 79  ? -2.617  30.506 -33.137 1.00 24.84 ? 95   ARG A CB  1 
ATOM   649  C  CG  . ARG A 1 79  ? -3.643  30.204 -32.054 1.00 24.55 ? 95   ARG A CG  1 
ATOM   650  C  CD  . ARG A 1 79  ? -4.686  29.194 -32.510 1.00 24.33 ? 95   ARG A CD  1 
ATOM   651  N  NE  . ARG A 1 79  ? -5.637  28.897 -31.438 1.00 24.25 ? 95   ARG A NE  1 
ATOM   652  C  CZ  . ARG A 1 79  ? -6.692  29.649 -31.128 1.00 24.21 ? 95   ARG A CZ  1 
ATOM   653  N  NH1 . ARG A 1 79  ? -6.957  30.760 -31.808 1.00 23.39 ? 95   ARG A NH1 1 
ATOM   654  N  NH2 . ARG A 1 79  ? -7.486  29.288 -30.128 1.00 23.43 ? 95   ARG A NH2 1 
ATOM   655  N  N   . GLN A 1 80  ? 0.200   30.617 -31.647 1.00 25.36 ? 96   GLN A N   1 
ATOM   656  C  CA  . GLN A 1 80  ? 1.078   30.298 -30.519 1.00 25.63 ? 96   GLN A CA  1 
ATOM   657  C  C   . GLN A 1 80  ? 1.765   31.547 -29.968 1.00 25.78 ? 96   GLN A C   1 
ATOM   658  O  O   . GLN A 1 80  ? 1.789   31.760 -28.754 1.00 25.49 ? 96   GLN A O   1 
ATOM   659  C  CB  . GLN A 1 80  ? 2.121   29.247 -30.914 1.00 25.90 ? 96   GLN A CB  1 
ATOM   660  C  CG  . GLN A 1 80  ? 1.550   27.855 -31.142 1.00 26.00 ? 96   GLN A CG  1 
ATOM   661  C  CD  . GLN A 1 80  ? 2.625   26.806 -31.355 1.00 26.49 ? 96   GLN A CD  1 
ATOM   662  O  OE1 . GLN A 1 80  ? 3.479   26.594 -30.494 1.00 26.09 ? 96   GLN A OE1 1 
ATOM   663  N  NE2 . GLN A 1 80  ? 2.585   26.142 -32.506 1.00 26.72 ? 96   GLN A NE2 1 
ATOM   664  N  N   . PHE A 1 81  ? 2.315   32.369 -30.861 1.00 26.20 ? 97   PHE A N   1 
ATOM   665  C  CA  . PHE A 1 81  ? 2.941   33.631 -30.460 1.00 26.60 ? 97   PHE A CA  1 
ATOM   666  C  C   . PHE A 1 81  ? 1.960   34.580 -29.775 1.00 26.85 ? 97   PHE A C   1 
ATOM   667  O  O   . PHE A 1 81  ? 2.302   35.207 -28.770 1.00 26.59 ? 97   PHE A O   1 
ATOM   668  C  CB  . PHE A 1 81  ? 3.606   34.322 -31.650 1.00 26.72 ? 97   PHE A CB  1 
ATOM   669  C  CG  . PHE A 1 81  ? 5.055   33.970 -31.819 1.00 26.64 ? 97   PHE A CG  1 
ATOM   670  C  CD1 . PHE A 1 81  ? 6.021   34.529 -30.987 1.00 26.75 ? 97   PHE A CD1 1 
ATOM   671  C  CD2 . PHE A 1 81  ? 5.457   33.088 -32.814 1.00 26.96 ? 97   PHE A CD2 1 
ATOM   672  C  CE1 . PHE A 1 81  ? 7.368   34.209 -31.139 1.00 27.29 ? 97   PHE A CE1 1 
ATOM   673  C  CE2 . PHE A 1 81  ? 6.801   32.762 -32.975 1.00 27.27 ? 97   PHE A CE2 1 
ATOM   674  C  CZ  . PHE A 1 81  ? 7.758   33.323 -32.135 1.00 27.44 ? 97   PHE A CZ  1 
ATOM   675  N  N   . LYS A 1 82  ? 0.746   34.672 -30.315 1.00 27.44 ? 98   LYS A N   1 
ATOM   676  C  CA  . LYS A 1 82  ? -0.301  35.502 -29.719 1.00 28.28 ? 98   LYS A CA  1 
ATOM   677  C  C   . LYS A 1 82  ? -0.580  35.072 -28.275 1.00 28.29 ? 98   LYS A C   1 
ATOM   678  O  O   . LYS A 1 82  ? -0.663  35.914 -27.381 1.00 28.50 ? 98   LYS A O   1 
ATOM   679  C  CB  . LYS A 1 82  ? -1.581  35.463 -30.562 1.00 28.32 ? 98   LYS A CB  1 
ATOM   680  C  CG  . LYS A 1 82  ? -2.510  36.649 -30.337 1.00 29.74 ? 98   LYS A CG  1 
ATOM   681  C  CD  . LYS A 1 82  ? -3.771  36.529 -31.187 1.00 31.69 ? 98   LYS A CD  1 
ATOM   682  C  CE  . LYS A 1 82  ? -4.640  37.772 -31.083 1.00 32.66 ? 98   LYS A CE  1 
ATOM   683  N  NZ  . LYS A 1 82  ? -5.086  38.050 -29.685 1.00 33.44 ? 98   LYS A NZ  1 
ATOM   684  N  N   . ALA A 1 83  ? -0.696  33.763 -28.056 1.00 28.74 ? 99   ALA A N   1 
ATOM   685  C  CA  . ALA A 1 83  ? -0.889  33.203 -26.713 1.00 29.07 ? 99   ALA A CA  1 
ATOM   686  C  C   . ALA A 1 83  ? 0.227   33.605 -25.742 1.00 29.50 ? 99   ALA A C   1 
ATOM   687  O  O   . ALA A 1 83  ? -0.039  33.915 -24.580 1.00 29.33 ? 99   ALA A O   1 
ATOM   688  C  CB  . ALA A 1 83  ? -1.017  31.689 -26.781 1.00 29.19 ? 99   ALA A CB  1 
ATOM   689  N  N   . LEU A 1 84  ? 1.466   33.622 -26.234 1.00 30.01 ? 100  LEU A N   1 
ATOM   690  C  CA  . LEU A 1 84  ? 2.631   33.998 -25.427 1.00 30.61 ? 100  LEU A CA  1 
ATOM   691  C  C   . LEU A 1 84  ? 2.679   35.476 -25.031 1.00 30.84 ? 100  LEU A C   1 
ATOM   692  O  O   . LEU A 1 84  ? 3.342   35.834 -24.056 1.00 31.05 ? 100  LEU A O   1 
ATOM   693  C  CB  . LEU A 1 84  ? 3.929   33.616 -26.145 1.00 30.87 ? 100  LEU A CB  1 
ATOM   694  C  CG  . LEU A 1 84  ? 4.206   32.131 -26.385 1.00 31.20 ? 100  LEU A CG  1 
ATOM   695  C  CD1 . LEU A 1 84  ? 5.373   31.979 -27.337 1.00 31.70 ? 100  LEU A CD1 1 
ATOM   696  C  CD2 . LEU A 1 84  ? 4.479   31.396 -25.084 1.00 31.56 ? 100  LEU A CD2 1 
ATOM   697  N  N   . THR A 1 85  ? 1.987   36.332 -25.781 1.00 30.97 ? 101  THR A N   1 
ATOM   698  C  CA  . THR A 1 85  ? 1.962   37.763 -25.466 1.00 31.21 ? 101  THR A CA  1 
ATOM   699  C  C   . THR A 1 85  ? 1.024   38.070 -24.301 1.00 31.07 ? 101  THR A C   1 
ATOM   700  O  O   . THR A 1 85  ? 1.170   39.096 -23.632 1.00 31.36 ? 101  THR A O   1 
ATOM   701  C  CB  . THR A 1 85  ? 1.554   38.635 -26.678 1.00 31.26 ? 101  THR A CB  1 
ATOM   702  O  OG1 . THR A 1 85  ? 0.198   38.352 -27.046 1.00 31.48 ? 101  THR A OG1 1 
ATOM   703  C  CG2 . THR A 1 85  ? 2.478   38.393 -27.865 1.00 31.33 ? 101  THR A CG2 1 
ATOM   704  N  N   . LYS A 1 86  ? 0.068   37.176 -24.064 1.00 30.75 ? 102  LYS A N   1 
ATOM   705  C  CA  . LYS A 1 86  ? -0.948  37.378 -23.034 1.00 30.60 ? 102  LYS A CA  1 
ATOM   706  C  C   . LYS A 1 86  ? -0.429  36.968 -21.661 1.00 30.11 ? 102  LYS A C   1 
ATOM   707  O  O   . LYS A 1 86  ? -0.348  35.782 -21.344 1.00 30.42 ? 102  LYS A O   1 
ATOM   708  C  CB  . LYS A 1 86  ? -2.231  36.622 -23.391 1.00 30.65 ? 102  LYS A CB  1 
ATOM   709  C  CG  . LYS A 1 86  ? -2.912  37.165 -24.639 1.00 31.93 ? 102  LYS A CG  1 
ATOM   710  C  CD  . LYS A 1 86  ? -4.096  36.319 -25.054 1.00 33.86 ? 102  LYS A CD  1 
ATOM   711  C  CE  . LYS A 1 86  ? -4.617  36.769 -26.410 1.00 35.06 ? 102  LYS A CE  1 
ATOM   712  N  NZ  . LYS A 1 86  ? -5.835  36.011 -26.803 1.00 36.01 ? 102  LYS A NZ  1 
ATOM   713  N  N   . LEU A 1 87  ? -0.088  37.967 -20.854 1.00 29.46 ? 103  LEU A N   1 
ATOM   714  C  CA  . LEU A 1 87  ? 0.573   37.754 -19.569 1.00 28.78 ? 103  LEU A CA  1 
ATOM   715  C  C   . LEU A 1 87  ? -0.382  37.509 -18.407 1.00 28.07 ? 103  LEU A C   1 
ATOM   716  O  O   . LEU A 1 87  ? -0.025  36.827 -17.444 1.00 27.90 ? 103  LEU A O   1 
ATOM   717  C  CB  . LEU A 1 87  ? 1.473   38.948 -19.238 1.00 28.95 ? 103  LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 87  ? 2.840   39.024 -19.918 1.00 29.45 ? 103  LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 87  ? 3.504   40.363 -19.639 1.00 29.86 ? 103  LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 87  ? 3.731   37.882 -19.461 1.00 29.74 ? 103  LEU A CD2 1 
ATOM   721  N  N   . GLY A 1 88  ? -1.586  38.069 -18.498 1.00 27.16 ? 104  GLY A N   1 
ATOM   722  C  CA  . GLY A 1 88  ? -2.527  38.053 -17.382 1.00 26.38 ? 104  GLY A CA  1 
ATOM   723  C  C   . GLY A 1 88  ? -1.943  38.777 -16.182 1.00 25.97 ? 104  GLY A C   1 
ATOM   724  O  O   . GLY A 1 88  ? -1.358  39.855 -16.321 1.00 25.89 ? 104  GLY A O   1 
ATOM   725  N  N   . TYR A 1 89  ? -2.076  38.170 -15.005 1.00 25.57 ? 105  TYR A N   1 
ATOM   726  C  CA  . TYR A 1 89  ? -1.562  38.758 -13.765 1.00 25.40 ? 105  TYR A CA  1 
ATOM   727  C  C   . TYR A 1 89  ? -0.051  38.979 -13.786 1.00 25.42 ? 105  TYR A C   1 
ATOM   728  O  O   . TYR A 1 89  ? 0.454   39.884 -13.122 1.00 25.54 ? 105  TYR A O   1 
ATOM   729  C  CB  . TYR A 1 89  ? -1.941  37.902 -12.551 1.00 25.40 ? 105  TYR A CB  1 
ATOM   730  C  CG  . TYR A 1 89  ? -3.425  37.850 -12.243 1.00 25.24 ? 105  TYR A CG  1 
ATOM   731  C  CD1 . TYR A 1 89  ? -4.294  38.850 -12.692 1.00 24.74 ? 105  TYR A CD1 1 
ATOM   732  C  CD2 . TYR A 1 89  ? -3.954  36.817 -11.472 1.00 24.86 ? 105  TYR A CD2 1 
ATOM   733  C  CE1 . TYR A 1 89  ? -5.655  38.804 -12.402 1.00 24.84 ? 105  TYR A CE1 1 
ATOM   734  C  CE2 . TYR A 1 89  ? -5.310  36.765 -11.172 1.00 24.68 ? 105  TYR A CE2 1 
ATOM   735  C  CZ  . TYR A 1 89  ? -6.154  37.760 -11.639 1.00 24.16 ? 105  TYR A CZ  1 
ATOM   736  O  OH  . TYR A 1 89  ? -7.495  37.714 -11.344 1.00 23.87 ? 105  TYR A OH  1 
ATOM   737  N  N   . ALA A 1 90  ? 0.656   38.159 -14.561 1.00 25.12 ? 106  ALA A N   1 
ATOM   738  C  CA  . ALA A 1 90  ? 2.115   38.231 -14.666 1.00 25.35 ? 106  ALA A CA  1 
ATOM   739  C  C   . ALA A 1 90  ? 2.633   39.547 -15.270 1.00 25.51 ? 106  ALA A C   1 
ATOM   740  O  O   . ALA A 1 90  ? 3.837   39.813 -15.239 1.00 25.73 ? 106  ALA A O   1 
ATOM   741  C  CB  . ALA A 1 90  ? 2.646   37.032 -15.442 1.00 25.31 ? 106  ALA A CB  1 
ATOM   742  N  N   . ALA A 1 91  ? 1.726   40.364 -15.809 1.00 25.31 ? 107  ALA A N   1 
ATOM   743  C  CA  . ALA A 1 91  ? 2.082   41.684 -16.335 1.00 25.54 ? 107  ALA A CA  1 
ATOM   744  C  C   . ALA A 1 91  ? 2.360   42.703 -15.225 1.00 25.93 ? 107  ALA A C   1 
ATOM   745  O  O   . ALA A 1 91  ? 3.003   43.725 -15.466 1.00 26.15 ? 107  ALA A O   1 
ATOM   746  C  CB  . ALA A 1 91  ? 0.990   42.202 -17.271 1.00 25.16 ? 107  ALA A CB  1 
ATOM   747  N  N   . LEU A 1 92  ? 1.865   42.420 -14.020 1.00 26.13 ? 108  LEU A N   1 
ATOM   748  C  CA  . LEU A 1 92  ? 2.026   43.306 -12.863 1.00 26.63 ? 108  LEU A CA  1 
ATOM   749  C  C   . LEU A 1 92  ? 3.484   43.436 -12.420 1.00 27.31 ? 108  LEU A C   1 
ATOM   750  O  O   . LEU A 1 92  ? 4.242   42.473 -12.524 1.00 27.28 ? 108  LEU A O   1 
ATOM   751  C  CB  . LEU A 1 92  ? 1.193   42.793 -11.681 1.00 26.54 ? 108  LEU A CB  1 
ATOM   752  C  CG  . LEU A 1 92  ? -0.321  43.003 -11.698 1.00 26.12 ? 108  LEU A CG  1 
ATOM   753  C  CD1 . LEU A 1 92  ? -0.982  42.129 -10.645 1.00 25.97 ? 108  LEU A CD1 1 
ATOM   754  C  CD2 . LEU A 1 92  ? -0.681  44.469 -11.488 1.00 26.16 ? 108  LEU A CD2 1 
ATOM   755  N  N   . PRO A 1 93  ? 3.878   44.627 -11.917 1.00 27.91 ? 109  PRO A N   1 
ATOM   756  C  CA  . PRO A 1 93  ? 5.201   44.782 -11.316 1.00 28.64 ? 109  PRO A CA  1 
ATOM   757  C  C   . PRO A 1 93  ? 5.424   43.739 -10.223 1.00 28.94 ? 109  PRO A C   1 
ATOM   758  O  O   . PRO A 1 93  ? 4.461   43.289 -9.597  1.00 28.71 ? 109  PRO A O   1 
ATOM   759  C  CB  . PRO A 1 93  ? 5.147   46.183 -10.700 1.00 29.02 ? 109  PRO A CB  1 
ATOM   760  C  CG  . PRO A 1 93  ? 4.151   46.914 -11.520 1.00 28.89 ? 109  PRO A CG  1 
ATOM   761  C  CD  . PRO A 1 93  ? 3.124   45.896 -11.922 1.00 28.03 ? 109  PRO A CD  1 
ATOM   762  N  N   . GLU A 1 94  ? 6.685   43.365 -10.011 1.00 29.49 ? 110  GLU A N   1 
ATOM   763  C  CA  . GLU A 1 94  ? 7.065   42.310 -9.066  1.00 29.92 ? 110  GLU A CA  1 
ATOM   764  C  C   . GLU A 1 94  ? 6.336   42.384 -7.719  1.00 30.24 ? 110  GLU A C   1 
ATOM   765  O  O   . GLU A 1 94  ? 5.769   41.387 -7.263  1.00 30.15 ? 110  GLU A O   1 
ATOM   766  C  CB  . GLU A 1 94  ? 8.584   42.317 -8.857  0.50 30.34 ? 110  GLU A CB  1 
ATOM   767  C  CG  . GLU A 1 94  ? 9.114   41.195 -7.980  0.50 30.83 ? 110  GLU A CG  1 
ATOM   768  C  CD  . GLU A 1 94  ? 10.621  41.239 -7.838  0.50 31.55 ? 110  GLU A CD  1 
ATOM   769  O  OE1 . GLU A 1 94  ? 11.289  41.751 -8.760  0.50 31.64 ? 110  GLU A OE1 1 
ATOM   770  O  OE2 . GLU A 1 94  ? 11.136  40.768 -6.804  0.50 32.24 ? 110  GLU A OE2 1 
ATOM   771  N  N   . ASP A 1 95  ? 6.355   43.561 -7.095  1.00 30.90 ? 111  ASP A N   1 
ATOM   772  C  CA  . ASP A 1 95  ? 5.732   43.762 -5.783  1.00 31.43 ? 111  ASP A CA  1 
ATOM   773  C  C   . ASP A 1 95  ? 4.205   43.647 -5.828  1.00 30.84 ? 111  ASP A C   1 
ATOM   774  O  O   . ASP A 1 95  ? 3.596   43.097 -4.908  1.00 30.79 ? 111  ASP A O   1 
ATOM   775  C  CB  . ASP A 1 95  ? 6.142   45.111 -5.184  1.00 32.14 ? 111  ASP A CB  1 
ATOM   776  C  CG  . ASP A 1 95  ? 7.624   45.177 -4.833  1.00 33.68 ? 111  ASP A CG  1 
ATOM   777  O  OD1 . ASP A 1 95  ? 8.246   44.117 -4.598  1.00 34.85 ? 111  ASP A OD1 1 
ATOM   778  O  OD2 . ASP A 1 95  ? 8.168   46.300 -4.784  1.00 35.43 ? 111  ASP A OD2 1 
ATOM   779  N  N   . ASP A 1 96  ? 3.601   44.166 -6.897  1.00 30.28 ? 112  ASP A N   1 
ATOM   780  C  CA  . ASP A 1 96  ? 2.149   44.098 -7.085  1.00 29.82 ? 112  ASP A CA  1 
ATOM   781  C  C   . ASP A 1 96  ? 1.663   42.672 -7.305  1.00 29.20 ? 112  ASP A C   1 
ATOM   782  O  O   . ASP A 1 96  ? 0.597   42.292 -6.811  1.00 28.90 ? 112  ASP A O   1 
ATOM   783  C  CB  . ASP A 1 96  ? 1.705   44.979 -8.256  1.00 29.65 ? 112  ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 96  ? 1.759   46.456 -7.930  1.00 30.59 ? 112  ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 96  ? 1.900   46.813 -6.740  1.00 31.60 ? 112  ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 96  ? 1.659   47.266 -8.872  1.00 31.39 ? 112  ASP A OD2 1 
ATOM   787  N  N   . TYR A 1 97  ? 2.443   41.893 -8.053  1.00 28.92 ? 113  TYR A N   1 
ATOM   788  C  CA  . TYR A 1 97  ? 2.130   40.487 -8.284  1.00 28.58 ? 113  TYR A CA  1 
ATOM   789  C  C   . TYR A 1 97  ? 2.200   39.689 -6.982  1.00 28.66 ? 113  TYR A C   1 
ATOM   790  O  O   . TYR A 1 97  ? 1.345   38.841 -6.727  1.00 28.33 ? 113  TYR A O   1 
ATOM   791  C  CB  . TYR A 1 97  ? 3.051   39.874 -9.344  1.00 28.65 ? 113  TYR A CB  1 
ATOM   792  C  CG  . TYR A 1 97  ? 2.649   38.469 -9.733  1.00 28.83 ? 113  TYR A CG  1 
ATOM   793  C  CD1 . TYR A 1 97  ? 1.552   38.243 -10.562 1.00 29.28 ? 113  TYR A CD1 1 
ATOM   794  C  CD2 . TYR A 1 97  ? 3.352   37.363 -9.257  1.00 29.68 ? 113  TYR A CD2 1 
ATOM   795  C  CE1 . TYR A 1 97  ? 1.167   36.953 -10.914 1.00 29.60 ? 113  TYR A CE1 1 
ATOM   796  C  CE2 . TYR A 1 97  ? 2.973   36.066 -9.604  1.00 29.77 ? 113  TYR A CE2 1 
ATOM   797  C  CZ  . TYR A 1 97  ? 1.882   35.871 -10.432 1.00 29.46 ? 113  TYR A CZ  1 
ATOM   798  O  OH  . TYR A 1 97  ? 1.501   34.595 -10.780 1.00 29.82 ? 113  TYR A OH  1 
ATOM   799  N  N   . ALA A 1 98  ? 3.215   39.975 -6.164  1.00 28.94 ? 114  ALA A N   1 
ATOM   800  C  CA  . ALA A 1 98  ? 3.374   39.318 -4.863  1.00 29.23 ? 114  ALA A CA  1 
ATOM   801  C  C   . ALA A 1 98  ? 2.212   39.642 -3.922  1.00 29.10 ? 114  ALA A C   1 
ATOM   802  O  O   . ALA A 1 98  ? 1.724   38.762 -3.210  1.00 29.18 ? 114  ALA A O   1 
ATOM   803  C  CB  . ALA A 1 98  ? 4.708   39.694 -4.224  1.00 29.65 ? 114  ALA A CB  1 
ATOM   804  N  N   . GLU A 1 99  ? 1.771   40.900 -3.935  1.00 29.03 ? 115  GLU A N   1 
ATOM   805  C  CA  . GLU A 1 99  ? 0.636   41.338 -3.123  1.00 29.11 ? 115  GLU A CA  1 
ATOM   806  C  C   . GLU A 1 99  ? -0.670  40.667 -3.559  1.00 28.50 ? 115  GLU A C   1 
ATOM   807  O  O   . GLU A 1 99  ? -1.465  40.249 -2.714  1.00 28.41 ? 115  GLU A O   1 
ATOM   808  C  CB  . GLU A 1 99  ? 0.489   42.863 -3.159  1.00 29.39 ? 115  GLU A CB  1 
ATOM   809  C  CG  . GLU A 1 99  ? -0.554  43.404 -2.177  1.00 30.24 ? 115  GLU A CG  1 
ATOM   810  C  CD  . GLU A 1 99  ? -0.761  44.907 -2.271  1.00 31.38 ? 115  GLU A CD  1 
ATOM   811  O  OE1 . GLU A 1 99  ? -0.093  45.569 -3.093  1.00 32.25 ? 115  GLU A OE1 1 
ATOM   812  O  OE2 . GLU A 1 99  ? -1.605  45.430 -1.512  1.00 32.32 ? 115  GLU A OE2 1 
ATOM   813  N  N   . LEU A 1 100 ? -0.882  40.565 -4.871  1.00 27.89 ? 116  LEU A N   1 
ATOM   814  C  CA  . LEU A 1 100 ? -2.076  39.907 -5.403  1.00 27.44 ? 116  LEU A CA  1 
ATOM   815  C  C   . LEU A 1 100 ? -2.132  38.434 -5.002  1.00 27.40 ? 116  LEU A C   1 
ATOM   816  O  O   . LEU A 1 100 ? -3.182  37.943 -4.590  1.00 27.17 ? 116  LEU A O   1 
ATOM   817  C  CB  . LEU A 1 100 ? -2.170  40.061 -6.928  1.00 26.97 ? 116  LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 100 ? -3.357  39.396 -7.643  1.00 26.53 ? 116  LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 100 ? -4.705  39.868 -7.099  1.00 25.87 ? 116  LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 100 ? -3.274  39.641 -9.141  1.00 25.74 ? 116  LEU A CD2 1 
ATOM   821  N  N   . LEU A 1 101 ? -1.002  37.741 -5.119  1.00 27.63 ? 117  LEU A N   1 
ATOM   822  C  CA  . LEU A 1 101 ? -0.910  36.345 -4.691  1.00 27.84 ? 117  LEU A CA  1 
ATOM   823  C  C   . LEU A 1 101 ? -1.226  36.188 -3.204  1.00 28.09 ? 117  LEU A C   1 
ATOM   824  O  O   . LEU A 1 101 ? -1.913  35.244 -2.816  1.00 27.95 ? 117  LEU A O   1 
ATOM   825  C  CB  . LEU A 1 101 ? 0.474   35.768 -4.992  1.00 28.16 ? 117  LEU A CB  1 
ATOM   826  C  CG  . LEU A 1 101 ? 0.888   35.511 -6.443  1.00 28.26 ? 117  LEU A CG  1 
ATOM   827  C  CD1 . LEU A 1 101 ? 2.342   35.092 -6.461  1.00 29.48 ? 117  LEU A CD1 1 
ATOM   828  C  CD2 . LEU A 1 101 ? 0.020   34.458 -7.117  1.00 28.40 ? 117  LEU A CD2 1 
ATOM   829  N  N   . ASP A 1 102 ? -0.722  37.113 -2.386  1.00 28.58 ? 118  ASP A N   1 
ATOM   830  C  CA  . ASP A 1 102 ? -1.003  37.125 -0.948  1.00 29.20 ? 118  ASP A CA  1 
ATOM   831  C  C   . ASP A 1 102 ? -2.487  37.367 -0.687  1.00 28.68 ? 118  ASP A C   1 
ATOM   832  O  O   . ASP A 1 102 ? -3.067  36.781 0.224   1.00 28.71 ? 118  ASP A O   1 
ATOM   833  C  CB  . ASP A 1 102 ? -0.172  38.197 -0.234  1.00 29.97 ? 118  ASP A CB  1 
ATOM   834  C  CG  . ASP A 1 102 ? 1.302   37.828 -0.114  1.00 31.56 ? 118  ASP A CG  1 
ATOM   835  O  OD1 . ASP A 1 102 ? 1.647   36.626 -0.154  1.00 33.21 ? 118  ASP A OD1 1 
ATOM   836  O  OD2 . ASP A 1 102 ? 2.126   38.754 0.029   1.00 33.59 ? 118  ASP A OD2 1 
ATOM   837  N  N   . THR A 1 103 ? -3.091  38.231 -1.501  1.00 28.18 ? 119  THR A N   1 
ATOM   838  C  CA  . THR A 1 103 ? -4.511  38.558 -1.386  1.00 27.70 ? 119  THR A CA  1 
ATOM   839  C  C   . THR A 1 103 ? -5.392  37.364 -1.773  1.00 27.09 ? 119  THR A C   1 
ATOM   840  O  O   . THR A 1 103 ? -6.353  37.041 -1.067  1.00 26.86 ? 119  THR A O   1 
ATOM   841  C  CB  . THR A 1 103 ? -4.862  39.798 -2.241  1.00 27.60 ? 119  THR A CB  1 
ATOM   842  O  OG1 . THR A 1 103 ? -4.036  40.898 -1.842  1.00 28.15 ? 119  THR A OG1 1 
ATOM   843  C  CG2 . THR A 1 103 ? -6.320  40.187 -2.071  1.00 27.35 ? 119  THR A CG2 1 
ATOM   844  N  N   . LEU A 1 104 ? -5.046  36.711 -2.882  1.00 26.63 ? 120  LEU A N   1 
ATOM   845  C  CA  . LEU A 1 104 ? -5.784  35.550 -3.382  1.00 26.25 ? 120  LEU A CA  1 
ATOM   846  C  C   . LEU A 1 104 ? -5.744  34.359 -2.424  1.00 26.63 ? 120  LEU A C   1 
ATOM   847  O  O   . LEU A 1 104 ? -6.768  33.705 -2.194  1.00 26.44 ? 120  LEU A O   1 
ATOM   848  C  CB  . LEU A 1 104 ? -5.272  35.127 -4.767  1.00 25.95 ? 120  LEU A CB  1 
ATOM   849  C  CG  . LEU A 1 104 ? -5.504  36.093 -5.935  1.00 25.66 ? 120  LEU A CG  1 
ATOM   850  C  CD1 . LEU A 1 104 ? -4.811  35.593 -7.195  1.00 25.71 ? 120  LEU A CD1 1 
ATOM   851  C  CD2 . LEU A 1 104 ? -6.990  36.322 -6.188  1.00 25.18 ? 120  LEU A CD2 1 
ATOM   852  N  N   . SER A 1 105 ? -4.569  34.073 -1.869  1.00 26.98 ? 121  SER A N   1 
ATOM   853  C  CA  . SER A 1 105 ? -4.446  32.966 -0.921  1.00 27.52 ? 121  SER A CA  1 
ATOM   854  C  C   . SER A 1 105 ? -5.166  33.276 0.394   1.00 27.66 ? 121  SER A C   1 
ATOM   855  O  O   . SER A 1 105 ? -5.731  32.380 1.018   1.00 27.71 ? 121  SER A O   1 
ATOM   856  C  CB  . SER A 1 105 ? -2.982  32.564 -0.696  1.00 27.80 ? 121  SER A CB  1 
ATOM   857  O  OG  . SER A 1 105 ? -2.184  33.674 -0.336  1.00 29.01 ? 121  SER A OG  1 
ATOM   858  N  N   . ALA A 1 106 ? -5.165  34.549 0.788   1.00 27.85 ? 122  ALA A N   1 
ATOM   859  C  CA  . ALA A 1 106 ? -5.895  34.996 1.975   1.00 28.19 ? 122  ALA A CA  1 
ATOM   860  C  C   . ALA A 1 106 ? -7.398  34.752 1.843   1.00 27.92 ? 122  ALA A C   1 
ATOM   861  O  O   . ALA A 1 106 ? -8.047  34.327 2.799   1.00 27.98 ? 122  ALA A O   1 
ATOM   862  C  CB  . ALA A 1 106 ? -5.616  36.463 2.258   1.00 28.43 ? 122  ALA A CB  1 
ATOM   863  N  N   . MET A 1 107 ? -7.943  35.008 0.656   1.00 27.57 ? 123  MET A N   1 
ATOM   864  C  CA  . MET A 1 107 ? -9.369  34.805 0.405   1.00 27.53 ? 123  MET A CA  1 
ATOM   865  C  C   . MET A 1 107 ? -9.736  33.329 0.286   1.00 27.52 ? 123  MET A C   1 
ATOM   866  O  O   . MET A 1 107 ? -10.748 32.896 0.841   1.00 27.21 ? 123  MET A O   1 
ATOM   867  C  CB  . MET A 1 107 ? -9.828  35.563 -0.842  1.00 27.14 ? 123  MET A CB  1 
ATOM   868  C  CG  . MET A 1 107 ? -9.782  37.069 -0.700  1.00 27.89 ? 123  MET A CG  1 
ATOM   869  S  SD  . MET A 1 107 ? -10.663 37.913 -2.020  1.00 29.31 ? 123  MET A SD  1 
ATOM   870  C  CE  . MET A 1 107 ? -9.674  37.463 -3.447  1.00 28.18 ? 123  MET A CE  1 
ATOM   871  N  N   . GLU A 1 108 ? -8.922  32.560 -0.435  1.00 27.83 ? 124  GLU A N   1 
ATOM   872  C  CA  . GLU A 1 108 ? -9.198  31.134 -0.605  1.00 28.21 ? 124  GLU A CA  1 
ATOM   873  C  C   . GLU A 1 108 ? -9.037  30.366 0.707   1.00 28.25 ? 124  GLU A C   1 
ATOM   874  O  O   . GLU A 1 108 ? -9.824  29.462 0.992   1.00 28.14 ? 124  GLU A O   1 
ATOM   875  C  CB  . GLU A 1 108 ? -8.347  30.507 -1.716  1.00 28.45 ? 124  GLU A CB  1 
ATOM   876  C  CG  . GLU A 1 108 ? -8.804  29.086 -2.077  1.00 30.27 ? 124  GLU A CG  1 
ATOM   877  C  CD  . GLU A 1 108 ? -8.054  28.474 -3.248  1.00 32.80 ? 124  GLU A CD  1 
ATOM   878  O  OE1 . GLU A 1 108 ? -6.830  28.706 -3.376  1.00 34.38 ? 124  GLU A OE1 1 
ATOM   879  O  OE2 . GLU A 1 108 ? -8.695  27.741 -4.031  1.00 33.34 ? 124  GLU A OE2 1 
ATOM   880  N  N   . SER A 1 109 ? -8.032  30.732 1.502   1.00 28.52 ? 125  SER A N   1 
ATOM   881  C  CA  . SER A 1 109 ? -7.809  30.084 2.800   1.00 28.85 ? 125  SER A CA  1 
ATOM   882  C  C   . SER A 1 109 ? -8.903  30.430 3.808   1.00 28.69 ? 125  SER A C   1 
ATOM   883  O  O   . SER A 1 109 ? -9.301  29.578 4.600   1.00 28.90 ? 125  SER A O   1 
ATOM   884  C  CB  . SER A 1 109 ? -6.424  30.408 3.373   1.00 29.37 ? 125  SER A CB  1 
ATOM   885  O  OG  . SER A 1 109 ? -6.315  31.774 3.730   1.00 30.01 ? 125  SER A OG  1 
ATOM   886  N  N   . ASN A 1 110 ? -9.383  31.674 3.773   1.00 28.25 ? 126  ASN A N   1 
ATOM   887  C  CA  . ASN A 1 110 ? -10.510 32.090 4.607   1.00 28.15 ? 126  ASN A CA  1 
ATOM   888  C  C   . ASN A 1 110 ? -11.726 31.208 4.348   1.00 27.72 ? 126  ASN A C   1 
ATOM   889  O  O   . ASN A 1 110 ? -12.301 30.647 5.283   1.00 27.72 ? 126  ASN A O   1 
ATOM   890  C  CB  . ASN A 1 110 ? -10.870 33.563 4.371   1.00 28.03 ? 126  ASN A CB  1 
ATOM   891  C  CG  . ASN A 1 110 ? -12.086 34.005 5.174   1.00 28.05 ? 126  ASN A CG  1 
ATOM   892  O  OD1 . ASN A 1 110 ? -13.207 34.024 4.664   1.00 27.92 ? 126  ASN A OD1 1 
ATOM   893  N  ND2 . ASN A 1 110 ? -11.872 34.344 6.436   1.00 27.90 ? 126  ASN A ND2 1 
ATOM   894  N  N   . PHE A 1 111 ? -12.098 31.090 3.073   1.00 27.12 ? 127  PHE A N   1 
ATOM   895  C  CA  . PHE A 1 111 ? -13.217 30.253 2.648   1.00 26.96 ? 127  PHE A CA  1 
ATOM   896  C  C   . PHE A 1 111 ? -13.050 28.811 3.118   1.00 27.30 ? 127  PHE A C   1 
ATOM   897  O  O   . PHE A 1 111 ? -13.979 28.223 3.671   1.00 27.37 ? 127  PHE A O   1 
ATOM   898  C  CB  . PHE A 1 111 ? -13.374 30.291 1.119   1.00 26.51 ? 127  PHE A CB  1 
ATOM   899  C  CG  . PHE A 1 111 ? -14.608 29.591 0.619   1.00 26.11 ? 127  PHE A CG  1 
ATOM   900  C  CD1 . PHE A 1 111 ? -14.598 28.220 0.369   1.00 26.01 ? 127  PHE A CD1 1 
ATOM   901  C  CD2 . PHE A 1 111 ? -15.787 30.301 0.410   1.00 26.00 ? 127  PHE A CD2 1 
ATOM   902  C  CE1 . PHE A 1 111 ? -15.741 27.567 -0.081  1.00 25.64 ? 127  PHE A CE1 1 
ATOM   903  C  CE2 . PHE A 1 111 ? -16.936 29.657 -0.045  1.00 25.79 ? 127  PHE A CE2 1 
ATOM   904  C  CZ  . PHE A 1 111 ? -16.914 28.288 -0.290  1.00 25.55 ? 127  PHE A CZ  1 
ATOM   905  N  N   . ALA A 1 112 ? -11.861 28.255 2.895   1.00 27.59 ? 128  ALA A N   1 
ATOM   906  C  CA  . ALA A 1 112 ? -11.580 26.858 3.215   1.00 28.10 ? 128  ALA A CA  1 
ATOM   907  C  C   . ALA A 1 112 ? -11.578 26.579 4.718   1.00 28.73 ? 128  ALA A C   1 
ATOM   908  O  O   . ALA A 1 112 ? -11.874 25.461 5.144   1.00 28.97 ? 128  ALA A O   1 
ATOM   909  C  CB  . ALA A 1 112 ? -10.259 26.431 2.593   1.00 28.11 ? 128  ALA A CB  1 
ATOM   910  N  N   . LYS A 1 113 ? -11.254 27.598 5.511   1.00 29.28 ? 129  LYS A N   1 
ATOM   911  C  CA  . LYS A 1 113 ? -11.140 27.451 6.966   1.00 30.26 ? 129  LYS A CA  1 
ATOM   912  C  C   . LYS A 1 113 ? -12.414 27.785 7.752   1.00 30.34 ? 129  LYS A C   1 
ATOM   913  O  O   . LYS A 1 113 ? -12.430 27.661 8.979   1.00 30.87 ? 129  LYS A O   1 
ATOM   914  C  CB  . LYS A 1 113 ? -9.970  28.282 7.500   1.00 30.74 ? 129  LYS A CB  1 
ATOM   915  C  CG  . LYS A 1 113 ? -8.598  27.694 7.216   1.00 31.86 ? 129  LYS A CG  1 
ATOM   916  C  CD  . LYS A 1 113 ? -7.512  28.561 7.833   1.00 34.12 ? 129  LYS A CD  1 
ATOM   917  C  CE  . LYS A 1 113 ? -6.149  27.919 7.704   1.00 35.30 ? 129  LYS A CE  1 
ATOM   918  N  NZ  . LYS A 1 113 ? -5.146  28.607 8.566   1.00 36.95 ? 129  LYS A NZ  1 
ATOM   919  N  N   . VAL A 1 114 ? -13.472 28.205 7.056   1.00 30.03 ? 130  VAL A N   1 
ATOM   920  C  CA  . VAL A 1 114 ? -14.736 28.573 7.712   1.00 30.19 ? 130  VAL A CA  1 
ATOM   921  C  C   . VAL A 1 114 ? -15.308 27.418 8.540   1.00 30.75 ? 130  VAL A C   1 
ATOM   922  O  O   . VAL A 1 114 ? -15.490 26.305 8.037   1.00 30.45 ? 130  VAL A O   1 
ATOM   923  C  CB  . VAL A 1 114 ? -15.804 29.089 6.699   1.00 29.63 ? 130  VAL A CB  1 
ATOM   924  C  CG1 . VAL A 1 114 ? -17.188 29.190 7.355   1.00 29.59 ? 130  VAL A CG1 1 
ATOM   925  C  CG2 . VAL A 1 114 ? -15.399 30.440 6.127   1.00 29.11 ? 130  VAL A CG2 1 
ATOM   926  N  N   . LYS A 1 115 ? -15.560 27.697 9.816   1.00 31.64 ? 131  LYS A N   1 
ATOM   927  C  CA  . LYS A 1 115 ? -16.229 26.765 10.716  1.00 32.53 ? 131  LYS A CA  1 
ATOM   928  C  C   . LYS A 1 115 ? -17.339 27.508 11.450  1.00 32.84 ? 131  LYS A C   1 
ATOM   929  O  O   . LYS A 1 115 ? -17.150 28.652 11.863  1.00 33.00 ? 131  LYS A O   1 
ATOM   930  C  CB  . LYS A 1 115 ? -15.243 26.179 11.736  1.00 33.20 ? 131  LYS A CB  1 
ATOM   931  C  CG  . LYS A 1 115 ? -14.079 25.371 11.152  1.00 33.84 ? 131  LYS A CG  1 
ATOM   932  C  CD  . LYS A 1 115 ? -14.492 23.946 10.807  1.00 34.99 ? 131  LYS A CD  1 
ATOM   933  C  CE  . LYS A 1 115 ? -13.291 23.010 10.748  1.00 35.83 ? 131  LYS A CE  1 
ATOM   934  N  NZ  . LYS A 1 115 ? -12.440 23.242 9.548   1.00 36.50 ? 131  LYS A NZ  1 
ATOM   935  N  N   . VAL A 1 116 ? -18.493 26.863 11.607  1.00 33.16 ? 132  VAL A N   1 
ATOM   936  C  CA  . VAL A 1 116 ? -19.609 27.458 12.353  1.00 33.84 ? 132  VAL A CA  1 
ATOM   937  C  C   . VAL A 1 116 ? -20.005 26.593 13.551  1.00 34.85 ? 132  VAL A C   1 
ATOM   938  O  O   . VAL A 1 116 ? -19.619 25.424 13.638  1.00 34.97 ? 132  VAL A O   1 
ATOM   939  C  CB  . VAL A 1 116 ? -20.857 27.746 11.458  1.00 33.21 ? 132  VAL A CB  1 
ATOM   940  C  CG1 . VAL A 1 116 ? -20.473 28.553 10.220  1.00 32.71 ? 132  VAL A CG1 1 
ATOM   941  C  CG2 . VAL A 1 116 ? -21.573 26.458 11.069  1.00 32.96 ? 132  VAL A CG2 1 
ATOM   942  N  N   . CYS A 1 117 ? -20.770 27.179 14.468  1.00 35.78 ? 133  CYS A N   1 
ATOM   943  C  CA  . CYS A 1 117 ? -21.265 26.455 15.636  1.00 37.13 ? 133  CYS A CA  1 
ATOM   944  C  C   . CYS A 1 117 ? -22.589 25.760 15.336  1.00 37.11 ? 133  CYS A C   1 
ATOM   945  O  O   . CYS A 1 117 ? -23.407 26.268 14.564  1.00 36.59 ? 133  CYS A O   1 
ATOM   946  C  CB  . CYS A 1 117 ? -21.408 27.392 16.838  1.00 37.72 ? 133  CYS A CB  1 
ATOM   947  S  SG  . CYS A 1 117 ? -19.868 28.225 17.309  1.00 39.65 ? 133  CYS A SG  1 
ATOM   948  N  N   . ASP A 1 118 ? -22.778 24.592 15.945  1.00 37.87 ? 134  ASP A N   1 
ATOM   949  C  CA  . ASP A 1 118 ? -23.999 23.803 15.795  1.00 38.27 ? 134  ASP A CA  1 
ATOM   950  C  C   . ASP A 1 118 ? -25.210 24.609 16.266  1.00 38.50 ? 134  ASP A C   1 
ATOM   951  O  O   . ASP A 1 118 ? -25.169 25.246 17.323  1.00 38.93 ? 134  ASP A O   1 
ATOM   952  C  CB  . ASP A 1 118 ? -23.877 22.496 16.592  1.00 38.88 ? 134  ASP A CB  1 
ATOM   953  C  CG  . ASP A 1 118 ? -24.940 21.468 16.226  1.00 39.26 ? 134  ASP A CG  1 
ATOM   954  O  OD1 . ASP A 1 118 ? -26.148 21.788 16.265  1.00 39.95 ? 134  ASP A OD1 1 
ATOM   955  O  OD2 . ASP A 1 118 ? -24.561 20.321 15.909  1.00 40.08 ? 134  ASP A OD2 1 
ATOM   956  N  N   . TYR A 1 119 ? -26.273 24.582 15.466  1.00 38.45 ? 135  TYR A N   1 
ATOM   957  C  CA  . TYR A 1 119 ? -27.532 25.261 15.785  1.00 38.76 ? 135  TYR A CA  1 
ATOM   958  C  C   . TYR A 1 119 ? -28.117 24.809 17.124  1.00 39.78 ? 135  TYR A C   1 
ATOM   959  O  O   . TYR A 1 119 ? -28.708 25.610 17.850  1.00 39.95 ? 135  TYR A O   1 
ATOM   960  C  CB  . TYR A 1 119 ? -28.550 25.023 14.666  1.00 38.06 ? 135  TYR A CB  1 
ATOM   961  C  CG  . TYR A 1 119 ? -29.905 25.674 14.868  1.00 37.50 ? 135  TYR A CG  1 
ATOM   962  C  CD1 . TYR A 1 119 ? -30.030 27.059 14.978  1.00 37.10 ? 135  TYR A CD1 1 
ATOM   963  C  CD2 . TYR A 1 119 ? -31.065 24.903 14.920  1.00 37.20 ? 135  TYR A CD2 1 
ATOM   964  C  CE1 . TYR A 1 119 ? -31.276 27.661 15.149  1.00 37.24 ? 135  TYR A CE1 1 
ATOM   965  C  CE2 . TYR A 1 119 ? -32.317 25.494 15.092  1.00 37.30 ? 135  TYR A CE2 1 
ATOM   966  C  CZ  . TYR A 1 119 ? -32.414 26.872 15.205  1.00 37.06 ? 135  TYR A CZ  1 
ATOM   967  O  OH  . TYR A 1 119 ? -33.645 27.460 15.372  1.00 36.94 ? 135  TYR A OH  1 
ATOM   968  N  N   . LYS A 1 120 ? -27.938 23.527 17.435  1.00 40.66 ? 136  LYS A N   1 
ATOM   969  C  CA  . LYS A 1 120 ? -28.485 22.918 18.648  1.00 41.94 ? 136  LYS A CA  1 
ATOM   970  C  C   . LYS A 1 120 ? -27.459 22.832 19.781  1.00 42.83 ? 136  LYS A C   1 
ATOM   971  O  O   . LYS A 1 120 ? -27.825 22.633 20.943  1.00 43.43 ? 136  LYS A O   1 
ATOM   972  C  CB  . LYS A 1 120 ? -29.035 21.522 18.334  1.00 41.97 ? 136  LYS A CB  1 
ATOM   973  C  CG  . LYS A 1 120 ? -30.164 21.501 17.309  1.00 42.25 ? 136  LYS A CG  1 
ATOM   974  C  CD  . LYS A 1 120 ? -30.438 20.082 16.819  1.00 43.58 ? 136  LYS A CD  1 
ATOM   975  C  CE  . LYS A 1 120 ? -31.661 20.022 15.909  1.00 43.87 ? 136  LYS A CE  1 
ATOM   976  N  NZ  . LYS A 1 120 ? -31.403 20.602 14.558  1.00 43.99 ? 136  LYS A NZ  1 
ATOM   977  N  N   . ASP A 1 121 ? -26.181 22.987 19.440  1.00 43.14 ? 137  ASP A N   1 
ATOM   978  C  CA  . ASP A 1 121 ? -25.098 22.864 20.414  1.00 44.06 ? 137  ASP A CA  1 
ATOM   979  C  C   . ASP A 1 121 ? -24.058 23.975 20.243  1.00 44.18 ? 137  ASP A C   1 
ATOM   980  O  O   . ASP A 1 121 ? -23.129 23.855 19.439  1.00 44.00 ? 137  ASP A O   1 
ATOM   981  C  CB  . ASP A 1 121 ? -24.442 21.481 20.301  1.00 44.27 ? 137  ASP A CB  1 
ATOM   982  C  CG  . ASP A 1 121 ? -23.629 21.110 21.531  1.00 45.32 ? 137  ASP A CG  1 
ATOM   983  O  OD1 . ASP A 1 121 ? -23.635 21.876 22.518  1.00 46.26 ? 137  ASP A OD1 1 
ATOM   984  O  OD2 . ASP A 1 121 ? -22.985 20.040 21.512  1.00 45.64 ? 137  ASP A OD2 1 
ATOM   985  N  N   . SER A 1 122 ? -24.215 25.047 21.017  1.00 44.59 ? 138  SER A N   1 
ATOM   986  C  CA  . SER A 1 122 ? -23.362 26.236 20.896  1.00 44.74 ? 138  SER A CA  1 
ATOM   987  C  C   . SER A 1 122 ? -21.900 26.007 21.306  1.00 45.14 ? 138  SER A C   1 
ATOM   988  O  O   . SER A 1 122 ? -21.051 26.877 21.094  1.00 45.25 ? 138  SER A O   1 
ATOM   989  C  CB  . SER A 1 122 ? -23.959 27.410 21.682  1.00 45.03 ? 138  SER A CB  1 
ATOM   990  O  OG  . SER A 1 122 ? -23.983 27.137 23.072  1.00 46.09 ? 138  SER A OG  1 
ATOM   991  N  N   . THR A 1 123 ? -21.613 24.842 21.884  1.00 45.46 ? 139  THR A N   1 
ATOM   992  C  CA  . THR A 1 123 ? -20.244 24.487 22.263  1.00 45.82 ? 139  THR A CA  1 
ATOM   993  C  C   . THR A 1 123 ? -19.505 23.702 21.169  1.00 45.21 ? 139  THR A C   1 
ATOM   994  O  O   . THR A 1 123 ? -18.275 23.590 21.199  1.00 45.51 ? 139  THR A O   1 
ATOM   995  C  CB  . THR A 1 123 ? -20.185 23.734 23.622  1.00 46.61 ? 139  THR A CB  1 
ATOM   996  O  OG1 . THR A 1 123 ? -18.835 23.720 24.099  1.00 47.74 ? 139  THR A OG1 1 
ATOM   997  C  CG2 . THR A 1 123 ? -20.687 22.295 23.496  1.00 46.61 ? 139  THR A CG2 1 
ATOM   998  N  N   . LYS A 1 124 ? -20.260 23.168 20.209  1.00 44.24 ? 140  LYS A N   1 
ATOM   999  C  CA  . LYS A 1 124 ? -19.691 22.420 19.091  1.00 43.46 ? 140  LYS A CA  1 
ATOM   1000 C  C   . LYS A 1 124 ? -19.527 23.338 17.877  1.00 42.46 ? 140  LYS A C   1 
ATOM   1001 O  O   . LYS A 1 124 ? -20.488 23.592 17.145  1.00 41.81 ? 140  LYS A O   1 
ATOM   1002 C  CB  . LYS A 1 124 ? -20.575 21.213 18.754  1.00 43.36 ? 140  LYS A CB  1 
ATOM   1003 C  CG  . LYS A 1 124 ? -19.997 20.291 17.692  1.00 43.67 ? 140  LYS A CG  1 
ATOM   1004 C  CD  . LYS A 1 124 ? -21.008 19.240 17.255  1.00 44.34 ? 140  LYS A CD  1 
ATOM   1005 C  CE  . LYS A 1 124 ? -20.567 18.542 15.971  1.00 44.24 ? 140  LYS A CE  1 
ATOM   1006 N  NZ  . LYS A 1 124 ? -19.283 17.799 16.125  1.00 44.91 ? 140  LYS A NZ  1 
ATOM   1007 N  N   . CYS A 1 125 ? -18.306 23.830 17.670  1.00 41.99 ? 141  CYS A N   1 
ATOM   1008 C  CA  . CYS A 1 125 ? -18.047 24.844 16.645  1.00 41.10 ? 141  CYS A CA  1 
ATOM   1009 C  C   . CYS A 1 125 ? -17.034 24.409 15.577  1.00 40.32 ? 141  CYS A C   1 
ATOM   1010 O  O   . CYS A 1 125 ? -16.190 25.199 15.147  1.00 40.20 ? 141  CYS A O   1 
ATOM   1011 C  CB  . CYS A 1 125 ? -17.626 26.164 17.304  1.00 41.48 ? 141  CYS A CB  1 
ATOM   1012 S  SG  . CYS A 1 125 ? -18.872 26.855 18.441  1.00 42.52 ? 141  CYS A SG  1 
ATOM   1013 N  N   . ASP A 1 126 ? -17.141 23.157 15.139  1.00 39.63 ? 142  ASP A N   1 
ATOM   1014 C  CA  . ASP A 1 126 ? -16.223 22.604 14.141  1.00 38.90 ? 142  ASP A CA  1 
ATOM   1015 C  C   . ASP A 1 126 ? -16.941 22.148 12.866  1.00 37.63 ? 142  ASP A C   1 
ATOM   1016 O  O   . ASP A 1 126 ? -16.462 21.263 12.151  1.00 37.45 ? 142  ASP A O   1 
ATOM   1017 C  CB  . ASP A 1 126 ? -15.394 21.461 14.745  1.00 39.67 ? 142  ASP A CB  1 
ATOM   1018 C  CG  . ASP A 1 126 ? -16.251 20.302 15.247  1.00 40.59 ? 142  ASP A CG  1 
ATOM   1019 O  OD1 . ASP A 1 126 ? -17.483 20.467 15.402  1.00 41.26 ? 142  ASP A OD1 1 
ATOM   1020 O  OD2 . ASP A 1 126 ? -15.681 19.218 15.493  1.00 41.92 ? 142  ASP A OD2 1 
ATOM   1021 N  N   . LEU A 1 127 ? -18.089 22.760 12.587  1.00 36.37 ? 143  LEU A N   1 
ATOM   1022 C  CA  . LEU A 1 127 ? -18.874 22.423 11.405  1.00 35.12 ? 143  LEU A CA  1 
ATOM   1023 C  C   . LEU A 1 127 ? -18.371 23.200 10.192  1.00 34.01 ? 143  LEU A C   1 
ATOM   1024 O  O   . LEU A 1 127 ? -18.447 24.429 10.156  1.00 33.70 ? 143  LEU A O   1 
ATOM   1025 C  CB  . LEU A 1 127 ? -20.364 22.698 11.645  1.00 35.02 ? 143  LEU A CB  1 
ATOM   1026 C  CG  . LEU A 1 127 ? -21.151 21.731 12.541  1.00 35.63 ? 143  LEU A CG  1 
ATOM   1027 C  CD1 . LEU A 1 127 ? -20.855 21.958 14.019  1.00 36.21 ? 143  LEU A CD1 1 
ATOM   1028 C  CD2 . LEU A 1 127 ? -22.643 21.872 12.281  1.00 35.73 ? 143  LEU A CD2 1 
ATOM   1029 N  N   . ALA A 1 128 ? -17.839 22.472 9.213   1.00 33.14 ? 144  ALA A N   1 
ATOM   1030 C  CA  . ALA A 1 128 ? -17.368 23.066 7.964   1.00 32.14 ? 144  ALA A CA  1 
ATOM   1031 C  C   . ALA A 1 128 ? -18.461 22.991 6.901   1.00 31.26 ? 144  ALA A C   1 
ATOM   1032 O  O   . ALA A 1 128 ? -19.401 22.202 7.026   1.00 31.03 ? 144  ALA A O   1 
ATOM   1033 C  CB  . ALA A 1 128 ? -16.104 22.361 7.487   1.00 32.15 ? 144  ALA A CB  1 
ATOM   1034 N  N   . LEU A 1 129 ? -18.340 23.816 5.862   1.00 30.46 ? 145  LEU A N   1 
ATOM   1035 C  CA  . LEU A 1 129 ? -19.300 23.810 4.753   1.00 29.79 ? 145  LEU A CA  1 
ATOM   1036 C  C   . LEU A 1 129 ? -19.432 22.408 4.163   1.00 29.79 ? 145  LEU A C   1 
ATOM   1037 O  O   . LEU A 1 129 ? -20.535 21.875 4.046   1.00 29.43 ? 145  LEU A O   1 
ATOM   1038 C  CB  . LEU A 1 129 ? -18.886 24.811 3.668   1.00 29.25 ? 145  LEU A CB  1 
ATOM   1039 C  CG  . LEU A 1 129 ? -19.769 24.931 2.420   1.00 28.67 ? 145  LEU A CG  1 
ATOM   1040 C  CD1 . LEU A 1 129 ? -21.091 25.634 2.738   1.00 28.29 ? 145  LEU A CD1 1 
ATOM   1041 C  CD2 . LEU A 1 129 ? -19.025 25.664 1.315   1.00 27.92 ? 145  LEU A CD2 1 
ATOM   1042 N  N   . ASP A 1 130 ? -18.291 21.824 3.808   1.00 30.10 ? 146  ASP A N   1 
ATOM   1043 C  CA  . ASP A 1 130 ? -18.223 20.473 3.277   1.00 30.39 ? 146  ASP A CA  1 
ATOM   1044 C  C   . ASP A 1 130 ? -17.610 19.565 4.348   1.00 30.87 ? 146  ASP A C   1 
ATOM   1045 O  O   . ASP A 1 130 ? -16.418 19.685 4.647   1.00 31.17 ? 146  ASP A O   1 
ATOM   1046 C  CB  . ASP A 1 130 ? -17.375 20.464 1.999   1.00 30.38 ? 146  ASP A CB  1 
ATOM   1047 C  CG  . ASP A 1 130 ? -17.425 19.137 1.255   1.00 30.80 ? 146  ASP A CG  1 
ATOM   1048 O  OD1 . ASP A 1 130 ? -18.090 18.187 1.722   1.00 31.66 ? 146  ASP A OD1 1 
ATOM   1049 O  OD2 . ASP A 1 130 ? -16.787 19.048 0.185   1.00 30.97 ? 146  ASP A OD2 1 
ATOM   1050 N  N   . PRO A 1 131 ? -18.411 18.637 4.913   1.00 31.09 ? 147  PRO A N   1 
ATOM   1051 C  CA  . PRO A 1 131 ? -19.794 18.328 4.546   1.00 30.89 ? 147  PRO A CA  1 
ATOM   1052 C  C   . PRO A 1 131 ? -20.900 18.837 5.484   1.00 30.99 ? 147  PRO A C   1 
ATOM   1053 O  O   . PRO A 1 131 ? -22.072 18.768 5.114   1.00 30.71 ? 147  PRO A O   1 
ATOM   1054 C  CB  . PRO A 1 131 ? -19.798 16.800 4.567   1.00 31.21 ? 147  PRO A CB  1 
ATOM   1055 C  CG  . PRO A 1 131 ? -18.820 16.444 5.662   1.00 31.70 ? 147  PRO A CG  1 
ATOM   1056 C  CD  . PRO A 1 131 ? -17.865 17.616 5.828   1.00 31.59 ? 147  PRO A CD  1 
ATOM   1057 N  N   . GLU A 1 132 ? -20.544 19.330 6.671   1.00 31.48 ? 148  GLU A N   1 
ATOM   1058 C  CA  . GLU A 1 132 ? -21.531 19.583 7.738   1.00 31.90 ? 148  GLU A CA  1 
ATOM   1059 C  C   . GLU A 1 132 ? -22.647 20.574 7.388   1.00 31.71 ? 148  GLU A C   1 
ATOM   1060 O  O   . GLU A 1 132 ? -23.830 20.242 7.502   1.00 31.63 ? 148  GLU A O   1 
ATOM   1061 C  CB  . GLU A 1 132 ? -20.848 19.999 9.050   1.00 32.43 ? 148  GLU A CB  1 
ATOM   1062 C  CG  . GLU A 1 132 ? -20.110 18.870 9.775   1.00 33.23 ? 148  GLU A CG  1 
ATOM   1063 C  CD  . GLU A 1 132 ? -18.709 18.625 9.231   1.00 33.78 ? 148  GLU A CD  1 
ATOM   1064 O  OE1 . GLU A 1 132 ? -18.099 19.567 8.682   1.00 33.71 ? 148  GLU A OE1 1 
ATOM   1065 O  OE2 . GLU A 1 132 ? -18.214 17.486 9.358   1.00 34.64 ? 148  GLU A OE2 1 
ATOM   1066 N  N   . ILE A 1 133 ? -22.275 21.781 6.967   1.00 31.60 ? 149  ILE A N   1 
ATOM   1067 C  CA  . ILE A 1 133 ? -23.264 22.827 6.697   1.00 31.51 ? 149  ILE A CA  1 
ATOM   1068 C  C   . ILE A 1 133 ? -24.105 22.492 5.462   1.00 31.38 ? 149  ILE A C   1 
ATOM   1069 O  O   . ILE A 1 133 ? -25.328 22.634 5.490   1.00 31.20 ? 149  ILE A O   1 
ATOM   1070 C  CB  . ILE A 1 133 ? -22.629 24.235 6.571   1.00 31.23 ? 149  ILE A CB  1 
ATOM   1071 C  CG1 . ILE A 1 133 ? -21.757 24.553 7.791   1.00 31.26 ? 149  ILE A CG1 1 
ATOM   1072 C  CG2 . ILE A 1 133 ? -23.716 25.297 6.424   1.00 31.22 ? 149  ILE A CG2 1 
ATOM   1073 C  CD1 . ILE A 1 133 ? -20.850 25.766 7.613   1.00 30.37 ? 149  ILE A CD1 1 
ATOM   1074 N  N   . GLU A 1 134 ? -23.448 22.028 4.399   1.00 31.66 ? 150  GLU A N   1 
ATOM   1075 C  CA  . GLU A 1 134 ? -24.139 21.636 3.167   1.00 31.83 ? 150  GLU A CA  1 
ATOM   1076 C  C   . GLU A 1 134 ? -25.155 20.516 3.389   1.00 31.98 ? 150  GLU A C   1 
ATOM   1077 O  O   . GLU A 1 134 ? -26.198 20.488 2.735   1.00 31.81 ? 150  GLU A O   1 
ATOM   1078 C  CB  . GLU A 1 134 ? -23.144 21.245 2.070   1.00 31.88 ? 150  GLU A CB  1 
ATOM   1079 C  CG  . GLU A 1 134 ? -22.514 22.439 1.356   1.00 33.08 ? 150  GLU A CG  1 
ATOM   1080 C  CD  . GLU A 1 134 ? -21.703 22.053 0.123   1.00 34.73 ? 150  GLU A CD  1 
ATOM   1081 O  OE1 . GLU A 1 134 ? -21.502 20.843 -0.120  1.00 36.12 ? 150  GLU A OE1 1 
ATOM   1082 O  OE2 . GLU A 1 134 ? -21.262 22.966 -0.606  1.00 35.27 ? 150  GLU A OE2 1 
ATOM   1083 N  N   . GLU A 1 135 ? -24.850 19.604 4.312   1.00 32.40 ? 151  GLU A N   1 
ATOM   1084 C  CA  . GLU A 1 135 ? -25.780 18.530 4.666   1.00 32.74 ? 151  GLU A CA  1 
ATOM   1085 C  C   . GLU A 1 135 ? -27.068 19.088 5.277   1.00 32.53 ? 151  GLU A C   1 
ATOM   1086 O  O   . GLU A 1 135 ? -28.161 18.634 4.941   1.00 32.58 ? 151  GLU A O   1 
ATOM   1087 C  CB  . GLU A 1 135 ? -25.124 17.520 5.612   1.00 33.24 ? 151  GLU A CB  1 
ATOM   1088 C  CG  . GLU A 1 135 ? -25.910 16.224 5.780   0.50 34.00 ? 151  GLU A CG  1 
ATOM   1089 C  CD  . GLU A 1 135 ? -25.108 15.133 6.461   0.50 35.29 ? 151  GLU A CD  1 
ATOM   1090 O  OE1 . GLU A 1 135 ? -24.672 15.335 7.614   0.50 35.94 ? 151  GLU A OE1 1 
ATOM   1091 O  OE2 . GLU A 1 135 ? -24.922 14.065 5.841   0.50 35.82 ? 151  GLU A OE2 1 
ATOM   1092 N  N   . VAL A 1 136 ? -26.932 20.075 6.160   1.00 32.53 ? 152  VAL A N   1 
ATOM   1093 C  CA  . VAL A 1 136 ? -28.093 20.713 6.790   1.00 32.36 ? 152  VAL A CA  1 
ATOM   1094 C  C   . VAL A 1 136 ? -28.920 21.487 5.757   1.00 31.91 ? 152  VAL A C   1 
ATOM   1095 O  O   . VAL A 1 136 ? -30.140 21.321 5.684   1.00 31.79 ? 152  VAL A O   1 
ATOM   1096 C  CB  . VAL A 1 136 ? -27.687 21.634 7.971   1.00 32.59 ? 152  VAL A CB  1 
ATOM   1097 C  CG1 . VAL A 1 136 ? -28.917 22.285 8.597   1.00 32.63 ? 152  VAL A CG1 1 
ATOM   1098 C  CG2 . VAL A 1 136 ? -26.918 20.845 9.027   1.00 33.17 ? 152  VAL A CG2 1 
ATOM   1099 N  N   . ILE A 1 137 ? -28.253 22.310 4.950   1.00 31.50 ? 153  ILE A N   1 
ATOM   1100 C  CA  . ILE A 1 137 ? -28.931 23.100 3.917   1.00 31.13 ? 153  ILE A CA  1 
ATOM   1101 C  C   . ILE A 1 137 ? -29.701 22.208 2.932   1.00 31.02 ? 153  ILE A C   1 
ATOM   1102 O  O   . ILE A 1 137 ? -30.798 22.560 2.492   1.00 30.72 ? 153  ILE A O   1 
ATOM   1103 C  CB  . ILE A 1 137 ? -27.945 24.039 3.160   1.00 30.96 ? 153  ILE A CB  1 
ATOM   1104 C  CG1 . ILE A 1 137 ? -27.231 24.996 4.132   1.00 31.07 ? 153  ILE A CG1 1 
ATOM   1105 C  CG2 . ILE A 1 137 ? -28.658 24.815 2.053   1.00 30.73 ? 153  ILE A CG2 1 
ATOM   1106 C  CD1 . ILE A 1 137 ? -28.133 26.012 4.849   1.00 30.96 ? 153  ILE A CD1 1 
ATOM   1107 N  N   . SER A 1 138 ? -29.131 21.049 2.610   1.00 31.21 ? 154  SER A N   1 
ATOM   1108 C  CA  . SER A 1 138 ? -29.756 20.120 1.669   1.00 31.39 ? 154  SER A CA  1 
ATOM   1109 C  C   . SER A 1 138 ? -30.892 19.289 2.275   1.00 31.51 ? 154  SER A C   1 
ATOM   1110 O  O   . SER A 1 138 ? -31.802 18.876 1.557   1.00 31.38 ? 154  SER A O   1 
ATOM   1111 C  CB  . SER A 1 138 ? -28.704 19.202 1.036   1.00 31.57 ? 154  SER A CB  1 
ATOM   1112 O  OG  . SER A 1 138 ? -28.029 18.444 2.023   1.00 33.02 ? 154  SER A OG  1 
ATOM   1113 N  N   . LYS A 1 139 ? -30.845 19.050 3.585   1.00 31.77 ? 155  LYS A N   1 
ATOM   1114 C  CA  . LYS A 1 139 ? -31.767 18.102 4.220   1.00 32.03 ? 155  LYS A CA  1 
ATOM   1115 C  C   . LYS A 1 139 ? -32.784 18.702 5.193   1.00 31.86 ? 155  LYS A C   1 
ATOM   1116 O  O   . LYS A 1 139 ? -33.902 18.199 5.304   1.00 31.83 ? 155  LYS A O   1 
ATOM   1117 C  CB  . LYS A 1 139 ? -30.992 16.968 4.902   1.00 32.61 ? 155  LYS A CB  1 
ATOM   1118 C  CG  . LYS A 1 139 ? -30.264 16.053 3.926   1.00 33.69 ? 155  LYS A CG  1 
ATOM   1119 C  CD  . LYS A 1 139 ? -29.559 14.910 4.638   1.00 35.87 ? 155  LYS A CD  1 
ATOM   1120 C  CE  . LYS A 1 139 ? -28.807 14.039 3.641   1.00 37.03 ? 155  LYS A CE  1 
ATOM   1121 N  NZ  . LYS A 1 139 ? -28.139 12.882 4.303   1.00 38.64 ? 155  LYS A NZ  1 
ATOM   1122 N  N   . SER A 1 140 ? -32.402 19.764 5.897   1.00 31.60 ? 156  SER A N   1 
ATOM   1123 C  CA  . SER A 1 140 ? -33.295 20.385 6.877   1.00 31.56 ? 156  SER A CA  1 
ATOM   1124 C  C   . SER A 1 140 ? -34.492 21.051 6.209   1.00 31.19 ? 156  SER A C   1 
ATOM   1125 O  O   . SER A 1 140 ? -34.365 21.672 5.152   1.00 30.70 ? 156  SER A O   1 
ATOM   1126 C  CB  . SER A 1 140 ? -32.547 21.405 7.737   1.00 31.58 ? 156  SER A CB  1 
ATOM   1127 O  OG  . SER A 1 140 ? -33.429 22.049 8.642   1.00 31.96 ? 156  SER A OG  1 
ATOM   1128 N  N   . ARG A 1 141 ? -35.656 20.900 6.830   1.00 31.15 ? 157  ARG A N   1 
ATOM   1129 C  CA  . ARG A 1 141 ? -36.858 21.601 6.391   1.00 31.00 ? 157  ARG A CA  1 
ATOM   1130 C  C   . ARG A 1 141 ? -37.364 22.500 7.521   1.00 30.85 ? 157  ARG A C   1 
ATOM   1131 O  O   . ARG A 1 141 ? -38.534 22.881 7.557   1.00 30.94 ? 157  ARG A O   1 
ATOM   1132 C  CB  . ARG A 1 141 ? -37.935 20.610 5.927   1.00 31.30 ? 157  ARG A CB  1 
ATOM   1133 C  CG  . ARG A 1 141 ? -37.469 19.582 4.890   1.00 32.06 ? 157  ARG A CG  1 
ATOM   1134 C  CD  . ARG A 1 141 ? -37.393 20.174 3.489   1.00 33.20 ? 157  ARG A CD  1 
ATOM   1135 N  NE  . ARG A 1 141 ? -37.078 19.159 2.483   1.00 34.21 ? 157  ARG A NE  1 
ATOM   1136 C  CZ  . ARG A 1 141 ? -35.925 19.069 1.823   1.00 34.97 ? 157  ARG A CZ  1 
ATOM   1137 N  NH1 . ARG A 1 141 ? -34.941 19.938 2.043   1.00 35.47 ? 157  ARG A NH1 1 
ATOM   1138 N  NH2 . ARG A 1 141 ? -35.755 18.104 0.930   1.00 34.84 ? 157  ARG A NH2 1 
ATOM   1139 N  N   . ASP A 1 142 ? -36.458 22.823 8.442   1.00 30.67 ? 158  ASP A N   1 
ATOM   1140 C  CA  . ASP A 1 142 ? -36.706 23.768 9.521   1.00 30.49 ? 158  ASP A CA  1 
ATOM   1141 C  C   . ASP A 1 142 ? -36.181 25.130 9.067   1.00 29.83 ? 158  ASP A C   1 
ATOM   1142 O  O   . ASP A 1 142 ? -34.970 25.369 9.075   1.00 29.64 ? 158  ASP A O   1 
ATOM   1143 C  CB  . ASP A 1 142 ? -35.996 23.295 10.802  1.00 31.11 ? 158  ASP A CB  1 
ATOM   1144 C  CG  . ASP A 1 142 ? -36.164 24.257 11.979  1.00 32.15 ? 158  ASP A CG  1 
ATOM   1145 O  OD1 . ASP A 1 142 ? -36.353 25.475 11.768  1.00 32.75 ? 158  ASP A OD1 1 
ATOM   1146 O  OD2 . ASP A 1 142 ? -36.085 23.789 13.134  1.00 33.49 ? 158  ASP A OD2 1 
ATOM   1147 N  N   . HIS A 1 143 ? -37.098 26.017 8.677   1.00 29.04 ? 159  HIS A N   1 
ATOM   1148 C  CA  . HIS A 1 143 ? -36.729 27.299 8.068   1.00 28.38 ? 159  HIS A CA  1 
ATOM   1149 C  C   . HIS A 1 143 ? -35.843 28.181 8.952   1.00 28.31 ? 159  HIS A C   1 
ATOM   1150 O  O   . HIS A 1 143 ? -34.990 28.907 8.444   1.00 28.13 ? 159  HIS A O   1 
ATOM   1151 C  CB  . HIS A 1 143 ? -37.966 28.063 7.579   1.00 28.08 ? 159  HIS A CB  1 
ATOM   1152 C  CG  . HIS A 1 143 ? -38.973 28.343 8.650   1.00 28.22 ? 159  HIS A CG  1 
ATOM   1153 N  ND1 . HIS A 1 143 ? -39.019 29.539 9.333   1.00 28.35 ? 159  HIS A ND1 1 
ATOM   1154 C  CD2 . HIS A 1 143 ? -39.979 27.586 9.149   1.00 28.00 ? 159  HIS A CD2 1 
ATOM   1155 C  CE1 . HIS A 1 143 ? -40.007 29.506 10.210  1.00 28.30 ? 159  HIS A CE1 1 
ATOM   1156 N  NE2 . HIS A 1 143 ? -40.605 28.332 10.119  1.00 28.53 ? 159  HIS A NE2 1 
ATOM   1157 N  N   . GLU A 1 144 ? -36.034 28.111 10.268  1.00 28.28 ? 160  GLU A N   1 
ATOM   1158 C  CA  . GLU A 1 144 ? -35.202 28.890 11.189  1.00 28.34 ? 160  GLU A CA  1 
ATOM   1159 C  C   . GLU A 1 144 ? -33.787 28.322 11.321  1.00 27.89 ? 160  GLU A C   1 
ATOM   1160 O  O   . GLU A 1 144 ? -32.821 29.077 11.409  1.00 27.75 ? 160  GLU A O   1 
ATOM   1161 C  CB  . GLU A 1 144 ? -35.876 29.053 12.554  1.00 28.94 ? 160  GLU A CB  1 
ATOM   1162 C  CG  . GLU A 1 144 ? -37.185 29.839 12.482  1.00 30.04 ? 160  GLU A CG  1 
ATOM   1163 C  CD  . GLU A 1 144 ? -37.460 30.682 13.712  1.00 32.31 ? 160  GLU A CD  1 
ATOM   1164 O  OE1 . GLU A 1 144 ? -37.036 30.302 14.828  1.00 33.72 ? 160  GLU A OE1 1 
ATOM   1165 O  OE2 . GLU A 1 144 ? -38.114 31.738 13.558  1.00 33.20 ? 160  GLU A OE2 1 
ATOM   1166 N  N   . GLU A 1 145 ? -33.674 26.995 11.320  1.00 27.43 ? 161  GLU A N   1 
ATOM   1167 C  CA  . GLU A 1 145 ? -32.373 26.327 11.317  1.00 27.11 ? 161  GLU A CA  1 
ATOM   1168 C  C   . GLU A 1 145 ? -31.596 26.688 10.053  1.00 26.30 ? 161  GLU A C   1 
ATOM   1169 O  O   . GLU A 1 145 ? -30.418 27.040 10.121  1.00 26.07 ? 161  GLU A O   1 
ATOM   1170 C  CB  . GLU A 1 145 ? -32.537 24.809 11.420  1.00 27.31 ? 161  GLU A CB  1 
ATOM   1171 C  CG  . GLU A 1 145 ? -31.221 24.032 11.350  1.00 28.14 ? 161  GLU A CG  1 
ATOM   1172 C  CD  . GLU A 1 145 ? -31.401 22.537 11.540  1.00 29.42 ? 161  GLU A CD  1 
ATOM   1173 O  OE1 . GLU A 1 145 ? -32.407 21.980 11.052  1.00 29.99 ? 161  GLU A OE1 1 
ATOM   1174 O  OE2 . GLU A 1 145 ? -30.526 21.916 12.177  1.00 30.20 ? 161  GLU A OE2 1 
ATOM   1175 N  N   . LEU A 1 146 ? -32.274 26.602 8.910   1.00 25.54 ? 162  LEU A N   1 
ATOM   1176 C  CA  . LEU A 1 146 ? -31.686 26.963 7.621   1.00 24.95 ? 162  LEU A CA  1 
ATOM   1177 C  C   . LEU A 1 146 ? -31.184 28.408 7.618   1.00 24.82 ? 162  LEU A C   1 
ATOM   1178 O  O   . LEU A 1 146 ? -30.070 28.681 7.161   1.00 24.52 ? 162  LEU A O   1 
ATOM   1179 C  CB  . LEU A 1 146 ? -32.693 26.735 6.489   1.00 24.52 ? 162  LEU A CB  1 
ATOM   1180 C  CG  . LEU A 1 146 ? -33.100 25.287 6.190   1.00 24.30 ? 162  LEU A CG  1 
ATOM   1181 C  CD1 . LEU A 1 146 ? -34.368 25.246 5.356   1.00 23.73 ? 162  LEU A CD1 1 
ATOM   1182 C  CD2 . LEU A 1 146 ? -31.975 24.522 5.497   1.00 24.04 ? 162  LEU A CD2 1 
ATOM   1183 N  N   . ALA A 1 147 ? -32.001 29.318 8.153   1.00 24.76 ? 163  ALA A N   1 
ATOM   1184 C  CA  . ALA A 1 147 ? -31.660 30.741 8.218   1.00 24.59 ? 163  ALA A CA  1 
ATOM   1185 C  C   . ALA A 1 147 ? -30.445 30.996 9.107   1.00 24.94 ? 163  ALA A C   1 
ATOM   1186 O  O   . ALA A 1 147 ? -29.613 31.854 8.798   1.00 24.91 ? 163  ALA A O   1 
ATOM   1187 C  CB  . ALA A 1 147 ? -32.855 31.558 8.689   1.00 24.71 ? 163  ALA A CB  1 
ATOM   1188 N  N   . TYR A 1 148 ? -30.348 30.248 10.205  1.00 25.07 ? 164  TYR A N   1 
ATOM   1189 C  CA  . TYR A 1 148 ? -29.198 30.337 11.101  1.00 25.41 ? 164  TYR A CA  1 
ATOM   1190 C  C   . TYR A 1 148 ? -27.893 30.001 10.374  1.00 24.97 ? 164  TYR A C   1 
ATOM   1191 O  O   . TYR A 1 148 ? -26.927 30.762 10.441  1.00 25.00 ? 164  TYR A O   1 
ATOM   1192 C  CB  . TYR A 1 148 ? -29.375 29.424 12.325  1.00 25.82 ? 164  TYR A CB  1 
ATOM   1193 C  CG  . TYR A 1 148 ? -28.094 29.217 13.112  1.00 26.66 ? 164  TYR A CG  1 
ATOM   1194 C  CD1 . TYR A 1 148 ? -27.681 30.147 14.067  1.00 27.59 ? 164  TYR A CD1 1 
ATOM   1195 C  CD2 . TYR A 1 148 ? -27.289 28.097 12.890  1.00 27.01 ? 164  TYR A CD2 1 
ATOM   1196 C  CE1 . TYR A 1 148 ? -26.500 29.967 14.783  1.00 28.12 ? 164  TYR A CE1 1 
ATOM   1197 C  CE2 . TYR A 1 148 ? -26.107 27.909 13.599  1.00 27.42 ? 164  TYR A CE2 1 
ATOM   1198 C  CZ  . TYR A 1 148 ? -25.720 28.845 14.544  1.00 28.30 ? 164  TYR A CZ  1 
ATOM   1199 O  OH  . TYR A 1 148 ? -24.551 28.660 15.246  1.00 28.81 ? 164  TYR A OH  1 
ATOM   1200 N  N   . TYR A 1 149 ? -27.873 28.861 9.687   1.00 24.55 ? 165  TYR A N   1 
ATOM   1201 C  CA  . TYR A 1 149 ? -26.670 28.411 8.988   1.00 24.44 ? 165  TYR A CA  1 
ATOM   1202 C  C   . TYR A 1 149 ? -26.317 29.307 7.805   1.00 23.98 ? 165  TYR A C   1 
ATOM   1203 O  O   . TYR A 1 149 ? -25.139 29.521 7.522   1.00 23.94 ? 165  TYR A O   1 
ATOM   1204 C  CB  . TYR A 1 149 ? -26.791 26.946 8.561   1.00 24.31 ? 165  TYR A CB  1 
ATOM   1205 C  CG  . TYR A 1 149 ? -26.586 25.974 9.706   1.00 25.32 ? 165  TYR A CG  1 
ATOM   1206 C  CD1 . TYR A 1 149 ? -25.319 25.776 10.260  1.00 26.03 ? 165  TYR A CD1 1 
ATOM   1207 C  CD2 . TYR A 1 149 ? -27.659 25.258 10.241  1.00 25.64 ? 165  TYR A CD2 1 
ATOM   1208 C  CE1 . TYR A 1 149 ? -25.123 24.890 11.314  1.00 26.68 ? 165  TYR A CE1 1 
ATOM   1209 C  CE2 . TYR A 1 149 ? -27.473 24.365 11.296  1.00 26.41 ? 165  TYR A CE2 1 
ATOM   1210 C  CZ  . TYR A 1 149 ? -26.202 24.188 11.826  1.00 26.93 ? 165  TYR A CZ  1 
ATOM   1211 O  OH  . TYR A 1 149 ? -26.006 23.311 12.866  1.00 27.55 ? 165  TYR A OH  1 
ATOM   1212 N  N   . TRP A 1 150 ? -27.338 29.833 7.130   1.00 23.66 ? 166  TRP A N   1 
ATOM   1213 C  CA  . TRP A 1 150 ? -27.131 30.801 6.052   1.00 23.36 ? 166  TRP A CA  1 
ATOM   1214 C  C   . TRP A 1 150 ? -26.376 32.021 6.578   1.00 23.74 ? 166  TRP A C   1 
ATOM   1215 O  O   . TRP A 1 150 ? -25.343 32.405 6.023   1.00 23.28 ? 166  TRP A O   1 
ATOM   1216 C  CB  . TRP A 1 150 ? -28.469 31.229 5.430   1.00 23.09 ? 166  TRP A CB  1 
ATOM   1217 C  CG  . TRP A 1 150 ? -28.324 32.043 4.160   1.00 22.17 ? 166  TRP A CG  1 
ATOM   1218 C  CD1 . TRP A 1 150 ? -28.466 31.592 2.881   1.00 21.80 ? 166  TRP A CD1 1 
ATOM   1219 C  CD2 . TRP A 1 150 ? -28.007 33.440 4.060   1.00 21.79 ? 166  TRP A CD2 1 
ATOM   1220 N  NE1 . TRP A 1 150 ? -28.262 32.620 1.988   1.00 21.40 ? 166  TRP A NE1 1 
ATOM   1221 C  CE2 . TRP A 1 150 ? -27.977 33.764 2.685   1.00 21.50 ? 166  TRP A CE2 1 
ATOM   1222 C  CE3 . TRP A 1 150 ? -27.750 34.451 4.999   1.00 22.15 ? 166  TRP A CE3 1 
ATOM   1223 C  CZ2 . TRP A 1 150 ? -27.696 35.055 2.223   1.00 21.16 ? 166  TRP A CZ2 1 
ATOM   1224 C  CZ3 . TRP A 1 150 ? -27.467 35.737 4.539   1.00 22.24 ? 166  TRP A CZ3 1 
ATOM   1225 C  CH2 . TRP A 1 150 ? -27.441 36.024 3.161   1.00 21.80 ? 166  TRP A CH2 1 
ATOM   1226 N  N   . ARG A 1 151 ? -26.888 32.613 7.659   1.00 24.32 ? 167  ARG A N   1 
ATOM   1227 C  CA  . ARG A 1 151 ? -26.296 33.819 8.233   1.00 25.10 ? 167  ARG A CA  1 
ATOM   1228 C  C   . ARG A 1 151 ? -24.872 33.576 8.730   1.00 25.33 ? 167  ARG A C   1 
ATOM   1229 O  O   . ARG A 1 151 ? -23.969 34.357 8.429   1.00 25.31 ? 167  ARG A O   1 
ATOM   1230 C  CB  . ARG A 1 151 ? -27.170 34.394 9.358   1.00 25.66 ? 167  ARG A CB  1 
ATOM   1231 C  CG  . ARG A 1 151 ? -26.745 35.791 9.805   1.00 27.36 ? 167  ARG A CG  1 
ATOM   1232 C  CD  . ARG A 1 151 ? -27.290 36.154 11.184  1.00 30.89 ? 167  ARG A CD  1 
ATOM   1233 N  NE  . ARG A 1 151 ? -28.644 36.709 11.145  1.00 33.36 ? 167  ARG A NE  1 
ATOM   1234 C  CZ  . ARG A 1 151 ? -28.939 37.988 10.906  1.00 34.68 ? 167  ARG A CZ  1 
ATOM   1235 N  NH1 . ARG A 1 151 ? -27.980 38.874 10.662  1.00 35.17 ? 167  ARG A NH1 1 
ATOM   1236 N  NH2 . ARG A 1 151 ? -30.203 38.387 10.905  1.00 34.96 ? 167  ARG A NH2 1 
ATOM   1237 N  N   . GLU A 1 152 ? -24.677 32.490 9.478   1.00 25.55 ? 168  GLU A N   1 
ATOM   1238 C  CA  . GLU A 1 152 ? -23.362 32.156 10.023  1.00 25.88 ? 168  GLU A CA  1 
ATOM   1239 C  C   . GLU A 1 152 ? -22.318 31.981 8.923   1.00 25.51 ? 168  GLU A C   1 
ATOM   1240 O  O   . GLU A 1 152 ? -21.217 32.520 9.028   1.00 25.57 ? 168  GLU A O   1 
ATOM   1241 C  CB  . GLU A 1 152 ? -23.426 30.910 10.915  1.00 26.41 ? 168  GLU A CB  1 
ATOM   1242 C  CG  . GLU A 1 152 ? -24.156 31.125 12.246  1.00 27.65 ? 168  GLU A CG  1 
ATOM   1243 C  CD  . GLU A 1 152 ? -23.533 32.218 13.103  1.00 29.67 ? 168  GLU A CD  1 
ATOM   1244 O  OE1 . GLU A 1 152 ? -22.352 32.082 13.491  1.00 30.58 ? 168  GLU A OE1 1 
ATOM   1245 O  OE2 . GLU A 1 152 ? -24.229 33.213 13.393  1.00 30.60 ? 168  GLU A OE2 1 
ATOM   1246 N  N   . PHE A 1 153 ? -22.674 31.254 7.865   1.00 24.88 ? 169  PHE A N   1 
ATOM   1247 C  CA  . PHE A 1 153 ? -21.745 31.022 6.759   1.00 24.74 ? 169  PHE A CA  1 
ATOM   1248 C  C   . PHE A 1 153 ? -21.410 32.282 5.951   1.00 24.37 ? 169  PHE A C   1 
ATOM   1249 O  O   . PHE A 1 153 ? -20.237 32.550 5.688   1.00 24.67 ? 169  PHE A O   1 
ATOM   1250 C  CB  . PHE A 1 153 ? -22.226 29.902 5.829   1.00 24.39 ? 169  PHE A CB  1 
ATOM   1251 C  CG  . PHE A 1 153 ? -21.243 29.572 4.742   1.00 24.81 ? 169  PHE A CG  1 
ATOM   1252 C  CD1 . PHE A 1 153 ? -20.079 28.859 5.033   1.00 24.73 ? 169  PHE A CD1 1 
ATOM   1253 C  CD2 . PHE A 1 153 ? -21.458 30.006 3.438   1.00 24.28 ? 169  PHE A CD2 1 
ATOM   1254 C  CE1 . PHE A 1 153 ? -19.154 28.567 4.037   1.00 25.34 ? 169  PHE A CE1 1 
ATOM   1255 C  CE2 . PHE A 1 153 ? -20.535 29.718 2.434   1.00 24.98 ? 169  PHE A CE2 1 
ATOM   1256 C  CZ  . PHE A 1 153 ? -19.383 28.997 2.735   1.00 24.66 ? 169  PHE A CZ  1 
ATOM   1257 N  N   . TYR A 1 154 ? -22.430 33.044 5.557   1.00 23.86 ? 170  TYR A N   1 
ATOM   1258 C  CA  . TYR A 1 154 ? -22.214 34.260 4.769   1.00 23.39 ? 170  TYR A CA  1 
ATOM   1259 C  C   . TYR A 1 154 ? -21.411 35.313 5.529   1.00 23.72 ? 170  TYR A C   1 
ATOM   1260 O  O   . TYR A 1 154 ? -20.575 35.995 4.940   1.00 23.67 ? 170  TYR A O   1 
ATOM   1261 C  CB  . TYR A 1 154 ? -23.539 34.844 4.271   1.00 22.82 ? 170  TYR A CB  1 
ATOM   1262 C  CG  . TYR A 1 154 ? -24.052 34.222 2.990   1.00 21.92 ? 170  TYR A CG  1 
ATOM   1263 C  CD1 . TYR A 1 154 ? -24.583 32.930 2.978   1.00 21.13 ? 170  TYR A CD1 1 
ATOM   1264 C  CD2 . TYR A 1 154 ? -24.024 34.933 1.788   1.00 20.80 ? 170  TYR A CD2 1 
ATOM   1265 C  CE1 . TYR A 1 154 ? -25.058 32.356 1.795   1.00 20.71 ? 170  TYR A CE1 1 
ATOM   1266 C  CE2 . TYR A 1 154 ? -24.501 34.371 0.606   1.00 20.17 ? 170  TYR A CE2 1 
ATOM   1267 C  CZ  . TYR A 1 154 ? -25.021 33.087 0.617   1.00 20.40 ? 170  TYR A CZ  1 
ATOM   1268 O  OH  . TYR A 1 154 ? -25.499 32.523 -0.548  1.00 19.21 ? 170  TYR A OH  1 
ATOM   1269 N  N   . ASP A 1 155 ? -21.660 35.438 6.831   1.00 24.09 ? 171  ASP A N   1 
ATOM   1270 C  CA  . ASP A 1 155 ? -20.890 36.358 7.671   1.00 24.64 ? 171  ASP A CA  1 
ATOM   1271 C  C   . ASP A 1 155 ? -19.401 35.997 7.692   1.00 24.83 ? 171  ASP A C   1 
ATOM   1272 O  O   . ASP A 1 155 ? -18.546 36.883 7.641   1.00 24.95 ? 171  ASP A O   1 
ATOM   1273 C  CB  . ASP A 1 155 ? -21.450 36.403 9.101   1.00 25.00 ? 171  ASP A CB  1 
ATOM   1274 C  CG  . ASP A 1 155 ? -22.781 37.148 9.198   1.00 25.33 ? 171  ASP A CG  1 
ATOM   1275 O  OD1 . ASP A 1 155 ? -23.240 37.738 8.192   1.00 24.84 ? 171  ASP A OD1 1 
ATOM   1276 O  OD2 . ASP A 1 155 ? -23.375 37.146 10.296  1.00 25.78 ? 171  ASP A OD2 1 
ATOM   1277 N  N   . LYS A 1 156 ? -19.104 34.698 7.741   1.00 24.90 ? 172  LYS A N   1 
ATOM   1278 C  CA  . LYS A 1 156 ? -17.727 34.202 7.878   1.00 25.45 ? 172  LYS A CA  1 
ATOM   1279 C  C   . LYS A 1 156 ? -16.987 34.035 6.550   1.00 24.96 ? 172  LYS A C   1 
ATOM   1280 O  O   . LYS A 1 156 ? -15.785 34.290 6.468   1.00 25.15 ? 172  LYS A O   1 
ATOM   1281 C  CB  . LYS A 1 156 ? -17.711 32.869 8.630   1.00 25.67 ? 172  LYS A CB  1 
ATOM   1282 C  CG  . LYS A 1 156 ? -18.084 32.968 10.098  1.00 26.97 ? 172  LYS A CG  1 
ATOM   1283 C  CD  . LYS A 1 156 ? -18.193 31.583 10.713  1.00 28.37 ? 172  LYS A CD  1 
ATOM   1284 C  CE  . LYS A 1 156 ? -18.753 31.635 12.129  1.00 29.74 ? 172  LYS A CE  1 
ATOM   1285 N  NZ  . LYS A 1 156 ? -17.787 32.242 13.080  1.00 31.26 ? 172  LYS A NZ  1 
ATOM   1286 N  N   . ALA A 1 157 ? -17.704 33.592 5.522   1.00 24.58 ? 173  ALA A N   1 
ATOM   1287 C  CA  . ALA A 1 157 ? -17.106 33.334 4.212   1.00 24.27 ? 173  ALA A CA  1 
ATOM   1288 C  C   . ALA A 1 157 ? -17.160 34.557 3.302   1.00 24.13 ? 173  ALA A C   1 
ATOM   1289 O  O   . ALA A 1 157 ? -16.329 34.710 2.402   1.00 24.03 ? 173  ALA A O   1 
ATOM   1290 C  CB  . ALA A 1 157 ? -17.786 32.153 3.546   1.00 23.93 ? 173  ALA A CB  1 
ATOM   1291 N  N   . GLY A 1 158 ? -18.139 35.423 3.537   1.00 24.11 ? 174  GLY A N   1 
ATOM   1292 C  CA  . GLY A 1 158 ? -18.309 36.619 2.723   1.00 23.90 ? 174  GLY A CA  1 
ATOM   1293 C  C   . GLY A 1 158 ? -17.731 37.870 3.355   1.00 24.26 ? 174  GLY A C   1 
ATOM   1294 O  O   . GLY A 1 158 ? -16.687 38.369 2.927   1.00 24.13 ? 174  GLY A O   1 
ATOM   1295 N  N   . THR A 1 159 ? -18.421 38.371 4.379   1.00 24.52 ? 175  THR A N   1 
ATOM   1296 C  CA  . THR A 1 159 ? -18.118 39.671 4.990   1.00 24.93 ? 175  THR A CA  1 
ATOM   1297 C  C   . THR A 1 159 ? -16.678 39.806 5.499   1.00 25.52 ? 175  THR A C   1 
ATOM   1298 O  O   . THR A 1 159 ? -16.056 40.858 5.325   1.00 25.71 ? 175  THR A O   1 
ATOM   1299 C  CB  . THR A 1 159 ? -19.123 40.002 6.121   1.00 25.19 ? 175  THR A CB  1 
ATOM   1300 O  OG1 . THR A 1 159 ? -20.458 39.872 5.618   1.00 24.22 ? 175  THR A OG1 1 
ATOM   1301 C  CG2 . THR A 1 159 ? -18.923 41.430 6.646   1.00 25.45 ? 175  THR A CG2 1 
ATOM   1302 N  N   . ALA A 1 160 ? -16.154 38.738 6.099   1.00 25.91 ? 176  ALA A N   1 
ATOM   1303 C  CA  . ALA A 1 160 ? -14.817 38.748 6.706   1.00 26.73 ? 176  ALA A CA  1 
ATOM   1304 C  C   . ALA A 1 160 ? -13.694 39.087 5.721   1.00 26.84 ? 176  ALA A C   1 
ATOM   1305 O  O   . ALA A 1 160 ? -12.586 39.444 6.129   1.00 27.17 ? 176  ALA A O   1 
ATOM   1306 C  CB  . ALA A 1 160 ? -14.539 37.406 7.385   1.00 26.86 ? 176  ALA A CB  1 
ATOM   1307 N  N   . VAL A 1 161 ? -13.997 38.996 4.430   1.00 26.48 ? 177  VAL A N   1 
ATOM   1308 C  CA  . VAL A 1 161 ? -12.996 39.115 3.373   1.00 26.75 ? 177  VAL A CA  1 
ATOM   1309 C  C   . VAL A 1 161 ? -13.159 40.364 2.469   1.00 26.65 ? 177  VAL A C   1 
ATOM   1310 O  O   . VAL A 1 161 ? -12.509 40.470 1.420   1.00 26.44 ? 177  VAL A O   1 
ATOM   1311 C  CB  . VAL A 1 161 ? -12.917 37.759 2.585   1.00 26.46 ? 177  VAL A CB  1 
ATOM   1312 C  CG1 . VAL A 1 161 ? -13.040 37.931 1.078   1.00 26.84 ? 177  VAL A CG1 1 
ATOM   1313 C  CG2 . VAL A 1 161 ? -11.669 36.978 2.984   1.00 26.84 ? 177  VAL A CG2 1 
ATOM   1314 N  N   A ARG A 1 162 ? -14.002 41.306 2.896   0.50 26.90 ? 178  ARG A N   1 
ATOM   1315 N  N   B ARG A 1 162 ? -14.004 41.300 2.905   0.50 26.83 ? 178  ARG A N   1 
ATOM   1316 C  CA  A ARG A 1 162 ? -14.309 42.502 2.099   0.50 26.91 ? 178  ARG A CA  1 
ATOM   1317 C  CA  B ARG A 1 162 ? -14.323 42.518 2.146   0.50 26.80 ? 178  ARG A CA  1 
ATOM   1318 C  C   A ARG A 1 162 ? -13.076 43.311 1.687   0.50 27.12 ? 178  ARG A C   1 
ATOM   1319 C  C   B ARG A 1 162 ? -13.095 43.319 1.703   0.50 27.05 ? 178  ARG A C   1 
ATOM   1320 O  O   A ARG A 1 162 ? -12.933 43.663 0.515   0.50 26.72 ? 178  ARG A O   1 
ATOM   1321 O  O   B ARG A 1 162 ? -12.971 43.668 0.528   0.50 26.65 ? 178  ARG A O   1 
ATOM   1322 C  CB  A ARG A 1 162 ? -15.308 43.412 2.820   0.50 27.20 ? 178  ARG A CB  1 
ATOM   1323 C  CB  B ARG A 1 162 ? -15.266 43.419 2.950   0.50 27.05 ? 178  ARG A CB  1 
ATOM   1324 C  CG  A ARG A 1 162 ? -15.497 44.757 2.127   0.50 27.47 ? 178  ARG A CG  1 
ATOM   1325 C  CG  B ARG A 1 162 ? -15.365 44.846 2.420   0.50 27.02 ? 178  ARG A CG  1 
ATOM   1326 C  CD  A ARG A 1 162 ? -16.244 45.751 3.001   0.50 28.15 ? 178  ARG A CD  1 
ATOM   1327 C  CD  B ARG A 1 162 ? -16.412 44.977 1.329   0.50 26.21 ? 178  ARG A CD  1 
ATOM   1328 N  NE  A ARG A 1 162 ? -17.678 45.489 3.035   0.50 28.57 ? 178  ARG A NE  1 
ATOM   1329 N  NE  B ARG A 1 162 ? -16.288 46.238 0.601   0.50 25.87 ? 178  ARG A NE  1 
ATOM   1330 C  CZ  A ARG A 1 162 ? -18.551 46.001 2.173   0.50 28.22 ? 178  ARG A CZ  1 
ATOM   1331 C  CZ  B ARG A 1 162 ? -17.309 46.902 0.069   0.50 24.98 ? 178  ARG A CZ  1 
ATOM   1332 N  NH1 A ARG A 1 162 ? -18.137 46.802 1.199   0.50 28.45 ? 178  ARG A NH1 1 
ATOM   1333 N  NH1 B ARG A 1 162 ? -18.542 46.436 0.192   0.50 24.54 ? 178  ARG A NH1 1 
ATOM   1334 N  NH2 A ARG A 1 162 ? -19.838 45.708 2.281   0.50 27.81 ? 178  ARG A NH2 1 
ATOM   1335 N  NH2 B ARG A 1 162 ? -17.095 48.040 -0.576  0.50 25.02 ? 178  ARG A NH2 1 
ATOM   1336 N  N   . SER A 1 163 ? -12.196 43.602 2.646   1.00 27.57 ? 179  SER A N   1 
ATOM   1337 C  CA  . SER A 1 163 ? -11.006 44.426 2.378   1.00 28.07 ? 179  SER A CA  1 
ATOM   1338 C  C   . SER A 1 163 ? -10.032 43.755 1.405   1.00 27.70 ? 179  SER A C   1 
ATOM   1339 O  O   . SER A 1 163 ? -9.481  44.414 0.520   1.00 27.63 ? 179  SER A O   1 
ATOM   1340 C  CB  . SER A 1 163 ? -10.299 44.823 3.680   1.00 28.68 ? 179  SER A CB  1 
ATOM   1341 O  OG  . SER A 1 163 ? -9.656  43.710 4.273   1.00 29.80 ? 179  SER A OG  1 
ATOM   1342 N  N   . GLN A 1 164 ? -9.842  42.446 1.565   1.00 27.51 ? 180  GLN A N   1 
ATOM   1343 C  CA  . GLN A 1 164 ? -9.022  41.661 0.643   1.00 27.31 ? 180  GLN A CA  1 
ATOM   1344 C  C   . GLN A 1 164 ? -9.635  41.664 -0.754  1.00 26.64 ? 180  GLN A C   1 
ATOM   1345 O  O   . GLN A 1 164 ? -8.925  41.821 -1.749  1.00 26.22 ? 180  GLN A O   1 
ATOM   1346 C  CB  . GLN A 1 164 ? -8.864  40.218 1.132   1.00 27.47 ? 180  GLN A CB  1 
ATOM   1347 C  CG  . GLN A 1 164 ? -8.000  40.054 2.379   1.00 28.92 ? 180  GLN A CG  1 
ATOM   1348 C  CD  . GLN A 1 164 ? -8.799  40.111 3.671   1.00 30.71 ? 180  GLN A CD  1 
ATOM   1349 O  OE1 . GLN A 1 164 ? -9.927  40.607 3.707   1.00 31.07 ? 180  GLN A OE1 1 
ATOM   1350 N  NE2 . GLN A 1 164 ? -8.210  39.599 4.746   1.00 32.20 ? 180  GLN A NE2 1 
ATOM   1351 N  N   . PHE A 1 165 ? -10.955 41.503 -0.821  1.00 26.11 ? 181  PHE A N   1 
ATOM   1352 C  CA  . PHE A 1 165 ? -11.651 41.496 -2.102  1.00 25.71 ? 181  PHE A CA  1 
ATOM   1353 C  C   . PHE A 1 165 ? -11.510 42.835 -2.828  1.00 25.80 ? 181  PHE A C   1 
ATOM   1354 O  O   . PHE A 1 165 ? -11.312 42.865 -4.043  1.00 25.61 ? 181  PHE A O   1 
ATOM   1355 C  CB  . PHE A 1 165 ? -13.126 41.118 -1.939  1.00 25.27 ? 181  PHE A CB  1 
ATOM   1356 C  CG  . PHE A 1 165 ? -13.801 40.775 -3.237  1.00 24.58 ? 181  PHE A CG  1 
ATOM   1357 C  CD1 . PHE A 1 165 ? -13.731 39.484 -3.748  1.00 24.01 ? 181  PHE A CD1 1 
ATOM   1358 C  CD2 . PHE A 1 165 ? -14.488 41.746 -3.959  1.00 24.09 ? 181  PHE A CD2 1 
ATOM   1359 C  CE1 . PHE A 1 165 ? -14.341 39.163 -4.954  1.00 23.83 ? 181  PHE A CE1 1 
ATOM   1360 C  CE2 . PHE A 1 165 ? -15.105 41.431 -5.170  1.00 23.96 ? 181  PHE A CE2 1 
ATOM   1361 C  CZ  . PHE A 1 165 ? -15.033 40.138 -5.665  1.00 23.48 ? 181  PHE A CZ  1 
ATOM   1362 N  N   . GLU A 1 166 ? -11.598 43.931 -2.075  1.00 26.20 ? 182  GLU A N   1 
ATOM   1363 C  CA  . GLU A 1 166 ? -11.414 45.278 -2.623  1.00 26.50 ? 182  GLU A CA  1 
ATOM   1364 C  C   . GLU A 1 166 ? -10.036 45.469 -3.259  1.00 26.24 ? 182  GLU A C   1 
ATOM   1365 O  O   . GLU A 1 166 ? -9.923  46.061 -4.335  1.00 25.76 ? 182  GLU A O   1 
ATOM   1366 C  CB  . GLU A 1 166 ? -11.631 46.342 -1.543  1.00 27.21 ? 182  GLU A CB  1 
ATOM   1367 C  CG  . GLU A 1 166 ? -13.089 46.587 -1.186  1.00 28.90 ? 182  GLU A CG  1 
ATOM   1368 C  CD  . GLU A 1 166 ? -13.270 47.724 -0.196  1.00 31.73 ? 182  GLU A CD  1 
ATOM   1369 O  OE1 . GLU A 1 166 ? -12.277 48.403 0.144   1.00 33.45 ? 182  GLU A OE1 1 
ATOM   1370 O  OE2 . GLU A 1 166 ? -14.414 47.944 0.244   1.00 32.99 ? 182  GLU A OE2 1 
ATOM   1371 N  N   . ARG A 1 167 ? -9.000  44.970 -2.584  1.00 26.17 ? 183  ARG A N   1 
ATOM   1372 C  CA  . ARG A 1 167 ? -7.629  45.058 -3.084  1.00 26.07 ? 183  ARG A CA  1 
ATOM   1373 C  C   . ARG A 1 167 ? -7.435  44.157 -4.304  1.00 25.40 ? 183  ARG A C   1 
ATOM   1374 O  O   . ARG A 1 167 ? -6.723  44.517 -5.244  1.00 25.45 ? 183  ARG A O   1 
ATOM   1375 C  CB  . ARG A 1 167 ? -6.618  44.717 -1.977  1.00 26.57 ? 183  ARG A CB  1 
ATOM   1376 C  CG  . ARG A 1 167 ? -5.144  44.951 -2.349  1.00 27.25 ? 183  ARG A CG  1 
ATOM   1377 C  CD  . ARG A 1 167 ? -4.891  46.367 -2.867  1.00 28.41 ? 183  ARG A CD  1 
ATOM   1378 N  NE  . ARG A 1 167 ? -3.484  46.587 -3.200  1.00 29.27 ? 183  ARG A NE  1 
ATOM   1379 C  CZ  . ARG A 1 167 ? -3.046  47.449 -4.115  1.00 29.68 ? 183  ARG A CZ  1 
ATOM   1380 N  NH1 . ARG A 1 167 ? -3.900  48.184 -4.817  1.00 29.40 ? 183  ARG A NH1 1 
ATOM   1381 N  NH2 . ARG A 1 167 ? -1.743  47.569 -4.335  1.00 30.31 ? 183  ARG A NH2 1 
ATOM   1382 N  N   . TYR A 1 168 ? -8.081  42.993 -4.278  1.00 24.69 ? 184  TYR A N   1 
ATOM   1383 C  CA  . TYR A 1 168 ? -8.093  42.071 -5.410  1.00 23.97 ? 184  TYR A CA  1 
ATOM   1384 C  C   . TYR A 1 168 ? -8.670  42.727 -6.672  1.00 23.56 ? 184  TYR A C   1 
ATOM   1385 O  O   . TYR A 1 168 ? -8.067  42.641 -7.743  1.00 23.25 ? 184  TYR A O   1 
ATOM   1386 C  CB  . TYR A 1 168 ? -8.849  40.790 -5.032  1.00 23.80 ? 184  TYR A CB  1 
ATOM   1387 C  CG  . TYR A 1 168 ? -9.544  40.067 -6.168  1.00 23.09 ? 184  TYR A CG  1 
ATOM   1388 C  CD1 . TYR A 1 168 ? -8.819  39.341 -7.117  1.00 22.80 ? 184  TYR A CD1 1 
ATOM   1389 C  CD2 . TYR A 1 168 ? -10.935 40.090 -6.278  1.00 22.93 ? 184  TYR A CD2 1 
ATOM   1390 C  CE1 . TYR A 1 168 ? -9.466  38.668 -8.156  1.00 21.98 ? 184  TYR A CE1 1 
ATOM   1391 C  CE2 . TYR A 1 168 ? -11.589 39.423 -7.308  1.00 22.60 ? 184  TYR A CE2 1 
ATOM   1392 C  CZ  . TYR A 1 168 ? -10.850 38.716 -8.243  1.00 22.03 ? 184  TYR A CZ  1 
ATOM   1393 O  OH  . TYR A 1 168 ? -11.505 38.053 -9.253  1.00 21.74 ? 184  TYR A OH  1 
ATOM   1394 N  N   . VAL A 1 169 ? -9.821  43.386 -6.533  1.00 23.25 ? 185  VAL A N   1 
ATOM   1395 C  CA  . VAL A 1 169 ? -10.442 44.137 -7.637  1.00 23.09 ? 185  VAL A CA  1 
ATOM   1396 C  C   . VAL A 1 169 ? -9.473  45.186 -8.197  1.00 23.30 ? 185  VAL A C   1 
ATOM   1397 O  O   . VAL A 1 169 ? -9.314  45.301 -9.414  1.00 22.94 ? 185  VAL A O   1 
ATOM   1398 C  CB  . VAL A 1 169 ? -11.791 44.791 -7.212  1.00 23.01 ? 185  VAL A CB  1 
ATOM   1399 C  CG1 . VAL A 1 169 ? -12.354 45.681 -8.322  1.00 22.79 ? 185  VAL A CG1 1 
ATOM   1400 C  CG2 . VAL A 1 169 ? -12.808 43.719 -6.838  1.00 22.67 ? 185  VAL A CG2 1 
ATOM   1401 N  N   . GLU A 1 170 ? -8.817  45.930 -7.305  1.00 23.77 ? 186  GLU A N   1 
ATOM   1402 C  CA  . GLU A 1 170 ? -7.830  46.939 -7.705  1.00 24.32 ? 186  GLU A CA  1 
ATOM   1403 C  C   . GLU A 1 170 ? -6.673  46.355 -8.519  1.00 23.85 ? 186  GLU A C   1 
ATOM   1404 O  O   . GLU A 1 170 ? -6.326  46.882 -9.577  1.00 23.93 ? 186  GLU A O   1 
ATOM   1405 C  CB  . GLU A 1 170 ? -7.284  47.683 -6.482  1.00 25.01 ? 186  GLU A CB  1 
ATOM   1406 C  CG  . GLU A 1 170 ? -8.257  48.690 -5.891  1.00 26.98 ? 186  GLU A CG  1 
ATOM   1407 C  CD  . GLU A 1 170 ? -7.784  49.277 -4.569  1.00 30.22 ? 186  GLU A CD  1 
ATOM   1408 O  OE1 . GLU A 1 170 ? -6.609  49.069 -4.191  1.00 30.93 ? 186  GLU A OE1 1 
ATOM   1409 O  OE2 . GLU A 1 170 ? -8.600  49.954 -3.907  1.00 32.13 ? 186  GLU A OE2 1 
ATOM   1410 N  N   . LEU A 1 171 ? -6.087  45.269 -8.024  1.00 23.43 ? 187  LEU A N   1 
ATOM   1411 C  CA  . LEU A 1 171 ? -4.933  44.656 -8.680  1.00 23.15 ? 187  LEU A CA  1 
ATOM   1412 C  C   . LEU A 1 171 ? -5.309  43.902 -9.955  1.00 22.60 ? 187  LEU A C   1 
ATOM   1413 O  O   . LEU A 1 171 ? -4.535  43.878 -10.912 1.00 22.43 ? 187  LEU A O   1 
ATOM   1414 C  CB  . LEU A 1 171 ? -4.160  43.760 -7.706  1.00 23.26 ? 187  LEU A CB  1 
ATOM   1415 C  CG  . LEU A 1 171 ? -3.412  44.521 -6.599  1.00 24.03 ? 187  LEU A CG  1 
ATOM   1416 C  CD1 . LEU A 1 171 ? -2.935  43.578 -5.504  1.00 23.42 ? 187  LEU A CD1 1 
ATOM   1417 C  CD2 . LEU A 1 171 ? -2.243  45.332 -7.160  1.00 24.43 ? 187  LEU A CD2 1 
ATOM   1418 N  N   . ASN A 1 172 ? -6.492  43.290 -9.958  1.00 22.13 ? 188  ASN A N   1 
ATOM   1419 C  CA  . ASN A 1 172 ? -7.030  42.640 -11.153 1.00 21.73 ? 188  ASN A CA  1 
ATOM   1420 C  C   . ASN A 1 172 ? -7.221  43.657 -12.280 1.00 21.70 ? 188  ASN A C   1 
ATOM   1421 O  O   . ASN A 1 172 ? -6.887  43.382 -13.433 1.00 21.61 ? 188  ASN A O   1 
ATOM   1422 C  CB  . ASN A 1 172 ? -8.349  41.920 -10.830 1.00 21.51 ? 188  ASN A CB  1 
ATOM   1423 C  CG  . ASN A 1 172 ? -9.039  41.359 -12.065 1.00 21.10 ? 188  ASN A CG  1 
ATOM   1424 O  OD1 . ASN A 1 172 ? -9.553  42.107 -12.898 1.00 21.95 ? 188  ASN A OD1 1 
ATOM   1425 N  ND2 . ASN A 1 172 ? -9.068  40.038 -12.178 1.00 20.94 ? 188  ASN A ND2 1 
ATOM   1426 N  N   . THR A 1 173 ? -7.749  44.828 -11.930 1.00 21.81 ? 189  THR A N   1 
ATOM   1427 C  CA  . THR A 1 173 ? -7.946  45.925 -12.878 1.00 21.93 ? 189  THR A CA  1 
ATOM   1428 C  C   . THR A 1 173 ? -6.611  46.450 -13.417 1.00 22.23 ? 189  THR A C   1 
ATOM   1429 O  O   . THR A 1 173 ? -6.463  46.657 -14.628 1.00 21.96 ? 189  THR A O   1 
ATOM   1430 C  CB  . THR A 1 173 ? -8.767  47.072 -12.244 1.00 22.17 ? 189  THR A CB  1 
ATOM   1431 O  OG1 . THR A 1 173 ? -9.990  46.541 -11.719 1.00 22.14 ? 189  THR A OG1 1 
ATOM   1432 C  CG2 . THR A 1 173 ? -9.092  48.154 -13.274 1.00 21.83 ? 189  THR A CG2 1 
ATOM   1433 N  N   . LYS A 1 174 ? -5.647  46.649 -12.517 1.00 22.60 ? 190  LYS A N   1 
ATOM   1434 C  CA  . LYS A 1 174 ? -4.311  47.103 -12.904 1.00 23.03 ? 190  LYS A CA  1 
ATOM   1435 C  C   . LYS A 1 174 ? -3.646  46.123 -13.878 1.00 22.78 ? 190  LYS A C   1 
ATOM   1436 O  O   . LYS A 1 174 ? -3.056  46.542 -14.877 1.00 22.88 ? 190  LYS A O   1 
ATOM   1437 C  CB  . LYS A 1 174 ? -3.429  47.334 -11.670 1.00 23.48 ? 190  LYS A CB  1 
ATOM   1438 C  CG  . LYS A 1 174 ? -2.084  47.973 -12.001 1.00 24.42 ? 190  LYS A CG  1 
ATOM   1439 C  CD  . LYS A 1 174 ? -1.266  48.289 -10.766 1.00 26.00 ? 190  LYS A CD  1 
ATOM   1440 C  CE  . LYS A 1 174 ? 0.005   49.026 -11.164 1.00 27.03 ? 190  LYS A CE  1 
ATOM   1441 N  NZ  . LYS A 1 174 ? 0.781   49.497 -9.989  1.00 28.39 ? 190  LYS A NZ  1 
ATOM   1442 N  N   . ALA A 1 175 ? -3.759  44.826 -13.581 1.00 22.54 ? 191  ALA A N   1 
ATOM   1443 C  CA  . ALA A 1 175 ? -3.235  43.761 -14.441 1.00 22.36 ? 191  ALA A CA  1 
ATOM   1444 C  C   . ALA A 1 175 ? -3.864  43.782 -15.833 1.00 22.22 ? 191  ALA A C   1 
ATOM   1445 O  O   . ALA A 1 175 ? -3.151  43.721 -16.840 1.00 22.24 ? 191  ALA A O   1 
ATOM   1446 C  CB  . ALA A 1 175 ? -3.436  42.398 -13.788 1.00 22.19 ? 191  ALA A CB  1 
ATOM   1447 N  N   . ALA A 1 176 ? -5.193  43.872 -15.881 1.00 21.96 ? 192  ALA A N   1 
ATOM   1448 C  CA  . ALA A 1 176 ? -5.930  43.930 -17.145 1.00 22.04 ? 192  ALA A CA  1 
ATOM   1449 C  C   . ALA A 1 176 ? -5.482  45.100 -18.018 1.00 22.32 ? 192  ALA A C   1 
ATOM   1450 O  O   . ALA A 1 176 ? -5.286  44.941 -19.224 1.00 22.41 ? 192  ALA A O   1 
ATOM   1451 C  CB  . ALA A 1 176 ? -7.421  44.012 -16.884 1.00 21.77 ? 192  ALA A CB  1 
ATOM   1452 N  N   . LYS A 1 177 ? -5.312  46.266 -17.400 1.00 22.63 ? 193  LYS A N   1 
ATOM   1453 C  CA  . LYS A 1 177 ? -4.901  47.465 -18.126 1.00 23.17 ? 193  LYS A CA  1 
ATOM   1454 C  C   . LYS A 1 177 ? -3.461  47.373 -18.639 1.00 23.36 ? 193  LYS A C   1 
ATOM   1455 O  O   . LYS A 1 177 ? -3.156  47.896 -19.710 1.00 23.29 ? 193  LYS A O   1 
ATOM   1456 C  CB  . LYS A 1 177 ? -5.128  48.726 -17.286 1.00 23.60 ? 193  LYS A CB  1 
ATOM   1457 C  CG  . LYS A 1 177 ? -6.606  49.052 -17.074 1.00 23.94 ? 193  LYS A CG  1 
ATOM   1458 C  CD  . LYS A 1 177 ? -6.798  50.419 -16.433 1.00 25.47 ? 193  LYS A CD  1 
ATOM   1459 C  CE  . LYS A 1 177 ? -8.266  50.697 -16.128 1.00 25.91 ? 193  LYS A CE  1 
ATOM   1460 N  NZ  . LYS A 1 177 ? -9.100  50.832 -17.361 1.00 26.22 ? 193  LYS A NZ  1 
ATOM   1461 N  N   . LEU A 1 178 ? -2.592  46.696 -17.888 1.00 23.42 ? 194  LEU A N   1 
ATOM   1462 C  CA  . LEU A 1 178 ? -1.219  46.428 -18.335 1.00 23.80 ? 194  LEU A CA  1 
ATOM   1463 C  C   . LEU A 1 178 ? -1.171  45.477 -19.534 1.00 23.80 ? 194  LEU A C   1 
ATOM   1464 O  O   . LEU A 1 178 ? -0.197  45.468 -20.290 1.00 23.92 ? 194  LEU A O   1 
ATOM   1465 C  CB  . LEU A 1 178 ? -0.358  45.888 -17.185 1.00 23.80 ? 194  LEU A CB  1 
ATOM   1466 C  CG  . LEU A 1 178 ? 0.167   46.925 -16.187 1.00 24.31 ? 194  LEU A CG  1 
ATOM   1467 C  CD1 . LEU A 1 178 ? 0.627   46.251 -14.903 1.00 24.10 ? 194  LEU A CD1 1 
ATOM   1468 C  CD2 . LEU A 1 178 ? 1.294   47.763 -16.793 1.00 25.06 ? 194  LEU A CD2 1 
ATOM   1469 N  N   . ASN A 1 179 ? -2.225  44.678 -19.694 1.00 23.60 ? 195  ASN A N   1 
ATOM   1470 C  CA  . ASN A 1 179 ? -2.408  43.851 -20.884 1.00 23.77 ? 195  ASN A CA  1 
ATOM   1471 C  C   . ASN A 1 179 ? -3.248  44.569 -21.944 1.00 23.63 ? 195  ASN A C   1 
ATOM   1472 O  O   . ASN A 1 179 ? -3.608  43.985 -22.972 1.00 23.47 ? 195  ASN A O   1 
ATOM   1473 C  CB  . ASN A 1 179 ? -3.042  42.510 -20.512 1.00 23.68 ? 195  ASN A CB  1 
ATOM   1474 C  CG  . ASN A 1 179 ? -2.105  41.625 -19.712 1.00 24.60 ? 195  ASN A CG  1 
ATOM   1475 O  OD1 . ASN A 1 179 ? -1.129  41.095 -20.243 1.00 26.49 ? 195  ASN A OD1 1 
ATOM   1476 N  ND2 . ASN A 1 179 ? -2.400  41.457 -18.429 1.00 25.16 ? 195  ASN A ND2 1 
ATOM   1477 N  N   . ASN A 1 180 ? -3.548  45.840 -21.675 1.00 23.79 ? 196  ASN A N   1 
ATOM   1478 C  CA  . ASN A 1 180 ? -4.345  46.704 -22.560 1.00 23.92 ? 196  ASN A CA  1 
ATOM   1479 C  C   . ASN A 1 180 ? -5.799  46.275 -22.785 1.00 23.44 ? 196  ASN A C   1 
ATOM   1480 O  O   . ASN A 1 180 ? -6.404  46.617 -23.802 1.00 23.35 ? 196  ASN A O   1 
ATOM   1481 C  CB  . ASN A 1 180 ? -3.618  46.969 -23.887 1.00 24.16 ? 196  ASN A CB  1 
ATOM   1482 C  CG  . ASN A 1 180 ? -2.411  47.869 -23.716 1.00 25.53 ? 196  ASN A CG  1 
ATOM   1483 O  OD1 . ASN A 1 180 ? -2.295  48.593 -22.722 1.00 25.09 ? 196  ASN A OD1 1 
ATOM   1484 N  ND2 . ASN A 1 180 ? -1.505  47.831 -24.686 1.00 27.53 ? 196  ASN A ND2 1 
ATOM   1485 N  N   . PHE A 1 181 ? -6.348  45.526 -21.831 1.00 23.06 ? 197  PHE A N   1 
ATOM   1486 C  CA  . PHE A 1 181 ? -7.794  45.339 -21.739 1.00 22.80 ? 197  PHE A CA  1 
ATOM   1487 C  C   . PHE A 1 181 ? -8.358  46.468 -20.881 1.00 22.85 ? 197  PHE A C   1 
ATOM   1488 O  O   . PHE A 1 181 ? -7.658  47.004 -20.013 1.00 22.95 ? 197  PHE A O   1 
ATOM   1489 C  CB  . PHE A 1 181 ? -8.151  43.984 -21.112 1.00 22.62 ? 197  PHE A CB  1 
ATOM   1490 C  CG  . PHE A 1 181 ? -7.755  42.794 -21.946 1.00 22.82 ? 197  PHE A CG  1 
ATOM   1491 C  CD1 . PHE A 1 181 ? -8.432  42.492 -23.128 1.00 22.95 ? 197  PHE A CD1 1 
ATOM   1492 C  CD2 . PHE A 1 181 ? -6.719  41.959 -21.534 1.00 23.23 ? 197  PHE A CD2 1 
ATOM   1493 C  CE1 . PHE A 1 181 ? -8.072  41.387 -23.898 1.00 22.98 ? 197  PHE A CE1 1 
ATOM   1494 C  CE2 . PHE A 1 181 ? -6.351  40.846 -22.295 1.00 23.71 ? 197  PHE A CE2 1 
ATOM   1495 C  CZ  . PHE A 1 181 ? -7.029  40.562 -23.480 1.00 23.45 ? 197  PHE A CZ  1 
ATOM   1496 N  N   . THR A 1 182 ? -9.618  46.827 -21.118 1.00 22.67 ? 198  THR A N   1 
ATOM   1497 C  CA  . THR A 1 182 ? -10.277 47.872 -20.334 1.00 22.70 ? 198  THR A CA  1 
ATOM   1498 C  C   . THR A 1 182 ? -10.357 47.475 -18.856 1.00 22.46 ? 198  THR A C   1 
ATOM   1499 O  O   . THR A 1 182 ? -10.111 48.296 -17.968 1.00 22.55 ? 198  THR A O   1 
ATOM   1500 C  CB  . THR A 1 182 ? -11.685 48.184 -20.883 1.00 22.82 ? 198  THR A CB  1 
ATOM   1501 O  OG1 . THR A 1 182 ? -11.597 48.438 -22.289 1.00 23.23 ? 198  THR A OG1 1 
ATOM   1502 C  CG2 . THR A 1 182 ? -12.278 49.412 -20.196 1.00 23.68 ? 198  THR A CG2 1 
ATOM   1503 N  N   . SER A 1 183 ? -10.683 46.209 -18.608 1.00 21.79 ? 199  SER A N   1 
ATOM   1504 C  CA  . SER A 1 183 ? -10.827 45.688 -17.253 1.00 21.41 ? 199  SER A CA  1 
ATOM   1505 C  C   . SER A 1 183 ? -10.700 44.168 -17.243 1.00 20.94 ? 199  SER A C   1 
ATOM   1506 O  O   . SER A 1 183 ? -10.501 43.543 -18.289 1.00 20.50 ? 199  SER A O   1 
ATOM   1507 C  CB  . SER A 1 183 ? -12.179 46.106 -16.660 1.00 21.51 ? 199  SER A CB  1 
ATOM   1508 O  OG  . SER A 1 183 ? -13.232 45.295 -17.150 1.00 21.15 ? 199  SER A OG  1 
ATOM   1509 N  N   . GLY A 1 184 ? -10.810 43.581 -16.054 1.00 20.71 ? 200  GLY A N   1 
ATOM   1510 C  CA  . GLY A 1 184 ? -10.782 42.132 -15.896 1.00 20.45 ? 200  GLY A CA  1 
ATOM   1511 C  C   . GLY A 1 184 ? -11.915 41.414 -16.607 1.00 20.26 ? 200  GLY A C   1 
ATOM   1512 O  O   . GLY A 1 184 ? -11.808 40.224 -16.904 1.00 20.07 ? 200  GLY A O   1 
ATOM   1513 N  N   . ALA A 1 185 ? -13.003 42.135 -16.870 1.00 20.31 ? 201  ALA A N   1 
ATOM   1514 C  CA  . ALA A 1 185 ? -14.127 41.598 -17.639 1.00 20.31 ? 201  ALA A CA  1 
ATOM   1515 C  C   . ALA A 1 185 ? -13.677 41.244 -19.052 1.00 20.42 ? 201  ALA A C   1 
ATOM   1516 O  O   . ALA A 1 185 ? -13.897 40.128 -19.519 1.00 20.30 ? 201  ALA A O   1 
ATOM   1517 C  CB  . ALA A 1 185 ? -15.270 42.597 -17.685 1.00 20.17 ? 201  ALA A CB  1 
ATOM   1518 N  N   . GLU A 1 186 ? -13.035 42.201 -19.718 1.00 20.79 ? 202  GLU A N   1 
ATOM   1519 C  CA  . GLU A 1 186 ? -12.541 42.006 -21.082 1.00 21.21 ? 202  GLU A CA  1 
ATOM   1520 C  C   . GLU A 1 186 ? -11.427 40.964 -21.124 1.00 21.04 ? 202  GLU A C   1 
ATOM   1521 O  O   . GLU A 1 186 ? -11.343 40.182 -22.073 1.00 20.92 ? 202  GLU A O   1 
ATOM   1522 C  CB  . GLU A 1 186 ? -12.073 43.332 -21.687 1.00 21.47 ? 202  GLU A CB  1 
ATOM   1523 C  CG  . GLU A 1 186 ? -13.206 44.310 -22.028 1.00 22.60 ? 202  GLU A CG  1 
ATOM   1524 C  CD  . GLU A 1 186 ? -13.853 44.951 -20.802 1.00 24.06 ? 202  GLU A CD  1 
ATOM   1525 O  OE1 . GLU A 1 186 ? -13.201 45.035 -19.738 1.00 24.23 ? 202  GLU A OE1 1 
ATOM   1526 O  OE2 . GLU A 1 186 ? -15.022 45.378 -20.905 1.00 25.35 ? 202  GLU A OE2 1 
ATOM   1527 N  N   . ALA A 1 187 ? -10.587 40.950 -20.087 1.00 21.02 ? 203  ALA A N   1 
ATOM   1528 C  CA  . ALA A 1 187 ? -9.537  39.943 -19.947 1.00 21.05 ? 203  ALA A CA  1 
ATOM   1529 C  C   . ALA A 1 187 ? -10.126 38.532 -19.915 1.00 20.93 ? 203  ALA A C   1 
ATOM   1530 O  O   . ALA A 1 187 ? -9.648  37.645 -20.621 1.00 21.07 ? 203  ALA A O   1 
ATOM   1531 C  CB  . ALA A 1 187 ? -8.697  40.205 -18.699 1.00 21.15 ? 203  ALA A CB  1 
ATOM   1532 N  N   . TRP A 1 188 ? -11.165 38.335 -19.103 1.00 20.63 ? 204  TRP A N   1 
ATOM   1533 C  CA  . TRP A 1 188 ? -11.861 37.050 -19.044 1.00 20.38 ? 204  TRP A CA  1 
ATOM   1534 C  C   . TRP A 1 188 ? -12.552 36.715 -20.365 1.00 20.24 ? 204  TRP A C   1 
ATOM   1535 O  O   . TRP A 1 188 ? -12.459 35.588 -20.850 1.00 20.01 ? 204  TRP A O   1 
ATOM   1536 C  CB  . TRP A 1 188 ? -12.895 37.030 -17.911 1.00 20.35 ? 204  TRP A CB  1 
ATOM   1537 C  CG  . TRP A 1 188 ? -12.333 36.765 -16.540 1.00 20.45 ? 204  TRP A CG  1 
ATOM   1538 C  CD1 . TRP A 1 188 ? -11.063 36.356 -16.226 1.00 20.72 ? 204  TRP A CD1 1 
ATOM   1539 C  CD2 . TRP A 1 188 ? -13.044 36.849 -15.300 1.00 20.40 ? 204  TRP A CD2 1 
ATOM   1540 N  NE1 . TRP A 1 188 ? -10.939 36.204 -14.862 1.00 20.42 ? 204  TRP A NE1 1 
ATOM   1541 C  CE2 . TRP A 1 188 ? -12.141 36.493 -14.273 1.00 20.33 ? 204  TRP A CE2 1 
ATOM   1542 C  CE3 . TRP A 1 188 ? -14.358 37.193 -14.957 1.00 20.34 ? 204  TRP A CE3 1 
ATOM   1543 C  CZ2 . TRP A 1 188 ? -12.509 36.479 -12.923 1.00 20.66 ? 204  TRP A CZ2 1 
ATOM   1544 C  CZ3 . TRP A 1 188 ? -14.725 37.173 -13.613 1.00 20.54 ? 204  TRP A CZ3 1 
ATOM   1545 C  CH2 . TRP A 1 188 ? -13.801 36.822 -12.616 1.00 20.60 ? 204  TRP A CH2 1 
ATOM   1546 N  N   . LEU A 1 189 ? -13.239 37.701 -20.938 1.00 20.17 ? 205  LEU A N   1 
ATOM   1547 C  CA  . LEU A 1 189 ? -14.002 37.500 -22.173 1.00 20.33 ? 205  LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 189 ? -13.133 37.175 -23.390 1.00 20.70 ? 205  LEU A C   1 
ATOM   1549 O  O   . LEU A 1 189 ? -13.602 36.554 -24.349 1.00 20.71 ? 205  LEU A O   1 
ATOM   1550 C  CB  . LEU A 1 189 ? -14.900 38.709 -22.451 1.00 20.16 ? 205  LEU A CB  1 
ATOM   1551 C  CG  . LEU A 1 189 ? -16.151 38.769 -21.571 1.00 19.64 ? 205  LEU A CG  1 
ATOM   1552 C  CD1 . LEU A 1 189 ? -16.730 40.172 -21.562 1.00 19.39 ? 205  LEU A CD1 1 
ATOM   1553 C  CD2 . LEU A 1 189 ? -17.186 37.750 -22.035 1.00 19.67 ? 205  LEU A CD2 1 
ATOM   1554 N  N   . ASP A 1 190 ? -11.870 37.592 -23.335 1.00 21.14 ? 206  ASP A N   1 
ATOM   1555 C  CA  . ASP A 1 190 ? -10.891 37.303 -24.388 1.00 21.72 ? 206  ASP A CA  1 
ATOM   1556 C  C   . ASP A 1 190 ? -10.713 35.799 -24.636 1.00 21.88 ? 206  ASP A C   1 
ATOM   1557 O  O   . ASP A 1 190 ? -10.406 35.384 -25.754 1.00 21.89 ? 206  ASP A O   1 
ATOM   1558 C  CB  . ASP A 1 190 ? -9.545  37.945 -24.043 1.00 22.01 ? 206  ASP A CB  1 
ATOM   1559 C  CG  . ASP A 1 190 ? -8.532  37.831 -25.173 1.00 22.66 ? 206  ASP A CG  1 
ATOM   1560 O  OD1 . ASP A 1 190 ? -8.759  38.420 -26.248 1.00 23.33 ? 206  ASP A OD1 1 
ATOM   1561 O  OD2 . ASP A 1 190 ? -7.506  37.153 -24.976 1.00 24.08 ? 206  ASP A OD2 1 
ATOM   1562 N  N   . GLU A 1 191 ? -10.920 34.993 -23.594 1.00 22.04 ? 207  GLU A N   1 
ATOM   1563 C  CA  . GLU A 1 191 ? -10.804 33.532 -23.688 1.00 22.45 ? 207  GLU A CA  1 
ATOM   1564 C  C   . GLU A 1 191 ? -11.820 32.898 -24.644 1.00 22.21 ? 207  GLU A C   1 
ATOM   1565 O  O   . GLU A 1 191 ? -11.658 31.742 -25.048 1.00 22.16 ? 207  GLU A O   1 
ATOM   1566 C  CB  . GLU A 1 191 ? -10.932 32.883 -22.300 1.00 22.65 ? 207  GLU A CB  1 
ATOM   1567 C  CG  . GLU A 1 191 ? -9.908  33.346 -21.259 1.00 24.51 ? 207  GLU A CG  1 
ATOM   1568 C  CD  . GLU A 1 191 ? -8.466  33.018 -21.627 1.00 27.56 ? 207  GLU A CD  1 
ATOM   1569 O  OE1 . GLU A 1 191 ? -8.219  31.998 -22.310 1.00 28.81 ? 207  GLU A OE1 1 
ATOM   1570 O  OE2 . GLU A 1 191 ? -7.570  33.788 -21.220 1.00 29.86 ? 207  GLU A OE2 1 
ATOM   1571 N  N   . TYR A 1 192 ? -12.862 33.650 -24.999 1.00 21.92 ? 208  TYR A N   1 
ATOM   1572 C  CA  . TYR A 1 192 ? -13.912 33.144 -25.887 1.00 22.08 ? 208  TYR A CA  1 
ATOM   1573 C  C   . TYR A 1 192 ? -13.735 33.564 -27.350 1.00 22.44 ? 208  TYR A C   1 
ATOM   1574 O  O   . TYR A 1 192 ? -14.499 33.136 -28.219 1.00 22.42 ? 208  TYR A O   1 
ATOM   1575 C  CB  . TYR A 1 192 ? -15.302 33.508 -25.348 1.00 21.71 ? 208  TYR A CB  1 
ATOM   1576 C  CG  . TYR A 1 192 ? -15.544 32.954 -23.960 1.00 21.19 ? 208  TYR A CG  1 
ATOM   1577 C  CD1 . TYR A 1 192 ? -15.880 31.612 -23.772 1.00 21.03 ? 208  TYR A CD1 1 
ATOM   1578 C  CD2 . TYR A 1 192 ? -15.411 33.765 -22.830 1.00 21.22 ? 208  TYR A CD2 1 
ATOM   1579 C  CE1 . TYR A 1 192 ? -16.092 31.096 -22.501 1.00 20.47 ? 208  TYR A CE1 1 
ATOM   1580 C  CE2 . TYR A 1 192 ? -15.619 33.257 -21.551 1.00 20.68 ? 208  TYR A CE2 1 
ATOM   1581 C  CZ  . TYR A 1 192 ? -15.955 31.922 -21.395 1.00 21.01 ? 208  TYR A CZ  1 
ATOM   1582 O  OH  . TYR A 1 192 ? -16.165 31.407 -20.136 1.00 20.52 ? 208  TYR A OH  1 
ATOM   1583 N  N   . GLU A 1 193 ? -12.721 34.392 -27.607 1.00 22.81 ? 209  GLU A N   1 
ATOM   1584 C  CA  . GLU A 1 193 ? -12.314 34.781 -28.965 1.00 23.54 ? 209  GLU A CA  1 
ATOM   1585 C  C   . GLU A 1 193 ? -13.497 35.170 -29.858 1.00 23.62 ? 209  GLU A C   1 
ATOM   1586 O  O   . GLU A 1 193 ? -13.618 34.689 -30.990 1.00 23.58 ? 209  GLU A O   1 
ATOM   1587 C  CB  . GLU A 1 193 ? -11.508 33.657 -29.634 1.00 23.96 ? 209  GLU A CB  1 
ATOM   1588 C  CG  . GLU A 1 193 ? -10.230 33.254 -28.918 1.00 25.62 ? 209  GLU A CG  1 
ATOM   1589 C  CD  . GLU A 1 193 ? -9.461  32.173 -29.667 1.00 27.77 ? 209  GLU A CD  1 
ATOM   1590 O  OE1 . GLU A 1 193 ? -9.093  32.391 -30.843 1.00 28.35 ? 209  GLU A OE1 1 
ATOM   1591 O  OE2 . GLU A 1 193 ? -9.221  31.103 -29.073 1.00 29.17 ? 209  GLU A OE2 1 
ATOM   1592 N  N   . ASP A 1 194 ? -14.370 36.029 -29.337 1.00 23.54 ? 210  ASP A N   1 
ATOM   1593 C  CA  . ASP A 1 194 ? -15.577 36.433 -30.047 1.00 23.87 ? 210  ASP A CA  1 
ATOM   1594 C  C   . ASP A 1 194 ? -16.073 37.754 -29.470 1.00 23.73 ? 210  ASP A C   1 
ATOM   1595 O  O   . ASP A 1 194 ? -16.506 37.814 -28.314 1.00 23.30 ? 210  ASP A O   1 
ATOM   1596 C  CB  . ASP A 1 194 ? -16.653 35.340 -29.934 1.00 24.02 ? 210  ASP A CB  1 
ATOM   1597 C  CG  . ASP A 1 194 ? -17.838 35.569 -30.859 1.00 24.86 ? 210  ASP A CG  1 
ATOM   1598 O  OD1 . ASP A 1 194 ? -18.140 36.733 -31.198 1.00 25.78 ? 210  ASP A OD1 1 
ATOM   1599 O  OD2 . ASP A 1 194 ? -18.485 34.573 -31.244 1.00 26.22 ? 210  ASP A OD2 1 
ATOM   1600 N  N   . ASP A 1 195 ? -16.009 38.810 -30.278 1.00 23.88 ? 211  ASP A N   1 
ATOM   1601 C  CA  . ASP A 1 195 ? -16.340 40.157 -29.805 1.00 23.97 ? 211  ASP A CA  1 
ATOM   1602 C  C   . ASP A 1 195 ? -17.846 40.428 -29.641 1.00 23.76 ? 211  ASP A C   1 
ATOM   1603 O  O   . ASP A 1 195 ? -18.235 41.505 -29.194 1.00 24.21 ? 211  ASP A O   1 
ATOM   1604 C  CB  . ASP A 1 195 ? -15.662 41.235 -30.672 1.00 24.32 ? 211  ASP A CB  1 
ATOM   1605 C  CG  . ASP A 1 195 ? -16.121 41.213 -32.125 0.50 24.73 ? 211  ASP A CG  1 
ATOM   1606 O  OD1 . ASP A 1 195 ? -16.900 40.320 -32.518 0.50 25.09 ? 211  ASP A OD1 1 
ATOM   1607 O  OD2 . ASP A 1 195 ? -15.685 42.103 -32.885 0.50 25.92 ? 211  ASP A OD2 1 
ATOM   1608 N  N   . THR A 1 196 ? -18.684 39.455 -29.995 1.00 23.39 ? 212  THR A N   1 
ATOM   1609 C  CA  . THR A 1 196 ? -20.130 39.560 -29.761 1.00 22.93 ? 212  THR A CA  1 
ATOM   1610 C  C   . THR A 1 196 ? -20.614 38.535 -28.727 1.00 22.39 ? 212  THR A C   1 
ATOM   1611 O  O   . THR A 1 196 ? -21.814 38.267 -28.627 1.00 22.25 ? 212  THR A O   1 
ATOM   1612 C  CB  . THR A 1 196 ? -20.951 39.379 -31.061 1.00 23.31 ? 212  THR A CB  1 
ATOM   1613 O  OG1 . THR A 1 196 ? -20.804 38.037 -31.540 1.00 23.43 ? 212  THR A OG1 1 
ATOM   1614 C  CG2 . THR A 1 196 ? -20.506 40.363 -32.144 1.00 23.60 ? 212  THR A CG2 1 
ATOM   1615 N  N   . PHE A 1 197 ? -19.681 37.983 -27.952 1.00 21.82 ? 213  PHE A N   1 
ATOM   1616 C  CA  . PHE A 1 197 ? -19.983 36.854 -27.064 1.00 21.43 ? 213  PHE A CA  1 
ATOM   1617 C  C   . PHE A 1 197 ? -21.019 37.181 -25.983 1.00 21.31 ? 213  PHE A C   1 
ATOM   1618 O  O   . PHE A 1 197 ? -21.914 36.376 -25.726 1.00 21.13 ? 213  PHE A O   1 
ATOM   1619 C  CB  . PHE A 1 197 ? -18.702 36.276 -26.448 1.00 21.10 ? 213  PHE A CB  1 
ATOM   1620 C  CG  . PHE A 1 197 ? -18.838 34.847 -25.983 1.00 20.74 ? 213  PHE A CG  1 
ATOM   1621 C  CD1 . PHE A 1 197 ? -18.936 33.807 -26.905 1.00 21.08 ? 213  PHE A CD1 1 
ATOM   1622 C  CD2 . PHE A 1 197 ? -18.852 34.541 -24.626 1.00 20.16 ? 213  PHE A CD2 1 
ATOM   1623 C  CE1 . PHE A 1 197 ? -19.060 32.483 -26.484 1.00 21.07 ? 213  PHE A CE1 1 
ATOM   1624 C  CE2 . PHE A 1 197 ? -18.974 33.218 -24.191 1.00 20.10 ? 213  PHE A CE2 1 
ATOM   1625 C  CZ  . PHE A 1 197 ? -19.077 32.188 -25.123 1.00 20.57 ? 213  PHE A CZ  1 
ATOM   1626 N  N   . GLU A 1 198 ? -20.902 38.361 -25.371 1.00 21.38 ? 214  GLU A N   1 
ATOM   1627 C  CA  . GLU A 1 198 ? -21.854 38.806 -24.345 1.00 21.50 ? 214  GLU A CA  1 
ATOM   1628 C  C   . GLU A 1 198 ? -23.269 38.922 -24.899 1.00 21.54 ? 214  GLU A C   1 
ATOM   1629 O  O   . GLU A 1 198 ? -24.223 38.475 -24.269 1.00 21.33 ? 214  GLU A O   1 
ATOM   1630 C  CB  . GLU A 1 198 ? -21.444 40.157 -23.762 1.00 21.54 ? 214  GLU A CB  1 
ATOM   1631 C  CG  . GLU A 1 198 ? -20.247 40.122 -22.847 1.00 21.78 ? 214  GLU A CG  1 
ATOM   1632 C  CD  . GLU A 1 198 ? -19.697 41.511 -22.600 1.00 22.66 ? 214  GLU A CD  1 
ATOM   1633 O  OE1 . GLU A 1 198 ? -19.004 42.043 -23.494 1.00 22.90 ? 214  GLU A OE1 1 
ATOM   1634 O  OE2 . GLU A 1 198 ? -19.956 42.067 -21.514 1.00 22.67 ? 214  GLU A OE2 1 
ATOM   1635 N  N   . GLN A 1 199 ? -23.397 39.531 -26.077 1.00 21.90 ? 215  GLN A N   1 
ATOM   1636 C  CA  . GLN A 1 199 ? -24.698 39.692 -26.717 1.00 22.40 ? 215  GLN A CA  1 
ATOM   1637 C  C   . GLN A 1 199 ? -25.316 38.343 -27.088 1.00 22.33 ? 215  GLN A C   1 
ATOM   1638 O  O   . GLN A 1 199 ? -26.525 38.153 -26.941 1.00 22.11 ? 215  GLN A O   1 
ATOM   1639 C  CB  . GLN A 1 199 ? -24.603 40.607 -27.944 1.00 22.73 ? 215  GLN A CB  1 
ATOM   1640 C  CG  . GLN A 1 199 ? -25.959 41.100 -28.463 1.00 24.39 ? 215  GLN A CG  1 
ATOM   1641 C  CD  . GLN A 1 199 ? -26.819 41.748 -27.382 1.00 25.86 ? 215  GLN A CD  1 
ATOM   1642 O  OE1 . GLN A 1 199 ? -26.367 42.637 -26.659 1.00 26.52 ? 215  GLN A OE1 1 
ATOM   1643 N  NE2 . GLN A 1 199 ? -28.066 41.301 -27.273 1.00 26.32 ? 215  GLN A NE2 1 
ATOM   1644 N  N   . GLN A 1 200 ? -24.479 37.416 -27.552 1.00 22.29 ? 216  GLN A N   1 
ATOM   1645 C  CA  . GLN A 1 200 ? -24.918 36.057 -27.876 1.00 22.67 ? 216  GLN A CA  1 
ATOM   1646 C  C   . GLN A 1 200 ? -25.547 35.369 -26.667 1.00 22.47 ? 216  GLN A C   1 
ATOM   1647 O  O   . GLN A 1 200 ? -26.583 34.707 -26.785 1.00 22.42 ? 216  GLN A O   1 
ATOM   1648 C  CB  . GLN A 1 200 ? -23.747 35.216 -28.381 1.00 22.59 ? 216  GLN A CB  1 
ATOM   1649 C  CG  . GLN A 1 200 ? -23.330 35.500 -29.813 1.00 23.43 ? 216  GLN A CG  1 
ATOM   1650 C  CD  . GLN A 1 200 ? -22.157 34.642 -30.240 1.00 24.10 ? 216  GLN A CD  1 
ATOM   1651 O  OE1 . GLN A 1 200 ? -22.220 33.413 -30.187 1.00 24.88 ? 216  GLN A OE1 1 
ATOM   1652 N  NE2 . GLN A 1 200 ? -21.075 35.285 -30.660 1.00 24.22 ? 216  GLN A NE2 1 
ATOM   1653 N  N   . LEU A 1 201 ? -24.909 35.533 -25.511 1.00 22.38 ? 217  LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 201 ? -25.407 34.966 -24.262 1.00 22.31 ? 217  LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 201 ? -26.682 35.651 -23.776 1.00 22.46 ? 217  LEU A C   1 
ATOM   1656 O  O   . LEU A 1 201 ? -27.585 34.983 -23.272 1.00 22.36 ? 217  LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 201 ? -24.324 34.986 -23.181 1.00 22.07 ? 217  LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 201 ? -23.186 33.979 -23.380 1.00 21.92 ? 217  LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 201 ? -22.022 34.315 -22.474 1.00 22.06 ? 217  LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 201 ? -23.654 32.544 -23.146 1.00 21.97 ? 217  LEU A CD2 1 
ATOM   1661 N  N   . GLU A 1 202 ? -26.760 36.973 -23.940 1.00 22.82 ? 218  GLU A N   1 
ATOM   1662 C  CA  . GLU A 1 202 ? -27.989 37.712 -23.635 1.00 23.32 ? 218  GLU A CA  1 
ATOM   1663 C  C   . GLU A 1 202 ? -29.158 37.179 -24.464 1.00 23.57 ? 218  GLU A C   1 
ATOM   1664 O  O   . GLU A 1 202 ? -30.253 36.977 -23.937 1.00 23.48 ? 218  GLU A O   1 
ATOM   1665 C  CB  . GLU A 1 202 ? -27.822 39.223 -23.867 1.00 23.61 ? 218  GLU A CB  1 
ATOM   1666 C  CG  . GLU A 1 202 ? -26.822 39.928 -22.936 1.00 24.16 ? 218  GLU A CG  1 
ATOM   1667 C  CD  . GLU A 1 202 ? -27.335 40.168 -21.513 1.00 25.64 ? 218  GLU A CD  1 
ATOM   1668 O  OE1 . GLU A 1 202 ? -28.498 39.828 -21.201 1.00 26.47 ? 218  GLU A OE1 1 
ATOM   1669 O  OE2 . GLU A 1 202 ? -26.556 40.712 -20.700 1.00 25.26 ? 218  GLU A OE2 1 
ATOM   1670 N  N   . ASP A 1 203 ? -28.910 36.944 -25.755 1.00 23.82 ? 219  ASP A N   1 
ATOM   1671 C  CA  . ASP A 1 203 ? -29.934 36.432 -26.669 1.00 24.21 ? 219  ASP A CA  1 
ATOM   1672 C  C   . ASP A 1 203 ? -30.406 35.029 -26.286 1.00 24.02 ? 219  ASP A C   1 
ATOM   1673 O  O   . ASP A 1 203 ? -31.609 34.772 -26.238 1.00 24.12 ? 219  ASP A O   1 
ATOM   1674 C  CB  . ASP A 1 203 ? -29.440 36.458 -28.122 1.00 24.60 ? 219  ASP A CB  1 
ATOM   1675 C  CG  . ASP A 1 203 ? -29.257 37.873 -28.661 1.00 25.50 ? 219  ASP A CG  1 
ATOM   1676 O  OD1 . ASP A 1 203 ? -29.685 38.842 -27.999 1.00 26.16 ? 219  ASP A OD1 1 
ATOM   1677 O  OD2 . ASP A 1 203 ? -28.678 38.018 -29.757 1.00 26.77 ? 219  ASP A OD2 1 
ATOM   1678 N  N   . ILE A 1 204 ? -29.460 34.133 -26.006 1.00 23.79 ? 220  ILE A N   1 
ATOM   1679 C  CA  . ILE A 1 204 ? -29.789 32.767 -25.589 1.00 23.77 ? 220  ILE A CA  1 
ATOM   1680 C  C   . ILE A 1 204 ? -30.527 32.769 -24.245 1.00 23.57 ? 220  ILE A C   1 
ATOM   1681 O  O   . ILE A 1 204 ? -31.531 32.073 -24.085 1.00 23.57 ? 220  ILE A O   1 
ATOM   1682 C  CB  . ILE A 1 204 ? -28.535 31.849 -25.535 1.00 23.65 ? 220  ILE A CB  1 
ATOM   1683 C  CG1 . ILE A 1 204 ? -27.992 31.605 -26.952 1.00 23.86 ? 220  ILE A CG1 1 
ATOM   1684 C  CG2 . ILE A 1 204 ? -28.864 30.515 -24.854 1.00 23.84 ? 220  ILE A CG2 1 
ATOM   1685 C  CD1 . ILE A 1 204 ? -26.575 31.042 -26.994 1.00 23.27 ? 220  ILE A CD1 1 
ATOM   1686 N  N   . PHE A 1 205 ? -30.038 33.567 -23.297 1.00 23.29 ? 221  PHE A N   1 
ATOM   1687 C  CA  . PHE A 1 205 ? -30.677 33.669 -21.987 1.00 23.30 ? 221  PHE A CA  1 
ATOM   1688 C  C   . PHE A 1 205 ? -32.118 34.176 -22.086 1.00 23.48 ? 221  PHE A C   1 
ATOM   1689 O  O   . PHE A 1 205 ? -33.006 33.651 -21.414 1.00 23.42 ? 221  PHE A O   1 
ATOM   1690 C  CB  . PHE A 1 205 ? -29.861 34.543 -21.028 1.00 23.08 ? 221  PHE A CB  1 
ATOM   1691 C  CG  . PHE A 1 205 ? -30.468 34.656 -19.655 1.00 23.52 ? 221  PHE A CG  1 
ATOM   1692 C  CD1 . PHE A 1 205 ? -30.433 33.575 -18.774 1.00 23.67 ? 221  PHE A CD1 1 
ATOM   1693 C  CD2 . PHE A 1 205 ? -31.089 35.832 -19.249 1.00 24.00 ? 221  PHE A CD2 1 
ATOM   1694 C  CE1 . PHE A 1 205 ? -31.007 33.666 -17.506 1.00 24.26 ? 221  PHE A CE1 1 
ATOM   1695 C  CE2 . PHE A 1 205 ? -31.665 35.936 -17.980 1.00 24.55 ? 221  PHE A CE2 1 
ATOM   1696 C  CZ  . PHE A 1 205 ? -31.623 34.849 -17.107 1.00 24.27 ? 221  PHE A CZ  1 
ATOM   1697 N  N   . ALA A 1 206 ? -32.340 35.183 -22.931 1.00 23.74 ? 222  ALA A N   1 
ATOM   1698 C  CA  . ALA A 1 206 ? -33.676 35.736 -23.160 1.00 24.23 ? 222  ALA A CA  1 
ATOM   1699 C  C   . ALA A 1 206 ? -34.673 34.684 -23.664 1.00 24.63 ? 222  ALA A C   1 
ATOM   1700 O  O   . ALA A 1 206 ? -35.856 34.733 -23.322 1.00 24.57 ? 222  ALA A O   1 
ATOM   1701 C  CB  . ALA A 1 206 ? -33.610 36.916 -24.122 1.00 24.42 ? 222  ALA A CB  1 
ATOM   1702 N  N   . ASP A 1 207 ? -34.184 33.737 -24.464 1.00 25.04 ? 223  ASP A N   1 
ATOM   1703 C  CA  . ASP A 1 207 ? -35.015 32.654 -24.998 1.00 25.71 ? 223  ASP A CA  1 
ATOM   1704 C  C   . ASP A 1 207 ? -35.425 31.642 -23.928 1.00 25.59 ? 223  ASP A C   1 
ATOM   1705 O  O   . ASP A 1 207 ? -36.538 31.115 -23.970 1.00 25.87 ? 223  ASP A O   1 
ATOM   1706 C  CB  . ASP A 1 207 ? -34.300 31.930 -26.145 1.00 25.97 ? 223  ASP A CB  1 
ATOM   1707 C  CG  . ASP A 1 207 ? -34.175 32.783 -27.401 1.00 27.25 ? 223  ASP A CG  1 
ATOM   1708 O  OD1 . ASP A 1 207 ? -34.901 33.792 -27.531 1.00 28.06 ? 223  ASP A OD1 1 
ATOM   1709 O  OD2 . ASP A 1 207 ? -33.347 32.430 -28.271 1.00 28.47 ? 223  ASP A OD2 1 
ATOM   1710 N  N   . ILE A 1 208 ? -34.527 31.380 -22.979 1.00 25.34 ? 224  ILE A N   1 
ATOM   1711 C  CA  . ILE A 1 208 ? -34.758 30.375 -21.932 1.00 25.42 ? 224  ILE A CA  1 
ATOM   1712 C  C   . ILE A 1 208 ? -35.422 30.974 -20.691 1.00 25.23 ? 224  ILE A C   1 
ATOM   1713 O  O   . ILE A 1 208 ? -36.045 30.257 -19.903 1.00 25.21 ? 224  ILE A O   1 
ATOM   1714 C  CB  . ILE A 1 208 ? -33.436 29.654 -21.511 1.00 25.35 ? 224  ILE A CB  1 
ATOM   1715 C  CG1 . ILE A 1 208 ? -32.639 29.168 -22.734 1.00 26.14 ? 224  ILE A CG1 1 
ATOM   1716 C  CG2 . ILE A 1 208 ? -33.717 28.496 -20.545 1.00 25.63 ? 224  ILE A CG2 1 
ATOM   1717 C  CD1 . ILE A 1 208 ? -33.337 28.115 -23.595 1.00 28.48 ? 224  ILE A CD1 1 
ATOM   1718 N  N   . ARG A 1 209 ? -35.288 32.288 -20.529 1.00 24.97 ? 225  ARG A N   1 
ATOM   1719 C  CA  . ARG A 1 209 ? -35.816 32.994 -19.359 1.00 24.87 ? 225  ARG A CA  1 
ATOM   1720 C  C   . ARG A 1 209 ? -37.306 32.736 -19.052 1.00 24.71 ? 225  ARG A C   1 
ATOM   1721 O  O   . ARG A 1 209 ? -37.651 32.548 -17.882 1.00 24.58 ? 225  ARG A O   1 
ATOM   1722 C  CB  . ARG A 1 209 ? -35.535 34.498 -19.465 1.00 25.01 ? 225  ARG A CB  1 
ATOM   1723 C  CG  . ARG A 1 209 ? -35.657 35.247 -18.150 1.00 25.66 ? 225  ARG A CG  1 
ATOM   1724 C  CD  . ARG A 1 209 ? -35.149 36.668 -18.286 1.00 26.91 ? 225  ARG A CD  1 
ATOM   1725 N  NE  . ARG A 1 209 ? -34.998 37.304 -16.979 1.00 27.23 ? 225  ARG A NE  1 
ATOM   1726 C  CZ  . ARG A 1 209 ? -34.368 38.457 -16.766 1.00 27.89 ? 225  ARG A CZ  1 
ATOM   1727 N  NH1 . ARG A 1 209 ? -33.812 39.121 -17.775 1.00 27.41 ? 225  ARG A NH1 1 
ATOM   1728 N  NH2 . ARG A 1 209 ? -34.295 38.948 -15.536 1.00 27.53 ? 225  ARG A NH2 1 
ATOM   1729 N  N   . PRO A 1 210 ? -38.187 32.719 -20.084 1.00 24.62 ? 226  PRO A N   1 
ATOM   1730 C  CA  . PRO A 1 210 ? -39.600 32.423 -19.803 1.00 24.57 ? 226  PRO A CA  1 
ATOM   1731 C  C   . PRO A 1 210 ? -39.823 31.063 -19.135 1.00 24.30 ? 226  PRO A C   1 
ATOM   1732 O  O   . PRO A 1 210 ? -40.672 30.956 -18.243 1.00 24.39 ? 226  PRO A O   1 
ATOM   1733 C  CB  . PRO A 1 210 ? -40.252 32.459 -21.192 1.00 25.02 ? 226  PRO A CB  1 
ATOM   1734 C  CG  . PRO A 1 210 ? -39.382 33.379 -21.979 1.00 25.01 ? 226  PRO A CG  1 
ATOM   1735 C  CD  . PRO A 1 210 ? -37.991 33.069 -21.506 1.00 24.77 ? 226  PRO A CD  1 
ATOM   1736 N  N   . LEU A 1 211 ? -39.070 30.042 -19.552 1.00 23.79 ? 227  LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 211 ? -39.145 28.726 -18.907 1.00 23.41 ? 227  LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 211 ? -38.720 28.798 -17.439 1.00 22.86 ? 227  LEU A C   1 
ATOM   1739 O  O   . LEU A 1 211 ? -39.378 28.208 -16.573 1.00 22.57 ? 227  LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 211 ? -38.323 27.669 -19.663 1.00 23.55 ? 227  LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 211 ? -38.241 26.245 -19.082 1.00 23.57 ? 227  LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 211 ? -39.628 25.632 -18.835 1.00 23.94 ? 227  LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 211 ? -37.402 25.327 -19.973 1.00 23.85 ? 227  LEU A CD2 1 
ATOM   1744 N  N   . TYR A 1 212 ? -37.637 29.526 -17.160 1.00 22.25 ? 228  TYR A N   1 
ATOM   1745 C  CA  . TYR A 1 212 ? -37.200 29.726 -15.778 1.00 21.82 ? 228  TYR A CA  1 
ATOM   1746 C  C   . TYR A 1 212 ? -38.297 30.343 -14.914 1.00 21.74 ? 228  TYR A C   1 
ATOM   1747 O  O   . TYR A 1 212 ? -38.515 29.899 -13.785 1.00 21.99 ? 228  TYR A O   1 
ATOM   1748 C  CB  . TYR A 1 212 ? -35.920 30.572 -15.674 1.00 21.60 ? 228  TYR A CB  1 
ATOM   1749 C  CG  . TYR A 1 212 ? -35.544 30.839 -14.228 1.00 21.12 ? 228  TYR A CG  1 
ATOM   1750 C  CD1 . TYR A 1 212 ? -35.074 29.807 -13.416 1.00 21.19 ? 228  TYR A CD1 1 
ATOM   1751 C  CD2 . TYR A 1 212 ? -35.694 32.108 -13.663 1.00 20.70 ? 228  TYR A CD2 1 
ATOM   1752 C  CE1 . TYR A 1 212 ? -34.750 30.026 -12.085 1.00 20.81 ? 228  TYR A CE1 1 
ATOM   1753 C  CE2 . TYR A 1 212 ? -35.368 32.340 -12.325 1.00 20.66 ? 228  TYR A CE2 1 
ATOM   1754 C  CZ  . TYR A 1 212 ? -34.898 31.290 -11.546 1.00 20.23 ? 228  TYR A CZ  1 
ATOM   1755 O  OH  . TYR A 1 212 ? -34.561 31.485 -10.229 1.00 20.04 ? 228  TYR A OH  1 
ATOM   1756 N  N   . GLN A 1 213 ? -38.971 31.364 -15.447 1.00 21.67 ? 229  GLN A N   1 
ATOM   1757 C  CA  . GLN A 1 213 ? -40.058 32.058 -14.744 1.00 21.83 ? 229  GLN A CA  1 
ATOM   1758 C  C   . GLN A 1 213 ? -41.168 31.094 -14.333 1.00 21.73 ? 229  GLN A C   1 
ATOM   1759 O  O   . GLN A 1 213 ? -41.722 31.210 -13.239 1.00 21.74 ? 229  GLN A O   1 
ATOM   1760 C  CB  . GLN A 1 213 ? -40.658 33.180 -15.607 1.00 22.02 ? 229  GLN A CB  1 
ATOM   1761 C  CG  . GLN A 1 213 ? -39.676 34.217 -16.124 0.50 22.71 ? 229  GLN A CG  1 
ATOM   1762 C  CD  . GLN A 1 213 ? -39.153 35.124 -15.039 0.50 23.76 ? 229  GLN A CD  1 
ATOM   1763 O  OE1 . GLN A 1 213 ? -39.819 36.073 -14.625 0.50 24.23 ? 229  GLN A OE1 1 
ATOM   1764 N  NE2 . GLN A 1 213 ? -37.945 34.841 -14.576 1.00 25.26 ? 229  GLN A NE2 1 
ATOM   1765 N  N   . GLN A 1 214 ? -41.493 30.156 -15.224 1.00 21.58 ? 230  GLN A N   1 
ATOM   1766 C  CA  . GLN A 1 214 ? -42.520 29.144 -14.962 1.00 21.45 ? 230  GLN A CA  1 
ATOM   1767 C  C   . GLN A 1 214 ? -42.087 28.177 -13.858 1.00 21.31 ? 230  GLN A C   1 
ATOM   1768 O  O   . GLN A 1 214 ? -42.886 27.823 -12.983 1.00 21.32 ? 230  GLN A O   1 
ATOM   1769 C  CB  . GLN A 1 214 ? -42.862 28.374 -16.246 1.00 21.79 ? 230  GLN A CB  1 
ATOM   1770 C  CG  . GLN A 1 214 ? -43.441 29.233 -17.377 1.00 21.66 ? 230  GLN A CG  1 
ATOM   1771 C  CD  . GLN A 1 214 ? -44.841 29.739 -17.084 1.00 21.88 ? 230  GLN A CD  1 
ATOM   1772 O  OE1 . GLN A 1 214 ? -45.719 28.977 -16.678 1.00 22.77 ? 230  GLN A OE1 1 
ATOM   1773 N  NE2 . GLN A 1 214 ? -45.060 31.031 -17.301 1.00 21.14 ? 230  GLN A NE2 1 
ATOM   1774 N  N   . ILE A 1 215 ? -40.821 27.759 -13.905 1.00 20.92 ? 231  ILE A N   1 
ATOM   1775 C  CA  . ILE A 1 215 ? -40.246 26.874 -12.890 1.00 20.85 ? 231  ILE A CA  1 
ATOM   1776 C  C   . ILE A 1 215 ? -40.232 27.581 -11.536 1.00 20.61 ? 231  ILE A C   1 
ATOM   1777 O  O   . ILE A 1 215 ? -40.656 27.011 -10.532 1.00 20.66 ? 231  ILE A O   1 
ATOM   1778 C  CB  . ILE A 1 215 ? -38.815 26.403 -13.278 1.00 20.74 ? 231  ILE A CB  1 
ATOM   1779 C  CG1 . ILE A 1 215 ? -38.872 25.513 -14.525 1.00 21.34 ? 231  ILE A CG1 1 
ATOM   1780 C  CG2 . ILE A 1 215 ? -38.142 25.664 -12.116 1.00 20.67 ? 231  ILE A CG2 1 
ATOM   1781 C  CD1 . ILE A 1 215 ? -37.525 25.223 -15.156 1.00 22.11 ? 231  ILE A CD1 1 
ATOM   1782 N  N   . HIS A 1 216 ? -39.750 28.824 -11.534 1.00 20.38 ? 232  HIS A N   1 
ATOM   1783 C  CA  . HIS A 1 216 ? -39.717 29.679 -10.346 1.00 20.24 ? 232  HIS A CA  1 
ATOM   1784 C  C   . HIS A 1 216 ? -41.105 29.792 -9.710  1.00 20.31 ? 232  HIS A C   1 
ATOM   1785 O  O   . HIS A 1 216 ? -41.263 29.559 -8.511  1.00 20.32 ? 232  HIS A O   1 
ATOM   1786 C  CB  . HIS A 1 216 ? -39.171 31.066 -10.717 1.00 20.04 ? 232  HIS A CB  1 
ATOM   1787 C  CG  . HIS A 1 216 ? -39.156 32.045 -9.584  1.00 20.46 ? 232  HIS A CG  1 
ATOM   1788 N  ND1 . HIS A 1 216 ? -40.288 32.701 -9.151  1.00 20.95 ? 232  HIS A ND1 1 
ATOM   1789 C  CD2 . HIS A 1 216 ? -38.141 32.494 -8.807  1.00 20.75 ? 232  HIS A CD2 1 
ATOM   1790 C  CE1 . HIS A 1 216 ? -39.974 33.500 -8.146  1.00 21.27 ? 232  HIS A CE1 1 
ATOM   1791 N  NE2 . HIS A 1 216 ? -38.677 33.395 -7.920  1.00 20.94 ? 232  HIS A NE2 1 
ATOM   1792 N  N   . GLY A 1 217 ? -42.099 30.140 -10.526 1.00 20.48 ? 233  GLY A N   1 
ATOM   1793 C  CA  . GLY A 1 217 ? -43.482 30.295 -10.071 1.00 20.57 ? 233  GLY A CA  1 
ATOM   1794 C  C   . GLY A 1 217 ? -44.037 29.036 -9.432  1.00 20.80 ? 233  GLY A C   1 
ATOM   1795 O  O   . GLY A 1 217 ? -44.632 29.089 -8.352  1.00 20.61 ? 233  GLY A O   1 
ATOM   1796 N  N   . TYR A 1 218 ? -43.826 27.901 -10.095 1.00 20.93 ? 234  TYR A N   1 
ATOM   1797 C  CA  . TYR A 1 218 ? -44.338 26.622 -9.611  1.00 21.37 ? 234  TYR A CA  1 
ATOM   1798 C  C   . TYR A 1 218 ? -43.669 26.184 -8.307  1.00 21.22 ? 234  TYR A C   1 
ATOM   1799 O  O   . TYR A 1 218 ? -44.346 25.722 -7.386  1.00 21.35 ? 234  TYR A O   1 
ATOM   1800 C  CB  . TYR A 1 218 ? -44.207 25.532 -10.682 1.00 21.56 ? 234  TYR A CB  1 
ATOM   1801 C  CG  . TYR A 1 218 ? -44.854 24.228 -10.275 1.00 22.69 ? 234  TYR A CG  1 
ATOM   1802 C  CD1 . TYR A 1 218 ? -46.234 24.055 -10.367 1.00 23.12 ? 234  TYR A CD1 1 
ATOM   1803 C  CD2 . TYR A 1 218 ? -44.087 23.174 -9.775  1.00 23.32 ? 234  TYR A CD2 1 
ATOM   1804 C  CE1 . TYR A 1 218 ? -46.836 22.861 -9.981  1.00 24.38 ? 234  TYR A CE1 1 
ATOM   1805 C  CE2 . TYR A 1 218 ? -44.679 21.976 -9.390  1.00 24.47 ? 234  TYR A CE2 1 
ATOM   1806 C  CZ  . TYR A 1 218 ? -46.053 21.828 -9.494  1.00 24.91 ? 234  TYR A CZ  1 
ATOM   1807 O  OH  . TYR A 1 218 ? -46.642 20.644 -9.111  1.00 26.48 ? 234  TYR A OH  1 
ATOM   1808 N  N   . VAL A 1 219 ? -42.348 26.337 -8.236  1.00 20.89 ? 235  VAL A N   1 
ATOM   1809 C  CA  . VAL A 1 219 ? -41.592 26.011 -7.024  1.00 20.78 ? 235  VAL A CA  1 
ATOM   1810 C  C   . VAL A 1 219 ? -42.063 26.865 -5.842  1.00 20.92 ? 235  VAL A C   1 
ATOM   1811 O  O   . VAL A 1 219 ? -42.275 26.345 -4.742  1.00 20.80 ? 235  VAL A O   1 
ATOM   1812 C  CB  . VAL A 1 219 ? -40.054 26.130 -7.247  1.00 20.66 ? 235  VAL A CB  1 
ATOM   1813 C  CG1 . VAL A 1 219 ? -39.294 26.116 -5.923  1.00 20.55 ? 235  VAL A CG1 1 
ATOM   1814 C  CG2 . VAL A 1 219 ? -39.562 24.996 -8.138  1.00 20.34 ? 235  VAL A CG2 1 
ATOM   1815 N  N   . ARG A 1 220 ? -42.245 28.164 -6.087  1.00 20.85 ? 236  ARG A N   1 
ATOM   1816 C  CA  . ARG A 1 220 ? -42.749 29.095 -5.075  1.00 21.03 ? 236  ARG A CA  1 
ATOM   1817 C  C   . ARG A 1 220 ? -44.130 28.671 -4.572  1.00 21.38 ? 236  ARG A C   1 
ATOM   1818 O  O   . ARG A 1 220 ? -44.386 28.681 -3.369  1.00 21.34 ? 236  ARG A O   1 
ATOM   1819 C  CB  . ARG A 1 220 ? -42.787 30.526 -5.628  1.00 20.99 ? 236  ARG A CB  1 
ATOM   1820 C  CG  . ARG A 1 220 ? -43.353 31.572 -4.658  1.00 20.96 ? 236  ARG A CG  1 
ATOM   1821 C  CD  . ARG A 1 220 ? -43.186 32.988 -5.196  1.00 20.63 ? 236  ARG A CD  1 
ATOM   1822 N  NE  . ARG A 1 220 ? -43.743 33.138 -6.540  1.00 20.11 ? 236  ARG A NE  1 
ATOM   1823 C  CZ  . ARG A 1 220 ? -43.614 34.227 -7.295  1.00 19.78 ? 236  ARG A CZ  1 
ATOM   1824 N  NH1 . ARG A 1 220 ? -42.949 35.290 -6.848  1.00 18.58 ? 236  ARG A NH1 1 
ATOM   1825 N  NH2 . ARG A 1 220 ? -44.160 34.256 -8.502  1.00 19.33 ? 236  ARG A NH2 1 
ATOM   1826 N  N   . PHE A 1 221 ? -45.002 28.298 -5.506  1.00 21.63 ? 237  PHE A N   1 
ATOM   1827 C  CA  . PHE A 1 221 ? -46.333 27.772 -5.197  1.00 22.15 ? 237  PHE A CA  1 
ATOM   1828 C  C   . PHE A 1 221 ? -46.245 26.551 -4.269  1.00 22.26 ? 237  PHE A C   1 
ATOM   1829 O  O   . PHE A 1 221 ? -46.931 26.486 -3.243  1.00 22.22 ? 237  PHE A O   1 
ATOM   1830 C  CB  . PHE A 1 221 ? -47.070 27.456 -6.513  1.00 22.30 ? 237  PHE A CB  1 
ATOM   1831 C  CG  . PHE A 1 221 ? -48.240 26.510 -6.371  1.00 23.04 ? 237  PHE A CG  1 
ATOM   1832 C  CD1 . PHE A 1 221 ? -49.409 26.904 -5.719  1.00 23.78 ? 237  PHE A CD1 1 
ATOM   1833 C  CD2 . PHE A 1 221 ? -48.182 25.236 -6.930  1.00 23.25 ? 237  PHE A CD2 1 
ATOM   1834 C  CE1 . PHE A 1 221 ? -50.493 26.029 -5.607  1.00 23.79 ? 237  PHE A CE1 1 
ATOM   1835 C  CE2 . PHE A 1 221 ? -49.259 24.354 -6.823  1.00 23.92 ? 237  PHE A CE2 1 
ATOM   1836 C  CZ  . PHE A 1 221 ? -50.416 24.751 -6.161  1.00 23.75 ? 237  PHE A CZ  1 
ATOM   1837 N  N   . ARG A 1 222 ? -45.371 25.612 -4.619  1.00 22.22 ? 238  ARG A N   1 
ATOM   1838 C  CA  . ARG A 1 222 ? -45.203 24.382 -3.849  1.00 22.55 ? 238  ARG A CA  1 
ATOM   1839 C  C   . ARG A 1 222 ? -44.547 24.608 -2.485  1.00 22.54 ? 238  ARG A C   1 
ATOM   1840 O  O   . ARG A 1 222 ? -44.871 23.915 -1.518  1.00 22.85 ? 238  ARG A O   1 
ATOM   1841 C  CB  . ARG A 1 222 ? -44.436 23.335 -4.665  1.00 22.59 ? 238  ARG A CB  1 
ATOM   1842 C  CG  . ARG A 1 222 ? -45.202 22.826 -5.902  1.00 23.34 ? 238  ARG A CG  1 
ATOM   1843 C  CD  . ARG A 1 222 ? -46.445 22.010 -5.519  1.00 24.36 ? 238  ARG A CD  1 
ATOM   1844 N  NE  . ARG A 1 222 ? -46.077 20.815 -4.761  1.00 25.48 ? 238  ARG A NE  1 
ATOM   1845 C  CZ  . ARG A 1 222 ? -45.752 19.647 -5.308  1.00 26.48 ? 238  ARG A CZ  1 
ATOM   1846 N  NH1 . ARG A 1 222 ? -45.760 19.495 -6.628  1.00 26.57 ? 238  ARG A NH1 1 
ATOM   1847 N  NH2 . ARG A 1 222 ? -45.419 18.625 -4.533  1.00 27.36 ? 238  ARG A NH2 1 
ATOM   1848 N  N   . LEU A 1 223 ? -43.638 25.579 -2.411  1.00 22.13 ? 239  LEU A N   1 
ATOM   1849 C  CA  . LEU A 1 223 ? -43.006 25.950 -1.142  1.00 22.17 ? 239  LEU A CA  1 
ATOM   1850 C  C   . LEU A 1 223 ? -43.995 26.591 -0.163  1.00 22.37 ? 239  LEU A C   1 
ATOM   1851 O  O   . LEU A 1 223 ? -43.887 26.395 1.050   1.00 22.41 ? 239  LEU A O   1 
ATOM   1852 C  CB  . LEU A 1 223 ? -41.799 26.869 -1.372  1.00 21.84 ? 239  LEU A CB  1 
ATOM   1853 C  CG  . LEU A 1 223 ? -40.518 26.222 -1.920  1.00 21.33 ? 239  LEU A CG  1 
ATOM   1854 C  CD1 . LEU A 1 223 ? -39.479 27.288 -2.248  1.00 20.79 ? 239  LEU A CD1 1 
ATOM   1855 C  CD2 . LEU A 1 223 ? -39.943 25.194 -0.950  1.00 20.98 ? 239  LEU A CD2 1 
ATOM   1856 N  N   . ARG A 1 224 ? -44.951 27.353 -0.697  1.00 22.49 ? 240  ARG A N   1 
ATOM   1857 C  CA  . ARG A 1 224 ? -46.017 27.959 0.111   1.00 22.94 ? 240  ARG A CA  1 
ATOM   1858 C  C   . ARG A 1 224 ? -46.883 26.894 0.783   1.00 23.50 ? 240  ARG A C   1 
ATOM   1859 O  O   . ARG A 1 224 ? -47.291 27.055 1.932   1.00 23.60 ? 240  ARG A O   1 
ATOM   1860 C  CB  . ARG A 1 224 ? -46.897 28.874 -0.744  1.00 22.92 ? 240  ARG A CB  1 
ATOM   1861 C  CG  . ARG A 1 224 ? -46.239 30.188 -1.154  1.00 22.52 ? 240  ARG A CG  1 
ATOM   1862 C  CD  . ARG A 1 224 ? -47.125 30.975 -2.105  1.00 22.20 ? 240  ARG A CD  1 
ATOM   1863 N  NE  . ARG A 1 224 ? -48.384 31.381 -1.478  1.00 22.20 ? 240  ARG A NE  1 
ATOM   1864 C  CZ  . ARG A 1 224 ? -49.544 31.499 -2.120  1.00 22.24 ? 240  ARG A CZ  1 
ATOM   1865 N  NH1 . ARG A 1 224 ? -49.622 31.236 -3.419  1.00 21.34 ? 240  ARG A NH1 1 
ATOM   1866 N  NH2 . ARG A 1 224 ? -50.633 31.872 -1.459  1.00 21.50 ? 240  ARG A NH2 1 
ATOM   1867 N  N   . LYS A 1 225 ? -47.159 25.811 0.059   1.00 23.92 ? 241  LYS A N   1 
ATOM   1868 C  CA  . LYS A 1 225 ? -47.934 24.692 0.594   1.00 24.70 ? 241  LYS A CA  1 
ATOM   1869 C  C   . LYS A 1 225 ? -47.180 23.966 1.708   1.00 24.77 ? 241  LYS A C   1 
ATOM   1870 O  O   . LYS A 1 225 ? -47.791 23.450 2.648   1.00 25.11 ? 241  LYS A O   1 
ATOM   1871 C  CB  . LYS A 1 225 ? -48.306 23.712 -0.523  1.00 24.90 ? 241  LYS A CB  1 
ATOM   1872 C  CG  . LYS A 1 225 ? -49.273 24.287 -1.551  1.00 26.14 ? 241  LYS A CG  1 
ATOM   1873 C  CD  . LYS A 1 225 ? -49.691 23.247 -2.581  1.00 28.90 ? 241  LYS A CD  1 
ATOM   1874 C  CE  . LYS A 1 225 ? -50.702 22.271 -2.002  1.00 30.69 ? 241  LYS A CE  1 
ATOM   1875 N  NZ  . LYS A 1 225 ? -51.196 21.342 -3.047  1.00 32.39 ? 241  LYS A NZ  1 
ATOM   1876 N  N   . HIS A 1 226 ? -45.853 23.942 1.605   1.00 24.37 ? 242  HIS A N   1 
ATOM   1877 C  CA  . HIS A 1 226 ? -45.013 23.269 2.595   1.00 24.26 ? 242  HIS A CA  1 
ATOM   1878 C  C   . HIS A 1 226 ? -44.740 24.120 3.841   1.00 24.25 ? 242  HIS A C   1 
ATOM   1879 O  O   . HIS A 1 226 ? -44.941 23.660 4.964   1.00 24.57 ? 242  HIS A O   1 
ATOM   1880 C  CB  . HIS A 1 226 ? -43.692 22.818 1.965   1.00 23.97 ? 242  HIS A CB  1 
ATOM   1881 C  CG  . HIS A 1 226 ? -42.863 21.955 2.864   1.00 24.21 ? 242  HIS A CG  1 
ATOM   1882 N  ND1 . HIS A 1 226 ? -42.981 20.583 2.893   1.00 24.80 ? 242  HIS A ND1 1 
ATOM   1883 C  CD2 . HIS A 1 226 ? -41.913 22.271 3.778   1.00 24.28 ? 242  HIS A CD2 1 
ATOM   1884 C  CE1 . HIS A 1 226 ? -42.135 20.089 3.780   1.00 24.34 ? 242  HIS A CE1 1 
ATOM   1885 N  NE2 . HIS A 1 226 ? -41.475 21.092 4.331   1.00 24.11 ? 242  HIS A NE2 1 
ATOM   1886 N  N   . TYR A 1 227 ? -44.277 25.352 3.633   1.00 23.98 ? 243  TYR A N   1 
ATOM   1887 C  CA  . TYR A 1 227 ? -43.851 26.229 4.729   1.00 24.04 ? 243  TYR A CA  1 
ATOM   1888 C  C   . TYR A 1 227 ? -44.931 27.184 5.244   1.00 24.27 ? 243  TYR A C   1 
ATOM   1889 O  O   . TYR A 1 227 ? -44.834 27.683 6.367   1.00 24.41 ? 243  TYR A O   1 
ATOM   1890 C  CB  . TYR A 1 227 ? -42.612 27.031 4.321   1.00 23.69 ? 243  TYR A CB  1 
ATOM   1891 C  CG  . TYR A 1 227 ? -41.347 26.209 4.247   1.00 23.41 ? 243  TYR A CG  1 
ATOM   1892 C  CD1 . TYR A 1 227 ? -40.655 25.861 5.405   1.00 23.28 ? 243  TYR A CD1 1 
ATOM   1893 C  CD2 . TYR A 1 227 ? -40.839 25.782 3.021   1.00 22.93 ? 243  TYR A CD2 1 
ATOM   1894 C  CE1 . TYR A 1 227 ? -39.493 25.104 5.349   1.00 23.21 ? 243  TYR A CE1 1 
ATOM   1895 C  CE2 . TYR A 1 227 ? -39.668 25.021 2.951   1.00 22.46 ? 243  TYR A CE2 1 
ATOM   1896 C  CZ  . TYR A 1 227 ? -39.004 24.691 4.121   1.00 22.72 ? 243  TYR A CZ  1 
ATOM   1897 O  OH  . TYR A 1 227 ? -37.855 23.942 4.079   1.00 22.12 ? 243  TYR A OH  1 
ATOM   1898 N  N   . GLY A 1 228 ? -45.946 27.442 4.424   1.00 24.35 ? 244  GLY A N   1 
ATOM   1899 C  CA  . GLY A 1 228 ? -47.000 28.390 4.787   1.00 24.82 ? 244  GLY A CA  1 
ATOM   1900 C  C   . GLY A 1 228 ? -46.684 29.787 4.294   1.00 24.83 ? 244  GLY A C   1 
ATOM   1901 O  O   . GLY A 1 228 ? -45.530 30.101 3.986   1.00 24.69 ? 244  GLY A O   1 
ATOM   1902 N  N   . ASP A 1 229 ? -47.710 30.629 4.231   1.00 25.11 ? 245  ASP A N   1 
ATOM   1903 C  CA  . ASP A 1 229 ? -47.585 31.971 3.662   1.00 25.40 ? 245  ASP A CA  1 
ATOM   1904 C  C   . ASP A 1 229 ? -46.829 32.967 4.547   1.00 25.26 ? 245  ASP A C   1 
ATOM   1905 O  O   . ASP A 1 229 ? -46.414 34.024 4.073   1.00 25.16 ? 245  ASP A O   1 
ATOM   1906 C  CB  . ASP A 1 229 ? -48.958 32.515 3.255   1.00 25.81 ? 245  ASP A CB  1 
ATOM   1907 C  CG  . ASP A 1 229 ? -49.456 31.918 1.947   1.00 26.98 ? 245  ASP A CG  1 
ATOM   1908 O  OD1 . ASP A 1 229 ? -49.473 30.677 1.814   1.00 29.03 ? 245  ASP A OD1 1 
ATOM   1909 O  OD2 . ASP A 1 229 ? -49.831 32.693 1.047   1.00 29.11 ? 245  ASP A OD2 1 
ATOM   1910 N  N   . ALA A 1 230 ? -46.638 32.624 5.819   1.00 25.26 ? 246  ALA A N   1 
ATOM   1911 C  CA  . ALA A 1 230 ? -45.806 33.433 6.711   1.00 25.37 ? 246  ALA A CA  1 
ATOM   1912 C  C   . ALA A 1 230 ? -44.329 33.384 6.294   1.00 25.18 ? 246  ALA A C   1 
ATOM   1913 O  O   . ALA A 1 230 ? -43.593 34.349 6.484   1.00 25.29 ? 246  ALA A O   1 
ATOM   1914 C  CB  . ALA A 1 230 ? -45.972 32.980 8.156   1.00 25.76 ? 246  ALA A CB  1 
ATOM   1915 N  N   . VAL A 1 231 ? -43.916 32.260 5.713   1.00 24.84 ? 247  VAL A N   1 
ATOM   1916 C  CA  . VAL A 1 231 ? -42.525 32.046 5.303   1.00 24.69 ? 247  VAL A CA  1 
ATOM   1917 C  C   . VAL A 1 231 ? -42.294 32.412 3.833   1.00 24.36 ? 247  VAL A C   1 
ATOM   1918 O  O   . VAL A 1 231 ? -41.267 33.005 3.494   1.00 24.34 ? 247  VAL A O   1 
ATOM   1919 C  CB  . VAL A 1 231 ? -42.079 30.582 5.563   1.00 24.56 ? 247  VAL A CB  1 
ATOM   1920 C  CG1 . VAL A 1 231 ? -40.626 30.365 5.156   1.00 24.49 ? 247  VAL A CG1 1 
ATOM   1921 C  CG2 . VAL A 1 231 ? -42.263 30.225 7.032   1.00 25.11 ? 247  VAL A CG2 1 
ATOM   1922 N  N   . VAL A 1 232 ? -43.246 32.047 2.974   1.00 24.29 ? 248  VAL A N   1 
ATOM   1923 C  CA  . VAL A 1 232 ? -43.138 32.264 1.527   1.00 24.05 ? 248  VAL A CA  1 
ATOM   1924 C  C   . VAL A 1 232 ? -44.357 33.024 1.006   1.00 24.26 ? 248  VAL A C   1 
ATOM   1925 O  O   . VAL A 1 232 ? -45.492 32.553 1.127   1.00 24.50 ? 248  VAL A O   1 
ATOM   1926 C  CB  . VAL A 1 232 ? -43.009 30.919 0.747   1.00 24.05 ? 248  VAL A CB  1 
ATOM   1927 C  CG1 . VAL A 1 232 ? -42.731 31.170 -0.733  1.00 23.44 ? 248  VAL A CG1 1 
ATOM   1928 C  CG2 . VAL A 1 232 ? -41.915 30.043 1.342   1.00 23.49 ? 248  VAL A CG2 1 
ATOM   1929 N  N   . SER A 1 233 ? -44.121 34.198 0.425   1.00 24.21 ? 249  SER A N   1 
ATOM   1930 C  CA  . SER A 1 233 ? -45.204 34.984 -0.164  1.00 24.29 ? 249  SER A CA  1 
ATOM   1931 C  C   . SER A 1 233 ? -45.444 34.584 -1.618  1.00 23.95 ? 249  SER A C   1 
ATOM   1932 O  O   . SER A 1 233 ? -44.548 34.058 -2.283  1.00 23.56 ? 249  SER A O   1 
ATOM   1933 C  CB  . SER A 1 233 ? -44.916 36.484 -0.058  1.00 24.59 ? 249  SER A CB  1 
ATOM   1934 O  OG  . SER A 1 233 ? -43.936 36.890 -0.994  1.00 24.83 ? 249  SER A OG  1 
ATOM   1935 N  N   . GLU A 1 234 ? -46.656 34.840 -2.100  1.00 23.86 ? 250  GLU A N   1 
ATOM   1936 C  CA  . GLU A 1 234 ? -47.034 34.525 -3.476  1.00 23.67 ? 250  GLU A CA  1 
ATOM   1937 C  C   . GLU A 1 234 ? -46.322 35.419 -4.490  1.00 23.38 ? 250  GLU A C   1 
ATOM   1938 O  O   . GLU A 1 234 ? -45.961 34.965 -5.577  1.00 23.06 ? 250  GLU A O   1 
ATOM   1939 C  CB  . GLU A 1 234 ? -48.550 34.656 -3.652  1.00 24.07 ? 250  GLU A CB  1 
ATOM   1940 C  CG  . GLU A 1 234 ? -49.071 34.220 -5.025  1.00 24.30 ? 250  GLU A CG  1 
ATOM   1941 C  CD  . GLU A 1 234 ? -50.552 34.490 -5.212  1.00 25.71 ? 250  GLU A CD  1 
ATOM   1942 O  OE1 . GLU A 1 234 ? -51.084 35.405 -4.548  1.00 26.50 ? 250  GLU A OE1 1 
ATOM   1943 O  OE2 . GLU A 1 234 ? -51.189 33.786 -6.028  1.00 26.31 ? 250  GLU A OE2 1 
ATOM   1944 N  N   . THR A 1 235 ? -46.121 36.683 -4.127  1.00 23.22 ? 251  THR A N   1 
ATOM   1945 C  CA  . THR A 1 235 ? -45.700 37.702 -5.091  1.00 23.20 ? 251  THR A CA  1 
ATOM   1946 C  C   . THR A 1 235 ? -44.246 38.160 -4.933  1.00 22.78 ? 251  THR A C   1 
ATOM   1947 O  O   . THR A 1 235 ? -43.723 38.863 -5.798  1.00 22.72 ? 251  THR A O   1 
ATOM   1948 C  CB  . THR A 1 235 ? -46.633 38.933 -5.044  1.00 23.56 ? 251  THR A CB  1 
ATOM   1949 O  OG1 . THR A 1 235 ? -46.642 39.474 -3.718  1.00 24.34 ? 251  THR A OG1 1 
ATOM   1950 C  CG2 . THR A 1 235 ? -48.057 38.549 -5.439  1.00 23.78 ? 251  THR A CG2 1 
ATOM   1951 N  N   . GLY A 1 236 ? -43.602 37.771 -3.835  1.00 22.31 ? 252  GLY A N   1 
ATOM   1952 C  CA  . GLY A 1 236 ? -42.225 38.187 -3.568  1.00 21.87 ? 252  GLY A CA  1 
ATOM   1953 C  C   . GLY A 1 236 ? -41.174 37.210 -4.077  1.00 21.22 ? 252  GLY A C   1 
ATOM   1954 O  O   . GLY A 1 236 ? -41.509 36.098 -4.491  1.00 20.81 ? 252  GLY A O   1 
ATOM   1955 N  N   . PRO A 1 237 ? -39.889 37.622 -4.050  1.00 21.06 ? 253  PRO A N   1 
ATOM   1956 C  CA  . PRO A 1 237 ? -38.784 36.708 -4.342  1.00 20.81 ? 253  PRO A CA  1 
ATOM   1957 C  C   . PRO A 1 237 ? -38.762 35.553 -3.340  1.00 20.82 ? 253  PRO A C   1 
ATOM   1958 O  O   . PRO A 1 237 ? -39.178 35.726 -2.188  1.00 21.18 ? 253  PRO A O   1 
ATOM   1959 C  CB  . PRO A 1 237 ? -37.536 37.585 -4.161  1.00 20.83 ? 253  PRO A CB  1 
ATOM   1960 C  CG  . PRO A 1 237 ? -38.022 38.990 -4.289  1.00 21.02 ? 253  PRO A CG  1 
ATOM   1961 C  CD  . PRO A 1 237 ? -39.414 38.982 -3.735  1.00 21.16 ? 253  PRO A CD  1 
ATOM   1962 N  N   . ILE A 1 238 ? -38.302 34.385 -3.779  1.00 20.58 ? 254  ILE A N   1 
ATOM   1963 C  CA  . ILE A 1 238 ? -38.231 33.209 -2.910  1.00 20.63 ? 254  ILE A CA  1 
ATOM   1964 C  C   . ILE A 1 238 ? -37.101 33.369 -1.883  1.00 20.70 ? 254  ILE A C   1 
ATOM   1965 O  O   . ILE A 1 238 ? -35.966 33.673 -2.262  1.00 20.41 ? 254  ILE A O   1 
ATOM   1966 C  CB  . ILE A 1 238 ? -38.031 31.899 -3.723  1.00 20.63 ? 254  ILE A CB  1 
ATOM   1967 C  CG1 . ILE A 1 238 ? -39.152 31.723 -4.755  1.00 20.48 ? 254  ILE A CG1 1 
ATOM   1968 C  CG2 . ILE A 1 238 ? -37.959 30.684 -2.786  1.00 20.41 ? 254  ILE A CG2 1 
ATOM   1969 C  CD1 . ILE A 1 238 ? -38.893 30.623 -5.787  1.00 20.83 ? 254  ILE A CD1 1 
ATOM   1970 N  N   . PRO A 1 239 ? -37.411 33.188 -0.580  1.00 20.94 ? 255  PRO A N   1 
ATOM   1971 C  CA  . PRO A 1 239 ? -36.352 33.156 0.433   1.00 21.17 ? 255  PRO A CA  1 
ATOM   1972 C  C   . PRO A 1 239 ? -35.393 32.013 0.117   1.00 21.10 ? 255  PRO A C   1 
ATOM   1973 O  O   . PRO A 1 239 ? -35.803 30.852 0.068   1.00 21.26 ? 255  PRO A O   1 
ATOM   1974 C  CB  . PRO A 1 239 ? -37.119 32.904 1.738   1.00 21.37 ? 255  PRO A CB  1 
ATOM   1975 C  CG  . PRO A 1 239 ? -38.484 33.429 1.473   1.00 21.25 ? 255  PRO A CG  1 
ATOM   1976 C  CD  . PRO A 1 239 ? -38.749 33.082 0.034   1.00 21.13 ? 255  PRO A CD  1 
ATOM   1977 N  N   . MET A 1 240 ? -34.132 32.360 -0.126  1.00 21.04 ? 256  MET A N   1 
ATOM   1978 C  CA  . MET A 1 240 ? -33.179 31.456 -0.774  1.00 20.79 ? 256  MET A CA  1 
ATOM   1979 C  C   . MET A 1 240 ? -32.737 30.258 0.067   1.00 20.91 ? 256  MET A C   1 
ATOM   1980 O  O   . MET A 1 240 ? -32.325 29.239 -0.481  1.00 20.79 ? 256  MET A O   1 
ATOM   1981 C  CB  . MET A 1 240 ? -31.956 32.236 -1.272  1.00 20.62 ? 256  MET A CB  1 
ATOM   1982 C  CG  . MET A 1 240 ? -31.059 32.784 -0.165  1.00 20.97 ? 256  MET A CG  1 
ATOM   1983 S  SD  . MET A 1 240 ? -29.732 33.827 -0.787  1.00 20.78 ? 256  MET A SD  1 
ATOM   1984 C  CE  . MET A 1 240 ? -28.755 32.650 -1.719  1.00 20.62 ? 256  MET A CE  1 
ATOM   1985 N  N   . HIS A 1 241 ? -32.827 30.383 1.389   1.00 21.05 ? 257  HIS A N   1 
ATOM   1986 C  CA  . HIS A 1 241 ? -32.411 29.311 2.295   1.00 21.29 ? 257  HIS A CA  1 
ATOM   1987 C  C   . HIS A 1 241 ? -33.326 28.082 2.225   1.00 21.35 ? 257  HIS A C   1 
ATOM   1988 O  O   . HIS A 1 241 ? -32.997 27.023 2.761   1.00 21.71 ? 257  HIS A O   1 
ATOM   1989 C  CB  . HIS A 1 241 ? -32.285 29.839 3.736   1.00 21.39 ? 257  HIS A CB  1 
ATOM   1990 C  CG  . HIS A 1 241 ? -33.583 30.273 4.351   1.00 21.67 ? 257  HIS A CG  1 
ATOM   1991 N  ND1 . HIS A 1 241 ? -34.466 31.123 3.718   1.00 21.16 ? 257  HIS A ND1 1 
ATOM   1992 C  CD2 . HIS A 1 241 ? -34.127 30.001 5.562   1.00 21.78 ? 257  HIS A CD2 1 
ATOM   1993 C  CE1 . HIS A 1 241 ? -35.507 31.338 4.503   1.00 21.37 ? 257  HIS A CE1 1 
ATOM   1994 N  NE2 . HIS A 1 241 ? -35.325 30.671 5.628   1.00 21.61 ? 257  HIS A NE2 1 
ATOM   1995 N  N   . LEU A 1 242 ? -34.458 28.228 1.541   1.00 21.35 ? 258  LEU A N   1 
ATOM   1996 C  CA  . LEU A 1 242 ? -35.445 27.156 1.412   1.00 21.47 ? 258  LEU A CA  1 
ATOM   1997 C  C   . LEU A 1 242 ? -35.242 26.322 0.153   1.00 21.45 ? 258  LEU A C   1 
ATOM   1998 O  O   . LEU A 1 242 ? -35.996 25.383 -0.105  1.00 21.64 ? 258  LEU A O   1 
ATOM   1999 C  CB  . LEU A 1 242 ? -36.860 27.746 1.402   1.00 21.42 ? 258  LEU A CB  1 
ATOM   2000 C  CG  . LEU A 1 242 ? -37.249 28.696 2.535   1.00 21.68 ? 258  LEU A CG  1 
ATOM   2001 C  CD1 . LEU A 1 242 ? -38.625 29.265 2.264   1.00 21.26 ? 258  LEU A CD1 1 
ATOM   2002 C  CD2 . LEU A 1 242 ? -37.216 27.989 3.884   1.00 21.88 ? 258  LEU A CD2 1 
ATOM   2003 N  N   . LEU A 1 243 ? -34.221 26.662 -0.627  1.00 21.46 ? 259  LEU A N   1 
ATOM   2004 C  CA  . LEU A 1 243 ? -34.040 26.062 -1.947  1.00 21.45 ? 259  LEU A CA  1 
ATOM   2005 C  C   . LEU A 1 243 ? -33.008 24.922 -1.999  1.00 21.65 ? 259  LEU A C   1 
ATOM   2006 O  O   . LEU A 1 243 ? -32.630 24.468 -3.079  1.00 21.66 ? 259  LEU A O   1 
ATOM   2007 C  CB  . LEU A 1 243 ? -33.754 27.153 -2.989  1.00 21.24 ? 259  LEU A CB  1 
ATOM   2008 C  CG  . LEU A 1 243 ? -34.946 28.077 -3.278  1.00 21.10 ? 259  LEU A CG  1 
ATOM   2009 C  CD1 . LEU A 1 243 ? -34.506 29.334 -4.014  1.00 21.01 ? 259  LEU A CD1 1 
ATOM   2010 C  CD2 . LEU A 1 243 ? -36.047 27.351 -4.053  1.00 20.80 ? 259  LEU A CD2 1 
ATOM   2011 N  N   . GLY A 1 244 ? -32.569 24.464 -0.828  1.00 21.87 ? 260  GLY A N   1 
ATOM   2012 C  CA  . GLY A 1 244 ? -31.728 23.269 -0.718  1.00 22.25 ? 260  GLY A CA  1 
ATOM   2013 C  C   . GLY A 1 244 ? -30.269 23.441 -1.097  1.00 22.29 ? 260  GLY A C   1 
ATOM   2014 O  O   . GLY A 1 244 ? -29.541 22.458 -1.229  1.00 22.60 ? 260  GLY A O   1 
ATOM   2015 N  N   . ASN A 1 245 ? -29.844 24.690 -1.261  1.00 22.16 ? 261  ASN A N   1 
ATOM   2016 C  CA  . ASN A 1 245 ? -28.484 25.016 -1.679  1.00 22.13 ? 261  ASN A CA  1 
ATOM   2017 C  C   . ASN A 1 245 ? -28.073 26.352 -1.073  1.00 22.01 ? 261  ASN A C   1 
ATOM   2018 O  O   . ASN A 1 245 ? -28.860 27.300 -1.067  1.00 21.81 ? 261  ASN A O   1 
ATOM   2019 C  CB  . ASN A 1 245 ? -28.407 25.058 -3.209  1.00 22.01 ? 261  ASN A CB  1 
ATOM   2020 C  CG  . ASN A 1 245 ? -27.013 25.353 -3.722  1.00 22.30 ? 261  ASN A CG  1 
ATOM   2021 O  OD1 . ASN A 1 245 ? -26.605 26.511 -3.809  1.00 22.79 ? 261  ASN A OD1 1 
ATOM   2022 N  ND2 . ASN A 1 245 ? -26.282 24.306 -4.085  1.00 22.40 ? 261  ASN A ND2 1 
ATOM   2023 N  N   . MET A 1 246 ? -26.843 26.421 -0.566  1.00 22.11 ? 262  MET A N   1 
ATOM   2024 C  CA  . MET A 1 246 ? -26.345 27.612 0.134   1.00 22.31 ? 262  MET A CA  1 
ATOM   2025 C  C   . MET A 1 246 ? -26.442 28.886 -0.712  1.00 22.17 ? 262  MET A C   1 
ATOM   2026 O  O   . MET A 1 246 ? -26.612 29.984 -0.176  1.00 22.35 ? 262  MET A O   1 
ATOM   2027 C  CB  . MET A 1 246 ? -24.901 27.396 0.612   1.00 22.31 ? 262  MET A CB  1 
ATOM   2028 C  CG  . MET A 1 246 ? -24.318 28.541 1.452   1.00 22.51 ? 262  MET A CG  1 
ATOM   2029 S  SD  . MET A 1 246 ? -25.257 28.871 2.962   1.00 22.62 ? 262  MET A SD  1 
ATOM   2030 C  CE  . MET A 1 246 ? -24.597 27.609 4.042   1.00 23.41 ? 262  MET A CE  1 
ATOM   2031 N  N   . TRP A 1 247 ? -26.348 28.725 -2.028  1.00 22.02 ? 263  TRP A N   1 
ATOM   2032 C  CA  . TRP A 1 247 ? -26.324 29.853 -2.955  1.00 21.90 ? 263  TRP A CA  1 
ATOM   2033 C  C   . TRP A 1 247 ? -27.557 29.864 -3.865  1.00 22.00 ? 263  TRP A C   1 
ATOM   2034 O  O   . TRP A 1 247 ? -27.675 30.711 -4.755  1.00 21.64 ? 263  TRP A O   1 
ATOM   2035 C  CB  . TRP A 1 247 ? -25.012 29.828 -3.754  1.00 21.82 ? 263  TRP A CB  1 
ATOM   2036 C  CG  . TRP A 1 247 ? -23.828 29.614 -2.844  1.00 21.82 ? 263  TRP A CG  1 
ATOM   2037 C  CD1 . TRP A 1 247 ? -23.123 30.574 -2.174  1.00 21.68 ? 263  TRP A CD1 1 
ATOM   2038 C  CD2 . TRP A 1 247 ? -23.256 28.356 -2.459  1.00 21.95 ? 263  TRP A CD2 1 
ATOM   2039 N  NE1 . TRP A 1 247 ? -22.139 29.993 -1.409  1.00 21.98 ? 263  TRP A NE1 1 
ATOM   2040 C  CE2 . TRP A 1 247 ? -22.198 28.634 -1.564  1.00 21.90 ? 263  TRP A CE2 1 
ATOM   2041 C  CE3 . TRP A 1 247 ? -23.532 27.021 -2.786  1.00 22.05 ? 263  TRP A CE3 1 
ATOM   2042 C  CZ2 . TRP A 1 247 ? -21.410 27.626 -0.995  1.00 22.39 ? 263  TRP A CZ2 1 
ATOM   2043 C  CZ3 . TRP A 1 247 ? -22.747 26.016 -2.218  1.00 22.42 ? 263  TRP A CZ3 1 
ATOM   2044 C  CH2 . TRP A 1 247 ? -21.697 26.327 -1.336  1.00 22.37 ? 263  TRP A CH2 1 
ATOM   2045 N  N   . ALA A 1 248 ? -28.481 28.934 -3.602  1.00 22.20 ? 264  ALA A N   1 
ATOM   2046 C  CA  . ALA A 1 248 ? -29.706 28.750 -4.391  1.00 22.45 ? 264  ALA A CA  1 
ATOM   2047 C  C   . ALA A 1 248 ? -29.422 28.581 -5.886  1.00 22.50 ? 264  ALA A C   1 
ATOM   2048 O  O   . ALA A 1 248 ? -30.244 28.944 -6.728  1.00 22.75 ? 264  ALA A O   1 
ATOM   2049 C  CB  . ALA A 1 248 ? -30.698 29.900 -4.142  1.00 22.33 ? 264  ALA A CB  1 
ATOM   2050 N  N   . GLN A 1 249 ? -28.255 28.026 -6.204  1.00 22.68 ? 265  GLN A N   1 
ATOM   2051 C  CA  . GLN A 1 249 ? -27.807 27.906 -7.590  1.00 22.83 ? 265  GLN A CA  1 
ATOM   2052 C  C   . GLN A 1 249 ? -28.468 26.742 -8.315  1.00 22.97 ? 265  GLN A C   1 
ATOM   2053 O  O   . GLN A 1 249 ? -28.654 26.789 -9.530  1.00 23.11 ? 265  GLN A O   1 
ATOM   2054 C  CB  . GLN A 1 249 ? -26.283 27.781 -7.658  1.00 22.84 ? 265  GLN A CB  1 
ATOM   2055 C  CG  . GLN A 1 249 ? -25.703 26.496 -7.088  1.00 23.50 ? 265  GLN A CG  1 
ATOM   2056 C  CD  . GLN A 1 249 ? -24.194 26.505 -7.098  1.00 25.05 ? 265  GLN A CD  1 
ATOM   2057 O  OE1 . GLN A 1 249 ? -23.563 27.297 -6.396  1.00 25.88 ? 265  GLN A OE1 1 
ATOM   2058 N  NE2 . GLN A 1 249 ? -23.603 25.625 -7.897  1.00 25.38 ? 265  GLN A NE2 1 
ATOM   2059 N  N   . GLN A 1 250 ? -28.803 25.702 -7.554  1.00 23.17 ? 266  GLN A N   1 
ATOM   2060 C  CA  . GLN A 1 250 ? -29.463 24.504 -8.067  1.00 23.52 ? 266  GLN A CA  1 
ATOM   2061 C  C   . GLN A 1 250 ? -30.416 23.992 -6.987  1.00 23.39 ? 266  GLN A C   1 
ATOM   2062 O  O   . GLN A 1 250 ? -30.057 23.958 -5.806  1.00 23.43 ? 266  GLN A O   1 
ATOM   2063 C  CB  . GLN A 1 250 ? -28.423 23.445 -8.454  1.00 23.79 ? 266  GLN A CB  1 
ATOM   2064 C  CG  . GLN A 1 250 ? -27.762 23.716 -9.817  1.00 25.23 ? 266  GLN A CG  1 
ATOM   2065 C  CD  . GLN A 1 250 ? -26.387 23.082 -9.980  1.00 27.59 ? 266  GLN A CD  1 
ATOM   2066 O  OE1 . GLN A 1 250 ? -25.451 23.384 -9.232  1.00 28.74 ? 266  GLN A OE1 1 
ATOM   2067 N  NE2 . GLN A 1 250 ? -26.252 22.225 -10.987 1.00 27.40 ? 266  GLN A NE2 1 
ATOM   2068 N  N   . TRP A 1 251 ? -31.630 23.617 -7.383  1.00 23.09 ? 267  TRP A N   1 
ATOM   2069 C  CA  . TRP A 1 251 ? -32.697 23.346 -6.410  1.00 23.14 ? 267  TRP A CA  1 
ATOM   2070 C  C   . TRP A 1 251 ? -33.082 21.872 -6.259  1.00 23.62 ? 267  TRP A C   1 
ATOM   2071 O  O   . TRP A 1 251 ? -34.100 21.558 -5.638  1.00 23.46 ? 267  TRP A O   1 
ATOM   2072 C  CB  . TRP A 1 251 ? -33.957 24.164 -6.736  1.00 22.77 ? 267  TRP A CB  1 
ATOM   2073 C  CG  . TRP A 1 251 ? -33.764 25.654 -6.889  1.00 22.03 ? 267  TRP A CG  1 
ATOM   2074 C  CD1 . TRP A 1 251 ? -32.697 26.405 -6.470  1.00 21.34 ? 267  TRP A CD1 1 
ATOM   2075 C  CD2 . TRP A 1 251 ? -34.693 26.575 -7.475  1.00 21.63 ? 267  TRP A CD2 1 
ATOM   2076 N  NE1 . TRP A 1 251 ? -32.897 27.730 -6.782  1.00 21.44 ? 267  TRP A NE1 1 
ATOM   2077 C  CE2 . TRP A 1 251 ? -34.116 27.863 -7.393  1.00 21.31 ? 267  TRP A CE2 1 
ATOM   2078 C  CE3 . TRP A 1 251 ? -35.956 26.436 -8.066  1.00 21.35 ? 267  TRP A CE3 1 
ATOM   2079 C  CZ2 . TRP A 1 251 ? -34.754 29.005 -7.889  1.00 21.44 ? 267  TRP A CZ2 1 
ATOM   2080 C  CZ3 . TRP A 1 251 ? -36.592 27.573 -8.558  1.00 21.30 ? 267  TRP A CZ3 1 
ATOM   2081 C  CH2 . TRP A 1 251 ? -35.989 28.840 -8.464  1.00 21.12 ? 267  TRP A CH2 1 
ATOM   2082 N  N   . SER A 1 252 ? -32.275 20.969 -6.810  1.00 24.15 ? 268  SER A N   1 
ATOM   2083 C  CA  . SER A 1 252 ? -32.640 19.549 -6.852  1.00 25.02 ? 268  SER A CA  1 
ATOM   2084 C  C   . SER A 1 252 ? -32.835 18.899 -5.478  1.00 25.29 ? 268  SER A C   1 
ATOM   2085 O  O   . SER A 1 252 ? -33.564 17.914 -5.365  1.00 25.49 ? 268  SER A O   1 
ATOM   2086 C  CB  . SER A 1 252 ? -31.639 18.744 -7.681  1.00 25.20 ? 268  SER A CB  1 
ATOM   2087 O  OG  . SER A 1 252 ? -30.358 18.751 -7.086  1.00 26.61 ? 268  SER A OG  1 
ATOM   2088 N  N   . GLU A 1 253 ? -32.206 19.456 -4.444  1.00 25.40 ? 269  GLU A N   1 
ATOM   2089 C  CA  . GLU A 1 253 ? -32.295 18.889 -3.094  1.00 26.04 ? 269  GLU A CA  1 
ATOM   2090 C  C   . GLU A 1 253 ? -33.692 19.019 -2.464  1.00 25.91 ? 269  GLU A C   1 
ATOM   2091 O  O   . GLU A 1 253 ? -34.003 18.321 -1.503  1.00 26.08 ? 269  GLU A O   1 
ATOM   2092 C  CB  . GLU A 1 253 ? -31.219 19.477 -2.165  1.00 26.13 ? 269  GLU A CB  1 
ATOM   2093 C  CG  . GLU A 1 253 ? -29.776 19.110 -2.537  1.00 28.02 ? 269  GLU A CG  1 
ATOM   2094 C  CD  . GLU A 1 253 ? -29.461 17.628 -2.351  1.00 30.67 ? 269  GLU A CD  1 
ATOM   2095 O  OE1 . GLU A 1 253 ? -29.958 17.021 -1.382  1.00 32.34 ? 269  GLU A OE1 1 
ATOM   2096 O  OE2 . GLU A 1 253 ? -28.718 17.068 -3.183  1.00 32.98 ? 269  GLU A OE2 1 
ATOM   2097 N  N   . ILE A 1 254 ? -34.525 19.908 -3.005  1.00 25.71 ? 270  ILE A N   1 
ATOM   2098 C  CA  . ILE A 1 254 ? -35.907 20.053 -2.526  1.00 25.76 ? 270  ILE A CA  1 
ATOM   2099 C  C   . ILE A 1 254 ? -36.933 19.400 -3.462  1.00 25.94 ? 270  ILE A C   1 
ATOM   2100 O  O   . ILE A 1 254 ? -38.139 19.620 -3.320  1.00 25.91 ? 270  ILE A O   1 
ATOM   2101 C  CB  . ILE A 1 254 ? -36.293 21.539 -2.230  1.00 25.51 ? 270  ILE A CB  1 
ATOM   2102 C  CG1 . ILE A 1 254 ? -36.324 22.377 -3.517  1.00 25.28 ? 270  ILE A CG1 1 
ATOM   2103 C  CG2 . ILE A 1 254 ? -35.357 22.143 -1.181  1.00 25.37 ? 270  ILE A CG2 1 
ATOM   2104 C  CD1 . ILE A 1 254 ? -37.171 23.640 -3.421  1.00 25.27 ? 270  ILE A CD1 1 
ATOM   2105 N  N   . ALA A 1 255 ? -36.454 18.586 -4.403  1.00 26.16 ? 271  ALA A N   1 
ATOM   2106 C  CA  . ALA A 1 255 ? -37.332 17.905 -5.362  1.00 26.59 ? 271  ALA A CA  1 
ATOM   2107 C  C   . ALA A 1 255 ? -38.444 17.091 -4.697  1.00 27.10 ? 271  ALA A C   1 
ATOM   2108 O  O   . ALA A 1 255 ? -39.549 17.008 -5.225  1.00 27.11 ? 271  ALA A O   1 
ATOM   2109 C  CB  . ALA A 1 255 ? -36.525 17.028 -6.307  1.00 26.70 ? 271  ALA A CB  1 
ATOM   2110 N  N   . ASP A 1 256 ? -38.148 16.503 -3.539  1.00 27.63 ? 272  ASP A N   1 
ATOM   2111 C  CA  . ASP A 1 256 ? -39.116 15.669 -2.819  1.00 28.50 ? 272  ASP A CA  1 
ATOM   2112 C  C   . ASP A 1 256 ? -40.356 16.429 -2.337  1.00 28.46 ? 272  ASP A C   1 
ATOM   2113 O  O   . ASP A 1 256 ? -41.395 15.819 -2.076  1.00 28.85 ? 272  ASP A O   1 
ATOM   2114 C  CB  . ASP A 1 256 ? -38.445 14.947 -1.644  1.00 28.92 ? 272  ASP A CB  1 
ATOM   2115 C  CG  . ASP A 1 256 ? -37.964 15.903 -0.569  1.00 29.76 ? 272  ASP A CG  1 
ATOM   2116 O  OD1 . ASP A 1 256 ? -37.029 16.685 -0.837  1.00 30.61 ? 272  ASP A OD1 1 
ATOM   2117 O  OD2 . ASP A 1 256 ? -38.525 15.871 0.546   1.00 31.23 ? 272  ASP A OD2 1 
ATOM   2118 N  N   . ILE A 1 257 ? -40.249 17.751 -2.218  1.00 28.12 ? 273  ILE A N   1 
ATOM   2119 C  CA  . ILE A 1 257 ? -41.395 18.566 -1.793  1.00 28.28 ? 273  ILE A CA  1 
ATOM   2120 C  C   . ILE A 1 257 ? -41.987 19.447 -2.904  1.00 27.90 ? 273  ILE A C   1 
ATOM   2121 O  O   . ILE A 1 257 ? -43.031 20.070 -2.709  1.00 28.05 ? 273  ILE A O   1 
ATOM   2122 C  CB  . ILE A 1 257 ? -41.098 19.402 -0.507  1.00 28.36 ? 273  ILE A CB  1 
ATOM   2123 C  CG1 . ILE A 1 257 ? -39.898 20.336 -0.711  1.00 28.23 ? 273  ILE A CG1 1 
ATOM   2124 C  CG2 . ILE A 1 257 ? -40.899 18.473 0.699   1.00 28.90 ? 273  ILE A CG2 1 
ATOM   2125 C  CD1 . ILE A 1 257 ? -39.712 21.378 0.387   1.00 29.04 ? 273  ILE A CD1 1 
ATOM   2126 N  N   . VAL A 1 258 ? -41.333 19.487 -4.065  1.00 27.57 ? 274  VAL A N   1 
ATOM   2127 C  CA  . VAL A 1 258 ? -41.826 20.293 -5.195  1.00 27.40 ? 274  VAL A CA  1 
ATOM   2128 C  C   . VAL A 1 258 ? -42.082 19.485 -6.476  1.00 27.66 ? 274  VAL A C   1 
ATOM   2129 O  O   . VAL A 1 258 ? -42.429 20.060 -7.514  1.00 27.72 ? 274  VAL A O   1 
ATOM   2130 C  CB  . VAL A 1 258 ? -40.905 21.519 -5.512  1.00 27.05 ? 274  VAL A CB  1 
ATOM   2131 C  CG1 . VAL A 1 258 ? -40.786 22.445 -4.304  1.00 26.53 ? 274  VAL A CG1 1 
ATOM   2132 C  CG2 . VAL A 1 258 ? -39.524 21.070 -6.001  1.00 26.74 ? 274  VAL A CG2 1 
ATOM   2133 N  N   . SER A 1 259 ? -41.926 18.163 -6.400  1.00 27.97 ? 275  SER A N   1 
ATOM   2134 C  CA  . SER A 1 259 ? -42.098 17.297 -7.572  1.00 28.49 ? 275  SER A CA  1 
ATOM   2135 C  C   . SER A 1 259 ? -43.534 17.340 -8.101  1.00 28.62 ? 275  SER A C   1 
ATOM   2136 O  O   . SER A 1 259 ? -44.485 17.264 -7.320  1.00 28.82 ? 275  SER A O   1 
ATOM   2137 C  CB  . SER A 1 259 ? -41.677 15.853 -7.274  1.00 28.73 ? 275  SER A CB  1 
ATOM   2138 O  OG  . SER A 1 259 ? -42.552 15.245 -6.341  1.00 30.31 ? 275  SER A OG  1 
ATOM   2139 N  N   . PRO A 1 260 ? -43.689 17.475 -9.432  1.00 28.63 ? 276  PRO A N   1 
ATOM   2140 C  CA  . PRO A 1 260 ? -44.989 17.509 -10.098 1.00 28.87 ? 276  PRO A CA  1 
ATOM   2141 C  C   . PRO A 1 260 ? -45.942 16.399 -9.646  1.00 29.34 ? 276  PRO A C   1 
ATOM   2142 O  O   . PRO A 1 260 ? -47.106 16.676 -9.352  1.00 29.35 ? 276  PRO A O   1 
ATOM   2143 C  CB  . PRO A 1 260 ? -44.616 17.330 -11.568 1.00 29.06 ? 276  PRO A CB  1 
ATOM   2144 C  CG  . PRO A 1 260 ? -43.298 18.007 -11.677 1.00 28.65 ? 276  PRO A CG  1 
ATOM   2145 C  CD  . PRO A 1 260 ? -42.586 17.693 -10.389 1.00 28.43 ? 276  PRO A CD  1 
ATOM   2146 N  N   . PHE A 1 261 ? -45.444 15.167 -9.571  1.00 29.57 ? 277  PHE A N   1 
ATOM   2147 C  CA  . PHE A 1 261 ? -46.261 14.017 -9.188  1.00 30.16 ? 277  PHE A CA  1 
ATOM   2148 C  C   . PHE A 1 261 ? -45.648 13.255 -8.009  1.00 30.44 ? 277  PHE A C   1 
ATOM   2149 O  O   . PHE A 1 261 ? -44.893 12.299 -8.206  1.00 30.51 ? 277  PHE A O   1 
ATOM   2150 C  CB  . PHE A 1 261 ? -46.495 13.096 -10.392 1.00 30.38 ? 277  PHE A CB  1 
ATOM   2151 C  CG  . PHE A 1 261 ? -47.142 13.785 -11.563 1.00 30.54 ? 277  PHE A CG  1 
ATOM   2152 C  CD1 . PHE A 1 261 ? -48.521 13.979 -11.600 1.00 30.97 ? 277  PHE A CD1 1 
ATOM   2153 C  CD2 . PHE A 1 261 ? -46.372 14.254 -12.623 1.00 30.18 ? 277  PHE A CD2 1 
ATOM   2154 C  CE1 . PHE A 1 261 ? -49.125 14.624 -12.678 1.00 31.00 ? 277  PHE A CE1 1 
ATOM   2155 C  CE2 . PHE A 1 261 ? -46.964 14.898 -13.706 1.00 30.48 ? 277  PHE A CE2 1 
ATOM   2156 C  CZ  . PHE A 1 261 ? -48.344 15.083 -13.733 1.00 30.96 ? 277  PHE A CZ  1 
ATOM   2157 N  N   . PRO A 1 262 ? -45.981 13.679 -6.773  1.00 30.67 ? 278  PRO A N   1 
ATOM   2158 C  CA  . PRO A 1 262 ? -45.403 13.127 -5.541  1.00 31.09 ? 278  PRO A CA  1 
ATOM   2159 C  C   . PRO A 1 262 ? -45.706 11.647 -5.303  1.00 31.84 ? 278  PRO A C   1 
ATOM   2160 O  O   . PRO A 1 262 ? -44.968 10.985 -4.573  1.00 32.13 ? 278  PRO A O   1 
ATOM   2161 C  CB  . PRO A 1 262 ? -46.045 13.979 -4.437  1.00 30.94 ? 278  PRO A CB  1 
ATOM   2162 C  CG  . PRO A 1 262 ? -46.494 15.219 -5.117  1.00 30.62 ? 278  PRO A CG  1 
ATOM   2163 C  CD  . PRO A 1 262 ? -46.920 14.776 -6.481  1.00 30.62 ? 278  PRO A CD  1 
ATOM   2164 N  N   . GLU A 1 263 ? -46.776 11.137 -5.910  1.00 32.56 ? 279  GLU A N   1 
ATOM   2165 C  CA  . GLU A 1 263 ? -47.147 9.726  -5.775  1.00 33.44 ? 279  GLU A CA  1 
ATOM   2166 C  C   . GLU A 1 263 ? -46.399 8.831  -6.769  1.00 33.86 ? 279  GLU A C   1 
ATOM   2167 O  O   . GLU A 1 263 ? -46.438 7.602  -6.659  1.00 34.38 ? 279  GLU A O   1 
ATOM   2168 C  CB  . GLU A 1 263 ? -48.662 9.549  -5.924  1.00 33.76 ? 279  GLU A CB  1 
ATOM   2169 C  CG  . GLU A 1 263 ? -49.475 10.133 -4.773  0.50 33.93 ? 279  GLU A CG  1 
ATOM   2170 C  CD  . GLU A 1 263 ? -50.977 10.007 -4.976  0.50 34.66 ? 279  GLU A CD  1 
ATOM   2171 O  OE1 . GLU A 1 263 ? -51.422 9.084  -5.693  0.50 35.21 ? 279  GLU A OE1 1 
ATOM   2172 O  OE2 . GLU A 1 263 ? -51.719 10.839 -4.412  0.50 34.81 ? 279  GLU A OE2 1 
ATOM   2173 N  N   . LYS A 1 264 ? -45.724 9.455  -7.732  1.00 33.75 ? 280  LYS A N   1 
ATOM   2174 C  CA  . LYS A 1 264 ? -44.944 8.736  -8.739  1.00 34.09 ? 280  LYS A CA  1 
ATOM   2175 C  C   . LYS A 1 264 ? -43.447 8.815  -8.427  1.00 33.86 ? 280  LYS A C   1 
ATOM   2176 O  O   . LYS A 1 264 ? -43.023 9.701  -7.679  1.00 33.47 ? 280  LYS A O   1 
ATOM   2177 C  CB  . LYS A 1 264 ? -45.251 9.275  -10.144 1.00 34.08 ? 280  LYS A CB  1 
ATOM   2178 C  CG  . LYS A 1 264 ? -46.655 8.940  -10.648 1.00 34.97 ? 280  LYS A CG  1 
ATOM   2179 C  CD  . LYS A 1 264 ? -46.865 7.432  -10.818 1.00 36.25 ? 280  LYS A CD  1 
ATOM   2180 C  CE  . LYS A 1 264 ? -48.308 7.097  -11.177 1.00 37.22 ? 280  LYS A CE  1 
ATOM   2181 N  NZ  . LYS A 1 264 ? -48.648 7.484  -12.578 1.00 37.66 ? 280  LYS A NZ  1 
ATOM   2182 N  N   . PRO A 1 265 ? -42.643 7.885  -8.989  1.00 34.12 ? 281  PRO A N   1 
ATOM   2183 C  CA  . PRO A 1 265 ? -41.220 7.794  -8.649  1.00 34.03 ? 281  PRO A CA  1 
ATOM   2184 C  C   . PRO A 1 265 ? -40.407 9.063  -8.902  1.00 33.58 ? 281  PRO A C   1 
ATOM   2185 O  O   . PRO A 1 265 ? -40.584 9.743  -9.920  1.00 33.32 ? 281  PRO A O   1 
ATOM   2186 C  CB  . PRO A 1 265 ? -40.707 6.652  -9.542  1.00 34.39 ? 281  PRO A CB  1 
ATOM   2187 C  CG  . PRO A 1 265 ? -41.749 6.466  -10.585 1.00 34.80 ? 281  PRO A CG  1 
ATOM   2188 C  CD  . PRO A 1 265 ? -43.038 6.813  -9.920  1.00 34.57 ? 281  PRO A CD  1 
ATOM   2189 N  N   . LEU A 1 266 ? -39.531 9.368  -7.952  1.00 33.38 ? 282  LEU A N   1 
ATOM   2190 C  CA  . LEU A 1 266 ? -38.559 10.439 -8.090  1.00 32.89 ? 282  LEU A CA  1 
ATOM   2191 C  C   . LEU A 1 266 ? -37.176 9.845  -7.850  1.00 32.81 ? 282  LEU A C   1 
ATOM   2192 O  O   . LEU A 1 266 ? -36.920 9.256  -6.796  1.00 32.92 ? 282  LEU A O   1 
ATOM   2193 C  CB  . LEU A 1 266 ? -38.857 11.562 -7.095  1.00 32.70 ? 282  LEU A CB  1 
ATOM   2194 C  CG  . LEU A 1 266 ? -37.957 12.800 -7.101  1.00 32.52 ? 282  LEU A CG  1 
ATOM   2195 C  CD1 . LEU A 1 266 ? -38.148 13.633 -8.371  1.00 32.21 ? 282  LEU A CD1 1 
ATOM   2196 C  CD2 . LEU A 1 266 ? -38.244 13.629 -5.863  1.00 32.68 ? 282  LEU A CD2 1 
ATOM   2197 N  N   . VAL A 1 267 ? -36.297 9.989  -8.838  1.00 32.50 ? 283  VAL A N   1 
ATOM   2198 C  CA  . VAL A 1 267 ? -34.983 9.348  -8.800  1.00 32.49 ? 283  VAL A CA  1 
ATOM   2199 C  C   . VAL A 1 267 ? -34.067 9.977  -7.747  1.00 32.19 ? 283  VAL A C   1 
ATOM   2200 O  O   . VAL A 1 267 ? -33.716 11.158 -7.832  1.00 31.71 ? 283  VAL A O   1 
ATOM   2201 C  CB  . VAL A 1 267 ? -34.294 9.348  -10.192 1.00 32.47 ? 283  VAL A CB  1 
ATOM   2202 C  CG1 . VAL A 1 267 ? -32.916 8.721  -10.103 1.00 32.44 ? 283  VAL A CG1 1 
ATOM   2203 C  CG2 . VAL A 1 267 ? -35.145 8.602  -11.215 1.00 32.76 ? 283  VAL A CG2 1 
ATOM   2204 N  N   . ASP A 1 268 ? -33.710 9.167  -6.754  1.00 32.33 ? 284  ASP A N   1 
ATOM   2205 C  CA  . ASP A 1 268 ? -32.770 9.541  -5.701  1.00 32.26 ? 284  ASP A CA  1 
ATOM   2206 C  C   . ASP A 1 268 ? -32.036 8.271  -5.256  1.00 32.48 ? 284  ASP A C   1 
ATOM   2207 O  O   . ASP A 1 268 ? -32.497 7.553  -4.365  1.00 32.64 ? 284  ASP A O   1 
ATOM   2208 C  CB  . ASP A 1 268 ? -33.508 10.194 -4.525  1.00 32.35 ? 284  ASP A CB  1 
ATOM   2209 C  CG  . ASP A 1 268 ? -32.568 10.858 -3.528  1.00 32.79 ? 284  ASP A CG  1 
ATOM   2210 O  OD1 . ASP A 1 268 ? -31.389 10.452 -3.424  1.00 33.42 ? 284  ASP A OD1 1 
ATOM   2211 O  OD2 . ASP A 1 268 ? -33.017 11.798 -2.842  1.00 34.15 ? 284  ASP A OD2 1 
ATOM   2212 N  N   . VAL A 1 269 ? -30.892 8.008  -5.886  1.00 32.28 ? 285  VAL A N   1 
ATOM   2213 C  CA  . VAL A 1 269 ? -30.191 6.727  -5.732  1.00 32.50 ? 285  VAL A CA  1 
ATOM   2214 C  C   . VAL A 1 269 ? -29.174 6.688  -4.585  1.00 32.45 ? 285  VAL A C   1 
ATOM   2215 O  O   . VAL A 1 269 ? -28.510 5.671  -4.379  1.00 32.65 ? 285  VAL A O   1 
ATOM   2216 C  CB  . VAL A 1 269 ? -29.520 6.267  -7.061  1.00 32.68 ? 285  VAL A CB  1 
ATOM   2217 C  CG1 . VAL A 1 269 ? -30.558 6.138  -8.173  1.00 32.69 ? 285  VAL A CG1 1 
ATOM   2218 C  CG2 . VAL A 1 269 ? -28.389 7.213  -7.472  1.00 32.20 ? 285  VAL A CG2 1 
ATOM   2219 N  N   . SER A 1 270 ? -29.070 7.788  -3.839  1.00 32.10 ? 286  SER A N   1 
ATOM   2220 C  CA  . SER A 1 270 ? -28.117 7.903  -2.729  1.00 32.18 ? 286  SER A CA  1 
ATOM   2221 C  C   . SER A 1 270 ? -28.247 6.772  -1.710  1.00 32.70 ? 286  SER A C   1 
ATOM   2222 O  O   . SER A 1 270 ? -27.242 6.201  -1.283  1.00 32.96 ? 286  SER A O   1 
ATOM   2223 C  CB  . SER A 1 270 ? -28.260 9.256  -2.031  1.00 31.85 ? 286  SER A CB  1 
ATOM   2224 O  OG  . SER A 1 270 ? -27.968 10.322 -2.917  1.00 31.64 ? 286  SER A OG  1 
ATOM   2225 N  N   . ALA A 1 271 ? -29.487 6.450  -1.338  1.00 32.86 ? 287  ALA A N   1 
ATOM   2226 C  CA  . ALA A 1 271 ? -29.769 5.378  -0.381  1.00 33.34 ? 287  ALA A CA  1 
ATOM   2227 C  C   . ALA A 1 271 ? -29.354 4.000  -0.903  1.00 33.82 ? 287  ALA A C   1 
ATOM   2228 O  O   . ALA A 1 271 ? -28.826 3.184  -0.148  1.00 34.13 ? 287  ALA A O   1 
ATOM   2229 C  CB  . ALA A 1 271 ? -31.246 5.389  0.016   1.00 33.32 ? 287  ALA A CB  1 
ATOM   2230 N  N   . GLU A 1 272 ? -29.587 3.753  -2.193  1.00 33.96 ? 288  GLU A N   1 
ATOM   2231 C  CA  . GLU A 1 272 ? -29.195 2.491  -2.828  1.00 34.73 ? 288  GLU A CA  1 
ATOM   2232 C  C   . GLU A 1 272 ? -27.682 2.359  -3.002  1.00 35.01 ? 288  GLU A C   1 
ATOM   2233 O  O   . GLU A 1 272 ? -27.145 1.251  -2.954  1.00 35.34 ? 288  GLU A O   1 
ATOM   2234 C  CB  . GLU A 1 272 ? -29.902 2.299  -4.175  1.00 34.69 ? 288  GLU A CB  1 
ATOM   2235 C  CG  . GLU A 1 272 ? -31.325 1.747  -4.070  1.00 35.55 ? 288  GLU A CG  1 
ATOM   2236 C  CD  . GLU A 1 272 ? -31.394 0.329  -3.499  1.00 36.91 ? 288  GLU A CD  1 
ATOM   2237 O  OE1 . GLU A 1 272 ? -30.423 -0.446 -3.650  1.00 37.50 ? 288  GLU A OE1 1 
ATOM   2238 O  OE2 . GLU A 1 272 ? -32.429 -0.008 -2.893  1.00 37.87 ? 288  GLU A OE2 1 
ATOM   2239 N  N   . MET A 1 273 ? -27.008 3.490  -3.209  1.00 34.69 ? 289  MET A N   1 
ATOM   2240 C  CA  . MET A 1 273 ? -25.548 3.523  -3.263  1.00 35.01 ? 289  MET A CA  1 
ATOM   2241 C  C   . MET A 1 273 ? -24.957 3.068  -1.926  1.00 35.82 ? 289  MET A C   1 
ATOM   2242 O  O   . MET A 1 273 ? -24.068 2.216  -1.895  1.00 36.38 ? 289  MET A O   1 
ATOM   2243 C  CB  . MET A 1 273 ? -25.048 4.928  -3.622  1.00 34.21 ? 289  MET A CB  1 
ATOM   2244 C  CG  . MET A 1 273 ? -25.331 5.356  -5.056  1.00 33.17 ? 289  MET A CG  1 
ATOM   2245 S  SD  . MET A 1 273 ? -24.904 7.083  -5.380  1.00 31.71 ? 289  MET A SD  1 
ATOM   2246 C  CE  . MET A 1 273 ? -23.113 6.997  -5.429  1.00 31.38 ? 289  MET A CE  1 
ATOM   2247 N  N   . GLU A 1 274 ? -25.472 3.628  -0.832  1.00 36.32 ? 290  GLU A N   1 
ATOM   2248 C  CA  . GLU A 1 274 ? -25.043 3.262  0.522   1.00 37.36 ? 290  GLU A CA  1 
ATOM   2249 C  C   . GLU A 1 274 ? -25.347 1.799  0.845   1.00 38.03 ? 290  GLU A C   1 
ATOM   2250 O  O   . GLU A 1 274 ? -24.500 1.094  1.399   1.00 38.53 ? 290  GLU A O   1 
ATOM   2251 C  CB  . GLU A 1 274 ? -25.695 4.172  1.567   1.00 37.28 ? 290  GLU A CB  1 
ATOM   2252 C  CG  . GLU A 1 274 ? -25.144 5.593  1.608   1.00 38.43 ? 290  GLU A CG  1 
ATOM   2253 C  CD  . GLU A 1 274 ? -25.700 6.402  2.771   1.00 40.54 ? 290  GLU A CD  1 
ATOM   2254 O  OE1 . GLU A 1 274 ? -25.543 5.969  3.935   1.00 42.35 ? 290  GLU A OE1 1 
ATOM   2255 O  OE2 . GLU A 1 274 ? -26.303 7.468  2.523   1.00 41.12 ? 290  GLU A OE2 1 
ATOM   2256 N  N   . LYS A 1 275 ? -26.552 1.356  0.487   1.00 38.19 ? 291  LYS A N   1 
ATOM   2257 C  CA  . LYS A 1 275 ? -26.992 -0.024 0.711   1.00 38.90 ? 291  LYS A CA  1 
ATOM   2258 C  C   . LYS A 1 275 ? -26.099 -1.038 -0.012  1.00 39.09 ? 291  LYS A C   1 
ATOM   2259 O  O   . LYS A 1 275 ? -25.802 -2.105 0.529   1.00 39.75 ? 291  LYS A O   1 
ATOM   2260 C  CB  . LYS A 1 275 ? -28.458 -0.196 0.290   1.00 38.98 ? 291  LYS A CB  1 
ATOM   2261 C  CG  . LYS A 1 275 ? -29.089 -1.516 0.723   1.00 40.42 ? 291  LYS A CG  1 
ATOM   2262 C  CD  . LYS A 1 275 ? -30.559 -1.593 0.333   1.00 41.52 ? 291  LYS A CD  1 
ATOM   2263 C  CE  . LYS A 1 275 ? -31.126 -2.980 0.617   1.00 42.73 ? 291  LYS A CE  1 
ATOM   2264 N  NZ  . LYS A 1 275 ? -32.584 -3.063 0.318   1.00 43.38 ? 291  LYS A NZ  1 
ATOM   2265 N  N   . GLN A 1 276 ? -25.664 -0.691 -1.222  1.00 38.46 ? 292  GLN A N   1 
ATOM   2266 C  CA  . GLN A 1 276 ? -24.795 -1.562 -2.015  1.00 38.50 ? 292  GLN A CA  1 
ATOM   2267 C  C   . GLN A 1 276 ? -23.308 -1.420 -1.665  1.00 38.07 ? 292  GLN A C   1 
ATOM   2268 O  O   . GLN A 1 276 ? -22.453 -2.038 -2.302  1.00 38.34 ? 292  GLN A O   1 
ATOM   2269 C  CB  . GLN A 1 276 ? -25.026 -1.334 -3.513  1.00 38.40 ? 292  GLN A CB  1 
ATOM   2270 C  CG  . GLN A 1 276 ? -26.360 -1.879 -4.014  1.00 39.30 ? 292  GLN A CG  1 
ATOM   2271 C  CD  . GLN A 1 276 ? -26.601 -1.608 -5.487  1.00 39.70 ? 292  GLN A CD  1 
ATOM   2272 O  OE1 . GLN A 1 276 ? -25.697 -1.727 -6.316  1.00 40.08 ? 292  GLN A OE1 1 
ATOM   2273 N  NE2 . GLN A 1 276 ? -27.834 -1.244 -5.820  1.00 40.26 ? 292  GLN A NE2 1 
ATOM   2274 N  N   . GLY A 1 277 ? -23.011 -0.610 -0.651  1.00 37.26 ? 293  GLY A N   1 
ATOM   2275 C  CA  . GLY A 1 277 ? -21.649 -0.469 -0.136  1.00 36.62 ? 293  GLY A CA  1 
ATOM   2276 C  C   . GLY A 1 277 ? -20.703 0.305  -1.035  1.00 35.78 ? 293  GLY A C   1 
ATOM   2277 O  O   . GLY A 1 277 ? -19.502 0.029  -1.060  1.00 35.81 ? 293  GLY A O   1 
ATOM   2278 N  N   . TYR A 1 278 ? -21.248 1.273  -1.772  1.00 34.68 ? 294  TYR A N   1 
ATOM   2279 C  CA  . TYR A 1 278 ? -20.455 2.155  -2.626  1.00 33.88 ? 294  TYR A CA  1 
ATOM   2280 C  C   . TYR A 1 278 ? -19.417 2.923  -1.814  1.00 33.33 ? 294  TYR A C   1 
ATOM   2281 O  O   . TYR A 1 278 ? -19.672 3.325  -0.677  1.00 33.04 ? 294  TYR A O   1 
ATOM   2282 C  CB  . TYR A 1 278 ? -21.361 3.155  -3.352  1.00 33.42 ? 294  TYR A CB  1 
ATOM   2283 C  CG  . TYR A 1 278 ? -21.885 2.709  -4.702  1.00 33.91 ? 294  TYR A CG  1 
ATOM   2284 C  CD1 . TYR A 1 278 ? -22.532 1.482  -4.862  1.00 35.04 ? 294  TYR A CD1 1 
ATOM   2285 C  CD2 . TYR A 1 278 ? -21.741 3.529  -5.821  1.00 34.46 ? 294  TYR A CD2 1 
ATOM   2286 C  CE1 . TYR A 1 278 ? -23.015 1.081  -6.107  1.00 35.62 ? 294  TYR A CE1 1 
ATOM   2287 C  CE2 . TYR A 1 278 ? -22.225 3.142  -7.063  1.00 34.78 ? 294  TYR A CE2 1 
ATOM   2288 C  CZ  . TYR A 1 278 ? -22.857 1.918  -7.203  1.00 35.56 ? 294  TYR A CZ  1 
ATOM   2289 O  OH  . TYR A 1 278 ? -23.330 1.537  -8.439  1.00 36.05 ? 294  TYR A OH  1 
ATOM   2290 N  N   . THR A 1 279 ? -18.244 3.108  -2.413  1.00 32.83 ? 295  THR A N   1 
ATOM   2291 C  CA  . THR A 1 279 ? -17.169 3.900  -1.828  1.00 32.34 ? 295  THR A CA  1 
ATOM   2292 C  C   . THR A 1 279 ? -16.744 4.971  -2.838  1.00 31.69 ? 295  THR A C   1 
ATOM   2293 O  O   . THR A 1 279 ? -17.070 4.859  -4.024  1.00 31.37 ? 295  THR A O   1 
ATOM   2294 C  CB  . THR A 1 279 ? -15.944 3.023  -1.480  1.00 32.85 ? 295  THR A CB  1 
ATOM   2295 O  OG1 . THR A 1 279 ? -15.480 2.360  -2.662  1.00 32.71 ? 295  THR A OG1 1 
ATOM   2296 C  CG2 . THR A 1 279 ? -16.291 1.984  -0.409  1.00 33.32 ? 295  THR A CG2 1 
ATOM   2297 N  N   . PRO A 1 280 ? -16.023 6.015  -2.380  1.00 31.32 ? 296  PRO A N   1 
ATOM   2298 C  CA  . PRO A 1 280 ? -15.455 6.966  -3.336  1.00 30.89 ? 296  PRO A CA  1 
ATOM   2299 C  C   . PRO A 1 280 ? -14.609 6.287  -4.418  1.00 31.03 ? 296  PRO A C   1 
ATOM   2300 O  O   . PRO A 1 280 ? -14.699 6.668  -5.584  1.00 30.84 ? 296  PRO A O   1 
ATOM   2301 C  CB  . PRO A 1 280 ? -14.592 7.865  -2.451  1.00 30.88 ? 296  PRO A CB  1 
ATOM   2302 C  CG  . PRO A 1 280 ? -15.322 7.883  -1.161  1.00 30.93 ? 296  PRO A CG  1 
ATOM   2303 C  CD  . PRO A 1 280 ? -15.846 6.478  -0.990  1.00 31.33 ? 296  PRO A CD  1 
ATOM   2304 N  N   . LEU A 1 281 ? -13.822 5.279  -4.037  1.00 31.41 ? 297  LEU A N   1 
ATOM   2305 C  CA  . LEU A 1 281 ? -13.000 4.532  -4.996  1.00 31.59 ? 297  LEU A CA  1 
ATOM   2306 C  C   . LEU A 1 281 ? -13.844 3.871  -6.088  1.00 31.42 ? 297  LEU A C   1 
ATOM   2307 O  O   . LEU A 1 281 ? -13.505 3.953  -7.267  1.00 31.23 ? 297  LEU A O   1 
ATOM   2308 C  CB  . LEU A 1 281 ? -12.114 3.495  -4.287  1.00 32.30 ? 297  LEU A CB  1 
ATOM   2309 C  CG  . LEU A 1 281 ? -11.134 2.676  -5.140  1.00 32.92 ? 297  LEU A CG  1 
ATOM   2310 C  CD1 . LEU A 1 281 ? -10.056 3.553  -5.770  1.00 33.01 ? 297  LEU A CD1 1 
ATOM   2311 C  CD2 . LEU A 1 281 ? -10.502 1.554  -4.319  1.00 34.07 ? 297  LEU A CD2 1 
ATOM   2312 N  N   . LYS A 1 282 ? -14.940 3.229  -5.686  1.00 31.51 ? 298  LYS A N   1 
ATOM   2313 C  CA  . LYS A 1 282 ? -15.866 2.591  -6.624  1.00 31.56 ? 298  LYS A CA  1 
ATOM   2314 C  C   . LYS A 1 282 ? -16.494 3.598  -7.595  1.00 30.70 ? 298  LYS A C   1 
ATOM   2315 O  O   . LYS A 1 282 ? -16.645 3.311  -8.784  1.00 30.64 ? 298  LYS A O   1 
ATOM   2316 C  CB  . LYS A 1 282 ? -16.959 1.825  -5.866  1.00 32.01 ? 298  LYS A CB  1 
ATOM   2317 C  CG  . LYS A 1 282 ? -17.971 1.090  -6.751  1.00 33.28 ? 298  LYS A CG  1 
ATOM   2318 C  CD  . LYS A 1 282 ? -17.303 0.026  -7.619  1.00 36.14 ? 298  LYS A CD  1 
ATOM   2319 C  CE  . LYS A 1 282 ? -18.331 -0.835 -8.341  1.00 37.73 ? 298  LYS A CE  1 
ATOM   2320 N  NZ  . LYS A 1 282 ? -17.677 -1.947 -9.092  1.00 38.86 ? 298  LYS A NZ  1 
ATOM   2321 N  N   . MET A 1 283 ? -16.853 4.770  -7.077  1.00 29.87 ? 299  MET A N   1 
ATOM   2322 C  CA  . MET A 1 283 ? -17.445 5.837  -7.886  1.00 29.16 ? 299  MET A CA  1 
ATOM   2323 C  C   . MET A 1 283 ? -16.488 6.315  -8.982  1.00 28.81 ? 299  MET A C   1 
ATOM   2324 O  O   . MET A 1 283 ? -16.890 6.479  -10.135 1.00 28.59 ? 299  MET A O   1 
ATOM   2325 C  CB  . MET A 1 283 ? -17.890 7.001  -6.994  1.00 28.61 ? 299  MET A CB  1 
ATOM   2326 C  CG  . MET A 1 283 ? -19.051 6.649  -6.060  1.00 28.79 ? 299  MET A CG  1 
ATOM   2327 S  SD  . MET A 1 283 ? -19.268 7.802  -4.690  1.00 28.65 ? 299  MET A SD  1 
ATOM   2328 C  CE  . MET A 1 283 ? -19.924 9.236  -5.542  1.00 27.69 ? 299  MET A CE  1 
ATOM   2329 N  N   . PHE A 1 284 ? -15.223 6.520  -8.622  1.00 28.83 ? 300  PHE A N   1 
ATOM   2330 C  CA  . PHE A 1 284 ? -14.206 6.914  -9.598  1.00 28.85 ? 300  PHE A CA  1 
ATOM   2331 C  C   . PHE A 1 284 ? -13.908 5.801  -10.599 1.00 29.25 ? 300  PHE A C   1 
ATOM   2332 O  O   . PHE A 1 284 ? -13.687 6.072  -11.780 1.00 29.24 ? 300  PHE A O   1 
ATOM   2333 C  CB  . PHE A 1 284 ? -12.929 7.393  -8.901  1.00 28.84 ? 300  PHE A CB  1 
ATOM   2334 C  CG  . PHE A 1 284 ? -12.991 8.825  -8.458  1.00 28.55 ? 300  PHE A CG  1 
ATOM   2335 C  CD1 . PHE A 1 284 ? -13.498 9.159  -7.206  1.00 28.30 ? 300  PHE A CD1 1 
ATOM   2336 C  CD2 . PHE A 1 284 ? -12.560 9.846  -9.302  1.00 28.30 ? 300  PHE A CD2 1 
ATOM   2337 C  CE1 . PHE A 1 284 ? -13.570 10.487 -6.796  1.00 28.02 ? 300  PHE A CE1 1 
ATOM   2338 C  CE2 . PHE A 1 284 ? -12.627 11.177 -8.900  1.00 27.95 ? 300  PHE A CE2 1 
ATOM   2339 C  CZ  . PHE A 1 284 ? -13.133 11.497 -7.643  1.00 27.89 ? 300  PHE A CZ  1 
ATOM   2340 N  N   . GLN A 1 285 ? -13.916 4.554  -10.125 1.00 29.76 ? 301  GLN A N   1 
ATOM   2341 C  CA  . GLN A 1 285 ? -13.730 3.387  -10.993 1.00 30.27 ? 301  GLN A CA  1 
ATOM   2342 C  C   . GLN A 1 285 ? -14.872 3.262  -12.003 1.00 30.23 ? 301  GLN A C   1 
ATOM   2343 O  O   . GLN A 1 285 ? -14.648 2.903  -13.160 1.00 30.27 ? 301  GLN A O   1 
ATOM   2344 C  CB  . GLN A 1 285 ? -13.601 2.101  -10.164 1.00 30.92 ? 301  GLN A CB  1 
ATOM   2345 C  CG  . GLN A 1 285 ? -12.251 1.936  -9.461  1.00 31.10 ? 301  GLN A CG  1 
ATOM   2346 C  CD  . GLN A 1 285 ? -12.242 0.817  -8.425  1.00 31.99 ? 301  GLN A CD  1 
ATOM   2347 O  OE1 . GLN A 1 285 ? -13.290 0.363  -7.967  1.00 32.17 ? 301  GLN A OE1 1 
ATOM   2348 N  NE2 . GLN A 1 285 ? -11.049 0.380  -8.044  1.00 32.63 ? 301  GLN A NE2 1 
ATOM   2349 N  N   . MET A 1 286 ? -16.090 3.567  -11.555 1.00 30.17 ? 302  MET A N   1 
ATOM   2350 C  CA  . MET A 1 286 ? -17.270 3.584  -12.422 1.00 30.37 ? 302  MET A CA  1 
ATOM   2351 C  C   . MET A 1 286 ? -17.215 4.717  -13.444 1.00 29.71 ? 302  MET A C   1 
ATOM   2352 O  O   . MET A 1 286 ? -17.651 4.553  -14.585 1.00 29.70 ? 302  MET A O   1 
ATOM   2353 C  CB  . MET A 1 286 ? -18.544 3.709  -11.590 1.00 30.47 ? 302  MET A CB  1 
ATOM   2354 C  CG  . MET A 1 286 ? -18.998 2.409  -10.952 1.00 32.48 ? 302  MET A CG  1 
ATOM   2355 S  SD  . MET A 1 286 ? -20.315 2.687  -9.756  1.00 36.19 ? 302  MET A SD  1 
ATOM   2356 C  CE  . MET A 1 286 ? -21.603 3.387  -10.795 1.00 34.96 ? 302  MET A CE  1 
ATOM   2357 N  N   . GLY A 1 287 ? -16.695 5.867  -13.022 1.00 29.28 ? 303  GLY A N   1 
ATOM   2358 C  CA  . GLY A 1 287 ? -16.470 6.991  -13.929 1.00 28.88 ? 303  GLY A CA  1 
ATOM   2359 C  C   . GLY A 1 287 ? -15.468 6.616  -15.005 1.00 29.15 ? 303  GLY A C   1 
ATOM   2360 O  O   . GLY A 1 287 ? -15.709 6.842  -16.193 1.00 28.91 ? 303  GLY A O   1 
ATOM   2361 N  N   . ASP A 1 288 ? -14.351 6.026  -14.578 1.00 29.54 ? 304  ASP A N   1 
ATOM   2362 C  CA  . ASP A 1 288 ? -13.311 5.529  -15.483 1.00 30.19 ? 304  ASP A CA  1 
ATOM   2363 C  C   . ASP A 1 288 ? -13.899 4.541  -16.492 1.00 30.68 ? 304  ASP A C   1 
ATOM   2364 O  O   . ASP A 1 288 ? -13.614 4.619  -17.686 1.00 30.90 ? 304  ASP A O   1 
ATOM   2365 C  CB  . ASP A 1 288 ? -12.182 4.867  -14.679 1.00 30.49 ? 304  ASP A CB  1 
ATOM   2366 C  CG  . ASP A 1 288 ? -10.977 4.489  -15.535 1.00 31.18 ? 304  ASP A CG  1 
ATOM   2367 O  OD1 . ASP A 1 288 ? -10.715 5.155  -16.563 1.00 30.54 ? 304  ASP A OD1 1 
ATOM   2368 O  OD2 . ASP A 1 288 ? -10.276 3.523  -15.159 1.00 32.21 ? 304  ASP A OD2 1 
ATOM   2369 N  N   . ASP A 1 289 ? -14.735 3.631  -15.994 1.00 31.16 ? 305  ASP A N   1 
ATOM   2370 C  CA  . ASP A 1 289 ? -15.442 2.655  -16.819 1.00 31.73 ? 305  ASP A CA  1 
ATOM   2371 C  C   . ASP A 1 289 ? -16.309 3.314  -17.895 1.00 31.26 ? 305  ASP A C   1 
ATOM   2372 O  O   . ASP A 1 289 ? -16.336 2.850  -19.035 1.00 31.45 ? 305  ASP A O   1 
ATOM   2373 C  CB  . ASP A 1 289 ? -16.284 1.730  -15.927 1.00 32.29 ? 305  ASP A CB  1 
ATOM   2374 C  CG  . ASP A 1 289 ? -17.205 0.810  -16.717 1.00 33.45 ? 305  ASP A CG  1 
ATOM   2375 O  OD1 . ASP A 1 289 ? -16.796 0.251  -17.758 1.00 34.57 ? 305  ASP A OD1 1 
ATOM   2376 O  OD2 . ASP A 1 289 ? -18.353 0.628  -16.274 1.00 35.36 ? 305  ASP A OD2 1 
ATOM   2377 N  N   . PHE A 1 290 ? -17.009 4.389  -17.533 1.00 30.64 ? 306  PHE A N   1 
ATOM   2378 C  CA  . PHE A 1 290 ? -17.868 5.096  -18.485 1.00 30.22 ? 306  PHE A CA  1 
ATOM   2379 C  C   . PHE A 1 290 ? -17.053 5.641  -19.660 1.00 30.19 ? 306  PHE A C   1 
ATOM   2380 O  O   . PHE A 1 290 ? -17.422 5.441  -20.818 1.00 30.32 ? 306  PHE A O   1 
ATOM   2381 C  CB  . PHE A 1 290 ? -18.647 6.230  -17.802 1.00 29.62 ? 306  PHE A CB  1 
ATOM   2382 C  CG  . PHE A 1 290 ? -19.947 6.576  -18.487 1.00 29.20 ? 306  PHE A CG  1 
ATOM   2383 C  CD1 . PHE A 1 290 ? -19.961 7.083  -19.787 1.00 28.50 ? 306  PHE A CD1 1 
ATOM   2384 C  CD2 . PHE A 1 290 ? -21.161 6.384  -17.835 1.00 28.74 ? 306  PHE A CD2 1 
ATOM   2385 C  CE1 . PHE A 1 290 ? -21.159 7.399  -20.420 1.00 28.61 ? 306  PHE A CE1 1 
ATOM   2386 C  CE2 . PHE A 1 290 ? -22.367 6.696  -18.464 1.00 28.63 ? 306  PHE A CE2 1 
ATOM   2387 C  CZ  . PHE A 1 290 ? -22.366 7.202  -19.756 1.00 28.40 ? 306  PHE A CZ  1 
ATOM   2388 N  N   . PHE A 1 291 ? -15.949 6.321  -19.354 1.00 30.03 ? 307  PHE A N   1 
ATOM   2389 C  CA  . PHE A 1 291 ? -15.059 6.859  -20.387 1.00 30.27 ? 307  PHE A CA  1 
ATOM   2390 C  C   . PHE A 1 291 ? -14.458 5.768  -21.274 1.00 30.98 ? 307  PHE A C   1 
ATOM   2391 O  O   . PHE A 1 291 ? -14.499 5.876  -22.502 1.00 31.30 ? 307  PHE A O   1 
ATOM   2392 C  CB  . PHE A 1 291 ? -13.955 7.725  -19.771 1.00 29.89 ? 307  PHE A CB  1 
ATOM   2393 C  CG  . PHE A 1 291 ? -14.413 9.102  -19.378 1.00 29.34 ? 307  PHE A CG  1 
ATOM   2394 C  CD1 . PHE A 1 291 ? -14.476 10.125 -20.322 1.00 28.96 ? 307  PHE A CD1 1 
ATOM   2395 C  CD2 . PHE A 1 291 ? -14.784 9.378  -18.067 1.00 28.95 ? 307  PHE A CD2 1 
ATOM   2396 C  CE1 . PHE A 1 291 ? -14.900 11.405 -19.964 1.00 28.09 ? 307  PHE A CE1 1 
ATOM   2397 C  CE2 . PHE A 1 291 ? -15.210 10.655 -17.699 1.00 28.28 ? 307  PHE A CE2 1 
ATOM   2398 C  CZ  . PHE A 1 291 ? -15.265 11.669 -18.648 1.00 27.89 ? 307  PHE A CZ  1 
ATOM   2399 N  N   . THR A 1 292 ? -13.918 4.716  -20.658 1.00 31.49 ? 308  THR A N   1 
ATOM   2400 C  CA  . THR A 1 292 ? -13.317 3.613  -21.420 1.00 32.27 ? 308  THR A CA  1 
ATOM   2401 C  C   . THR A 1 292 ? -14.345 2.880  -22.280 1.00 32.56 ? 308  THR A C   1 
ATOM   2402 O  O   . THR A 1 292 ? -14.015 2.405  -23.366 1.00 32.88 ? 308  THR A O   1 
ATOM   2403 C  CB  . THR A 1 292 ? -12.553 2.603  -20.525 1.00 32.70 ? 308  THR A CB  1 
ATOM   2404 O  OG1 . THR A 1 292 ? -13.437 2.045  -19.547 1.00 33.41 ? 308  THR A OG1 1 
ATOM   2405 C  CG2 . THR A 1 292 ? -11.398 3.280  -19.822 1.00 32.38 ? 308  THR A CG2 1 
ATOM   2406 N  N   . SER A 1 293 ? -15.587 2.804  -21.798 1.00 32.65 ? 309  SER A N   1 
ATOM   2407 C  CA  . SER A 1 293 ? -16.679 2.168  -22.544 1.00 33.02 ? 309  SER A CA  1 
ATOM   2408 C  C   . SER A 1 293 ? -16.983 2.900  -23.850 1.00 33.04 ? 309  SER A C   1 
ATOM   2409 O  O   . SER A 1 293 ? -17.500 2.306  -24.795 1.00 33.29 ? 309  SER A O   1 
ATOM   2410 C  CB  . SER A 1 293 ? -17.949 2.082  -21.691 1.00 33.06 ? 309  SER A CB  1 
ATOM   2411 O  OG  . SER A 1 293 ? -18.653 3.313  -21.683 1.00 32.12 ? 309  SER A OG  1 
ATOM   2412 N  N   . MET A 1 294 ? -16.659 4.190  -23.887 1.00 32.63 ? 310  MET A N   1 
ATOM   2413 C  CA  . MET A 1 294 ? -16.863 5.020  -25.070 1.00 32.81 ? 310  MET A CA  1 
ATOM   2414 C  C   . MET A 1 294 ? -15.626 5.040  -25.970 1.00 33.16 ? 310  MET A C   1 
ATOM   2415 O  O   . MET A 1 294 ? -15.524 5.872  -26.875 1.00 32.90 ? 310  MET A O   1 
ATOM   2416 C  CB  . MET A 1 294 ? -17.218 6.450  -24.657 1.00 32.17 ? 310  MET A CB  1 
ATOM   2417 C  CG  . MET A 1 294 ? -18.569 6.594  -23.979 1.00 32.53 ? 310  MET A CG  1 
ATOM   2418 S  SD  . MET A 1 294 ? -18.842 8.265  -23.366 1.00 33.46 ? 310  MET A SD  1 
ATOM   2419 C  CE  . MET A 1 294 ? -18.905 9.197  -24.895 1.00 33.04 ? 310  MET A CE  1 
ATOM   2420 N  N   . ASN A 1 295 ? -14.697 4.119  -25.712 1.00 33.82 ? 311  ASN A N   1 
ATOM   2421 C  CA  . ASN A 1 295 ? -13.421 4.034  -26.433 1.00 34.46 ? 311  ASN A CA  1 
ATOM   2422 C  C   . ASN A 1 295 ? -12.521 5.256  -26.182 1.00 33.83 ? 311  ASN A C   1 
ATOM   2423 O  O   . ASN A 1 295 ? -11.716 5.644  -27.031 1.00 33.88 ? 311  ASN A O   1 
ATOM   2424 C  CB  . ASN A 1 295 ? -13.652 3.779  -27.935 1.00 35.12 ? 311  ASN A CB  1 
ATOM   2425 C  CG  . ASN A 1 295 ? -12.392 3.331  -28.661 1.00 36.90 ? 311  ASN A CG  1 
ATOM   2426 O  OD1 . ASN A 1 295 ? -11.507 2.700  -28.074 1.00 37.52 ? 311  ASN A OD1 1 
ATOM   2427 N  ND2 . ASN A 1 295 ? -12.310 3.659  -29.953 1.00 39.02 ? 311  ASN A ND2 1 
ATOM   2428 N  N   . LEU A 1 296 ? -12.669 5.854  -25.003 1.00 33.21 ? 312  LEU A N   1 
ATOM   2429 C  CA  . LEU A 1 296 ? -11.809 6.958  -24.588 1.00 32.60 ? 312  LEU A CA  1 
ATOM   2430 C  C   . LEU A 1 296 ? -10.715 6.451  -23.647 1.00 32.74 ? 312  LEU A C   1 
ATOM   2431 O  O   . LEU A 1 296 ? -10.659 5.258  -23.341 1.00 33.22 ? 312  LEU A O   1 
ATOM   2432 C  CB  . LEU A 1 296 ? -12.633 8.096  -23.963 1.00 32.02 ? 312  LEU A CB  1 
ATOM   2433 C  CG  . LEU A 1 296 ? -13.570 8.869  -24.904 1.00 31.50 ? 312  LEU A CG  1 
ATOM   2434 C  CD1 . LEU A 1 296 ? -14.509 9.777  -24.120 1.00 30.98 ? 312  LEU A CD1 1 
ATOM   2435 C  CD2 . LEU A 1 296 ? -12.797 9.672  -25.950 1.00 31.38 ? 312  LEU A CD2 1 
ATOM   2436 N  N   . THR A 1 297 ? -9.850  7.356  -23.198 1.00 32.37 ? 313  THR A N   1 
ATOM   2437 C  CA  . THR A 1 297 ? -8.622  6.986  -22.491 1.00 32.50 ? 313  THR A CA  1 
ATOM   2438 C  C   . THR A 1 297 ? -8.854  6.608  -21.026 1.00 32.54 ? 313  THR A C   1 
ATOM   2439 O  O   . THR A 1 297 ? -9.543  7.322  -20.291 1.00 31.98 ? 313  THR A O   1 
ATOM   2440 C  CB  . THR A 1 297 ? -7.574  8.118  -22.587 1.00 32.23 ? 313  THR A CB  1 
ATOM   2441 O  OG1 . THR A 1 297 ? -7.503  8.580  -23.940 1.00 32.22 ? 313  THR A OG1 1 
ATOM   2442 C  CG2 . THR A 1 297 ? -6.194  7.634  -22.151 1.00 32.46 ? 313  THR A CG2 1 
ATOM   2443 N  N   . LYS A 1 298 ? -8.270  5.480  -20.618 1.00 32.95 ? 314  LYS A N   1 
ATOM   2444 C  CA  . LYS A 1 298 ? -8.321  5.026  -19.226 1.00 33.12 ? 314  LYS A CA  1 
ATOM   2445 C  C   . LYS A 1 298 ? -7.452  5.896  -18.323 1.00 32.63 ? 314  LYS A C   1 
ATOM   2446 O  O   . LYS A 1 298 ? -6.463  6.485  -18.771 1.00 32.50 ? 314  LYS A O   1 
ATOM   2447 C  CB  . LYS A 1 298 ? -7.910  3.547  -19.105 1.00 33.89 ? 314  LYS A CB  1 
ATOM   2448 C  CG  . LYS A 1 298 ? -6.451  3.245  -19.440 1.00 35.36 ? 314  LYS A CG  1 
ATOM   2449 C  CD  . LYS A 1 298 ? -6.112  1.779  -19.193 1.00 37.45 ? 314  LYS A CD  1 
ATOM   2450 C  CE  . LYS A 1 298 ? -4.694  1.463  -19.648 1.00 38.63 ? 314  LYS A CE  1 
ATOM   2451 N  NZ  . LYS A 1 298 ? -4.397  0.003  -19.567 1.00 40.32 ? 314  LYS A NZ  1 
ATOM   2452 N  N   . LEU A 1 299 ? -7.828  5.975  -17.052 1.00 32.20 ? 315  LEU A N   1 
ATOM   2453 C  CA  . LEU A 1 299 ? -7.046  6.720  -16.076 1.00 31.94 ? 315  LEU A CA  1 
ATOM   2454 C  C   . LEU A 1 299 ? -5.687  6.052  -15.853 1.00 32.49 ? 315  LEU A C   1 
ATOM   2455 O  O   . LEU A 1 299 ? -5.619  4.841  -15.636 1.00 32.77 ? 315  LEU A O   1 
ATOM   2456 C  CB  . LEU A 1 299 ? -7.813  6.863  -14.759 1.00 31.69 ? 315  LEU A CB  1 
ATOM   2457 C  CG  . LEU A 1 299 ? -9.109  7.682  -14.810 1.00 30.84 ? 315  LEU A CG  1 
ATOM   2458 C  CD1 . LEU A 1 299 ? -9.902  7.511  -13.531 1.00 30.78 ? 315  LEU A CD1 1 
ATOM   2459 C  CD2 . LEU A 1 299 ? -8.827  9.151  -15.067 1.00 29.99 ? 315  LEU A CD2 1 
ATOM   2460 N  N   . PRO A 1 300 ? -4.600  6.839  -15.931 1.00 32.52 ? 316  PRO A N   1 
ATOM   2461 C  CA  . PRO A 1 300 ? -3.253  6.311  -15.718 1.00 33.13 ? 316  PRO A CA  1 
ATOM   2462 C  C   . PRO A 1 300 ? -2.992  5.994  -14.247 1.00 33.58 ? 316  PRO A C   1 
ATOM   2463 O  O   . PRO A 1 300 ? -3.761  6.413  -13.375 1.00 33.24 ? 316  PRO A O   1 
ATOM   2464 C  CB  . PRO A 1 300 ? -2.351  7.456  -16.186 1.00 32.83 ? 316  PRO A CB  1 
ATOM   2465 C  CG  . PRO A 1 300 ? -3.176  8.681  -16.006 1.00 32.10 ? 316  PRO A CG  1 
ATOM   2466 C  CD  . PRO A 1 300 ? -4.582  8.270  -16.296 1.00 31.90 ? 316  PRO A CD  1 
ATOM   2467 N  N   . GLN A 1 301 ? -1.913  5.262  -13.982 1.00 34.23 ? 317  GLN A N   1 
ATOM   2468 C  CA  . GLN A 1 301 ? -1.587  4.821  -12.627 1.00 34.82 ? 317  GLN A CA  1 
ATOM   2469 C  C   . GLN A 1 301 ? -1.307  5.987  -11.675 1.00 34.34 ? 317  GLN A C   1 
ATOM   2470 O  O   . GLN A 1 301 ? -1.669  5.926  -10.498 1.00 34.19 ? 317  GLN A O   1 
ATOM   2471 C  CB  . GLN A 1 301 ? -0.415  3.830  -12.648 1.00 35.81 ? 317  GLN A CB  1 
ATOM   2472 C  CG  . GLN A 1 301 ? -0.322  2.920  -11.418 1.00 37.47 ? 317  GLN A CG  1 
ATOM   2473 C  CD  . GLN A 1 301 ? -1.618  2.174  -11.117 1.00 39.57 ? 317  GLN A CD  1 
ATOM   2474 O  OE1 . GLN A 1 301 ? -2.284  1.658  -12.017 1.00 40.76 ? 317  GLN A OE1 1 
ATOM   2475 N  NE2 . GLN A 1 301 ? -1.977  2.116  -9.841  1.00 40.21 ? 317  GLN A NE2 1 
ATOM   2476 N  N   . ASP A 1 302 ? -0.683  7.046  -12.196 1.00 33.85 ? 318  ASP A N   1 
ATOM   2477 C  CA  . ASP A 1 302 ? -0.432  8.269  -11.428 1.00 33.64 ? 318  ASP A CA  1 
ATOM   2478 C  C   . ASP A 1 302 ? -1.706  8.840  -10.797 1.00 32.89 ? 318  ASP A C   1 
ATOM   2479 O  O   . ASP A 1 302 ? -1.676  9.326  -9.662  1.00 32.84 ? 318  ASP A O   1 
ATOM   2480 C  CB  . ASP A 1 302 ? 0.234   9.340  -12.302 1.00 33.45 ? 318  ASP A CB  1 
ATOM   2481 C  CG  . ASP A 1 302 ? 1.753   9.210  -12.354 1.00 34.74 ? 318  ASP A CG  1 
ATOM   2482 O  OD1 . ASP A 1 302 ? 2.309   8.239  -11.797 1.00 36.11 ? 318  ASP A OD1 1 
ATOM   2483 O  OD2 . ASP A 1 302 ? 2.395   10.098 -12.958 1.00 35.47 ? 318  ASP A OD2 1 
ATOM   2484 N  N   . PHE A 1 303 ? -2.815  8.778  -11.534 1.00 32.35 ? 319  PHE A N   1 
ATOM   2485 C  CA  . PHE A 1 303 ? -4.106  9.245  -11.023 1.00 31.97 ? 319  PHE A CA  1 
ATOM   2486 C  C   . PHE A 1 303 ? -4.499  8.499  -9.750  1.00 32.11 ? 319  PHE A C   1 
ATOM   2487 O  O   . PHE A 1 303 ? -4.828  9.122  -8.740  1.00 31.96 ? 319  PHE A O   1 
ATOM   2488 C  CB  . PHE A 1 303 ? -5.215  9.118  -12.078 1.00 31.59 ? 319  PHE A CB  1 
ATOM   2489 C  CG  . PHE A 1 303 ? -6.569  9.572  -11.591 1.00 31.58 ? 319  PHE A CG  1 
ATOM   2490 C  CD1 . PHE A 1 303 ? -7.440  8.677  -10.971 1.00 31.84 ? 319  PHE A CD1 1 
ATOM   2491 C  CD2 . PHE A 1 303 ? -6.968  10.898 -11.740 1.00 31.04 ? 319  PHE A CD2 1 
ATOM   2492 C  CE1 . PHE A 1 303 ? -8.686  9.096  -10.509 1.00 31.49 ? 319  PHE A CE1 1 
ATOM   2493 C  CE2 . PHE A 1 303 ? -8.212  11.325 -11.286 1.00 30.63 ? 319  PHE A CE2 1 
ATOM   2494 C  CZ  . PHE A 1 303 ? -9.073  10.423 -10.668 1.00 31.10 ? 319  PHE A CZ  1 
ATOM   2495 N  N   . TRP A 1 304 ? -4.458  7.170  -9.803  1.00 32.49 ? 320  TRP A N   1 
ATOM   2496 C  CA  . TRP A 1 304 ? -4.845  6.350  -8.657  1.00 32.69 ? 320  TRP A CA  1 
ATOM   2497 C  C   . TRP A 1 304 ? -3.849  6.478  -7.506  1.00 33.11 ? 320  TRP A C   1 
ATOM   2498 O  O   . TRP A 1 304 ? -4.241  6.447  -6.338  1.00 33.17 ? 320  TRP A O   1 
ATOM   2499 C  CB  . TRP A 1 304 ? -5.007  4.885  -9.062  1.00 33.12 ? 320  TRP A CB  1 
ATOM   2500 C  CG  . TRP A 1 304 ? -6.031  4.649  -10.140 1.00 32.56 ? 320  TRP A CG  1 
ATOM   2501 C  CD1 . TRP A 1 304 ? -5.793  4.212  -11.412 1.00 32.61 ? 320  TRP A CD1 1 
ATOM   2502 C  CD2 . TRP A 1 304 ? -7.453  4.827  -10.038 1.00 32.11 ? 320  TRP A CD2 1 
ATOM   2503 N  NE1 . TRP A 1 304 ? -6.972  4.110  -12.109 1.00 32.23 ? 320  TRP A NE1 1 
ATOM   2504 C  CE2 . TRP A 1 304 ? -8.007  4.479  -11.291 1.00 31.74 ? 320  TRP A CE2 1 
ATOM   2505 C  CE3 . TRP A 1 304 ? -8.310  5.249  -9.011  1.00 31.57 ? 320  TRP A CE3 1 
ATOM   2506 C  CZ2 . TRP A 1 304 ? -9.382  4.538  -11.546 1.00 31.64 ? 320  TRP A CZ2 1 
ATOM   2507 C  CZ3 . TRP A 1 304 ? -9.681  5.308  -9.266  1.00 31.28 ? 320  TRP A CZ3 1 
ATOM   2508 C  CH2 . TRP A 1 304 ? -10.200 4.955  -10.526 1.00 31.13 ? 320  TRP A CH2 1 
ATOM   2509 N  N   . ASP A 1 305 ? -2.570  6.635  -7.846  1.00 33.21 ? 321  ASP A N   1 
ATOM   2510 C  CA  . ASP A 1 305 ? -1.499  6.737  -6.854  1.00 33.68 ? 321  ASP A CA  1 
ATOM   2511 C  C   . ASP A 1 305 ? -1.524  8.050  -6.076  1.00 33.18 ? 321  ASP A C   1 
ATOM   2512 O  O   . ASP A 1 305 ? -1.268  8.063  -4.872  1.00 33.26 ? 321  ASP A O   1 
ATOM   2513 C  CB  . ASP A 1 305 ? -0.123  6.578  -7.520  1.00 34.08 ? 321  ASP A CB  1 
ATOM   2514 C  CG  . ASP A 1 305 ? 0.162   5.152  -7.978  1.00 35.28 ? 321  ASP A CG  1 
ATOM   2515 O  OD1 . ASP A 1 305 ? -0.642  4.237  -7.697  1.00 36.27 ? 321  ASP A OD1 1 
ATOM   2516 O  OD2 . ASP A 1 305 ? 1.209   4.946  -8.626  1.00 36.58 ? 321  ASP A OD2 1 
ATOM   2517 N  N   . LYS A 1 306 ? -1.832  9.146  -6.768  1.00 32.60 ? 322  LYS A N   1 
ATOM   2518 C  CA  . LYS A 1 306 ? -1.605  10.488 -6.227  1.00 32.35 ? 322  LYS A CA  1 
ATOM   2519 C  C   . LYS A 1 306 ? -2.869  11.301 -5.909  1.00 31.87 ? 322  LYS A C   1 
ATOM   2520 O  O   . LYS A 1 306 ? -2.792  12.299 -5.184  1.00 31.71 ? 322  LYS A O   1 
ATOM   2521 C  CB  . LYS A 1 306 ? -0.704  11.288 -7.171  1.00 32.30 ? 322  LYS A CB  1 
ATOM   2522 C  CG  . LYS A 1 306 ? 0.684   10.699 -7.403  1.00 32.94 ? 322  LYS A CG  1 
ATOM   2523 C  CD  . LYS A 1 306 ? 1.432   11.523 -8.438  1.00 33.20 ? 322  LYS A CD  1 
ATOM   2524 C  CE  . LYS A 1 306 ? 2.826   10.981 -8.695  1.00 33.99 ? 322  LYS A CE  1 
ATOM   2525 N  NZ  . LYS A 1 306 ? 3.624   11.953 -9.492  1.00 34.22 ? 322  LYS A NZ  1 
ATOM   2526 N  N   . SER A 1 307 ? -4.015  10.891 -6.451  1.00 31.58 ? 323  SER A N   1 
ATOM   2527 C  CA  . SER A 1 307 ? -5.274  11.608 -6.217  1.00 31.24 ? 323  SER A CA  1 
ATOM   2528 C  C   . SER A 1 307 ? -5.723  11.539 -4.759  1.00 31.60 ? 323  SER A C   1 
ATOM   2529 O  O   . SER A 1 307 ? -5.390  10.596 -4.038  1.00 31.70 ? 323  SER A O   1 
ATOM   2530 C  CB  . SER A 1 307 ? -6.392  11.081 -7.122  1.00 30.99 ? 323  SER A CB  1 
ATOM   2531 O  OG  . SER A 1 307 ? -6.177  11.448 -8.474  1.00 30.64 ? 323  SER A OG  1 
ATOM   2532 N  N   . ILE A 1 308 ? -6.465  12.559 -4.337  1.00 31.43 ? 324  ILE A N   1 
ATOM   2533 C  CA  . ILE A 1 308 ? -7.136  12.554 -3.044  1.00 31.99 ? 324  ILE A CA  1 
ATOM   2534 C  C   . ILE A 1 308 ? -8.634  12.489 -3.320  1.00 31.93 ? 324  ILE A C   1 
ATOM   2535 O  O   . ILE A 1 308 ? -9.216  13.432 -3.857  1.00 31.28 ? 324  ILE A O   1 
ATOM   2536 C  CB  . ILE A 1 308 ? -6.772  13.795 -2.193  1.00 31.90 ? 324  ILE A CB  1 
ATOM   2537 C  CG1 . ILE A 1 308 ? -5.265  13.822 -1.915  1.00 32.66 ? 324  ILE A CG1 1 
ATOM   2538 C  CG2 . ILE A 1 308 ? -7.559  13.798 -0.881  1.00 32.34 ? 324  ILE A CG2 1 
ATOM   2539 C  CD1 . ILE A 1 308 ? -4.738  15.161 -1.441  1.00 32.43 ? 324  ILE A CD1 1 
ATOM   2540 N  N   . ILE A 1 309 ? -9.246  11.360 -2.975  1.00 32.56 ? 325  ILE A N   1 
ATOM   2541 C  CA  . ILE A 1 309 ? -10.656 11.124 -3.292  1.00 32.99 ? 325  ILE A CA  1 
ATOM   2542 C  C   . ILE A 1 309 ? -11.545 11.035 -2.045  1.00 33.45 ? 325  ILE A C   1 
ATOM   2543 O  O   . ILE A 1 309 ? -12.732 10.739 -2.142  1.00 33.35 ? 325  ILE A O   1 
ATOM   2544 C  CB  . ILE A 1 309 ? -10.849 9.885  -4.212  1.00 33.14 ? 325  ILE A CB  1 
ATOM   2545 C  CG1 . ILE A 1 309 ? -10.311 8.615  -3.538  1.00 33.87 ? 325  ILE A CG1 1 
ATOM   2546 C  CG2 . ILE A 1 309 ? -10.191 10.123 -5.577  1.00 33.04 ? 325  ILE A CG2 1 
ATOM   2547 C  CD1 . ILE A 1 309 ? -10.724 7.325  -4.221  1.00 34.36 ? 325  ILE A CD1 1 
ATOM   2548 N  N   . GLU A 1 310 ? -10.957 11.305 -0.882  1.00 34.39 ? 326  GLU A N   1 
ATOM   2549 C  CA  . GLU A 1 310 ? -11.690 11.373 0.382   1.00 35.25 ? 326  GLU A CA  1 
ATOM   2550 C  C   . GLU A 1 310 ? -11.149 12.519 1.221   1.00 35.36 ? 326  GLU A C   1 
ATOM   2551 O  O   . GLU A 1 310 ? -9.950  12.808 1.177   1.00 35.25 ? 326  GLU A O   1 
ATOM   2552 C  CB  . GLU A 1 310 ? -11.547 10.067 1.167   1.00 36.09 ? 326  GLU A CB  1 
ATOM   2553 C  CG  . GLU A 1 310 ? -12.375 8.910  0.632   1.00 37.75 ? 326  GLU A CG  1 
ATOM   2554 C  CD  . GLU A 1 310 ? -12.294 7.662  1.501   1.00 40.51 ? 326  GLU A CD  1 
ATOM   2555 O  OE1 . GLU A 1 310 ? -11.885 7.765  2.679   1.00 41.82 ? 326  GLU A OE1 1 
ATOM   2556 O  OE2 . GLU A 1 310 ? -12.646 6.571  1.001   1.00 41.57 ? 326  GLU A OE2 1 
ATOM   2557 N  N   . LYS A 1 311 ? -12.026 13.166 1.987   1.00 35.49 ? 327  LYS A N   1 
ATOM   2558 C  CA  . LYS A 1 311 ? -11.594 14.205 2.915   1.00 35.95 ? 327  LYS A CA  1 
ATOM   2559 C  C   . LYS A 1 311 ? -10.687 13.579 3.977   1.00 36.99 ? 327  LYS A C   1 
ATOM   2560 O  O   . LYS A 1 311 ? -11.075 12.603 4.622   1.00 37.22 ? 327  LYS A O   1 
ATOM   2561 C  CB  . LYS A 1 311 ? -12.788 14.913 3.565   1.00 35.70 ? 327  LYS A CB  1 
ATOM   2562 C  CG  . LYS A 1 311 ? -12.402 16.151 4.371   1.00 35.69 ? 327  LYS A CG  1 
ATOM   2563 C  CD  . LYS A 1 311 ? -13.607 16.853 4.974   1.00 36.03 ? 327  LYS A CD  1 
ATOM   2564 C  CE  . LYS A 1 311 ? -13.177 18.083 5.765   1.00 36.52 ? 327  LYS A CE  1 
ATOM   2565 N  NZ  . LYS A 1 311 ? -14.336 18.866 6.287   1.00 37.01 ? 327  LYS A NZ  1 
ATOM   2566 N  N   . PRO A 1 312 ? -9.465  14.125 4.138   1.00 37.63 ? 328  PRO A N   1 
ATOM   2567 C  CA  . PRO A 1 312 ? -8.502  13.643 5.131   1.00 38.66 ? 328  PRO A CA  1 
ATOM   2568 C  C   . PRO A 1 312 ? -9.080  13.647 6.545   1.00 39.45 ? 328  PRO A C   1 
ATOM   2569 O  O   . PRO A 1 312 ? -9.851  14.545 6.896   1.00 39.28 ? 328  PRO A O   1 
ATOM   2570 C  CB  . PRO A 1 312 ? -7.356  14.651 5.022   1.00 38.65 ? 328  PRO A CB  1 
ATOM   2571 C  CG  . PRO A 1 312 ? -7.440  15.159 3.632   1.00 37.89 ? 328  PRO A CG  1 
ATOM   2572 C  CD  . PRO A 1 312 ? -8.901  15.212 3.315   1.00 37.24 ? 328  PRO A CD  1 
ATOM   2573 N  N   . THR A 1 313 ? -8.707  12.644 7.337   1.00 40.58 ? 329  THR A N   1 
ATOM   2574 C  CA  . THR A 1 313 ? -9.267  12.450 8.678   1.00 41.55 ? 329  THR A CA  1 
ATOM   2575 C  C   . THR A 1 313 ? -8.404  13.038 9.801   1.00 42.28 ? 329  THR A C   1 
ATOM   2576 O  O   . THR A 1 313 ? -8.776  12.971 10.975  1.00 42.78 ? 329  THR A O   1 
ATOM   2577 C  CB  . THR A 1 313 ? -9.552  10.957 8.967   1.00 41.99 ? 329  THR A CB  1 
ATOM   2578 O  OG1 . THR A 1 313 ? -8.405  10.172 8.617   1.00 42.69 ? 329  THR A OG1 1 
ATOM   2579 C  CG2 . THR A 1 313 ? -10.759 10.475 8.169   1.00 41.72 ? 329  THR A CG2 1 
ATOM   2580 N  N   . ASP A 1 314 ? -7.256  13.609 9.442   1.00 42.50 ? 330  ASP A N   1 
ATOM   2581 C  CA  . ASP A 1 314 ? -6.467  14.397 10.390  1.00 43.07 ? 330  ASP A CA  1 
ATOM   2582 C  C   . ASP A 1 314 ? -7.076  15.800 10.512  1.00 42.63 ? 330  ASP A C   1 
ATOM   2583 O  O   . ASP A 1 314 ? -8.006  16.143 9.777   1.00 42.32 ? 330  ASP A O   1 
ATOM   2584 C  CB  . ASP A 1 314 ? -4.986  14.447 9.980   1.00 43.31 ? 330  ASP A CB  1 
ATOM   2585 C  CG  . ASP A 1 314 ? -4.786  14.813 8.512   1.00 43.38 ? 330  ASP A CG  1 
ATOM   2586 O  OD1 . ASP A 1 314 ? -5.730  15.333 7.878   1.00 43.32 ? 330  ASP A OD1 1 
ATOM   2587 O  OD2 . ASP A 1 314 ? -3.675  14.583 7.990   1.00 44.10 ? 330  ASP A OD2 1 
ATOM   2588 N  N   . GLY A 1 315 ? -6.562  16.609 11.433  1.00 42.86 ? 331  GLY A N   1 
ATOM   2589 C  CA  . GLY A 1 315 ? -7.151  17.923 11.703  1.00 42.25 ? 331  GLY A CA  1 
ATOM   2590 C  C   . GLY A 1 315 ? -6.823  19.031 10.713  1.00 41.44 ? 331  GLY A C   1 
ATOM   2591 O  O   . GLY A 1 315 ? -7.167  20.192 10.951  1.00 41.37 ? 331  GLY A O   1 
ATOM   2592 N  N   . ARG A 1 316 ? -6.183  18.676 9.599   1.00 40.82 ? 332  ARG A N   1 
ATOM   2593 C  CA  . ARG A 1 316 ? -5.631  19.664 8.666   1.00 40.02 ? 332  ARG A CA  1 
ATOM   2594 C  C   . ARG A 1 316 ? -6.679  20.454 7.875   1.00 38.98 ? 332  ARG A C   1 
ATOM   2595 O  O   . ARG A 1 316 ? -7.796  19.982 7.646   1.00 38.66 ? 332  ARG A O   1 
ATOM   2596 C  CB  . ARG A 1 316 ? -4.608  19.013 7.721   1.00 40.14 ? 332  ARG A CB  1 
ATOM   2597 C  CG  . ARG A 1 316 ? -5.174  18.381 6.448   1.00 40.05 ? 332  ARG A CG  1 
ATOM   2598 C  CD  . ARG A 1 316 ? -4.238  17.290 5.953   1.00 41.71 ? 332  ARG A CD  1 
ATOM   2599 N  NE  . ARG A 1 316 ? -4.343  17.043 4.517   1.00 42.20 ? 332  ARG A NE  1 
ATOM   2600 C  CZ  . ARG A 1 316 ? -3.988  15.906 3.923   1.00 42.58 ? 332  ARG A CZ  1 
ATOM   2601 N  NH1 . ARG A 1 316 ? -3.528  14.887 4.638   1.00 43.26 ? 332  ARG A NH1 1 
ATOM   2602 N  NH2 . ARG A 1 316 ? -4.112  15.780 2.609   1.00 42.44 ? 332  ARG A NH2 1 
ATOM   2603 N  N   . ASP A 1 317 ? -6.300  21.663 7.472   1.00 38.18 ? 333  ASP A N   1 
ATOM   2604 C  CA  . ASP A 1 317 ? -7.135  22.491 6.612   1.00 37.04 ? 333  ASP A CA  1 
ATOM   2605 C  C   . ASP A 1 317 ? -6.791  22.223 5.153   1.00 36.13 ? 333  ASP A C   1 
ATOM   2606 O  O   . ASP A 1 317 ? -5.623  22.020 4.812   1.00 36.21 ? 333  ASP A O   1 
ATOM   2607 C  CB  . ASP A 1 317 ? -6.942  23.974 6.941   1.00 37.12 ? 333  ASP A CB  1 
ATOM   2608 C  CG  . ASP A 1 317 ? -7.427  24.334 8.338   1.00 37.86 ? 333  ASP A CG  1 
ATOM   2609 O  OD1 . ASP A 1 317 ? -8.627  24.135 8.629   1.00 38.25 ? 333  ASP A OD1 1 
ATOM   2610 O  OD2 . ASP A 1 317 ? -6.604  24.815 9.146   1.00 38.88 ? 333  ASP A OD2 1 
ATOM   2611 N  N   . LEU A 1 318 ? -7.817  22.204 4.305   1.00 34.98 ? 334  LEU A N   1 
ATOM   2612 C  CA  . LEU A 1 318 ? -7.645  22.014 2.865   1.00 34.04 ? 334  LEU A CA  1 
ATOM   2613 C  C   . LEU A 1 318 ? -8.796  22.652 2.093   1.00 33.07 ? 334  LEU A C   1 
ATOM   2614 O  O   . LEU A 1 318 ? -9.832  22.983 2.670   1.00 32.95 ? 334  LEU A O   1 
ATOM   2615 C  CB  . LEU A 1 318 ? -7.534  20.522 2.508   1.00 34.19 ? 334  LEU A CB  1 
ATOM   2616 C  CG  . LEU A 1 318 ? -8.798  19.650 2.479   1.00 34.19 ? 334  LEU A CG  1 
ATOM   2617 C  CD1 . LEU A 1 318 ? -8.633  18.501 1.494   1.00 34.48 ? 334  LEU A CD1 1 
ATOM   2618 C  CD2 . LEU A 1 318 ? -9.166  19.129 3.867   1.00 34.72 ? 334  LEU A CD2 1 
ATOM   2619 N  N   . VAL A 1 319 ? -8.605  22.823 0.788   1.00 32.19 ? 335  VAL A N   1 
ATOM   2620 C  CA  . VAL A 1 319 ? -9.687  23.241 -0.097  1.00 31.26 ? 335  VAL A CA  1 
ATOM   2621 C  C   . VAL A 1 319 ? -10.456 21.988 -0.514  1.00 31.02 ? 335  VAL A C   1 
ATOM   2622 O  O   . VAL A 1 319 ? -9.919  21.131 -1.223  1.00 30.92 ? 335  VAL A O   1 
ATOM   2623 C  CB  . VAL A 1 319 ? -9.159  24.000 -1.343  1.00 31.03 ? 335  VAL A CB  1 
ATOM   2624 C  CG1 . VAL A 1 319 ? -10.305 24.365 -2.282  1.00 30.13 ? 335  VAL A CG1 1 
ATOM   2625 C  CG2 . VAL A 1 319 ? -8.388  25.253 -0.927  1.00 30.80 ? 335  VAL A CG2 1 
ATOM   2626 N  N   . CYS A 1 320 ? -11.700 21.871 -0.054  1.00 30.57 ? 336  CYS A N   1 
ATOM   2627 C  CA  . CYS A 1 320 ? -12.524 20.701 -0.370  1.00 30.53 ? 336  CYS A CA  1 
ATOM   2628 C  C   . CYS A 1 320 ? -13.332 20.846 -1.658  1.00 29.63 ? 336  CYS A C   1 
ATOM   2629 O  O   . CYS A 1 320 ? -13.818 19.846 -2.186  1.00 29.94 ? 336  CYS A O   1 
ATOM   2630 C  CB  . CYS A 1 320 ? -13.450 20.315 0.795   1.00 30.74 ? 336  CYS A CB  1 
ATOM   2631 S  SG  . CYS A 1 320 ? -12.872 18.934 1.853   1.00 32.88 ? 336  CYS A SG  1 
ATOM   2632 N  N   . HIS A 1 321 ? -13.482 22.068 -2.165  1.00 28.66 ? 337  HIS A N   1 
ATOM   2633 C  CA  . HIS A 1 321 ? -14.176 22.250 -3.439  1.00 27.71 ? 337  HIS A CA  1 
ATOM   2634 C  C   . HIS A 1 321 ? -13.414 21.487 -4.517  1.00 27.46 ? 337  HIS A C   1 
ATOM   2635 O  O   . HIS A 1 321 ? -12.232 21.752 -4.756  1.00 27.36 ? 337  HIS A O   1 
ATOM   2636 C  CB  . HIS A 1 321 ? -14.331 23.727 -3.810  1.00 27.35 ? 337  HIS A CB  1 
ATOM   2637 C  CG  . HIS A 1 321 ? -15.287 23.960 -4.941  1.00 26.71 ? 337  HIS A CG  1 
ATOM   2638 N  ND1 . HIS A 1 321 ? -16.603 24.321 -4.741  1.00 26.17 ? 337  HIS A ND1 1 
ATOM   2639 C  CD2 . HIS A 1 321 ? -15.123 23.866 -6.282  1.00 26.41 ? 337  HIS A CD2 1 
ATOM   2640 C  CE1 . HIS A 1 321 ? -17.205 24.447 -5.910  1.00 26.02 ? 337  HIS A CE1 1 
ATOM   2641 N  NE2 . HIS A 1 321 ? -16.330 24.175 -6.861  1.00 25.83 ? 337  HIS A NE2 1 
ATOM   2642 N  N   . ALA A 1 322 ? -14.095 20.530 -5.143  1.00 27.08 ? 338  ALA A N   1 
ATOM   2643 C  CA  . ALA A 1 322 ? -13.451 19.561 -6.031  1.00 27.09 ? 338  ALA A CA  1 
ATOM   2644 C  C   . ALA A 1 322 ? -12.673 20.216 -7.169  1.00 26.94 ? 338  ALA A C   1 
ATOM   2645 O  O   . ALA A 1 322 ? -13.078 21.255 -7.694  1.00 26.49 ? 338  ALA A O   1 
ATOM   2646 C  CB  . ALA A 1 322 ? -14.471 18.570 -6.573  1.00 27.01 ? 338  ALA A CB  1 
ATOM   2647 N  N   . SER A 1 323 ? -11.547 19.604 -7.528  1.00 27.24 ? 339  SER A N   1 
ATOM   2648 C  CA  . SER A 1 323 ? -10.683 20.119 -8.587  1.00 27.21 ? 339  SER A CA  1 
ATOM   2649 C  C   . SER A 1 323 ? -9.923  18.999 -9.291  1.00 27.58 ? 339  SER A C   1 
ATOM   2650 O  O   . SER A 1 323 ? -9.657  17.946 -8.702  1.00 27.74 ? 339  SER A O   1 
ATOM   2651 C  CB  . SER A 1 323 ? -9.698  21.153 -8.029  1.00 27.32 ? 339  SER A CB  1 
ATOM   2652 O  OG  . SER A 1 323 ? -8.934  20.609 -6.966  1.00 27.71 ? 339  SER A OG  1 
ATOM   2653 N  N   . ALA A 1 324 ? -9.598  19.238 -10.560 1.00 27.40 ? 340  ALA A N   1 
ATOM   2654 C  CA  . ALA A 1 324 ? -8.784  18.328 -11.361 1.00 27.81 ? 340  ALA A CA  1 
ATOM   2655 C  C   . ALA A 1 324 ? -7.474  19.023 -11.721 1.00 27.93 ? 340  ALA A C   1 
ATOM   2656 O  O   . ALA A 1 324 ? -7.443  20.237 -11.914 1.00 27.79 ? 340  ALA A O   1 
ATOM   2657 C  CB  . ALA A 1 324 ? -9.532  17.911 -12.612 1.00 27.70 ? 340  ALA A CB  1 
ATOM   2658 N  N   . TRP A 1 325 ? -6.397  18.251 -11.814 1.00 28.18 ? 341  TRP A N   1 
ATOM   2659 C  CA  . TRP A 1 325 ? -5.061  18.823 -11.899 1.00 28.37 ? 341  TRP A CA  1 
ATOM   2660 C  C   . TRP A 1 325 ? -4.244  18.229 -13.041 1.00 28.53 ? 341  TRP A C   1 
ATOM   2661 O  O   . TRP A 1 325 ? -4.112  17.010 -13.157 1.00 28.70 ? 341  TRP A O   1 
ATOM   2662 C  CB  . TRP A 1 325 ? -4.328  18.642 -10.564 1.00 28.60 ? 341  TRP A CB  1 
ATOM   2663 C  CG  . TRP A 1 325 ? -4.950  19.392 -9.416  1.00 28.80 ? 341  TRP A CG  1 
ATOM   2664 C  CD1 . TRP A 1 325 ? -6.106  19.076 -8.754  1.00 29.02 ? 341  TRP A CD1 1 
ATOM   2665 C  CD2 . TRP A 1 325 ? -4.440  20.573 -8.786  1.00 29.15 ? 341  TRP A CD2 1 
ATOM   2666 N  NE1 . TRP A 1 325 ? -6.352  19.993 -7.762  1.00 29.36 ? 341  TRP A NE1 1 
ATOM   2667 C  CE2 . TRP A 1 325 ? -5.345  20.923 -7.757  1.00 29.31 ? 341  TRP A CE2 1 
ATOM   2668 C  CE3 . TRP A 1 325 ? -3.308  21.374 -8.992  1.00 29.14 ? 341  TRP A CE3 1 
ATOM   2669 C  CZ2 . TRP A 1 325 ? -5.154  22.038 -6.936  1.00 29.46 ? 341  TRP A CZ2 1 
ATOM   2670 C  CZ3 . TRP A 1 325 ? -3.117  22.483 -8.175  1.00 29.68 ? 341  TRP A CZ3 1 
ATOM   2671 C  CH2 . TRP A 1 325 ? -4.036  22.803 -7.158  1.00 29.65 ? 341  TRP A CH2 1 
ATOM   2672 N  N   . ASP A 1 326 ? -3.715  19.109 -13.888 1.00 28.33 ? 342  ASP A N   1 
ATOM   2673 C  CA  . ASP A 1 326 ? -2.833  18.721 -14.981 1.00 28.63 ? 342  ASP A CA  1 
ATOM   2674 C  C   . ASP A 1 326 ? -1.418  19.176 -14.640 1.00 28.83 ? 342  ASP A C   1 
ATOM   2675 O  O   . ASP A 1 326 ? -1.176  20.366 -14.432 1.00 28.67 ? 342  ASP A O   1 
ATOM   2676 C  CB  . ASP A 1 326 ? -3.304  19.362 -16.292 1.00 28.33 ? 342  ASP A CB  1 
ATOM   2677 C  CG  . ASP A 1 326 ? -2.597  18.802 -17.522 1.00 28.72 ? 342  ASP A CG  1 
ATOM   2678 O  OD1 . ASP A 1 326 ? -1.674  17.967 -17.386 1.00 29.18 ? 342  ASP A OD1 1 
ATOM   2679 O  OD2 . ASP A 1 326 ? -2.977  19.204 -18.642 1.00 28.49 ? 342  ASP A OD2 1 
ATOM   2680 N  N   . PHE A 1 327 ? -0.487  18.229 -14.579 1.00 29.31 ? 343  PHE A N   1 
ATOM   2681 C  CA  . PHE A 1 327 ? 0.890   18.543 -14.193 1.00 29.64 ? 343  PHE A CA  1 
ATOM   2682 C  C   . PHE A 1 327 ? 1.829   18.713 -15.389 1.00 29.89 ? 343  PHE A C   1 
ATOM   2683 O  O   . PHE A 1 327 ? 3.041   18.876 -15.225 1.00 30.03 ? 343  PHE A O   1 
ATOM   2684 C  CB  . PHE A 1 327 ? 1.409   17.523 -13.172 1.00 30.03 ? 343  PHE A CB  1 
ATOM   2685 C  CG  . PHE A 1 327 ? 0.741   17.639 -11.832 1.00 29.85 ? 343  PHE A CG  1 
ATOM   2686 C  CD1 . PHE A 1 327 ? -0.513  17.078 -11.615 1.00 29.81 ? 343  PHE A CD1 1 
ATOM   2687 C  CD2 . PHE A 1 327 ? 1.345   18.347 -10.801 1.00 29.96 ? 343  PHE A CD2 1 
ATOM   2688 C  CE1 . PHE A 1 327 ? -1.147  17.206 -10.388 1.00 29.12 ? 343  PHE A CE1 1 
ATOM   2689 C  CE2 . PHE A 1 327 ? 0.719   18.477 -9.563  1.00 29.76 ? 343  PHE A CE2 1 
ATOM   2690 C  CZ  . PHE A 1 327 ? -0.528  17.907 -9.358  1.00 29.47 ? 343  PHE A CZ  1 
ATOM   2691 N  N   . TYR A 1 328 ? 1.242   18.689 -16.585 1.00 30.00 ? 344  TYR A N   1 
ATOM   2692 C  CA  . TYR A 1 328 ? 1.922   19.043 -17.841 1.00 30.39 ? 344  TYR A CA  1 
ATOM   2693 C  C   . TYR A 1 328 ? 3.136   18.177 -18.197 1.00 30.83 ? 344  TYR A C   1 
ATOM   2694 O  O   . TYR A 1 328 ? 4.039   18.616 -18.913 1.00 30.89 ? 344  TYR A O   1 
ATOM   2695 C  CB  . TYR A 1 328 ? 2.264   20.541 -17.877 1.00 30.36 ? 344  TYR A CB  1 
ATOM   2696 C  CG  . TYR A 1 328 ? 1.043   21.430 -17.876 1.00 31.08 ? 344  TYR A CG  1 
ATOM   2697 C  CD1 . TYR A 1 328 ? 0.333   21.674 -19.052 1.00 32.14 ? 344  TYR A CD1 1 
ATOM   2698 C  CD2 . TYR A 1 328 ? 0.588   22.019 -16.698 1.00 32.03 ? 344  TYR A CD2 1 
ATOM   2699 C  CE1 . TYR A 1 328 ? -0.797  22.486 -19.056 1.00 32.97 ? 344  TYR A CE1 1 
ATOM   2700 C  CE2 . TYR A 1 328 ? -0.541  22.835 -16.691 1.00 32.54 ? 344  TYR A CE2 1 
ATOM   2701 C  CZ  . TYR A 1 328 ? -1.226  23.062 -17.871 1.00 33.26 ? 344  TYR A CZ  1 
ATOM   2702 O  OH  . TYR A 1 328 ? -2.341  23.868 -17.871 1.00 35.23 ? 344  TYR A OH  1 
ATOM   2703 N  N   . LEU A 1 329 ? 3.146   16.946 -17.698 1.00 31.16 ? 345  LEU A N   1 
ATOM   2704 C  CA  . LEU A 1 329 ? 4.125   15.961 -18.128 1.00 31.68 ? 345  LEU A CA  1 
ATOM   2705 C  C   . LEU A 1 329 ? 3.403   14.968 -19.039 1.00 31.75 ? 345  LEU A C   1 
ATOM   2706 O  O   . LEU A 1 329 ? 2.666   15.375 -19.944 1.00 31.44 ? 345  LEU A O   1 
ATOM   2707 C  CB  . LEU A 1 329 ? 4.777   15.273 -16.919 1.00 32.01 ? 345  LEU A CB  1 
ATOM   2708 C  CG  . LEU A 1 329 ? 5.459   16.151 -15.859 1.00 32.17 ? 345  LEU A CG  1 
ATOM   2709 C  CD1 . LEU A 1 329 ? 5.963   15.296 -14.700 1.00 32.80 ? 345  LEU A CD1 1 
ATOM   2710 C  CD2 . LEU A 1 329 ? 6.597   16.987 -16.444 1.00 32.37 ? 345  LEU A CD2 1 
ATOM   2711 N  N   . THR A 1 330 ? 3.615   13.678 -18.810 1.00 32.00 ? 346  THR A N   1 
ATOM   2712 C  CA  . THR A 1 330 ? 2.839   12.646 -19.481 1.00 32.19 ? 346  THR A CA  1 
ATOM   2713 C  C   . THR A 1 330 ? 2.137   11.804 -18.416 1.00 32.25 ? 346  THR A C   1 
ATOM   2714 O  O   . THR A 1 330 ? 2.789   11.235 -17.538 1.00 32.52 ? 346  THR A O   1 
ATOM   2715 C  CB  . THR A 1 330 ? 3.725   11.762 -20.390 1.00 32.78 ? 346  THR A CB  1 
ATOM   2716 O  OG1 . THR A 1 330 ? 4.420   12.589 -21.336 1.00 33.37 ? 346  THR A OG1 1 
ATOM   2717 C  CG2 . THR A 1 330 ? 2.883   10.729 -21.143 1.00 32.85 ? 346  THR A CG2 1 
ATOM   2718 N  N   . ASP A 1 331 ? 0.806   11.769 -18.484 1.00 32.00 ? 347  ASP A N   1 
ATOM   2719 C  CA  . ASP A 1 331 ? -0.035  10.933 -17.611 1.00 32.21 ? 347  ASP A CA  1 
ATOM   2720 C  C   . ASP A 1 331 ? -0.022  11.289 -16.118 1.00 32.11 ? 347  ASP A C   1 
ATOM   2721 O  O   . ASP A 1 331 ? -0.548  10.537 -15.297 1.00 32.36 ? 347  ASP A O   1 
ATOM   2722 C  CB  . ASP A 1 331 ? 0.294   9.442  -17.802 1.00 32.80 ? 347  ASP A CB  1 
ATOM   2723 C  CG  . ASP A 1 331 ? -0.167  8.908  -19.145 1.00 33.16 ? 347  ASP A CG  1 
ATOM   2724 O  OD1 . ASP A 1 331 ? -0.987  9.573  -19.817 1.00 32.69 ? 347  ASP A OD1 1 
ATOM   2725 O  OD2 . ASP A 1 331 ? 0.292   7.814  -19.528 1.00 34.07 ? 347  ASP A OD2 1 
ATOM   2726 N  N   . ASP A 1 332 ? 0.572   12.427 -15.768 1.00 31.83 ? 348  ASP A N   1 
ATOM   2727 C  CA  . ASP A 1 332 ? 0.530   12.905 -14.390 1.00 31.75 ? 348  ASP A CA  1 
ATOM   2728 C  C   . ASP A 1 332 ? -0.668  13.835 -14.232 1.00 31.01 ? 348  ASP A C   1 
ATOM   2729 O  O   . ASP A 1 332 ? -0.561  15.054 -14.402 1.00 30.59 ? 348  ASP A O   1 
ATOM   2730 C  CB  . ASP A 1 332 ? 1.841   13.598 -13.998 1.00 32.18 ? 348  ASP A CB  1 
ATOM   2731 C  CG  . ASP A 1 332 ? 1.991   13.779 -12.487 1.00 33.07 ? 348  ASP A CG  1 
ATOM   2732 O  OD1 . ASP A 1 332 ? 1.000   13.624 -11.740 1.00 34.08 ? 348  ASP A OD1 1 
ATOM   2733 O  OD2 . ASP A 1 332 ? 3.118   14.083 -12.045 1.00 35.27 ? 348  ASP A OD2 1 
ATOM   2734 N  N   . VAL A 1 333 ? -1.816  13.230 -13.938 1.00 30.61 ? 349  VAL A N   1 
ATOM   2735 C  CA  . VAL A 1 333 ? -3.072  13.947 -13.728 1.00 29.84 ? 349  VAL A CA  1 
ATOM   2736 C  C   . VAL A 1 333 ? -3.701  13.487 -12.412 1.00 29.85 ? 349  VAL A C   1 
ATOM   2737 O  O   . VAL A 1 333 ? -3.549  12.326 -12.024 1.00 30.06 ? 349  VAL A O   1 
ATOM   2738 C  CB  . VAL A 1 333 ? -4.067  13.752 -14.909 1.00 29.67 ? 349  VAL A CB  1 
ATOM   2739 C  CG1 . VAL A 1 333 ? -3.563  14.464 -16.165 1.00 29.50 ? 349  VAL A CG1 1 
ATOM   2740 C  CG2 . VAL A 1 333 ? -4.316  12.270 -15.192 1.00 30.02 ? 349  VAL A CG2 1 
ATOM   2741 N  N   . ARG A 1 334 ? -4.394  14.396 -11.727 1.00 29.25 ? 350  ARG A N   1 
ATOM   2742 C  CA  . ARG A 1 334 ? -4.939  14.117 -10.393 1.00 29.26 ? 350  ARG A CA  1 
ATOM   2743 C  C   . ARG A 1 334 ? -6.267  14.809 -10.151 1.00 28.58 ? 350  ARG A C   1 
ATOM   2744 O  O   . ARG A 1 334 ? -6.544  15.861 -10.728 1.00 28.00 ? 350  ARG A O   1 
ATOM   2745 C  CB  . ARG A 1 334 ? -3.975  14.595 -9.306  1.00 29.53 ? 350  ARG A CB  1 
ATOM   2746 C  CG  . ARG A 1 334 ? -2.704  13.809 -9.176  1.00 30.63 ? 350  ARG A CG  1 
ATOM   2747 C  CD  . ARG A 1 334 ? -1.753  14.524 -8.247  1.00 30.99 ? 350  ARG A CD  1 
ATOM   2748 N  NE  . ARG A 1 334 ? -0.392  14.475 -8.765  1.00 31.70 ? 350  ARG A NE  1 
ATOM   2749 C  CZ  . ARG A 1 334 ? 0.660   15.030 -8.174  1.00 32.18 ? 350  ARG A CZ  1 
ATOM   2750 N  NH1 . ARG A 1 334 ? 0.523   15.681 -7.025  1.00 32.32 ? 350  ARG A NH1 1 
ATOM   2751 N  NH2 . ARG A 1 334 ? 1.854   14.931 -8.738  1.00 33.15 ? 350  ARG A NH2 1 
ATOM   2752 N  N   . ILE A 1 335 ? -7.070  14.218 -9.272  1.00 28.47 ? 351  ILE A N   1 
ATOM   2753 C  CA  . ILE A 1 335 ? -8.266  14.865 -8.745  1.00 27.79 ? 351  ILE A CA  1 
ATOM   2754 C  C   . ILE A 1 335 ? -8.149  15.000 -7.229  1.00 27.94 ? 351  ILE A C   1 
ATOM   2755 O  O   . ILE A 1 335 ? -7.611  14.115 -6.553  1.00 28.18 ? 351  ILE A O   1 
ATOM   2756 C  CB  . ILE A 1 335 ? -9.562  14.102 -9.139  1.00 27.84 ? 351  ILE A CB  1 
ATOM   2757 C  CG1 . ILE A 1 335 ? -9.972  14.472 -10.567 1.00 27.21 ? 351  ILE A CG1 1 
ATOM   2758 C  CG2 . ILE A 1 335 ? -10.715 14.415 -8.176  1.00 27.56 ? 351  ILE A CG2 1 
ATOM   2759 C  CD1 . ILE A 1 335 ? -11.038 13.580 -11.160 1.00 26.90 ? 351  ILE A CD1 1 
ATOM   2760 N  N   . LYS A 1 336 ? -8.626  16.129 -6.710  1.00 27.42 ? 352  LYS A N   1 
ATOM   2761 C  CA  . LYS A 1 336 ? -8.802  16.315 -5.278  1.00 27.43 ? 352  LYS A CA  1 
ATOM   2762 C  C   . LYS A 1 336 ? -10.283 16.563 -5.013  1.00 27.22 ? 352  LYS A C   1 
ATOM   2763 O  O   . LYS A 1 336 ? -10.815 17.621 -5.359  1.00 26.78 ? 352  LYS A O   1 
ATOM   2764 C  CB  . LYS A 1 336 ? -7.948  17.477 -4.766  1.00 27.38 ? 352  LYS A CB  1 
ATOM   2765 C  CG  . LYS A 1 336 ? -8.081  17.755 -3.268  1.00 27.43 ? 352  LYS A CG  1 
ATOM   2766 C  CD  . LYS A 1 336 ? -6.906  18.571 -2.727  1.00 27.73 ? 352  LYS A CD  1 
ATOM   2767 C  CE  . LYS A 1 336 ? -6.779  19.944 -3.390  1.00 27.44 ? 352  LYS A CE  1 
ATOM   2768 N  NZ  . LYS A 1 336 ? -7.914  20.846 -3.051  1.00 26.37 ? 352  LYS A NZ  1 
ATOM   2769 N  N   . GLN A 1 337 ? -10.942 15.569 -4.423  1.00 27.35 ? 353  GLN A N   1 
ATOM   2770 C  CA  . GLN A 1 337 ? -12.365 15.655 -4.113  1.00 27.40 ? 353  GLN A CA  1 
ATOM   2771 C  C   . GLN A 1 337 ? -12.640 15.067 -2.735  1.00 27.92 ? 353  GLN A C   1 
ATOM   2772 O  O   . GLN A 1 337 ? -12.146 13.988 -2.400  1.00 28.24 ? 353  GLN A O   1 
ATOM   2773 C  CB  . GLN A 1 337 ? -13.194 14.929 -5.181  1.00 27.14 ? 353  GLN A CB  1 
ATOM   2774 C  CG  . GLN A 1 337 ? -14.711 15.013 -4.980  1.00 27.05 ? 353  GLN A CG  1 
ATOM   2775 C  CD  . GLN A 1 337 ? -15.508 14.497 -6.167  1.00 26.65 ? 353  GLN A CD  1 
ATOM   2776 O  OE1 . GLN A 1 337 ? -15.001 14.410 -7.285  1.00 26.90 ? 353  GLN A OE1 1 
ATOM   2777 N  NE2 . GLN A 1 337 ? -16.771 14.163 -5.929  1.00 26.82 ? 353  GLN A NE2 1 
ATOM   2778 N  N   . CYS A 1 338 ? -13.422 15.790 -1.938  1.00 28.06 ? 354  CYS A N   1 
ATOM   2779 C  CA  . CYS A 1 338 ? -13.853 15.309 -0.630  1.00 28.73 ? 354  CYS A CA  1 
ATOM   2780 C  C   . CYS A 1 338 ? -15.148 14.514 -0.823  1.00 28.61 ? 354  CYS A C   1 
ATOM   2781 O  O   . CYS A 1 338 ? -16.228 14.935 -0.401  1.00 28.38 ? 354  CYS A O   1 
ATOM   2782 C  CB  . CYS A 1 338 ? -14.007 16.485 0.346   1.00 28.77 ? 354  CYS A CB  1 
ATOM   2783 S  SG  . CYS A 1 338 ? -12.444 17.396 0.579   1.00 30.07 ? 354  CYS A SG  1 
ATOM   2784 N  N   . THR A 1 339 ? -15.008 13.354 -1.470  1.00 28.83 ? 355  THR A N   1 
ATOM   2785 C  CA  . THR A 1 339 ? -16.135 12.589 -2.014  1.00 28.76 ? 355  THR A CA  1 
ATOM   2786 C  C   . THR A 1 339 ? -17.055 12.002 -0.947  1.00 29.33 ? 355  THR A C   1 
ATOM   2787 O  O   . THR A 1 339 ? -16.597 11.436 0.049   1.00 29.46 ? 355  THR A O   1 
ATOM   2788 C  CB  . THR A 1 339 ? -15.660 11.442 -2.945  1.00 28.98 ? 355  THR A CB  1 
ATOM   2789 O  OG1 . THR A 1 339 ? -14.543 11.876 -3.734  1.00 28.59 ? 355  THR A OG1 1 
ATOM   2790 C  CG2 . THR A 1 339 ? -16.787 10.983 -3.871  1.00 28.55 ? 355  THR A CG2 1 
ATOM   2791 N  N   . ARG A 1 340 ? -18.356 12.152 -1.179  1.00 29.44 ? 356  ARG A N   1 
ATOM   2792 C  CA  . ARG A 1 340 ? -19.381 11.510 -0.365  1.00 30.28 ? 356  ARG A CA  1 
ATOM   2793 C  C   . ARG A 1 340 ? -20.201 10.570 -1.243  1.00 30.36 ? 356  ARG A C   1 
ATOM   2794 O  O   . ARG A 1 340 ? -20.246 10.734 -2.465  1.00 30.15 ? 356  ARG A O   1 
ATOM   2795 C  CB  . ARG A 1 340 ? -20.281 12.558 0.290   1.00 30.22 ? 356  ARG A CB  1 
ATOM   2796 C  CG  . ARG A 1 340 ? -19.575 13.406 1.340   1.00 31.47 ? 356  ARG A CG  1 
ATOM   2797 C  CD  . ARG A 1 340 ? -20.373 14.655 1.689   1.00 32.95 ? 356  ARG A CD  1 
ATOM   2798 N  NE  . ARG A 1 340 ? -20.364 15.635 0.605   1.00 34.00 ? 356  ARG A NE  1 
ATOM   2799 C  CZ  . ARG A 1 340 ? -21.397 15.888 -0.196  1.00 34.83 ? 356  ARG A CZ  1 
ATOM   2800 N  NH1 . ARG A 1 340 ? -22.546 15.239 -0.041  1.00 35.21 ? 356  ARG A NH1 1 
ATOM   2801 N  NH2 . ARG A 1 340 ? -21.284 16.799 -1.155  1.00 34.86 ? 356  ARG A NH2 1 
ATOM   2802 N  N   . VAL A 1 341 ? -20.843 9.588  -0.619  1.00 30.78 ? 357  VAL A N   1 
ATOM   2803 C  CA  . VAL A 1 341 ? -21.626 8.591  -1.350  1.00 31.00 ? 357  VAL A CA  1 
ATOM   2804 C  C   . VAL A 1 341 ? -23.067 9.081  -1.558  1.00 30.78 ? 357  VAL A C   1 
ATOM   2805 O  O   . VAL A 1 341 ? -23.980 8.705  -0.818  1.00 30.91 ? 357  VAL A O   1 
ATOM   2806 C  CB  . VAL A 1 341 ? -21.578 7.202  -0.647  1.00 31.55 ? 357  VAL A CB  1 
ATOM   2807 C  CG1 . VAL A 1 341 ? -22.300 6.145  -1.472  1.00 31.65 ? 357  VAL A CG1 1 
ATOM   2808 C  CG2 . VAL A 1 341 ? -20.134 6.774  -0.407  1.00 31.88 ? 357  VAL A CG2 1 
ATOM   2809 N  N   . THR A 1 342 ? -23.248 9.945  -2.558  1.00 30.48 ? 358  THR A N   1 
ATOM   2810 C  CA  . THR A 1 342 ? -24.569 10.461 -2.940  1.00 30.39 ? 358  THR A CA  1 
ATOM   2811 C  C   . THR A 1 342 ? -24.703 10.507 -4.464  1.00 30.44 ? 358  THR A C   1 
ATOM   2812 O  O   . THR A 1 342 ? -23.703 10.420 -5.180  1.00 30.26 ? 358  THR A O   1 
ATOM   2813 C  CB  . THR A 1 342 ? -24.837 11.891 -2.389  1.00 29.97 ? 358  THR A CB  1 
ATOM   2814 O  OG1 . THR A 1 342 ? -23.961 12.827 -3.027  1.00 29.86 ? 358  THR A OG1 1 
ATOM   2815 C  CG2 . THR A 1 342 ? -24.653 11.965 -0.873  1.00 30.07 ? 358  THR A CG2 1 
ATOM   2816 N  N   . GLN A 1 343 ? -25.937 10.653 -4.949  1.00 30.66 ? 359  GLN A N   1 
ATOM   2817 C  CA  . GLN A 1 343 ? -26.208 10.786 -6.386  1.00 30.86 ? 359  GLN A CA  1 
ATOM   2818 C  C   . GLN A 1 343 ? -25.538 12.028 -6.981  1.00 30.54 ? 359  GLN A C   1 
ATOM   2819 O  O   . GLN A 1 343 ? -24.897 11.946 -8.032  1.00 30.43 ? 359  GLN A O   1 
ATOM   2820 C  CB  . GLN A 1 343 ? -27.717 10.821 -6.664  1.00 30.94 ? 359  GLN A CB  1 
ATOM   2821 C  CG  . GLN A 1 343 ? -28.065 10.973 -8.151  1.00 31.59 ? 359  GLN A CG  1 
ATOM   2822 C  CD  . GLN A 1 343 ? -29.559 11.005 -8.428  1.00 32.72 ? 359  GLN A CD  1 
ATOM   2823 O  OE1 . GLN A 1 343 ? -30.043 11.848 -9.185  1.00 33.58 ? 359  GLN A OE1 1 
ATOM   2824 N  NE2 . GLN A 1 343 ? -30.293 10.082 -7.827  1.00 32.86 ? 359  GLN A NE2 1 
ATOM   2825 N  N   . ASP A 1 344 ? -25.690 13.168 -6.306  1.00 30.27 ? 360  ASP A N   1 
ATOM   2826 C  CA  . ASP A 1 344 ? -25.087 14.425 -6.758  1.00 30.16 ? 360  ASP A CA  1 
ATOM   2827 C  C   . ASP A 1 344 ? -23.567 14.313 -6.864  1.00 29.77 ? 360  ASP A C   1 
ATOM   2828 O  O   . ASP A 1 344 ? -22.964 14.830 -7.806  1.00 29.41 ? 360  ASP A O   1 
ATOM   2829 C  CB  . ASP A 1 344 ? -25.466 15.582 -5.829  1.00 30.37 ? 360  ASP A CB  1 
ATOM   2830 C  CG  . ASP A 1 344 ? -25.073 16.938 -6.397  1.00 31.85 ? 360  ASP A CG  1 
ATOM   2831 O  OD1 . ASP A 1 344 ? -25.556 17.289 -7.498  1.00 34.34 ? 360  ASP A OD1 1 
ATOM   2832 O  OD2 . ASP A 1 344 ? -24.283 17.655 -5.746  1.00 33.57 ? 360  ASP A OD2 1 
ATOM   2833 N  N   . GLN A 1 345 ? -22.961 13.628 -5.896  1.00 29.63 ? 361  GLN A N   1 
ATOM   2834 C  CA  . GLN A 1 345 ? -21.518 13.408 -5.887  1.00 29.47 ? 361  GLN A CA  1 
ATOM   2835 C  C   . GLN A 1 345 ? -21.063 12.490 -7.016  1.00 29.52 ? 361  GLN A C   1 
ATOM   2836 O  O   . GLN A 1 345 ? -19.945 12.627 -7.514  1.00 29.32 ? 361  GLN A O   1 
ATOM   2837 C  CB  . GLN A 1 345 ? -21.062 12.860 -4.537  1.00 29.84 ? 361  GLN A CB  1 
ATOM   2838 C  CG  . GLN A 1 345 ? -20.922 13.921 -3.458  1.00 29.80 ? 361  GLN A CG  1 
ATOM   2839 C  CD  . GLN A 1 345 ? -19.672 14.755 -3.627  1.00 30.38 ? 361  GLN A CD  1 
ATOM   2840 O  OE1 . GLN A 1 345 ? -18.577 14.329 -3.265  1.00 30.36 ? 361  GLN A OE1 1 
ATOM   2841 N  NE2 . GLN A 1 345 ? -19.827 15.954 -4.179  1.00 30.06 ? 361  GLN A NE2 1 
ATOM   2842 N  N   . LEU A 1 346 ? -21.931 11.561 -7.415  1.00 29.42 ? 362  LEU A N   1 
ATOM   2843 C  CA  . LEU A 1 346 ? -21.664 10.710 -8.572  1.00 29.52 ? 362  LEU A CA  1 
ATOM   2844 C  C   . LEU A 1 346 ? -21.539 11.552 -9.844  1.00 29.11 ? 362  LEU A C   1 
ATOM   2845 O  O   . LEU A 1 346 ? -20.703 11.260 -10.702 1.00 29.03 ? 362  LEU A O   1 
ATOM   2846 C  CB  . LEU A 1 346 ? -22.745 9.631  -8.727  1.00 29.89 ? 362  LEU A CB  1 
ATOM   2847 C  CG  . LEU A 1 346 ? -22.531 8.513  -9.755  1.00 30.45 ? 362  LEU A CG  1 
ATOM   2848 C  CD1 . LEU A 1 346 ? -21.334 7.639  -9.399  1.00 31.19 ? 362  LEU A CD1 1 
ATOM   2849 C  CD2 . LEU A 1 346 ? -23.790 7.665  -9.885  1.00 31.12 ? 362  LEU A CD2 1 
ATOM   2850 N  N   . PHE A 1 347 ? -22.359 12.599 -9.951  1.00 28.48 ? 363  PHE A N   1 
ATOM   2851 C  CA  . PHE A 1 347 ? -22.263 13.546 -11.067 1.00 28.00 ? 363  PHE A CA  1 
ATOM   2852 C  C   . PHE A 1 347 ? -20.987 14.380 -10.985 1.00 27.60 ? 363  PHE A C   1 
ATOM   2853 O  O   . PHE A 1 347 ? -20.334 14.622 -12.000 1.00 27.68 ? 363  PHE A O   1 
ATOM   2854 C  CB  . PHE A 1 347 ? -23.487 14.472 -11.140 1.00 27.75 ? 363  PHE A CB  1 
ATOM   2855 C  CG  . PHE A 1 347 ? -24.808 13.749 -11.237 1.00 28.05 ? 363  PHE A CG  1 
ATOM   2856 C  CD1 . PHE A 1 347 ? -24.920 12.537 -11.918 1.00 28.49 ? 363  PHE A CD1 1 
ATOM   2857 C  CD2 . PHE A 1 347 ? -25.952 14.303 -10.668 1.00 28.14 ? 363  PHE A CD2 1 
ATOM   2858 C  CE1 . PHE A 1 347 ? -26.141 11.878 -12.005 1.00 29.03 ? 363  PHE A CE1 1 
ATOM   2859 C  CE2 . PHE A 1 347 ? -27.180 13.655 -10.756 1.00 28.02 ? 363  PHE A CE2 1 
ATOM   2860 C  CZ  . PHE A 1 347 ? -27.275 12.441 -11.423 1.00 28.71 ? 363  PHE A CZ  1 
ATOM   2861 N  N   . THR A 1 348 ? -20.639 14.814 -9.775  1.00 27.28 ? 364  THR A N   1 
ATOM   2862 C  CA  . THR A 1 348 ? -19.415 15.584 -9.539  1.00 27.06 ? 364  THR A CA  1 
ATOM   2863 C  C   . THR A 1 348 ? -18.161 14.790 -9.931  1.00 27.21 ? 364  THR A C   1 
ATOM   2864 O  O   . THR A 1 348 ? -17.246 15.338 -10.556 1.00 27.16 ? 364  THR A O   1 
ATOM   2865 C  CB  . THR A 1 348 ? -19.328 16.069 -8.072  1.00 27.06 ? 364  THR A CB  1 
ATOM   2866 O  OG1 . THR A 1 348 ? -20.460 16.897 -7.778  1.00 26.94 ? 364  THR A OG1 1 
ATOM   2867 C  CG2 . THR A 1 348 ? -18.057 16.874 -7.830  1.00 27.12 ? 364  THR A CG2 1 
ATOM   2868 N  N   . VAL A 1 349 ? -18.134 13.504 -9.578  1.00 27.27 ? 365  VAL A N   1 
ATOM   2869 C  CA  . VAL A 1 349 ? -17.040 12.609 -9.972  1.00 27.40 ? 365  VAL A CA  1 
ATOM   2870 C  C   . VAL A 1 349 ? -16.876 12.590 -11.494 1.00 27.27 ? 365  VAL A C   1 
ATOM   2871 O  O   . VAL A 1 349 ? -15.765 12.750 -12.001 1.00 27.26 ? 365  VAL A O   1 
ATOM   2872 C  CB  . VAL A 1 349 ? -17.229 11.169 -9.412  1.00 27.76 ? 365  VAL A CB  1 
ATOM   2873 C  CG1 . VAL A 1 349 ? -16.252 10.189 -10.063 1.00 27.97 ? 365  VAL A CG1 1 
ATOM   2874 C  CG2 . VAL A 1 349 ? -17.053 11.160 -7.899  1.00 27.80 ? 365  VAL A CG2 1 
ATOM   2875 N  N   . HIS A 1 350 ? -17.986 12.421 -12.211 1.00 27.07 ? 366  HIS A N   1 
ATOM   2876 C  CA  . HIS A 1 350 ? -17.978 12.435 -13.676 1.00 27.07 ? 366  HIS A CA  1 
ATOM   2877 C  C   . HIS A 1 350 ? -17.586 13.793 -14.265 1.00 26.70 ? 366  HIS A C   1 
ATOM   2878 O  O   . HIS A 1 350 ? -16.901 13.850 -15.290 1.00 26.49 ? 366  HIS A O   1 
ATOM   2879 C  CB  . HIS A 1 350 ? -19.328 11.981 -14.230 1.00 27.10 ? 366  HIS A CB  1 
ATOM   2880 C  CG  . HIS A 1 350 ? -19.572 10.511 -14.085 1.00 27.81 ? 366  HIS A CG  1 
ATOM   2881 N  ND1 . HIS A 1 350 ? -19.425 9.626  -15.131 1.00 28.39 ? 366  HIS A ND1 1 
ATOM   2882 C  CD2 . HIS A 1 350 ? -19.939 9.769  -13.014 1.00 27.56 ? 366  HIS A CD2 1 
ATOM   2883 C  CE1 . HIS A 1 350 ? -19.698 8.404  -14.712 1.00 28.25 ? 366  HIS A CE1 1 
ATOM   2884 N  NE2 . HIS A 1 350 ? -20.012 8.463  -13.431 1.00 28.61 ? 366  HIS A NE2 1 
ATOM   2885 N  N   . HIS A 1 351 ? -18.021 14.875 -13.615 1.00 26.28 ? 367  HIS A N   1 
ATOM   2886 C  CA  . HIS A 1 351 ? -17.638 16.231 -14.020 1.00 26.08 ? 367  HIS A CA  1 
ATOM   2887 C  C   . HIS A 1 351 ? -16.119 16.396 -14.002 1.00 26.12 ? 367  HIS A C   1 
ATOM   2888 O  O   . HIS A 1 351 ? -15.521 16.842 -14.986 1.00 26.21 ? 367  HIS A O   1 
ATOM   2889 C  CB  . HIS A 1 351 ? -18.298 17.290 -13.121 1.00 25.67 ? 367  HIS A CB  1 
ATOM   2890 C  CG  . HIS A 1 351 ? -17.838 18.690 -13.399 1.00 25.14 ? 367  HIS A CG  1 
ATOM   2891 N  ND1 . HIS A 1 351 ? -18.541 19.557 -14.206 1.00 24.63 ? 367  HIS A ND1 1 
ATOM   2892 C  CD2 . HIS A 1 351 ? -16.739 19.367 -12.988 1.00 25.10 ? 367  HIS A CD2 1 
ATOM   2893 C  CE1 . HIS A 1 351 ? -17.900 20.709 -14.278 1.00 24.44 ? 367  HIS A CE1 1 
ATOM   2894 N  NE2 . HIS A 1 351 ? -16.799 20.619 -13.553 1.00 24.74 ? 367  HIS A NE2 1 
ATOM   2895 N  N   . GLU A 1 352 ? -15.508 16.026 -12.880 1.00 26.29 ? 368  GLU A N   1 
ATOM   2896 C  CA  . GLU A 1 352 ? -14.068 16.171 -12.691 1.00 26.34 ? 368  GLU A CA  1 
ATOM   2897 C  C   . GLU A 1 352 ? -13.267 15.239 -13.591 1.00 26.29 ? 368  GLU A C   1 
ATOM   2898 O  O   . GLU A 1 352 ? -12.191 15.608 -14.071 1.00 26.20 ? 368  GLU A O   1 
ATOM   2899 C  CB  . GLU A 1 352 ? -13.690 15.962 -11.220 1.00 26.67 ? 368  GLU A CB  1 
ATOM   2900 C  CG  . GLU A 1 352 ? -14.161 17.079 -10.292 1.00 27.43 ? 368  GLU A CG  1 
ATOM   2901 C  CD  . GLU A 1 352 ? -13.685 18.452 -10.735 1.00 27.97 ? 368  GLU A CD  1 
ATOM   2902 O  OE1 . GLU A 1 352 ? -12.498 18.600 -11.086 1.00 28.48 ? 368  GLU A OE1 1 
ATOM   2903 O  OE2 . GLU A 1 352 ? -14.504 19.388 -10.732 1.00 28.83 ? 368  GLU A OE2 1 
ATOM   2904 N  N   . LEU A 1 353 ? -13.796 14.039 -13.825 1.00 26.22 ? 369  LEU A N   1 
ATOM   2905 C  CA  . LEU A 1 353 ? -13.164 13.085 -14.737 1.00 26.34 ? 369  LEU A CA  1 
ATOM   2906 C  C   . LEU A 1 353 ? -13.234 13.569 -16.187 1.00 25.99 ? 369  LEU A C   1 
ATOM   2907 O  O   . LEU A 1 353 ? -12.413 13.177 -17.019 1.00 26.17 ? 369  LEU A O   1 
ATOM   2908 C  CB  . LEU A 1 353 ? -13.775 11.688 -14.586 1.00 26.67 ? 369  LEU A CB  1 
ATOM   2909 C  CG  . LEU A 1 353 ? -13.429 10.912 -13.308 1.00 26.87 ? 369  LEU A CG  1 
ATOM   2910 C  CD1 . LEU A 1 353 ? -14.234 9.631  -13.241 1.00 27.24 ? 369  LEU A CD1 1 
ATOM   2911 C  CD2 . LEU A 1 353 ? -11.936 10.607 -13.202 1.00 26.81 ? 369  LEU A CD2 1 
ATOM   2912 N  N   . GLY A 1 354 ? -14.213 14.427 -16.475 1.00 25.40 ? 370  GLY A N   1 
ATOM   2913 C  CA  . GLY A 1 354 ? -14.303 15.105 -17.768 1.00 24.86 ? 370  GLY A CA  1 
ATOM   2914 C  C   . GLY A 1 354 ? -13.111 16.015 -18.022 1.00 24.68 ? 370  GLY A C   1 
ATOM   2915 O  O   . GLY A 1 354 ? -12.584 16.056 -19.137 1.00 24.71 ? 370  GLY A O   1 
ATOM   2916 N  N   . HIS A 1 355 ? -12.690 16.744 -16.986 1.00 24.30 ? 371  HIS A N   1 
ATOM   2917 C  CA  . HIS A 1 355 ? -11.482 17.572 -17.048 1.00 23.99 ? 371  HIS A CA  1 
ATOM   2918 C  C   . HIS A 1 355 ? -10.239 16.719 -17.272 1.00 24.25 ? 371  HIS A C   1 
ATOM   2919 O  O   . HIS A 1 355 ? -9.409  17.034 -18.125 1.00 24.18 ? 371  HIS A O   1 
ATOM   2920 C  CB  . HIS A 1 355 ? -11.298 18.381 -15.765 1.00 23.80 ? 371  HIS A CB  1 
ATOM   2921 C  CG  . HIS A 1 355 ? -12.307 19.467 -15.574 1.00 23.59 ? 371  HIS A CG  1 
ATOM   2922 N  ND1 . HIS A 1 355 ? -12.470 20.500 -16.471 1.00 23.15 ? 371  HIS A ND1 1 
ATOM   2923 C  CD2 . HIS A 1 355 ? -13.184 19.699 -14.569 1.00 22.76 ? 371  HIS A CD2 1 
ATOM   2924 C  CE1 . HIS A 1 355 ? -13.416 21.313 -16.036 1.00 23.00 ? 371  HIS A CE1 1 
ATOM   2925 N  NE2 . HIS A 1 355 ? -13.864 20.850 -14.883 1.00 22.92 ? 371  HIS A NE2 1 
ATOM   2926 N  N   . ILE A 1 356 ? -10.122 15.643 -16.496 1.00 24.35 ? 372  ILE A N   1 
ATOM   2927 C  CA  . ILE A 1 356 ? -8.997  14.714 -16.607 1.00 24.55 ? 372  ILE A CA  1 
ATOM   2928 C  C   . ILE A 1 356 ? -8.891  14.135 -18.018 1.00 24.59 ? 372  ILE A C   1 
ATOM   2929 O  O   . ILE A 1 356 ? -7.800  14.089 -18.592 1.00 24.84 ? 372  ILE A O   1 
ATOM   2930 C  CB  . ILE A 1 356 ? -9.079  13.573 -15.553 1.00 24.89 ? 372  ILE A CB  1 
ATOM   2931 C  CG1 . ILE A 1 356 ? -9.011  14.134 -14.124 1.00 24.60 ? 372  ILE A CG1 1 
ATOM   2932 C  CG2 . ILE A 1 356 ? -7.990  12.519 -15.796 1.00 25.33 ? 372  ILE A CG2 1 
ATOM   2933 C  CD1 . ILE A 1 356 ? -7.650  14.700 -13.700 1.00 24.81 ? 372  ILE A CD1 1 
ATOM   2934 N  N   . GLN A 1 357 ? -10.023 13.709 -18.575 1.00 24.42 ? 373  GLN A N   1 
ATOM   2935 C  CA  . GLN A 1 357 ? -10.058 13.189 -19.939 1.00 24.68 ? 373  GLN A CA  1 
ATOM   2936 C  C   . GLN A 1 357 ? -9.530  14.214 -20.943 1.00 24.49 ? 373  GLN A C   1 
ATOM   2937 O  O   . GLN A 1 357 ? -8.733  13.875 -21.822 1.00 24.65 ? 373  GLN A O   1 
ATOM   2938 C  CB  . GLN A 1 357 ? -11.470 12.736 -20.321 1.00 24.76 ? 373  GLN A CB  1 
ATOM   2939 C  CG  . GLN A 1 357 ? -11.564 12.030 -21.682 1.00 25.36 ? 373  GLN A CG  1 
ATOM   2940 C  CD  . GLN A 1 357 ? -10.808 10.709 -21.734 1.00 26.80 ? 373  GLN A CD  1 
ATOM   2941 O  OE1 . GLN A 1 357 ? -10.734 9.975  -20.742 1.00 27.74 ? 373  GLN A OE1 1 
ATOM   2942 N  NE2 . GLN A 1 357 ? -10.253 10.394 -22.899 1.00 26.31 ? 373  GLN A NE2 1 
ATOM   2943 N  N   . TYR A 1 358 ? -9.973  15.463 -20.796 1.00 23.95 ? 374  TYR A N   1 
ATOM   2944 C  CA  . TYR A 1 358 ? -9.500  16.564 -21.631 1.00 23.80 ? 374  TYR A CA  1 
ATOM   2945 C  C   . TYR A 1 358 ? -7.976  16.700 -21.531 1.00 23.94 ? 374  TYR A C   1 
ATOM   2946 O  O   . TYR A 1 358 ? -7.304  16.814 -22.558 1.00 23.88 ? 374  TYR A O   1 
ATOM   2947 C  CB  . TYR A 1 358 ? -10.180 17.877 -21.219 1.00 23.35 ? 374  TYR A CB  1 
ATOM   2948 C  CG  . TYR A 1 358 ? -10.599 18.803 -22.355 1.00 22.92 ? 374  TYR A CG  1 
ATOM   2949 C  CD1 . TYR A 1 358 ? -9.952  18.784 -23.594 1.00 22.99 ? 374  TYR A CD1 1 
ATOM   2950 C  CD2 . TYR A 1 358 ? -11.655 19.696 -22.182 1.00 22.36 ? 374  TYR A CD2 1 
ATOM   2951 C  CE1 . TYR A 1 358 ? -10.342 19.644 -24.628 1.00 22.80 ? 374  TYR A CE1 1 
ATOM   2952 C  CE2 . TYR A 1 358 ? -12.054 20.558 -23.204 1.00 22.30 ? 374  TYR A CE2 1 
ATOM   2953 C  CZ  . TYR A 1 358 ? -11.394 20.527 -24.422 1.00 22.83 ? 374  TYR A CZ  1 
ATOM   2954 O  OH  . TYR A 1 358 ? -11.795 21.376 -25.429 1.00 22.54 ? 374  TYR A OH  1 
ATOM   2955 N  N   . PHE A 1 359 ? -7.440  16.662 -20.305 1.00 24.07 ? 375  PHE A N   1 
ATOM   2956 C  CA  . PHE A 1 359 ? -5.983  16.730 -20.077 1.00 24.45 ? 375  PHE A CA  1 
ATOM   2957 C  C   . PHE A 1 359 ? -5.246  15.645 -20.860 1.00 25.06 ? 375  PHE A C   1 
ATOM   2958 O  O   . PHE A 1 359 ? -4.246  15.919 -21.530 1.00 25.14 ? 375  PHE A O   1 
ATOM   2959 C  CB  . PHE A 1 359 ? -5.613  16.568 -18.593 1.00 24.51 ? 375  PHE A CB  1 
ATOM   2960 C  CG  . PHE A 1 359 ? -6.190  17.615 -17.668 1.00 24.32 ? 375  PHE A CG  1 
ATOM   2961 C  CD1 . PHE A 1 359 ? -6.496  18.900 -18.114 1.00 24.17 ? 375  PHE A CD1 1 
ATOM   2962 C  CD2 . PHE A 1 359 ? -6.374  17.316 -16.319 1.00 24.50 ? 375  PHE A CD2 1 
ATOM   2963 C  CE1 . PHE A 1 359 ? -7.013  19.856 -17.236 1.00 23.91 ? 375  PHE A CE1 1 
ATOM   2964 C  CE2 . PHE A 1 359 ? -6.887  18.265 -15.436 1.00 24.24 ? 375  PHE A CE2 1 
ATOM   2965 C  CZ  . PHE A 1 359 ? -7.205  19.538 -15.895 1.00 23.94 ? 375  PHE A CZ  1 
ATOM   2966 N  N   . LEU A 1 360 ? -5.745  14.413 -20.755 1.00 25.50 ? 376  LEU A N   1 
ATOM   2967 C  CA  . LEU A 1 360 ? -5.131  13.258 -21.407 1.00 26.21 ? 376  LEU A CA  1 
ATOM   2968 C  C   . LEU A 1 360 ? -5.249  13.340 -22.926 1.00 26.36 ? 376  LEU A C   1 
ATOM   2969 O  O   . LEU A 1 360 ? -4.324  12.957 -23.646 1.00 26.70 ? 376  LEU A O   1 
ATOM   2970 C  CB  . LEU A 1 360 ? -5.745  11.949 -20.891 1.00 26.43 ? 376  LEU A CB  1 
ATOM   2971 C  CG  . LEU A 1 360 ? -5.539  11.593 -19.412 1.00 26.74 ? 376  LEU A CG  1 
ATOM   2972 C  CD1 . LEU A 1 360 ? -6.444  10.436 -19.002 1.00 27.18 ? 376  LEU A CD1 1 
ATOM   2973 C  CD2 . LEU A 1 360 ? -4.079  11.272 -19.100 1.00 27.05 ? 376  LEU A CD2 1 
ATOM   2974 N  N   . GLN A 1 361 ? -6.381  13.857 -23.400 1.00 26.10 ? 377  GLN A N   1 
ATOM   2975 C  CA  . GLN A 1 361 ? -6.648  13.978 -24.833 1.00 26.40 ? 377  GLN A CA  1 
ATOM   2976 C  C   . GLN A 1 361 ? -5.734  14.981 -25.545 1.00 26.33 ? 377  GLN A C   1 
ATOM   2977 O  O   . GLN A 1 361 ? -5.366  14.769 -26.703 1.00 26.47 ? 377  GLN A O   1 
ATOM   2978 C  CB  . GLN A 1 361 ? -8.117  14.327 -25.091 1.00 26.23 ? 377  GLN A CB  1 
ATOM   2979 C  CG  . GLN A 1 361 ? -9.106  13.184 -24.820 1.00 27.38 ? 377  GLN A CG  1 
ATOM   2980 C  CD  . GLN A 1 361 ? -9.042  12.068 -25.849 1.00 28.57 ? 377  GLN A CD  1 
ATOM   2981 O  OE1 . GLN A 1 361 ? -9.222  10.893 -25.518 1.00 29.95 ? 377  GLN A OE1 1 
ATOM   2982 N  NE2 . GLN A 1 361 ? -8.785  12.427 -27.103 1.00 28.61 ? 377  GLN A NE2 1 
ATOM   2983 N  N   . TYR A 1 362 ? -5.368  16.064 -24.861 1.00 26.01 ? 378  TYR A N   1 
ATOM   2984 C  CA  . TYR A 1 362 ? -4.522  17.089 -25.484 1.00 26.06 ? 378  TYR A CA  1 
ATOM   2985 C  C   . TYR A 1 362 ? -3.073  17.180 -24.979 1.00 26.30 ? 378  TYR A C   1 
ATOM   2986 O  O   . TYR A 1 362 ? -2.366  18.131 -25.315 1.00 26.22 ? 378  TYR A O   1 
ATOM   2987 C  CB  . TYR A 1 362 ? -5.205  18.474 -25.493 1.00 25.41 ? 378  TYR A CB  1 
ATOM   2988 C  CG  . TYR A 1 362 ? -5.527  19.123 -24.149 1.00 24.63 ? 378  TYR A CG  1 
ATOM   2989 C  CD1 . TYR A 1 362 ? -4.591  19.181 -23.113 1.00 24.31 ? 378  TYR A CD1 1 
ATOM   2990 C  CD2 . TYR A 1 362 ? -6.760  19.740 -23.948 1.00 24.17 ? 378  TYR A CD2 1 
ATOM   2991 C  CE1 . TYR A 1 362 ? -4.897  19.803 -21.898 1.00 23.53 ? 378  TYR A CE1 1 
ATOM   2992 C  CE2 . TYR A 1 362 ? -7.075  20.362 -22.744 1.00 23.28 ? 378  TYR A CE2 1 
ATOM   2993 C  CZ  . TYR A 1 362 ? -6.145  20.393 -21.726 1.00 23.62 ? 378  TYR A CZ  1 
ATOM   2994 O  OH  . TYR A 1 362 ? -6.472  21.020 -20.544 1.00 23.04 ? 378  TYR A OH  1 
ATOM   2995 N  N   . GLN A 1 363 ? -2.625  16.195 -24.200 1.00 26.76 ? 379  GLN A N   1 
ATOM   2996 C  CA  . GLN A 1 363 ? -1.279  16.248 -23.609 1.00 27.28 ? 379  GLN A CA  1 
ATOM   2997 C  C   . GLN A 1 363 ? -0.138  16.190 -24.641 1.00 27.45 ? 379  GLN A C   1 
ATOM   2998 O  O   . GLN A 1 363 ? 1.001   16.521 -24.322 1.00 27.51 ? 379  GLN A O   1 
ATOM   2999 C  CB  . GLN A 1 363 ? -1.096  15.188 -22.507 1.00 27.52 ? 379  GLN A CB  1 
ATOM   3000 C  CG  . GLN A 1 363 ? -1.087  13.739 -22.982 1.00 28.92 ? 379  GLN A CG  1 
ATOM   3001 C  CD  . GLN A 1 363 ? -0.942  12.735 -21.843 1.00 30.15 ? 379  GLN A CD  1 
ATOM   3002 O  OE1 . GLN A 1 363 ? -0.825  13.106 -20.672 1.00 30.60 ? 379  GLN A OE1 1 
ATOM   3003 N  NE2 . GLN A 1 363 ? -0.948  11.454 -22.187 1.00 30.90 ? 379  GLN A NE2 1 
ATOM   3004 N  N   . HIS A 1 364 ? -0.463  15.788 -25.868 1.00 27.68 ? 380  HIS A N   1 
ATOM   3005 C  CA  . HIS A 1 364 ? 0.500   15.733 -26.972 1.00 28.20 ? 380  HIS A CA  1 
ATOM   3006 C  C   . HIS A 1 364 ? 0.675   17.091 -27.658 1.00 27.96 ? 380  HIS A C   1 
ATOM   3007 O  O   . HIS A 1 364 ? 1.628   17.287 -28.414 1.00 28.01 ? 380  HIS A O   1 
ATOM   3008 C  CB  . HIS A 1 364 ? 0.052   14.697 -28.008 1.00 28.61 ? 380  HIS A CB  1 
ATOM   3009 C  CG  . HIS A 1 364 ? -1.248  15.035 -28.668 1.00 28.79 ? 380  HIS A CG  1 
ATOM   3010 N  ND1 . HIS A 1 364 ? -1.337  15.404 -29.993 1.00 29.54 ? 380  HIS A ND1 1 
ATOM   3011 C  CD2 . HIS A 1 364 ? -2.508  15.092 -28.176 1.00 28.30 ? 380  HIS A CD2 1 
ATOM   3012 C  CE1 . HIS A 1 364 ? -2.598  15.660 -30.292 1.00 29.08 ? 380  HIS A CE1 1 
ATOM   3013 N  NE2 . HIS A 1 364 ? -3.329  15.476 -29.207 1.00 28.73 ? 380  HIS A NE2 1 
ATOM   3014 N  N   . GLN A 1 365 ? -0.252  18.016 -27.402 1.00 27.51 ? 381  GLN A N   1 
ATOM   3015 C  CA  . GLN A 1 365 ? -0.214  19.359 -27.996 1.00 27.32 ? 381  GLN A CA  1 
ATOM   3016 C  C   . GLN A 1 365 ? 0.930   20.198 -27.424 1.00 27.29 ? 381  GLN A C   1 
ATOM   3017 O  O   . GLN A 1 365 ? 1.395   19.925 -26.315 1.00 27.22 ? 381  GLN A O   1 
ATOM   3018 C  CB  . GLN A 1 365 ? -1.546  20.091 -27.761 1.00 26.84 ? 381  GLN A CB  1 
ATOM   3019 C  CG  . GLN A 1 365 ? -2.761  19.477 -28.464 1.00 27.24 ? 381  GLN A CG  1 
ATOM   3020 C  CD  . GLN A 1 365 ? -2.857  19.828 -29.946 1.00 28.35 ? 381  GLN A CD  1 
ATOM   3021 O  OE1 . GLN A 1 365 ? -3.599  19.190 -30.695 1.00 28.97 ? 381  GLN A OE1 1 
ATOM   3022 N  NE2 . GLN A 1 365 ? -2.115  20.845 -30.372 1.00 27.86 ? 381  GLN A NE2 1 
ATOM   3023 N  N   . PRO A 1 366 ? 1.388   21.224 -28.177 1.00 27.28 ? 382  PRO A N   1 
ATOM   3024 C  CA  . PRO A 1 366 ? 2.289   22.220 -27.594 1.00 27.21 ? 382  PRO A CA  1 
ATOM   3025 C  C   . PRO A 1 366 ? 1.665   22.819 -26.336 1.00 26.80 ? 382  PRO A C   1 
ATOM   3026 O  O   . PRO A 1 366 ? 0.440   22.959 -26.270 1.00 26.67 ? 382  PRO A O   1 
ATOM   3027 C  CB  . PRO A 1 366 ? 2.380   23.292 -28.685 1.00 27.12 ? 382  PRO A CB  1 
ATOM   3028 C  CG  . PRO A 1 366 ? 2.112   22.572 -29.946 1.00 27.43 ? 382  PRO A CG  1 
ATOM   3029 C  CD  . PRO A 1 366 ? 1.142   21.477 -29.610 1.00 27.41 ? 382  PRO A CD  1 
ATOM   3030 N  N   . PHE A 1 367 ? 2.498   23.167 -25.357 1.00 26.74 ? 383  PHE A N   1 
ATOM   3031 C  CA  . PHE A 1 367 ? 2.025   23.673 -24.062 1.00 26.46 ? 383  PHE A CA  1 
ATOM   3032 C  C   . PHE A 1 367 ? 0.894   24.705 -24.145 1.00 25.91 ? 383  PHE A C   1 
ATOM   3033 O  O   . PHE A 1 367 ? -0.101  24.587 -23.432 1.00 25.46 ? 383  PHE A O   1 
ATOM   3034 C  CB  . PHE A 1 367 ? 3.185   24.237 -23.231 1.00 26.75 ? 383  PHE A CB  1 
ATOM   3035 C  CG  . PHE A 1 367 ? 2.743   24.940 -21.974 1.00 27.10 ? 383  PHE A CG  1 
ATOM   3036 C  CD1 . PHE A 1 367 ? 2.400   24.212 -20.838 1.00 27.89 ? 383  PHE A CD1 1 
ATOM   3037 C  CD2 . PHE A 1 367 ? 2.655   26.327 -21.932 1.00 27.34 ? 383  PHE A CD2 1 
ATOM   3038 C  CE1 . PHE A 1 367 ? 1.986   24.856 -19.674 1.00 28.10 ? 383  PHE A CE1 1 
ATOM   3039 C  CE2 . PHE A 1 367 ? 2.238   26.982 -20.772 1.00 27.98 ? 383  PHE A CE2 1 
ATOM   3040 C  CZ  . PHE A 1 367 ? 1.903   26.243 -19.642 1.00 27.64 ? 383  PHE A CZ  1 
ATOM   3041 N  N   . VAL A 1 368 ? 1.051   25.717 -24.999 1.00 25.64 ? 384  VAL A N   1 
ATOM   3042 C  CA  . VAL A 1 368 ? 0.050   26.793 -25.089 1.00 25.25 ? 384  VAL A CA  1 
ATOM   3043 C  C   . VAL A 1 368 ? -1.325  26.293 -25.554 1.00 24.93 ? 384  VAL A C   1 
ATOM   3044 O  O   . VAL A 1 368 ? -2.340  26.941 -25.304 1.00 24.65 ? 384  VAL A O   1 
ATOM   3045 C  CB  . VAL A 1 368 ? 0.522   28.006 -25.952 1.00 25.29 ? 384  VAL A CB  1 
ATOM   3046 C  CG1 . VAL A 1 368 ? 1.688   28.727 -25.280 1.00 25.50 ? 384  VAL A CG1 1 
ATOM   3047 C  CG2 . VAL A 1 368 ? 0.878   27.581 -27.376 1.00 25.89 ? 384  VAL A CG2 1 
ATOM   3048 N  N   . TYR A 1 369 ? -1.345  25.138 -26.217 1.00 24.90 ? 385  TYR A N   1 
ATOM   3049 C  CA  . TYR A 1 369 ? -2.590  24.529 -26.685 1.00 24.71 ? 385  TYR A CA  1 
ATOM   3050 C  C   . TYR A 1 369 ? -3.161  23.512 -25.689 1.00 24.73 ? 385  TYR A C   1 
ATOM   3051 O  O   . TYR A 1 369 ? -4.243  22.961 -25.906 1.00 24.80 ? 385  TYR A O   1 
ATOM   3052 C  CB  . TYR A 1 369 ? -2.388  23.866 -28.050 1.00 25.02 ? 385  TYR A CB  1 
ATOM   3053 C  CG  . TYR A 1 369 ? -2.125  24.820 -29.203 1.00 24.78 ? 385  TYR A CG  1 
ATOM   3054 C  CD1 . TYR A 1 369 ? -2.524  26.158 -29.146 1.00 24.42 ? 385  TYR A CD1 1 
ATOM   3055 C  CD2 . TYR A 1 369 ? -1.506  24.369 -30.367 1.00 25.24 ? 385  TYR A CD2 1 
ATOM   3056 C  CE1 . TYR A 1 369 ? -2.293  27.025 -30.213 1.00 24.58 ? 385  TYR A CE1 1 
ATOM   3057 C  CE2 . TYR A 1 369 ? -1.276  25.223 -31.439 1.00 25.30 ? 385  TYR A CE2 1 
ATOM   3058 C  CZ  . TYR A 1 369 ? -1.672  26.549 -31.357 1.00 24.87 ? 385  TYR A CZ  1 
ATOM   3059 O  OH  . TYR A 1 369 ? -1.444  27.397 -32.418 1.00 24.96 ? 385  TYR A OH  1 
ATOM   3060 N  N   . ARG A 1 370 ? -2.435  23.268 -24.601 1.00 24.71 ? 386  ARG A N   1 
ATOM   3061 C  CA  . ARG A 1 370 ? -2.866  22.301 -23.595 1.00 24.81 ? 386  ARG A CA  1 
ATOM   3062 C  C   . ARG A 1 370 ? -3.868  22.920 -22.618 1.00 24.38 ? 386  ARG A C   1 
ATOM   3063 O  O   . ARG A 1 370 ? -3.613  23.034 -21.419 1.00 24.48 ? 386  ARG A O   1 
ATOM   3064 C  CB  . ARG A 1 370 ? -1.664  21.674 -22.878 1.00 24.96 ? 386  ARG A CB  1 
ATOM   3065 C  CG  . ARG A 1 370 ? -0.836  20.754 -23.774 1.00 25.70 ? 386  ARG A CG  1 
ATOM   3066 C  CD  . ARG A 1 370 ? 0.407   20.230 -23.073 1.00 26.27 ? 386  ARG A CD  1 
ATOM   3067 N  NE  . ARG A 1 370 ? 0.085   19.218 -22.069 1.00 26.63 ? 386  ARG A NE  1 
ATOM   3068 C  CZ  . ARG A 1 370 ? 0.979   18.429 -21.478 1.00 27.35 ? 386  ARG A CZ  1 
ATOM   3069 N  NH1 . ARG A 1 370 ? 2.268   18.518 -21.791 1.00 27.40 ? 386  ARG A NH1 1 
ATOM   3070 N  NH2 . ARG A 1 370 ? 0.581   17.539 -20.578 1.00 27.06 ? 386  ARG A NH2 1 
ATOM   3071 N  N   . THR A 1 371 ? -5.006  23.330 -23.169 1.00 24.31 ? 387  THR A N   1 
ATOM   3072 C  CA  . THR A 1 371 ? -6.133  23.872 -22.409 1.00 24.08 ? 387  THR A CA  1 
ATOM   3073 C  C   . THR A 1 371 ? -7.392  23.733 -23.270 1.00 23.81 ? 387  THR A C   1 
ATOM   3074 O  O   . THR A 1 371 ? -7.301  23.330 -24.428 1.00 23.89 ? 387  THR A O   1 
ATOM   3075 C  CB  . THR A 1 371 ? -5.888  25.340 -21.952 1.00 23.93 ? 387  THR A CB  1 
ATOM   3076 O  OG1 . THR A 1 371 ? -6.961  25.763 -21.103 1.00 24.46 ? 387  THR A OG1 1 
ATOM   3077 C  CG2 . THR A 1 371 ? -5.773  26.290 -23.140 1.00 24.24 ? 387  THR A CG2 1 
ATOM   3078 N  N   . GLY A 1 372 ? -8.558  24.045 -22.710 1.00 23.43 ? 388  GLY A N   1 
ATOM   3079 C  CA  . GLY A 1 372 ? -9.823  23.887 -23.439 1.00 23.29 ? 388  GLY A CA  1 
ATOM   3080 C  C   . GLY A 1 372 ? -9.967  24.826 -24.624 1.00 23.18 ? 388  GLY A C   1 
ATOM   3081 O  O   . GLY A 1 372 ? -9.329  25.880 -24.666 1.00 22.97 ? 388  GLY A O   1 
ATOM   3082 N  N   . ALA A 1 373 ? -10.806 24.440 -25.588 1.00 23.21 ? 389  ALA A N   1 
ATOM   3083 C  CA  . ALA A 1 373 ? -11.106 25.276 -26.758 1.00 23.23 ? 389  ALA A CA  1 
ATOM   3084 C  C   . ALA A 1 373 ? -11.620 26.649 -26.321 1.00 22.76 ? 389  ALA A C   1 
ATOM   3085 O  O   . ALA A 1 373 ? -11.246 27.675 -26.890 1.00 22.82 ? 389  ALA A O   1 
ATOM   3086 C  CB  . ALA A 1 373 ? -12.110 24.585 -27.665 1.00 23.41 ? 389  ALA A CB  1 
ATOM   3087 N  N   . ASN A 1 374 ? -12.499 26.641 -25.322 1.00 22.46 ? 390  ASN A N   1 
ATOM   3088 C  CA  . ASN A 1 374 ? -12.751 27.801 -24.464 1.00 22.11 ? 390  ASN A CA  1 
ATOM   3089 C  C   . ASN A 1 374 ? -13.097 27.287 -23.055 1.00 21.90 ? 390  ASN A C   1 
ATOM   3090 O  O   . ASN A 1 374 ? -13.336 26.089 -22.892 1.00 22.19 ? 390  ASN A O   1 
ATOM   3091 C  CB  . ASN A 1 374 ? -13.788 28.779 -25.070 1.00 22.14 ? 390  ASN A CB  1 
ATOM   3092 C  CG  . ASN A 1 374 ? -15.225 28.279 -24.990 1.00 22.29 ? 390  ASN A CG  1 
ATOM   3093 O  OD1 . ASN A 1 374 ? -15.661 27.731 -23.980 1.00 23.04 ? 390  ASN A OD1 1 
ATOM   3094 N  ND2 . ASN A 1 374 ? -15.986 28.520 -26.053 1.00 22.57 ? 390  ASN A ND2 1 
ATOM   3095 N  N   . PRO A 1 375 ? -13.090 28.162 -22.029 1.00 21.67 ? 391  PRO A N   1 
ATOM   3096 C  CA  . PRO A 1 375 ? -13.305 27.648 -20.667 1.00 21.35 ? 391  PRO A CA  1 
ATOM   3097 C  C   . PRO A 1 375 ? -14.594 26.832 -20.482 1.00 21.23 ? 391  PRO A C   1 
ATOM   3098 O  O   . PRO A 1 375 ? -14.619 25.907 -19.664 1.00 21.21 ? 391  PRO A O   1 
ATOM   3099 C  CB  . PRO A 1 375 ? -13.341 28.921 -19.822 1.00 21.16 ? 391  PRO A CB  1 
ATOM   3100 C  CG  . PRO A 1 375 ? -12.474 29.869 -20.562 1.00 21.53 ? 391  PRO A CG  1 
ATOM   3101 C  CD  . PRO A 1 375 ? -12.744 29.597 -22.015 1.00 21.41 ? 391  PRO A CD  1 
ATOM   3102 N  N   . GLY A 1 376 ? -15.638 27.161 -21.243 1.00 20.98 ? 392  GLY A N   1 
ATOM   3103 C  CA  . GLY A 1 376 ? -16.908 26.431 -21.197 1.00 20.84 ? 392  GLY A CA  1 
ATOM   3104 C  C   . GLY A 1 376 ? -16.827 24.997 -21.700 1.00 21.19 ? 392  GLY A C   1 
ATOM   3105 O  O   . GLY A 1 376 ? -17.528 24.120 -21.198 1.00 20.91 ? 392  GLY A O   1 
ATOM   3106 N  N   . PHE A 1 377 ? -15.975 24.762 -22.699 1.00 21.42 ? 393  PHE A N   1 
ATOM   3107 C  CA  . PHE A 1 377 ? -15.746 23.417 -23.228 1.00 21.85 ? 393  PHE A CA  1 
ATOM   3108 C  C   . PHE A 1 377 ? -15.221 22.475 -22.147 1.00 22.06 ? 393  PHE A C   1 
ATOM   3109 O  O   . PHE A 1 377 ? -15.699 21.352 -22.018 1.00 22.49 ? 393  PHE A O   1 
ATOM   3110 C  CB  . PHE A 1 377 ? -14.767 23.455 -24.407 1.00 21.94 ? 393  PHE A CB  1 
ATOM   3111 C  CG  . PHE A 1 377 ? -15.411 23.769 -25.731 1.00 22.05 ? 393  PHE A CG  1 
ATOM   3112 C  CD1 . PHE A 1 377 ? -16.071 24.977 -25.937 1.00 21.88 ? 393  PHE A CD1 1 
ATOM   3113 C  CD2 . PHE A 1 377 ? -15.346 22.855 -26.779 1.00 22.45 ? 393  PHE A CD2 1 
ATOM   3114 C  CE1 . PHE A 1 377 ? -16.663 25.266 -27.160 1.00 22.27 ? 393  PHE A CE1 1 
ATOM   3115 C  CE2 . PHE A 1 377 ? -15.931 23.138 -28.007 1.00 22.40 ? 393  PHE A CE2 1 
ATOM   3116 C  CZ  . PHE A 1 377 ? -16.590 24.343 -28.199 1.00 22.47 ? 393  PHE A CZ  1 
ATOM   3117 N  N   . HIS A 1 378 ? -14.254 22.951 -21.365 1.00 22.18 ? 394  HIS A N   1 
ATOM   3118 C  CA  . HIS A 1 378 ? -13.648 22.159 -20.295 1.00 22.55 ? 394  HIS A CA  1 
ATOM   3119 C  C   . HIS A 1 378 ? -14.681 21.745 -19.242 1.00 22.57 ? 394  HIS A C   1 
ATOM   3120 O  O   . HIS A 1 378 ? -14.683 20.603 -18.778 1.00 22.69 ? 394  HIS A O   1 
ATOM   3121 C  CB  . HIS A 1 378 ? -12.503 22.937 -19.636 1.00 22.38 ? 394  HIS A CB  1 
ATOM   3122 C  CG  . HIS A 1 378 ? -11.214 22.178 -19.575 1.00 23.10 ? 394  HIS A CG  1 
ATOM   3123 N  ND1 . HIS A 1 378 ? -11.061 21.027 -18.833 1.00 23.23 ? 394  HIS A ND1 1 
ATOM   3124 C  CD2 . HIS A 1 378 ? -10.019 22.404 -20.170 1.00 23.31 ? 394  HIS A CD2 1 
ATOM   3125 C  CE1 . HIS A 1 378 ? -9.827  20.577 -18.971 1.00 24.03 ? 394  HIS A CE1 1 
ATOM   3126 N  NE2 . HIS A 1 378 ? -9.174  21.394 -19.778 1.00 23.78 ? 394  HIS A NE2 1 
ATOM   3127 N  N   . GLU A 1 379 ? -15.563 22.675 -18.882 1.00 22.37 ? 395  GLU A N   1 
ATOM   3128 C  CA  . GLU A 1 379 ? -16.607 22.412 -17.889 1.00 22.38 ? 395  GLU A CA  1 
ATOM   3129 C  C   . GLU A 1 379 ? -17.719 21.495 -18.409 1.00 22.56 ? 395  GLU A C   1 
ATOM   3130 O  O   . GLU A 1 379 ? -18.386 20.815 -17.622 1.00 22.76 ? 395  GLU A O   1 
ATOM   3131 C  CB  . GLU A 1 379 ? -17.201 23.730 -17.368 1.00 22.02 ? 395  GLU A CB  1 
ATOM   3132 C  CG  . GLU A 1 379 ? -16.187 24.675 -16.714 1.00 22.18 ? 395  GLU A CG  1 
ATOM   3133 C  CD  . GLU A 1 379 ? -15.417 24.036 -15.564 1.00 22.47 ? 395  GLU A CD  1 
ATOM   3134 O  OE1 . GLU A 1 379 ? -15.989 23.190 -14.847 1.00 22.85 ? 395  GLU A OE1 1 
ATOM   3135 O  OE2 . GLU A 1 379 ? -14.236 24.382 -15.370 1.00 22.67 ? 395  GLU A OE2 1 
ATOM   3136 N  N   . ALA A 1 380 ? -17.898 21.463 -19.729 1.00 22.57 ? 396  ALA A N   1 
ATOM   3137 C  CA  . ALA A 1 380 ? -18.996 20.718 -20.352 1.00 22.81 ? 396  ALA A CA  1 
ATOM   3138 C  C   . ALA A 1 380 ? -18.769 19.210 -20.489 1.00 23.25 ? 396  ALA A C   1 
ATOM   3139 O  O   . ALA A 1 380 ? -19.732 18.443 -20.447 1.00 23.45 ? 396  ALA A O   1 
ATOM   3140 C  CB  . ALA A 1 380 ? -19.344 21.321 -21.708 1.00 22.62 ? 396  ALA A CB  1 
ATOM   3141 N  N   . VAL A 1 381 ? -17.513 18.792 -20.653 1.00 23.54 ? 397  VAL A N   1 
ATOM   3142 C  CA  . VAL A 1 381 ? -17.190 17.391 -20.984 1.00 24.17 ? 397  VAL A CA  1 
ATOM   3143 C  C   . VAL A 1 381 ? -17.812 16.388 -20.015 1.00 24.37 ? 397  VAL A C   1 
ATOM   3144 O  O   . VAL A 1 381 ? -18.553 15.500 -20.433 1.00 24.64 ? 397  VAL A O   1 
ATOM   3145 C  CB  . VAL A 1 381 ? -15.659 17.132 -21.081 1.00 24.28 ? 397  VAL A CB  1 
ATOM   3146 C  CG1 . VAL A 1 381 ? -15.384 15.699 -21.546 1.00 24.71 ? 397  VAL A CG1 1 
ATOM   3147 C  CG2 . VAL A 1 381 ? -15.007 18.119 -22.023 1.00 24.06 ? 397  VAL A CG2 1 
ATOM   3148 N  N   . GLY A 1 382 ? -17.506 16.539 -18.728 1.00 24.47 ? 398  GLY A N   1 
ATOM   3149 C  CA  . GLY A 1 382 ? -17.994 15.622 -17.702 1.00 24.83 ? 398  GLY A CA  1 
ATOM   3150 C  C   . GLY A 1 382 ? -19.498 15.672 -17.518 1.00 24.95 ? 398  GLY A C   1 
ATOM   3151 O  O   . GLY A 1 382 ? -20.124 14.656 -17.219 1.00 25.27 ? 398  GLY A O   1 
ATOM   3152 N  N   . ASP A 1 383 ? -20.075 16.856 -17.710 1.00 24.90 ? 399  ASP A N   1 
ATOM   3153 C  CA  . ASP A 1 383 ? -21.520 17.057 -17.574 1.00 25.03 ? 399  ASP A CA  1 
ATOM   3154 C  C   . ASP A 1 383 ? -22.337 16.345 -18.654 1.00 25.32 ? 399  ASP A C   1 
ATOM   3155 O  O   . ASP A 1 383 ? -23.489 15.978 -18.421 1.00 25.02 ? 399  ASP A O   1 
ATOM   3156 C  CB  . ASP A 1 383 ? -21.856 18.550 -17.561 1.00 24.76 ? 399  ASP A CB  1 
ATOM   3157 C  CG  . ASP A 1 383 ? -21.615 19.196 -16.207 1.00 25.11 ? 399  ASP A CG  1 
ATOM   3158 O  OD1 . ASP A 1 383 ? -20.844 18.635 -15.394 1.00 25.97 ? 399  ASP A OD1 1 
ATOM   3159 O  OD2 . ASP A 1 383 ? -22.198 20.276 -15.958 1.00 24.32 ? 399  ASP A OD2 1 
ATOM   3160 N  N   . VAL A 1 384 ? -21.743 16.156 -19.832 1.00 25.68 ? 400  VAL A N   1 
ATOM   3161 C  CA  . VAL A 1 384 ? -22.394 15.389 -20.895 1.00 26.20 ? 400  VAL A CA  1 
ATOM   3162 C  C   . VAL A 1 384 ? -22.598 13.938 -20.452 1.00 26.74 ? 400  VAL A C   1 
ATOM   3163 O  O   . VAL A 1 384 ? -23.665 13.361 -20.673 1.00 27.00 ? 400  VAL A O   1 
ATOM   3164 C  CB  . VAL A 1 384 ? -21.614 15.448 -22.229 1.00 26.36 ? 400  VAL A CB  1 
ATOM   3165 C  CG1 . VAL A 1 384 ? -22.317 14.622 -23.298 1.00 26.65 ? 400  VAL A CG1 1 
ATOM   3166 C  CG2 . VAL A 1 384 ? -21.471 16.886 -22.698 1.00 25.85 ? 400  VAL A CG2 1 
ATOM   3167 N  N   . LEU A 1 385 ? -21.581 13.363 -19.814 1.00 27.09 ? 401  LEU A N   1 
ATOM   3168 C  CA  . LEU A 1 385 ? -21.684 12.001 -19.293 1.00 27.84 ? 401  LEU A CA  1 
ATOM   3169 C  C   . LEU A 1 385 ? -22.640 11.939 -18.102 1.00 27.79 ? 401  LEU A C   1 
ATOM   3170 O  O   . LEU A 1 385 ? -23.391 10.975 -17.958 1.00 28.30 ? 401  LEU A O   1 
ATOM   3171 C  CB  . LEU A 1 385 ? -20.314 11.430 -18.902 1.00 27.97 ? 401  LEU A CB  1 
ATOM   3172 C  CG  . LEU A 1 385 ? -19.106 11.368 -19.855 1.00 28.90 ? 401  LEU A CG  1 
ATOM   3173 C  CD1 . LEU A 1 385 ? -18.320 10.104 -19.552 1.00 28.97 ? 401  LEU A CD1 1 
ATOM   3174 C  CD2 . LEU A 1 385 ? -19.456 11.417 -21.341 1.00 29.04 ? 401  LEU A CD2 1 
ATOM   3175 N  N   . SER A 1 386 ? -22.613 12.975 -17.263 1.00 27.50 ? 402  SER A N   1 
ATOM   3176 C  CA  . SER A 1 386 ? -23.497 13.065 -16.095 1.00 27.43 ? 402  SER A CA  1 
ATOM   3177 C  C   . SER A 1 386 ? -24.978 13.105 -16.473 1.00 27.35 ? 402  SER A C   1 
ATOM   3178 O  O   . SER A 1 386 ? -25.818 12.568 -15.748 1.00 27.40 ? 402  SER A O   1 
ATOM   3179 C  CB  . SER A 1 386 ? -23.145 14.279 -15.234 1.00 26.98 ? 402  SER A CB  1 
ATOM   3180 O  OG  . SER A 1 386 ? -21.962 14.051 -14.485 1.00 27.73 ? 402  SER A OG  1 
ATOM   3181 N  N   . LEU A 1 387 ? -25.288 13.741 -17.603 1.00 27.19 ? 403  LEU A N   1 
ATOM   3182 C  CA  . LEU A 1 387 ? -26.653 13.759 -18.131 1.00 27.26 ? 403  LEU A CA  1 
ATOM   3183 C  C   . LEU A 1 387 ? -27.157 12.349 -18.441 1.00 27.86 ? 403  LEU A C   1 
ATOM   3184 O  O   . LEU A 1 387 ? -28.296 12.015 -18.119 1.00 27.89 ? 403  LEU A O   1 
ATOM   3185 C  CB  . LEU A 1 387 ? -26.760 14.651 -19.375 1.00 26.95 ? 403  LEU A CB  1 
ATOM   3186 C  CG  . LEU A 1 387 ? -26.912 16.165 -19.192 1.00 26.43 ? 403  LEU A CG  1 
ATOM   3187 C  CD1 . LEU A 1 387 ? -26.750 16.870 -20.529 1.00 26.05 ? 403  LEU A CD1 1 
ATOM   3188 C  CD2 . LEU A 1 387 ? -28.252 16.541 -18.544 1.00 25.78 ? 403  LEU A CD2 1 
ATOM   3189 N  N   . SER A 1 388 ? -26.308 11.527 -19.058 1.00 28.29 ? 404  SER A N   1 
ATOM   3190 C  CA  . SER A 1 388 ? -26.671 10.137 -19.345 1.00 29.02 ? 404  SER A CA  1 
ATOM   3191 C  C   . SER A 1 388 ? -26.664 9.271  -18.084 1.00 28.93 ? 404  SER A C   1 
ATOM   3192 O  O   . SER A 1 388 ? -27.508 8.387  -17.941 1.00 29.29 ? 404  SER A O   1 
ATOM   3193 C  CB  . SER A 1 388 ? -25.770 9.535  -20.428 1.00 29.46 ? 404  SER A CB  1 
ATOM   3194 O  OG  . SER A 1 388 ? -24.419 9.544  -20.016 1.00 31.12 ? 404  SER A OG  1 
ATOM   3195 N  N   . VAL A 1 389 ? -25.724 9.530  -17.171 1.00 28.53 ? 405  VAL A N   1 
ATOM   3196 C  CA  . VAL A 1 389 ? -25.685 8.834  -15.874 1.00 28.34 ? 405  VAL A CA  1 
ATOM   3197 C  C   . VAL A 1 389 ? -26.983 9.067  -15.090 1.00 28.04 ? 405  VAL A C   1 
ATOM   3198 O  O   . VAL A 1 389 ? -27.475 8.161  -14.415 1.00 28.27 ? 405  VAL A O   1 
ATOM   3199 C  CB  . VAL A 1 389 ? -24.452 9.249  -15.014 1.00 28.15 ? 405  VAL A CB  1 
ATOM   3200 C  CG1 . VAL A 1 389 ? -24.544 8.678  -13.597 1.00 28.26 ? 405  VAL A CG1 1 
ATOM   3201 C  CG2 . VAL A 1 389 ? -23.161 8.781  -15.665 1.00 28.25 ? 405  VAL A CG2 1 
ATOM   3202 N  N   . SER A 1 390 ? -27.536 10.274 -15.214 1.00 27.35 ? 406  SER A N   1 
ATOM   3203 C  CA  . SER A 1 390 ? -28.741 10.680 -14.484 1.00 26.98 ? 406  SER A CA  1 
ATOM   3204 C  C   . SER A 1 390 ? -30.034 10.031 -14.981 1.00 27.29 ? 406  SER A C   1 
ATOM   3205 O  O   . SER A 1 390 ? -31.037 10.018 -14.259 1.00 27.19 ? 406  SER A O   1 
ATOM   3206 C  CB  . SER A 1 390 ? -28.899 12.202 -14.531 1.00 26.47 ? 406  SER A CB  1 
ATOM   3207 O  OG  . SER A 1 390 ? -29.382 12.624 -15.794 1.00 25.79 ? 406  SER A OG  1 
ATOM   3208 N  N   . THR A 1 391 ? -30.017 9.518  -16.211 1.00 27.59 ? 407  THR A N   1 
ATOM   3209 C  CA  . THR A 1 391 ? -31.211 8.924  -16.818 1.00 27.86 ? 407  THR A CA  1 
ATOM   3210 C  C   . THR A 1 391 ? -31.641 7.653  -16.091 1.00 28.40 ? 407  THR A C   1 
ATOM   3211 O  O   . THR A 1 391 ? -30.792 6.889  -15.618 1.00 28.50 ? 407  THR A O   1 
ATOM   3212 C  CB  . THR A 1 391 ? -31.011 8.578  -18.320 1.00 28.17 ? 407  THR A CB  1 
ATOM   3213 O  OG1 . THR A 1 391 ? -30.000 7.572  -18.458 1.00 27.90 ? 407  THR A OG1 1 
ATOM   3214 C  CG2 . THR A 1 391 ? -30.627 9.811  -19.120 1.00 27.77 ? 407  THR A CG2 1 
ATOM   3215 N  N   . PRO A 1 392 ? -32.965 7.429  -15.990 1.00 28.73 ? 408  PRO A N   1 
ATOM   3216 C  CA  . PRO A 1 392 ? -33.473 6.155  -15.488 1.00 29.22 ? 408  PRO A CA  1 
ATOM   3217 C  C   . PRO A 1 392 ? -32.877 4.965  -16.242 1.00 29.87 ? 408  PRO A C   1 
ATOM   3218 O  O   . PRO A 1 392 ? -32.575 3.943  -15.627 1.00 30.11 ? 408  PRO A O   1 
ATOM   3219 C  CB  . PRO A 1 392 ? -34.975 6.259  -15.746 1.00 29.32 ? 408  PRO A CB  1 
ATOM   3220 C  CG  . PRO A 1 392 ? -35.260 7.714  -15.632 1.00 28.78 ? 408  PRO A CG  1 
ATOM   3221 C  CD  . PRO A 1 392 ? -34.051 8.403  -16.211 1.00 28.44 ? 408  PRO A CD  1 
ATOM   3222 N  N   . LYS A 1 393 ? -32.691 5.118  -17.554 1.00 30.07 ? 409  LYS A N   1 
ATOM   3223 C  CA  . LYS A 1 393 ? -32.088 4.078  -18.392 1.00 30.85 ? 409  LYS A CA  1 
ATOM   3224 C  C   . LYS A 1 393 ? -30.743 3.592  -17.843 1.00 30.87 ? 409  LYS A C   1 
ATOM   3225 O  O   . LYS A 1 393 ? -30.545 2.390  -17.670 1.00 31.08 ? 409  LYS A O   1 
ATOM   3226 C  CB  . LYS A 1 393 ? -31.935 4.565  -19.838 1.00 30.82 ? 409  LYS A CB  1 
ATOM   3227 C  CG  . LYS A 1 393 ? -31.321 3.532  -20.790 1.00 32.24 ? 409  LYS A CG  1 
ATOM   3228 C  CD  . LYS A 1 393 ? -31.271 4.038  -22.225 1.00 33.18 ? 409  LYS A CD  1 
ATOM   3229 C  CE  . LYS A 1 393 ? -32.638 3.953  -22.896 1.00 34.02 ? 409  LYS A CE  1 
ATOM   3230 N  NZ  . LYS A 1 393 ? -32.688 4.754  -24.151 1.00 33.77 ? 409  LYS A NZ  1 
ATOM   3231 N  N   . HIS A 1 394 ? -29.833 4.524  -17.557 1.00 30.48 ? 410  HIS A N   1 
ATOM   3232 C  CA  . HIS A 1 394 ? -28.510 4.160  -17.054 1.00 30.67 ? 410  HIS A CA  1 
ATOM   3233 C  C   . HIS A 1 394 ? -28.544 3.658  -15.612 1.00 30.96 ? 410  HIS A C   1 
ATOM   3234 O  O   . HIS A 1 394 ? -27.879 2.678  -15.278 1.00 31.34 ? 410  HIS A O   1 
ATOM   3235 C  CB  . HIS A 1 394 ? -27.520 5.324  -17.178 1.00 30.27 ? 410  HIS A CB  1 
ATOM   3236 C  CG  . HIS A 1 394 ? -26.117 4.953  -16.812 1.00 30.36 ? 410  HIS A CG  1 
ATOM   3237 N  ND1 . HIS A 1 394 ? -25.268 4.305  -17.684 1.00 30.99 ? 410  HIS A ND1 1 
ATOM   3238 C  CD2 . HIS A 1 394 ? -25.423 5.114  -15.662 1.00 30.53 ? 410  HIS A CD2 1 
ATOM   3239 C  CE1 . HIS A 1 394 ? -24.108 4.092  -17.089 1.00 31.21 ? 410  HIS A CE1 1 
ATOM   3240 N  NE2 . HIS A 1 394 ? -24.176 4.574  -15.861 1.00 31.02 ? 410  HIS A NE2 1 
ATOM   3241 N  N   . LEU A 1 395 ? -29.315 4.333  -14.763 1.00 30.81 ? 411  LEU A N   1 
ATOM   3242 C  CA  . LEU A 1 395 ? -29.362 3.998  -13.339 1.00 31.18 ? 411  LEU A CA  1 
ATOM   3243 C  C   . LEU A 1 395 ? -29.964 2.619  -13.075 1.00 32.06 ? 411  LEU A C   1 
ATOM   3244 O  O   . LEU A 1 395 ? -29.607 1.960  -12.095 1.00 32.15 ? 411  LEU A O   1 
ATOM   3245 C  CB  . LEU A 1 395 ? -30.083 5.089  -12.543 1.00 30.53 ? 411  LEU A CB  1 
ATOM   3246 C  CG  . LEU A 1 395 ? -29.334 6.428  -12.460 1.00 29.95 ? 411  LEU A CG  1 
ATOM   3247 C  CD1 . LEU A 1 395 ? -30.255 7.541  -11.995 1.00 29.41 ? 411  LEU A CD1 1 
ATOM   3248 C  CD2 . LEU A 1 395 ? -28.088 6.347  -11.568 1.00 29.25 ? 411  LEU A CD2 1 
ATOM   3249 N  N   . GLU A 1 396 ? -30.862 2.186  -13.958 1.00 32.83 ? 412  GLU A N   1 
ATOM   3250 C  CA  . GLU A 1 396 ? -31.386 0.822  -13.928 1.00 34.20 ? 412  GLU A CA  1 
ATOM   3251 C  C   . GLU A 1 396 ? -30.333 -0.209 -14.342 1.00 34.69 ? 412  GLU A C   1 
ATOM   3252 O  O   . GLU A 1 396 ? -30.276 -1.301 -13.772 1.00 35.30 ? 412  GLU A O   1 
ATOM   3253 C  CB  . GLU A 1 396 ? -32.631 0.692  -14.808 1.00 34.60 ? 412  GLU A CB  1 
ATOM   3254 C  CG  . GLU A 1 396 ? -33.903 1.228  -14.168 1.00 35.96 ? 412  GLU A CG  1 
ATOM   3255 C  CD  . GLU A 1 396 ? -35.161 0.754  -14.875 1.00 38.49 ? 412  GLU A CD  1 
ATOM   3256 O  OE1 . GLU A 1 396 ? -35.415 1.198  -16.016 1.00 39.93 ? 412  GLU A OE1 1 
ATOM   3257 O  OE2 . GLU A 1 396 ? -35.905 -0.057 -14.284 1.00 39.52 ? 412  GLU A OE2 1 
ATOM   3258 N  N   . LYS A 1 397 ? -29.504 0.142  -15.327 1.00 34.81 ? 413  LYS A N   1 
ATOM   3259 C  CA  . LYS A 1 397 ? -28.421 -0.736 -15.798 1.00 35.33 ? 413  LYS A CA  1 
ATOM   3260 C  C   . LYS A 1 397 ? -27.414 -1.063 -14.693 1.00 35.36 ? 413  LYS A C   1 
ATOM   3261 O  O   . LYS A 1 397 ? -26.935 -2.196 -14.596 1.00 35.73 ? 413  LYS A O   1 
ATOM   3262 C  CB  . LYS A 1 397 ? -27.683 -0.118 -16.987 1.00 35.35 ? 413  LYS A CB  1 
ATOM   3263 C  CG  . LYS A 1 397 ? -28.467 -0.080 -18.282 1.00 36.10 ? 413  LYS A CG  1 
ATOM   3264 C  CD  . LYS A 1 397 ? -27.620 0.497  -19.409 1.00 36.48 ? 413  LYS A CD  1 
ATOM   3265 C  CE  . LYS A 1 397 ? -28.476 0.803  -20.630 1.00 37.11 ? 413  LYS A CE  1 
ATOM   3266 N  NZ  . LYS A 1 397 ? -27.711 1.520  -21.684 1.00 37.13 ? 413  LYS A NZ  1 
ATOM   3267 N  N   . ILE A 1 398 ? -27.102 -0.069 -13.863 1.00 34.66 ? 414  ILE A N   1 
ATOM   3268 C  CA  . ILE A 1 398 ? -26.126 -0.240 -12.785 1.00 34.69 ? 414  ILE A CA  1 
ATOM   3269 C  C   . ILE A 1 398 ? -26.780 -0.633 -11.457 1.00 34.98 ? 414  ILE A C   1 
ATOM   3270 O  O   . ILE A 1 398 ? -26.126 -0.638 -10.410 1.00 35.11 ? 414  ILE A O   1 
ATOM   3271 C  CB  . ILE A 1 398 ? -25.208 1.007  -12.619 1.00 34.20 ? 414  ILE A CB  1 
ATOM   3272 C  CG1 . ILE A 1 398 ? -26.033 2.273  -12.352 1.00 33.30 ? 414  ILE A CG1 1 
ATOM   3273 C  CG2 . ILE A 1 398 ? -24.324 1.181  -13.848 1.00 33.92 ? 414  ILE A CG2 1 
ATOM   3274 C  CD1 . ILE A 1 398 ? -25.199 3.509  -12.060 1.00 32.98 ? 414  ILE A CD1 1 
ATOM   3275 N  N   . GLY A 1 399 ? -28.071 -0.959 -11.514 1.00 35.09 ? 415  GLY A N   1 
ATOM   3276 C  CA  . GLY A 1 399 ? -28.809 -1.478 -10.365 1.00 35.38 ? 415  GLY A CA  1 
ATOM   3277 C  C   . GLY A 1 399 ? -29.054 -0.500 -9.232  1.00 35.08 ? 415  GLY A C   1 
ATOM   3278 O  O   . GLY A 1 399 ? -29.339 -0.914 -8.108  1.00 35.34 ? 415  GLY A O   1 
ATOM   3279 N  N   . LEU A 1 400 ? -28.953 0.795  -9.521  1.00 34.54 ? 416  LEU A N   1 
ATOM   3280 C  CA  . LEU A 1 400 ? -29.171 1.825  -8.506  1.00 34.20 ? 416  LEU A CA  1 
ATOM   3281 C  C   . LEU A 1 400 ? -30.626 2.284  -8.438  1.00 34.21 ? 416  LEU A C   1 
ATOM   3282 O  O   . LEU A 1 400 ? -31.059 2.832  -7.424  1.00 34.08 ? 416  LEU A O   1 
ATOM   3283 C  CB  . LEU A 1 400 ? -28.241 3.023  -8.723  1.00 33.57 ? 416  LEU A CB  1 
ATOM   3284 C  CG  . LEU A 1 400 ? -26.748 2.840  -8.430  1.00 33.72 ? 416  LEU A CG  1 
ATOM   3285 C  CD1 . LEU A 1 400 ? -26.021 4.166  -8.605  1.00 33.02 ? 416  LEU A CD1 1 
ATOM   3286 C  CD2 . LEU A 1 400 ? -26.508 2.282  -7.027  1.00 33.47 ? 416  LEU A CD2 1 
ATOM   3287 N  N   . LEU A 1 401 ? -31.365 2.059  -9.522  1.00 34.56 ? 417  LEU A N   1 
ATOM   3288 C  CA  . LEU A 1 401 ? -32.786 2.388  -9.585  1.00 34.76 ? 417  LEU A CA  1 
ATOM   3289 C  C   . LEU A 1 401 ? -33.597 1.114  -9.801  1.00 35.67 ? 417  LEU A C   1 
ATOM   3290 O  O   . LEU A 1 401 ? -33.434 0.432  -10.815 1.00 36.03 ? 417  LEU A O   1 
ATOM   3291 C  CB  . LEU A 1 401 ? -33.051 3.405  -10.703 1.00 34.28 ? 417  LEU A CB  1 
ATOM   3292 C  CG  . LEU A 1 401 ? -34.469 3.948  -10.919 1.00 34.01 ? 417  LEU A CG  1 
ATOM   3293 C  CD1 . LEU A 1 401 ? -34.999 4.680  -9.689  1.00 33.64 ? 417  LEU A CD1 1 
ATOM   3294 C  CD2 . LEU A 1 401 ? -34.491 4.862  -12.133 1.00 33.30 ? 417  LEU A CD2 1 
ATOM   3295 N  N   . LYS A 1 402 ? -34.461 0.799  -8.839  1.00 36.27 ? 418  LYS A N   1 
ATOM   3296 C  CA  . LYS A 1 402 ? -35.220 -0.453 -8.852  1.00 37.37 ? 418  LYS A CA  1 
ATOM   3297 C  C   . LYS A 1 402 ? -36.727 -0.214 -8.928  1.00 37.50 ? 418  LYS A C   1 
ATOM   3298 O  O   . LYS A 1 402 ? -37.235 0.777  -8.393  1.00 37.02 ? 418  LYS A O   1 
ATOM   3299 C  CB  . LYS A 1 402 ? -34.885 -1.297 -7.615  1.00 37.85 ? 418  LYS A CB  1 
ATOM   3300 C  CG  . LYS A 1 402 ? -33.392 -1.582 -7.424  1.00 38.51 ? 418  LYS A CG  1 
ATOM   3301 C  CD  . LYS A 1 402 ? -33.157 -2.578 -6.294  1.00 40.21 ? 418  LYS A CD  1 
ATOM   3302 C  CE  . LYS A 1 402 ? -31.697 -2.603 -5.848  1.00 40.03 ? 418  LYS A CE  1 
ATOM   3303 N  NZ  . LYS A 1 402 ? -30.759 -3.078 -6.902  1.00 40.90 ? 418  LYS A NZ  1 
ATOM   3304 N  N   . ASP A 1 403 ? -37.423 -1.130 -9.603  1.00 38.22 ? 419  ASP A N   1 
ATOM   3305 C  CA  . ASP A 1 403 ? -38.888 -1.122 -9.736  1.00 38.63 ? 419  ASP A CA  1 
ATOM   3306 C  C   . ASP A 1 403 ? -39.442 0.204  -10.275 1.00 37.99 ? 419  ASP A C   1 
ATOM   3307 O  O   . ASP A 1 403 ? -40.443 0.723  -9.772  1.00 37.76 ? 419  ASP A O   1 
ATOM   3308 C  CB  . ASP A 1 403 ? -39.561 -1.499 -8.405  1.00 39.07 ? 419  ASP A CB  1 
ATOM   3309 C  CG  . ASP A 1 403 ? -39.074 -2.833 -7.855  1.00 40.55 ? 419  ASP A CG  1 
ATOM   3310 O  OD1 . ASP A 1 403 ? -38.938 -3.802 -8.635  1.00 42.03 ? 419  ASP A OD1 1 
ATOM   3311 O  OD2 . ASP A 1 403 ? -38.826 -2.909 -6.634  1.00 41.97 ? 419  ASP A OD2 1 
ATOM   3312 N  N   . TYR A 1 404 ? -38.780 0.733  -11.302 1.00 37.56 ? 420  TYR A N   1 
ATOM   3313 C  CA  . TYR A 1 404 ? -39.131 2.021  -11.895 1.00 37.03 ? 420  TYR A CA  1 
ATOM   3314 C  C   . TYR A 1 404 ? -40.055 1.837  -13.097 1.00 37.38 ? 420  TYR A C   1 
ATOM   3315 O  O   . TYR A 1 404 ? -39.740 1.088  -14.023 1.00 37.79 ? 420  TYR A O   1 
ATOM   3316 C  CB  . TYR A 1 404 ? -37.857 2.769  -12.309 1.00 36.49 ? 420  TYR A CB  1 
ATOM   3317 C  CG  . TYR A 1 404 ? -38.066 4.195  -12.782 1.00 35.63 ? 420  TYR A CG  1 
ATOM   3318 C  CD1 . TYR A 1 404 ? -38.174 5.246  -11.869 1.00 34.68 ? 420  TYR A CD1 1 
ATOM   3319 C  CD2 . TYR A 1 404 ? -38.133 4.495  -14.143 1.00 35.01 ? 420  TYR A CD2 1 
ATOM   3320 C  CE1 . TYR A 1 404 ? -38.357 6.560  -12.301 1.00 34.06 ? 420  TYR A CE1 1 
ATOM   3321 C  CE2 . TYR A 1 404 ? -38.318 5.804  -14.584 1.00 34.56 ? 420  TYR A CE2 1 
ATOM   3322 C  CZ  . TYR A 1 404 ? -38.427 6.829  -13.659 1.00 33.92 ? 420  TYR A CZ  1 
ATOM   3323 O  OH  . TYR A 1 404 ? -38.605 8.124  -14.091 1.00 33.55 ? 420  TYR A OH  1 
ATOM   3324 N  N   . VAL A 1 405 ? -41.197 2.521  -13.067 1.00 37.28 ? 421  VAL A N   1 
ATOM   3325 C  CA  . VAL A 1 405 ? -42.139 2.513  -14.184 1.00 37.77 ? 421  VAL A CA  1 
ATOM   3326 C  C   . VAL A 1 405 ? -42.103 3.877  -14.867 1.00 37.34 ? 421  VAL A C   1 
ATOM   3327 O  O   . VAL A 1 405 ? -42.509 4.886  -14.286 1.00 36.86 ? 421  VAL A O   1 
ATOM   3328 C  CB  . VAL A 1 405 ? -43.585 2.170  -13.733 1.00 38.08 ? 421  VAL A CB  1 
ATOM   3329 C  CG1 . VAL A 1 405 ? -44.547 2.217  -14.919 1.00 38.52 ? 421  VAL A CG1 1 
ATOM   3330 C  CG2 . VAL A 1 405 ? -43.632 0.799  -13.066 1.00 38.78 ? 421  VAL A CG2 1 
ATOM   3331 N  N   . ARG A 1 406 ? -41.607 3.897  -16.101 1.00 37.52 ? 422  ARG A N   1 
ATOM   3332 C  CA  . ARG A 1 406 ? -41.424 5.145  -16.835 1.00 37.27 ? 422  ARG A CA  1 
ATOM   3333 C  C   . ARG A 1 406 ? -42.688 5.538  -17.610 1.00 37.19 ? 422  ARG A C   1 
ATOM   3334 O  O   . ARG A 1 406 ? -42.740 5.428  -18.839 1.00 37.63 ? 422  ARG A O   1 
ATOM   3335 C  CB  . ARG A 1 406 ? -40.207 5.048  -17.767 1.00 37.44 ? 422  ARG A CB  1 
ATOM   3336 C  CG  . ARG A 1 406 ? -39.805 6.371  -18.403 1.00 37.78 ? 422  ARG A CG  1 
ATOM   3337 C  CD  . ARG A 1 406 ? -39.054 6.157  -19.713 1.00 39.46 ? 422  ARG A CD  1 
ATOM   3338 N  NE  . ARG A 1 406 ? -39.127 7.335  -20.580 1.00 39.87 ? 422  ARG A NE  1 
ATOM   3339 C  CZ  . ARG A 1 406 ? -38.398 8.434  -20.413 1.00 39.57 ? 422  ARG A CZ  1 
ATOM   3340 N  NH1 . ARG A 1 406 ? -37.537 8.516  -19.409 1.00 40.16 ? 422  ARG A NH1 1 
ATOM   3341 N  NH2 . ARG A 1 406 ? -38.530 9.456  -21.247 1.00 39.37 ? 422  ARG A NH2 1 
ATOM   3342 N  N   . ASP A 1 407 ? -43.709 5.981  -16.880 1.00 36.61 ? 423  ASP A N   1 
ATOM   3343 C  CA  . ASP A 1 407 ? -44.918 6.515  -17.506 1.00 36.28 ? 423  ASP A CA  1 
ATOM   3344 C  C   . ASP A 1 407 ? -44.784 8.026  -17.730 1.00 35.45 ? 423  ASP A C   1 
ATOM   3345 O  O   . ASP A 1 407 ? -43.723 8.601  -17.473 1.00 34.87 ? 423  ASP A O   1 
ATOM   3346 C  CB  . ASP A 1 407 ? -46.176 6.161  -16.690 1.00 36.52 ? 423  ASP A CB  1 
ATOM   3347 C  CG  . ASP A 1 407 ? -46.114 6.650  -15.246 1.00 36.14 ? 423  ASP A CG  1 
ATOM   3348 O  OD1 . ASP A 1 407 ? -45.329 7.570  -14.933 1.00 35.17 ? 423  ASP A OD1 1 
ATOM   3349 O  OD2 . ASP A 1 407 ? -46.868 6.105  -14.414 1.00 36.78 ? 423  ASP A OD2 1 
ATOM   3350 N  N   . ASP A 1 408 ? -45.853 8.658  -18.212 1.00 35.13 ? 424  ASP A N   1 
ATOM   3351 C  CA  . ASP A 1 408 ? -45.852 10.096 -18.499 1.00 34.45 ? 424  ASP A CA  1 
ATOM   3352 C  C   . ASP A 1 408 ? -45.541 10.948 -17.270 1.00 33.42 ? 424  ASP A C   1 
ATOM   3353 O  O   . ASP A 1 408 ? -44.824 11.945 -17.363 1.00 32.86 ? 424  ASP A O   1 
ATOM   3354 C  CB  . ASP A 1 408 ? -47.194 10.527 -19.098 1.00 34.98 ? 424  ASP A CB  1 
ATOM   3355 C  CG  . ASP A 1 408 ? -47.432 9.955  -20.488 1.00 36.34 ? 424  ASP A CG  1 
ATOM   3356 O  OD1 . ASP A 1 408 ? -46.532 9.286  -21.040 1.00 37.56 ? 424  ASP A OD1 1 
ATOM   3357 O  OD2 . ASP A 1 408 ? -48.533 10.181 -21.031 1.00 38.29 ? 424  ASP A OD2 1 
ATOM   3358 N  N   . GLU A 1 409 ? -46.079 10.545 -16.122 1.00 32.86 ? 425  GLU A N   1 
ATOM   3359 C  CA  . GLU A 1 409 ? -45.908 11.300 -14.884 1.00 31.96 ? 425  GLU A CA  1 
ATOM   3360 C  C   . GLU A 1 409 ? -44.492 11.181 -14.313 1.00 31.09 ? 425  GLU A C   1 
ATOM   3361 O  O   . GLU A 1 409 ? -43.906 12.180 -13.893 1.00 30.50 ? 425  GLU A O   1 
ATOM   3362 C  CB  . GLU A 1 409 ? -46.975 10.906 -13.857 1.00 32.21 ? 425  GLU A CB  1 
ATOM   3363 C  CG  . GLU A 1 409 ? -48.378 11.371 -14.257 1.00 33.43 ? 425  GLU A CG  1 
ATOM   3364 C  CD  . GLU A 1 409 ? -49.469 10.964 -13.277 1.00 35.05 ? 425  GLU A CD  1 
ATOM   3365 O  OE1 . GLU A 1 409 ? -49.187 10.217 -12.316 1.00 36.06 ? 425  GLU A OE1 1 
ATOM   3366 O  OE2 . GLU A 1 409 ? -50.622 11.399 -13.476 1.00 35.99 ? 425  GLU A OE2 1 
ATOM   3367 N  N   . ALA A 1 410 ? -43.945 9.966  -14.314 1.00 30.62 ? 426  ALA A N   1 
ATOM   3368 C  CA  . ALA A 1 410 ? -42.559 9.743  -13.895 1.00 29.89 ? 426  ALA A CA  1 
ATOM   3369 C  C   . ALA A 1 410 ? -41.574 10.502 -14.785 1.00 29.22 ? 426  ALA A C   1 
ATOM   3370 O  O   . ALA A 1 410 ? -40.542 10.979 -14.306 1.00 28.70 ? 426  ALA A O   1 
ATOM   3371 C  CB  . ALA A 1 410 ? -42.231 8.256  -13.887 1.00 30.30 ? 426  ALA A CB  1 
ATOM   3372 N  N   . ARG A 1 411 ? -41.900 10.614 -16.074 1.00 28.83 ? 427  ARG A N   1 
ATOM   3373 C  CA  . ARG A 1 411 ? -41.063 11.352 -17.021 1.00 28.35 ? 427  ARG A CA  1 
ATOM   3374 C  C   . ARG A 1 411 ? -41.027 12.845 -16.687 1.00 27.47 ? 427  ARG A C   1 
ATOM   3375 O  O   . ARG A 1 411 ? -39.961 13.463 -16.708 1.00 27.03 ? 427  ARG A O   1 
ATOM   3376 C  CB  . ARG A 1 411 ? -41.543 11.151 -18.457 1.00 28.66 ? 427  ARG A CB  1 
ATOM   3377 C  CG  . ARG A 1 411 ? -40.569 11.695 -19.488 1.00 29.13 ? 427  ARG A CG  1 
ATOM   3378 C  CD  . ARG A 1 411 ? -41.256 12.044 -20.789 1.00 30.32 ? 427  ARG A CD  1 
ATOM   3379 N  NE  . ARG A 1 411 ? -40.287 12.468 -21.794 1.00 30.43 ? 427  ARG A NE  1 
ATOM   3380 C  CZ  . ARG A 1 411 ? -40.599 12.870 -23.022 1.00 30.88 ? 427  ARG A CZ  1 
ATOM   3381 N  NH1 . ARG A 1 411 ? -41.865 12.912 -23.415 1.00 30.97 ? 427  ARG A NH1 1 
ATOM   3382 N  NH2 . ARG A 1 411 ? -39.637 13.231 -23.861 1.00 30.27 ? 427  ARG A NH2 1 
ATOM   3383 N  N   . ILE A 1 412 ? -42.195 13.409 -16.384 1.00 27.12 ? 428  ILE A N   1 
ATOM   3384 C  CA  . ILE A 1 412 ? -42.309 14.808 -15.956 1.00 26.40 ? 428  ILE A CA  1 
ATOM   3385 C  C   . ILE A 1 412 ? -41.517 15.062 -14.668 1.00 25.88 ? 428  ILE A C   1 
ATOM   3386 O  O   . ILE A 1 412 ? -40.815 16.070 -14.564 1.00 25.59 ? 428  ILE A O   1 
ATOM   3387 C  CB  . ILE A 1 412 ? -43.800 15.259 -15.814 1.00 26.50 ? 428  ILE A CB  1 
ATOM   3388 C  CG1 . ILE A 1 412 ? -44.507 15.264 -17.179 1.00 26.95 ? 428  ILE A CG1 1 
ATOM   3389 C  CG2 . ILE A 1 412 ? -43.917 16.637 -15.155 1.00 25.59 ? 428  ILE A CG2 1 
ATOM   3390 C  CD1 . ILE A 1 412 ? -43.882 16.179 -18.235 1.00 27.21 ? 428  ILE A CD1 1 
ATOM   3391 N  N   . ASN A 1 413 ? -41.625 14.144 -13.705 1.00 25.78 ? 429  ASN A N   1 
ATOM   3392 C  CA  . ASN A 1 413 ? -40.818 14.190 -12.478 1.00 25.33 ? 429  ASN A CA  1 
ATOM   3393 C  C   . ASN A 1 413 ? -39.316 14.293 -12.770 1.00 25.08 ? 429  ASN A C   1 
ATOM   3394 O  O   . ASN A 1 413 ? -38.615 15.117 -12.178 1.00 24.40 ? 429  ASN A O   1 
ATOM   3395 C  CB  . ASN A 1 413 ? -41.082 12.954 -11.606 1.00 25.67 ? 429  ASN A CB  1 
ATOM   3396 C  CG  . ASN A 1 413 ? -42.313 13.096 -10.715 1.00 25.92 ? 429  ASN A CG  1 
ATOM   3397 O  OD1 . ASN A 1 413 ? -42.655 12.170 -9.977  1.00 26.75 ? 429  ASN A OD1 1 
ATOM   3398 N  ND2 . ASN A 1 413 ? -42.977 14.244 -10.777 1.00 24.46 ? 429  ASN A ND2 1 
ATOM   3399 N  N   . GLN A 1 414 ? -38.842 13.455 -13.693 1.00 25.23 ? 430  GLN A N   1 
ATOM   3400 C  CA  . GLN A 1 414 ? -37.423 13.387 -14.051 1.00 25.26 ? 430  GLN A CA  1 
ATOM   3401 C  C   . GLN A 1 414 ? -36.950 14.620 -14.825 1.00 24.89 ? 430  GLN A C   1 
ATOM   3402 O  O   . GLN A 1 414 ? -35.852 15.134 -14.574 1.00 24.62 ? 430  GLN A O   1 
ATOM   3403 C  CB  . GLN A 1 414 ? -37.131 12.094 -14.830 1.00 25.78 ? 430  GLN A CB  1 
ATOM   3404 C  CG  . GLN A 1 414 ? -35.703 11.963 -15.381 1.00 26.21 ? 430  GLN A CG  1 
ATOM   3405 C  CD  . GLN A 1 414 ? -34.621 11.918 -14.306 1.00 27.11 ? 430  GLN A CD  1 
ATOM   3406 O  OE1 . GLN A 1 414 ? -34.872 11.556 -13.152 1.00 27.10 ? 430  GLN A OE1 1 
ATOM   3407 N  NE2 . GLN A 1 414 ? -33.398 12.276 -14.694 1.00 27.18 ? 430  GLN A NE2 1 
ATOM   3408 N  N   . LEU A 1 415 ? -37.775 15.084 -15.762 1.00 24.89 ? 431  LEU A N   1 
ATOM   3409 C  CA  . LEU A 1 415 ? -37.496 16.316 -16.499 1.00 24.65 ? 431  LEU A CA  1 
ATOM   3410 C  C   . LEU A 1 415 ? -37.425 17.518 -15.561 1.00 24.23 ? 431  LEU A C   1 
ATOM   3411 O  O   . LEU A 1 415 ? -36.531 18.360 -15.686 1.00 23.86 ? 431  LEU A O   1 
ATOM   3412 C  CB  . LEU A 1 415 ? -38.552 16.553 -17.583 1.00 24.65 ? 431  LEU A CB  1 
ATOM   3413 C  CG  . LEU A 1 415 ? -38.362 15.814 -18.911 1.00 25.44 ? 431  LEU A CG  1 
ATOM   3414 C  CD1 . LEU A 1 415 ? -39.673 15.754 -19.687 1.00 25.66 ? 431  LEU A CD1 1 
ATOM   3415 C  CD2 . LEU A 1 415 ? -37.260 16.460 -19.752 1.00 24.58 ? 431  LEU A CD2 1 
ATOM   3416 N  N   . PHE A 1 416 ? -38.366 17.583 -14.621 1.00 24.17 ? 432  PHE A N   1 
ATOM   3417 C  CA  . PHE A 1 416 ? -38.412 18.666 -13.645 1.00 23.95 ? 432  PHE A CA  1 
ATOM   3418 C  C   . PHE A 1 416 ? -37.193 18.629 -12.727 1.00 23.75 ? 432  PHE A C   1 
ATOM   3419 O  O   . PHE A 1 416 ? -36.585 19.664 -12.462 1.00 23.54 ? 432  PHE A O   1 
ATOM   3420 C  CB  . PHE A 1 416 ? -39.707 18.604 -12.830 1.00 24.21 ? 432  PHE A CB  1 
ATOM   3421 C  CG  . PHE A 1 416 ? -40.004 19.863 -12.067 1.00 24.32 ? 432  PHE A CG  1 
ATOM   3422 C  CD1 . PHE A 1 416 ? -40.542 20.973 -12.713 1.00 24.65 ? 432  PHE A CD1 1 
ATOM   3423 C  CD2 . PHE A 1 416 ? -39.744 19.942 -10.703 1.00 24.73 ? 432  PHE A CD2 1 
ATOM   3424 C  CE1 . PHE A 1 416 ? -40.819 22.144 -12.008 1.00 25.18 ? 432  PHE A CE1 1 
ATOM   3425 C  CE2 . PHE A 1 416 ? -40.019 21.106 -9.989  1.00 24.44 ? 432  PHE A CE2 1 
ATOM   3426 C  CZ  . PHE A 1 416 ? -40.555 22.209 -10.644 1.00 24.82 ? 432  PHE A CZ  1 
ATOM   3427 N  N   . LEU A 1 417 ? -36.843 17.431 -12.257 1.00 23.81 ? 433  LEU A N   1 
ATOM   3428 C  CA  . LEU A 1 417 ? -35.642 17.219 -11.452 1.00 23.81 ? 433  LEU A CA  1 
ATOM   3429 C  C   . LEU A 1 417 ? -34.392 17.735 -12.166 1.00 23.48 ? 433  LEU A C   1 
ATOM   3430 O  O   . LEU A 1 417 ? -33.567 18.420 -11.560 1.00 22.98 ? 433  LEU A O   1 
ATOM   3431 C  CB  . LEU A 1 417 ? -35.483 15.730 -11.099 1.00 24.10 ? 433  LEU A CB  1 
ATOM   3432 C  CG  . LEU A 1 417 ? -34.221 15.263 -10.358 1.00 24.48 ? 433  LEU A CG  1 
ATOM   3433 C  CD1 . LEU A 1 417 ? -34.138 15.845 -8.948  1.00 24.68 ? 433  LEU A CD1 1 
ATOM   3434 C  CD2 . LEU A 1 417 ? -34.146 13.738 -10.316 1.00 24.97 ? 433  LEU A CD2 1 
ATOM   3435 N  N   . THR A 1 418 ? -34.267 17.406 -13.454 1.00 23.48 ? 434  THR A N   1 
ATOM   3436 C  CA  . THR A 1 418 ? -33.146 17.869 -14.277 1.00 23.42 ? 434  THR A CA  1 
ATOM   3437 C  C   . THR A 1 418 ? -33.159 19.394 -14.435 1.00 23.03 ? 434  THR A C   1 
ATOM   3438 O  O   . THR A 1 418 ? -32.110 20.038 -14.350 1.00 22.85 ? 434  THR A O   1 
ATOM   3439 C  CB  . THR A 1 418 ? -33.134 17.174 -15.666 1.00 23.62 ? 434  THR A CB  1 
ATOM   3440 O  OG1 . THR A 1 418 ? -33.163 15.753 -15.486 1.00 24.22 ? 434  THR A OG1 1 
ATOM   3441 C  CG2 . THR A 1 418 ? -31.882 17.547 -16.461 1.00 23.92 ? 434  THR A CG2 1 
ATOM   3442 N  N   . ALA A 1 419 ? -34.348 19.961 -14.642 1.00 23.02 ? 435  ALA A N   1 
ATOM   3443 C  CA  . ALA A 1 419 ? -34.514 21.409 -14.801 1.00 23.04 ? 435  ALA A CA  1 
ATOM   3444 C  C   . ALA A 1 419 ? -34.139 22.181 -13.540 1.00 23.05 ? 435  ALA A C   1 
ATOM   3445 O  O   . ALA A 1 419 ? -33.601 23.288 -13.625 1.00 22.67 ? 435  ALA A O   1 
ATOM   3446 C  CB  . ALA A 1 419 ? -35.935 21.741 -15.217 1.00 22.93 ? 435  ALA A CB  1 
ATOM   3447 N  N   . LEU A 1 420 ? -34.427 21.594 -12.378 1.00 23.53 ? 436  LEU A N   1 
ATOM   3448 C  CA  . LEU A 1 420 ? -34.050 22.184 -11.089 1.00 23.95 ? 436  LEU A CA  1 
ATOM   3449 C  C   . LEU A 1 420 ? -32.534 22.341 -10.966 1.00 24.33 ? 436  LEU A C   1 
ATOM   3450 O  O   . LEU A 1 420 ? -32.050 23.159 -10.182 1.00 24.31 ? 436  LEU A O   1 
ATOM   3451 C  CB  . LEU A 1 420 ? -34.595 21.349 -9.925  1.00 23.82 ? 436  LEU A CB  1 
ATOM   3452 C  CG  . LEU A 1 420 ? -36.109 21.327 -9.676  1.00 24.08 ? 436  LEU A CG  1 
ATOM   3453 C  CD1 . LEU A 1 420 ? -36.458 20.315 -8.589  1.00 24.14 ? 436  LEU A CD1 1 
ATOM   3454 C  CD2 . LEU A 1 420 ? -36.654 22.712 -9.317  1.00 23.75 ? 436  LEU A CD2 1 
ATOM   3455 N  N   . ASP A 1 421 ? -31.801 21.546 -11.747 1.00 25.14 ? 437  ASP A N   1 
ATOM   3456 C  CA  . ASP A 1 421 ? -30.342 21.631 -11.835 1.00 25.77 ? 437  ASP A CA  1 
ATOM   3457 C  C   . ASP A 1 421 ? -29.852 22.458 -13.024 1.00 25.43 ? 437  ASP A C   1 
ATOM   3458 O  O   . ASP A 1 421 ? -28.890 23.216 -12.894 1.00 26.01 ? 437  ASP A O   1 
ATOM   3459 C  CB  . ASP A 1 421 ? -29.724 20.231 -11.926 1.00 26.53 ? 437  ASP A CB  1 
ATOM   3460 C  CG  . ASP A 1 421 ? -29.419 19.627 -10.568 1.00 28.60 ? 437  ASP A CG  1 
ATOM   3461 O  OD1 . ASP A 1 421 ? -29.581 20.315 -9.537  1.00 31.66 ? 437  ASP A OD1 1 
ATOM   3462 O  OD2 . ASP A 1 421 ? -29.005 18.446 -10.535 1.00 31.98 ? 437  ASP A OD2 1 
ATOM   3463 N  N   . LYS A 1 422 ? -30.498 22.303 -14.179 1.00 24.82 ? 438  LYS A N   1 
ATOM   3464 C  CA  . LYS A 1 422 ? -29.965 22.847 -15.436 1.00 24.06 ? 438  LYS A CA  1 
ATOM   3465 C  C   . LYS A 1 422 ? -30.535 24.204 -15.870 1.00 23.58 ? 438  LYS A C   1 
ATOM   3466 O  O   . LYS A 1 422 ? -29.798 25.042 -16.395 1.00 23.49 ? 438  LYS A O   1 
ATOM   3467 C  CB  . LYS A 1 422 ? -30.096 21.823 -16.574 1.00 24.33 ? 438  LYS A CB  1 
ATOM   3468 C  CG  . LYS A 1 422 ? -29.369 20.497 -16.333 1.00 24.34 ? 438  LYS A CG  1 
ATOM   3469 C  CD  . LYS A 1 422 ? -27.864 20.685 -16.165 1.00 24.05 ? 438  LYS A CD  1 
ATOM   3470 C  CE  . LYS A 1 422 ? -27.153 19.362 -15.934 1.00 24.91 ? 438  LYS A CE  1 
ATOM   3471 N  NZ  . LYS A 1 422 ? -25.671 19.549 -15.852 1.00 25.22 ? 438  LYS A NZ  1 
ATOM   3472 N  N   . ILE A 1 423 ? -31.834 24.416 -15.667 1.00 22.85 ? 439  ILE A N   1 
ATOM   3473 C  CA  . ILE A 1 423 ? -32.471 25.680 -16.057 1.00 22.15 ? 439  ILE A CA  1 
ATOM   3474 C  C   . ILE A 1 423 ? -32.318 26.725 -14.955 1.00 21.83 ? 439  ILE A C   1 
ATOM   3475 O  O   . ILE A 1 423 ? -31.952 27.872 -15.223 1.00 21.43 ? 439  ILE A O   1 
ATOM   3476 C  CB  . ILE A 1 423 ? -33.975 25.499 -16.413 1.00 22.41 ? 439  ILE A CB  1 
ATOM   3477 C  CG1 . ILE A 1 423 ? -34.152 24.512 -17.578 1.00 22.52 ? 439  ILE A CG1 1 
ATOM   3478 C  CG2 . ILE A 1 423 ? -34.640 26.853 -16.723 1.00 21.71 ? 439  ILE A CG2 1 
ATOM   3479 C  CD1 . ILE A 1 423 ? -33.468 24.919 -18.886 1.00 23.21 ? 439  ILE A CD1 1 
ATOM   3480 N  N   . VAL A 1 424 ? -32.601 26.310 -13.722 1.00 21.30 ? 440  VAL A N   1 
ATOM   3481 C  CA  . VAL A 1 424 ? -32.459 27.157 -12.537 1.00 20.95 ? 440  VAL A CA  1 
ATOM   3482 C  C   . VAL A 1 424 ? -31.067 27.790 -12.449 1.00 20.51 ? 440  VAL A C   1 
ATOM   3483 O  O   . VAL A 1 424 ? -30.922 28.949 -12.056 1.00 20.67 ? 440  VAL A O   1 
ATOM   3484 C  CB  . VAL A 1 424 ? -32.762 26.341 -11.257 1.00 20.95 ? 440  VAL A CB  1 
ATOM   3485 C  CG1 . VAL A 1 424 ? -32.231 27.041 -10.012 1.00 21.10 ? 440  VAL A CG1 1 
ATOM   3486 C  CG2 . VAL A 1 424 ? -34.257 26.073 -11.142 1.00 20.94 ? 440  VAL A CG2 1 
ATOM   3487 N  N   . PHE A 1 425 ? -30.056 27.018 -12.831 1.00 20.17 ? 441  PHE A N   1 
ATOM   3488 C  CA  . PHE A 1 425 ? -28.659 27.445 -12.773 1.00 19.73 ? 441  PHE A CA  1 
ATOM   3489 C  C   . PHE A 1 425 ? -28.305 28.607 -13.708 1.00 19.55 ? 441  PHE A C   1 
ATOM   3490 O  O   . PHE A 1 425 ? -27.410 29.395 -13.402 1.00 19.25 ? 441  PHE A O   1 
ATOM   3491 C  CB  . PHE A 1 425 ? -27.746 26.250 -13.061 1.00 19.86 ? 441  PHE A CB  1 
ATOM   3492 C  CG  . PHE A 1 425 ? -26.280 26.563 -12.959 1.00 19.56 ? 441  PHE A CG  1 
ATOM   3493 C  CD1 . PHE A 1 425 ? -25.671 26.716 -11.719 1.00 19.44 ? 441  PHE A CD1 1 
ATOM   3494 C  CD2 . PHE A 1 425 ? -25.510 26.706 -14.106 1.00 19.22 ? 441  PHE A CD2 1 
ATOM   3495 C  CE1 . PHE A 1 425 ? -24.316 27.006 -11.625 1.00 19.89 ? 441  PHE A CE1 1 
ATOM   3496 C  CE2 . PHE A 1 425 ? -24.157 26.986 -14.024 1.00 19.20 ? 441  PHE A CE2 1 
ATOM   3497 C  CZ  . PHE A 1 425 ? -23.559 27.142 -12.782 1.00 19.76 ? 441  PHE A CZ  1 
ATOM   3498 N  N   . LEU A 1 426 ? -28.996 28.705 -14.842 1.00 19.49 ? 442  LEU A N   1 
ATOM   3499 C  CA  . LEU A 1 426 ? -28.629 29.680 -15.877 1.00 19.57 ? 442  LEU A CA  1 
ATOM   3500 C  C   . LEU A 1 426 ? -28.608 31.143 -15.400 1.00 19.35 ? 442  LEU A C   1 
ATOM   3501 O  O   . LEU A 1 426 ? -27.587 31.813 -15.564 1.00 19.20 ? 442  LEU A O   1 
ATOM   3502 C  CB  . LEU A 1 426 ? -29.475 29.503 -17.146 1.00 19.66 ? 442  LEU A CB  1 
ATOM   3503 C  CG  . LEU A 1 426 ? -29.443 28.113 -17.791 1.00 20.10 ? 442  LEU A CG  1 
ATOM   3504 C  CD1 . LEU A 1 426 ? -30.442 28.033 -18.933 1.00 20.92 ? 442  LEU A CD1 1 
ATOM   3505 C  CD2 . LEU A 1 426 ? -28.045 27.755 -18.277 1.00 20.10 ? 442  LEU A CD2 1 
ATOM   3506 N  N   . PRO A 1 427 ? -29.716 31.641 -14.800 1.00 19.30 ? 443  PRO A N   1 
ATOM   3507 C  CA  . PRO A 1 427 ? -29.640 33.015 -14.293 1.00 19.29 ? 443  PRO A CA  1 
ATOM   3508 C  C   . PRO A 1 427 ? -28.610 33.180 -13.173 1.00 19.22 ? 443  PRO A C   1 
ATOM   3509 O  O   . PRO A 1 427 ? -27.946 34.213 -13.109 1.00 19.41 ? 443  PRO A O   1 
ATOM   3510 C  CB  . PRO A 1 427 ? -31.061 33.299 -13.781 1.00 19.33 ? 443  PRO A CB  1 
ATOM   3511 C  CG  . PRO A 1 427 ? -31.716 31.979 -13.657 1.00 19.60 ? 443  PRO A CG  1 
ATOM   3512 C  CD  . PRO A 1 427 ? -31.072 31.078 -14.655 1.00 19.36 ? 443  PRO A CD  1 
ATOM   3513 N  N   . PHE A 1 428 ? -28.466 32.173 -12.312 1.00 19.08 ? 444  PHE A N   1 
ATOM   3514 C  CA  . PHE A 1 428 ? -27.448 32.229 -11.260 1.00 18.84 ? 444  PHE A CA  1 
ATOM   3515 C  C   . PHE A 1 428 ? -26.054 32.441 -11.847 1.00 18.62 ? 444  PHE A C   1 
ATOM   3516 O  O   . PHE A 1 428 ? -25.332 33.351 -11.439 1.00 18.39 ? 444  PHE A O   1 
ATOM   3517 C  CB  . PHE A 1 428 ? -27.441 30.966 -10.396 1.00 18.99 ? 444  PHE A CB  1 
ATOM   3518 C  CG  . PHE A 1 428 ? -26.269 30.895 -9.454  1.00 18.78 ? 444  PHE A CG  1 
ATOM   3519 C  CD1 . PHE A 1 428 ? -26.339 31.484 -8.194  1.00 19.21 ? 444  PHE A CD1 1 
ATOM   3520 C  CD2 . PHE A 1 428 ? -25.084 30.266 -9.836  1.00 18.85 ? 444  PHE A CD2 1 
ATOM   3521 C  CE1 . PHE A 1 428 ? -25.255 31.435 -7.325  1.00 18.63 ? 444  PHE A CE1 1 
ATOM   3522 C  CE2 . PHE A 1 428 ? -23.993 30.213 -8.970  1.00 19.35 ? 444  PHE A CE2 1 
ATOM   3523 C  CZ  . PHE A 1 428 ? -24.082 30.798 -7.711  1.00 19.14 ? 444  PHE A CZ  1 
ATOM   3524 N  N   . ALA A 1 429 ? -25.685 31.587 -12.796 1.00 18.54 ? 445  ALA A N   1 
ATOM   3525 C  CA  . ALA A 1 429 ? -24.354 31.636 -13.402 1.00 18.61 ? 445  ALA A CA  1 
ATOM   3526 C  C   . ALA A 1 429 ? -24.094 32.980 -14.072 1.00 18.67 ? 445  ALA A C   1 
ATOM   3527 O  O   . ALA A 1 429 ? -23.006 33.543 -13.929 1.00 18.71 ? 445  ALA A O   1 
ATOM   3528 C  CB  . ALA A 1 429 ? -24.170 30.501 -14.384 1.00 18.36 ? 445  ALA A CB  1 
ATOM   3529 N  N   . PHE A 1 430 ? -25.096 33.491 -14.791 1.00 18.79 ? 446  PHE A N   1 
ATOM   3530 C  CA  . PHE A 1 430 ? -24.981 34.788 -15.464 1.00 18.97 ? 446  PHE A CA  1 
ATOM   3531 C  C   . PHE A 1 430 ? -24.684 35.906 -14.462 1.00 18.95 ? 446  PHE A C   1 
ATOM   3532 O  O   . PHE A 1 430 ? -23.832 36.755 -14.722 1.00 19.05 ? 446  PHE A O   1 
ATOM   3533 C  CB  . PHE A 1 430 ? -26.251 35.118 -16.259 1.00 19.17 ? 446  PHE A CB  1 
ATOM   3534 C  CG  . PHE A 1 430 ? -25.998 35.834 -17.573 1.00 19.71 ? 446  PHE A CG  1 
ATOM   3535 C  CD1 . PHE A 1 430 ? -24.736 36.335 -17.897 1.00 20.21 ? 446  PHE A CD1 1 
ATOM   3536 C  CD2 . PHE A 1 430 ? -27.041 36.021 -18.478 1.00 20.72 ? 446  PHE A CD2 1 
ATOM   3537 C  CE1 . PHE A 1 430 ? -24.511 36.992 -19.111 1.00 21.06 ? 446  PHE A CE1 1 
ATOM   3538 C  CE2 . PHE A 1 430 ? -26.830 36.682 -19.691 1.00 21.49 ? 446  PHE A CE2 1 
ATOM   3539 C  CZ  . PHE A 1 430 ? -25.563 37.168 -20.008 1.00 21.24 ? 446  PHE A CZ  1 
ATOM   3540 N  N   . THR A 1 431 ? -25.364 35.886 -13.313 1.00 18.67 ? 447  THR A N   1 
ATOM   3541 C  CA  . THR A 1 431 ? -25.206 36.945 -12.307 1.00 18.63 ? 447  THR A CA  1 
ATOM   3542 C  C   . THR A 1 431 ? -23.849 36.960 -11.608 1.00 18.71 ? 447  THR A C   1 
ATOM   3543 O  O   . THR A 1 431 ? -23.390 38.020 -11.187 1.00 18.87 ? 447  THR A O   1 
ATOM   3544 C  CB  . THR A 1 431 ? -26.317 36.932 -11.228 1.00 18.67 ? 447  THR A CB  1 
ATOM   3545 O  OG1 . THR A 1 431 ? -26.288 35.693 -10.503 1.00 18.09 ? 447  THR A OG1 1 
ATOM   3546 C  CG2 . THR A 1 431 ? -27.681 37.145 -11.856 1.00 18.40 ? 447  THR A CG2 1 
ATOM   3547 N  N   . MET A 1 432 ? -23.223 35.793 -11.467 1.00 18.81 ? 448  MET A N   1 
ATOM   3548 C  CA  . MET A 1 432 ? -21.899 35.711 -10.849 1.00 19.01 ? 448  MET A CA  1 
ATOM   3549 C  C   . MET A 1 432 ? -20.900 36.595 -11.597 1.00 19.25 ? 448  MET A C   1 
ATOM   3550 O  O   . MET A 1 432 ? -20.176 37.376 -10.981 1.00 19.17 ? 448  MET A O   1 
ATOM   3551 C  CB  . MET A 1 432 ? -21.394 34.264 -10.780 1.00 19.14 ? 448  MET A CB  1 
ATOM   3552 C  CG  . MET A 1 432 ? -22.149 33.347 -9.813  1.00 19.23 ? 448  MET A CG  1 
ATOM   3553 S  SD  . MET A 1 432 ? -22.225 33.945 -8.106  1.00 20.59 ? 448  MET A SD  1 
ATOM   3554 C  CE  . MET A 1 432 ? -23.824 34.745 -8.073  1.00 19.34 ? 448  MET A CE  1 
ATOM   3555 N  N   . ASP A 1 433 ? -20.881 36.488 -12.924 1.00 18.95 ? 449  ASP A N   1 
ATOM   3556 C  CA  . ASP A 1 433 ? -19.967 37.311 -13.709 1.00 19.08 ? 449  ASP A CA  1 
ATOM   3557 C  C   . ASP A 1 433 ? -20.501 38.696 -14.078 1.00 18.93 ? 449  ASP A C   1 
ATOM   3558 O  O   . ASP A 1 433 ? -19.716 39.629 -14.187 1.00 19.20 ? 449  ASP A O   1 
ATOM   3559 C  CB  . ASP A 1 433 ? -19.394 36.549 -14.910 1.00 19.10 ? 449  ASP A CB  1 
ATOM   3560 C  CG  . ASP A 1 433 ? -18.217 35.672 -14.520 1.00 19.84 ? 449  ASP A CG  1 
ATOM   3561 O  OD1 . ASP A 1 433 ? -17.956 35.539 -13.301 1.00 20.64 ? 449  ASP A OD1 1 
ATOM   3562 O  OD2 . ASP A 1 433 ? -17.541 35.128 -15.420 1.00 20.01 ? 449  ASP A OD2 1 
ATOM   3563 N  N   . LYS A 1 434 ? -21.819 38.845 -14.231 1.00 18.78 ? 450  LYS A N   1 
ATOM   3564 C  CA  . LYS A 1 434 ? -22.400 40.186 -14.388 1.00 18.62 ? 450  LYS A CA  1 
ATOM   3565 C  C   . LYS A 1 434 ? -22.016 41.063 -13.196 1.00 18.68 ? 450  LYS A C   1 
ATOM   3566 O  O   . LYS A 1 434 ? -21.696 42.242 -13.362 1.00 18.41 ? 450  LYS A O   1 
ATOM   3567 C  CB  . LYS A 1 434 ? -23.921 40.141 -14.539 1.00 18.60 ? 450  LYS A CB  1 
ATOM   3568 C  CG  . LYS A 1 434 ? -24.404 39.817 -15.953 1.00 18.71 ? 450  LYS A CG  1 
ATOM   3569 C  CD  . LYS A 1 434 ? -25.917 39.706 -16.001 1.00 18.51 ? 450  LYS A CD  1 
ATOM   3570 C  CE  . LYS A 1 434 ? -26.423 39.625 -17.438 1.00 19.16 ? 450  LYS A CE  1 
ATOM   3571 N  NZ  . LYS A 1 434 ? -26.379 40.959 -18.096 1.00 19.33 ? 450  LYS A NZ  1 
ATOM   3572 N  N   . TYR A 1 435 ? -22.029 40.474 -12.001 1.00 18.44 ? 451  TYR A N   1 
ATOM   3573 C  CA  . TYR A 1 435 ? -21.620 41.189 -10.793 1.00 18.58 ? 451  TYR A CA  1 
ATOM   3574 C  C   . TYR A 1 435 ? -20.148 41.582 -10.833 1.00 18.53 ? 451  TYR A C   1 
ATOM   3575 O  O   . TYR A 1 435 ? -19.811 42.761 -10.699 1.00 18.59 ? 451  TYR A O   1 
ATOM   3576 C  CB  . TYR A 1 435 ? -21.904 40.363 -9.537  1.00 18.64 ? 451  TYR A CB  1 
ATOM   3577 C  CG  . TYR A 1 435 ? -21.458 41.041 -8.258  1.00 19.31 ? 451  TYR A CG  1 
ATOM   3578 C  CD1 . TYR A 1 435 ? -22.043 42.235 -7.839  1.00 19.95 ? 451  TYR A CD1 1 
ATOM   3579 C  CD2 . TYR A 1 435 ? -20.448 40.491 -7.469  1.00 20.19 ? 451  TYR A CD2 1 
ATOM   3580 C  CE1 . TYR A 1 435 ? -21.636 42.865 -6.666  1.00 20.36 ? 451  TYR A CE1 1 
ATOM   3581 C  CE2 . TYR A 1 435 ? -20.036 41.114 -6.290  1.00 20.46 ? 451  TYR A CE2 1 
ATOM   3582 C  CZ  . TYR A 1 435 ? -20.638 42.297 -5.897  1.00 20.70 ? 451  TYR A CZ  1 
ATOM   3583 O  OH  . TYR A 1 435 ? -20.240 42.918 -4.734  1.00 22.21 ? 451  TYR A OH  1 
ATOM   3584 N  N   . ARG A 1 436 ? -19.278 40.592 -11.010 1.00 18.55 ? 452  ARG A N   1 
ATOM   3585 C  CA  . ARG A 1 436 ? -17.840 40.841 -11.023 1.00 18.82 ? 452  ARG A CA  1 
ATOM   3586 C  C   . ARG A 1 436 ? -17.409 41.742 -12.182 1.00 18.81 ? 452  ARG A C   1 
ATOM   3587 O  O   . ARG A 1 436 ? -16.555 42.610 -11.996 1.00 18.94 ? 452  ARG A O   1 
ATOM   3588 C  CB  . ARG A 1 436 ? -17.050 39.531 -10.985 1.00 18.83 ? 452  ARG A CB  1 
ATOM   3589 C  CG  . ARG A 1 436 ? -17.125 38.837 -9.622  1.00 19.25 ? 452  ARG A CG  1 
ATOM   3590 C  CD  . ARG A 1 436 ? -16.187 37.650 -9.531  1.00 19.70 ? 452  ARG A CD  1 
ATOM   3591 N  NE  . ARG A 1 436 ? -16.608 36.554 -10.398 1.00 19.59 ? 452  ARG A NE  1 
ATOM   3592 C  CZ  . ARG A 1 436 ? -16.040 35.352 -10.433 1.00 19.81 ? 452  ARG A CZ  1 
ATOM   3593 N  NH1 . ARG A 1 436 ? -15.009 35.065 -9.646  1.00 20.20 ? 452  ARG A NH1 1 
ATOM   3594 N  NH2 . ARG A 1 436 ? -16.507 34.432 -11.264 1.00 19.98 ? 452  ARG A NH2 1 
ATOM   3595 N  N   . TRP A 1 437 ? -18.016 41.557 -13.358 1.00 18.74 ? 453  TRP A N   1 
ATOM   3596 C  CA  . TRP A 1 437 ? -17.775 42.462 -14.489 1.00 18.95 ? 453  TRP A CA  1 
ATOM   3597 C  C   . TRP A 1 437 ? -18.050 43.913 -14.110 1.00 19.11 ? 453  TRP A C   1 
ATOM   3598 O  O   . TRP A 1 437 ? -17.245 44.788 -14.412 1.00 19.21 ? 453  TRP A O   1 
ATOM   3599 C  CB  . TRP A 1 437 ? -18.636 42.118 -15.710 1.00 18.75 ? 453  TRP A CB  1 
ATOM   3600 C  CG  . TRP A 1 437 ? -18.334 40.817 -16.400 1.00 19.10 ? 453  TRP A CG  1 
ATOM   3601 C  CD1 . TRP A 1 437 ? -17.209 40.047 -16.277 1.00 19.25 ? 453  TRP A CD1 1 
ATOM   3602 C  CD2 . TRP A 1 437 ? -19.172 40.153 -17.352 1.00 19.35 ? 453  TRP A CD2 1 
ATOM   3603 N  NE1 . TRP A 1 437 ? -17.306 38.934 -17.082 1.00 19.58 ? 453  TRP A NE1 1 
ATOM   3604 C  CE2 . TRP A 1 437 ? -18.500 38.978 -17.757 1.00 19.64 ? 453  TRP A CE2 1 
ATOM   3605 C  CE3 . TRP A 1 437 ? -20.432 40.437 -17.899 1.00 19.67 ? 453  TRP A CE3 1 
ATOM   3606 C  CZ2 . TRP A 1 437 ? -19.048 38.082 -18.682 1.00 19.59 ? 453  TRP A CZ2 1 
ATOM   3607 C  CZ3 . TRP A 1 437 ? -20.978 39.544 -18.821 1.00 19.73 ? 453  TRP A CZ3 1 
ATOM   3608 C  CH2 . TRP A 1 437 ? -20.283 38.382 -19.202 1.00 19.91 ? 453  TRP A CH2 1 
ATOM   3609 N  N   . SER A 1 438 ? -19.185 44.160 -13.452 1.00 19.39 ? 454  SER A N   1 
ATOM   3610 C  CA  . SER A 1 438 ? -19.588 45.524 -13.087 1.00 19.85 ? 454  SER A CA  1 
ATOM   3611 C  C   . SER A 1 438 ? -18.607 46.178 -12.114 1.00 20.24 ? 454  SER A C   1 
ATOM   3612 O  O   . SER A 1 438 ? -18.368 47.388 -12.184 1.00 20.41 ? 454  SER A O   1 
ATOM   3613 C  CB  . SER A 1 438 ? -21.017 45.559 -12.531 1.00 19.93 ? 454  SER A CB  1 
ATOM   3614 O  OG  . SER A 1 438 ? -21.092 45.011 -11.225 1.00 20.30 ? 454  SER A OG  1 
ATOM   3615 N  N   . LEU A 1 439 ? -18.037 45.375 -11.218 1.00 20.24 ? 455  LEU A N   1 
ATOM   3616 C  CA  . LEU A 1 439 ? -17.008 45.861 -10.299 1.00 20.74 ? 455  LEU A CA  1 
ATOM   3617 C  C   . LEU A 1 439 ? -15.688 46.104 -11.030 1.00 20.86 ? 455  LEU A C   1 
ATOM   3618 O  O   . LEU A 1 439 ? -15.052 47.145 -10.837 1.00 21.12 ? 455  LEU A O   1 
ATOM   3619 C  CB  . LEU A 1 439 ? -16.805 44.890 -9.126  1.00 20.71 ? 455  LEU A CB  1 
ATOM   3620 C  CG  . LEU A 1 439 ? -18.000 44.470 -8.259  1.00 21.09 ? 455  LEU A CG  1 
ATOM   3621 C  CD1 . LEU A 1 439 ? -17.497 43.762 -7.008  1.00 21.50 ? 455  LEU A CD1 1 
ATOM   3622 C  CD2 . LEU A 1 439 ? -18.900 45.639 -7.877  1.00 21.68 ? 455  LEU A CD2 1 
ATOM   3623 N  N   . PHE A 1 440 ? -15.292 45.146 -11.871 1.00 20.67 ? 456  PHE A N   1 
ATOM   3624 C  CA  . PHE A 1 440 ? -14.070 45.254 -12.678 1.00 21.13 ? 456  PHE A CA  1 
ATOM   3625 C  C   . PHE A 1 440 ? -14.095 46.489 -13.584 1.00 21.50 ? 456  PHE A C   1 
ATOM   3626 O  O   . PHE A 1 440 ? -13.088 47.184 -13.731 1.00 21.68 ? 456  PHE A O   1 
ATOM   3627 C  CB  . PHE A 1 440 ? -13.866 43.997 -13.539 1.00 20.73 ? 456  PHE A CB  1 
ATOM   3628 C  CG  . PHE A 1 440 ? -13.490 42.756 -12.758 1.00 21.22 ? 456  PHE A CG  1 
ATOM   3629 C  CD1 . PHE A 1 440 ? -12.973 42.837 -11.464 1.00 21.22 ? 456  PHE A CD1 1 
ATOM   3630 C  CD2 . PHE A 1 440 ? -13.659 41.497 -13.329 1.00 21.21 ? 456  PHE A CD2 1 
ATOM   3631 C  CE1 . PHE A 1 440 ? -12.628 41.687 -10.755 1.00 21.38 ? 456  PHE A CE1 1 
ATOM   3632 C  CE2 . PHE A 1 440 ? -13.310 40.340 -12.631 1.00 21.19 ? 456  PHE A CE2 1 
ATOM   3633 C  CZ  . PHE A 1 440 ? -12.797 40.435 -11.342 1.00 21.51 ? 456  PHE A CZ  1 
ATOM   3634 N  N   . ARG A 1 441 ? -15.258 46.752 -14.178 1.00 21.79 ? 457  ARG A N   1 
ATOM   3635 C  CA  . ARG A 1 441 ? -15.446 47.865 -15.111 1.00 22.33 ? 457  ARG A CA  1 
ATOM   3636 C  C   . ARG A 1 441 ? -15.615 49.225 -14.419 1.00 23.00 ? 457  ARG A C   1 
ATOM   3637 O  O   . ARG A 1 441 ? -15.696 50.257 -15.086 1.00 23.19 ? 457  ARG A O   1 
ATOM   3638 C  CB  . ARG A 1 441 ? -16.639 47.577 -16.033 1.00 21.98 ? 457  ARG A CB  1 
ATOM   3639 C  CG  . ARG A 1 441 ? -16.344 46.534 -17.106 1.00 21.67 ? 457  ARG A CG  1 
ATOM   3640 C  CD  . ARG A 1 441 ? -17.605 45.966 -17.743 1.00 21.08 ? 457  ARG A CD  1 
ATOM   3641 N  NE  . ARG A 1 441 ? -17.280 45.143 -18.911 1.00 20.73 ? 457  ARG A NE  1 
ATOM   3642 C  CZ  . ARG A 1 441 ? -18.106 44.271 -19.486 1.00 20.89 ? 457  ARG A CZ  1 
ATOM   3643 N  NH1 . ARG A 1 441 ? -19.330 44.081 -19.010 1.00 20.71 ? 457  ARG A NH1 1 
ATOM   3644 N  NH2 . ARG A 1 441 ? -17.704 43.576 -20.544 1.00 20.85 ? 457  ARG A NH2 1 
ATOM   3645 N  N   . GLY A 1 442 ? -15.662 49.220 -13.089 1.00 23.56 ? 458  GLY A N   1 
ATOM   3646 C  CA  . GLY A 1 442 ? -15.822 50.449 -12.309 1.00 24.51 ? 458  GLY A CA  1 
ATOM   3647 C  C   . GLY A 1 442 ? -17.216 51.047 -12.412 1.00 25.09 ? 458  GLY A C   1 
ATOM   3648 O  O   . GLY A 1 442 ? -17.384 52.265 -12.314 1.00 25.39 ? 458  GLY A O   1 
ATOM   3649 N  N   . GLU A 1 443 ? -18.213 50.186 -12.601 1.00 25.17 ? 459  GLU A N   1 
ATOM   3650 C  CA  . GLU A 1 443 ? -19.598 50.616 -12.817 1.00 25.90 ? 459  GLU A CA  1 
ATOM   3651 C  C   . GLU A 1 443 ? -20.406 50.752 -11.522 1.00 26.28 ? 459  GLU A C   1 
ATOM   3652 O  O   . GLU A 1 443 ? -21.478 51.356 -11.520 1.00 26.27 ? 459  GLU A O   1 
ATOM   3653 C  CB  . GLU A 1 443 ? -20.306 49.668 -13.794 1.00 25.65 ? 459  GLU A CB  1 
ATOM   3654 C  CG  . GLU A 1 443 ? -19.761 49.739 -15.220 1.00 26.44 ? 459  GLU A CG  1 
ATOM   3655 C  CD  . GLU A 1 443 ? -20.228 48.595 -16.111 1.00 27.45 ? 459  GLU A CD  1 
ATOM   3656 O  OE1 . GLU A 1 443 ? -20.817 47.615 -15.598 1.00 27.55 ? 459  GLU A OE1 1 
ATOM   3657 O  OE2 . GLU A 1 443 ? -19.995 48.677 -17.336 1.00 27.88 ? 459  GLU A OE2 1 
ATOM   3658 N  N   . VAL A 1 444 ? -19.887 50.190 -10.432 1.00 26.66 ? 460  VAL A N   1 
ATOM   3659 C  CA  . VAL A 1 444 ? -20.538 50.269 -9.124  1.00 27.35 ? 460  VAL A CA  1 
ATOM   3660 C  C   . VAL A 1 444 ? -19.606 50.942 -8.115  1.00 28.13 ? 460  VAL A C   1 
ATOM   3661 O  O   . VAL A 1 444 ? -18.460 50.523 -7.944  1.00 28.28 ? 460  VAL A O   1 
ATOM   3662 C  CB  . VAL A 1 444 ? -20.950 48.866 -8.585  1.00 26.99 ? 460  VAL A CB  1 
ATOM   3663 C  CG1 . VAL A 1 444 ? -21.766 48.995 -7.297  1.00 27.12 ? 460  VAL A CG1 1 
ATOM   3664 C  CG2 . VAL A 1 444 ? -21.736 48.080 -9.631  1.00 26.73 ? 460  VAL A CG2 1 
ATOM   3665 N  N   . ASP A 1 445 ? -20.102 51.981 -7.450  1.00 29.10 ? 461  ASP A N   1 
ATOM   3666 C  CA  . ASP A 1 445 ? -19.357 52.626 -6.367  1.00 30.19 ? 461  ASP A CA  1 
ATOM   3667 C  C   . ASP A 1 445 ? -19.216 51.674 -5.183  1.00 30.04 ? 461  ASP A C   1 
ATOM   3668 O  O   . ASP A 1 445 ? -20.139 50.913 -4.882  1.00 29.65 ? 461  ASP A O   1 
ATOM   3669 C  CB  . ASP A 1 445 ? -20.054 53.915 -5.927  1.00 31.10 ? 461  ASP A CB  1 
ATOM   3670 C  CG  . ASP A 1 445 ? -20.044 54.984 -7.008  1.00 32.92 ? 461  ASP A CG  1 
ATOM   3671 O  OD1 . ASP A 1 445 ? -19.041 55.079 -7.752  1.00 35.03 ? 461  ASP A OD1 1 
ATOM   3672 O  OD2 . ASP A 1 445 ? -21.038 55.737 -7.109  1.00 35.40 ? 461  ASP A OD2 1 
ATOM   3673 N  N   . LYS A 1 446 ? -18.062 51.728 -4.517  1.00 30.16 ? 462  LYS A N   1 
ATOM   3674 C  CA  . LYS A 1 446 ? -17.751 50.819 -3.408  1.00 30.22 ? 462  LYS A CA  1 
ATOM   3675 C  C   . LYS A 1 446 ? -18.801 50.826 -2.299  1.00 29.91 ? 462  LYS A C   1 
ATOM   3676 O  O   . LYS A 1 446 ? -19.018 49.810 -1.641  1.00 29.82 ? 462  LYS A O   1 
ATOM   3677 C  CB  . LYS A 1 446 ? -16.351 51.091 -2.842  1.00 30.76 ? 462  LYS A CB  1 
ATOM   3678 C  CG  . LYS A 1 446 ? -15.248 50.388 -3.623  1.00 31.80 ? 462  LYS A CG  1 
ATOM   3679 C  CD  . LYS A 1 446 ? -13.914 50.381 -2.893  1.00 34.35 ? 462  LYS A CD  1 
ATOM   3680 C  CE  . LYS A 1 446 ? -13.027 51.531 -3.343  1.00 36.18 ? 462  LYS A CE  1 
ATOM   3681 N  NZ  . LYS A 1 446 ? -11.590 51.239 -3.065  1.00 38.02 ? 462  LYS A NZ  1 
ATOM   3682 N  N   . ALA A 1 447 ? -19.461 51.968 -2.120  1.00 29.81 ? 463  ALA A N   1 
ATOM   3683 C  CA  . ALA A 1 447 ? -20.531 52.115 -1.132  1.00 29.57 ? 463  ALA A CA  1 
ATOM   3684 C  C   . ALA A 1 447 ? -21.791 51.323 -1.493  1.00 28.83 ? 463  ALA A C   1 
ATOM   3685 O  O   . ALA A 1 447 ? -22.687 51.174 -0.662  1.00 28.77 ? 463  ALA A O   1 
ATOM   3686 C  CB  . ALA A 1 447 ? -20.868 53.591 -0.936  1.00 30.08 ? 463  ALA A CB  1 
ATOM   3687 N  N   . ASN A 1 448 ? -21.854 50.815 -2.725  1.00 27.79 ? 464  ASN A N   1 
ATOM   3688 C  CA  . ASN A 1 448 ? -23.029 50.085 -3.207  1.00 27.17 ? 464  ASN A CA  1 
ATOM   3689 C  C   . ASN A 1 448 ? -22.754 48.624 -3.591  1.00 26.25 ? 464  ASN A C   1 
ATOM   3690 O  O   . ASN A 1 448 ? -23.623 47.957 -4.152  1.00 25.81 ? 464  ASN A O   1 
ATOM   3691 C  CB  . ASN A 1 448 ? -23.674 50.823 -4.394  1.00 27.23 ? 464  ASN A CB  1 
ATOM   3692 C  CG  . ASN A 1 448 ? -24.053 52.264 -4.064  1.00 28.51 ? 464  ASN A CG  1 
ATOM   3693 O  OD1 . ASN A 1 448 ? -23.790 53.179 -4.848  1.00 29.91 ? 464  ASN A OD1 1 
ATOM   3694 N  ND2 . ASN A 1 448 ? -24.673 52.471 -2.907  1.00 28.65 ? 464  ASN A ND2 1 
ATOM   3695 N  N   . TRP A 1 449 ? -21.558 48.128 -3.271  1.00 25.72 ? 465  TRP A N   1 
ATOM   3696 C  CA  . TRP A 1 449 ? -21.113 46.803 -3.722  1.00 24.88 ? 465  TRP A CA  1 
ATOM   3697 C  C   . TRP A 1 449 ? -21.976 45.625 -3.272  1.00 24.48 ? 465  TRP A C   1 
ATOM   3698 O  O   . TRP A 1 449 ? -22.248 44.730 -4.071  1.00 23.95 ? 465  TRP A O   1 
ATOM   3699 C  CB  . TRP A 1 449 ? -19.648 46.563 -3.344  1.00 25.14 ? 465  TRP A CB  1 
ATOM   3700 C  CG  . TRP A 1 449 ? -18.661 47.129 -4.330  1.00 24.72 ? 465  TRP A CG  1 
ATOM   3701 C  CD1 . TRP A 1 449 ? -18.895 48.093 -5.271  1.00 24.47 ? 465  TRP A CD1 1 
ATOM   3702 C  CD2 . TRP A 1 449 ? -17.275 46.786 -4.445  1.00 24.63 ? 465  TRP A CD2 1 
ATOM   3703 N  NE1 . TRP A 1 449 ? -17.746 48.358 -5.976  1.00 24.59 ? 465  TRP A NE1 1 
ATOM   3704 C  CE2 . TRP A 1 449 ? -16.735 47.572 -5.488  1.00 24.82 ? 465  TRP A CE2 1 
ATOM   3705 C  CE3 . TRP A 1 449 ? -16.438 45.884 -3.774  1.00 24.80 ? 465  TRP A CE3 1 
ATOM   3706 C  CZ2 . TRP A 1 449 ? -15.393 47.484 -5.877  1.00 25.03 ? 465  TRP A CZ2 1 
ATOM   3707 C  CZ3 . TRP A 1 449 ? -15.103 45.799 -4.158  1.00 24.88 ? 465  TRP A CZ3 1 
ATOM   3708 C  CH2 . TRP A 1 449 ? -14.596 46.596 -5.201  1.00 24.84 ? 465  TRP A CH2 1 
ATOM   3709 N  N   . ASN A 1 450 ? -22.407 45.611 -2.012  1.00 24.36 ? 466  ASN A N   1 
ATOM   3710 C  CA  . ASN A 1 450 ? -23.196 44.476 -1.529  1.00 24.15 ? 466  ASN A CA  1 
ATOM   3711 C  C   . ASN A 1 450 ? -24.618 44.425 -2.077  1.00 24.02 ? 466  ASN A C   1 
ATOM   3712 O  O   . ASN A 1 450 ? -25.078 43.367 -2.504  1.00 23.89 ? 466  ASN A O   1 
ATOM   3713 C  CB  . ASN A 1 450 ? -23.214 44.367 -0.001  1.00 24.30 ? 466  ASN A CB  1 
ATOM   3714 C  CG  . ASN A 1 450 ? -23.660 42.986 0.470   1.00 23.88 ? 466  ASN A CG  1 
ATOM   3715 O  OD1 . ASN A 1 450 ? -24.485 42.855 1.376   1.00 23.87 ? 466  ASN A OD1 1 
ATOM   3716 N  ND2 . ASN A 1 450 ? -23.129 41.951 -0.164  1.00 22.14 ? 466  ASN A ND2 1 
ATOM   3717 N  N   . CYS A 1 451 ? -25.315 45.556 -2.066  1.00 24.39 ? 467  CYS A N   1 
ATOM   3718 C  CA  . CYS A 1 451 ? -26.677 45.569 -2.586  1.00 24.41 ? 467  CYS A CA  1 
ATOM   3719 C  C   . CYS A 1 451 ? -26.710 45.431 -4.113  1.00 23.40 ? 467  CYS A C   1 
ATOM   3720 O  O   . CYS A 1 451 ? -27.694 44.955 -4.664  1.00 22.83 ? 467  CYS A O   1 
ATOM   3721 C  CB  . CYS A 1 451 ? -27.474 46.769 -2.072  1.00 25.27 ? 467  CYS A CB  1 
ATOM   3722 S  SG  . CYS A 1 451 ? -27.865 46.683 -0.276  1.00 28.95 ? 467  CYS A SG  1 
ATOM   3723 N  N   . ALA A 1 452 ? -25.617 45.807 -4.779  1.00 22.82 ? 468  ALA A N   1 
ATOM   3724 C  CA  . ALA A 1 452 ? -25.456 45.533 -6.211  1.00 22.06 ? 468  ALA A CA  1 
ATOM   3725 C  C   . ALA A 1 452 ? -25.475 44.032 -6.502  1.00 21.40 ? 468  ALA A C   1 
ATOM   3726 O  O   . ALA A 1 452 ? -25.968 43.605 -7.549  1.00 21.02 ? 468  ALA A O   1 
ATOM   3727 C  CB  . ALA A 1 452 ? -24.179 46.156 -6.743  1.00 22.16 ? 468  ALA A CB  1 
ATOM   3728 N  N   . PHE A 1 453 ? -24.938 43.240 -5.574  1.00 20.90 ? 469  PHE A N   1 
ATOM   3729 C  CA  . PHE A 1 453 ? -24.938 41.781 -5.700  1.00 20.43 ? 469  PHE A CA  1 
ATOM   3730 C  C   . PHE A 1 453 ? -26.357 41.240 -5.573  1.00 20.14 ? 469  PHE A C   1 
ATOM   3731 O  O   . PHE A 1 453 ? -26.839 40.532 -6.460  1.00 19.53 ? 469  PHE A O   1 
ATOM   3732 C  CB  . PHE A 1 453 ? -24.014 41.138 -4.651  1.00 20.34 ? 469  PHE A CB  1 
ATOM   3733 C  CG  . PHE A 1 453 ? -23.969 39.629 -4.710  1.00 20.71 ? 469  PHE A CG  1 
ATOM   3734 C  CD1 . PHE A 1 453 ? -23.247 38.975 -5.710  1.00 20.33 ? 469  PHE A CD1 1 
ATOM   3735 C  CD2 . PHE A 1 453 ? -24.633 38.863 -3.756  1.00 21.05 ? 469  PHE A CD2 1 
ATOM   3736 C  CE1 . PHE A 1 453 ? -23.199 37.581 -5.764  1.00 20.50 ? 469  PHE A CE1 1 
ATOM   3737 C  CE2 . PHE A 1 453 ? -24.592 37.466 -3.799  1.00 20.81 ? 469  PHE A CE2 1 
ATOM   3738 C  CZ  . PHE A 1 453 ? -23.875 36.824 -4.805  1.00 20.97 ? 469  PHE A CZ  1 
ATOM   3739 N  N   . TRP A 1 454 ? -27.021 41.587 -4.473  1.00 20.10 ? 470  TRP A N   1 
ATOM   3740 C  CA  . TRP A 1 454 ? -28.376 41.105 -4.218  1.00 20.16 ? 470  TRP A CA  1 
ATOM   3741 C  C   . TRP A 1 454 ? -29.412 41.627 -5.217  1.00 20.43 ? 470  TRP A C   1 
ATOM   3742 O  O   . TRP A 1 454 ? -30.381 40.930 -5.517  1.00 20.20 ? 470  TRP A O   1 
ATOM   3743 C  CB  . TRP A 1 454 ? -28.783 41.361 -2.762  1.00 20.20 ? 470  TRP A CB  1 
ATOM   3744 C  CG  . TRP A 1 454 ? -27.972 40.518 -1.810  1.00 19.54 ? 470  TRP A CG  1 
ATOM   3745 C  CD1 . TRP A 1 454 ? -27.129 40.962 -0.830  1.00 19.50 ? 470  TRP A CD1 1 
ATOM   3746 C  CD2 . TRP A 1 454 ? -27.902 39.087 -1.781  1.00 18.84 ? 470  TRP A CD2 1 
ATOM   3747 N  NE1 . TRP A 1 454 ? -26.552 39.893 -0.181  1.00 19.08 ? 470  TRP A NE1 1 
ATOM   3748 C  CE2 . TRP A 1 454 ? -27.007 38.732 -0.746  1.00 18.80 ? 470  TRP A CE2 1 
ATOM   3749 C  CE3 . TRP A 1 454 ? -28.516 38.067 -2.525  1.00 18.88 ? 470  TRP A CE3 1 
ATOM   3750 C  CZ2 . TRP A 1 454 ? -26.712 37.402 -0.434  1.00 18.69 ? 470  TRP A CZ2 1 
ATOM   3751 C  CZ3 . TRP A 1 454 ? -28.217 36.744 -2.216  1.00 18.96 ? 470  TRP A CZ3 1 
ATOM   3752 C  CH2 . TRP A 1 454 ? -27.322 36.426 -1.178  1.00 18.61 ? 470  TRP A CH2 1 
ATOM   3753 N  N   . LYS A 1 455 ? -29.187 42.831 -5.745  1.00 20.83 ? 471  LYS A N   1 
ATOM   3754 C  CA  . LYS A 1 455 ? -30.037 43.378 -6.808  1.00 21.35 ? 471  LYS A CA  1 
ATOM   3755 C  C   . LYS A 1 455 ? -30.047 42.477 -8.043  1.00 20.93 ? 471  LYS A C   1 
ATOM   3756 O  O   . LYS A 1 455 ? -31.106 42.216 -8.614  1.00 20.83 ? 471  LYS A O   1 
ATOM   3757 C  CB  . LYS A 1 455 ? -29.604 44.794 -7.198  1.00 21.77 ? 471  LYS A CB  1 
ATOM   3758 C  CG  . LYS A 1 455 ? -30.146 45.891 -6.297  1.00 23.94 ? 471  LYS A CG  1 
ATOM   3759 C  CD  . LYS A 1 455 ? -29.522 47.239 -6.651  1.00 26.87 ? 471  LYS A CD  1 
ATOM   3760 C  CE  . LYS A 1 455 ? -29.935 48.323 -5.667  1.00 29.26 ? 471  LYS A CE  1 
ATOM   3761 N  NZ  . LYS A 1 455 ? -31.344 48.756 -5.881  1.00 31.47 ? 471  LYS A NZ  1 
ATOM   3762 N  N   . LEU A 1 456 ? -28.868 42.004 -8.446  1.00 20.90 ? 472  LEU A N   1 
ATOM   3763 C  CA  . LEU A 1 456 ? -28.749 41.091 -9.587  1.00 20.85 ? 472  LEU A CA  1 
ATOM   3764 C  C   . LEU A 1 456 ? -29.394 39.736 -9.314  1.00 20.77 ? 472  LEU A C   1 
ATOM   3765 O  O   . LEU A 1 456 ? -30.091 39.195 -10.173 1.00 20.49 ? 472  LEU A O   1 
ATOM   3766 C  CB  . LEU A 1 456 ? -27.283 40.902 -9.990  1.00 20.90 ? 472  LEU A CB  1 
ATOM   3767 C  CG  . LEU A 1 456 ? -26.616 42.036 -10.774 1.00 21.43 ? 472  LEU A CG  1 
ATOM   3768 C  CD1 . LEU A 1 456 ? -25.119 41.822 -10.796 1.00 21.17 ? 472  LEU A CD1 1 
ATOM   3769 C  CD2 . LEU A 1 456 ? -27.161 42.148 -12.199 1.00 21.55 ? 472  LEU A CD2 1 
ATOM   3770 N  N   . ARG A 1 457 ? -29.159 39.194 -8.118  1.00 20.92 ? 473  ARG A N   1 
ATOM   3771 C  CA  . ARG A 1 457 ? -29.757 37.921 -7.713  1.00 21.10 ? 473  ARG A CA  1 
ATOM   3772 C  C   . ARG A 1 457 ? -31.290 38.008 -7.739  1.00 21.35 ? 473  ARG A C   1 
ATOM   3773 O  O   . ARG A 1 457 ? -31.967 37.054 -8.131  1.00 21.31 ? 473  ARG A O   1 
ATOM   3774 C  CB  . ARG A 1 457 ? -29.254 37.496 -6.324  1.00 21.20 ? 473  ARG A CB  1 
ATOM   3775 C  CG  . ARG A 1 457 ? -27.721 37.383 -6.184  1.00 21.36 ? 473  ARG A CG  1 
ATOM   3776 C  CD  . ARG A 1 457 ? -27.102 36.285 -7.064  1.00 22.21 ? 473  ARG A CD  1 
ATOM   3777 N  NE  . ARG A 1 457 ? -27.720 34.987 -6.810  1.00 22.53 ? 473  ARG A NE  1 
ATOM   3778 C  CZ  . ARG A 1 457 ? -28.480 34.323 -7.675  1.00 23.00 ? 473  ARG A CZ  1 
ATOM   3779 N  NH1 . ARG A 1 457 ? -28.710 34.805 -8.895  1.00 22.45 ? 473  ARG A NH1 1 
ATOM   3780 N  NH2 . ARG A 1 457 ? -29.009 33.162 -7.316  1.00 23.67 ? 473  ARG A NH2 1 
ATOM   3781 N  N   . ASP A 1 458 ? -31.817 39.162 -7.331  1.00 21.43 ? 474  ASP A N   1 
ATOM   3782 C  CA  . ASP A 1 458 ? -33.248 39.469 -7.406  1.00 21.83 ? 474  ASP A CA  1 
ATOM   3783 C  C   . ASP A 1 458 ? -33.701 39.545 -8.872  1.00 21.85 ? 474  ASP A C   1 
ATOM   3784 O  O   . ASP A 1 458 ? -34.534 38.747 -9.308  1.00 21.94 ? 474  ASP A O   1 
ATOM   3785 C  CB  . ASP A 1 458 ? -33.527 40.784 -6.649  1.00 22.02 ? 474  ASP A CB  1 
ATOM   3786 C  CG  . ASP A 1 458 ? -34.969 41.288 -6.794  1.00 22.75 ? 474  ASP A CG  1 
ATOM   3787 O  OD1 . ASP A 1 458 ? -35.784 40.691 -7.528  1.00 23.51 ? 474  ASP A OD1 1 
ATOM   3788 O  OD2 . ASP A 1 458 ? -35.285 42.315 -6.157  1.00 23.45 ? 474  ASP A OD2 1 
ATOM   3789 N  N   . GLU A 1 459 ? -33.131 40.487 -9.625  1.00 22.00 ? 475  GLU A N   1 
ATOM   3790 C  CA  . GLU A 1 459 ? -33.517 40.741 -11.023 1.00 22.32 ? 475  GLU A CA  1 
ATOM   3791 C  C   . GLU A 1 459 ? -33.547 39.481 -11.905 1.00 21.70 ? 475  GLU A C   1 
ATOM   3792 O  O   . GLU A 1 459 ? -34.486 39.281 -12.682 1.00 21.39 ? 475  GLU A O   1 
ATOM   3793 C  CB  . GLU A 1 459 ? -32.592 41.800 -11.642 1.00 22.79 ? 475  GLU A CB  1 
ATOM   3794 C  CG  . GLU A 1 459 ? -32.945 42.200 -13.084 1.00 25.91 ? 475  GLU A CG  1 
ATOM   3795 C  CD  . GLU A 1 459 ? -31.947 43.175 -13.710 1.00 29.55 ? 475  GLU A CD  1 
ATOM   3796 O  OE1 . GLU A 1 459 ? -31.037 43.671 -13.003 1.00 31.49 ? 475  GLU A OE1 1 
ATOM   3797 O  OE2 . GLU A 1 459 ? -32.075 43.447 -14.923 1.00 31.55 ? 475  GLU A OE2 1 
ATOM   3798 N  N   . TYR A 1 460 ? -32.529 38.636 -11.776 1.00 21.03 ? 476  TYR A N   1 
ATOM   3799 C  CA  . TYR A 1 460 ? -32.390 37.483 -12.662 1.00 20.80 ? 476  TYR A CA  1 
ATOM   3800 C  C   . TYR A 1 460 ? -32.966 36.180 -12.112 1.00 20.34 ? 476  TYR A C   1 
ATOM   3801 O  O   . TYR A 1 460 ? -33.611 35.437 -12.849 1.00 20.50 ? 476  TYR A O   1 
ATOM   3802 C  CB  . TYR A 1 460 ? -30.927 37.311 -13.098 1.00 20.68 ? 476  TYR A CB  1 
ATOM   3803 C  CG  . TYR A 1 460 ? -30.469 38.373 -14.082 1.00 21.37 ? 476  TYR A CG  1 
ATOM   3804 C  CD1 . TYR A 1 460 ? -29.991 39.609 -13.640 1.00 21.30 ? 476  TYR A CD1 1 
ATOM   3805 C  CD2 . TYR A 1 460 ? -30.523 38.144 -15.457 1.00 22.07 ? 476  TYR A CD2 1 
ATOM   3806 C  CE1 . TYR A 1 460 ? -29.578 40.589 -14.545 1.00 21.70 ? 476  TYR A CE1 1 
ATOM   3807 C  CE2 . TYR A 1 460 ? -30.116 39.117 -16.369 1.00 22.03 ? 476  TYR A CE2 1 
ATOM   3808 C  CZ  . TYR A 1 460 ? -29.646 40.333 -15.907 1.00 22.45 ? 476  TYR A CZ  1 
ATOM   3809 O  OH  . TYR A 1 460 ? -29.242 41.291 -16.807 1.00 22.51 ? 476  TYR A OH  1 
ATOM   3810 N  N   . SER A 1 461 ? -32.739 35.905 -10.828 1.00 20.00 ? 477  SER A N   1 
ATOM   3811 C  CA  . SER A 1 461 ? -33.146 34.629 -10.226 1.00 19.69 ? 477  SER A CA  1 
ATOM   3812 C  C   . SER A 1 461 ? -34.432 34.689 -9.391  1.00 19.65 ? 477  SER A C   1 
ATOM   3813 O  O   . SER A 1 461 ? -35.061 33.658 -9.145  1.00 19.61 ? 477  SER A O   1 
ATOM   3814 C  CB  . SER A 1 461 ? -32.010 34.042 -9.381  1.00 19.49 ? 477  SER A CB  1 
ATOM   3815 O  OG  . SER A 1 461 ? -30.973 33.523 -10.200 1.00 19.54 ? 477  SER A OG  1 
ATOM   3816 N  N   . GLY A 1 462 ? -34.819 35.884 -8.952  1.00 19.58 ? 478  GLY A N   1 
ATOM   3817 C  CA  . GLY A 1 462 ? -36.027 36.038 -8.135  1.00 19.54 ? 478  GLY A CA  1 
ATOM   3818 C  C   . GLY A 1 462 ? -35.899 35.361 -6.787  1.00 19.51 ? 478  GLY A C   1 
ATOM   3819 O  O   . GLY A 1 462 ? -36.851 34.752 -6.283  1.00 19.30 ? 478  GLY A O   1 
ATOM   3820 N  N   . ILE A 1 463 ? -34.699 35.448 -6.224  1.00 19.43 ? 479  ILE A N   1 
ATOM   3821 C  CA  . ILE A 1 463 ? -34.419 34.937 -4.891  1.00 19.49 ? 479  ILE A CA  1 
ATOM   3822 C  C   . ILE A 1 463 ? -33.869 36.076 -4.043  1.00 19.73 ? 479  ILE A C   1 
ATOM   3823 O  O   . ILE A 1 463 ? -33.471 37.114 -4.577  1.00 19.65 ? 479  ILE A O   1 
ATOM   3824 C  CB  . ILE A 1 463 ? -33.449 33.708 -4.918  1.00 19.44 ? 479  ILE A CB  1 
ATOM   3825 C  CG1 . ILE A 1 463 ? -32.076 34.068 -5.505  1.00 19.02 ? 479  ILE A CG1 1 
ATOM   3826 C  CG2 . ILE A 1 463 ? -34.065 32.546 -5.701  1.00 19.29 ? 479  ILE A CG2 1 
ATOM   3827 C  CD1 . ILE A 1 463 ? -31.077 34.598 -4.486  1.00 19.57 ? 479  ILE A CD1 1 
ATOM   3828 N  N   . GLU A 1 464 ? -33.850 35.879 -2.726  1.00 20.03 ? 480  GLU A N   1 
ATOM   3829 C  CA  . GLU A 1 464 ? -33.381 36.896 -1.793  1.00 20.45 ? 480  GLU A CA  1 
ATOM   3830 C  C   . GLU A 1 464 ? -32.858 36.234 -0.518  1.00 20.69 ? 480  GLU A C   1 
ATOM   3831 O  O   . GLU A 1 464 ? -33.236 35.098 -0.217  1.00 20.63 ? 480  GLU A O   1 
ATOM   3832 C  CB  . GLU A 1 464 ? -34.513 37.877 -1.455  1.00 20.67 ? 480  GLU A CB  1 
ATOM   3833 C  CG  . GLU A 1 464 ? -35.692 37.246 -0.710  1.00 21.37 ? 480  GLU A CG  1 
ATOM   3834 C  CD  . GLU A 1 464 ? -36.760 38.251 -0.315  1.00 22.45 ? 480  GLU A CD  1 
ATOM   3835 O  OE1 . GLU A 1 464 ? -36.877 39.309 -0.971  1.00 22.77 ? 480  GLU A OE1 1 
ATOM   3836 O  OE2 . GLU A 1 464 ? -37.495 37.977 0.655   1.00 23.23 ? 480  GLU A OE2 1 
ATOM   3837 N  N   . PRO A 1 465 ? -31.990 36.941 0.234   1.00 21.01 ? 481  PRO A N   1 
ATOM   3838 C  CA  . PRO A 1 465 ? -31.516 36.435 1.525   1.00 21.33 ? 481  PRO A CA  1 
ATOM   3839 C  C   . PRO A 1 465 ? -32.661 36.212 2.517   1.00 21.75 ? 481  PRO A C   1 
ATOM   3840 O  O   . PRO A 1 465 ? -33.700 36.876 2.412   1.00 21.79 ? 481  PRO A O   1 
ATOM   3841 C  CB  . PRO A 1 465 ? -30.601 37.558 2.028   1.00 21.38 ? 481  PRO A CB  1 
ATOM   3842 C  CG  . PRO A 1 465 ? -30.167 38.271 0.810   1.00 21.46 ? 481  PRO A CG  1 
ATOM   3843 C  CD  . PRO A 1 465 ? -31.329 38.208 -0.133  1.00 21.06 ? 481  PRO A CD  1 
ATOM   3844 N  N   . PRO A 1 466 ? -32.475 35.282 3.476   1.00 22.24 ? 482  PRO A N   1 
ATOM   3845 C  CA  . PRO A 1 466 ? -33.474 34.990 4.510   1.00 22.66 ? 482  PRO A CA  1 
ATOM   3846 C  C   . PRO A 1 466 ? -33.617 36.120 5.525   1.00 23.33 ? 482  PRO A C   1 
ATOM   3847 O  O   . PRO A 1 466 ? -34.654 36.235 6.182   1.00 23.75 ? 482  PRO A O   1 
ATOM   3848 C  CB  . PRO A 1 466 ? -32.904 33.748 5.204   1.00 22.72 ? 482  PRO A CB  1 
ATOM   3849 C  CG  . PRO A 1 466 ? -31.438 33.826 4.978   1.00 22.67 ? 482  PRO A CG  1 
ATOM   3850 C  CD  . PRO A 1 466 ? -31.298 34.402 3.597   1.00 22.13 ? 482  PRO A CD  1 
ATOM   3851 N  N   . VAL A 1 467 ? -32.568 36.926 5.655   1.00 23.60 ? 483  VAL A N   1 
ATOM   3852 C  CA  . VAL A 1 467 ? -32.542 38.047 6.587   1.00 24.03 ? 483  VAL A CA  1 
ATOM   3853 C  C   . VAL A 1 467 ? -32.134 39.316 5.851   1.00 24.09 ? 483  VAL A C   1 
ATOM   3854 O  O   . VAL A 1 467 ? -31.584 39.255 4.745   1.00 23.76 ? 483  VAL A O   1 
ATOM   3855 C  CB  . VAL A 1 467 ? -31.577 37.793 7.778   1.00 24.43 ? 483  VAL A CB  1 
ATOM   3856 C  CG1 . VAL A 1 467 ? -32.099 36.665 8.664   1.00 24.74 ? 483  VAL A CG1 1 
ATOM   3857 C  CG2 . VAL A 1 467 ? -30.157 37.490 7.288   1.00 24.48 ? 483  VAL A CG2 1 
ATOM   3858 N  N   . VAL A 1 468 ? -32.413 40.462 6.466   1.00 24.37 ? 484  VAL A N   1 
ATOM   3859 C  CA  . VAL A 1 468 ? -32.052 41.752 5.893   1.00 24.49 ? 484  VAL A CA  1 
ATOM   3860 C  C   . VAL A 1 468 ? -30.534 41.934 5.917   1.00 24.46 ? 484  VAL A C   1 
ATOM   3861 O  O   . VAL A 1 468 ? -29.898 41.813 6.968   1.00 24.80 ? 484  VAL A O   1 
ATOM   3862 C  CB  . VAL A 1 468 ? -32.753 42.923 6.628   1.00 25.00 ? 484  VAL A CB  1 
ATOM   3863 C  CG1 . VAL A 1 468 ? -32.314 44.263 6.051   1.00 25.19 ? 484  VAL A CG1 1 
ATOM   3864 C  CG2 . VAL A 1 468 ? -34.269 42.781 6.541   1.00 24.92 ? 484  VAL A CG2 1 
ATOM   3865 N  N   . ARG A 1 469 ? -29.967 42.196 4.741   1.00 23.89 ? 485  ARG A N   1 
ATOM   3866 C  CA  . ARG A 1 469 ? -28.550 42.515 4.604   1.00 23.89 ? 485  ARG A CA  1 
ATOM   3867 C  C   . ARG A 1 469 ? -28.392 44.002 4.295   1.00 24.19 ? 485  ARG A C   1 
ATOM   3868 O  O   . ARG A 1 469 ? -29.365 44.685 3.967   1.00 24.17 ? 485  ARG A O   1 
ATOM   3869 C  CB  . ARG A 1 469 ? -27.888 41.666 3.503   1.00 23.32 ? 485  ARG A CB  1 
ATOM   3870 C  CG  . ARG A 1 469 ? -28.171 40.158 3.572   1.00 22.64 ? 485  ARG A CG  1 
ATOM   3871 C  CD  . ARG A 1 469 ? -27.600 39.510 4.834   1.00 21.77 ? 485  ARG A CD  1 
ATOM   3872 N  NE  . ARG A 1 469 ? -26.172 39.203 4.732   1.00 21.13 ? 485  ARG A NE  1 
ATOM   3873 C  CZ  . ARG A 1 469 ? -25.427 38.770 5.748   1.00 21.58 ? 485  ARG A CZ  1 
ATOM   3874 N  NH1 . ARG A 1 469 ? -25.966 38.602 6.950   1.00 21.26 ? 485  ARG A NH1 1 
ATOM   3875 N  NH2 . ARG A 1 469 ? -24.139 38.505 5.567   1.00 20.56 ? 485  ARG A NH2 1 
ATOM   3876 N  N   . SER A 1 470 ? -27.167 44.499 4.415   1.00 24.49 ? 486  SER A N   1 
ATOM   3877 C  CA  . SER A 1 470 ? -26.868 45.896 4.126   1.00 24.96 ? 486  SER A CA  1 
ATOM   3878 C  C   . SER A 1 470 ? -25.447 46.011 3.589   1.00 25.18 ? 486  SER A C   1 
ATOM   3879 O  O   . SER A 1 470 ? -24.802 45.001 3.298   1.00 25.06 ? 486  SER A O   1 
ATOM   3880 C  CB  . SER A 1 470 ? -27.045 46.758 5.385   1.00 25.50 ? 486  SER A CB  1 
ATOM   3881 O  OG  . SER A 1 470 ? -26.003 46.523 6.317   1.00 25.52 ? 486  SER A OG  1 
ATOM   3882 N  N   . GLU A 1 471 ? -24.958 47.241 3.465   1.00 25.71 ? 487  GLU A N   1 
ATOM   3883 C  CA  . GLU A 1 471 ? -23.590 47.475 3.013   1.00 25.91 ? 487  GLU A CA  1 
ATOM   3884 C  C   . GLU A 1 471 ? -22.571 47.231 4.130   1.00 26.33 ? 487  GLU A C   1 
ATOM   3885 O  O   . GLU A 1 471 ? -21.363 47.341 3.913   1.00 26.44 ? 487  GLU A O   1 
ATOM   3886 C  CB  . GLU A 1 471 ? -23.444 48.876 2.410   1.00 26.10 ? 487  GLU A CB  1 
ATOM   3887 C  CG  . GLU A 1 471 ? -24.281 49.099 1.153   1.00 26.40 ? 487  GLU A CG  1 
ATOM   3888 C  CD  . GLU A 1 471 ? -23.838 48.254 -0.044  1.00 26.21 ? 487  GLU A CD  1 
ATOM   3889 O  OE1 . GLU A 1 471 ? -22.701 47.728 -0.047  1.00 25.81 ? 487  GLU A OE1 1 
ATOM   3890 O  OE2 . GLU A 1 471 ? -24.635 48.127 -0.996  1.00 26.67 ? 487  GLU A OE2 1 
ATOM   3891 N  N   . LYS A 1 472 ? -23.070 46.888 5.318   1.00 26.53 ? 488  LYS A N   1 
ATOM   3892 C  CA  . LYS A 1 472 ? -22.226 46.404 6.407   1.00 26.95 ? 488  LYS A CA  1 
ATOM   3893 C  C   . LYS A 1 472 ? -21.816 44.950 6.175   1.00 26.25 ? 488  LYS A C   1 
ATOM   3894 O  O   . LYS A 1 472 ? -20.826 44.481 6.735   1.00 26.32 ? 488  LYS A O   1 
ATOM   3895 C  CB  . LYS A 1 472 ? -22.936 46.544 7.757   1.00 27.58 ? 488  LYS A CB  1 
ATOM   3896 C  CG  . LYS A 1 472 ? -23.106 47.980 8.225   1.00 29.27 ? 488  LYS A CG  1 
ATOM   3897 C  CD  . LYS A 1 472 ? -23.990 48.043 9.465   1.00 31.61 ? 488  LYS A CD  1 
ATOM   3898 C  CE  . LYS A 1 472 ? -24.368 49.477 9.803   1.00 33.47 ? 488  LYS A CE  1 
ATOM   3899 N  NZ  . LYS A 1 472 ? -25.601 49.537 10.646  1.00 34.88 ? 488  LYS A NZ  1 
ATOM   3900 N  N   . ASP A 1 473 ? -22.589 44.243 5.352   1.00 25.42 ? 489  ASP A N   1 
ATOM   3901 C  CA  . ASP A 1 473 ? -22.266 42.874 4.964   1.00 24.80 ? 489  ASP A CA  1 
ATOM   3902 C  C   . ASP A 1 473 ? -21.599 42.876 3.593   1.00 24.26 ? 489  ASP A C   1 
ATOM   3903 O  O   . ASP A 1 473 ? -21.702 43.854 2.850   1.00 23.96 ? 489  ASP A O   1 
ATOM   3904 C  CB  . ASP A 1 473 ? -23.535 42.017 4.924   1.00 24.59 ? 489  ASP A CB  1 
ATOM   3905 C  CG  . ASP A 1 473 ? -24.382 42.168 6.176   1.00 24.99 ? 489  ASP A CG  1 
ATOM   3906 O  OD1 . ASP A 1 473 ? -23.890 41.847 7.278   1.00 24.78 ? 489  ASP A OD1 1 
ATOM   3907 O  OD2 . ASP A 1 473 ? -25.536 42.621 6.053   1.00 24.58 ? 489  ASP A OD2 1 
ATOM   3908 N  N   . PHE A 1 474 ? -20.909 41.786 3.264   1.00 23.83 ? 490  PHE A N   1 
ATOM   3909 C  CA  . PHE A 1 474 ? -20.353 41.608 1.922   1.00 23.27 ? 490  PHE A CA  1 
ATOM   3910 C  C   . PHE A 1 474 ? -20.433 40.142 1.529   1.00 22.85 ? 490  PHE A C   1 
ATOM   3911 O  O   . PHE A 1 474 ? -19.588 39.337 1.909   1.00 22.81 ? 490  PHE A O   1 
ATOM   3912 C  CB  . PHE A 1 474 ? -18.920 42.143 1.826   1.00 23.34 ? 490  PHE A CB  1 
ATOM   3913 C  CG  . PHE A 1 474 ? -18.418 42.263 0.416   1.00 23.20 ? 490  PHE A CG  1 
ATOM   3914 C  CD1 . PHE A 1 474 ? -19.018 43.147 -0.477  1.00 23.08 ? 490  PHE A CD1 1 
ATOM   3915 C  CD2 . PHE A 1 474 ? -17.348 41.495 -0.022  1.00 23.00 ? 490  PHE A CD2 1 
ATOM   3916 C  CE1 . PHE A 1 474 ? -18.561 43.258 -1.791  1.00 23.12 ? 490  PHE A CE1 1 
ATOM   3917 C  CE2 . PHE A 1 474 ? -16.883 41.602 -1.336  1.00 22.70 ? 490  PHE A CE2 1 
ATOM   3918 C  CZ  . PHE A 1 474 ? -17.493 42.486 -2.218  1.00 22.29 ? 490  PHE A CZ  1 
ATOM   3919 N  N   . ASP A 1 475 ? -21.454 39.812 0.747   1.00 22.28 ? 491  ASP A N   1 
ATOM   3920 C  CA  . ASP A 1 475 ? -21.903 38.429 0.600   1.00 22.01 ? 491  ASP A CA  1 
ATOM   3921 C  C   . ASP A 1 475 ? -21.355 37.645 -0.597  1.00 21.57 ? 491  ASP A C   1 
ATOM   3922 O  O   . ASP A 1 475 ? -21.349 36.413 -0.574  1.00 21.47 ? 491  ASP A O   1 
ATOM   3923 C  CB  . ASP A 1 475 ? -23.434 38.385 0.630   1.00 21.80 ? 491  ASP A CB  1 
ATOM   3924 C  CG  . ASP A 1 475 ? -23.993 38.772 1.990   1.00 22.36 ? 491  ASP A CG  1 
ATOM   3925 O  OD1 . ASP A 1 475 ? -23.486 38.242 3.000   1.00 22.40 ? 491  ASP A OD1 1 
ATOM   3926 O  OD2 . ASP A 1 475 ? -24.924 39.606 2.055   1.00 22.38 ? 491  ASP A OD2 1 
ATOM   3927 N  N   . ALA A 1 476 ? -20.887 38.348 -1.625  1.00 21.37 ? 492  ALA A N   1 
ATOM   3928 C  CA  . ALA A 1 476 ? -20.383 37.691 -2.843  1.00 20.96 ? 492  ALA A CA  1 
ATOM   3929 C  C   . ALA A 1 476 ? -19.300 36.618 -2.609  1.00 20.94 ? 492  ALA A C   1 
ATOM   3930 O  O   . ALA A 1 476 ? -19.402 35.525 -3.170  1.00 20.64 ? 492  ALA A O   1 
ATOM   3931 C  CB  . ALA A 1 476 ? -19.917 38.722 -3.868  1.00 20.96 ? 492  ALA A CB  1 
ATOM   3932 N  N   . PRO A 1 477 ? -18.273 36.913 -1.775  1.00 21.22 ? 493  PRO A N   1 
ATOM   3933 C  CA  . PRO A 1 477 ? -17.211 35.921 -1.548  1.00 21.28 ? 493  PRO A CA  1 
ATOM   3934 C  C   . PRO A 1 477 ? -17.647 34.657 -0.798  1.00 21.40 ? 493  PRO A C   1 
ATOM   3935 O  O   . PRO A 1 477 ? -16.843 33.732 -0.648  1.00 21.34 ? 493  PRO A O   1 
ATOM   3936 C  CB  . PRO A 1 477 ? -16.174 36.694 -0.720  1.00 21.61 ? 493  PRO A CB  1 
ATOM   3937 C  CG  . PRO A 1 477 ? -16.450 38.125 -1.006  1.00 21.57 ? 493  PRO A CG  1 
ATOM   3938 C  CD  . PRO A 1 477 ? -17.943 38.189 -1.113  1.00 21.40 ? 493  PRO A CD  1 
ATOM   3939 N  N   . ALA A 1 478 ? -18.900 34.606 -0.346  1.00 21.40 ? 494  ALA A N   1 
ATOM   3940 C  CA  . ALA A 1 478 ? -19.428 33.390 0.281   1.00 21.57 ? 494  ALA A CA  1 
ATOM   3941 C  C   . ALA A 1 478 ? -19.593 32.261 -0.743  1.00 21.43 ? 494  ALA A C   1 
ATOM   3942 O  O   . ALA A 1 478 ? -19.789 31.104 -0.375  1.00 21.56 ? 494  ALA A O   1 
ATOM   3943 C  CB  . ALA A 1 478 ? -20.741 33.672 1.003   1.00 21.65 ? 494  ALA A CB  1 
ATOM   3944 N  N   . LYS A 1 479 ? -19.512 32.615 -2.026  1.00 21.17 ? 495  LYS A N   1 
ATOM   3945 C  CA  . LYS A 1 479 ? -19.463 31.648 -3.121  1.00 21.06 ? 495  LYS A CA  1 
ATOM   3946 C  C   . LYS A 1 479 ? -17.999 31.328 -3.429  1.00 21.10 ? 495  LYS A C   1 
ATOM   3947 O  O   . LYS A 1 479 ? -17.193 32.241 -3.631  1.00 20.78 ? 495  LYS A O   1 
ATOM   3948 C  CB  . LYS A 1 479 ? -20.155 32.226 -4.363  1.00 21.01 ? 495  LYS A CB  1 
ATOM   3949 C  CG  . LYS A 1 479 ? -20.114 31.336 -5.606  1.00 21.23 ? 495  LYS A CG  1 
ATOM   3950 C  CD  . LYS A 1 479 ? -20.917 30.061 -5.406  1.00 22.19 ? 495  LYS A CD  1 
ATOM   3951 C  CE  . LYS A 1 479 ? -20.614 29.053 -6.497  1.00 22.93 ? 495  LYS A CE  1 
ATOM   3952 N  NZ  . LYS A 1 479 ? -20.960 27.674 -6.060  1.00 23.41 ? 495  LYS A NZ  1 
ATOM   3953 N  N   . TYR A 1 480 ? -17.663 30.036 -3.468  1.00 21.04 ? 496  TYR A N   1 
ATOM   3954 C  CA  . TYR A 1 480 ? -16.269 29.595 -3.614  1.00 21.30 ? 496  TYR A CA  1 
ATOM   3955 C  C   . TYR A 1 480 ? -15.516 30.310 -4.736  1.00 21.11 ? 496  TYR A C   1 
ATOM   3956 O  O   . TYR A 1 480 ? -14.450 30.879 -4.508  1.00 21.20 ? 496  TYR A O   1 
ATOM   3957 C  CB  . TYR A 1 480 ? -16.170 28.074 -3.814  1.00 21.41 ? 496  TYR A CB  1 
ATOM   3958 C  CG  . TYR A 1 480 ? -14.775 27.625 -4.215  1.00 22.06 ? 496  TYR A CG  1 
ATOM   3959 C  CD1 . TYR A 1 480 ? -13.750 27.534 -3.270  1.00 22.61 ? 496  TYR A CD1 1 
ATOM   3960 C  CD2 . TYR A 1 480 ? -14.475 27.321 -5.544  1.00 22.47 ? 496  TYR A CD2 1 
ATOM   3961 C  CE1 . TYR A 1 480 ? -12.466 27.140 -3.636  1.00 23.20 ? 496  TYR A CE1 1 
ATOM   3962 C  CE2 . TYR A 1 480 ? -13.192 26.925 -5.919  1.00 23.15 ? 496  TYR A CE2 1 
ATOM   3963 C  CZ  . TYR A 1 480 ? -12.198 26.836 -4.962  1.00 23.20 ? 496  TYR A CZ  1 
ATOM   3964 O  OH  . TYR A 1 480 ? -10.934 26.447 -5.332  1.00 24.34 ? 496  TYR A OH  1 
ATOM   3965 N  N   . HIS A 1 481 ? -16.086 30.272 -5.936  1.00 20.85 ? 497  HIS A N   1 
ATOM   3966 C  CA  . HIS A 1 481 ? -15.449 30.813 -7.139  1.00 20.78 ? 497  HIS A CA  1 
ATOM   3967 C  C   . HIS A 1 481 ? -15.117 32.299 -7.035  1.00 20.88 ? 497  HIS A C   1 
ATOM   3968 O  O   . HIS A 1 481 ? -14.159 32.769 -7.652  1.00 20.88 ? 497  HIS A O   1 
ATOM   3969 C  CB  . HIS A 1 481 ? -16.335 30.561 -8.357  1.00 20.46 ? 497  HIS A CB  1 
ATOM   3970 C  CG  . HIS A 1 481 ? -16.589 29.110 -8.626  1.00 20.84 ? 497  HIS A CG  1 
ATOM   3971 N  ND1 . HIS A 1 481 ? -17.362 28.323 -7.800  1.00 20.55 ? 497  HIS A ND1 1 
ATOM   3972 C  CD2 . HIS A 1 481 ? -16.179 28.307 -9.636  1.00 20.72 ? 497  HIS A CD2 1 
ATOM   3973 C  CE1 . HIS A 1 481 ? -17.413 27.096 -8.286  1.00 21.01 ? 497  HIS A CE1 1 
ATOM   3974 N  NE2 . HIS A 1 481 ? -16.705 27.060 -9.402  1.00 21.11 ? 497  HIS A NE2 1 
ATOM   3975 N  N   . ILE A 1 482 ? -15.914 33.031 -6.259  1.00 20.96 ? 498  ILE A N   1 
ATOM   3976 C  CA  . ILE A 1 482 ? -15.677 34.457 -6.044  1.00 21.28 ? 498  ILE A CA  1 
ATOM   3977 C  C   . ILE A 1 482 ? -14.487 34.670 -5.094  1.00 21.45 ? 498  ILE A C   1 
ATOM   3978 O  O   . ILE A 1 482 ? -13.623 35.508 -5.359  1.00 21.58 ? 498  ILE A O   1 
ATOM   3979 C  CB  . ILE A 1 482 ? -16.971 35.196 -5.591  1.00 21.37 ? 498  ILE A CB  1 
ATOM   3980 C  CG1 . ILE A 1 482 ? -18.025 35.121 -6.708  1.00 21.64 ? 498  ILE A CG1 1 
ATOM   3981 C  CG2 . ILE A 1 482 ? -16.677 36.649 -5.231  1.00 21.40 ? 498  ILE A CG2 1 
ATOM   3982 C  CD1 . ILE A 1 482 ? -19.330 35.846 -6.425  1.00 23.57 ? 498  ILE A CD1 1 
ATOM   3983 N  N   . SER A 1 483 ? -14.428 33.894 -4.014  1.00 21.64 ? 499  SER A N   1 
ATOM   3984 C  CA  . SER A 1 483 ? -13.261 33.907 -3.124  1.00 21.89 ? 499  SER A CA  1 
ATOM   3985 C  C   . SER A 1 483 ? -11.998 33.377 -3.808  1.00 21.88 ? 499  SER A C   1 
ATOM   3986 O  O   . SER A 1 483 ? -10.895 33.855 -3.533  1.00 22.23 ? 499  SER A O   1 
ATOM   3987 C  CB  . SER A 1 483 ? -13.530 33.109 -1.844  1.00 22.21 ? 499  SER A CB  1 
ATOM   3988 O  OG  . SER A 1 483 ? -14.230 33.889 -0.891  1.00 22.28 ? 499  SER A OG  1 
ATOM   3989 N  N   . ALA A 1 484 ? -12.166 32.403 -4.702  1.00 21.48 ? 500  ALA A N   1 
ATOM   3990 C  CA  . ALA A 1 484 ? -11.030 31.722 -5.332  1.00 21.41 ? 500  ALA A CA  1 
ATOM   3991 C  C   . ALA A 1 484 ? -10.599 32.318 -6.677  1.00 21.19 ? 500  ALA A C   1 
ATOM   3992 O  O   . ALA A 1 484 ? -9.698  31.782 -7.328  1.00 21.02 ? 500  ALA A O   1 
ATOM   3993 C  CB  . ALA A 1 484 ? -11.321 30.230 -5.480  1.00 21.38 ? 500  ALA A CB  1 
ATOM   3994 N  N   . ASP A 1 485 ? -11.237 33.418 -7.081  1.00 20.91 ? 501  ASP A N   1 
ATOM   3995 C  CA  . ASP A 1 485 ? -10.933 34.091 -8.352  1.00 20.98 ? 501  ASP A CA  1 
ATOM   3996 C  C   . ASP A 1 485 ? -11.020 33.116 -9.538  1.00 20.91 ? 501  ASP A C   1 
ATOM   3997 O  O   . ASP A 1 485 ? -10.083 32.977 -10.334 1.00 21.03 ? 501  ASP A O   1 
ATOM   3998 C  CB  . ASP A 1 485 ? -9.568  34.807 -8.281  1.00 20.96 ? 501  ASP A CB  1 
ATOM   3999 C  CG  . ASP A 1 485 ? -9.205  35.546 -9.570  1.00 21.20 ? 501  ASP A CG  1 
ATOM   4000 O  OD1 . ASP A 1 485 ? -10.105 36.087 -10.249 1.00 20.30 ? 501  ASP A OD1 1 
ATOM   4001 O  OD2 . ASP A 1 485 ? -8.002  35.588 -9.899  1.00 21.19 ? 501  ASP A OD2 1 
ATOM   4002 N  N   . VAL A 1 486 ? -12.154 32.431 -9.632  1.00 20.74 ? 502  VAL A N   1 
ATOM   4003 C  CA  . VAL A 1 486 ? -12.424 31.541 -10.755 1.00 20.51 ? 502  VAL A CA  1 
ATOM   4004 C  C   . VAL A 1 486 ? -13.554 32.145 -11.575 1.00 20.33 ? 502  VAL A C   1 
ATOM   4005 O  O   . VAL A 1 486 ? -14.662 32.345 -11.066 1.00 20.41 ? 502  VAL A O   1 
ATOM   4006 C  CB  . VAL A 1 486 ? -12.796 30.108 -10.296 1.00 20.65 ? 502  VAL A CB  1 
ATOM   4007 C  CG1 . VAL A 1 486 ? -13.129 29.225 -11.494 1.00 20.31 ? 502  VAL A CG1 1 
ATOM   4008 C  CG2 . VAL A 1 486 ? -11.663 29.485 -9.481  1.00 20.91 ? 502  VAL A CG2 1 
ATOM   4009 N  N   . GLU A 1 487 ? -13.257 32.454 -12.837 1.00 20.11 ? 503  GLU A N   1 
ATOM   4010 C  CA  . GLU A 1 487 ? -14.240 32.991 -13.776 1.00 19.95 ? 503  GLU A CA  1 
ATOM   4011 C  C   . GLU A 1 487 ? -15.458 32.064 -13.810 1.00 19.64 ? 503  GLU A C   1 
ATOM   4012 O  O   . GLU A 1 487 ? -15.308 30.840 -13.748 1.00 19.67 ? 503  GLU A O   1 
ATOM   4013 C  CB  . GLU A 1 487 ? -13.596 33.148 -15.164 1.00 20.10 ? 503  GLU A CB  1 
ATOM   4014 C  CG  . GLU A 1 487 ? -14.473 33.804 -16.224 1.00 20.39 ? 503  GLU A CG  1 
ATOM   4015 C  CD  . GLU A 1 487 ? -15.088 32.808 -17.196 1.00 21.50 ? 503  GLU A CD  1 
ATOM   4016 O  OE1 . GLU A 1 487 ? -15.244 31.623 -16.836 1.00 21.08 ? 503  GLU A OE1 1 
ATOM   4017 O  OE2 . GLU A 1 487 ? -15.412 33.216 -18.333 1.00 21.43 ? 503  GLU A OE2 1 
ATOM   4018 N  N   . TYR A 1 488 ? -16.659 32.640 -13.874 1.00 19.20 ? 504  TYR A N   1 
ATOM   4019 C  CA  . TYR A 1 488 ? -17.878 31.833 -13.764 1.00 18.98 ? 504  TYR A CA  1 
ATOM   4020 C  C   . TYR A 1 488 ? -18.658 31.657 -15.066 1.00 18.87 ? 504  TYR A C   1 
ATOM   4021 O  O   . TYR A 1 488 ? -19.437 30.713 -15.194 1.00 19.09 ? 504  TYR A O   1 
ATOM   4022 C  CB  . TYR A 1 488 ? -18.799 32.345 -12.647 1.00 18.79 ? 504  TYR A CB  1 
ATOM   4023 C  CG  . TYR A 1 488 ? -19.550 31.227 -11.950 1.00 18.43 ? 504  TYR A CG  1 
ATOM   4024 C  CD1 . TYR A 1 488 ? -18.950 30.493 -10.927 1.00 17.95 ? 504  TYR A CD1 1 
ATOM   4025 C  CD2 . TYR A 1 488 ? -20.848 30.887 -12.330 1.00 18.32 ? 504  TYR A CD2 1 
ATOM   4026 C  CE1 . TYR A 1 488 ? -19.628 29.456 -10.291 1.00 18.64 ? 504  TYR A CE1 1 
ATOM   4027 C  CE2 . TYR A 1 488 ? -21.537 29.853 -11.700 1.00 18.59 ? 504  TYR A CE2 1 
ATOM   4028 C  CZ  . TYR A 1 488 ? -20.920 29.145 -10.681 1.00 18.74 ? 504  TYR A CZ  1 
ATOM   4029 O  OH  . TYR A 1 488 ? -21.591 28.121 -10.057 1.00 18.57 ? 504  TYR A OH  1 
ATOM   4030 N  N   . LEU A 1 489 ? -18.439 32.545 -16.031 1.00 18.82 ? 505  LEU A N   1 
ATOM   4031 C  CA  . LEU A 1 489 ? -19.158 32.480 -17.305 1.00 18.90 ? 505  LEU A CA  1 
ATOM   4032 C  C   . LEU A 1 489 ? -18.981 31.127 -17.995 1.00 19.00 ? 505  LEU A C   1 
ATOM   4033 O  O   . LEU A 1 489 ? -19.877 30.671 -18.708 1.00 19.10 ? 505  LEU A O   1 
ATOM   4034 C  CB  . LEU A 1 489 ? -18.731 33.613 -18.241 1.00 18.93 ? 505  LEU A CB  1 
ATOM   4035 C  CG  . LEU A 1 489 ? -19.693 33.954 -19.380 1.00 18.70 ? 505  LEU A CG  1 
ATOM   4036 C  CD1 . LEU A 1 489 ? -20.912 34.720 -18.863 1.00 19.01 ? 505  LEU A CD1 1 
ATOM   4037 C  CD2 . LEU A 1 489 ? -18.969 34.749 -20.454 1.00 18.88 ? 505  LEU A CD2 1 
ATOM   4038 N  N   . ARG A 1 490 ? -17.831 30.493 -17.767 1.00 18.91 ? 506  ARG A N   1 
ATOM   4039 C  CA  . ARG A 1 490 ? -17.571 29.129 -18.234 1.00 19.15 ? 506  ARG A CA  1 
ATOM   4040 C  C   . ARG A 1 490 ? -18.738 28.176 -17.955 1.00 19.12 ? 506  ARG A C   1 
ATOM   4041 O  O   . ARG A 1 490 ? -19.020 27.293 -18.761 1.00 19.21 ? 506  ARG A O   1 
ATOM   4042 C  CB  . ARG A 1 490 ? -16.281 28.577 -17.612 1.00 19.09 ? 506  ARG A CB  1 
ATOM   4043 C  CG  . ARG A 1 490 ? -16.286 28.500 -16.082 1.00 19.40 ? 506  ARG A CG  1 
ATOM   4044 C  CD  . ARG A 1 490 ? -14.943 28.039 -15.533 1.00 19.27 ? 506  ARG A CD  1 
ATOM   4045 N  NE  . ARG A 1 490 ? -13.882 29.012 -15.796 1.00 19.04 ? 506  ARG A NE  1 
ATOM   4046 C  CZ  . ARG A 1 490 ? -12.611 28.860 -15.434 1.00 19.70 ? 506  ARG A CZ  1 
ATOM   4047 N  NH1 . ARG A 1 490 ? -12.222 27.770 -14.780 1.00 19.75 ? 506  ARG A NH1 1 
ATOM   4048 N  NH2 . ARG A 1 490 ? -11.724 29.804 -15.726 1.00 20.13 ? 506  ARG A NH2 1 
ATOM   4049 N  N   . TYR A 1 491 ? -19.413 28.364 -16.820 1.00 19.00 ? 507  TYR A N   1 
ATOM   4050 C  CA  . TYR A 1 491 ? -20.514 27.484 -16.428 1.00 18.98 ? 507  TYR A CA  1 
ATOM   4051 C  C   . TYR A 1 491 ? -21.808 27.776 -17.189 1.00 18.97 ? 507  TYR A C   1 
ATOM   4052 O  O   . TYR A 1 491 ? -22.552 26.851 -17.521 1.00 19.05 ? 507  TYR A O   1 
ATOM   4053 C  CB  . TYR A 1 491 ? -20.736 27.523 -14.912 1.00 19.06 ? 507  TYR A CB  1 
ATOM   4054 C  CG  . TYR A 1 491 ? -19.542 27.037 -14.127 1.00 19.21 ? 507  TYR A CG  1 
ATOM   4055 C  CD1 . TYR A 1 491 ? -19.211 25.680 -14.094 1.00 20.07 ? 507  TYR A CD1 1 
ATOM   4056 C  CD2 . TYR A 1 491 ? -18.737 27.930 -13.430 1.00 19.38 ? 507  TYR A CD2 1 
ATOM   4057 C  CE1 . TYR A 1 491 ? -18.107 25.229 -13.383 1.00 20.51 ? 507  TYR A CE1 1 
ATOM   4058 C  CE2 . TYR A 1 491 ? -17.629 27.489 -12.714 1.00 20.08 ? 507  TYR A CE2 1 
ATOM   4059 C  CZ  . TYR A 1 491 ? -17.322 26.138 -12.693 1.00 20.71 ? 507  TYR A CZ  1 
ATOM   4060 O  OH  . TYR A 1 491 ? -16.229 25.699 -11.983 1.00 22.13 ? 507  TYR A OH  1 
ATOM   4061 N  N   . LEU A 1 492 ? -22.075 29.052 -17.465 1.00 18.64 ? 508  LEU A N   1 
ATOM   4062 C  CA  . LEU A 1 492 ? -23.211 29.419 -18.305 1.00 18.60 ? 508  LEU A CA  1 
ATOM   4063 C  C   . LEU A 1 492 ? -23.005 28.858 -19.712 1.00 18.74 ? 508  LEU A C   1 
ATOM   4064 O  O   . LEU A 1 492 ? -23.911 28.247 -20.284 1.00 18.65 ? 508  LEU A O   1 
ATOM   4065 C  CB  . LEU A 1 492 ? -23.420 30.940 -18.340 1.00 18.46 ? 508  LEU A CB  1 
ATOM   4066 C  CG  . LEU A 1 492 ? -24.524 31.465 -19.270 1.00 18.93 ? 508  LEU A CG  1 
ATOM   4067 C  CD1 . LEU A 1 492 ? -25.899 30.877 -18.929 1.00 19.32 ? 508  LEU A CD1 1 
ATOM   4068 C  CD2 . LEU A 1 492 ? -24.568 32.985 -19.254 1.00 18.65 ? 508  LEU A CD2 1 
ATOM   4069 N  N   . VAL A 1 493 ? -21.804 29.054 -20.252 1.00 18.75 ? 509  VAL A N   1 
ATOM   4070 C  CA  . VAL A 1 493 ? -21.446 28.494 -21.554 1.00 19.00 ? 509  VAL A CA  1 
ATOM   4071 C  C   . VAL A 1 493 ? -21.590 26.968 -21.526 1.00 19.34 ? 509  VAL A C   1 
ATOM   4072 O  O   . VAL A 1 493 ? -22.222 26.389 -22.408 1.00 19.23 ? 509  VAL A O   1 
ATOM   4073 C  CB  . VAL A 1 493 ? -20.018 28.907 -21.989 1.00 19.11 ? 509  VAL A CB  1 
ATOM   4074 C  CG1 . VAL A 1 493 ? -19.656 28.280 -23.339 1.00 18.95 ? 509  VAL A CG1 1 
ATOM   4075 C  CG2 . VAL A 1 493 ? -19.903 30.424 -22.065 1.00 18.51 ? 509  VAL A CG2 1 
ATOM   4076 N  N   . SER A 1 494 ? -21.030 26.337 -20.494 1.00 19.61 ? 510  SER A N   1 
ATOM   4077 C  CA  . SER A 1 494 ? -21.093 24.882 -20.336 1.00 20.34 ? 510  SER A CA  1 
ATOM   4078 C  C   . SER A 1 494 ? -22.519 24.340 -20.356 1.00 20.55 ? 510  SER A C   1 
ATOM   4079 O  O   . SER A 1 494 ? -22.816 23.402 -21.090 1.00 20.73 ? 510  SER A O   1 
ATOM   4080 C  CB  . SER A 1 494 ? -20.408 24.442 -19.040 1.00 20.22 ? 510  SER A CB  1 
ATOM   4081 O  OG  . SER A 1 494 ? -20.709 23.086 -18.756 1.00 21.28 ? 510  SER A OG  1 
ATOM   4082 N  N   . PHE A 1 495 ? -23.395 24.936 -19.552 1.00 20.66 ? 511  PHE A N   1 
ATOM   4083 C  CA  . PHE A 1 495 ? -24.773 24.460 -19.428 1.00 21.08 ? 511  PHE A CA  1 
ATOM   4084 C  C   . PHE A 1 495 ? -25.577 24.598 -20.724 1.00 21.42 ? 511  PHE A C   1 
ATOM   4085 O  O   . PHE A 1 495 ? -26.526 23.850 -20.942 1.00 21.85 ? 511  PHE A O   1 
ATOM   4086 C  CB  . PHE A 1 495 ? -25.478 25.139 -18.250 1.00 20.83 ? 511  PHE A CB  1 
ATOM   4087 C  CG  . PHE A 1 495 ? -25.232 24.466 -16.920 1.00 20.98 ? 511  PHE A CG  1 
ATOM   4088 C  CD1 . PHE A 1 495 ? -23.936 24.191 -16.482 1.00 21.21 ? 511  PHE A CD1 1 
ATOM   4089 C  CD2 . PHE A 1 495 ? -26.301 24.099 -16.107 1.00 21.36 ? 511  PHE A CD2 1 
ATOM   4090 C  CE1 . PHE A 1 495 ? -23.710 23.569 -15.252 1.00 21.45 ? 511  PHE A CE1 1 
ATOM   4091 C  CE2 . PHE A 1 495 ? -26.087 23.480 -14.876 1.00 21.11 ? 511  PHE A CE2 1 
ATOM   4092 C  CZ  . PHE A 1 495 ? -24.791 23.214 -14.448 1.00 21.81 ? 511  PHE A CZ  1 
ATOM   4093 N  N   . ILE A 1 496 ? -25.186 25.541 -21.579 1.00 21.48 ? 512  ILE A N   1 
ATOM   4094 C  CA  . ILE A 1 496 ? -25.767 25.662 -22.917 1.00 21.71 ? 512  ILE A CA  1 
ATOM   4095 C  C   . ILE A 1 496 ? -25.172 24.621 -23.877 1.00 22.08 ? 512  ILE A C   1 
ATOM   4096 O  O   . ILE A 1 496 ? -25.907 23.823 -24.466 1.00 22.34 ? 512  ILE A O   1 
ATOM   4097 C  CB  . ILE A 1 496 ? -25.589 27.090 -23.498 1.00 21.69 ? 512  ILE A CB  1 
ATOM   4098 C  CG1 . ILE A 1 496 ? -26.352 28.116 -22.654 1.00 21.57 ? 512  ILE A CG1 1 
ATOM   4099 C  CG2 . ILE A 1 496 ? -26.053 27.150 -24.958 1.00 21.82 ? 512  ILE A CG2 1 
ATOM   4100 C  CD1 . ILE A 1 496 ? -25.878 29.546 -22.848 1.00 22.54 ? 512  ILE A CD1 1 
ATOM   4101 N  N   . ILE A 1 497 ? -23.847 24.624 -24.025 1.00 22.11 ? 513  ILE A N   1 
ATOM   4102 C  CA  . ILE A 1 497 ? -23.192 23.764 -25.021 1.00 22.55 ? 513  ILE A CA  1 
ATOM   4103 C  C   . ILE A 1 497 ? -23.214 22.271 -24.671 1.00 22.80 ? 513  ILE A C   1 
ATOM   4104 O  O   . ILE A 1 497 ? -23.157 21.431 -25.568 1.00 23.03 ? 513  ILE A O   1 
ATOM   4105 C  CB  . ILE A 1 497 ? -21.748 24.227 -25.375 1.00 22.46 ? 513  ILE A CB  1 
ATOM   4106 C  CG1 . ILE A 1 497 ? -20.804 24.092 -24.172 1.00 22.59 ? 513  ILE A CG1 1 
ATOM   4107 C  CG2 . ILE A 1 497 ? -21.765 25.655 -25.953 1.00 22.45 ? 513  ILE A CG2 1 
ATOM   4108 C  CD1 . ILE A 1 497 ? -19.327 24.239 -24.517 1.00 22.23 ? 513  ILE A CD1 1 
ATOM   4109 N  N   . GLN A 1 498 ? -23.311 21.938 -23.382 1.00 22.66 ? 514  GLN A N   1 
ATOM   4110 C  CA  . GLN A 1 498 ? -23.360 20.525 -22.982 1.00 22.96 ? 514  GLN A CA  1 
ATOM   4111 C  C   . GLN A 1 498 ? -24.586 19.805 -23.553 1.00 23.26 ? 514  GLN A C   1 
ATOM   4112 O  O   . GLN A 1 498 ? -24.559 18.590 -23.750 1.00 23.61 ? 514  GLN A O   1 
ATOM   4113 C  CB  . GLN A 1 498 ? -23.275 20.349 -21.460 1.00 22.74 ? 514  GLN A CB  1 
ATOM   4114 C  CG  . GLN A 1 498 ? -24.522 20.767 -20.684 1.00 22.71 ? 514  GLN A CG  1 
ATOM   4115 C  CD  . GLN A 1 498 ? -24.360 20.597 -19.186 1.00 22.63 ? 514  GLN A CD  1 
ATOM   4116 O  OE1 . GLN A 1 498 ? -25.106 19.851 -18.557 1.00 23.82 ? 514  GLN A OE1 1 
ATOM   4117 N  NE2 . GLN A 1 498 ? -23.378 21.282 -18.609 1.00 22.21 ? 514  GLN A NE2 1 
ATOM   4118 N  N   . PHE A 1 499 ? -25.651 20.557 -23.821 1.00 23.25 ? 515  PHE A N   1 
ATOM   4119 C  CA  . PHE A 1 499 ? -26.836 19.991 -24.458 1.00 23.52 ? 515  PHE A CA  1 
ATOM   4120 C  C   . PHE A 1 499 ? -26.657 19.848 -25.965 1.00 23.87 ? 515  PHE A C   1 
ATOM   4121 O  O   . PHE A 1 499 ? -27.261 18.971 -26.579 1.00 24.11 ? 515  PHE A O   1 
ATOM   4122 C  CB  . PHE A 1 499 ? -28.091 20.793 -24.112 1.00 23.40 ? 515  PHE A CB  1 
ATOM   4123 C  CG  . PHE A 1 499 ? -28.567 20.576 -22.701 1.00 23.37 ? 515  PHE A CG  1 
ATOM   4124 C  CD1 . PHE A 1 499 ? -28.076 21.355 -21.661 1.00 23.02 ? 515  PHE A CD1 1 
ATOM   4125 C  CD2 . PHE A 1 499 ? -29.489 19.575 -22.410 1.00 23.86 ? 515  PHE A CD2 1 
ATOM   4126 C  CE1 . PHE A 1 499 ? -28.503 21.150 -20.346 1.00 23.19 ? 515  PHE A CE1 1 
ATOM   4127 C  CE2 . PHE A 1 499 ? -29.924 19.361 -21.102 1.00 23.87 ? 515  PHE A CE2 1 
ATOM   4128 C  CZ  . PHE A 1 499 ? -29.429 20.153 -20.067 1.00 23.46 ? 515  PHE A CZ  1 
ATOM   4129 N  N   . GLN A 1 500 ? -25.833 20.711 -26.556 1.00 23.74 ? 516  GLN A N   1 
ATOM   4130 C  CA  . GLN A 1 500 ? -25.438 20.555 -27.959 1.00 24.28 ? 516  GLN A CA  1 
ATOM   4131 C  C   . GLN A 1 500 ? -24.614 19.281 -28.122 1.00 24.60 ? 516  GLN A C   1 
ATOM   4132 O  O   . GLN A 1 500 ? -24.859 18.496 -29.042 1.00 25.19 ? 516  GLN A O   1 
ATOM   4133 C  CB  . GLN A 1 500 ? -24.649 21.769 -28.461 1.00 24.10 ? 516  GLN A CB  1 
ATOM   4134 C  CG  . GLN A 1 500 ? -25.426 23.076 -28.456 1.00 24.27 ? 516  GLN A CG  1 
ATOM   4135 C  CD  . GLN A 1 500 ? -24.656 24.217 -29.092 1.00 25.10 ? 516  GLN A CD  1 
ATOM   4136 O  OE1 . GLN A 1 500 ? -24.371 24.204 -30.294 1.00 26.23 ? 516  GLN A OE1 1 
ATOM   4137 N  NE2 . GLN A 1 500 ? -24.320 25.216 -28.289 1.00 23.72 ? 516  GLN A NE2 1 
ATOM   4138 N  N   . PHE A 1 501 ? -23.652 19.078 -27.219 1.00 24.50 ? 517  PHE A N   1 
ATOM   4139 C  CA  . PHE A 1 501 ? -22.823 17.867 -27.207 1.00 24.98 ? 517  PHE A CA  1 
ATOM   4140 C  C   . PHE A 1 501 ? -23.645 16.611 -26.928 1.00 25.48 ? 517  PHE A C   1 
ATOM   4141 O  O   . PHE A 1 501 ? -23.490 15.599 -27.614 1.00 25.85 ? 517  PHE A O   1 
ATOM   4142 C  CB  . PHE A 1 501 ? -21.704 17.962 -26.162 1.00 24.73 ? 517  PHE A CB  1 
ATOM   4143 C  CG  . PHE A 1 501 ? -20.704 19.061 -26.414 1.00 24.60 ? 517  PHE A CG  1 
ATOM   4144 C  CD1 . PHE A 1 501 ? -20.346 19.429 -27.710 1.00 25.01 ? 517  PHE A CD1 1 
ATOM   4145 C  CD2 . PHE A 1 501 ? -20.107 19.719 -25.342 1.00 24.24 ? 517  PHE A CD2 1 
ATOM   4146 C  CE1 . PHE A 1 501 ? -19.415 20.442 -27.929 1.00 24.72 ? 517  PHE A CE1 1 
ATOM   4147 C  CE2 . PHE A 1 501 ? -19.174 20.728 -25.551 1.00 24.09 ? 517  PHE A CE2 1 
ATOM   4148 C  CZ  . PHE A 1 501 ? -18.829 21.093 -26.848 1.00 24.57 ? 517  PHE A CZ  1 
ATOM   4149 N  N   . TYR A 1 502 ? -24.505 16.684 -25.911 1.00 25.36 ? 518  TYR A N   1 
ATOM   4150 C  CA  . TYR A 1 502 ? -25.346 15.556 -25.503 1.00 25.94 ? 518  TYR A CA  1 
ATOM   4151 C  C   . TYR A 1 502 ? -26.289 15.118 -26.619 1.00 26.31 ? 518  TYR A C   1 
ATOM   4152 O  O   . TYR A 1 502 ? -26.358 13.933 -26.937 1.00 26.75 ? 518  TYR A O   1 
ATOM   4153 C  CB  . TYR A 1 502 ? -26.134 15.905 -24.235 1.00 25.66 ? 518  TYR A CB  1 
ATOM   4154 C  CG  . TYR A 1 502 ? -26.977 14.784 -23.658 1.00 26.55 ? 518  TYR A CG  1 
ATOM   4155 C  CD1 . TYR A 1 502 ? -26.385 13.673 -23.052 1.00 27.26 ? 518  TYR A CD1 1 
ATOM   4156 C  CD2 . TYR A 1 502 ? -28.370 14.852 -23.689 1.00 27.21 ? 518  TYR A CD2 1 
ATOM   4157 C  CE1 . TYR A 1 502 ? -27.163 12.646 -22.508 1.00 27.66 ? 518  TYR A CE1 1 
ATOM   4158 C  CE2 . TYR A 1 502 ? -29.155 13.836 -23.148 1.00 27.73 ? 518  TYR A CE2 1 
ATOM   4159 C  CZ  . TYR A 1 502 ? -28.546 12.738 -22.558 1.00 27.96 ? 518  TYR A CZ  1 
ATOM   4160 O  OH  . TYR A 1 502 ? -29.325 11.738 -22.020 1.00 28.52 ? 518  TYR A OH  1 
ATOM   4161 N  N   . LYS A 1 503 ? -26.994 16.078 -27.215 1.00 26.23 ? 519  LYS A N   1 
ATOM   4162 C  CA  . LYS A 1 503 ? -27.906 15.804 -28.325 1.00 26.80 ? 519  LYS A CA  1 
ATOM   4163 C  C   . LYS A 1 503 ? -27.186 15.115 -29.486 1.00 27.30 ? 519  LYS A C   1 
ATOM   4164 O  O   . LYS A 1 503 ? -27.672 14.113 -30.018 1.00 27.53 ? 519  LYS A O   1 
ATOM   4165 C  CB  . LYS A 1 503 ? -28.580 17.097 -28.806 1.00 26.65 ? 519  LYS A CB  1 
ATOM   4166 C  CG  . LYS A 1 503 ? -29.553 16.909 -29.966 1.00 27.46 ? 519  LYS A CG  1 
ATOM   4167 C  CD  . LYS A 1 503 ? -30.069 18.239 -30.490 1.00 27.68 ? 519  LYS A CD  1 
ATOM   4168 C  CE  . LYS A 1 503 ? -30.689 18.066 -31.870 1.00 29.04 ? 519  LYS A CE  1 
ATOM   4169 N  NZ  . LYS A 1 503 ? -31.257 19.335 -32.401 1.00 29.52 ? 519  LYS A NZ  1 
ATOM   4170 N  N   . SER A 1 504 ? -26.028 15.652 -29.864 1.00 27.19 ? 520  SER A N   1 
ATOM   4171 C  CA  . SER A 1 504 ? -25.252 15.105 -30.977 1.00 27.81 ? 520  SER A CA  1 
ATOM   4172 C  C   . SER A 1 504 ? -24.669 13.732 -30.662 1.00 28.15 ? 520  SER A C   1 
ATOM   4173 O  O   . SER A 1 504 ? -24.711 12.836 -31.506 1.00 28.74 ? 520  SER A O   1 
ATOM   4174 C  CB  . SER A 1 504 ? -24.152 16.076 -31.404 1.00 27.46 ? 520  SER A CB  1 
ATOM   4175 O  OG  . SER A 1 504 ? -24.717 17.230 -32.001 1.00 27.76 ? 520  SER A OG  1 
ATOM   4176 N  N   . ALA A 1 505 ? -24.138 13.571 -29.449 1.00 28.07 ? 521  ALA A N   1 
ATOM   4177 C  CA  . ALA A 1 505 ? -23.613 12.282 -28.991 1.00 28.60 ? 521  ALA A CA  1 
ATOM   4178 C  C   . ALA A 1 505 ? -24.713 11.223 -28.960 1.00 29.21 ? 521  ALA A C   1 
ATOM   4179 O  O   . ALA A 1 505 ? -24.492 10.080 -29.368 1.00 29.62 ? 521  ALA A O   1 
ATOM   4180 C  CB  . ALA A 1 505 ? -22.962 12.418 -27.620 1.00 28.22 ? 521  ALA A CB  1 
ATOM   4181 N  N   . CYS A 1 506 ? -25.896 11.618 -28.488 1.00 29.34 ? 522  CYS A N   1 
ATOM   4182 C  CA  . CYS A 1 506 ? -27.059 10.732 -28.438 1.00 30.13 ? 522  CYS A CA  1 
ATOM   4183 C  C   . CYS A 1 506 ? -27.516 10.287 -29.827 1.00 30.94 ? 522  CYS A C   1 
ATOM   4184 O  O   . CYS A 1 506 ? -27.839 9.116  -30.029 1.00 31.55 ? 522  CYS A O   1 
ATOM   4185 C  CB  . CYS A 1 506 ? -28.209 11.397 -27.680 1.00 29.81 ? 522  CYS A CB  1 
ATOM   4186 S  SG  . CYS A 1 506 ? -27.890 11.559 -25.918 1.00 29.65 ? 522  CYS A SG  1 
ATOM   4187 N  N   . ILE A 1 507 ? -27.539 11.222 -30.775 1.00 31.20 ? 523  ILE A N   1 
ATOM   4188 C  CA  . ILE A 1 507 ? -27.863 10.909 -32.168 1.00 32.07 ? 523  ILE A CA  1 
ATOM   4189 C  C   . ILE A 1 507 ? -26.831 9.937  -32.759 1.00 32.70 ? 523  ILE A C   1 
ATOM   4190 O  O   . ILE A 1 507 ? -27.200 8.963  -33.420 1.00 33.22 ? 523  ILE A O   1 
ATOM   4191 C  CB  . ILE A 1 507 ? -28.002 12.192 -33.037 1.00 31.96 ? 523  ILE A CB  1 
ATOM   4192 C  CG1 . ILE A 1 507 ? -29.267 12.963 -32.640 1.00 31.85 ? 523  ILE A CG1 1 
ATOM   4193 C  CG2 . ILE A 1 507 ? -28.046 11.842 -34.530 1.00 32.69 ? 523  ILE A CG2 1 
ATOM   4194 C  CD1 . ILE A 1 507 ? -29.315 14.406 -33.130 1.00 31.66 ? 523  ILE A CD1 1 
ATOM   4195 N  N   . LYS A 1 508 ? -25.551 10.195 -32.491 1.00 32.66 ? 524  LYS A N   1 
ATOM   4196 C  CA  . LYS A 1 508 ? -24.457 9.333  -32.954 1.00 33.35 ? 524  LYS A CA  1 
ATOM   4197 C  C   . LYS A 1 508 ? -24.508 7.940  -32.324 1.00 33.87 ? 524  LYS A C   1 
ATOM   4198 O  O   . LYS A 1 508 ? -24.074 6.960  -32.935 1.00 34.38 ? 524  LYS A O   1 
ATOM   4199 C  CB  . LYS A 1 508 ? -23.099 9.978  -32.662 1.00 32.94 ? 524  LYS A CB  1 
ATOM   4200 C  CG  . LYS A 1 508 ? -22.795 11.217 -33.488 1.00 32.78 ? 524  LYS A CG  1 
ATOM   4201 C  CD  . LYS A 1 508 ? -21.637 11.993 -32.886 1.00 32.76 ? 524  LYS A CD  1 
ATOM   4202 C  CE  . LYS A 1 508 ? -21.478 13.360 -33.538 1.00 33.07 ? 524  LYS A CE  1 
ATOM   4203 N  NZ  . LYS A 1 508 ? -20.988 13.271 -34.944 1.00 33.64 ? 524  LYS A NZ  1 
ATOM   4204 N  N   . ALA A 1 509 ? -25.036 7.866  -31.104 1.00 33.73 ? 525  ALA A N   1 
ATOM   4205 C  CA  . ALA A 1 509 ? -25.164 6.606  -30.373 1.00 34.35 ? 525  ALA A CA  1 
ATOM   4206 C  C   . ALA A 1 509 ? -26.394 5.803  -30.799 1.00 35.06 ? 525  ALA A C   1 
ATOM   4207 O  O   . ALA A 1 509 ? -26.547 4.646  -30.408 1.00 35.42 ? 525  ALA A O   1 
ATOM   4208 C  CB  . ALA A 1 509 ? -25.201 6.871  -28.869 1.00 33.78 ? 525  ALA A CB  1 
ATOM   4209 N  N   . GLY A 1 510 ? -27.265 6.423  -31.594 1.00 35.34 ? 526  GLY A N   1 
ATOM   4210 C  CA  . GLY A 1 510 ? -28.546 5.823  -31.966 1.00 36.18 ? 526  GLY A CA  1 
ATOM   4211 C  C   . GLY A 1 510 ? -29.509 5.814  -30.791 1.00 36.16 ? 526  GLY A C   1 
ATOM   4212 O  O   . GLY A 1 510 ? -30.413 4.979  -30.722 1.00 36.48 ? 526  GLY A O   1 
ATOM   4213 N  N   . GLN A 1 511 ? -29.305 6.753  -29.868 1.00 35.70 ? 527  GLN A N   1 
ATOM   4214 C  CA  . GLN A 1 511 ? -30.073 6.831  -28.627 1.00 35.77 ? 527  GLN A CA  1 
ATOM   4215 C  C   . GLN A 1 511 ? -31.136 7.931  -28.654 1.00 35.72 ? 527  GLN A C   1 
ATOM   4216 O  O   . GLN A 1 511 ? -31.955 8.030  -27.736 1.00 35.52 ? 527  GLN A O   1 
ATOM   4217 C  CB  . GLN A 1 511 ? -29.131 7.043  -27.437 1.00 35.31 ? 527  GLN A CB  1 
ATOM   4218 C  CG  . GLN A 1 511 ? -28.395 5.791  -26.974 1.00 35.75 ? 527  GLN A CG  1 
ATOM   4219 C  CD  . GLN A 1 511 ? -29.280 4.850  -26.173 1.00 36.62 ? 527  GLN A CD  1 
ATOM   4220 O  OE1 . GLN A 1 511 ? -29.353 3.655  -26.460 1.00 37.12 ? 527  GLN A OE1 1 
ATOM   4221 N  NE2 . GLN A 1 511 ? -29.957 5.387  -25.164 1.00 35.75 ? 527  GLN A NE2 1 
ATOM   4222 N  N   . TYR A 1 512 ? -31.116 8.755  -29.700 1.00 36.02 ? 528  TYR A N   1 
ATOM   4223 C  CA  . TYR A 1 512 ? -32.097 9.826  -29.848 1.00 36.19 ? 528  TYR A CA  1 
ATOM   4224 C  C   . TYR A 1 512 ? -32.599 9.989  -31.277 1.00 37.07 ? 528  TYR A C   1 
ATOM   4225 O  O   . TYR A 1 512 ? -31.816 10.121 -32.219 1.00 37.12 ? 528  TYR A O   1 
ATOM   4226 C  CB  . TYR A 1 512 ? -31.550 11.161 -29.326 1.00 35.37 ? 528  TYR A CB  1 
ATOM   4227 C  CG  . TYR A 1 512 ? -32.481 12.338 -29.553 1.00 34.98 ? 528  TYR A CG  1 
ATOM   4228 C  CD1 . TYR A 1 512 ? -33.795 12.317 -29.079 1.00 34.69 ? 528  TYR A CD1 1 
ATOM   4229 C  CD2 . TYR A 1 512 ? -32.045 13.477 -30.232 1.00 34.56 ? 528  TYR A CD2 1 
ATOM   4230 C  CE1 . TYR A 1 512 ? -34.653 13.391 -29.284 1.00 34.33 ? 528  TYR A CE1 1 
ATOM   4231 C  CE2 . TYR A 1 512 ? -32.897 14.562 -30.438 1.00 34.14 ? 528  TYR A CE2 1 
ATOM   4232 C  CZ  . TYR A 1 512 ? -34.198 14.509 -29.960 1.00 33.93 ? 528  TYR A CZ  1 
ATOM   4233 O  OH  . TYR A 1 512 ? -35.051 15.569 -30.157 1.00 33.68 ? 528  TYR A OH  1 
ATOM   4234 N  N   . ASP A 1 513 ? -33.922 9.983  -31.404 1.00 37.96 ? 529  ASP A N   1 
ATOM   4235 C  CA  . ASP A 1 513 ? -34.620 10.250 -32.652 1.00 39.11 ? 529  ASP A CA  1 
ATOM   4236 C  C   . ASP A 1 513 ? -35.885 11.021 -32.281 1.00 39.31 ? 529  ASP A C   1 
ATOM   4237 O  O   . ASP A 1 513 ? -36.730 10.501 -31.547 1.00 39.42 ? 529  ASP A O   1 
ATOM   4238 C  CB  . ASP A 1 513 ? -34.967 8.932  -33.359 1.00 39.93 ? 529  ASP A CB  1 
ATOM   4239 C  CG  . ASP A 1 513 ? -35.520 9.133  -34.771 1.00 40.91 ? 529  ASP A CG  1 
ATOM   4240 O  OD1 . ASP A 1 513 ? -36.152 10.173 -35.054 1.00 40.96 ? 529  ASP A OD1 1 
ATOM   4241 O  OD2 . ASP A 1 513 ? -35.327 8.225  -35.607 1.00 42.30 ? 529  ASP A OD2 1 
ATOM   4242 N  N   . PRO A 1 514 ? -36.015 12.271 -32.773 1.00 39.61 ? 530  PRO A N   1 
ATOM   4243 C  CA  . PRO A 1 514 ? -37.150 13.137 -32.421 1.00 39.79 ? 530  PRO A CA  1 
ATOM   4244 C  C   . PRO A 1 514 ? -38.502 12.638 -32.940 1.00 40.72 ? 530  PRO A C   1 
ATOM   4245 O  O   . PRO A 1 514 ? -39.545 13.080 -32.456 1.00 40.63 ? 530  PRO A O   1 
ATOM   4246 C  CB  . PRO A 1 514 ? -36.789 14.476 -33.077 1.00 39.55 ? 530  PRO A CB  1 
ATOM   4247 C  CG  . PRO A 1 514 ? -35.853 14.121 -34.178 1.00 39.78 ? 530  PRO A CG  1 
ATOM   4248 C  CD  . PRO A 1 514 ? -35.062 12.957 -33.666 1.00 39.59 ? 530  PRO A CD  1 
ATOM   4249 N  N   . ASP A 1 515 ? -38.477 11.728 -33.912 1.00 41.78 ? 531  ASP A N   1 
ATOM   4250 C  CA  . ASP A 1 515 ? -39.700 11.157 -34.483 1.00 42.86 ? 531  ASP A CA  1 
ATOM   4251 C  C   . ASP A 1 515 ? -40.019 9.769  -33.920 1.00 43.22 ? 531  ASP A C   1 
ATOM   4252 O  O   . ASP A 1 515 ? -41.006 9.141  -34.311 1.00 44.04 ? 531  ASP A O   1 
ATOM   4253 C  CB  . ASP A 1 515 ? -39.604 11.113 -36.013 1.00 43.65 ? 531  ASP A CB  1 
ATOM   4254 C  CG  . ASP A 1 515 ? -39.481 12.497 -36.634 1.00 44.02 ? 531  ASP A CG  1 
ATOM   4255 O  OD1 . ASP A 1 515 ? -40.097 13.454 -36.113 1.00 44.37 ? 531  ASP A OD1 1 
ATOM   4256 O  OD2 . ASP A 1 515 ? -38.768 12.629 -37.651 1.00 45.04 ? 531  ASP A OD2 1 
ATOM   4257 N  N   . ASN A 1 516 ? -39.180 9.300  -33.000 1.00 42.91 ? 532  ASN A N   1 
ATOM   4258 C  CA  . ASN A 1 516 ? -39.370 8.006  -32.353 1.00 43.07 ? 532  ASN A CA  1 
ATOM   4259 C  C   . ASN A 1 516 ? -39.667 8.185  -30.867 1.00 42.38 ? 532  ASN A C   1 
ATOM   4260 O  O   . ASN A 1 516 ? -38.820 8.663  -30.106 1.00 41.73 ? 532  ASN A O   1 
ATOM   4261 C  CB  . ASN A 1 516 ? -38.134 7.120  -32.559 1.00 43.36 ? 532  ASN A CB  1 
ATOM   4262 C  CG  . ASN A 1 516 ? -38.359 5.670  -32.141 1.00 44.08 ? 532  ASN A CG  1 
ATOM   4263 O  OD1 . ASN A 1 516 ? -39.378 5.324  -31.541 1.00 44.79 ? 532  ASN A OD1 1 
ATOM   4264 N  ND2 . ASN A 1 516 ? -37.395 4.815  -32.462 1.00 44.45 ? 532  ASN A ND2 1 
ATOM   4265 N  N   . VAL A 1 517 ? -40.874 7.790  -30.466 1.00 42.37 ? 533  VAL A N   1 
ATOM   4266 C  CA  . VAL A 1 517 ? -41.335 7.910  -29.078 1.00 41.74 ? 533  VAL A CA  1 
ATOM   4267 C  C   . VAL A 1 517 ? -40.515 7.040  -28.109 1.00 41.34 ? 533  VAL A C   1 
ATOM   4268 O  O   . VAL A 1 517 ? -40.479 7.300  -26.904 1.00 40.93 ? 533  VAL A O   1 
ATOM   4269 C  CB  . VAL A 1 517 ? -42.869 7.617  -28.966 1.00 42.21 ? 533  VAL A CB  1 
ATOM   4270 C  CG1 . VAL A 1 517 ? -43.175 6.126  -29.147 1.00 43.05 ? 533  VAL A CG1 1 
ATOM   4271 C  CG2 . VAL A 1 517 ? -43.441 8.139  -27.652 1.00 41.86 ? 533  VAL A CG2 1 
ATOM   4272 N  N   . GLU A 1 518 ? -39.842 6.028  -28.651 1.00 41.48 ? 534  GLU A N   1 
ATOM   4273 C  CA  . GLU A 1 518 ? -39.048 5.097  -27.850 1.00 41.15 ? 534  GLU A CA  1 
ATOM   4274 C  C   . GLU A 1 518 ? -37.632 5.607  -27.581 1.00 40.03 ? 534  GLU A C   1 
ATOM   4275 O  O   . GLU A 1 518 ? -36.912 5.045  -26.751 1.00 39.89 ? 534  GLU A O   1 
ATOM   4276 C  CB  . GLU A 1 518 ? -38.991 3.717  -28.522 1.00 42.10 ? 534  GLU A CB  1 
ATOM   4277 C  CG  . GLU A 1 518 ? -40.354 3.081  -28.812 1.00 43.93 ? 534  GLU A CG  1 
ATOM   4278 C  CD  . GLU A 1 518 ? -41.217 2.902  -27.569 1.00 45.64 ? 534  GLU A CD  1 
ATOM   4279 O  OE1 . GLU A 1 518 ? -40.681 2.527  -26.502 1.00 46.16 ? 534  GLU A OE1 1 
ATOM   4280 O  OE2 . GLU A 1 518 ? -42.443 3.130  -27.666 1.00 47.08 ? 534  GLU A OE2 1 
ATOM   4281 N  N   . LEU A 1 519 ? -37.239 6.670  -28.278 1.00 39.00 ? 535  LEU A N   1 
ATOM   4282 C  CA  . LEU A 1 519 ? -35.902 7.241  -28.120 1.00 37.80 ? 535  LEU A CA  1 
ATOM   4283 C  C   . LEU A 1 519 ? -35.944 8.737  -27.774 1.00 36.63 ? 535  LEU A C   1 
ATOM   4284 O  O   . LEU A 1 519 ? -35.517 9.572  -28.577 1.00 36.43 ? 535  LEU A O   1 
ATOM   4285 C  CB  . LEU A 1 519 ? -35.052 6.988  -29.377 1.00 38.18 ? 535  LEU A CB  1 
ATOM   4286 C  CG  . LEU A 1 519 ? -34.792 5.541  -29.822 1.00 38.75 ? 535  LEU A CG  1 
ATOM   4287 C  CD1 . LEU A 1 519 ? -34.204 5.502  -31.230 1.00 38.91 ? 535  LEU A CD1 1 
ATOM   4288 C  CD2 . LEU A 1 519 ? -33.888 4.799  -28.841 1.00 38.59 ? 535  LEU A CD2 1 
ATOM   4289 N  N   . PRO A 1 520 ? -36.460 9.082  -26.575 1.00 35.66 ? 536  PRO A N   1 
ATOM   4290 C  CA  . PRO A 1 520 ? -36.481 10.491 -26.187 1.00 34.63 ? 536  PRO A CA  1 
ATOM   4291 C  C   . PRO A 1 520 ? -35.109 10.957 -25.705 1.00 33.63 ? 536  PRO A C   1 
ATOM   4292 O  O   . PRO A 1 520 ? -34.328 10.155 -25.187 1.00 33.56 ? 536  PRO A O   1 
ATOM   4293 C  CB  . PRO A 1 520 ? -37.491 10.523 -25.038 1.00 34.46 ? 536  PRO A CB  1 
ATOM   4294 C  CG  . PRO A 1 520 ? -37.407 9.171  -24.423 1.00 34.99 ? 536  PRO A CG  1 
ATOM   4295 C  CD  . PRO A 1 520 ? -36.989 8.209  -25.507 1.00 35.71 ? 536  PRO A CD  1 
ATOM   4296 N  N   . LEU A 1 521 ? -34.826 12.246 -25.870 1.00 32.81 ? 537  LEU A N   1 
ATOM   4297 C  CA  . LEU A 1 521 ? -33.527 12.801 -25.491 1.00 31.91 ? 537  LEU A CA  1 
ATOM   4298 C  C   . LEU A 1 521 ? -33.252 12.658 -23.993 1.00 31.47 ? 537  LEU A C   1 
ATOM   4299 O  O   . LEU A 1 521 ? -32.117 12.395 -23.585 1.00 31.14 ? 537  LEU A O   1 
ATOM   4300 C  CB  . LEU A 1 521 ? -33.425 14.267 -25.928 1.00 31.67 ? 537  LEU A CB  1 
ATOM   4301 C  CG  . LEU A 1 521 ? -32.070 14.979 -25.827 1.00 30.97 ? 537  LEU A CG  1 
ATOM   4302 C  CD1 . LEU A 1 521 ? -30.965 14.216 -26.550 1.00 30.93 ? 537  LEU A CD1 1 
ATOM   4303 C  CD2 . LEU A 1 521 ? -32.187 16.395 -26.366 1.00 30.75 ? 537  LEU A CD2 1 
ATOM   4304 N  N   . ASP A 1 522 ? -34.304 12.799 -23.188 1.00 31.03 ? 538  ASP A N   1 
ATOM   4305 C  CA  . ASP A 1 522 ? -34.184 12.785 -21.728 1.00 30.64 ? 538  ASP A CA  1 
ATOM   4306 C  C   . ASP A 1 522 ? -33.998 11.395 -21.102 1.00 30.90 ? 538  ASP A C   1 
ATOM   4307 O  O   . ASP A 1 522 ? -33.915 11.265 -19.876 1.00 30.72 ? 538  ASP A O   1 
ATOM   4308 C  CB  . ASP A 1 522 ? -35.358 13.536 -21.076 1.00 30.30 ? 538  ASP A CB  1 
ATOM   4309 C  CG  . ASP A 1 522 ? -36.717 13.104 -21.618 1.00 30.56 ? 538  ASP A CG  1 
ATOM   4310 O  OD1 . ASP A 1 522 ? -37.005 13.363 -22.807 1.00 30.48 ? 538  ASP A OD1 1 
ATOM   4311 O  OD2 . ASP A 1 522 ? -37.506 12.527 -20.843 1.00 29.70 ? 538  ASP A OD2 1 
ATOM   4312 N  N   . ASN A 1 523 ? -33.933 10.359 -21.937 1.00 31.27 ? 539  ASN A N   1 
ATOM   4313 C  CA  . ASN A 1 523 ? -33.581 9.019  -21.462 1.00 31.45 ? 539  ASN A CA  1 
ATOM   4314 C  C   . ASN A 1 523 ? -32.434 8.389  -22.265 1.00 31.63 ? 539  ASN A C   1 
ATOM   4315 O  O   . ASN A 1 523 ? -32.308 7.165  -22.337 1.00 32.05 ? 539  ASN A O   1 
ATOM   4316 C  CB  . ASN A 1 523 ? -34.811 8.103  -21.432 1.00 31.95 ? 539  ASN A CB  1 
ATOM   4317 C  CG  . ASN A 1 523 ? -34.699 7.006  -20.380 1.00 32.23 ? 539  ASN A CG  1 
ATOM   4318 O  OD1 . ASN A 1 523 ? -34.092 7.198  -19.324 1.00 31.91 ? 539  ASN A OD1 1 
ATOM   4319 N  ND2 . ASN A 1 523 ? -35.291 5.850  -20.665 1.00 32.24 ? 539  ASN A ND2 1 
ATOM   4320 N  N   . CYS A 1 524 ? -31.595 9.237  -22.854 1.00 31.13 ? 540  CYS A N   1 
ATOM   4321 C  CA  . CYS A 1 524 ? -30.448 8.777  -23.633 1.00 31.18 ? 540  CYS A CA  1 
ATOM   4322 C  C   . CYS A 1 524 ? -29.266 8.378  -22.748 1.00 30.85 ? 540  CYS A C   1 
ATOM   4323 O  O   . CYS A 1 524 ? -28.852 9.133  -21.866 1.00 30.30 ? 540  CYS A O   1 
ATOM   4324 C  CB  . CYS A 1 524 ? -30.021 9.851  -24.639 1.00 30.94 ? 540  CYS A CB  1 
ATOM   4325 S  SG  . CYS A 1 524 ? -28.307 9.709  -25.201 1.00 31.68 ? 540  CYS A SG  1 
ATOM   4326 N  N   . ASP A 1 525 ? -28.728 7.186  -22.997 1.00 30.96 ? 541  ASP A N   1 
ATOM   4327 C  CA  . ASP A 1 525 ? -27.520 6.725  -22.322 1.00 30.72 ? 541  ASP A CA  1 
ATOM   4328 C  C   . ASP A 1 525 ? -26.427 6.453  -23.351 1.00 30.90 ? 541  ASP A C   1 
ATOM   4329 O  O   . ASP A 1 525 ? -26.543 5.529  -24.162 1.00 31.16 ? 541  ASP A O   1 
ATOM   4330 C  CB  . ASP A 1 525 ? -27.809 5.469  -21.491 1.00 31.05 ? 541  ASP A CB  1 
ATOM   4331 C  CG  . ASP A 1 525 ? -26.620 5.031  -20.641 1.00 31.05 ? 541  ASP A CG  1 
ATOM   4332 O  OD1 . ASP A 1 525 ? -25.639 5.799  -20.508 1.00 29.98 ? 541  ASP A OD1 1 
ATOM   4333 O  OD2 . ASP A 1 525 ? -26.671 3.906  -20.100 1.00 31.25 ? 541  ASP A OD2 1 
ATOM   4334 N  N   . ILE A 1 526 ? -25.368 7.260  -23.312 1.00 30.38 ? 542  ILE A N   1 
ATOM   4335 C  CA  . ILE A 1 526 ? -24.252 7.105  -24.252 1.00 30.60 ? 542  ILE A CA  1 
ATOM   4336 C  C   . ILE A 1 526 ? -23.172 6.123  -23.772 1.00 30.83 ? 542  ILE A C   1 
ATOM   4337 O  O   . ILE A 1 526 ? -22.125 5.993  -24.410 1.00 30.74 ? 542  ILE A O   1 
ATOM   4338 C  CB  . ILE A 1 526 ? -23.615 8.474  -24.665 1.00 30.13 ? 542  ILE A CB  1 
ATOM   4339 C  CG1 . ILE A 1 526 ? -23.123 9.253  -23.437 1.00 29.51 ? 542  ILE A CG1 1 
ATOM   4340 C  CG2 . ILE A 1 526 ? -24.597 9.289  -25.516 1.00 29.86 ? 542  ILE A CG2 1 
ATOM   4341 C  CD1 . ILE A 1 526 ? -22.228 10.438 -23.765 1.00 28.70 ? 542  ILE A CD1 1 
ATOM   4342 N  N   . TYR A 1 527 ? -23.427 5.435  -22.659 1.00 30.95 ? 543  TYR A N   1 
ATOM   4343 C  CA  . TYR A 1 527 ? -22.504 4.408  -22.174 1.00 31.42 ? 543  TYR A CA  1 
ATOM   4344 C  C   . TYR A 1 527 ? -22.270 3.373  -23.266 1.00 32.11 ? 543  TYR A C   1 
ATOM   4345 O  O   . TYR A 1 527 ? -23.214 2.936  -23.925 1.00 32.51 ? 543  TYR A O   1 
ATOM   4346 C  CB  . TYR A 1 527 ? -23.026 3.725  -20.901 1.00 31.51 ? 543  TYR A CB  1 
ATOM   4347 C  CG  . TYR A 1 527 ? -22.073 2.683  -20.339 1.00 32.14 ? 543  TYR A CG  1 
ATOM   4348 C  CD1 . TYR A 1 527 ? -21.079 3.040  -19.430 1.00 32.42 ? 543  TYR A CD1 1 
ATOM   4349 C  CD2 . TYR A 1 527 ? -22.159 1.342  -20.727 1.00 33.27 ? 543  TYR A CD2 1 
ATOM   4350 C  CE1 . TYR A 1 527 ? -20.194 2.093  -18.918 1.00 32.72 ? 543  TYR A CE1 1 
ATOM   4351 C  CE2 . TYR A 1 527 ? -21.276 0.385  -20.222 1.00 33.62 ? 543  TYR A CE2 1 
ATOM   4352 C  CZ  . TYR A 1 527 ? -20.298 0.770  -19.317 1.00 33.70 ? 543  TYR A CZ  1 
ATOM   4353 O  OH  . TYR A 1 527 ? -19.423 -0.161 -18.808 1.00 34.12 ? 543  TYR A OH  1 
ATOM   4354 N  N   . GLY A 1 528 ? -21.007 3.011  -23.467 1.00 32.35 ? 544  GLY A N   1 
ATOM   4355 C  CA  . GLY A 1 528 ? -20.644 1.966  -24.420 1.00 33.03 ? 544  GLY A CA  1 
ATOM   4356 C  C   . GLY A 1 528 ? -20.588 2.393  -25.878 1.00 33.12 ? 544  GLY A C   1 
ATOM   4357 O  O   . GLY A 1 528 ? -20.244 1.589  -26.745 1.00 33.63 ? 544  GLY A O   1 
ATOM   4358 N  N   . SER A 1 529 ? -20.919 3.654  -26.152 1.00 32.53 ? 545  SER A N   1 
ATOM   4359 C  CA  . SER A 1 529 ? -20.958 4.155  -27.527 1.00 32.59 ? 545  SER A CA  1 
ATOM   4360 C  C   . SER A 1 529 ? -19.584 4.618  -28.014 1.00 32.40 ? 545  SER A C   1 
ATOM   4361 O  O   . SER A 1 529 ? -19.061 5.638  -27.556 1.00 31.79 ? 545  SER A O   1 
ATOM   4362 C  CB  . SER A 1 529 ? -21.990 5.278  -27.666 1.00 32.19 ? 545  SER A CB  1 
ATOM   4363 O  OG  . SER A 1 529 ? -21.942 5.866  -28.955 1.00 32.42 ? 545  SER A OG  1 
ATOM   4364 N  N   . ALA A 1 530 ? -19.012 3.858  -28.946 1.00 32.87 ? 546  ALA A N   1 
ATOM   4365 C  CA  . ALA A 1 530 ? -17.735 4.212  -29.569 1.00 32.79 ? 546  ALA A CA  1 
ATOM   4366 C  C   . ALA A 1 530 ? -17.882 5.400  -30.519 1.00 32.44 ? 546  ALA A C   1 
ATOM   4367 O  O   . ALA A 1 530 ? -16.946 6.185  -30.687 1.00 32.05 ? 546  ALA A O   1 
ATOM   4368 C  CB  . ALA A 1 530 ? -17.145 3.011  -30.303 1.00 33.56 ? 546  ALA A CB  1 
ATOM   4369 N  N   . ALA A 1 531 ? -19.059 5.519  -31.135 1.00 32.54 ? 547  ALA A N   1 
ATOM   4370 C  CA  . ALA A 1 531 ? -19.368 6.623  -32.048 1.00 32.38 ? 547  ALA A CA  1 
ATOM   4371 C  C   . ALA A 1 531 ? -19.402 7.974  -31.329 1.00 31.67 ? 547  ALA A C   1 
ATOM   4372 O  O   . ALA A 1 531 ? -18.876 8.966  -31.838 1.00 31.54 ? 547  ALA A O   1 
ATOM   4373 C  CB  . ALA A 1 531 ? -20.683 6.365  -32.770 1.00 32.72 ? 547  ALA A CB  1 
ATOM   4374 N  N   . ALA A 1 532 ? -20.017 8.006  -30.147 1.00 31.23 ? 548  ALA A N   1 
ATOM   4375 C  CA  . ALA A 1 532 ? -20.033 9.214  -29.318 1.00 30.55 ? 548  ALA A CA  1 
ATOM   4376 C  C   . ALA A 1 532 ? -18.623 9.557  -28.842 1.00 30.18 ? 548  ALA A C   1 
ATOM   4377 O  O   . ALA A 1 532 ? -18.236 10.727 -28.822 1.00 29.81 ? 548  ALA A O   1 
ATOM   4378 C  CB  . ALA A 1 532 ? -20.975 9.044  -28.133 1.00 30.19 ? 548  ALA A CB  1 
ATOM   4379 N  N   . GLY A 1 533 ? -17.863 8.526  -28.475 1.00 30.37 ? 549  GLY A N   1 
ATOM   4380 C  CA  . GLY A 1 533 ? -16.483 8.689  -28.020 1.00 30.14 ? 549  GLY A CA  1 
ATOM   4381 C  C   . GLY A 1 533 ? -15.557 9.245  -29.087 1.00 30.10 ? 549  GLY A C   1 
ATOM   4382 O  O   . GLY A 1 533 ? -14.651 10.024 -28.781 1.00 29.71 ? 549  GLY A O   1 
ATOM   4383 N  N   . ALA A 1 534 ? -15.791 8.843  -30.337 1.00 30.40 ? 550  ALA A N   1 
ATOM   4384 C  CA  . ALA A 1 534 ? -15.012 9.331  -31.476 1.00 30.55 ? 550  ALA A CA  1 
ATOM   4385 C  C   . ALA A 1 534 ? -15.177 10.838 -31.654 1.00 30.03 ? 550  ALA A C   1 
ATOM   4386 O  O   . ALA A 1 534 ? -14.202 11.545 -31.914 1.00 29.83 ? 550  ALA A O   1 
ATOM   4387 C  CB  . ALA A 1 534 ? -15.404 8.591  -32.753 1.00 31.22 ? 550  ALA A CB  1 
ATOM   4388 N  N   . ALA A 1 535 ? -16.412 11.319 -31.505 1.00 29.66 ? 551  ALA A N   1 
ATOM   4389 C  CA  . ALA A 1 535 ? -16.707 12.748 -31.568 1.00 29.19 ? 551  ALA A CA  1 
ATOM   4390 C  C   . ALA A 1 535 ? -15.955 13.505 -30.472 1.00 28.68 ? 551  ALA A C   1 
ATOM   4391 O  O   . ALA A 1 535 ? -15.350 14.544 -30.739 1.00 28.41 ? 551  ALA A O   1 
ATOM   4392 C  CB  . ALA A 1 535 ? -18.208 12.992 -31.466 1.00 29.00 ? 551  ALA A CB  1 
ATOM   4393 N  N   . PHE A 1 536 ? -15.983 12.970 -29.250 1.00 28.51 ? 552  PHE A N   1 
ATOM   4394 C  CA  . PHE A 1 536 ? -15.210 13.532 -28.141 1.00 28.29 ? 552  PHE A CA  1 
ATOM   4395 C  C   . PHE A 1 536 ? -13.708 13.539 -28.425 1.00 28.31 ? 552  PHE A C   1 
ATOM   4396 O  O   . PHE A 1 536 ? -13.046 14.551 -28.210 1.00 27.95 ? 552  PHE A O   1 
ATOM   4397 C  CB  . PHE A 1 536 ? -15.500 12.799 -26.827 1.00 28.41 ? 552  PHE A CB  1 
ATOM   4398 C  CG  . PHE A 1 536 ? -16.714 13.310 -26.106 1.00 28.69 ? 552  PHE A CG  1 
ATOM   4399 C  CD1 . PHE A 1 536 ? -16.674 14.524 -25.424 1.00 28.87 ? 552  PHE A CD1 1 
ATOM   4400 C  CD2 . PHE A 1 536 ? -17.897 12.580 -26.108 1.00 29.40 ? 552  PHE A CD2 1 
ATOM   4401 C  CE1 . PHE A 1 536 ? -17.801 15.008 -24.754 1.00 29.05 ? 552  PHE A CE1 1 
ATOM   4402 C  CE2 . PHE A 1 536 ? -19.028 13.052 -25.441 1.00 29.43 ? 552  PHE A CE2 1 
ATOM   4403 C  CZ  . PHE A 1 536 ? -18.977 14.268 -24.761 1.00 29.06 ? 552  PHE A CZ  1 
ATOM   4404 N  N   . HIS A 1 537 ? -13.177 12.421 -28.918 1.00 28.68 ? 553  HIS A N   1 
ATOM   4405 C  CA  . HIS A 1 537 ? -11.755 12.349 -29.253 1.00 28.88 ? 553  HIS A CA  1 
ATOM   4406 C  C   . HIS A 1 537 ? -11.369 13.409 -30.289 1.00 28.68 ? 553  HIS A C   1 
ATOM   4407 O  O   . HIS A 1 537 ? -10.384 14.126 -30.108 1.00 28.55 ? 553  HIS A O   1 
ATOM   4408 C  CB  . HIS A 1 537 ? -11.357 10.951 -29.738 1.00 29.52 ? 553  HIS A CB  1 
ATOM   4409 C  CG  . HIS A 1 537 ? -9.995  10.900 -30.359 1.00 30.08 ? 553  HIS A CG  1 
ATOM   4410 N  ND1 . HIS A 1 537 ? -9.800  10.685 -31.707 1.00 31.29 ? 553  HIS A ND1 1 
ATOM   4411 C  CD2 . HIS A 1 537 ? -8.763  11.065 -29.822 1.00 30.12 ? 553  HIS A CD2 1 
ATOM   4412 C  CE1 . HIS A 1 537 ? -8.505  10.703 -31.971 1.00 31.41 ? 553  HIS A CE1 1 
ATOM   4413 N  NE2 . HIS A 1 537 ? -7.854  10.934 -30.844 1.00 31.49 ? 553  HIS A NE2 1 
ATOM   4414 N  N   . ASN A 1 538 ? -12.159 13.510 -31.357 1.00 28.75 ? 554  ASN A N   1 
ATOM   4415 C  CA  . ASN A 1 538 ? -11.920 14.482 -32.425 1.00 28.80 ? 554  ASN A CA  1 
ATOM   4416 C  C   . ASN A 1 538 ? -11.854 15.925 -31.928 1.00 28.01 ? 554  ASN A C   1 
ATOM   4417 O  O   . ASN A 1 538 ? -11.057 16.720 -32.425 1.00 27.89 ? 554  ASN A O   1 
ATOM   4418 C  CB  . ASN A 1 538 ? -12.990 14.359 -33.517 1.00 29.25 ? 554  ASN A CB  1 
ATOM   4419 C  CG  . ASN A 1 538 ? -12.858 13.080 -34.330 1.00 30.80 ? 554  ASN A CG  1 
ATOM   4420 O  OD1 . ASN A 1 538 ? -11.795 12.460 -34.377 1.00 32.30 ? 554  ASN A OD1 1 
ATOM   4421 N  ND2 . ASN A 1 538 ? -13.945 12.685 -34.980 1.00 31.95 ? 554  ASN A ND2 1 
ATOM   4422 N  N   . MET A 1 539 ? -12.687 16.248 -30.941 1.00 27.31 ? 555  MET A N   1 
ATOM   4423 C  CA  . MET A 1 539 ? -12.765 17.599 -30.393 1.00 26.60 ? 555  MET A CA  1 
ATOM   4424 C  C   . MET A 1 539 ? -11.725 17.854 -29.302 1.00 26.14 ? 555  MET A C   1 
ATOM   4425 O  O   . MET A 1 539 ? -10.982 18.838 -29.363 1.00 25.90 ? 555  MET A O   1 
ATOM   4426 C  CB  . MET A 1 539 ? -14.177 17.879 -29.863 1.00 26.31 ? 555  MET A CB  1 
ATOM   4427 C  CG  . MET A 1 539 ? -14.338 19.237 -29.189 1.00 26.32 ? 555  MET A CG  1 
ATOM   4428 S  SD  . MET A 1 539 ? -16.029 19.566 -28.667 1.00 26.71 ? 555  MET A SD  1 
ATOM   4429 C  CE  . MET A 1 539 ? -16.162 18.500 -27.228 1.00 26.81 ? 555  MET A CE  1 
ATOM   4430 N  N   . LEU A 1 540 ? -11.680 16.970 -28.306 1.00 25.83 ? 556  LEU A N   1 
ATOM   4431 C  CA  . LEU A 1 540 ? -10.814 17.162 -27.143 1.00 25.52 ? 556  LEU A CA  1 
ATOM   4432 C  C   . LEU A 1 540 ? -9.320  17.138 -27.481 1.00 25.64 ? 556  LEU A C   1 
ATOM   4433 O  O   . LEU A 1 540 ? -8.535  17.872 -26.878 1.00 25.28 ? 556  LEU A O   1 
ATOM   4434 C  CB  . LEU A 1 540 ? -11.128 16.137 -26.046 1.00 25.46 ? 556  LEU A CB  1 
ATOM   4435 C  CG  . LEU A 1 540 ? -12.559 16.034 -25.497 1.00 25.41 ? 556  LEU A CG  1 
ATOM   4436 C  CD1 . LEU A 1 540 ? -12.606 15.078 -24.313 1.00 25.46 ? 556  LEU A CD1 1 
ATOM   4437 C  CD2 . LEU A 1 540 ? -13.119 17.395 -25.110 1.00 24.60 ? 556  LEU A CD2 1 
ATOM   4438 N  N   . SER A 1 541 ? -8.937  16.305 -28.447 1.00 25.93 ? 557  SER A N   1 
ATOM   4439 C  CA  . SER A 1 541 ? -7.530  16.171 -28.839 1.00 26.32 ? 557  SER A CA  1 
ATOM   4440 C  C   . SER A 1 541 ? -6.967  17.453 -29.452 1.00 26.05 ? 557  SER A C   1 
ATOM   4441 O  O   . SER A 1 541 ? -5.748  17.637 -29.506 1.00 26.34 ? 557  SER A O   1 
ATOM   4442 C  CB  . SER A 1 541 ? -7.337  14.992 -29.798 1.00 26.89 ? 557  SER A CB  1 
ATOM   4443 O  OG  . SER A 1 541 ? -8.047  15.196 -31.006 1.00 27.21 ? 557  SER A OG  1 
ATOM   4444 N  N   . MET A 1 542 ? -7.862  18.332 -29.900 1.00 25.73 ? 558  MET A N   1 
ATOM   4445 C  CA  . MET A 1 542 ? -7.484  19.623 -30.476 1.00 25.44 ? 558  MET A CA  1 
ATOM   4446 C  C   . MET A 1 542 ? -6.966  20.605 -29.431 1.00 24.75 ? 558  MET A C   1 
ATOM   4447 O  O   . MET A 1 542 ? -6.171  21.488 -29.748 1.00 24.60 ? 558  MET A O   1 
ATOM   4448 C  CB  . MET A 1 542 ? -8.669  20.251 -31.213 1.00 25.34 ? 558  MET A CB  1 
ATOM   4449 C  CG  . MET A 1 542 ? -9.089  19.515 -32.477 1.00 26.46 ? 558  MET A CG  1 
ATOM   4450 S  SD  . MET A 1 542 ? -10.602 20.178 -33.202 1.00 27.83 ? 558  MET A SD  1 
ATOM   4451 C  CE  . MET A 1 542 ? -10.043 21.778 -33.791 1.00 27.01 ? 558  MET A CE  1 
ATOM   4452 N  N   . GLY A 1 543 ? -7.423  20.458 -28.190 1.00 24.31 ? 559  GLY A N   1 
ATOM   4453 C  CA  . GLY A 1 543 ? -7.117  21.431 -27.146 1.00 23.68 ? 559  GLY A CA  1 
ATOM   4454 C  C   . GLY A 1 543 ? -7.512  22.827 -27.593 1.00 23.42 ? 559  GLY A C   1 
ATOM   4455 O  O   . GLY A 1 543 ? -8.619  23.033 -28.099 1.00 23.21 ? 559  GLY A O   1 
ATOM   4456 N  N   . ALA A 1 544 ? -6.594  23.777 -27.431 1.00 23.25 ? 560  ALA A N   1 
ATOM   4457 C  CA  . ALA A 1 544 ? -6.814  25.155 -27.870 1.00 23.11 ? 560  ALA A CA  1 
ATOM   4458 C  C   . ALA A 1 544 ? -6.046  25.498 -29.152 1.00 23.45 ? 560  ALA A C   1 
ATOM   4459 O  O   . ALA A 1 544 ? -5.742  26.669 -29.405 1.00 23.48 ? 560  ALA A O   1 
ATOM   4460 C  CB  . ALA A 1 544 ? -6.454  26.127 -26.753 1.00 22.67 ? 560  ALA A CB  1 
ATOM   4461 N  N   . SER A 1 545 ? -5.756  24.479 -29.964 1.00 23.82 ? 561  SER A N   1 
ATOM   4462 C  CA  . SER A 1 545 ? -5.026  24.656 -31.228 1.00 24.16 ? 561  SER A CA  1 
ATOM   4463 C  C   . SER A 1 545 ? -5.789  25.487 -32.261 1.00 24.27 ? 561  SER A C   1 
ATOM   4464 O  O   . SER A 1 545 ? -5.183  26.090 -33.148 1.00 24.33 ? 561  SER A O   1 
ATOM   4465 C  CB  . SER A 1 545 ? -4.634  23.304 -31.831 1.00 24.42 ? 561  SER A CB  1 
ATOM   4466 O  OG  . SER A 1 545 ? -5.778  22.524 -32.129 1.00 24.47 ? 561  SER A OG  1 
ATOM   4467 N  N   . LYS A 1 546 ? -7.115  25.501 -32.143 1.00 24.21 ? 562  LYS A N   1 
ATOM   4468 C  CA  . LYS A 1 546 ? -7.983  26.246 -33.052 1.00 24.41 ? 562  LYS A CA  1 
ATOM   4469 C  C   . LYS A 1 546 ? -9.054  26.996 -32.256 1.00 23.92 ? 562  LYS A C   1 
ATOM   4470 O  O   . LYS A 1 546 ? -9.394  26.578 -31.142 1.00 23.59 ? 562  LYS A O   1 
ATOM   4471 C  CB  . LYS A 1 546 ? -8.647  25.297 -34.061 1.00 24.94 ? 562  LYS A CB  1 
ATOM   4472 C  CG  . LYS A 1 546 ? -7.682  24.554 -34.999 1.00 26.56 ? 562  LYS A CG  1 
ATOM   4473 C  CD  . LYS A 1 546 ? -6.953  25.505 -35.947 1.00 29.34 ? 562  LYS A CD  1 
ATOM   4474 C  CE  . LYS A 1 546 ? -7.668  25.642 -37.282 1.00 31.43 ? 562  LYS A CE  1 
ATOM   4475 N  NZ  . LYS A 1 546 ? -7.260  24.560 -38.231 1.00 33.53 ? 562  LYS A NZ  1 
ATOM   4476 N  N   . PRO A 1 547 ? -9.589  28.107 -32.816 1.00 23.74 ? 563  PRO A N   1 
ATOM   4477 C  CA  . PRO A 1 547 ? -10.717 28.787 -32.162 1.00 23.37 ? 563  PRO A CA  1 
ATOM   4478 C  C   . PRO A 1 547 ? -11.871 27.813 -31.919 1.00 23.23 ? 563  PRO A C   1 
ATOM   4479 O  O   . PRO A 1 547 ? -12.072 26.884 -32.710 1.00 23.32 ? 563  PRO A O   1 
ATOM   4480 C  CB  . PRO A 1 547 ? -11.126 29.854 -33.181 1.00 23.50 ? 563  PRO A CB  1 
ATOM   4481 C  CG  . PRO A 1 547 ? -9.882  30.132 -33.954 1.00 23.90 ? 563  PRO A CG  1 
ATOM   4482 C  CD  . PRO A 1 547 ? -9.150  28.817 -34.033 1.00 23.94 ? 563  PRO A CD  1 
ATOM   4483 N  N   . TRP A 1 548 ? -12.622 28.029 -30.840 1.00 22.85 ? 564  TRP A N   1 
ATOM   4484 C  CA  . TRP A 1 548 ? -13.625 27.058 -30.381 1.00 22.82 ? 564  TRP A CA  1 
ATOM   4485 C  C   . TRP A 1 548 ? -14.699 26.625 -31.404 1.00 23.25 ? 564  TRP A C   1 
ATOM   4486 O  O   . TRP A 1 548 ? -15.163 25.487 -31.335 1.00 23.43 ? 564  TRP A O   1 
ATOM   4487 C  CB  . TRP A 1 548 ? -14.258 27.489 -29.045 1.00 22.26 ? 564  TRP A CB  1 
ATOM   4488 C  CG  . TRP A 1 548 ? -15.110 28.719 -29.121 1.00 21.69 ? 564  TRP A CG  1 
ATOM   4489 C  CD1 . TRP A 1 548 ? -14.732 29.997 -28.825 1.00 20.91 ? 564  TRP A CD1 1 
ATOM   4490 C  CD2 . TRP A 1 548 ? -16.490 28.789 -29.510 1.00 21.12 ? 564  TRP A CD2 1 
ATOM   4491 N  NE1 . TRP A 1 548 ? -15.785 30.858 -29.013 1.00 20.66 ? 564  TRP A NE1 1 
ATOM   4492 C  CE2 . TRP A 1 548 ? -16.876 30.145 -29.434 1.00 20.60 ? 564  TRP A CE2 1 
ATOM   4493 C  CE3 . TRP A 1 548 ? -17.434 27.838 -29.925 1.00 21.56 ? 564  TRP A CE3 1 
ATOM   4494 C  CZ2 . TRP A 1 548 ? -18.170 30.578 -29.753 1.00 20.66 ? 564  TRP A CZ2 1 
ATOM   4495 C  CZ3 . TRP A 1 548 ? -18.724 28.269 -30.244 1.00 21.52 ? 564  TRP A CZ3 1 
ATOM   4496 C  CH2 . TRP A 1 548 ? -19.077 29.628 -30.155 1.00 21.36 ? 564  TRP A CH2 1 
ATOM   4497 N  N   . PRO A 1 549 ? -15.101 27.511 -32.347 1.00 23.65 ? 565  PRO A N   1 
ATOM   4498 C  CA  . PRO A 1 549 ? -16.059 27.025 -33.349 1.00 24.16 ? 565  PRO A CA  1 
ATOM   4499 C  C   . PRO A 1 549 ? -15.516 25.877 -34.207 1.00 24.82 ? 565  PRO A C   1 
ATOM   4500 O  O   . PRO A 1 549 ? -16.296 25.047 -34.679 1.00 24.86 ? 565  PRO A O   1 
ATOM   4501 C  CB  . PRO A 1 549 ? -16.321 28.260 -34.216 1.00 24.25 ? 565  PRO A CB  1 
ATOM   4502 C  CG  . PRO A 1 549 ? -16.033 29.408 -33.325 1.00 23.66 ? 565  PRO A CG  1 
ATOM   4503 C  CD  . PRO A 1 549 ? -14.868 28.962 -32.495 1.00 23.61 ? 565  PRO A CD  1 
ATOM   4504 N  N   . ASP A 1 550 ? -14.196 25.839 -34.400 1.00 25.10 ? 566  ASP A N   1 
ATOM   4505 C  CA  . ASP A 1 550 ? -13.538 24.734 -35.103 1.00 25.98 ? 566  ASP A CA  1 
ATOM   4506 C  C   . ASP A 1 550 ? -13.567 23.452 -34.273 1.00 25.92 ? 566  ASP A C   1 
ATOM   4507 O  O   . ASP A 1 550 ? -13.645 22.350 -34.822 1.00 26.34 ? 566  ASP A O   1 
ATOM   4508 C  CB  . ASP A 1 550 ? -12.087 25.088 -35.451 1.00 26.18 ? 566  ASP A CB  1 
ATOM   4509 C  CG  . ASP A 1 550 ? -11.979 26.208 -36.480 1.00 27.64 ? 566  ASP A CG  1 
ATOM   4510 O  OD1 . ASP A 1 550 ? -12.825 26.276 -37.394 1.00 28.87 ? 566  ASP A OD1 1 
ATOM   4511 O  OD2 . ASP A 1 550 ? -11.036 27.020 -36.376 1.00 28.63 ? 566  ASP A OD2 1 
ATOM   4512 N  N   . ALA A 1 551 ? -13.493 23.603 -32.953 1.00 25.55 ? 567  ALA A N   1 
ATOM   4513 C  CA  . ALA A 1 551 ? -13.563 22.467 -32.039 1.00 25.72 ? 567  ALA A CA  1 
ATOM   4514 C  C   . ALA A 1 551 ? -14.973 21.881 -31.998 1.00 25.99 ? 567  ALA A C   1 
ATOM   4515 O  O   . ALA A 1 551 ? -15.142 20.658 -31.999 1.00 26.22 ? 567  ALA A O   1 
ATOM   4516 C  CB  . ALA A 1 551 ? -13.102 22.868 -30.652 1.00 25.26 ? 567  ALA A CB  1 
ATOM   4517 N  N   . LEU A 1 552 ? -15.978 22.758 -31.972 1.00 26.01 ? 568  LEU A N   1 
ATOM   4518 C  CA  . LEU A 1 552 ? -17.376 22.342 -32.064 1.00 26.44 ? 568  LEU A CA  1 
ATOM   4519 C  C   . LEU A 1 552 ? -17.650 21.655 -33.401 1.00 27.09 ? 568  LEU A C   1 
ATOM   4520 O  O   . LEU A 1 552 ? -18.354 20.647 -33.447 1.00 27.28 ? 568  LEU A O   1 
ATOM   4521 C  CB  . LEU A 1 552 ? -18.324 23.536 -31.863 1.00 26.21 ? 568  LEU A CB  1 
ATOM   4522 C  CG  . LEU A 1 552 ? -19.841 23.293 -31.941 1.00 26.54 ? 568  LEU A CG  1 
ATOM   4523 C  CD1 . LEU A 1 552 ? -20.320 22.279 -30.904 1.00 26.92 ? 568  LEU A CD1 1 
ATOM   4524 C  CD2 . LEU A 1 552 ? -20.610 24.602 -31.806 1.00 26.21 ? 568  LEU A CD2 1 
ATOM   4525 N  N   . GLU A 1 553 ? -17.079 22.195 -34.479 1.00 27.57 ? 569  GLU A N   1 
ATOM   4526 C  CA  . GLU A 1 553 ? -17.240 21.623 -35.819 1.00 28.42 ? 569  GLU A CA  1 
ATOM   4527 C  C   . GLU A 1 553 ? -16.685 20.203 -35.904 1.00 28.71 ? 569  GLU A C   1 
ATOM   4528 O  O   . GLU A 1 553 ? -17.265 19.346 -36.569 1.00 29.14 ? 569  GLU A O   1 
ATOM   4529 C  CB  . GLU A 1 553 ? -16.590 22.518 -36.881 1.00 28.67 ? 569  GLU A CB  1 
ATOM   4530 C  CG  . GLU A 1 553 ? -17.052 22.219 -38.308 1.00 30.38 ? 569  GLU A CG  1 
ATOM   4531 C  CD  . GLU A 1 553 ? -16.498 23.186 -39.344 1.00 32.33 ? 569  GLU A CD  1 
ATOM   4532 O  OE1 . GLU A 1 553 ? -15.653 24.038 -39.000 1.00 32.84 ? 569  GLU A OE1 1 
ATOM   4533 O  OE2 . GLU A 1 553 ? -16.916 23.094 -40.516 1.00 34.14 ? 569  GLU A OE2 1 
ATOM   4534 N  N   . ALA A 1 554 ? -15.571 19.964 -35.216 1.00 28.63 ? 570  ALA A N   1 
ATOM   4535 C  CA  . ALA A 1 554 ? -14.959 18.638 -35.150 1.00 29.03 ? 570  ALA A CA  1 
ATOM   4536 C  C   . ALA A 1 554 ? -15.861 17.629 -34.440 1.00 29.15 ? 570  ALA A C   1 
ATOM   4537 O  O   . ALA A 1 554 ? -15.828 16.437 -34.752 1.00 29.49 ? 570  ALA A O   1 
ATOM   4538 C  CB  . ALA A 1 554 ? -13.608 18.714 -34.467 1.00 28.81 ? 570  ALA A CB  1 
ATOM   4539 N  N   . PHE A 1 555 ? -16.665 18.112 -33.495 1.00 28.75 ? 571  PHE A N   1 
ATOM   4540 C  CA  . PHE A 1 555 ? -17.601 17.258 -32.767 1.00 28.95 ? 571  PHE A CA  1 
ATOM   4541 C  C   . PHE A 1 555 ? -18.830 16.890 -33.605 1.00 29.40 ? 571  PHE A C   1 
ATOM   4542 O  O   . PHE A 1 555 ? -19.141 15.707 -33.755 1.00 29.81 ? 571  PHE A O   1 
ATOM   4543 C  CB  . PHE A 1 555 ? -18.025 17.913 -31.444 1.00 28.39 ? 571  PHE A CB  1 
ATOM   4544 C  CG  . PHE A 1 555 ? -18.746 16.982 -30.501 1.00 28.43 ? 571  PHE A CG  1 
ATOM   4545 C  CD1 . PHE A 1 555 ? -20.129 16.833 -30.563 1.00 28.99 ? 571  PHE A CD1 1 
ATOM   4546 C  CD2 . PHE A 1 555 ? -18.040 16.260 -29.542 1.00 28.58 ? 571  PHE A CD2 1 
ATOM   4547 C  CE1 . PHE A 1 555 ? -20.798 15.970 -29.689 1.00 28.82 ? 571  PHE A CE1 1 
ATOM   4548 C  CE2 . PHE A 1 555 ? -18.700 15.399 -28.662 1.00 28.61 ? 571  PHE A CE2 1 
ATOM   4549 C  CZ  . PHE A 1 555 ? -20.080 15.254 -28.737 1.00 28.47 ? 571  PHE A CZ  1 
ATOM   4550 N  N   . ASN A 1 556 ? -19.521 17.894 -34.146 1.00 29.39 ? 572  ASN A N   1 
ATOM   4551 C  CA  . ASN A 1 556 ? -20.816 17.663 -34.797 1.00 29.91 ? 572  ASN A CA  1 
ATOM   4552 C  C   . ASN A 1 556 ? -21.093 18.457 -36.080 1.00 30.17 ? 572  ASN A C   1 
ATOM   4553 O  O   . ASN A 1 556 ? -22.213 18.435 -36.593 1.00 30.37 ? 572  ASN A O   1 
ATOM   4554 C  CB  . ASN A 1 556 ? -21.962 17.859 -33.789 1.00 29.51 ? 572  ASN A CB  1 
ATOM   4555 C  CG  . ASN A 1 556 ? -22.114 19.306 -33.325 1.00 29.26 ? 572  ASN A CG  1 
ATOM   4556 O  OD1 . ASN A 1 556 ? -21.418 20.211 -33.794 1.00 29.06 ? 572  ASN A OD1 1 
ATOM   4557 N  ND2 . ASN A 1 556 ? -23.036 19.526 -32.395 1.00 28.38 ? 572  ASN A ND2 1 
ATOM   4558 N  N   . GLY A 1 557 ? -20.082 19.161 -36.584 1.00 30.22 ? 573  GLY A N   1 
ATOM   4559 C  CA  . GLY A 1 557 ? -20.219 19.934 -37.820 1.00 30.55 ? 573  GLY A CA  1 
ATOM   4560 C  C   . GLY A 1 557 ? -20.829 21.317 -37.658 1.00 30.39 ? 573  GLY A C   1 
ATOM   4561 O  O   . GLY A 1 557 ? -21.027 22.028 -38.643 1.00 30.53 ? 573  GLY A O   1 
ATOM   4562 N  N   . GLU A 1 558 ? -21.129 21.702 -36.419 1.00 29.96 ? 574  GLU A N   1 
ATOM   4563 C  CA  . GLU A 1 558 ? -21.713 23.015 -36.141 1.00 29.85 ? 574  GLU A CA  1 
ATOM   4564 C  C   . GLU A 1 558 ? -20.646 24.001 -35.670 1.00 29.10 ? 574  GLU A C   1 
ATOM   4565 O  O   . GLU A 1 558 ? -19.587 23.598 -35.197 1.00 28.87 ? 574  GLU A O   1 
ATOM   4566 C  CB  . GLU A 1 558 ? -22.847 22.899 -35.117 1.00 29.87 ? 574  GLU A CB  1 
ATOM   4567 C  CG  . GLU A 1 558 ? -23.977 21.979 -35.571 1.00 31.72 ? 574  GLU A CG  1 
ATOM   4568 C  CD  . GLU A 1 558 ? -25.174 21.970 -34.635 1.00 33.52 ? 574  GLU A CD  1 
ATOM   4569 O  OE1 . GLU A 1 558 ? -25.082 22.506 -33.505 1.00 33.29 ? 574  GLU A OE1 1 
ATOM   4570 O  OE2 . GLU A 1 558 ? -26.218 21.415 -35.038 1.00 35.04 ? 574  GLU A OE2 1 
ATOM   4571 N  N   . ARG A 1 559 ? -20.929 25.293 -35.811 1.00 28.77 ? 575  ARG A N   1 
ATOM   4572 C  CA  . ARG A 1 559 ? -19.948 26.337 -35.506 1.00 28.24 ? 575  ARG A CA  1 
ATOM   4573 C  C   . ARG A 1 559 ? -20.506 27.408 -34.568 1.00 27.86 ? 575  ARG A C   1 
ATOM   4574 O  O   . ARG A 1 559 ? -19.790 28.333 -34.172 1.00 27.66 ? 575  ARG A O   1 
ATOM   4575 C  CB  . ARG A 1 559 ? -19.445 26.990 -36.800 1.00 28.55 ? 575  ARG A CB  1 
ATOM   4576 C  CG  . ARG A 1 559 ? -18.635 26.066 -37.709 1.00 28.85 ? 575  ARG A CG  1 
ATOM   4577 C  CD  . ARG A 1 559 ? -18.057 26.810 -38.914 1.00 29.40 ? 575  ARG A CD  1 
ATOM   4578 N  NE  . ARG A 1 559 ? -17.191 27.923 -38.517 1.00 29.15 ? 575  ARG A NE  1 
ATOM   4579 C  CZ  . ARG A 1 559 ? -15.917 27.801 -38.151 1.00 29.19 ? 575  ARG A CZ  1 
ATOM   4580 N  NH1 . ARG A 1 559 ? -15.335 26.609 -38.125 1.00 29.30 ? 575  ARG A NH1 1 
ATOM   4581 N  NH2 . ARG A 1 559 ? -15.223 28.877 -37.807 1.00 28.72 ? 575  ARG A NH2 1 
ATOM   4582 N  N   . ILE A 1 560 ? -21.782 27.271 -34.213 1.00 27.58 ? 576  ILE A N   1 
ATOM   4583 C  CA  . ILE A 1 560 ? -22.494 28.300 -33.459 1.00 27.31 ? 576  ILE A CA  1 
ATOM   4584 C  C   . ILE A 1 560 ? -22.961 27.775 -32.103 1.00 26.77 ? 576  ILE A C   1 
ATOM   4585 O  O   . ILE A 1 560 ? -23.518 26.680 -32.004 1.00 26.71 ? 576  ILE A O   1 
ATOM   4586 C  CB  . ILE A 1 560 ? -23.702 28.858 -34.270 1.00 27.68 ? 576  ILE A CB  1 
ATOM   4587 C  CG1 . ILE A 1 560 ? -23.226 29.450 -35.604 1.00 28.46 ? 576  ILE A CG1 1 
ATOM   4588 C  CG2 . ILE A 1 560 ? -24.468 29.922 -33.468 1.00 27.66 ? 576  ILE A CG2 1 
ATOM   4589 C  CD1 . ILE A 1 560 ? -24.302 29.516 -36.682 1.00 29.88 ? 576  ILE A CD1 1 
ATOM   4590 N  N   . MET A 1 561 ? -22.708 28.560 -31.060 1.00 26.12 ? 577  MET A N   1 
ATOM   4591 C  CA  . MET A 1 561 ? -23.274 28.305 -29.743 1.00 25.58 ? 577  MET A CA  1 
ATOM   4592 C  C   . MET A 1 561 ? -24.771 28.615 -29.799 1.00 25.56 ? 577  MET A C   1 
ATOM   4593 O  O   . MET A 1 561 ? -25.171 29.719 -30.183 1.00 25.52 ? 577  MET A O   1 
ATOM   4594 C  CB  . MET A 1 561 ? -22.569 29.165 -28.692 1.00 25.30 ? 577  MET A CB  1 
ATOM   4595 C  CG  . MET A 1 561 ? -23.089 28.998 -27.270 1.00 24.97 ? 577  MET A CG  1 
ATOM   4596 S  SD  . MET A 1 561 ? -22.137 29.986 -26.100 1.00 25.27 ? 577  MET A SD  1 
ATOM   4597 C  CE  . MET A 1 561 ? -22.524 31.649 -26.648 1.00 24.51 ? 577  MET A CE  1 
ATOM   4598 N  N   . SER A 1 562 ? -25.590 27.636 -29.422 1.00 25.46 ? 578  SER A N   1 
ATOM   4599 C  CA  . SER A 1 562 ? -27.035 27.724 -29.605 1.00 25.71 ? 578  SER A CA  1 
ATOM   4600 C  C   . SER A 1 562 ? -27.820 27.150 -28.431 1.00 25.40 ? 578  SER A C   1 
ATOM   4601 O  O   . SER A 1 562 ? -27.455 26.117 -27.866 1.00 25.19 ? 578  SER A O   1 
ATOM   4602 C  CB  . SER A 1 562 ? -27.442 27.011 -30.902 1.00 26.15 ? 578  SER A CB  1 
ATOM   4603 O  OG  . SER A 1 562 ? -28.851 26.979 -31.056 1.00 26.96 ? 578  SER A OG  1 
ATOM   4604 N  N   . GLY A 1 563 ? -28.912 27.827 -28.085 1.00 25.36 ? 579  GLY A N   1 
ATOM   4605 C  CA  . GLY A 1 563 ? -29.825 27.358 -27.047 1.00 25.24 ? 579  GLY A CA  1 
ATOM   4606 C  C   . GLY A 1 563 ? -30.899 26.413 -27.564 1.00 25.58 ? 579  GLY A C   1 
ATOM   4607 O  O   . GLY A 1 563 ? -31.804 26.033 -26.820 1.00 25.46 ? 579  GLY A O   1 
ATOM   4608 N  N   . LYS A 1 564 ? -30.796 26.028 -28.836 1.00 25.88 ? 580  LYS A N   1 
ATOM   4609 C  CA  . LYS A 1 564 ? -31.777 25.137 -29.464 1.00 26.42 ? 580  LYS A CA  1 
ATOM   4610 C  C   . LYS A 1 564 ? -31.841 23.769 -28.777 1.00 26.13 ? 580  LYS A C   1 
ATOM   4611 O  O   . LYS A 1 564 ? -32.930 23.260 -28.504 1.00 26.19 ? 580  LYS A O   1 
ATOM   4612 C  CB  . LYS A 1 564 ? -31.486 24.978 -30.963 1.00 27.03 ? 580  LYS A CB  1 
ATOM   4613 C  CG  . LYS A 1 564 ? -32.503 24.132 -31.724 1.00 28.92 ? 580  LYS A CG  1 
ATOM   4614 C  CD  . LYS A 1 564 ? -32.079 23.933 -33.174 1.00 31.49 ? 580  LYS A CD  1 
ATOM   4615 C  CE  . LYS A 1 564 ? -33.043 23.019 -33.913 1.00 33.15 ? 580  LYS A CE  1 
ATOM   4616 N  NZ  . LYS A 1 564 ? -32.626 22.831 -35.332 1.00 35.36 ? 580  LYS A NZ  1 
ATOM   4617 N  N   . ALA A 1 565 ? -30.675 23.193 -28.489 1.00 25.61 ? 581  ALA A N   1 
ATOM   4618 C  CA  . ALA A 1 565 ? -30.595 21.849 -27.912 1.00 25.35 ? 581  ALA A CA  1 
ATOM   4619 C  C   . ALA A 1 565 ? -31.161 21.758 -26.491 1.00 24.88 ? 581  ALA A C   1 
ATOM   4620 O  O   . ALA A 1 565 ? -31.902 20.828 -26.176 1.00 24.87 ? 581  ALA A O   1 
ATOM   4621 C  CB  . ALA A 1 565 ? -29.168 21.336 -27.955 1.00 25.31 ? 581  ALA A CB  1 
ATOM   4622 N  N   . ILE A 1 566 ? -30.819 22.723 -25.639 1.00 24.31 ? 582  ILE A N   1 
ATOM   4623 C  CA  . ILE A 1 566 ? -31.340 22.740 -24.271 1.00 24.00 ? 582  ILE A CA  1 
ATOM   4624 C  C   . ILE A 1 566 ? -32.864 22.947 -24.249 1.00 24.30 ? 582  ILE A C   1 
ATOM   4625 O  O   . ILE A 1 566 ? -33.565 22.334 -23.443 1.00 24.35 ? 582  ILE A O   1 
ATOM   4626 C  CB  . ILE A 1 566 ? -30.582 23.755 -23.352 1.00 23.54 ? 582  ILE A CB  1 
ATOM   4627 C  CG1 . ILE A 1 566 ? -30.984 23.557 -21.882 1.00 22.92 ? 582  ILE A CG1 1 
ATOM   4628 C  CG2 . ILE A 1 566 ? -30.786 25.204 -23.824 1.00 23.31 ? 582  ILE A CG2 1 
ATOM   4629 C  CD1 . ILE A 1 566 ? -30.149 24.350 -20.880 1.00 21.95 ? 582  ILE A CD1 1 
ATOM   4630 N  N   . ALA A 1 567 ? -33.370 23.779 -25.155 1.00 24.60 ? 583  ALA A N   1 
ATOM   4631 C  CA  . ALA A 1 567 ? -34.811 24.012 -25.266 1.00 25.06 ? 583  ALA A CA  1 
ATOM   4632 C  C   . ALA A 1 567 ? -35.537 22.766 -25.776 1.00 25.64 ? 583  ALA A C   1 
ATOM   4633 O  O   . ALA A 1 567 ? -36.659 22.472 -25.357 1.00 25.68 ? 583  ALA A O   1 
ATOM   4634 C  CB  . ALA A 1 567 ? -35.090 25.203 -26.171 1.00 25.34 ? 583  ALA A CB  1 
ATOM   4635 N  N   . GLU A 1 568 ? -34.879 22.040 -26.677 1.00 26.02 ? 584  GLU A N   1 
ATOM   4636 C  CA  . GLU A 1 568 ? -35.398 20.794 -27.234 1.00 26.72 ? 584  GLU A CA  1 
ATOM   4637 C  C   . GLU A 1 568 ? -35.531 19.737 -26.139 1.00 26.60 ? 584  GLU A C   1 
ATOM   4638 O  O   . GLU A 1 568 ? -36.547 19.046 -26.057 1.00 27.01 ? 584  GLU A O   1 
ATOM   4639 C  CB  . GLU A 1 568 ? -34.468 20.302 -28.347 1.00 27.05 ? 584  GLU A CB  1 
ATOM   4640 C  CG  . GLU A 1 568 ? -35.018 19.182 -29.217 1.00 28.30 ? 584  GLU A CG  1 
ATOM   4641 C  CD  . GLU A 1 568 ? -34.166 18.941 -30.456 1.00 29.64 ? 584  GLU A CD  1 
ATOM   4642 O  OE1 . GLU A 1 568 ? -33.577 19.909 -30.983 1.00 30.08 ? 584  GLU A OE1 1 
ATOM   4643 O  OE2 . GLU A 1 568 ? -34.083 17.779 -30.902 1.00 30.14 ? 584  GLU A OE2 1 
ATOM   4644 N  N   . TYR A 1 569 ? -34.503 19.632 -25.298 1.00 26.09 ? 585  TYR A N   1 
ATOM   4645 C  CA  . TYR A 1 569 ? -34.489 18.703 -24.167 1.00 26.03 ? 585  TYR A CA  1 
ATOM   4646 C  C   . TYR A 1 569 ? -35.686 18.921 -23.234 1.00 25.98 ? 585  TYR A C   1 
ATOM   4647 O  O   . TYR A 1 569 ? -36.348 17.961 -22.831 1.00 26.00 ? 585  TYR A O   1 
ATOM   4648 C  CB  . TYR A 1 569 ? -33.175 18.856 -23.387 1.00 25.57 ? 585  TYR A CB  1 
ATOM   4649 C  CG  . TYR A 1 569 ? -32.937 17.827 -22.300 1.00 25.56 ? 585  TYR A CG  1 
ATOM   4650 C  CD1 . TYR A 1 569 ? -33.550 17.945 -21.048 1.00 25.27 ? 585  TYR A CD1 1 
ATOM   4651 C  CD2 . TYR A 1 569 ? -32.082 16.746 -22.514 1.00 25.19 ? 585  TYR A CD2 1 
ATOM   4652 C  CE1 . TYR A 1 569 ? -33.327 17.009 -20.047 1.00 25.30 ? 585  TYR A CE1 1 
ATOM   4653 C  CE2 . TYR A 1 569 ? -31.851 15.806 -21.516 1.00 25.41 ? 585  TYR A CE2 1 
ATOM   4654 C  CZ  . TYR A 1 569 ? -32.479 15.944 -20.286 1.00 25.06 ? 585  TYR A CZ  1 
ATOM   4655 O  OH  . TYR A 1 569 ? -32.260 15.019 -19.294 1.00 25.44 ? 585  TYR A OH  1 
ATOM   4656 N  N   . PHE A 1 570 ? -35.958 20.183 -22.901 1.00 25.80 ? 586  PHE A N   1 
ATOM   4657 C  CA  . PHE A 1 570 ? -36.981 20.520 -21.907 1.00 25.81 ? 586  PHE A CA  1 
ATOM   4658 C  C   . PHE A 1 570 ? -38.352 20.870 -22.485 1.00 26.25 ? 586  PHE A C   1 
ATOM   4659 O  O   . PHE A 1 570 ? -39.278 21.179 -21.735 1.00 26.38 ? 586  PHE A O   1 
ATOM   4660 C  CB  . PHE A 1 570 ? -36.484 21.645 -20.990 1.00 25.14 ? 586  PHE A CB  1 
ATOM   4661 C  CG  . PHE A 1 570 ? -35.351 21.235 -20.098 1.00 24.80 ? 586  PHE A CG  1 
ATOM   4662 C  CD1 . PHE A 1 570 ? -35.585 20.446 -18.975 1.00 24.18 ? 586  PHE A CD1 1 
ATOM   4663 C  CD2 . PHE A 1 570 ? -34.048 21.624 -20.385 1.00 24.04 ? 586  PHE A CD2 1 
ATOM   4664 C  CE1 . PHE A 1 570 ? -34.539 20.054 -18.151 1.00 23.99 ? 586  PHE A CE1 1 
ATOM   4665 C  CE2 . PHE A 1 570 ? -32.994 21.239 -19.561 1.00 24.37 ? 586  PHE A CE2 1 
ATOM   4666 C  CZ  . PHE A 1 570 ? -33.241 20.453 -18.441 1.00 24.00 ? 586  PHE A CZ  1 
ATOM   4667 N  N   . GLU A 1 571 ? -38.488 20.799 -23.808 1.00 26.92 ? 587  GLU A N   1 
ATOM   4668 C  CA  . GLU A 1 571 ? -39.752 21.129 -24.478 1.00 27.59 ? 587  GLU A CA  1 
ATOM   4669 C  C   . GLU A 1 571 ? -40.987 20.394 -23.909 1.00 27.71 ? 587  GLU A C   1 
ATOM   4670 O  O   . GLU A 1 571 ? -42.012 21.035 -23.672 1.00 27.62 ? 587  GLU A O   1 
ATOM   4671 C  CB  . GLU A 1 571 ? -39.632 20.963 -26.005 1.00 28.19 ? 587  GLU A CB  1 
ATOM   4672 C  CG  . GLU A 1 571 ? -40.921 21.201 -26.799 1.00 29.89 ? 587  GLU A CG  1 
ATOM   4673 C  CD  . GLU A 1 571 ? -41.419 22.645 -26.772 1.00 31.46 ? 587  GLU A CD  1 
ATOM   4674 O  OE1 . GLU A 1 571 ? -40.673 23.557 -26.343 1.00 31.91 ? 587  GLU A OE1 1 
ATOM   4675 O  OE2 . GLU A 1 571 ? -42.576 22.865 -27.195 1.00 32.24 ? 587  GLU A OE2 1 
ATOM   4676 N  N   . PRO A 1 572 ? -40.896 19.063 -23.678 1.00 27.96 ? 588  PRO A N   1 
ATOM   4677 C  CA  . PRO A 1 572 ? -42.047 18.383 -23.065 1.00 28.08 ? 588  PRO A CA  1 
ATOM   4678 C  C   . PRO A 1 572 ? -42.384 18.888 -21.659 1.00 27.60 ? 588  PRO A C   1 
ATOM   4679 O  O   . PRO A 1 572 ? -43.555 18.889 -21.275 1.00 27.68 ? 588  PRO A O   1 
ATOM   4680 C  CB  . PRO A 1 572 ? -41.616 16.910 -23.021 1.00 28.41 ? 588  PRO A CB  1 
ATOM   4681 C  CG  . PRO A 1 572 ? -40.145 16.915 -23.239 1.00 28.48 ? 588  PRO A CG  1 
ATOM   4682 C  CD  . PRO A 1 572 ? -39.865 18.097 -24.100 1.00 28.18 ? 588  PRO A CD  1 
ATOM   4683 N  N   . LEU A 1 573 ? -41.370 19.314 -20.907 1.00 27.03 ? 589  LEU A N   1 
ATOM   4684 C  CA  . LEU A 1 573 ? -41.593 19.928 -19.599 1.00 26.60 ? 589  LEU A CA  1 
ATOM   4685 C  C   . LEU A 1 573 ? -42.259 21.295 -19.742 1.00 26.58 ? 589  LEU A C   1 
ATOM   4686 O  O   . LEU A 1 573 ? -43.192 21.609 -19.000 1.00 26.40 ? 589  LEU A O   1 
ATOM   4687 C  CB  . LEU A 1 573 ? -40.287 20.050 -18.806 1.00 26.06 ? 589  LEU A CB  1 
ATOM   4688 C  CG  . LEU A 1 573 ? -40.378 20.741 -17.439 1.00 25.67 ? 589  LEU A CG  1 
ATOM   4689 C  CD1 . LEU A 1 573 ? -41.157 19.893 -16.430 1.00 25.74 ? 589  LEU A CD1 1 
ATOM   4690 C  CD2 . LEU A 1 573 ? -38.997 21.064 -16.911 1.00 24.59 ? 589  LEU A CD2 1 
ATOM   4691 N  N   . ARG A 1 574 ? -41.782 22.096 -20.697 1.00 26.71 ? 590  ARG A N   1 
ATOM   4692 C  CA  . ARG A 1 574 ? -42.345 23.426 -20.951 1.00 26.83 ? 590  ARG A CA  1 
ATOM   4693 C  C   . ARG A 1 574 ? -43.850 23.354 -21.211 1.00 27.16 ? 590  ARG A C   1 
ATOM   4694 O  O   . ARG A 1 574 ? -44.621 24.107 -20.611 1.00 27.00 ? 590  ARG A O   1 
ATOM   4695 C  CB  . ARG A 1 574 ? -41.635 24.116 -22.123 1.00 27.00 ? 590  ARG A CB  1 
ATOM   4696 C  CG  . ARG A 1 574 ? -42.061 25.570 -22.330 1.00 27.46 ? 590  ARG A CG  1 
ATOM   4697 C  CD  . ARG A 1 574 ? -41.614 26.125 -23.682 1.00 28.72 ? 590  ARG A CD  1 
ATOM   4698 N  NE  . ARG A 1 574 ? -42.260 25.456 -24.813 1.00 30.40 ? 590  ARG A NE  1 
ATOM   4699 C  CZ  . ARG A 1 574 ? -43.482 25.731 -25.268 1.00 31.59 ? 590  ARG A CZ  1 
ATOM   4700 N  NH1 . ARG A 1 574 ? -44.228 26.665 -24.693 1.00 32.06 ? 590  ARG A NH1 1 
ATOM   4701 N  NH2 . ARG A 1 574 ? -43.964 25.062 -26.305 1.00 32.53 ? 590  ARG A NH2 1 
ATOM   4702 N  N   . VAL A 1 575 ? -44.256 22.441 -22.094 1.00 27.49 ? 591  VAL A N   1 
ATOM   4703 C  CA  . VAL A 1 575 ? -45.669 22.250 -22.424 1.00 27.92 ? 591  VAL A CA  1 
ATOM   4704 C  C   . VAL A 1 575 ? -46.490 21.901 -21.178 1.00 27.65 ? 591  VAL A C   1 
ATOM   4705 O  O   . VAL A 1 575 ? -47.511 22.537 -20.909 1.00 27.74 ? 591  VAL A O   1 
ATOM   4706 C  CB  . VAL A 1 575 ? -45.868 21.177 -23.532 1.00 28.49 ? 591  VAL A CB  1 
ATOM   4707 C  CG1 . VAL A 1 575 ? -47.352 20.898 -23.765 1.00 29.30 ? 591  VAL A CG1 1 
ATOM   4708 C  CG2 . VAL A 1 575 ? -45.208 21.623 -24.830 1.00 29.06 ? 591  VAL A CG2 1 
ATOM   4709 N  N   . TRP A 1 576 ? -46.033 20.906 -20.420 1.00 27.39 ? 592  TRP A N   1 
ATOM   4710 C  CA  . TRP A 1 576 ? -46.731 20.482 -19.206 1.00 27.42 ? 592  TRP A CA  1 
ATOM   4711 C  C   . TRP A 1 576 ? -46.798 21.584 -18.145 1.00 26.74 ? 592  TRP A C   1 
ATOM   4712 O  O   . TRP A 1 576 ? -47.851 21.807 -17.542 1.00 26.70 ? 592  TRP A O   1 
ATOM   4713 C  CB  . TRP A 1 576 ? -46.096 19.221 -18.606 1.00 27.48 ? 592  TRP A CB  1 
ATOM   4714 C  CG  . TRP A 1 576 ? -46.791 18.778 -17.351 1.00 28.13 ? 592  TRP A CG  1 
ATOM   4715 C  CD1 . TRP A 1 576 ? -47.873 17.951 -17.265 1.00 28.89 ? 592  TRP A CD1 1 
ATOM   4716 C  CD2 . TRP A 1 576 ? -46.476 19.169 -16.006 1.00 28.49 ? 592  TRP A CD2 1 
ATOM   4717 N  NE1 . TRP A 1 576 ? -48.244 17.791 -15.952 1.00 29.31 ? 592  TRP A NE1 1 
ATOM   4718 C  CE2 . TRP A 1 576 ? -47.406 18.530 -15.158 1.00 28.92 ? 592  TRP A CE2 1 
ATOM   4719 C  CE3 . TRP A 1 576 ? -45.496 19.994 -15.437 1.00 28.69 ? 592  TRP A CE3 1 
ATOM   4720 C  CZ2 . TRP A 1 576 ? -47.384 18.684 -13.768 1.00 29.17 ? 592  TRP A CZ2 1 
ATOM   4721 C  CZ3 . TRP A 1 576 ? -45.475 20.150 -14.052 1.00 29.00 ? 592  TRP A CZ3 1 
ATOM   4722 C  CH2 . TRP A 1 576 ? -46.417 19.499 -13.237 1.00 29.34 ? 592  TRP A CH2 1 
ATOM   4723 N  N   . LEU A 1 577 ? -45.674 22.265 -17.927 1.00 26.20 ? 593  LEU A N   1 
ATOM   4724 C  CA  . LEU A 1 577 ? -45.549 23.244 -16.845 1.00 25.70 ? 593  LEU A CA  1 
ATOM   4725 C  C   . LEU A 1 577 ? -46.389 24.499 -17.069 1.00 25.71 ? 593  LEU A C   1 
ATOM   4726 O  O   . LEU A 1 577 ? -47.038 24.990 -16.141 1.00 25.55 ? 593  LEU A O   1 
ATOM   4727 C  CB  . LEU A 1 577 ? -44.079 23.608 -16.612 1.00 25.35 ? 593  LEU A CB  1 
ATOM   4728 C  CG  . LEU A 1 577 ? -43.725 24.515 -15.429 1.00 25.13 ? 593  LEU A CG  1 
ATOM   4729 C  CD1 . LEU A 1 577 ? -44.172 23.926 -14.093 1.00 25.24 ? 593  LEU A CD1 1 
ATOM   4730 C  CD2 . LEU A 1 577 ? -42.235 24.768 -15.425 1.00 24.93 ? 593  LEU A CD2 1 
ATOM   4731 N  N   . GLU A 1 578 ? -46.371 25.013 -18.298 1.00 25.76 ? 594  GLU A N   1 
ATOM   4732 C  CA  . GLU A 1 578 ? -47.204 26.155 -18.668 1.00 25.97 ? 594  GLU A CA  1 
ATOM   4733 C  C   . GLU A 1 578 ? -48.677 25.861 -18.400 1.00 26.20 ? 594  GLU A C   1 
ATOM   4734 O  O   . GLU A 1 578 ? -49.392 26.702 -17.856 1.00 26.29 ? 594  GLU A O   1 
ATOM   4735 C  CB  . GLU A 1 578 ? -46.994 26.534 -20.136 1.00 26.13 ? 594  GLU A CB  1 
ATOM   4736 C  CG  . GLU A 1 578 ? -45.705 27.305 -20.395 1.00 26.64 ? 594  GLU A CG  1 
ATOM   4737 C  CD  . GLU A 1 578 ? -45.547 27.738 -21.844 1.00 28.14 ? 594  GLU A CD  1 
ATOM   4738 O  OE1 . GLU A 1 578 ? -46.559 27.803 -22.577 1.00 29.18 ? 594  GLU A OE1 1 
ATOM   4739 O  OE2 . GLU A 1 578 ? -44.400 28.021 -22.252 1.00 28.58 ? 594  GLU A OE2 1 
ATOM   4740 N  N   . ALA A 1 579 ? -49.110 24.657 -18.769 1.00 26.36 ? 595  ALA A N   1 
ATOM   4741 C  CA  . ALA A 1 579 ? -50.481 24.214 -18.551 1.00 26.72 ? 595  ALA A CA  1 
ATOM   4742 C  C   . ALA A 1 579 ? -50.796 24.023 -17.067 1.00 26.50 ? 595  ALA A C   1 
ATOM   4743 O  O   . ALA A 1 579 ? -51.887 24.380 -16.612 1.00 26.67 ? 595  ALA A O   1 
ATOM   4744 C  CB  . ALA A 1 579 ? -50.758 22.928 -19.335 1.00 27.10 ? 595  ALA A CB  1 
ATOM   4745 N  N   . GLU A 1 580 ? -49.841 23.470 -16.318 1.00 26.17 ? 596  GLU A N   1 
ATOM   4746 C  CA  . GLU A 1 580 ? -50.024 23.217 -14.886 1.00 26.23 ? 596  GLU A CA  1 
ATOM   4747 C  C   . GLU A 1 580 ? -50.116 24.507 -14.074 1.00 25.78 ? 596  GLU A C   1 
ATOM   4748 O  O   . GLU A 1 580 ? -50.905 24.595 -13.130 1.00 25.82 ? 596  GLU A O   1 
ATOM   4749 C  CB  . GLU A 1 580 ? -48.915 22.316 -14.332 1.00 26.14 ? 596  GLU A CB  1 
ATOM   4750 C  CG  . GLU A 1 580 ? -49.204 21.752 -12.932 1.00 27.34 ? 596  GLU A CG  1 
ATOM   4751 C  CD  . GLU A 1 580 ? -50.276 20.663 -12.923 1.00 29.43 ? 596  GLU A CD  1 
ATOM   4752 O  OE1 . GLU A 1 580 ? -50.674 20.179 -14.005 1.00 30.26 ? 596  GLU A OE1 1 
ATOM   4753 O  OE2 . GLU A 1 580 ? -50.719 20.285 -11.821 1.00 30.90 ? 596  GLU A OE2 1 
ATOM   4754 N  N   . ASN A 1 581 ? -49.310 25.498 -14.446 1.00 25.33 ? 597  ASN A N   1 
ATOM   4755 C  CA  . ASN A 1 581 ? -49.351 26.812 -13.808 1.00 25.10 ? 597  ASN A CA  1 
ATOM   4756 C  C   . ASN A 1 581 ? -50.670 27.548 -14.054 1.00 25.57 ? 597  ASN A C   1 
ATOM   4757 O  O   . ASN A 1 581 ? -51.193 28.206 -13.154 1.00 25.36 ? 597  ASN A O   1 
ATOM   4758 C  CB  . ASN A 1 581 ? -48.158 27.669 -14.244 1.00 24.64 ? 597  ASN A CB  1 
ATOM   4759 C  CG  . ASN A 1 581 ? -46.878 27.313 -13.502 1.00 24.39 ? 597  ASN A CG  1 
ATOM   4760 O  OD1 . ASN A 1 581 ? -46.915 26.773 -12.395 1.00 23.73 ? 597  ASN A OD1 1 
ATOM   4761 N  ND2 . ASN A 1 581 ? -45.734 27.627 -14.107 1.00 24.33 ? 597  ASN A ND2 1 
ATOM   4762 N  N   . ILE A 1 582 ? -51.204 27.420 -15.270 1.00 25.99 ? 598  ILE A N   1 
ATOM   4763 C  CA  . ILE A 1 582 ? -52.512 27.990 -15.612 1.00 26.66 ? 598  ILE A CA  1 
ATOM   4764 C  C   . ILE A 1 582 ? -53.626 27.272 -14.844 1.00 27.04 ? 598  ILE A C   1 
ATOM   4765 O  O   . ILE A 1 582 ? -54.503 27.914 -14.263 1.00 27.13 ? 598  ILE A O   1 
ATOM   4766 C  CB  . ILE A 1 582 ? -52.773 27.950 -17.145 1.00 26.95 ? 598  ILE A CB  1 
ATOM   4767 C  CG1 . ILE A 1 582 ? -51.837 28.926 -17.872 1.00 26.90 ? 598  ILE A CG1 1 
ATOM   4768 C  CG2 . ILE A 1 582 ? -54.237 28.275 -17.465 1.00 27.44 ? 598  ILE A CG2 1 
ATOM   4769 C  CD1 . ILE A 1 582 ? -51.729 28.687 -19.381 1.00 27.80 ? 598  ILE A CD1 1 
ATOM   4770 N  N   . LYS A 1 583 ? -53.567 25.941 -14.838 1.00 27.48 ? 599  LYS A N   1 
ATOM   4771 C  CA  . LYS A 1 583 ? -54.515 25.095 -14.112 1.00 28.13 ? 599  LYS A CA  1 
ATOM   4772 C  C   . LYS A 1 583 ? -54.607 25.475 -12.632 1.00 27.74 ? 599  LYS A C   1 
ATOM   4773 O  O   . LYS A 1 583 ? -55.699 25.513 -12.057 1.00 27.74 ? 599  LYS A O   1 
ATOM   4774 C  CB  . LYS A 1 583 ? -54.094 23.631 -14.248 1.00 28.46 ? 599  LYS A CB  1 
ATOM   4775 C  CG  . LYS A 1 583 ? -55.140 22.608 -13.834 1.00 30.47 ? 599  LYS A CG  1 
ATOM   4776 C  CD  . LYS A 1 583 ? -54.672 21.191 -14.175 1.00 33.05 ? 599  LYS A CD  1 
ATOM   4777 C  CE  . LYS A 1 583 ? -54.780 20.909 -15.674 1.00 34.79 ? 599  LYS A CE  1 
ATOM   4778 N  NZ  . LYS A 1 583 ? -54.163 19.604 -16.052 1.00 36.18 ? 599  LYS A NZ  1 
ATOM   4779 N  N   . ASN A 1 584 ? -53.453 25.758 -12.032 1.00 27.13 ? 600  ASN A N   1 
ATOM   4780 C  CA  . ASN A 1 584 ? -53.361 26.098 -10.613 1.00 26.84 ? 600  ASN A CA  1 
ATOM   4781 C  C   . ASN A 1 584 ? -53.315 27.603 -10.339 1.00 26.49 ? 600  ASN A C   1 
ATOM   4782 O  O   . ASN A 1 584 ? -53.061 28.017 -9.206  1.00 26.32 ? 600  ASN A O   1 
ATOM   4783 C  CB  . ASN A 1 584 ? -52.142 25.410 -9.983  1.00 26.54 ? 600  ASN A CB  1 
ATOM   4784 C  CG  . ASN A 1 584 ? -52.363 23.929 -9.746  1.00 27.05 ? 600  ASN A CG  1 
ATOM   4785 O  OD1 . ASN A 1 584 ? -52.940 23.532 -8.733  1.00 27.19 ? 600  ASN A OD1 1 
ATOM   4786 N  ND2 . ASN A 1 584 ? -51.892 23.102 -10.674 1.00 27.23 ? 600  ASN A ND2 1 
ATOM   4787 N  N   . ASN A 1 585 ? -53.558 28.414 -11.372 1.00 26.43 ? 601  ASN A N   1 
ATOM   4788 C  CA  . ASN A 1 585 ? -53.601 29.878 -11.235 1.00 26.16 ? 601  ASN A CA  1 
ATOM   4789 C  C   . ASN A 1 585 ? -52.339 30.410 -10.540 1.00 25.56 ? 601  ASN A C   1 
ATOM   4790 O  O   . ASN A 1 585 ? -52.407 31.262 -9.649  1.00 25.37 ? 601  ASN A O   1 
ATOM   4791 C  CB  . ASN A 1 585 ? -54.882 30.301 -10.488 1.00 26.50 ? 601  ASN A CB  1 
ATOM   4792 C  CG  . ASN A 1 585 ? -55.209 31.786 -10.638 1.00 26.97 ? 601  ASN A CG  1 
ATOM   4793 O  OD1 . ASN A 1 585 ? -55.933 32.352 -9.815  1.00 28.16 ? 601  ASN A OD1 1 
ATOM   4794 N  ND2 . ASN A 1 585 ? -54.691 32.416 -11.686 1.00 26.87 ? 601  ASN A ND2 1 
ATOM   4795 N  N   . VAL A 1 586 ? -51.190 29.884 -10.958 1.00 24.98 ? 602  VAL A N   1 
ATOM   4796 C  CA  . VAL A 1 586 ? -49.913 30.176 -10.313 1.00 24.44 ? 602  VAL A CA  1 
ATOM   4797 C  C   . VAL A 1 586 ? -49.404 31.556 -10.716 1.00 24.20 ? 602  VAL A C   1 
ATOM   4798 O  O   . VAL A 1 586 ? -49.344 31.887 -11.903 1.00 24.09 ? 602  VAL A O   1 
ATOM   4799 C  CB  . VAL A 1 586 ? -48.853 29.094 -10.639 1.00 24.42 ? 602  VAL A CB  1 
ATOM   4800 C  CG1 . VAL A 1 586 ? -47.485 29.483 -10.093 1.00 23.67 ? 602  VAL A CG1 1 
ATOM   4801 C  CG2 . VAL A 1 586 ? -49.281 27.742 -10.075 1.00 24.44 ? 602  VAL A CG2 1 
ATOM   4802 N  N   . HIS A 1 587 ? -49.046 32.356 -9.716  1.00 23.65 ? 603  HIS A N   1 
ATOM   4803 C  CA  . HIS A 1 587 ? -48.494 33.681 -9.957  1.00 23.48 ? 603  HIS A CA  1 
ATOM   4804 C  C   . HIS A 1 587 ? -47.072 33.580 -10.501 1.00 23.11 ? 603  HIS A C   1 
ATOM   4805 O  O   . HIS A 1 587 ? -46.238 32.840 -9.961  1.00 22.85 ? 603  HIS A O   1 
ATOM   4806 C  CB  . HIS A 1 587 ? -48.521 34.522 -8.680  1.00 23.43 ? 603  HIS A CB  1 
ATOM   4807 C  CG  . HIS A 1 587 ? -48.125 35.948 -8.894  1.00 23.65 ? 603  HIS A CG  1 
ATOM   4808 N  ND1 . HIS A 1 587 ? -46.887 36.438 -8.537  1.00 23.90 ? 603  HIS A ND1 1 
ATOM   4809 C  CD2 . HIS A 1 587 ? -48.797 36.986 -9.445  1.00 23.31 ? 603  HIS A CD2 1 
ATOM   4810 C  CE1 . HIS A 1 587 ? -46.816 37.718 -8.854  1.00 23.39 ? 603  HIS A CE1 1 
ATOM   4811 N  NE2 . HIS A 1 587 ? -47.962 38.075 -9.404  1.00 24.35 ? 603  HIS A NE2 1 
ATOM   4812 N  N   . ILE A 1 588 ? -46.813 34.321 -11.577 1.00 23.06 ? 604  ILE A N   1 
ATOM   4813 C  CA  . ILE A 1 588 ? -45.501 34.345 -12.227 1.00 22.82 ? 604  ILE A CA  1 
ATOM   4814 C  C   . ILE A 1 588 ? -44.871 35.727 -12.074 1.00 22.77 ? 604  ILE A C   1 
ATOM   4815 O  O   . ILE A 1 588 ? -45.543 36.745 -12.251 1.00 22.96 ? 604  ILE A O   1 
ATOM   4816 C  CB  . ILE A 1 588 ? -45.594 33.969 -13.736 1.00 22.95 ? 604  ILE A CB  1 
ATOM   4817 C  CG1 . ILE A 1 588 ? -46.389 32.664 -13.940 1.00 23.02 ? 604  ILE A CG1 1 
ATOM   4818 C  CG2 . ILE A 1 588 ? -44.197 33.882 -14.372 1.00 22.64 ? 604  ILE A CG2 1 
ATOM   4819 C  CD1 . ILE A 1 588 ? -45.775 31.416 -13.286 1.00 23.02 ? 604  ILE A CD1 1 
ATOM   4820 N  N   . GLY A 1 589 ? -43.582 35.753 -11.742 1.00 22.62 ? 605  GLY A N   1 
ATOM   4821 C  CA  . GLY A 1 589 ? -42.861 37.007 -11.532 1.00 22.67 ? 605  GLY A CA  1 
ATOM   4822 C  C   . GLY A 1 589 ? -42.789 37.378 -10.062 1.00 22.78 ? 605  GLY A C   1 
ATOM   4823 O  O   . GLY A 1 589 ? -43.416 36.737 -9.218  1.00 22.89 ? 605  GLY A O   1 
ATOM   4824 N  N   . TRP A 1 590 ? -42.025 38.421 -9.753  1.00 22.69 ? 606  TRP A N   1 
ATOM   4825 C  CA  . TRP A 1 590 ? -41.811 38.821 -8.365  1.00 22.92 ? 606  TRP A CA  1 
ATOM   4826 C  C   . TRP A 1 590 ? -41.611 40.320 -8.221  1.00 23.32 ? 606  TRP A C   1 
ATOM   4827 O  O   . TRP A 1 590 ? -41.109 40.985 -9.130  1.00 23.34 ? 606  TRP A O   1 
ATOM   4828 C  CB  . TRP A 1 590 ? -40.614 38.076 -7.760  1.00 22.38 ? 606  TRP A CB  1 
ATOM   4829 C  CG  . TRP A 1 590 ? -39.367 38.208 -8.575  1.00 22.17 ? 606  TRP A CG  1 
ATOM   4830 C  CD1 . TRP A 1 590 ? -38.418 39.184 -8.471  1.00 21.91 ? 606  TRP A CD1 1 
ATOM   4831 C  CD2 . TRP A 1 590 ? -38.941 37.346 -9.636  1.00 21.23 ? 606  TRP A CD2 1 
ATOM   4832 N  NE1 . TRP A 1 590 ? -37.422 38.978 -9.395  1.00 21.78 ? 606  TRP A NE1 1 
ATOM   4833 C  CE2 . TRP A 1 590 ? -37.720 37.858 -10.126 1.00 21.35 ? 606  TRP A CE2 1 
ATOM   4834 C  CE3 . TRP A 1 590 ? -39.470 36.183 -10.216 1.00 20.86 ? 606  TRP A CE3 1 
ATOM   4835 C  CZ2 . TRP A 1 590 ? -37.016 37.248 -11.167 1.00 20.74 ? 606  TRP A CZ2 1 
ATOM   4836 C  CZ3 . TRP A 1 590 ? -38.771 35.576 -11.247 1.00 20.56 ? 606  TRP A CZ3 1 
ATOM   4837 C  CH2 . TRP A 1 590 ? -37.554 36.110 -11.712 1.00 21.23 ? 606  TRP A CH2 1 
ATOM   4838 N  N   . THR A 1 591 ? -42.009 40.840 -7.065  1.00 23.77 ? 607  THR A N   1 
ATOM   4839 C  CA  . THR A 1 591 ? -41.753 42.228 -6.710  1.00 24.24 ? 607  THR A CA  1 
ATOM   4840 C  C   . THR A 1 591 ? -40.284 42.391 -6.326  1.00 24.23 ? 607  THR A C   1 
ATOM   4841 O  O   . THR A 1 591 ? -39.596 41.404 -6.049  1.00 23.83 ? 607  THR A O   1 
ATOM   4842 C  CB  . THR A 1 591 ? -42.638 42.673 -5.535  1.00 24.54 ? 607  THR A CB  1 
ATOM   4843 O  OG1 . THR A 1 591 ? -42.566 41.697 -4.488  1.00 24.52 ? 607  THR A OG1 1 
ATOM   4844 C  CG2 . THR A 1 591 ? -44.087 42.830 -5.985  1.00 25.39 ? 607  THR A CG2 1 
ATOM   4845 N  N   . THR A 1 592 ? -39.808 43.633 -6.315  1.00 24.46 ? 608  THR A N   1 
ATOM   4846 C  CA  . THR A 1 592 ? -38.430 43.929 -5.934  1.00 24.65 ? 608  THR A CA  1 
ATOM   4847 C  C   . THR A 1 592 ? -38.211 43.624 -4.450  1.00 24.60 ? 608  THR A C   1 
ATOM   4848 O  O   . THR A 1 592 ? -39.027 43.991 -3.601  1.00 24.53 ? 608  THR A O   1 
ATOM   4849 C  CB  . THR A 1 592 ? -38.058 45.395 -6.262  1.00 25.05 ? 608  THR A CB  1 
ATOM   4850 O  OG1 . THR A 1 592 ? -38.294 45.640 -7.654  1.00 25.70 ? 608  THR A OG1 1 
ATOM   4851 C  CG2 . THR A 1 592 ? -36.588 45.672 -5.954  1.00 25.17 ? 608  THR A CG2 1 
ATOM   4852 N  N   . SER A 1 593 ? -37.110 42.933 -4.163  1.00 24.40 ? 609  SER A N   1 
ATOM   4853 C  CA  . SER A 1 593 ? -36.759 42.509 -2.811  1.00 24.60 ? 609  SER A CA  1 
ATOM   4854 C  C   . SER A 1 593 ? -36.521 43.684 -1.863  1.00 25.32 ? 609  SER A C   1 
ATOM   4855 O  O   . SER A 1 593 ? -36.042 44.739 -2.280  1.00 25.13 ? 609  SER A O   1 
ATOM   4856 C  CB  . SER A 1 593 ? -35.508 41.630 -2.858  1.00 24.27 ? 609  SER A CB  1 
ATOM   4857 O  OG  . SER A 1 593 ? -35.067 41.276 -1.559  1.00 23.52 ? 609  SER A OG  1 
ATOM   4858 N  N   . ASN A 1 594 ? -36.868 43.480 -0.593  1.00 25.91 ? 610  ASN A N   1 
ATOM   4859 C  CA  A ASN A 1 594 ? -36.637 44.432 0.488   0.50 26.76 ? 610  ASN A CA  1 
ATOM   4860 C  CA  B ASN A 1 594 ? -36.587 44.504 0.421   0.50 26.85 ? 610  ASN A CA  1 
ATOM   4861 C  C   . ASN A 1 594 ? -35.495 44.022 1.403   1.00 26.85 ? 610  ASN A C   1 
ATOM   4862 O  O   . ASN A 1 594 ? -35.306 44.604 2.473   1.00 27.05 ? 610  ASN A O   1 
ATOM   4863 C  CB  A ASN A 1 594 ? -37.955 44.658 1.312   0.50 26.81 ? 610  ASN A CB  1 
ATOM   4864 C  CB  B ASN A 1 594 ? -37.892 44.909 1.184   0.50 27.05 ? 610  ASN A CB  1 
ATOM   4865 C  CG  A ASN A 1 594 ? -38.345 43.458 2.211   0.50 26.71 ? 610  ASN A CG  1 
ATOM   4866 C  CG  B ASN A 1 594 ? -39.025 45.364 0.250   0.50 27.47 ? 610  ASN A CG  1 
ATOM   4867 O  OD1 A ASN A 1 594 ? -37.926 42.318 1.993   0.50 26.41 ? 610  ASN A OD1 1 
ATOM   4868 O  OD1 B ASN A 1 594 ? -38.886 46.333 -0.502  0.50 27.88 ? 610  ASN A OD1 1 
ATOM   4869 N  ND2 A ASN A 1 594 ? -39.162 43.732 3.221   0.50 27.12 ? 610  ASN A ND2 1 
ATOM   4870 N  ND2 B ASN A 1 594 ? -40.154 44.665 0.313   0.50 27.84 ? 610  ASN A ND2 1 
ATOM   4871 N  N   . LYS A 1 595 ? -34.748 42.997 0.991   1.00 26.91 ? 611  LYS A N   1 
ATOM   4872 C  CA  . LYS A 1 595 ? -33.741 42.359 1.852   1.00 27.59 ? 611  LYS A CA  1 
ATOM   4873 C  C   . LYS A 1 595 ? -32.307 42.910 1.798   1.00 28.06 ? 611  LYS A C   1 
ATOM   4874 O  O   . LYS A 1 595 ? -31.412 42.358 2.443   1.00 28.16 ? 611  LYS A O   1 
ATOM   4875 C  CB  . LYS A 1 595 ? -33.732 40.839 1.626   1.00 27.23 ? 611  LYS A CB  1 
ATOM   4876 C  CG  . LYS A 1 595 ? -34.994 40.117 2.098   1.00 27.55 ? 611  LYS A CG  1 
ATOM   4877 C  CD  . LYS A 1 595 ? -35.178 40.202 3.614   1.00 28.64 ? 611  LYS A CD  1 
ATOM   4878 C  CE  . LYS A 1 595 ? -36.302 39.292 4.095   1.00 29.35 ? 611  LYS A CE  1 
ATOM   4879 N  NZ  . LYS A 1 595 ? -37.620 39.634 3.488   1.00 30.26 ? 611  LYS A NZ  1 
ATOM   4880 N  N   . CYS A 1 596 ? -32.087 43.982 1.041   1.00 28.64 ? 612  CYS A N   1 
ATOM   4881 C  CA  . CYS A 1 596 ? -30.804 44.694 1.086   1.00 29.45 ? 612  CYS A CA  1 
ATOM   4882 C  C   . CYS A 1 596 ? -31.031 46.195 1.225   1.00 30.42 ? 612  CYS A C   1 
ATOM   4883 O  O   . CYS A 1 596 ? -31.523 46.848 0.301   1.00 30.35 ? 612  CYS A O   1 
ATOM   4884 C  CB  . CYS A 1 596 ? -29.919 44.382 -0.132  1.00 29.00 ? 612  CYS A CB  1 
ATOM   4885 S  SG  . CYS A 1 596 ? -28.130 44.693 0.133   1.00 28.55 ? 612  CYS A SG  1 
ATOM   4886 N  N   . VAL A 1 597 ? -30.668 46.725 2.392   1.00 31.61 ? 613  VAL A N   1 
ATOM   4887 C  CA  . VAL A 1 597 ? -30.846 48.140 2.722   1.00 32.91 ? 613  VAL A CA  1 
ATOM   4888 C  C   . VAL A 1 597 ? -29.658 48.967 2.227   1.00 33.63 ? 613  VAL A C   1 
ATOM   4889 O  O   . VAL A 1 597 ? -28.513 48.712 2.605   1.00 33.75 ? 613  VAL A O   1 
ATOM   4890 C  CB  . VAL A 1 597 ? -31.051 48.335 4.252   1.00 33.31 ? 613  VAL A CB  1 
ATOM   4891 C  CG1 . VAL A 1 597 ? -31.012 49.816 4.640   1.00 34.03 ? 613  VAL A CG1 1 
ATOM   4892 C  CG2 . VAL A 1 597 ? -32.365 47.716 4.686   1.00 33.38 ? 613  VAL A CG2 1 
ATOM   4893 N  N   . SER A 1 598 ? -29.946 49.954 1.379   1.00 34.50 ? 614  SER A N   1 
ATOM   4894 C  CA  . SER A 1 598 ? -28.917 50.809 0.779   1.00 35.30 ? 614  SER A CA  1 
ATOM   4895 C  C   . SER A 1 598 ? -28.361 51.839 1.759   1.00 35.92 ? 614  SER A C   1 
ATOM   4896 O  O   . SER A 1 598 ? -29.021 52.214 2.729   1.00 36.68 ? 614  SER A O   1 
ATOM   4897 C  CB  . SER A 1 598 ? -29.465 51.511 -0.467  1.00 35.32 ? 614  SER A CB  1 
ATOM   4898 O  OG  . SER A 1 598 ? -29.737 50.572 -1.494  1.00 36.12 ? 614  SER A OG  1 
ATOM   4899 N  N   . ARG B 2 1   ? -13.747 22.386 -12.129 1.00 30.54 ? 1    ARG P N   1 
ATOM   4900 C  CA  . ARG B 2 1   ? -14.309 22.510 -10.755 1.00 30.51 ? 1    ARG P CA  1 
ATOM   4901 C  C   . ARG B 2 1   ? -15.830 22.503 -10.852 1.00 30.20 ? 1    ARG P C   1 
ATOM   4902 O  O   . ARG B 2 1   ? -16.385 23.058 -11.804 1.00 30.23 ? 1    ARG P O   1 
ATOM   4903 C  CB  . ARG B 2 1   ? -13.812 23.791 -10.081 1.00 30.70 ? 1    ARG P CB  1 
ATOM   4904 C  CG  . ARG B 2 1   ? -12.310 23.821 -9.878  1.00 31.72 ? 1    ARG P CG  1 
ATOM   4905 C  CD  . ARG B 2 1   ? -11.815 25.175 -9.402  1.00 33.48 ? 1    ARG P CD  1 
ATOM   4906 N  NE  . ARG B 2 1   ? -10.463 25.428 -9.899  1.00 35.62 ? 1    ARG P NE  1 
ATOM   4907 C  CZ  . ARG B 2 1   ? -9.555  26.191 -9.296  1.00 36.50 ? 1    ARG P CZ  1 
ATOM   4908 N  NH1 . ARG B 2 1   ? -9.827  26.791 -8.141  1.00 36.43 ? 1    ARG P NH1 1 
ATOM   4909 N  NH2 . ARG B 2 1   ? -8.359  26.344 -9.849  1.00 37.18 ? 1    ARG P NH2 1 
ATOM   4910 N  N   . PRO B 2 2   ? -16.515 21.863 -9.883  1.00 29.81 ? 2    PRO P N   1 
ATOM   4911 C  CA  . PRO B 2 2   ? -17.972 21.874 -9.937  1.00 29.58 ? 2    PRO P CA  1 
ATOM   4912 C  C   . PRO B 2 2   ? -18.481 23.306 -9.839  1.00 29.24 ? 2    PRO P C   1 
ATOM   4913 O  O   . PRO B 2 2   ? -17.827 24.138 -9.206  1.00 29.13 ? 2    PRO P O   1 
ATOM   4914 C  CB  . PRO B 2 2   ? -18.385 21.092 -8.683  1.00 29.52 ? 2    PRO P CB  1 
ATOM   4915 C  CG  . PRO B 2 2   ? -17.178 20.385 -8.232  1.00 29.81 ? 2    PRO P CG  1 
ATOM   4916 C  CD  . PRO B 2 2   ? -16.020 21.209 -8.661  1.00 29.86 ? 2    PRO P CD  1 
ATOM   4917 N  N   . PRO B 2 3   ? -19.630 23.601 -10.472 1.00 29.12 ? 3    PRO P N   1 
ATOM   4918 C  CA  . PRO B 2 3   ? -20.246 24.920 -10.329 1.00 29.01 ? 3    PRO P CA  1 
ATOM   4919 C  C   . PRO B 2 3   ? -20.515 25.263 -8.863  1.00 28.91 ? 3    PRO P C   1 
ATOM   4920 O  O   . PRO B 2 3   ? -20.633 26.429 -8.497  1.00 28.74 ? 3    PRO P O   1 
ATOM   4921 C  CB  . PRO B 2 3   ? -21.571 24.776 -11.086 1.00 29.00 ? 3    PRO P CB  1 
ATOM   4922 C  CG  . PRO B 2 3   ? -21.788 23.309 -11.243 1.00 29.23 ? 3    PRO P CG  1 
ATOM   4923 C  CD  . PRO B 2 3   ? -20.421 22.728 -11.356 1.00 29.17 ? 3    PRO P CD  1 
ATOM   4924 N  N   . GLY B 2 4   ? -20.614 24.379 -8.010  1.00 28.84 ? 4    GLY P N   1 
HETATM 4925 C  C1  . NAG C 3 .   ? -0.310  48.633 -24.627 1.00 24.00 ? 1    NAG B C1  1 
HETATM 4926 C  C2  . NAG C 3 .   ? 0.926   47.825 -25.020 1.00 25.59 ? 1    NAG B C2  1 
HETATM 4927 C  C3  . NAG C 3 .   ? 2.184   48.680 -24.898 1.00 26.34 ? 1    NAG B C3  1 
HETATM 4928 C  C4  . NAG C 3 .   ? 2.017   50.047 -25.564 1.00 27.11 ? 1    NAG B C4  1 
HETATM 4929 C  C5  . NAG C 3 .   ? 0.698   50.713 -25.154 1.00 25.71 ? 1    NAG B C5  1 
HETATM 4930 C  C6  . NAG C 3 .   ? 0.453   52.006 -25.927 1.00 25.46 ? 1    NAG B C6  1 
HETATM 4931 C  C7  . NAG C 3 .   ? 0.866   45.413 -24.624 1.00 26.74 ? 1    NAG B C7  1 
HETATM 4932 C  C8  . NAG C 3 .   ? 1.038   44.306 -23.622 1.00 26.91 ? 1    NAG B C8  1 
HETATM 4933 N  N2  . NAG C 3 .   ? 1.056   46.652 -24.172 1.00 26.23 ? 1    NAG B N2  1 
HETATM 4934 O  O3  . NAG C 3 .   ? 3.269   47.997 -25.480 1.00 26.13 ? 1    NAG B O3  1 
HETATM 4935 O  O4  . NAG C 3 .   ? 3.109   50.851 -25.171 1.00 30.14 ? 1    NAG B O4  1 
HETATM 4936 O  O5  . NAG C 3 .   ? -0.392  49.835 -25.376 1.00 24.56 ? 1    NAG B O5  1 
HETATM 4937 O  O6  . NAG C 3 .   ? -0.634  52.700 -25.357 1.00 25.22 ? 1    NAG B O6  1 
HETATM 4938 O  O7  . NAG C 3 .   ? 0.565   45.154 -25.790 1.00 26.92 ? 1    NAG B O7  1 
HETATM 4939 C  C1  . NAG C 3 .   ? 3.918   51.236 -26.301 1.00 33.12 ? 2    NAG B C1  1 
HETATM 4940 C  C2  . NAG C 3 .   ? 4.852   52.353 -25.839 1.00 34.87 ? 2    NAG B C2  1 
HETATM 4941 C  C3  . NAG C 3 .   ? 5.747   52.825 -26.986 1.00 35.99 ? 2    NAG B C3  1 
HETATM 4942 C  C4  . NAG C 3 .   ? 6.431   51.662 -27.718 1.00 37.28 ? 2    NAG B C4  1 
HETATM 4943 C  C5  . NAG C 3 .   ? 5.469   50.492 -27.975 1.00 36.24 ? 2    NAG B C5  1 
HETATM 4944 C  C6  . NAG C 3 .   ? 6.248   49.243 -28.374 1.00 36.35 ? 2    NAG B C6  1 
HETATM 4945 C  C7  . NAG C 3 .   ? 3.375   54.386 -25.742 1.00 36.02 ? 2    NAG B C7  1 
HETATM 4946 C  C8  . NAG C 3 .   ? 2.752   55.369 -24.794 1.00 35.82 ? 2    NAG B C8  1 
HETATM 4947 N  N2  . NAG C 3 .   ? 4.126   53.437 -25.174 1.00 35.10 ? 2    NAG B N2  1 
HETATM 4948 O  O3  . NAG C 3 .   ? 6.713   53.701 -26.452 1.00 35.64 ? 2    NAG B O3  1 
HETATM 4949 O  O4  . NAG C 3 .   ? 6.932   52.108 -28.967 1.00 40.47 ? 2    NAG B O4  1 
HETATM 4950 O  O5  . NAG C 3 .   ? 4.679   50.171 -26.839 1.00 34.35 ? 2    NAG B O5  1 
HETATM 4951 O  O6  . NAG C 3 .   ? 5.577   48.600 -29.433 1.00 37.26 ? 2    NAG B O6  1 
HETATM 4952 O  O7  . NAG C 3 .   ? 3.175   54.493 -26.955 1.00 36.73 ? 2    NAG B O7  1 
HETATM 4953 C  C1  . BMA C 3 .   ? 8.332   52.463 -28.906 1.00 43.80 ? 3    BMA B C1  1 
HETATM 4954 C  C2  . BMA C 3 .   ? 8.998   52.178 -30.252 1.00 44.97 ? 3    BMA B C2  1 
HETATM 4955 C  C3  . BMA C 3 .   ? 10.464  52.635 -30.268 1.00 46.57 ? 3    BMA B C3  1 
HETATM 4956 C  C4  . BMA C 3 .   ? 10.642  54.044 -29.700 1.00 46.89 ? 3    BMA B C4  1 
HETATM 4957 C  C5  . BMA C 3 .   ? 9.870   54.210 -28.389 1.00 47.31 ? 3    BMA B C5  1 
HETATM 4958 C  C6  . BMA C 3 .   ? 9.914   55.647 -27.873 1.00 49.03 ? 3    BMA B C6  1 
HETATM 4959 O  O2  . BMA C 3 .   ? 8.281   52.831 -31.278 1.00 44.64 ? 3    BMA B O2  1 
HETATM 4960 O  O3  . BMA C 3 .   ? 10.976  52.613 -31.587 1.00 48.00 ? 3    BMA B O3  1 
HETATM 4961 O  O4  . BMA C 3 .   ? 12.019  54.275 -29.498 1.00 47.15 ? 3    BMA B O4  1 
HETATM 4962 O  O5  . BMA C 3 .   ? 8.517   53.827 -28.577 1.00 45.53 ? 3    BMA B O5  1 
HETATM 4963 O  O6  . BMA C 3 .   ? 8.884   55.828 -26.925 1.00 51.38 ? 3    BMA B O6  1 
HETATM 4964 C  C1  . MAN C 3 .   ? 11.806  51.448 -31.796 1.00 49.26 ? 4    MAN B C1  1 
HETATM 4965 C  C2  . MAN C 3 .   ? 12.864  51.734 -32.865 1.00 49.69 ? 4    MAN B C2  1 
HETATM 4966 C  C3  . MAN C 3 .   ? 12.235  51.837 -34.259 1.00 49.93 ? 4    MAN B C3  1 
HETATM 4967 C  C4  . MAN C 3 .   ? 11.258  50.692 -34.539 1.00 50.25 ? 4    MAN B C4  1 
HETATM 4968 C  C5  . MAN C 3 .   ? 10.315  50.447 -33.350 1.00 50.49 ? 4    MAN B C5  1 
HETATM 4969 C  C6  . MAN C 3 .   ? 9.422   49.219 -33.505 1.00 51.79 ? 4    MAN B C6  1 
HETATM 4970 O  O2  . MAN C 3 .   ? 13.831  50.705 -32.850 1.00 49.94 ? 4    MAN B O2  1 
HETATM 4971 O  O3  . MAN C 3 .   ? 13.243  51.857 -35.247 1.00 49.98 ? 4    MAN B O3  1 
HETATM 4972 O  O4  . MAN C 3 .   ? 10.519  50.991 -35.705 1.00 49.96 ? 4    MAN B O4  1 
HETATM 4973 O  O5  . MAN C 3 .   ? 11.067  50.295 -32.158 1.00 49.90 ? 4    MAN B O5  1 
HETATM 4974 O  O6  . MAN C 3 .   ? 9.871   48.450 -34.596 1.00 53.29 ? 4    MAN B O6  1 
HETATM 4975 C  C1  . BMA C 3 .   ? 8.853   47.538 -35.054 1.00 54.55 ? 5    BMA B C1  1 
HETATM 4976 C  C2  . BMA C 3 .   ? 8.152   48.061 -36.319 1.00 55.18 ? 5    BMA B C2  1 
HETATM 4977 C  C3  . BMA C 3 .   ? 8.896   47.659 -37.598 1.00 55.44 ? 5    BMA B C3  1 
HETATM 4978 C  C4  . BMA C 3 .   ? 10.329  47.214 -37.309 1.00 55.45 ? 5    BMA B C4  1 
HETATM 4979 C  C5  . BMA C 3 .   ? 10.361  46.077 -36.279 1.00 55.56 ? 5    BMA B C5  1 
HETATM 4980 C  C6  . BMA C 3 .   ? 11.744  45.931 -35.646 1.00 55.70 ? 5    BMA B C6  1 
HETATM 4981 O  O2  . BMA C 3 .   ? 7.980   49.463 -36.260 1.00 56.14 ? 5    BMA B O2  1 
HETATM 4982 O  O3  . BMA C 3 .   ? 8.901   48.723 -38.524 1.00 55.65 ? 5    BMA B O3  1 
HETATM 4983 O  O4  . BMA C 3 .   ? 10.955  46.807 -38.505 1.00 55.61 ? 5    BMA B O4  1 
HETATM 4984 O  O5  . BMA C 3 .   ? 9.371   46.228 -35.261 1.00 55.13 ? 5    BMA B O5  1 
HETATM 4985 O  O6  . BMA C 3 .   ? 12.568  45.162 -36.491 1.00 56.17 ? 5    BMA B O6  1 
HETATM 4986 C  C1  . MAN C 3 .   ? 9.299   56.758 -25.905 1.00 53.06 ? 6    MAN B C1  1 
HETATM 4987 C  C2  . MAN C 3 .   ? 9.111   56.143 -24.510 1.00 53.87 ? 6    MAN B C2  1 
HETATM 4988 C  C3  . MAN C 3 .   ? 7.650   56.186 -24.040 1.00 54.26 ? 6    MAN B C3  1 
HETATM 4989 C  C4  . MAN C 3 .   ? 6.989   57.537 -24.314 1.00 54.31 ? 6    MAN B C4  1 
HETATM 4990 C  C5  . MAN C 3 .   ? 7.251   57.988 -25.754 1.00 54.30 ? 6    MAN B C5  1 
HETATM 4991 C  C6  . MAN C 3 .   ? 6.667   59.368 -26.039 1.00 54.69 ? 6    MAN B C6  1 
HETATM 4992 O  O2  . MAN C 3 .   ? 9.944   56.809 -23.583 1.00 54.47 ? 6    MAN B O2  1 
HETATM 4993 O  O3  . MAN C 3 .   ? 7.559   55.889 -22.660 1.00 54.18 ? 6    MAN B O3  1 
HETATM 4994 O  O4  . MAN C 3 .   ? 5.605   57.422 -24.072 1.00 54.45 ? 6    MAN B O4  1 
HETATM 4995 O  O5  . MAN C 3 .   ? 8.648   58.016 -26.007 1.00 53.77 ? 6    MAN B O5  1 
HETATM 4996 O  O6  . MAN C 3 .   ? 6.875   59.690 -27.396 1.00 55.02 ? 6    MAN B O6  1 
HETATM 4997 ZN ZN  . ZN  D 4 .   ? -15.145 21.857 -13.603 1.00 24.63 ? 1615 ZN  A ZN  1 
HETATM 4998 C  C1  . NAG E 5 .   ? -11.192 3.331  -30.806 0.40 27.85 ? 1622 NAG A C1  1 
HETATM 4999 C  C2  . NAG E 5 .   ? -11.848 3.002  -32.145 0.40 29.04 ? 1622 NAG A C2  1 
HETATM 5000 C  C3  . NAG E 5 .   ? -10.809 2.828  -33.247 0.40 29.47 ? 1622 NAG A C3  1 
HETATM 5001 C  C4  . NAG E 5 .   ? -9.848  4.006  -33.255 0.40 29.51 ? 1622 NAG A C4  1 
HETATM 5002 C  C5  . NAG E 5 .   ? -9.279  4.220  -31.860 0.40 29.28 ? 1622 NAG A C5  1 
HETATM 5003 C  C6  . NAG E 5 .   ? -8.332  5.413  -31.841 0.40 29.40 ? 1622 NAG A C6  1 
HETATM 5004 C  C7  . NAG E 5 .   ? -13.859 1.727  -32.583 0.40 29.64 ? 1622 NAG A C7  1 
HETATM 5005 C  C8  . NAG E 5 .   ? -14.602 0.438  -32.399 0.40 29.92 ? 1622 NAG A C8  1 
HETATM 5006 N  N2  . NAG E 5 .   ? -12.653 1.801  -32.031 0.40 29.33 ? 1622 NAG A N2  1 
HETATM 5007 O  O3  . NAG E 5 .   ? -11.451 2.740  -34.499 0.40 29.93 ? 1622 NAG A O3  1 
HETATM 5008 O  O4  . NAG E 5 .   ? -8.799  3.762  -34.166 0.40 30.08 ? 1622 NAG A O4  1 
HETATM 5009 O  O5  . NAG E 5 .   ? -10.338 4.445  -30.955 0.40 28.60 ? 1622 NAG A O5  1 
HETATM 5010 O  O6  . NAG E 5 .   ? -8.496  6.128  -30.637 0.40 29.78 ? 1622 NAG A O6  1 
HETATM 5011 O  O7  . NAG E 5 .   ? -14.362 2.653  -33.217 0.40 30.04 ? 1622 NAG A O7  1 
HETATM 5012 C  C1  . NAG F 5 .   ? 1.367   19.907 5.816   0.50 33.82 ? 1623 NAG A C1  1 
HETATM 5013 C  C2  . NAG F 5 .   ? 1.871   18.493 6.116   0.50 35.67 ? 1623 NAG A C2  1 
HETATM 5014 C  C3  . NAG F 5 .   ? 2.908   18.468 7.240   0.70 36.12 ? 1623 NAG A C3  1 
HETATM 5015 C  C4  . NAG F 5 .   ? 3.961   19.565 7.095   0.70 36.21 ? 1623 NAG A C4  1 
HETATM 5016 C  C5  . NAG F 5 .   ? 3.302   20.909 6.780   0.70 35.88 ? 1623 NAG A C5  1 
HETATM 5017 C  C6  . NAG F 5 .   ? 4.344   21.993 6.521   0.70 35.97 ? 1623 NAG A C6  1 
HETATM 5018 C  C7  . NAG F 5 .   ? 0.386   16.579 5.771   0.70 36.73 ? 1623 NAG A C7  1 
HETATM 5019 C  C8  . NAG F 5 .   ? -0.767  15.799 6.327   0.70 37.08 ? 1623 NAG A C8  1 
HETATM 5020 N  N2  . NAG F 5 .   ? 0.770   17.629 6.495   0.70 36.25 ? 1623 NAG A N2  1 
HETATM 5021 O  O3  . NAG F 5 .   ? 3.548   17.211 7.248   0.70 36.70 ? 1623 NAG A O3  1 
HETATM 5022 O  O4  . NAG F 5 .   ? 4.700   19.653 8.295   0.70 36.90 ? 1623 NAG A O4  1 
HETATM 5023 O  O5  . NAG F 5 .   ? 2.471   20.778 5.640   0.70 34.86 ? 1623 NAG A O5  1 
HETATM 5024 O  O6  . NAG F 5 .   ? 3.702   23.235 6.346   0.70 35.88 ? 1623 NAG A O6  1 
HETATM 5025 O  O7  . NAG F 5 .   ? 0.911   16.238 4.710   0.70 37.13 ? 1623 NAG A O7  1 
HETATM 5026 C  CAC . FLC G 6 .   ? -6.812  23.410 -12.545 1.00 56.59 ? 1624 FLC A CAC 1 
HETATM 5027 C  CA  . FLC G 6 .   ? -7.463  22.719 -13.729 1.00 56.17 ? 1624 FLC A CA  1 
HETATM 5028 C  CB  . FLC G 6 .   ? -8.899  23.175 -14.009 1.00 56.02 ? 1624 FLC A CB  1 
HETATM 5029 C  CBC . FLC G 6 .   ? -8.993  23.668 -15.438 1.00 56.03 ? 1624 FLC A CBC 1 
HETATM 5030 C  CG  . FLC G 6 .   ? -9.877  22.007 -13.829 1.00 55.91 ? 1624 FLC A CG  1 
HETATM 5031 C  CGC . FLC G 6 .   ? -10.396 21.797 -12.418 1.00 55.85 ? 1624 FLC A CGC 1 
HETATM 5032 O  OA1 . FLC G 6 .   ? -5.935  24.276 -12.768 1.00 56.67 ? 1624 FLC A OA1 1 
HETATM 5033 O  OA2 . FLC G 6 .   ? -7.157  23.091 -11.386 1.00 56.45 ? 1624 FLC A OA2 1 
HETATM 5034 O  OB1 . FLC G 6 .   ? -7.988  24.186 -15.976 1.00 55.97 ? 1624 FLC A OB1 1 
HETATM 5035 O  OB2 . FLC G 6 .   ? -10.077 23.548 -16.053 1.00 56.06 ? 1624 FLC A OB2 1 
HETATM 5036 O  OG1 . FLC G 6 .   ? -9.793  22.293 -11.442 1.00 55.78 ? 1624 FLC A OG1 1 
HETATM 5037 O  OG2 . FLC G 6 .   ? -11.428 21.107 -12.271 1.00 55.46 ? 1624 FLC A OG2 1 
HETATM 5038 O  OHB . FLC G 6 .   ? -9.263  24.262 -13.142 1.00 56.09 ? 1624 FLC A OHB 1 
HETATM 5039 O  O   . HOH H 7 .   ? 7.841   33.953 -43.285 1.00 44.62 ? 2001 HOH A O   1 
HETATM 5040 O  O   . HOH H 7 .   ? 9.387   29.925 -43.436 1.00 43.27 ? 2002 HOH A O   1 
HETATM 5041 O  O   . HOH H 7 .   ? 12.512  40.243 -36.160 1.00 42.16 ? 2003 HOH A O   1 
HETATM 5042 O  O   . HOH H 7 .   ? 7.155   31.253 -44.481 1.00 43.82 ? 2004 HOH A O   1 
HETATM 5043 O  O   . HOH H 7 .   ? 5.484   28.456 -42.077 1.00 48.01 ? 2005 HOH A O   1 
HETATM 5044 O  O   . HOH H 7 .   ? 7.038   35.042 -45.443 1.00 35.17 ? 2006 HOH A O   1 
HETATM 5045 O  O   . HOH H 7 .   ? 2.582   28.229 -44.040 1.00 52.02 ? 2007 HOH A O   1 
HETATM 5046 O  O   . HOH H 7 .   ? 12.801  28.867 -26.802 1.00 37.32 ? 2008 HOH A O   1 
HETATM 5047 O  O   . HOH H 7 .   ? 5.498   24.797 -30.761 1.00 26.47 ? 2009 HOH A O   1 
HETATM 5048 O  O   . HOH H 7 .   ? 5.350   22.864 -1.940  1.00 40.52 ? 2010 HOH A O   1 
HETATM 5049 O  O   . HOH H 7 .   ? -2.741  32.387 -7.009  1.00 35.43 ? 2011 HOH A O   1 
HETATM 5050 O  O   . HOH H 7 .   ? 9.597   18.711 -13.225 1.00 38.44 ? 2012 HOH A O   1 
HETATM 5051 O  O   . HOH H 7 .   ? 8.168   27.393 -12.309 1.00 41.58 ? 2013 HOH A O   1 
HETATM 5052 O  O   . HOH H 7 .   ? 9.817   29.344 -13.504 1.00 39.97 ? 2014 HOH A O   1 
HETATM 5053 O  O   . HOH H 7 .   ? 1.799   28.346 -17.049 1.00 30.33 ? 2015 HOH A O   1 
HETATM 5054 O  O   . HOH H 7 .   ? 9.935   41.199 -12.547 1.00 38.91 ? 2016 HOH A O   1 
HETATM 5055 O  O   . HOH H 7 .   ? 4.686   16.135 -11.403 1.00 35.00 ? 2017 HOH A O   1 
HETATM 5056 O  O   . HOH H 7 .   ? 7.126   22.744 -6.482  1.00 35.01 ? 2018 HOH A O   1 
HETATM 5057 O  O   . HOH H 7 .   ? 0.168   26.025 -12.080 1.00 39.58 ? 2019 HOH A O   1 
HETATM 5058 O  O   . HOH H 7 .   ? -1.416  30.550 -11.896 1.00 52.21 ? 2020 HOH A O   1 
HETATM 5059 O  O   . HOH H 7 .   ? 3.444   18.762 -4.340  1.00 43.04 ? 2021 HOH A O   1 
HETATM 5060 O  O   . HOH H 7 .   ? 5.906   21.651 -4.293  1.00 43.16 ? 2022 HOH A O   1 
HETATM 5061 O  O   . HOH H 7 .   ? 3.224   24.641 -1.446  1.00 33.66 ? 2023 HOH A O   1 
HETATM 5062 O  O   . HOH H 7 .   ? -3.588  25.783 -4.293  1.00 33.51 ? 2024 HOH A O   1 
HETATM 5063 O  O   . HOH H 7 .   ? -0.391  13.161 -4.205  1.00 45.35 ? 2025 HOH A O   1 
HETATM 5064 O  O   . HOH H 7 .   ? -2.894  30.068 3.808   1.00 41.51 ? 2026 HOH A O   1 
HETATM 5065 O  O   . HOH H 7 .   ? -5.595  37.479 -15.867 1.00 37.47 ? 2027 HOH A O   1 
HETATM 5066 O  O   . HOH H 7 .   ? -6.736  33.230 -12.880 1.00 39.56 ? 2028 HOH A O   1 
HETATM 5067 O  O   . HOH H 7 .   ? -3.562  22.364 7.492   1.00 37.78 ? 2029 HOH A O   1 
HETATM 5068 O  O   . HOH H 7 .   ? 8.149   38.746 -5.565  1.00 41.69 ? 2030 HOH A O   1 
HETATM 5069 O  O   . HOH H 7 .   ? 0.298   27.339 9.089   1.00 41.71 ? 2031 HOH A O   1 
HETATM 5070 O  O   . HOH H 7 .   ? 3.463   26.752 8.227   1.00 49.14 ? 2032 HOH A O   1 
HETATM 5071 O  O   . HOH H 7 .   ? -9.506  31.921 8.495   1.00 43.04 ? 2033 HOH A O   1 
HETATM 5072 O  O   . HOH H 7 .   ? -15.534 24.526 1.636   1.00 33.50 ? 2034 HOH A O   1 
HETATM 5073 O  O   . HOH H 7 .   ? -3.639  33.642 4.231   1.00 47.96 ? 2035 HOH A O   1 
HETATM 5074 O  O   . HOH H 7 .   ? -1.969  32.839 -4.467  1.00 25.90 ? 2036 HOH A O   1 
HETATM 5075 O  O   . HOH H 7 .   ? -16.741 14.112 4.138   1.00 36.04 ? 2037 HOH A O   1 
HETATM 5076 O  O   . HOH H 7 .   ? 9.862   34.320 -5.670  1.00 45.51 ? 2038 HOH A O   1 
HETATM 5077 O  O   . HOH H 7 .   ? -21.214 19.607 -4.072  1.00 49.04 ? 2039 HOH A O   1 
HETATM 5078 O  O   . HOH H 7 .   ? -19.573 21.534 -5.052  1.00 39.10 ? 2040 HOH A O   1 
HETATM 5079 O  O   . HOH H 7 .   ? 7.649   38.041 -9.994  1.00 33.89 ? 2041 HOH A O   1 
HETATM 5080 O  O   . HOH H 7 .   ? 12.114  33.336 -13.252 1.00 30.73 ? 2042 HOH A O   1 
HETATM 5081 O  O   . HOH H 7 .   ? 11.245  39.341 -16.011 1.00 48.75 ? 2043 HOH A O   1 
HETATM 5082 O  O   . HOH H 7 .   ? -20.613 40.380 10.001  1.00 33.60 ? 2044 HOH A O   1 
HETATM 5083 O  O   . HOH H 7 .   ? 7.472   41.849 -20.420 1.00 38.24 ? 2045 HOH A O   1 
HETATM 5084 O  O   . HOH H 7 .   ? 7.771   39.621 -12.200 1.00 33.28 ? 2046 HOH A O   1 
HETATM 5085 O  O   . HOH H 7 .   ? -12.112 49.456 -6.996  1.00 37.98 ? 2047 HOH A O   1 
HETATM 5086 O  O   . HOH H 7 .   ? -8.773  50.637 -9.783  1.00 37.65 ? 2048 HOH A O   1 
HETATM 5087 O  O   . HOH H 7 .   ? -6.287  50.288 -12.679 1.00 34.85 ? 2049 HOH A O   1 
HETATM 5088 O  O   . HOH H 7 .   ? -3.914  50.639 -8.887  1.00 49.93 ? 2050 HOH A O   1 
HETATM 5089 O  O   . HOH H 7 .   ? -8.572  51.767 -12.679 1.00 47.22 ? 2051 HOH A O   1 
HETATM 5090 O  O   . HOH H 7 .   ? -12.545 51.094 -11.564 1.00 46.61 ? 2052 HOH A O   1 
HETATM 5091 O  O   . HOH H 7 .   ? 0.058   50.289 -14.418 1.00 32.84 ? 2053 HOH A O   1 
HETATM 5092 O  O   . HOH H 7 .   ? -4.027  51.006 -13.987 1.00 30.05 ? 2054 HOH A O   1 
HETATM 5093 O  O   . HOH H 7 .   ? 4.731   40.376 -29.551 1.00 32.62 ? 2055 HOH A O   1 
HETATM 5094 O  O   . HOH H 7 .   ? -5.879  37.161 -18.531 1.00 39.56 ? 2056 HOH A O   1 
HETATM 5095 O  O   . HOH H 7 .   ? -11.503 43.575 -25.327 1.00 28.29 ? 2057 HOH A O   1 
HETATM 5096 O  O   . HOH H 7 .   ? -13.521 45.546 -25.687 1.00 46.52 ? 2058 HOH A O   1 
HETATM 5097 O  O   . HOH H 7 .   ? 6.567   41.534 -33.378 1.00 27.85 ? 2059 HOH A O   1 
HETATM 5098 O  O   . HOH H 7 .   ? -14.760 41.312 -25.177 1.00 32.35 ? 2060 HOH A O   1 
HETATM 5099 O  O   . HOH H 7 .   ? -18.495 48.149 -21.082 1.00 37.96 ? 2061 HOH A O   1 
HETATM 5100 O  O   . HOH H 7 .   ? -15.778 49.685 -18.955 1.00 37.63 ? 2062 HOH A O   1 
HETATM 5101 O  O   . HOH H 7 .   ? 5.400   41.715 -37.887 1.00 32.68 ? 2063 HOH A O   1 
HETATM 5102 O  O   . HOH H 7 .   ? -9.610  32.806 -15.975 1.00 26.83 ? 2064 HOH A O   1 
HETATM 5103 O  O   . HOH H 7 .   ? -6.272  29.469 -24.662 1.00 36.53 ? 2065 HOH A O   1 
HETATM 5104 O  O   . HOH H 7 .   ? 4.624   41.262 -35.231 1.00 28.95 ? 2066 HOH A O   1 
HETATM 5105 O  O   . HOH H 7 .   ? -13.378 31.885 -34.611 1.00 35.61 ? 2067 HOH A O   1 
HETATM 5106 O  O   . HOH H 7 .   ? -1.160  38.846 -38.351 1.00 22.86 ? 2068 HOH A O   1 
HETATM 5107 O  O   . HOH H 7 .   ? -0.190  37.673 -41.155 1.00 26.54 ? 2069 HOH A O   1 
HETATM 5108 O  O   . HOH H 7 .   ? 5.293   42.278 -31.301 1.00 30.59 ? 2070 HOH A O   1 
HETATM 5109 O  O   . HOH H 7 .   ? 2.323   42.059 -28.864 1.00 38.56 ? 2071 HOH A O   1 
HETATM 5110 O  O   . HOH H 7 .   ? -22.127 43.613 -25.465 1.00 29.78 ? 2072 HOH A O   1 
HETATM 5111 O  O   . HOH H 7 .   ? -23.450 42.605 -30.801 1.00 36.94 ? 2073 HOH A O   1 
HETATM 5112 O  O   . HOH H 7 .   ? -25.472 36.312 -32.884 1.00 42.27 ? 2074 HOH A O   1 
HETATM 5113 O  O   . HOH H 7 .   ? -21.197 47.001 -24.767 1.00 90.24 ? 2075 HOH A O   1 
HETATM 5114 O  O   . HOH H 7 .   ? -22.889 46.022 -18.877 1.00 41.27 ? 2076 HOH A O   1 
HETATM 5115 O  O   . HOH H 7 .   ? -23.686 47.850 -25.329 1.00 40.66 ? 2077 HOH A O   1 
HETATM 5116 O  O   . HOH H 7 .   ? -22.365 45.781 -27.091 1.00 36.02 ? 2078 HOH A O   1 
HETATM 5117 O  O   . HOH H 7 .   ? 4.827   36.504 -44.891 1.00 30.87 ? 2079 HOH A O   1 
HETATM 5118 O  O   . HOH H 7 .   ? -29.231 32.572 -30.115 1.00 31.46 ? 2080 HOH A O   1 
HETATM 5119 O  O   . HOH H 7 .   ? -31.609 40.477 -24.005 1.00 38.25 ? 2081 HOH A O   1 
HETATM 5120 O  O   . HOH H 7 .   ? -24.707 40.345 -31.556 1.00 40.59 ? 2082 HOH A O   1 
HETATM 5121 O  O   . HOH H 7 .   ? -35.412 40.409 -24.016 1.00 51.28 ? 2083 HOH A O   1 
HETATM 5122 O  O   . HOH H 7 .   ? -1.505  28.797 -42.088 1.00 40.23 ? 2084 HOH A O   1 
HETATM 5123 O  O   . HOH H 7 .   ? -1.835  32.647 -43.265 1.00 49.95 ? 2085 HOH A O   1 
HETATM 5124 O  O   . HOH H 7 .   ? -35.648 38.886 -21.631 1.00 35.47 ? 2086 HOH A O   1 
HETATM 5125 O  O   . HOH H 7 .   ? -37.462 26.861 -23.670 1.00 41.92 ? 2087 HOH A O   1 
HETATM 5126 O  O   . HOH H 7 .   ? -40.757 29.346 -23.102 1.00 36.83 ? 2088 HOH A O   1 
HETATM 5127 O  O   . HOH H 7 .   ? -42.510 35.193 -17.858 1.00 37.28 ? 2089 HOH A O   1 
HETATM 5128 O  O   . HOH H 7 .   ? -3.535  32.570 -36.286 1.00 39.86 ? 2090 HOH A O   1 
HETATM 5129 O  O   . HOH H 7 .   ? -3.316  36.101 -38.276 1.00 26.34 ? 2091 HOH A O   1 
HETATM 5130 O  O   . HOH H 7 .   ? -48.391 30.311 -20.040 1.00 30.97 ? 2092 HOH A O   1 
HETATM 5131 O  O   . HOH H 7 .   ? -49.326 31.366 -16.583 1.00 38.88 ? 2093 HOH A O   1 
HETATM 5132 O  O   . HOH H 7 .   ? 0.838   22.999 -33.573 1.00 47.51 ? 2094 HOH A O   1 
HETATM 5133 O  O   . HOH H 7 .   ? -3.298  25.708 -34.906 1.00 33.87 ? 2095 HOH A O   1 
HETATM 5134 O  O   . HOH H 7 .   ? -2.579  23.119 -35.212 1.00 47.53 ? 2096 HOH A O   1 
HETATM 5135 O  O   . HOH H 7 .   ? 3.281   24.455 -36.805 1.00 37.82 ? 2097 HOH A O   1 
HETATM 5136 O  O   . HOH H 7 .   ? -2.746  34.747 -33.912 1.00 38.27 ? 2098 HOH A O   1 
HETATM 5137 O  O   . HOH H 7 .   ? -3.658  32.624 -29.657 1.00 32.62 ? 2099 HOH A O   1 
HETATM 5138 O  O   . HOH H 7 .   ? -4.471  29.032 -28.138 1.00 32.93 ? 2100 HOH A O   1 
HETATM 5139 O  O   . HOH H 7 .   ? -5.962  31.656 -34.309 1.00 36.79 ? 2101 HOH A O   1 
HETATM 5140 O  O   . HOH H 7 .   ? -9.133  27.455 -28.580 1.00 24.15 ? 2102 HOH A O   1 
HETATM 5141 O  O   . HOH H 7 .   ? -47.263 41.723 -7.556  1.00 35.57 ? 2103 HOH A O   1 
HETATM 5142 O  O   . HOH H 7 .   ? -7.100  35.133 -28.927 1.00 54.87 ? 2104 HOH A O   1 
HETATM 5143 O  O   . HOH H 7 .   ? -6.731  39.972 -27.314 1.00 33.14 ? 2105 HOH A O   1 
HETATM 5144 O  O   . HOH H 7 .   ? -0.427  41.028 -22.732 1.00 42.01 ? 2106 HOH A O   1 
HETATM 5145 O  O   . HOH H 7 .   ? 2.920   41.320 -24.067 1.00 44.71 ? 2107 HOH A O   1 
HETATM 5146 O  O   . HOH H 7 .   ? -7.940  33.881 -26.318 1.00 37.06 ? 2108 HOH A O   1 
HETATM 5147 O  O   . HOH H 7 .   ? -3.262  38.837 -20.758 1.00 37.44 ? 2109 HOH A O   1 
HETATM 5148 O  O   . HOH H 7 .   ? -24.764 17.065 -13.249 1.00 44.84 ? 2110 HOH A O   1 
HETATM 5149 O  O   . HOH H 7 .   ? -3.508  35.641 -14.990 1.00 30.33 ? 2111 HOH A O   1 
HETATM 5150 O  O   . HOH H 7 .   ? -7.949  36.949 -14.777 1.00 31.44 ? 2112 HOH A O   1 
HETATM 5151 O  O   . HOH H 7 .   ? -9.029  35.300 -12.738 1.00 25.69 ? 2113 HOH A O   1 
HETATM 5152 O  O   . HOH H 7 .   ? 4.919   45.530 -14.827 1.00 40.74 ? 2114 HOH A O   1 
HETATM 5153 O  O   . HOH H 7 .   ? 3.845   44.241 -18.064 1.00 40.05 ? 2115 HOH A O   1 
HETATM 5154 O  O   . HOH H 7 .   ? 8.677   44.049 -11.946 1.00 45.11 ? 2116 HOH A O   1 
HETATM 5155 O  O   . HOH H 7 .   ? 7.659   46.051 -8.026  1.00 43.55 ? 2117 HOH A O   1 
HETATM 5156 O  O   . HOH H 7 .   ? 6.321   38.737 -7.807  1.00 29.99 ? 2118 HOH A O   1 
HETATM 5157 O  O   . HOH H 7 .   ? 2.231   46.141 -4.153  1.00 38.28 ? 2119 HOH A O   1 
HETATM 5158 O  O   . HOH H 7 .   ? 4.354   42.973 -2.345  1.00 40.34 ? 2120 HOH A O   1 
HETATM 5159 O  O   . HOH H 7 .   ? -0.401  48.884 -6.351  1.00 39.17 ? 2121 HOH A O   1 
HETATM 5160 O  O   . HOH H 7 .   ? 3.147   36.577 -2.516  1.00 34.59 ? 2122 HOH A O   1 
HETATM 5161 O  O   . HOH H 7 .   ? -12.273 2.124  -0.789  1.00 52.39 ? 2123 HOH A O   1 
HETATM 5162 O  O   . HOH H 7 .   ? -6.678  2.166  -7.131  1.00 39.36 ? 2124 HOH A O   1 
HETATM 5163 O  O   . HOH H 7 .   ? -9.085  0.945  -22.079 1.00 43.36 ? 2125 HOH A O   1 
HETATM 5164 O  O   . HOH H 7 .   ? -8.280  33.451 -4.269  1.00 25.33 ? 2126 HOH A O   1 
HETATM 5165 O  O   . HOH H 7 .   ? -7.409  34.514 5.331   1.00 35.54 ? 2127 HOH A O   1 
HETATM 5166 O  O   . HOH H 7 .   ? -14.033 33.526 2.014   1.00 23.79 ? 2128 HOH A O   1 
HETATM 5167 O  O   . HOH H 7 .   ? -6.181  25.619 -3.764  1.00 53.81 ? 2129 HOH A O   1 
HETATM 5168 O  O   . HOH H 7 .   ? -7.444  32.150 6.727   1.00 44.73 ? 2130 HOH A O   1 
HETATM 5169 O  O   . HOH H 7 .   ? -12.207 31.226 7.925   1.00 29.76 ? 2131 HOH A O   1 
HETATM 5170 O  O   . HOH H 7 .   ? -14.108 34.124 8.520   1.00 33.59 ? 2132 HOH A O   1 
HETATM 5171 O  O   . HOH H 7 .   ? -9.432  35.424 7.015   1.00 47.86 ? 2133 HOH A O   1 
HETATM 5172 O  O   . HOH H 7 .   ? -16.225 26.867 3.310   1.00 28.56 ? 2134 HOH A O   1 
HETATM 5173 O  O   . HOH H 7 .   ? -13.284 24.527 7.304   1.00 36.62 ? 2135 HOH A O   1 
HETATM 5174 O  O   . HOH H 7 .   ? -10.296 23.374 5.795   1.00 36.66 ? 2136 HOH A O   1 
HETATM 5175 O  O   . HOH H 7 .   ? -12.070 29.050 11.323  1.00 49.81 ? 2137 HOH A O   1 
HETATM 5176 O  O   . HOH H 7 .   ? -16.098 25.416 5.592   1.00 27.62 ? 2138 HOH A O   1 
HETATM 5177 O  O   . HOH H 7 .   ? -12.830 21.628 6.703   1.00 43.98 ? 2139 HOH A O   1 
HETATM 5178 O  O   . HOH H 7 .   ? -21.012 29.911 14.301  1.00 37.29 ? 2140 HOH A O   1 
HETATM 5179 O  O   . HOH H 7 .   ? -25.396 27.759 18.167  1.00 56.58 ? 2141 HOH A O   1 
HETATM 5180 O  O   . HOH H 7 .   ? -28.067 21.715 13.197  1.00 31.68 ? 2142 HOH A O   1 
HETATM 5181 O  O   . HOH H 7 .   ? -35.709 25.846 14.890  1.00 34.55 ? 2143 HOH A O   1 
HETATM 5182 O  O   . HOH H 7 .   ? -34.472 30.125 16.085  1.00 44.58 ? 2144 HOH A O   1 
HETATM 5183 O  O   . HOH H 7 .   ? -20.939 18.765 -11.281 1.00 41.21 ? 2145 HOH A O   1 
HETATM 5184 O  O   . HOH H 7 .   ? -15.604 22.806 3.786   1.00 37.77 ? 2146 HOH A O   1 
HETATM 5185 O  O   . HOH H 7 .   ? -17.814 16.986 -1.199  1.00 33.96 ? 2147 HOH A O   1 
HETATM 5186 O  O   . HOH H 7 .   ? -20.675 18.792 1.246   1.00 37.12 ? 2148 HOH A O   1 
HETATM 5187 O  O   . HOH H 7 .   ? -16.894 15.843 2.149   1.00 34.45 ? 2149 HOH A O   1 
HETATM 5188 O  O   . HOH H 7 .   ? -17.267 20.971 -1.653  1.00 31.34 ? 2150 HOH A O   1 
HETATM 5189 O  O   . HOH H 7 .   ? -22.724 17.676 2.769   1.00 35.82 ? 2151 HOH A O   1 
HETATM 5190 O  O   . HOH H 7 .   ? -24.386 18.568 9.532   1.00 35.37 ? 2152 HOH A O   1 
HETATM 5191 O  O   . HOH H 7 .   ? -15.869 14.476 6.753   1.00 37.64 ? 2153 HOH A O   1 
HETATM 5192 O  O   . HOH H 7 .   ? -26.841 21.823 -0.177  1.00 40.67 ? 2154 HOH A O   1 
HETATM 5193 O  O   . HOH H 7 .   ? -19.962 19.653 -1.823  1.00 42.76 ? 2155 HOH A O   1 
HETATM 5194 O  O   . HOH H 7 .   ? -20.375 23.266 -3.136  1.00 36.46 ? 2156 HOH A O   1 
HETATM 5195 O  O   . HOH H 7 .   ? -28.961 16.751 -14.169 1.00 40.54 ? 2157 HOH A O   1 
HETATM 5196 O  O   . HOH H 7 .   ? -22.162 16.067 7.876   1.00 44.48 ? 2158 HOH A O   1 
HETATM 5197 O  O   . HOH H 7 .   ? -34.442 22.554 2.607   1.00 38.10 ? 2159 HOH A O   1 
HETATM 5198 O  O   . HOH H 7 .   ? -32.901 24.507 1.994   1.00 26.85 ? 2160 HOH A O   1 
HETATM 5199 O  O   . HOH H 7 .   ? -34.873 16.211 3.769   1.00 38.85 ? 2161 HOH A O   1 
HETATM 5200 O  O   . HOH H 7 .   ? -27.605 11.316 1.103   1.00 49.93 ? 2162 HOH A O   1 
HETATM 5201 O  O   . HOH H 7 .   ? -35.897 19.370 9.130   1.00 37.71 ? 2163 HOH A O   1 
HETATM 5202 O  O   . HOH H 7 .   ? -37.217 31.507 7.596   1.00 33.31 ? 2164 HOH A O   1 
HETATM 5203 O  O   . HOH H 7 .   ? -32.815 31.192 12.888  1.00 31.08 ? 2165 HOH A O   1 
HETATM 5204 O  O   . HOH H 7 .   ? -37.666 27.810 15.524  1.00 38.00 ? 2166 HOH A O   1 
HETATM 5205 O  O   . HOH H 7 .   ? -40.594 30.944 12.930  1.00 32.67 ? 2167 HOH A O   1 
HETATM 5206 O  O   . HOH H 7 .   ? -24.473 44.920 -13.889 1.00 34.53 ? 2168 HOH A O   1 
HETATM 5207 O  O   . HOH H 7 .   ? -25.251 44.708 -18.427 1.00 49.12 ? 2169 HOH A O   1 
HETATM 5208 O  O   . HOH H 7 .   ? -29.538 29.712 0.339   1.00 26.28 ? 2170 HOH A O   1 
HETATM 5209 O  O   . HOH H 7 .   ? -28.009 40.364 8.292   1.00 25.88 ? 2171 HOH A O   1 
HETATM 5210 O  O   . HOH H 7 .   ? -25.245 39.015 10.518  1.00 32.84 ? 2172 HOH A O   1 
HETATM 5211 O  O   . HOH H 7 .   ? -26.603 47.972 -8.893  1.00 42.55 ? 2173 HOH A O   1 
HETATM 5212 O  O   . HOH H 7 .   ? -24.953 33.652 -2.876  1.00 22.39 ? 2174 HOH A O   1 
HETATM 5213 O  O   . HOH H 7 .   ? -18.002 38.607 9.586   1.00 41.54 ? 2175 HOH A O   1 
HETATM 5214 O  O   . HOH H 7 .   ? -22.064 40.057 7.690   1.00 25.08 ? 2176 HOH A O   1 
HETATM 5215 O  O   . HOH H 7 .   ? -35.151 44.029 -10.080 1.00 36.38 ? 2177 HOH A O   1 
HETATM 5216 O  O   . HOH H 7 .   ? -20.026 34.905 12.375  1.00 36.67 ? 2178 HOH A O   1 
HETATM 5217 O  O   . HOH H 7 .   ? -12.508 42.955 5.534   1.00 34.06 ? 2179 HOH A O   1 
HETATM 5218 O  O   . HOH H 7 .   ? -20.315 48.694 0.419   1.00 35.21 ? 2180 HOH A O   1 
HETATM 5219 O  O   . HOH H 7 .   ? -8.686  46.840 0.708   1.00 38.47 ? 2181 HOH A O   1 
HETATM 5220 O  O   . HOH H 7 .   ? -5.448  39.140 4.528   1.00 43.48 ? 2182 HOH A O   1 
HETATM 5221 O  O   . HOH H 7 .   ? -9.165  30.127 -12.464 1.00 44.15 ? 2183 HOH A O   1 
HETATM 5222 O  O   . HOH H 7 .   ? -11.518 48.122 -4.917  1.00 38.60 ? 2184 HOH A O   1 
HETATM 5223 O  O   . HOH H 7 .   ? -13.624 36.632 -7.728  1.00 18.18 ? 2185 HOH A O   1 
HETATM 5224 O  O   . HOH H 7 .   ? -6.404  49.370 -10.162 1.00 28.97 ? 2186 HOH A O   1 
HETATM 5225 O  O   . HOH H 7 .   ? -5.414  50.007 -1.974  1.00 41.25 ? 2187 HOH A O   1 
HETATM 5226 O  O   . HOH H 7 .   ? -7.368  41.089 -15.087 1.00 22.87 ? 2188 HOH A O   1 
HETATM 5227 O  O   . HOH H 7 .   ? -10.774 44.567 -13.546 1.00 22.53 ? 2189 HOH A O   1 
HETATM 5228 O  O   . HOH H 7 .   ? -9.529  39.207 -15.208 1.00 21.26 ? 2190 HOH A O   1 
HETATM 5229 O  O   . HOH H 7 .   ? -12.200 48.255 -11.014 1.00 29.22 ? 2191 HOH A O   1 
HETATM 5230 O  O   . HOH H 7 .   ? -10.510 48.837 -8.997  1.00 36.84 ? 2192 HOH A O   1 
HETATM 5231 O  O   . HOH H 7 .   ? -2.290  49.254 -15.274 1.00 24.36 ? 2193 HOH A O   1 
HETATM 5232 O  O   . HOH H 7 .   ? 3.183   50.386 -11.119 1.00 40.80 ? 2194 HOH A O   1 
HETATM 5233 O  O   . HOH H 7 .   ? -35.787 2.200  -22.443 1.00 60.21 ? 2195 HOH A O   1 
HETATM 5234 O  O   . HOH H 7 .   ? -5.119  40.228 -16.195 1.00 29.25 ? 2196 HOH A O   1 
HETATM 5235 O  O   . HOH H 7 .   ? -1.730  49.648 -20.530 1.00 29.43 ? 2197 HOH A O   1 
HETATM 5236 O  O   . HOH H 7 .   ? -4.231  50.657 -20.506 1.00 35.80 ? 2198 HOH A O   1 
HETATM 5237 O  O   . HOH H 7 .   ? -1.590  50.092 -17.946 1.00 34.29 ? 2199 HOH A O   1 
HETATM 5238 O  O   . HOH H 7 .   ? 2.091   43.754 -20.223 1.00 43.50 ? 2200 HOH A O   1 
HETATM 5239 O  O   . HOH H 7 .   ? -5.114  40.187 -18.929 1.00 34.36 ? 2201 HOH A O   1 
HETATM 5240 O  O   . HOH H 7 .   ? -8.704  47.241 -24.968 1.00 32.43 ? 2202 HOH A O   1 
HETATM 5241 O  O   . HOH H 7 .   ? -10.565 45.745 -23.745 1.00 20.55 ? 2203 HOH A O   1 
HETATM 5242 O  O   . HOH H 7 .   ? -11.927 49.322 -15.332 1.00 33.77 ? 2204 HOH A O   1 
HETATM 5243 O  O   . HOH H 7 .   ? -12.164 41.034 -24.404 1.00 21.91 ? 2205 HOH A O   1 
HETATM 5244 O  O   . HOH H 7 .   ? -16.101 45.559 -23.645 1.00 35.36 ? 2206 HOH A O   1 
HETATM 5245 O  O   . HOH H 7 .   ? -15.799 47.890 -20.847 1.00 30.30 ? 2207 HOH A O   1 
HETATM 5246 O  O   . HOH H 7 .   ? -8.435  35.692 -19.245 1.00 50.84 ? 2208 HOH A O   1 
HETATM 5247 O  O   . HOH H 7 .   ? -12.893 33.356 -19.411 1.00 23.33 ? 2209 HOH A O   1 
HETATM 5248 O  O   . HOH H 7 .   ? -7.971  34.861 -16.512 1.00 33.30 ? 2210 HOH A O   1 
HETATM 5249 O  O   . HOH H 7 .   ? -13.957 37.428 -26.819 1.00 24.98 ? 2211 HOH A O   1 
HETATM 5250 O  O   . HOH H 7 .   ? -10.706 40.161 -26.543 1.00 34.66 ? 2212 HOH A O   1 
HETATM 5251 O  O   . HOH H 7 .   ? -9.375  30.809 -26.187 1.00 51.45 ? 2213 HOH A O   1 
HETATM 5252 O  O   . HOH H 7 .   ? -6.948  32.056 -24.802 1.00 42.18 ? 2214 HOH A O   1 
HETATM 5253 O  O   . HOH H 7 .   ? -40.956 17.440 -27.591 1.00 34.26 ? 2215 HOH A O   1 
HETATM 5254 O  O   . HOH H 7 .   ? -14.302 32.238 -32.051 1.00 26.82 ? 2216 HOH A O   1 
HETATM 5255 O  O   . HOH H 7 .   ? -13.725 35.866 -33.424 1.00 43.80 ? 2217 HOH A O   1 
HETATM 5256 O  O   . HOH H 7 .   ? -11.534 29.836 -28.532 1.00 27.82 ? 2218 HOH A O   1 
HETATM 5257 O  O   . HOH H 7 .   ? -16.514 39.272 -25.903 1.00 23.79 ? 2219 HOH A O   1 
HETATM 5258 O  O   . HOH H 7 .   ? -19.480 35.119 -33.657 1.00 37.53 ? 2220 HOH A O   1 
HETATM 5259 O  O   . HOH H 7 .   ? -17.168 32.544 -32.457 1.00 27.98 ? 2221 HOH A O   1 
HETATM 5260 O  O   . HOH H 7 .   ? -14.387 38.572 -32.641 1.00 32.98 ? 2222 HOH A O   1 
HETATM 5261 O  O   . HOH H 7 .   ? -18.880 40.568 -25.903 1.00 22.92 ? 2223 HOH A O   1 
HETATM 5262 O  O   . HOH H 7 .   ? -21.249 41.474 -27.122 1.00 21.49 ? 2224 HOH A O   1 
HETATM 5263 O  O   . HOH H 7 .   ? -17.340 43.150 -27.330 1.00 33.76 ? 2225 HOH A O   1 
HETATM 5264 O  O   . HOH H 7 .   ? -21.174 42.942 -29.497 1.00 28.92 ? 2226 HOH A O   1 
HETATM 5265 O  O   . HOH H 7 .   ? -53.244 25.482 -20.918 1.00 38.07 ? 2227 HOH A O   1 
HETATM 5266 O  O   . HOH H 7 .   ? -22.535 37.061 -33.355 1.00 51.17 ? 2228 HOH A O   1 
HETATM 5267 O  O   . HOH H 7 .   ? -20.222 44.466 -23.581 1.00 38.12 ? 2229 HOH A O   1 
HETATM 5268 O  O   . HOH H 7 .   ? -16.513 43.025 -23.897 1.00 35.56 ? 2230 HOH A O   1 
HETATM 5269 O  O   . HOH H 7 .   ? -22.251 42.619 -20.271 1.00 25.02 ? 2231 HOH A O   1 
HETATM 5270 O  O   . HOH H 7 .   ? -21.711 45.156 -21.175 1.00 39.98 ? 2232 HOH A O   1 
HETATM 5271 O  O   . HOH H 7 .   ? -51.389 36.107 -10.879 1.00 41.30 ? 2233 HOH A O   1 
HETATM 5272 O  O   . HOH H 7 .   ? -25.491 44.464 -28.606 1.00 49.51 ? 2234 HOH A O   1 
HETATM 5273 O  O   . HOH H 7 .   ? -24.800 45.868 -26.662 1.00 77.68 ? 2235 HOH A O   1 
HETATM 5274 O  O   . HOH H 7 .   ? -24.447 42.929 -24.282 1.00 30.55 ? 2236 HOH A O   1 
HETATM 5275 O  O   . HOH H 7 .   ? -26.971 33.801 -29.392 1.00 23.36 ? 2237 HOH A O   1 
HETATM 5276 O  O   . HOH H 7 .   ? -24.743 32.399 -30.427 1.00 26.04 ? 2238 HOH A O   1 
HETATM 5277 O  O   . HOH H 7 .   ? -21.701 31.181 -31.588 1.00 25.35 ? 2239 HOH A O   1 
HETATM 5278 O  O   . HOH H 7 .   ? -30.943 38.573 -21.901 1.00 22.35 ? 2240 HOH A O   1 
HETATM 5279 O  O   . HOH H 7 .   ? -29.831 41.244 -19.353 1.00 28.18 ? 2241 HOH A O   1 
HETATM 5280 O  O   . HOH H 7 .   ? -24.456 42.024 -21.756 1.00 29.80 ? 2242 HOH A O   1 
HETATM 5281 O  O   . HOH H 7 .   ? -31.501 33.952 -29.546 1.00 38.55 ? 2243 HOH A O   1 
HETATM 5282 O  O   . HOH H 7 .   ? -33.405 36.148 -27.750 1.00 30.58 ? 2244 HOH A O   1 
HETATM 5283 O  O   . HOH H 7 .   ? -31.823 39.517 -26.473 1.00 47.26 ? 2245 HOH A O   1 
HETATM 5284 O  O   . HOH H 7 .   ? -28.156 39.947 -31.531 1.00 47.05 ? 2246 HOH A O   1 
HETATM 5285 O  O   . HOH H 7 .   ? -27.386 35.947 -31.014 1.00 31.65 ? 2247 HOH A O   1 
HETATM 5286 O  O   . HOH H 7 .   ? -37.064 36.755 -22.017 1.00 33.19 ? 2248 HOH A O   1 
HETATM 5287 O  O   . HOH H 7 .   ? -36.032 28.379 -25.444 1.00 40.44 ? 2249 HOH A O   1 
HETATM 5288 O  O   . HOH H 7 .   ? -38.130 29.429 -22.559 1.00 35.36 ? 2250 HOH A O   1 
HETATM 5289 O  O   . HOH H 7 .   ? -38.516 32.046 -25.663 1.00 41.52 ? 2251 HOH A O   1 
HETATM 5290 O  O   . HOH H 7 .   ? -31.794 30.219 -27.622 1.00 40.76 ? 2252 HOH A O   1 
HETATM 5291 O  O   . HOH H 7 .   ? -35.563 36.060 -14.601 1.00 26.48 ? 2253 HOH A O   1 
HETATM 5292 O  O   . HOH H 7 .   ? -38.276 37.876 -17.519 1.00 43.92 ? 2254 HOH A O   1 
HETATM 5293 O  O   . HOH H 7 .   ? -33.272 38.390 -20.586 1.00 33.75 ? 2255 HOH A O   1 
HETATM 5294 O  O   . HOH H 7 .   ? -33.261 41.589 -16.374 1.00 38.84 ? 2256 HOH A O   1 
HETATM 5295 O  O   . HOH H 7 .   ? -38.665 36.269 -19.684 1.00 37.33 ? 2257 HOH A O   1 
HETATM 5296 O  O   . HOH H 7 .   ? -42.842 32.599 -18.350 1.00 25.17 ? 2258 HOH A O   1 
HETATM 5297 O  O   . HOH H 7 .   ? -42.294 28.974 -20.904 1.00 30.76 ? 2259 HOH A O   1 
HETATM 5298 O  O   . HOH H 7 .   ? -31.909 30.880 -10.422 1.00 23.64 ? 2260 HOH A O   1 
HETATM 5299 O  O   . HOH H 7 .   ? -42.177 33.278 -11.314 1.00 18.99 ? 2261 HOH A O   1 
HETATM 5300 O  O   . HOH H 7 .   ? -48.259 29.199 -17.624 1.00 25.72 ? 2262 HOH A O   1 
HETATM 5301 O  O   . HOH H 7 .   ? -47.250 33.118 -17.225 1.00 44.40 ? 2263 HOH A O   1 
HETATM 5302 O  O   . HOH H 7 .   ? -43.663 31.583 -20.580 1.00 31.00 ? 2264 HOH A O   1 
HETATM 5303 O  O   . HOH H 7 .   ? -45.841 31.325 -7.583  1.00 20.83 ? 2265 HOH A O   1 
HETATM 5304 O  O   . HOH H 7 .   ? -49.301 20.690 -9.653  1.00 39.81 ? 2266 HOH A O   1 
HETATM 5305 O  O   . HOH H 7 .   ? -45.930 21.386 -1.998  1.00 37.21 ? 2267 HOH A O   1 
HETATM 5306 O  O   . HOH H 7 .   ? -43.215 16.427 -4.023  1.00 40.94 ? 2268 HOH A O   1 
HETATM 5307 O  O   . HOH H 7 .   ? -44.982 18.766 -1.134  1.00 35.59 ? 2269 HOH A O   1 
HETATM 5308 O  O   . HOH H 7 .   ? -47.729 30.939 -5.614  1.00 24.36 ? 2270 HOH A O   1 
HETATM 5309 O  O   . HOH H 7 .   ? -47.482 20.220 1.664   1.00 40.64 ? 2271 HOH A O   1 
HETATM 5310 O  O   . HOH H 7 .   ? -45.032 19.048 1.519   1.00 30.72 ? 2272 HOH A O   1 
HETATM 5311 O  O   . HOH H 7 .   ? -36.722 23.660 1.808   1.00 23.23 ? 2273 HOH A O   1 
HETATM 5312 O  O   . HOH H 7 .   ? -48.638 35.223 -0.106  1.00 33.74 ? 2274 HOH A O   1 
HETATM 5313 O  O   . HOH H 7 .   ? -44.132 36.894 6.423   1.00 37.45 ? 2275 HOH A O   1 
HETATM 5314 O  O   . HOH H 7 .   ? -41.488 35.770 2.783   1.00 38.59 ? 2276 HOH A O   1 
HETATM 5315 O  O   . HOH H 7 .   ? -38.891 33.247 4.951   1.00 30.59 ? 2277 HOH A O   1 
HETATM 5316 O  O   . HOH H 7 .   ? -41.813 34.049 -2.248  1.00 22.12 ? 2278 HOH A O   1 
HETATM 5317 O  O   . HOH H 7 .   ? -49.921 31.612 -7.176  1.00 21.58 ? 2279 HOH A O   1 
HETATM 5318 O  O   . HOH H 7 .   ? -45.083 39.846 -7.969  1.00 27.01 ? 2280 HOH A O   1 
HETATM 5319 O  O   . HOH H 7 .   ? -44.611 40.988 -2.917  1.00 31.77 ? 2281 HOH A O   1 
HETATM 5320 O  O   . HOH H 7 .   ? -40.001 37.476 -0.422  1.00 39.25 ? 2282 HOH A O   1 
HETATM 5321 O  O   . HOH H 7 .   ? -30.626 21.933 -4.139  1.00 25.98 ? 2283 HOH A O   1 
HETATM 5322 O  O   . HOH H 7 .   ? -27.753 21.566 -4.043  1.00 44.43 ? 2284 HOH A O   1 
HETATM 5323 O  O   . HOH H 7 .   ? -23.709 23.775 -5.073  1.00 30.81 ? 2285 HOH A O   1 
HETATM 5324 O  O   . HOH H 7 .   ? -25.253 23.974 -0.529  1.00 21.28 ? 2286 HOH A O   1 
HETATM 5325 O  O   . HOH H 7 .   ? -26.922 33.494 -4.725  1.00 22.60 ? 2287 HOH A O   1 
HETATM 5326 O  O   . HOH H 7 .   ? -30.601 31.268 -7.946  1.00 26.09 ? 2288 HOH A O   1 
HETATM 5327 O  O   . HOH H 7 .   ? -21.077 24.740 -5.402  1.00 29.32 ? 2289 HOH A O   1 
HETATM 5328 O  O   . HOH H 7 .   ? -25.496 20.139 -13.021 1.00 33.22 ? 2290 HOH A O   1 
HETATM 5329 O  O   . HOH H 7 .   ? -33.016 15.351 -5.179  1.00 41.76 ? 2291 HOH A O   1 
HETATM 5330 O  O   . HOH H 7 .   ? -27.367 20.258 -7.946  1.00 53.16 ? 2292 HOH A O   1 
HETATM 5331 O  O   . HOH H 7 .   ? -28.055 18.019 -5.658  1.00 60.40 ? 2293 HOH A O   1 
HETATM 5332 O  O   . HOH H 7 .   ? -35.350 15.694 -2.929  1.00 40.01 ? 2294 HOH A O   1 
HETATM 5333 O  O   . HOH H 7 .   ? -32.204 15.454 -1.729  1.00 46.26 ? 2295 HOH A O   1 
HETATM 5334 O  O   . HOH H 7 .   ? -27.156 15.040 -1.976  1.00 44.12 ? 2296 HOH A O   1 
HETATM 5335 O  O   . HOH H 7 .   ? -43.898 15.071 0.344   1.00 34.70 ? 2297 HOH A O   1 
HETATM 5336 O  O   . HOH H 7 .   ? -48.654 12.195 -7.887  1.00 32.38 ? 2298 HOH A O   1 
HETATM 5337 O  O   . HOH H 7 .   ? -39.120 9.929  -12.201 1.00 25.41 ? 2299 HOH A O   1 
HETATM 5338 O  O   . HOH H 7 .   ? -39.396 7.423  -5.830  1.00 46.57 ? 2300 HOH A O   1 
HETATM 5339 O  O   . HOH H 7 .   ? -37.375 8.813  -4.242  1.00 46.87 ? 2301 HOH A O   1 
HETATM 5340 O  O   . HOH H 7 .   ? -37.158 5.850  -7.306  1.00 34.75 ? 2302 HOH A O   1 
HETATM 5341 O  O   . HOH H 7 .   ? -36.852 11.599 -11.283 1.00 25.78 ? 2303 HOH A O   1 
HETATM 5342 O  O   . HOH H 7 .   ? -32.118 13.185 -7.022  1.00 38.33 ? 2304 HOH A O   1 
HETATM 5343 O  O   . HOH H 7 .   ? -34.626 6.409  -6.556  1.00 28.04 ? 2305 HOH A O   1 
HETATM 5344 O  O   . HOH H 7 .   ? -35.409 6.812  -4.002  1.00 36.94 ? 2306 HOH A O   1 
HETATM 5345 O  O   . HOH H 7 .   ? -32.036 5.034  -3.442  1.00 27.58 ? 2307 HOH A O   1 
HETATM 5346 O  O   . HOH H 7 .   ? -34.287 7.419  -1.634  1.00 35.91 ? 2308 HOH A O   1 
HETATM 5347 O  O   . HOH H 7 .   ? -31.742 8.361  -1.587  1.00 35.15 ? 2309 HOH A O   1 
HETATM 5348 O  O   . HOH H 7 .   ? -27.632 13.474 -4.163  1.00 31.38 ? 2310 HOH A O   1 
HETATM 5349 O  O   . HOH H 7 .   ? -28.640 12.453 -1.066  1.00 44.46 ? 2311 HOH A O   1 
HETATM 5350 O  O   . HOH H 7 .   ? -34.596 1.017  -4.110  1.00 46.22 ? 2312 HOH A O   1 
HETATM 5351 O  O   . HOH H 7 .   ? -12.715 4.769  -1.243  1.00 32.88 ? 2313 HOH A O   1 
HETATM 5352 O  O   . HOH H 7 .   ? -8.476  1.868  -9.164  1.00 39.06 ? 2314 HOH A O   1 
HETATM 5353 O  O   . HOH H 7 .   ? -20.160 5.497  -14.326 1.00 39.69 ? 2315 HOH A O   1 
HETATM 5354 O  O   . HOH H 7 .   ? -11.014 7.512  -17.947 1.00 28.75 ? 2316 HOH A O   1 
HETATM 5355 O  O   . HOH H 7 .   ? -11.192 1.590  -13.412 1.00 46.16 ? 2317 HOH A O   1 
HETATM 5356 O  O   . HOH H 7 .   ? -7.594  3.222  -14.990 1.00 33.25 ? 2318 HOH A O   1 
HETATM 5357 O  O   . HOH H 7 .   ? -15.255 0.019  -19.567 1.00 40.00 ? 2319 HOH A O   1 
HETATM 5358 O  O   . HOH H 7 .   ? -11.234 2.415  -24.166 1.00 44.49 ? 2320 HOH A O   1 
HETATM 5359 O  O   . HOH H 7 .   ? -14.288 5.601  -30.803 1.00 36.63 ? 2321 HOH A O   1 
HETATM 5360 O  O   . HOH H 7 .   ? -5.770  10.381 -24.694 1.00 38.40 ? 2322 HOH A O   1 
HETATM 5361 O  O   . HOH H 7 .   ? -7.002  3.815  -22.775 1.00 40.77 ? 2323 HOH A O   1 
HETATM 5362 O  O   . HOH H 7 .   ? -3.991  6.332  -19.848 1.00 37.35 ? 2324 HOH A O   1 
HETATM 5363 O  O   . HOH H 7 .   ? -4.338  1.421  -8.495  1.00 39.16 ? 2325 HOH A O   1 
HETATM 5364 O  O   . HOH H 7 .   ? -7.877  9.633  -1.068  1.00 33.51 ? 2326 HOH A O   1 
HETATM 5365 O  O   . HOH H 7 .   ? -14.925 12.723 1.908   1.00 33.11 ? 2327 HOH A O   1 
HETATM 5366 O  O   . HOH H 7 .   ? -6.355  11.335 6.368   1.00 58.04 ? 2328 HOH A O   1 
HETATM 5367 O  O   . HOH H 7 .   ? -12.658 23.558 1.989   1.00 42.28 ? 2329 HOH A O   1 
HETATM 5368 O  O   . HOH H 7 .   ? -10.091 20.142 -4.642  1.00 30.22 ? 2330 HOH A O   1 
HETATM 5369 O  O   . HOH H 7 .   ? -14.789 17.824 -3.113  1.00 34.63 ? 2331 HOH A O   1 
HETATM 5370 O  O   . HOH H 7 .   ? -16.152 23.750 -0.802  1.00 38.64 ? 2332 HOH A O   1 
HETATM 5371 O  O   . HOH H 7 .   ? -10.946 23.790 -6.222  1.00 34.18 ? 2333 HOH A O   1 
HETATM 5372 O  O   . HOH H 7 .   ? -18.031 25.225 -2.553  1.00 21.46 ? 2334 HOH A O   1 
HETATM 5373 O  O   . HOH H 7 .   ? -16.990 20.459 -4.447  1.00 26.16 ? 2335 HOH A O   1 
HETATM 5374 O  O   . HOH H 7 .   ? -4.161  21.926 -13.854 1.00 42.29 ? 2336 HOH A O   1 
HETATM 5375 O  O   . HOH H 7 .   ? -0.705  15.688 -18.845 1.00 37.25 ? 2337 HOH A O   1 
HETATM 5376 O  O   . HOH H 7 .   ? -2.234  18.046 -20.811 1.00 25.67 ? 2338 HOH A O   1 
HETATM 5377 O  O   . HOH H 7 .   ? -4.376  21.405 -18.846 1.00 22.26 ? 2339 HOH A O   1 
HETATM 5378 O  O   . HOH H 7 .   ? 0.950   15.219 -16.853 1.00 30.30 ? 2340 HOH A O   1 
HETATM 5379 O  O   . HOH H 7 .   ? -5.077  22.688 -16.624 1.00 32.78 ? 2341 HOH A O   1 
HETATM 5380 O  O   . HOH H 7 .   ? -2.883  8.414  -21.339 1.00 44.01 ? 2342 HOH A O   1 
HETATM 5381 O  O   . HOH H 7 .   ? -7.303  23.200 -4.183  1.00 31.66 ? 2343 HOH A O   1 
HETATM 5382 O  O   . HOH H 7 .   ? -24.453 15.310 -2.104  1.00 41.22 ? 2344 HOH A O   1 
HETATM 5383 O  O   . HOH H 7 .   ? -20.279 9.119  2.049   1.00 36.77 ? 2345 HOH A O   1 
HETATM 5384 O  O   . HOH H 7 .   ? -30.821 13.670 -11.746 1.00 31.94 ? 2346 HOH A O   1 
HETATM 5385 O  O   . HOH H 7 .   ? -30.781 14.926 -9.299  1.00 39.92 ? 2347 HOH A O   1 
HETATM 5386 O  O   . HOH H 7 .   ? -23.340 17.534 -8.990  1.00 49.65 ? 2348 HOH A O   1 
HETATM 5387 O  O   . HOH H 7 .   ? -27.801 16.729 -8.857  1.00 36.82 ? 2349 HOH A O   1 
HETATM 5388 O  O   . HOH H 7 .   ? -21.680 17.398 -5.490  1.00 44.78 ? 2350 HOH A O   1 
HETATM 5389 O  O   . HOH H 7 .   ? -17.487 17.733 -3.982  1.00 37.03 ? 2351 HOH A O   1 
HETATM 5390 O  O   . HOH H 7 .   ? -21.846 16.775 -13.625 1.00 30.02 ? 2352 HOH A O   1 
HETATM 5391 O  O   . HOH H 7 .   ? -15.643 18.271 -17.438 1.00 23.20 ? 2353 HOH A O   1 
HETATM 5392 O  O   . HOH H 7 .   ? -11.229 10.522 -17.789 1.00 28.74 ? 2354 HOH A O   1 
HETATM 5393 O  O   . HOH H 7 .   ? -10.637 21.200 -27.697 1.00 22.44 ? 2355 HOH A O   1 
HETATM 5394 O  O   . HOH H 7 .   ? -3.486  10.228 -23.390 1.00 43.67 ? 2356 HOH A O   1 
HETATM 5395 O  O   . HOH H 7 .   ? -2.823  12.888 -26.049 1.00 27.06 ? 2357 HOH A O   1 
HETATM 5396 O  O   . HOH H 7 .   ? -5.566  12.593 -28.258 1.00 30.68 ? 2358 HOH A O   1 
HETATM 5397 O  O   . HOH H 7 .   ? -8.919  8.607  -27.582 1.00 35.67 ? 2359 HOH A O   1 
HETATM 5398 O  O   . HOH H 7 .   ? -5.970  10.172 -27.351 1.00 38.59 ? 2360 HOH A O   1 
HETATM 5399 O  O   . HOH H 7 .   ? -0.349  11.491 -25.379 1.00 42.88 ? 2361 HOH A O   1 
HETATM 5400 O  O   . HOH H 7 .   ? -4.232  16.095 -32.821 1.00 41.23 ? 2362 HOH A O   1 
HETATM 5401 O  O   . HOH H 7 .   ? -1.279  21.447 -32.958 1.00 36.21 ? 2363 HOH A O   1 
HETATM 5402 O  O   . HOH H 7 .   ? 5.035   21.559 -25.455 1.00 36.38 ? 2364 HOH A O   1 
HETATM 5403 O  O   . HOH H 7 .   ? -1.336  25.493 -21.161 1.00 32.55 ? 2365 HOH A O   1 
HETATM 5404 O  O   . HOH H 7 .   ? 4.011   20.402 -23.335 1.00 48.58 ? 2366 HOH A O   1 
HETATM 5405 O  O   . HOH H 7 .   ? -10.266 25.818 -20.825 1.00 27.01 ? 2367 HOH A O   1 
HETATM 5406 O  O   . HOH H 7 .   ? -8.601  28.447 -25.118 1.00 32.26 ? 2368 HOH A O   1 
HETATM 5407 O  O   . HOH H 7 .   ? -9.848  27.716 -22.635 1.00 31.71 ? 2369 HOH A O   1 
HETATM 5408 O  O   . HOH H 7 .   ? -18.878 28.546 -26.741 1.00 25.59 ? 2370 HOH A O   1 
HETATM 5409 O  O   . HOH H 7 .   ? -12.950 25.765 -17.489 1.00 22.63 ? 2371 HOH A O   1 
HETATM 5410 O  O   . HOH H 7 .   ? -20.371 22.292 -16.259 1.00 23.36 ? 2372 HOH A O   1 
HETATM 5411 O  O   . HOH H 7 .   ? -13.383 25.513 -13.107 1.00 30.61 ? 2373 HOH A O   1 
HETATM 5412 O  O   . HOH H 7 .   ? -24.724 17.012 -16.251 1.00 39.75 ? 2374 HOH A O   1 
HETATM 5413 O  O   . HOH H 7 .   ? -22.461 20.694 -13.304 1.00 31.88 ? 2375 HOH A O   1 
HETATM 5414 O  O   . HOH H 7 .   ? -26.499 15.512 -14.655 1.00 38.39 ? 2376 HOH A O   1 
HETATM 5415 O  O   . HOH H 7 .   ? -30.497 13.114 -19.790 1.00 30.99 ? 2377 HOH A O   1 
HETATM 5416 O  O   . HOH H 7 .   ? -32.129 11.367 -12.176 1.00 27.80 ? 2378 HOH A O   1 
HETATM 5417 O  O   . HOH H 7 .   ? -30.863 14.859 -14.403 1.00 30.84 ? 2379 HOH A O   1 
HETATM 5418 O  O   . HOH H 7 .   ? -35.792 3.635  -18.705 1.00 47.36 ? 2380 HOH A O   1 
HETATM 5419 O  O   . HOH H 7 .   ? -31.929 0.323  -18.464 1.00 34.94 ? 2381 HOH A O   1 
HETATM 5420 O  O   . HOH H 7 .   ? -33.503 7.618  -25.389 1.00 34.57 ? 2382 HOH A O   1 
HETATM 5421 O  O   . HOH H 7 .   ? -30.374 -3.757 -12.307 1.00 40.42 ? 2383 HOH A O   1 
HETATM 5422 O  O   . HOH H 7 .   ? -38.130 0.385  -16.078 1.00 47.95 ? 2384 HOH A O   1 
HETATM 5423 O  O   . HOH H 7 .   ? -32.858 4.215  -6.035  1.00 35.08 ? 2385 HOH A O   1 
HETATM 5424 O  O   . HOH H 7 .   ? -34.799 2.344  -6.428  1.00 30.53 ? 2386 HOH A O   1 
HETATM 5425 O  O   . HOH H 7 .   ? -38.297 3.728  -8.724  1.00 38.23 ? 2387 HOH A O   1 
HETATM 5426 O  O   . HOH H 7 .   ? -42.157 3.001  -10.248 1.00 35.35 ? 2388 HOH A O   1 
HETATM 5427 O  O   . HOH H 7 .   ? -44.544 5.535  -12.621 1.00 38.29 ? 2389 HOH A O   1 
HETATM 5428 O  O   . HOH H 7 .   ? -41.572 5.096  -21.604 1.00 58.86 ? 2390 HOH A O   1 
HETATM 5429 O  O   . HOH H 7 .   ? -36.084 10.221 -18.368 1.00 36.79 ? 2391 HOH A O   1 
HETATM 5430 O  O   . HOH H 7 .   ? -48.077 3.761  -14.618 1.00 44.73 ? 2392 HOH A O   1 
HETATM 5431 O  O   . HOH H 7 .   ? -48.735 8.600  -16.109 1.00 46.21 ? 2393 HOH A O   1 
HETATM 5432 O  O   . HOH H 7 .   ? -44.766 12.942 -20.029 1.00 41.45 ? 2394 HOH A O   1 
HETATM 5433 O  O   . HOH H 7 .   ? -44.688 11.437 -22.241 1.00 46.66 ? 2395 HOH A O   1 
HETATM 5434 O  O   . HOH H 7 .   ? -49.969 10.413 -9.564  1.00 45.23 ? 2396 HOH A O   1 
HETATM 5435 O  O   . HOH H 7 .   ? -37.498 12.480 -18.171 1.00 39.16 ? 2397 HOH A O   1 
HETATM 5436 O  O   . HOH H 7 .   ? -33.340 12.694 -17.678 1.00 43.29 ? 2398 HOH A O   1 
HETATM 5437 O  O   . HOH H 7 .   ? -31.366 17.176 -10.631 1.00 37.94 ? 2399 HOH A O   1 
HETATM 5438 O  O   . HOH H 7 .   ? -16.422 36.075 -17.726 1.00 19.90 ? 2400 HOH A O   1 
HETATM 5439 O  O   . HOH H 7 .   ? -22.440 43.398 -15.617 1.00 19.72 ? 2401 HOH A O   1 
HETATM 5440 O  O   . HOH H 7 .   ? -23.667 42.568 -17.932 1.00 23.10 ? 2402 HOH A O   1 
HETATM 5441 O  O   . HOH H 7 .   ? -27.502 43.533 -16.399 1.00 45.78 ? 2403 HOH A O   1 
HETATM 5442 O  O   . HOH H 7 .   ? -21.424 41.246 -2.251  1.00 19.47 ? 2404 HOH A O   1 
HETATM 5443 O  O   . HOH H 7 .   ? -16.911 49.219 -9.499  1.00 45.49 ? 2405 HOH A O   1 
HETATM 5444 O  O   . HOH H 7 .   ? -24.049 45.350 -11.198 1.00 28.83 ? 2406 HOH A O   1 
HETATM 5445 O  O   . HOH H 7 .   ? -13.863 50.226 -17.231 1.00 45.07 ? 2407 HOH A O   1 
HETATM 5446 O  O   . HOH H 7 .   ? -20.942 45.253 -16.979 1.00 26.91 ? 2408 HOH A O   1 
HETATM 5447 O  O   . HOH H 7 .   ? -19.165 53.787 -10.282 1.00 45.05 ? 2409 HOH A O   1 
HETATM 5448 O  O   . HOH H 7 .   ? -23.243 47.675 -14.768 1.00 29.40 ? 2410 HOH A O   1 
HETATM 5449 O  O   . HOH H 7 .   ? -18.240 50.581 -18.176 1.00 31.50 ? 2411 HOH A O   1 
HETATM 5450 O  O   . HOH H 7 .   ? -20.658 47.548 -19.601 1.00 35.97 ? 2412 HOH A O   1 
HETATM 5451 O  O   . HOH H 7 .   ? -22.990 52.625 -7.546  1.00 35.20 ? 2413 HOH A O   1 
HETATM 5452 O  O   . HOH H 7 .   ? -18.370 54.658 -3.042  1.00 40.94 ? 2414 HOH A O   1 
HETATM 5453 O  O   . HOH H 7 .   ? -15.793 53.263 -5.813  1.00 41.95 ? 2415 HOH A O   1 
HETATM 5454 O  O   . HOH H 7 .   ? -26.155 50.361 -1.440  1.00 33.48 ? 2416 HOH A O   1 
HETATM 5455 O  O   . HOH H 7 .   ? -26.073 49.027 -6.279  1.00 49.83 ? 2417 HOH A O   1 
HETATM 5456 O  O   . HOH H 7 .   ? -26.188 45.381 -9.538  1.00 21.22 ? 2418 HOH A O   1 
HETATM 5457 O  O   . HOH H 7 .   ? -31.717 39.167 -3.917  1.00 20.37 ? 2419 HOH A O   1 
HETATM 5458 O  O   . HOH H 7 .   ? -31.863 43.443 -3.343  1.00 24.34 ? 2420 HOH A O   1 
HETATM 5459 O  O   . HOH H 7 .   ? -33.044 44.575 -8.273  1.00 37.67 ? 2421 HOH A O   1 
HETATM 5460 O  O   . HOH H 7 .   ? -33.627 46.520 -4.553  1.00 32.07 ? 2422 HOH A O   1 
HETATM 5461 O  O   . HOH H 7 .   ? -37.050 42.413 -9.077  1.00 28.07 ? 2423 HOH A O   1 
HETATM 5462 O  O   . HOH H 7 .   ? -33.348 44.022 -5.618  1.00 24.03 ? 2424 HOH A O   1 
HETATM 5463 O  O   . HOH H 7 .   ? -36.737 40.604 -12.806 1.00 34.07 ? 2425 HOH A O   1 
HETATM 5464 O  O   . HOH H 7 .   ? -38.745 41.131 -0.189  1.00 22.26 ? 2426 HOH A O   1 
HETATM 5465 O  O   . HOH H 7 .   ? -36.437 36.253 2.427   1.00 24.29 ? 2427 HOH A O   1 
HETATM 5466 O  O   . HOH H 7 .   ? -37.373 35.470 4.788   1.00 37.58 ? 2428 HOH A O   1 
HETATM 5467 O  O   . HOH H 7 .   ? -33.817 40.344 8.918   1.00 33.69 ? 2429 HOH A O   1 
HETATM 5468 O  O   . HOH H 7 .   ? -25.608 41.319 9.149   1.00 31.69 ? 2430 HOH A O   1 
HETATM 5469 O  O   . HOH H 7 .   ? -26.432 44.368 7.822   1.00 25.30 ? 2431 HOH A O   1 
HETATM 5470 O  O   . HOH H 7 .   ? -26.479 49.790 3.836   1.00 26.87 ? 2432 HOH A O   1 
HETATM 5471 O  O   . HOH H 7 .   ? -22.164 34.607 -2.505  1.00 21.89 ? 2433 HOH A O   1 
HETATM 5472 O  O   . HOH H 7 .   ? -19.451 27.456 -3.406  1.00 23.77 ? 2434 HOH A O   1 
HETATM 5473 O  O   . HOH H 7 .   ? -8.339  31.072 -9.771  1.00 35.58 ? 2435 HOH A O   1 
HETATM 5474 O  O   . HOH H 7 .   ? -6.741  31.918 -5.761  1.00 43.10 ? 2436 HOH A O   1 
HETATM 5475 O  O   . HOH H 7 .   ? -10.381 32.521 -13.426 1.00 26.54 ? 2437 HOH A O   1 
HETATM 5476 O  O   . HOH H 7 .   ? -6.489  33.501 -9.633  1.00 31.09 ? 2438 HOH A O   1 
HETATM 5477 O  O   . HOH H 7 .   ? -9.231  27.572 -13.299 1.00 40.67 ? 2439 HOH A O   1 
HETATM 5478 O  O   . HOH H 7 .   ? -11.370 31.845 -17.805 1.00 26.69 ? 2440 HOH A O   1 
HETATM 5479 O  O   . HOH H 7 .   ? -9.438  29.714 -18.542 1.00 42.23 ? 2441 HOH A O   1 
HETATM 5480 O  O   . HOH H 7 .   ? -8.963  29.484 -15.153 1.00 42.09 ? 2442 HOH A O   1 
HETATM 5481 O  O   . HOH H 7 .   ? -28.271 24.266 -26.011 1.00 22.59 ? 2443 HOH A O   1 
HETATM 5482 O  O   . HOH H 7 .   ? -26.760 19.356 -30.951 1.00 35.46 ? 2444 HOH A O   1 
HETATM 5483 O  O   . HOH H 7 .   ? -26.451 21.868 -31.392 1.00 42.89 ? 2445 HOH A O   1 
HETATM 5484 O  O   . HOH H 7 .   ? -25.050 25.334 -33.707 1.00 29.51 ? 2446 HOH A O   1 
HETATM 5485 O  O   . HOH H 7 .   ? -32.274 19.500 -35.154 1.00 52.34 ? 2447 HOH A O   1 
HETATM 5486 O  O   . HOH H 7 .   ? -25.875 16.420 -34.393 1.00 42.39 ? 2448 HOH A O   1 
HETATM 5487 O  O   . HOH H 7 .   ? -23.356 7.001  -35.572 1.00 39.62 ? 2449 HOH A O   1 
HETATM 5488 O  O   . HOH H 7 .   ? -24.124 14.607 -35.318 1.00 63.70 ? 2450 HOH A O   1 
HETATM 5489 O  O   . HOH H 7 .   ? -37.386 15.774 -28.826 1.00 32.73 ? 2451 HOH A O   1 
HETATM 5490 O  O   . HOH H 7 .   ? -40.937 9.823  -25.944 1.00 41.20 ? 2452 HOH A O   1 
HETATM 5491 O  O   . HOH H 7 .   ? -36.568 5.272  -23.135 1.00 42.90 ? 2453 HOH A O   1 
HETATM 5492 O  O   . HOH H 7 .   ? -36.892 14.193 -26.427 1.00 36.18 ? 2454 HOH A O   1 
HETATM 5493 O  O   . HOH H 7 .   ? -36.564 15.605 -24.166 1.00 27.83 ? 2455 HOH A O   1 
HETATM 5494 O  O   . HOH H 7 .   ? -18.659 9.405  -34.345 1.00 36.16 ? 2456 HOH A O   1 
HETATM 5495 O  O   . HOH H 7 .   ? -9.598  16.451 -34.577 1.00 35.46 ? 2457 HOH A O   1 
HETATM 5496 O  O   . HOH H 7 .   ? -9.245  23.845 -30.635 1.00 20.54 ? 2458 HOH A O   1 
HETATM 5497 O  O   . HOH H 7 .   ? -12.564 21.567 -37.127 1.00 31.72 ? 2459 HOH A O   1 
HETATM 5498 O  O   . HOH H 7 .   ? -13.028 23.785 -38.607 1.00 44.59 ? 2460 HOH A O   1 
HETATM 5499 O  O   . HOH H 7 .   ? -23.095 26.066 -37.577 1.00 35.89 ? 2461 HOH A O   1 
HETATM 5500 O  O   . HOH H 7 .   ? -19.482 30.871 -33.419 1.00 29.55 ? 2462 HOH A O   1 
HETATM 5501 O  O   . HOH H 7 .   ? -28.247 23.807 -30.081 1.00 38.96 ? 2463 HOH A O   1 
HETATM 5502 O  O   . HOH H 7 .   ? -29.526 28.996 -32.675 1.00 53.77 ? 2464 HOH A O   1 
HETATM 5503 O  O   . HOH H 7 .   ? -29.899 29.975 -29.619 1.00 30.14 ? 2465 HOH A O   1 
HETATM 5504 O  O   . HOH H 7 .   ? -35.278 23.853 -29.619 1.00 29.61 ? 2466 HOH A O   1 
HETATM 5505 O  O   . HOH H 7 .   ? -38.270 24.282 -24.114 1.00 29.60 ? 2467 HOH A O   1 
HETATM 5506 O  O   . HOH H 7 .   ? -38.270 18.166 -27.865 1.00 31.02 ? 2468 HOH A O   1 
HETATM 5507 O  O   . HOH H 7 .   ? -44.066 20.469 -27.866 1.00 46.20 ? 2469 HOH A O   1 
HETATM 5508 O  O   . HOH H 7 .   ? -45.494 17.313 -22.147 1.00 34.64 ? 2470 HOH A O   1 
HETATM 5509 O  O   . HOH H 7 .   ? -47.575 25.722 -24.001 1.00 41.39 ? 2471 HOH A O   1 
HETATM 5510 O  O   . HOH H 7 .   ? -44.475 30.038 -24.037 1.00 45.44 ? 2472 HOH A O   1 
HETATM 5511 O  O   . HOH H 7 .   ? -48.960 24.018 -22.445 1.00 27.30 ? 2473 HOH A O   1 
HETATM 5512 O  O   . HOH H 7 .   ? -50.251 20.327 -17.059 1.00 36.63 ? 2474 HOH A O   1 
HETATM 5513 O  O   . HOH H 7 .   ? -49.361 28.403 -22.185 1.00 39.87 ? 2475 HOH A O   1 
HETATM 5514 O  O   . HOH H 7 .   ? -50.640 25.974 -21.526 1.00 35.23 ? 2476 HOH A O   1 
HETATM 5515 O  O   . HOH H 7 .   ? -54.042 24.448 -18.300 1.00 29.38 ? 2477 HOH A O   1 
HETATM 5516 O  O   . HOH H 7 .   ? -50.217 31.012 -14.137 1.00 35.78 ? 2478 HOH A O   1 
HETATM 5517 O  O   . HOH H 7 .   ? -51.395 29.232 -7.308  1.00 29.87 ? 2479 HOH A O   1 
HETATM 5518 O  O   . HOH H 7 .   ? -45.602 39.423 -11.748 1.00 45.47 ? 2480 HOH A O   1 
HETATM 5519 O  O   . HOH H 7 .   ? -48.913 35.439 -13.053 1.00 33.87 ? 2481 HOH A O   1 
HETATM 5520 O  O   . HOH H 7 .   ? -40.965 39.774 -12.111 1.00 36.37 ? 2482 HOH A O   1 
HETATM 5521 O  O   . HOH H 7 .   ? -44.368 41.205 -10.176 1.00 45.82 ? 2483 HOH A O   1 
HETATM 5522 O  O   . HOH H 7 .   ? -40.804 42.351 -2.464  1.00 28.93 ? 2484 HOH A O   1 
HETATM 5523 O  O   . HOH H 7 .   ? -41.798 45.678 -7.036  1.00 34.73 ? 2485 HOH A O   1 
HETATM 5524 O  O   . HOH H 7 .   ? -35.611 47.617 -3.121  1.00 44.79 ? 2486 HOH A O   1 
HETATM 5525 O  O   . HOH H 7 .   ? -33.528 45.189 -1.325  1.00 30.27 ? 2487 HOH A O   1 
HETATM 5526 O  O   . HOH H 7 .   ? -32.341 41.181 -1.983  1.00 18.45 ? 2488 HOH A O   1 
HETATM 5527 O  O   . HOH H 7 .   ? -36.495 45.230 4.727   1.00 21.98 ? 2489 HOH A O   1 
HETATM 5528 O  O   . HOH H 7 .   ? -37.777 43.182 6.156   1.00 34.71 ? 2490 HOH A O   1 
HETATM 5529 O  O   . HOH H 7 .   ? -39.559 37.821 4.329   1.00 50.04 ? 2491 HOH A O   1 
HETATM 5530 O  O   . HOH H 7 .   ? -34.039 47.642 -0.238  1.00 47.05 ? 2492 HOH A O   1 
HETATM 5531 O  O   . HOH H 7 .   ? -32.935 50.375 1.022   1.00 39.69 ? 2493 HOH A O   1 
HETATM 5532 O  O   . HOH H 7 .   ? 3.621   52.923 -22.608 1.00 47.90 ? 2494 HOH A O   1 
HETATM 5533 O  O   . HOH H 7 .   ? 6.680   55.459 -30.029 1.00 35.78 ? 2495 HOH A O   1 
HETATM 5534 O  O   . HOH H 7 .   ? 8.541   52.842 -35.678 1.00 40.82 ? 2496 HOH A O   1 
HETATM 5535 O  O   . HOH H 7 .   ? 5.894   62.679 -26.847 1.00 60.50 ? 2497 HOH A O   1 
HETATM 5536 O  O   . HOH H 7 .   ? -11.916 7.550  -30.836 1.00 39.54 ? 2498 HOH A O   1 
HETATM 5537 O  O   . HOH H 7 .   ? -10.346 26.461 -18.208 1.00 34.17 ? 2499 HOH A O   1 
HETATM 5538 O  O   . HOH I 7 .   ? -21.592 21.630 -7.929  1.00 29.32 ? 2001 HOH P O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 1   ? 0.5338 0.5015 0.5795 0.0070  0.0801  0.0936  17   ALA A N   
2    C CA  . ALA A 1   ? 0.5364 0.5038 0.5721 0.0075  0.0830  0.0875  17   ALA A CA  
3    C C   . ALA A 1   ? 0.5308 0.4976 0.5645 0.0072  0.0795  0.0824  17   ALA A C   
4    O O   . ALA A 1   ? 0.5254 0.4921 0.5667 0.0070  0.0790  0.0829  17   ALA A O   
5    C CB  . ALA A 1   ? 0.5417 0.5094 0.5791 0.0080  0.0913  0.0867  17   ALA A CB  
6    N N   . LEU A 2   ? 0.5305 0.4973 0.5540 0.0073  0.0770  0.0779  18   LEU A N   
7    C CA  . LEU A 2   ? 0.5256 0.4920 0.5462 0.0070  0.0737  0.0729  18   LEU A CA  
8    C C   . LEU A 2   ? 0.5245 0.4906 0.5455 0.0069  0.0790  0.0683  18   LEU A C   
9    O O   . LEU A 2   ? 0.5202 0.4857 0.5439 0.0067  0.0774  0.0658  18   LEU A O   
10   C CB  . LEU A 2   ? 0.5276 0.4946 0.5376 0.0071  0.0696  0.0699  18   LEU A CB  
11   C CG  . LEU A 2   ? 0.5267 0.4931 0.5366 0.0072  0.0631  0.0732  18   LEU A CG  
12   C CD1 . LEU A 2   ? 0.5301 0.4978 0.5298 0.0078  0.0612  0.0718  18   LEU A CD1 
13   C CD2 . LEU A 2   ? 0.5215 0.4868 0.5352 0.0067  0.0578  0.0720  18   LEU A CD2 
14   N N   . VAL A 3   ? 0.5282 0.4947 0.5467 0.0071  0.0856  0.0671  19   VAL A N   
15   C CA  . VAL A 3   ? 0.5281 0.4938 0.5474 0.0069  0.0918  0.0625  19   VAL A CA  
16   C C   . VAL A 3   ? 0.5210 0.4856 0.5526 0.0073  0.0942  0.0656  19   VAL A C   
17   O O   . VAL A 3   ? 0.5193 0.4830 0.5537 0.0072  0.0956  0.0624  19   VAL A O   
18   C CB  . VAL A 3   ? 0.5367 0.5032 0.5507 0.0068  0.0987  0.0607  19   VAL A CB  
19   C CG1 . VAL A 3   ? 0.5407 0.5058 0.5564 0.0064  0.1058  0.0557  19   VAL A CG1 
20   C CG2 . VAL A 3   ? 0.5414 0.5100 0.5429 0.0065  0.0962  0.0578  19   VAL A CG2 
21   N N   . LYS A 4   ? 0.5165 0.4817 0.5558 0.0077  0.0947  0.0721  20   LYS A N   
22   C CA  . LYS A 4   ? 0.5092 0.4745 0.5609 0.0081  0.0965  0.0762  20   LYS A CA  
23   C C   . LYS A 4   ? 0.4951 0.4610 0.5508 0.0078  0.0899  0.0769  20   LYS A C   
24   O O   . LYS A 4   ? 0.4902 0.4561 0.5529 0.0082  0.0915  0.0770  20   LYS A O   
25   C CB  . LYS A 4   ? 0.5121 0.4786 0.5709 0.0084  0.0980  0.0831  20   LYS A CB  
26   C CG  . LYS A 4   ? 0.5220 0.4895 0.5941 0.0090  0.1010  0.0877  20   LYS A CG  
27   C CD  . LYS A 4   ? 0.5408 0.5098 0.6199 0.0091  0.1022  0.0946  20   LYS A CD  
28   C CE  . LYS A 4   ? 0.5464 0.5174 0.6393 0.0097  0.1048  0.0995  20   LYS A CE  
29   N NZ  . LYS A 4   ? 0.5556 0.5287 0.6562 0.0097  0.1059  0.1064  20   LYS A NZ  
30   N N   . GLU A 5   ? 0.4852 0.4514 0.5363 0.0073  0.0828  0.0774  21   GLU A N   
31   C CA  . GLU A 5   ? 0.4726 0.4395 0.5266 0.0068  0.0762  0.0780  21   GLU A CA  
32   C C   . GLU A 5   ? 0.4656 0.4316 0.5157 0.0069  0.0756  0.0723  21   GLU A C   
33   O O   . GLU A 5   ? 0.4591 0.4259 0.5149 0.0069  0.0735  0.0730  21   GLU A O   
34   C CB  . GLU A 5   ? 0.4720 0.4389 0.5217 0.0062  0.0694  0.0794  21   GLU A CB  
35   C CG  . GLU A 5   ? 0.4674 0.4352 0.5214 0.0054  0.0628  0.0809  21   GLU A CG  
36   C CD  . GLU A 5   ? 0.4705 0.4375 0.5191 0.0048  0.0565  0.0807  21   GLU A CD  
37   O OE1 . GLU A 5   ? 0.4724 0.4396 0.5236 0.0043  0.0554  0.0849  21   GLU A OE1 
38   O OE2 . GLU A 5   ? 0.4688 0.4350 0.5111 0.0048  0.0529  0.0766  21   GLU A OE2 
39   N N   . GLU A 6   ? 0.4636 0.4286 0.5043 0.0068  0.0774  0.0668  22   GLU A N   
40   C CA  . GLU A 6   ? 0.4578 0.4220 0.4947 0.0067  0.0772  0.0609  22   GLU A CA  
41   C C   . GLU A 6   ? 0.4552 0.4187 0.4996 0.0071  0.0832  0.0603  22   GLU A C   
42   O O   . GLU A 6   ? 0.4494 0.4126 0.4956 0.0071  0.0820  0.0580  22   GLU A O   
43   C CB  . GLU A 6   ? 0.4620 0.4260 0.4874 0.0063  0.0781  0.0552  22   GLU A CB  
44   C CG  . GLU A 6   ? 0.4584 0.4221 0.4788 0.0059  0.0754  0.0495  22   GLU A CG  
45   C CD  . GLU A 6   ? 0.4611 0.4256 0.4700 0.0053  0.0750  0.0443  22   GLU A CD  
46   O OE1 . GLU A 6   ? 0.4589 0.4246 0.4625 0.0054  0.0741  0.0459  22   GLU A OE1 
47   O OE2 . GLU A 6   ? 0.4574 0.4220 0.4629 0.0047  0.0754  0.0387  22   GLU A OE2 
48   N N   . ILE A 7   ? 0.4563 0.4195 0.5056 0.0075  0.0897  0.0625  23   ILE A N   
49   C CA  . ILE A 7   ? 0.4556 0.4180 0.5140 0.0082  0.0960  0.0631  23   ILE A CA  
50   C C   . ILE A 7   ? 0.4485 0.4128 0.5173 0.0088  0.0928  0.0687  23   ILE A C   
51   O O   . ILE A 7   ? 0.4455 0.4097 0.5193 0.0093  0.0939  0.0680  23   ILE A O   
52   C CB  . ILE A 7   ? 0.4619 0.4236 0.5235 0.0087  0.1040  0.0647  23   ILE A CB  
53   C CG1 . ILE A 7   ? 0.4694 0.4297 0.5203 0.0079  0.1078  0.0583  23   ILE A CG1 
54   C CG2 . ILE A 7   ? 0.4608 0.4217 0.5337 0.0097  0.1105  0.0665  23   ILE A CG2 
55   C CD1 . ILE A 7   ? 0.4802 0.4403 0.5316 0.0082  0.1144  0.0599  23   ILE A CD1 
56   N N   . GLN A 8   ? 0.4461 0.4125 0.5181 0.0087  0.0886  0.0743  24   GLN A N   
57   C CA  . GLN A 8   ? 0.4417 0.4110 0.5229 0.0088  0.0846  0.0798  24   GLN A CA  
58   C C   . GLN A 8   ? 0.4345 0.4044 0.5125 0.0083  0.0781  0.0774  24   GLN A C   
59   O O   . GLN A 8   ? 0.4290 0.4011 0.5141 0.0087  0.0768  0.0799  24   GLN A O   
60   C CB  . GLN A 8   ? 0.4422 0.4136 0.5264 0.0082  0.0812  0.0854  24   GLN A CB  
61   C CG  . GLN A 8   ? 0.4605 0.4322 0.5505 0.0088  0.0876  0.0893  24   GLN A CG  
62   C CD  . GLN A 8   ? 0.4772 0.4504 0.5685 0.0080  0.0843  0.0940  24   GLN A CD  
63   O OE1 . GLN A 8   ? 0.4862 0.4589 0.5710 0.0070  0.0784  0.0928  24   GLN A OE1 
64   N NE2 . GLN A 8   ? 0.4886 0.4636 0.5890 0.0084  0.0883  0.0994  24   GLN A NE2 
65   N N   . ALA A 9   ? 0.4322 0.4006 0.4997 0.0076  0.0741  0.0728  25   ALA A N   
66   C CA  . ALA A 9   ? 0.4265 0.3951 0.4898 0.0072  0.0681  0.0700  25   ALA A CA  
67   C C   . ALA A 9   ? 0.4250 0.3928 0.4894 0.0078  0.0711  0.0664  25   ALA A C   
68   O O   . ALA A 9   ? 0.4207 0.3899 0.4875 0.0079  0.0675  0.0668  25   ALA A O   
69   C CB  . ALA A 9   ? 0.4278 0.3949 0.4800 0.0066  0.0641  0.0661  25   ALA A CB  
70   N N   . LYS A 10  ? 0.4289 0.3945 0.4917 0.0081  0.0778  0.0628  26   LYS A N   
71   C CA  . LYS A 10  ? 0.4311 0.3955 0.4958 0.0085  0.0819  0.0592  26   LYS A CA  
72   C C   . LYS A 10  ? 0.4264 0.3925 0.5034 0.0096  0.0842  0.0644  26   LYS A C   
73   O O   . LYS A 10  ? 0.4204 0.3869 0.4999 0.0099  0.0834  0.0636  26   LYS A O   
74   C CB  . LYS A 10  ? 0.4396 0.4012 0.5008 0.0082  0.0893  0.0544  26   LYS A CB  
75   C CG  . LYS A 10  ? 0.4498 0.4095 0.5109 0.0081  0.0933  0.0489  26   LYS A CG  
76   C CD  . LYS A 10  ? 0.4755 0.4327 0.5324 0.0074  0.1005  0.0436  26   LYS A CD  
77   C CE  . LYS A 10  ? 0.4925 0.4476 0.5486 0.0068  0.1042  0.0372  26   LYS A CE  
78   N NZ  . LYS A 10  ? 0.5135 0.4664 0.5650 0.0057  0.1112  0.0313  26   LYS A NZ  
79   N N   . GLU A 11  ? 0.4255 0.3929 0.5100 0.0102  0.0870  0.0700  27   GLU A N   
80   C CA  . GLU A 11  ? 0.4230 0.3931 0.5199 0.0113  0.0890  0.0761  27   GLU A CA  
81   C C   . GLU A 11  ? 0.4116 0.3858 0.5108 0.0110  0.0811  0.0799  27   GLU A C   
82   O O   . GLU A 11  ? 0.4063 0.3831 0.5127 0.0118  0.0811  0.0828  27   GLU A O   
83   C CB  . GLU A 11  ? 0.4288 0.3999 0.5331 0.0119  0.0937  0.0813  27   GLU A CB  
84   C CG  . GLU A 11  ? 0.4527 0.4199 0.5559 0.0123  0.1024  0.0779  27   GLU A CG  
85   C CD  . GLU A 11  ? 0.4798 0.4481 0.5905 0.0131  0.1072  0.0832  27   GLU A CD  
86   O OE1 . GLU A 11  ? 0.4883 0.4598 0.6105 0.0142  0.1082  0.0898  27   GLU A OE1 
87   O OE2 . GLU A 11  ? 0.4925 0.4588 0.5977 0.0126  0.1101  0.0811  27   GLU A OE2 
88   N N   . TYR A 12  ? 0.4056 0.3806 0.4987 0.0098  0.0746  0.0799  28   TYR A N   
89   C CA  . TYR A 12  ? 0.3983 0.3768 0.4919 0.0090  0.0668  0.0823  28   TYR A CA  
90   C C   . TYR A 12  ? 0.3926 0.3707 0.4824 0.0091  0.0641  0.0784  28   TYR A C   
91   O O   . TYR A 12  ? 0.3857 0.3674 0.4806 0.0093  0.0613  0.0814  28   TYR A O   
92   C CB  . TYR A 12  ? 0.3991 0.3771 0.4861 0.0076  0.0611  0.0819  28   TYR A CB  
93   C CG  . TYR A 12  ? 0.3984 0.3791 0.4841 0.0065  0.0531  0.0826  28   TYR A CG  
94   C CD1 . TYR A 12  ? 0.4033 0.3886 0.4966 0.0057  0.0499  0.0884  28   TYR A CD1 
95   C CD2 . TYR A 12  ? 0.4019 0.3807 0.4786 0.0060  0.0488  0.0775  28   TYR A CD2 
96   C CE1 . TYR A 12  ? 0.4046 0.3925 0.4964 0.0044  0.0428  0.0885  28   TYR A CE1 
97   C CE2 . TYR A 12  ? 0.4057 0.3866 0.4811 0.0050  0.0419  0.0778  28   TYR A CE2 
98   C CZ  . TYR A 12  ? 0.4096 0.3950 0.4923 0.0041  0.0389  0.0831  28   TYR A CZ  
99   O OH  . TYR A 12  ? 0.4169 0.4044 0.4978 0.0028  0.0322  0.0829  28   TYR A OH  
100  N N   . LEU A 13  ? 0.3924 0.3667 0.4733 0.0089  0.0651  0.0719  29   LEU A N   
101  C CA  . LEU A 13  ? 0.3910 0.3647 0.4676 0.0090  0.0628  0.0676  29   LEU A CA  
102  C C   . LEU A 13  ? 0.3920 0.3663 0.4762 0.0102  0.0674  0.0686  29   LEU A C   
103  O O   . LEU A 13  ? 0.3870 0.3633 0.4725 0.0104  0.0643  0.0691  29   LEU A O   
104  C CB  . LEU A 13  ? 0.3924 0.3623 0.4583 0.0084  0.0632  0.0605  29   LEU A CB  
105  C CG  . LEU A 13  ? 0.3927 0.3620 0.4496 0.0074  0.0576  0.0587  29   LEU A CG  
106  C CD1 . LEU A 13  ? 0.3944 0.3610 0.4421 0.0071  0.0595  0.0524  29   LEU A CD1 
107  C CD2 . LEU A 13  ? 0.3861 0.3572 0.4408 0.0070  0.0501  0.0590  29   LEU A CD2 
108  N N   . GLU A 14  ? 0.3972 0.3697 0.4866 0.0110  0.0752  0.0690  30   GLU A N   
109  C CA  . GLU A 14  ? 0.4021 0.3745 0.4994 0.0123  0.0806  0.0700  30   GLU A CA  
110  C C   . GLU A 14  ? 0.3940 0.3716 0.5014 0.0133  0.0786  0.0775  30   GLU A C   
111  O O   . GLU A 14  ? 0.3927 0.3718 0.5038 0.0141  0.0787  0.0783  30   GLU A O   
112  C CB  . GLU A 14  ? 0.4103 0.3794 0.5116 0.0129  0.0899  0.0687  30   GLU A CB  
113  C CG  . GLU A 14  ? 0.4359 0.4027 0.5417 0.0137  0.0959  0.0663  30   GLU A CG  
114  C CD  . GLU A 14  ? 0.4687 0.4320 0.5797 0.0143  0.1057  0.0652  30   GLU A CD  
115  O OE1 . GLU A 14  ? 0.4865 0.4482 0.5940 0.0137  0.1079  0.0637  30   GLU A OE1 
116  O OE2 . GLU A 14  ? 0.4826 0.4446 0.6016 0.0155  0.1114  0.0658  30   GLU A OE2 
117  N N   . ASN A 15  ? 0.3910 0.3718 0.5026 0.0131  0.0767  0.0831  31   ASN A N   
118  C CA  A ASN A 15  ? 0.3861 0.3732 0.5070 0.0138  0.0740  0.0905  31   ASN A CA  
119  C CA  B ASN A 15  ? 0.3866 0.3737 0.5075 0.0137  0.0740  0.0905  31   ASN A CA  
120  C C   . ASN A 15  ? 0.3813 0.3717 0.4977 0.0128  0.0656  0.0902  31   ASN A C   
121  O O   . ASN A 15  ? 0.3770 0.3717 0.4988 0.0135  0.0643  0.0938  31   ASN A O   
122  C CB  A ASN A 15  ? 0.3865 0.3764 0.5129 0.0135  0.0740  0.0961  31   ASN A CB  
123  C CB  B ASN A 15  ? 0.3875 0.3774 0.5136 0.0134  0.0738  0.0960  31   ASN A CB  
124  C CG  A ASN A 15  ? 0.3902 0.3781 0.5240 0.0149  0.0829  0.0981  31   ASN A CG  
125  C CG  B ASN A 15  ? 0.3859 0.3832 0.5215 0.0137  0.0706  0.1038  31   ASN A CG  
126  O OD1 A ASN A 15  ? 0.3922 0.3785 0.5312 0.0164  0.0891  0.0979  31   ASN A OD1 
127  O OD1 B ASN A 15  ? 0.3889 0.3892 0.5328 0.0153  0.0736  0.1076  31   ASN A OD1 
128  N ND2 A ASN A 15  ? 0.3909 0.3787 0.5255 0.0144  0.0840  0.1000  31   ASN A ND2 
129  N ND2 B ASN A 15  ? 0.3892 0.3900 0.5239 0.0121  0.0646  0.1063  31   ASN A ND2 
130  N N   . LEU A 16  ? 0.3788 0.3673 0.4852 0.0111  0.0602  0.0861  32   LEU A N   
131  C CA  . LEU A 16  ? 0.3748 0.3658 0.4761 0.0100  0.0523  0.0850  32   LEU A CA  
132  C C   . LEU A 16  ? 0.3713 0.3612 0.4693 0.0107  0.0521  0.0813  32   LEU A C   
133  O O   . LEU A 16  ? 0.3674 0.3615 0.4670 0.0107  0.0481  0.0834  32   LEU A O   
134  C CB  . LEU A 16  ? 0.3751 0.3636 0.4671 0.0084  0.0475  0.0815  32   LEU A CB  
135  C CG  . LEU A 16  ? 0.3766 0.3670 0.4632 0.0070  0.0395  0.0801  32   LEU A CG  
136  C CD1 . LEU A 16  ? 0.3750 0.3720 0.4687 0.0062  0.0356  0.0861  32   LEU A CD1 
137  C CD2 . LEU A 16  ? 0.3828 0.3695 0.4605 0.0058  0.0362  0.0763  32   LEU A CD2 
138  N N   . ASN A 17  ? 0.3719 0.3567 0.4654 0.0111  0.0564  0.0757  33   ASN A N   
139  C CA  . ASN A 17  ? 0.3716 0.3551 0.4628 0.0116  0.0571  0.0720  33   ASN A CA  
140  C C   . ASN A 17  ? 0.3701 0.3574 0.4715 0.0132  0.0599  0.0771  33   ASN A C   
141  O O   . ASN A 17  ? 0.3683 0.3579 0.4692 0.0134  0.0568  0.0773  33   ASN A O   
142  C CB  . ASN A 17  ? 0.3735 0.3514 0.4600 0.0116  0.0624  0.0656  33   ASN A CB  
143  C CG  . ASN A 17  ? 0.3732 0.3485 0.4479 0.0103  0.0581  0.0596  33   ASN A CG  
144  O OD1 . ASN A 17  ? 0.3837 0.3562 0.4542 0.0097  0.0602  0.0570  33   ASN A OD1 
145  N ND2 . ASN A 17  ? 0.3595 0.3358 0.4290 0.0099  0.0524  0.0576  33   ASN A ND2 
146  N N   . LYS A 18  ? 0.3715 0.3594 0.4822 0.0143  0.0658  0.0816  34   LYS A N   
147  C CA  . LYS A 18  ? 0.3711 0.3629 0.4928 0.0161  0.0691  0.0876  34   LYS A CA  
148  C C   . LYS A 18  ? 0.3642 0.3637 0.4894 0.0160  0.0627  0.0938  34   LYS A C   
149  O O   . LYS A 18  ? 0.3629 0.3663 0.4925 0.0170  0.0622  0.0970  34   LYS A O   
150  C CB  . LYS A 18  ? 0.3771 0.3677 0.5083 0.0175  0.0773  0.0911  34   LYS A CB  
151  C CG  . LYS A 18  ? 0.3920 0.3756 0.5214 0.0177  0.0848  0.0850  34   LYS A CG  
152  C CD  . LYS A 18  ? 0.4123 0.3945 0.5519 0.0192  0.0936  0.0885  34   LYS A CD  
153  C CE  . LYS A 18  ? 0.4243 0.4055 0.5624 0.0184  0.0943  0.0889  34   LYS A CE  
154  N NZ  . LYS A 18  ? 0.4367 0.4143 0.5819 0.0196  0.1041  0.0893  34   LYS A NZ  
155  N N   . GLU A 19  ? 0.3589 0.3607 0.4819 0.0145  0.0579  0.0954  35   GLU A N   
156  C CA  . GLU A 19  ? 0.3526 0.3617 0.4775 0.0136  0.0511  0.1002  35   GLU A CA  
157  C C   . GLU A 19  ? 0.3468 0.3567 0.4636 0.0127  0.0449  0.0964  35   GLU A C   
158  O O   . GLU A 19  ? 0.3423 0.3584 0.4622 0.0129  0.0417  0.1002  35   GLU A O   
159  C CB  . GLU A 19  ? 0.3543 0.3649 0.4786 0.0119  0.0477  0.1019  35   GLU A CB  
160  C CG  . GLU A 19  ? 0.3598 0.3773 0.4840 0.0102  0.0399  0.1050  35   GLU A CG  
161  C CD  . GLU A 19  ? 0.3730 0.3944 0.5026 0.0090  0.0385  0.1098  35   GLU A CD  
162  O OE1 . GLU A 19  ? 0.3836 0.4008 0.5132 0.0089  0.0418  0.1089  35   GLU A OE1 
163  O OE2 . GLU A 19  ? 0.3800 0.4092 0.5139 0.0080  0.0339  0.1145  35   GLU A OE2 
164  N N   . LEU A 20  ? 0.3430 0.3471 0.4495 0.0117  0.0432  0.0892  36   LEU A N   
165  C CA  . LEU A 20  ? 0.3406 0.3446 0.4390 0.0110  0.0378  0.0850  36   LEU A CA  
166  C C   . LEU A 20  ? 0.3392 0.3441 0.4399 0.0125  0.0403  0.0850  36   LEU A C   
167  O O   . LEU A 20  ? 0.3362 0.3449 0.4350 0.0123  0.0358  0.0855  36   LEU A O   
168  C CB  . LEU A 20  ? 0.3411 0.3388 0.4289 0.0099  0.0363  0.0777  36   LEU A CB  
169  C CG  . LEU A 20  ? 0.3429 0.3398 0.4265 0.0082  0.0321  0.0772  36   LEU A CG  
170  C CD1 . LEU A 20  ? 0.3431 0.3337 0.4177 0.0077  0.0324  0.0709  36   LEU A CD1 
171  C CD2 . LEU A 20  ? 0.3423 0.3436 0.4237 0.0067  0.0247  0.0783  36   LEU A CD2 
172  N N   . ALA A 21  ? 0.3412 0.3425 0.4462 0.0140  0.0475  0.0843  37   ALA A N   
173  C CA  . ALA A 21  ? 0.3429 0.3446 0.4516 0.0156  0.0510  0.0846  37   ALA A CA  
174  C C   . ALA A 21  ? 0.3420 0.3515 0.4596 0.0168  0.0502  0.0926  37   ALA A C   
175  O O   . ALA A 21  ? 0.3401 0.3527 0.4572 0.0173  0.0481  0.0934  37   ALA A O   
176  C CB  . ALA A 21  ? 0.3459 0.3421 0.4586 0.0167  0.0596  0.0826  37   ALA A CB  
177  N N   . LYS A 22  ? 0.3437 0.3568 0.4692 0.0172  0.0516  0.0989  38   LYS A N   
178  C CA  . LYS A 22  ? 0.3450 0.3666 0.4800 0.0184  0.0511  0.1074  38   LYS A CA  
179  C C   . LYS A 22  ? 0.3443 0.3729 0.4749 0.0168  0.0425  0.1088  38   LYS A C   
180  O O   . LYS A 22  ? 0.3432 0.3783 0.4774 0.0177  0.0410  0.1132  38   LYS A O   
181  C CB  . LYS A 22  ? 0.3457 0.3696 0.4904 0.0191  0.0549  0.1134  38   LYS A CB  
182  C CG  . LYS A 22  ? 0.3462 0.3783 0.5031 0.0211  0.0569  0.1228  38   LYS A CG  
183  C CD  . LYS A 22  ? 0.3395 0.3696 0.5027 0.0237  0.0639  0.1240  38   LYS A CD  
184  C CE  . LYS A 22  ? 0.3407 0.3771 0.5182 0.0261  0.0684  0.1339  38   LYS A CE  
185  N NZ  . LYS A 22  ? 0.3349 0.3731 0.5185 0.0286  0.0723  0.1373  38   LYS A NZ  
186  N N   . ARG A 23  ? 0.3458 0.3730 0.4688 0.0144  0.0370  0.1052  39   ARG A N   
187  C CA  . ARG A 23  ? 0.3478 0.3805 0.4656 0.0124  0.0289  0.1051  39   ARG A CA  
188  C C   . ARG A 23  ? 0.3496 0.3809 0.4595 0.0124  0.0261  0.1003  39   ARG A C   
189  O O   . ARG A 23  ? 0.3491 0.3869 0.4579 0.0118  0.0214  0.1023  39   ARG A O   
190  C CB  . ARG A 23  ? 0.3484 0.3788 0.4605 0.0099  0.0247  0.1020  39   ARG A CB  
191  C CG  . ARG A 23  ? 0.3487 0.3830 0.4687 0.0094  0.0254  0.1078  39   ARG A CG  
192  C CD  . ARG A 23  ? 0.3523 0.3827 0.4666 0.0071  0.0222  0.1041  39   ARG A CD  
193  N NE  . ARG A 23  ? 0.3502 0.3845 0.4723 0.0065  0.0230  0.1096  39   ARG A NE  
194  C CZ  . ARG A 23  ? 0.3520 0.3938 0.4772 0.0045  0.0179  0.1135  39   ARG A CZ  
195  N NH1 . ARG A 23  ? 0.3478 0.3941 0.4686 0.0029  0.0117  0.1123  39   ARG A NH1 
196  N NH2 . ARG A 23  ? 0.3558 0.4009 0.4886 0.0040  0.0191  0.1185  39   ARG A NH2 
197  N N   . THR A 24  ? 0.3533 0.3766 0.4577 0.0129  0.0291  0.0940  40   THR A N   
198  C CA  . THR A 24  ? 0.3570 0.3785 0.4544 0.0130  0.0271  0.0891  40   THR A CA  
199  C C   . THR A 24  ? 0.3581 0.3836 0.4617 0.0151  0.0302  0.0933  40   THR A C   
200  O O   . THR A 24  ? 0.3603 0.3886 0.4602 0.0151  0.0269  0.0925  40   THR A O   
201  C CB  . THR A 24  ? 0.3580 0.3705 0.4481 0.0129  0.0294  0.0814  40   THR A CB  
202  O OG1 . THR A 24  ? 0.3595 0.3688 0.4446 0.0112  0.0269  0.0786  40   THR A OG1 
203  C CG2 . THR A 24  ? 0.3609 0.3721 0.4433 0.0127  0.0264  0.0763  40   THR A CG2 
204  N N   . ASN A 25  ? 0.3594 0.3851 0.4728 0.0170  0.0368  0.0978  41   ASN A N   
205  C CA  . ASN A 25  ? 0.3591 0.3891 0.4806 0.0192  0.0404  0.1033  41   ASN A CA  
206  C C   . ASN A 25  ? 0.3589 0.3990 0.4818 0.0190  0.0349  0.1091  41   ASN A C   
207  O O   . ASN A 25  ? 0.3573 0.4006 0.4797 0.0199  0.0342  0.1100  41   ASN A O   
208  C CB  . ASN A 25  ? 0.3594 0.3887 0.4924 0.0212  0.0481  0.1084  41   ASN A CB  
209  C CG  . ASN A 25  ? 0.3586 0.3932 0.5015 0.0237  0.0520  0.1154  41   ASN A CG  
210  O OD1 . ASN A 25  ? 0.3603 0.3915 0.5037 0.0249  0.0559  0.1133  41   ASN A OD1 
211  N ND2 . ASN A 25  ? 0.3517 0.3950 0.5026 0.0245  0.0510  0.1240  41   ASN A ND2 
212  N N   . VAL A 26  ? 0.3592 0.4047 0.4839 0.0176  0.0310  0.1127  42   VAL A N   
213  C CA  . VAL A 26  ? 0.3601 0.4163 0.4861 0.0169  0.0253  0.1181  42   VAL A CA  
214  C C   . VAL A 26  ? 0.3586 0.4155 0.4736 0.0151  0.0188  0.1128  42   VAL A C   
215  O O   . VAL A 26  ? 0.3546 0.4184 0.4698 0.0156  0.0164  0.1159  42   VAL A O   
216  C CB  . VAL A 26  ? 0.3624 0.4238 0.4922 0.0152  0.0224  0.1223  42   VAL A CB  
217  C CG1 . VAL A 26  ? 0.3658 0.4390 0.4966 0.0140  0.0162  0.1274  42   VAL A CG1 
218  C CG2 . VAL A 26  ? 0.3644 0.4257 0.5058 0.0172  0.0291  0.1281  42   VAL A CG2 
219  N N   . GLU A 27  ? 0.3578 0.4076 0.4635 0.0132  0.0161  0.1052  43   GLU A N   
220  C CA  . GLU A 27  ? 0.3580 0.4071 0.4534 0.0116  0.0105  0.0994  43   GLU A CA  
221  C C   . GLU A 27  ? 0.3552 0.4024 0.4486 0.0135  0.0130  0.0974  43   GLU A C   
222  O O   . GLU A 27  ? 0.3538 0.4055 0.4431 0.0131  0.0093  0.0972  43   GLU A O   
223  C CB  . GLU A 27  ? 0.3611 0.4021 0.4480 0.0097  0.0083  0.0920  43   GLU A CB  
224  C CG  . GLU A 27  ? 0.3730 0.4131 0.4496 0.0081  0.0025  0.0862  43   GLU A CG  
225  C CD  . GLU A 27  ? 0.3937 0.4248 0.4625 0.0071  0.0018  0.0788  43   GLU A CD  
226  O OE1 . GLU A 27  ? 0.3986 0.4232 0.4677 0.0084  0.0064  0.0764  43   GLU A OE1 
227  O OE2 . GLU A 27  ? 0.3989 0.4297 0.4613 0.0050  -0.0033 0.0753  43   GLU A OE2 
228  N N   . THR A 28  ? 0.3531 0.3936 0.4493 0.0152  0.0193  0.0958  44   THR A N   
229  C CA  . THR A 28  ? 0.3534 0.3913 0.4486 0.0169  0.0225  0.0935  44   THR A CA  
230  C C   . THR A 28  ? 0.3532 0.3992 0.4554 0.0187  0.0237  0.1008  44   THR A C   
231  O O   . THR A 28  ? 0.3518 0.3994 0.4505 0.0192  0.0225  0.0996  44   THR A O   
232  C CB  . THR A 28  ? 0.3524 0.3818 0.4502 0.0180  0.0295  0.0903  44   THR A CB  
233  O OG1 . THR A 28  ? 0.3531 0.3761 0.4445 0.0163  0.0281  0.0843  44   THR A OG1 
234  C CG2 . THR A 28  ? 0.3558 0.3818 0.4514 0.0191  0.0321  0.0865  44   THR A CG2 
235  N N   . GLU A 29  ? 0.3539 0.4054 0.4659 0.0198  0.0261  0.1086  45   GLU A N   
236  C CA  . GLU A 29  ? 0.3553 0.4157 0.4749 0.0217  0.0273  0.1167  45   GLU A CA  
237  C C   . GLU A 29  ? 0.3525 0.4216 0.4663 0.0203  0.0200  0.1179  45   GLU A C   
238  O O   . GLU A 29  ? 0.3519 0.4256 0.4661 0.0216  0.0201  0.1205  45   GLU A O   
239  C CB  . GLU A 29  ? 0.3591 0.4244 0.4907 0.0231  0.0310  0.1252  45   GLU A CB  
240  C CG  . GLU A 29  ? 0.3730 0.4314 0.5131 0.0254  0.0400  0.1261  45   GLU A CG  
241  C CD  . GLU A 29  ? 0.3971 0.4561 0.5430 0.0281  0.0453  0.1292  45   GLU A CD  
242  O OE1 . GLU A 29  ? 0.4041 0.4686 0.5469 0.0284  0.0419  0.1306  45   GLU A OE1 
243  O OE2 . GLU A 29  ? 0.4065 0.4603 0.5604 0.0300  0.0531  0.1303  45   GLU A OE2 
244  N N   . ALA A 30  ? 0.3486 0.4198 0.4570 0.0176  0.0139  0.1159  46   ALA A N   
245  C CA  . ALA A 30  ? 0.3467 0.4256 0.4487 0.0156  0.0068  0.1157  46   ALA A CA  
246  C C   . ALA A 30  ? 0.3457 0.4199 0.4373 0.0151  0.0045  0.1083  46   ALA A C   
247  O O   . ALA A 30  ? 0.3437 0.4244 0.4318 0.0148  0.0012  0.1093  46   ALA A O   
248  C CB  . ALA A 30  ? 0.3472 0.4283 0.4466 0.0126  0.0015  0.1147  46   ALA A CB  
249  N N   . ALA A 31  ? 0.3430 0.4065 0.4297 0.0148  0.0062  0.1010  47   ALA A N   
250  C CA  . ALA A 31  ? 0.3446 0.4031 0.4222 0.0146  0.0047  0.0938  47   ALA A CA  
251  C C   . ALA A 31  ? 0.3437 0.4032 0.4245 0.0171  0.0089  0.0959  47   ALA A C   
252  O O   . ALA A 31  ? 0.3438 0.4052 0.4190 0.0171  0.0065  0.0938  47   ALA A O   
253  C CB  . ALA A 31  ? 0.3425 0.3902 0.4151 0.0139  0.0059  0.0863  47   ALA A CB  
254  N N   . TRP A 32  ? 0.3441 0.4021 0.4342 0.0193  0.0154  0.1001  48   TRP A N   
255  C CA  . TRP A 32  ? 0.3467 0.4057 0.4420 0.0219  0.0204  0.1032  48   TRP A CA  
256  C C   . TRP A 32  ? 0.3490 0.4193 0.4465 0.0227  0.0179  0.1102  48   TRP A C   
257  O O   . TRP A 32  ? 0.3491 0.4210 0.4443 0.0237  0.0181  0.1099  48   TRP A O   
258  C CB  . TRP A 32  ? 0.3460 0.4014 0.4520 0.0239  0.0281  0.1068  48   TRP A CB  
259  C CG  . TRP A 32  ? 0.3459 0.4041 0.4599 0.0266  0.0335  0.1122  48   TRP A CG  
260  C CD1 . TRP A 32  ? 0.3471 0.4141 0.4703 0.0286  0.0352  0.1219  48   TRP A CD1 
261  C CD2 . TRP A 32  ? 0.3457 0.3980 0.4597 0.0278  0.0380  0.1085  48   TRP A CD2 
262  N NE1 . TRP A 32  ? 0.3488 0.4155 0.4778 0.0310  0.0407  0.1247  48   TRP A NE1 
263  C CE2 . TRP A 32  ? 0.3470 0.4046 0.4705 0.0304  0.0425  0.1164  48   TRP A CE2 
264  C CE3 . TRP A 32  ? 0.3447 0.3883 0.4518 0.0268  0.0386  0.0996  48   TRP A CE3 
265  C CZ2 . TRP A 32  ? 0.3471 0.4009 0.4738 0.0320  0.0478  0.1153  48   TRP A CZ2 
266  C CZ3 . TRP A 32  ? 0.3468 0.3872 0.4568 0.0282  0.0436  0.0983  48   TRP A CZ3 
267  C CH2 . TRP A 32  ? 0.3463 0.3915 0.4661 0.0307  0.0482  0.1060  48   TRP A CH2 
268  N N   . ALA A 33  ? 0.3512 0.4297 0.4532 0.0222  0.0155  0.1166  49   ALA A N   
269  C CA  . ALA A 33  ? 0.3544 0.4452 0.4588 0.0228  0.0129  0.1241  49   ALA A CA  
270  C C   . ALA A 33  ? 0.3573 0.4517 0.4507 0.0208  0.0064  0.1197  49   ALA A C   
271  O O   . ALA A 33  ? 0.3581 0.4597 0.4513 0.0219  0.0058  0.1234  49   ALA A O   
272  C CB  . ALA A 33  ? 0.3548 0.4538 0.4656 0.0221  0.0110  0.1309  49   ALA A CB  
273  N N   . TYR A 34  ? 0.3590 0.4481 0.4434 0.0181  0.0020  0.1119  50   TYR A N   
274  C CA  . TYR A 34  ? 0.3632 0.4543 0.4369 0.0161  -0.0038 0.1068  50   TYR A CA  
275  C C   . TYR A 34  ? 0.3631 0.4487 0.4318 0.0174  -0.0018 0.1019  50   TYR A C   
276  O O   . TYR A 34  ? 0.3619 0.4531 0.4263 0.0175  -0.0040 0.1023  50   TYR A O   
277  C CB  . TYR A 34  ? 0.3654 0.4519 0.4319 0.0129  -0.0085 0.1001  50   TYR A CB  
278  C CG  . TYR A 34  ? 0.3750 0.4618 0.4306 0.0108  -0.0138 0.0938  50   TYR A CG  
279  C CD1 . TYR A 34  ? 0.3869 0.4842 0.4395 0.0092  -0.0186 0.0963  50   TYR A CD1 
280  C CD2 . TYR A 34  ? 0.3849 0.4618 0.4330 0.0104  -0.0140 0.0854  50   TYR A CD2 
281  C CE1 . TYR A 34  ? 0.4002 0.4976 0.4427 0.0073  -0.0230 0.0901  50   TYR A CE1 
282  C CE2 . TYR A 34  ? 0.3962 0.4731 0.4347 0.0087  -0.0184 0.0796  50   TYR A CE2 
283  C CZ  . TYR A 34  ? 0.4045 0.4913 0.4403 0.0071  -0.0228 0.0819  50   TYR A CZ  
284  O OH  . TYR A 34  ? 0.4207 0.5074 0.4471 0.0053  -0.0268 0.0759  50   TYR A OH  
285  N N   . GLY A 35  ? 0.3622 0.4373 0.4314 0.0183  0.0023  0.0973  51   GLY A N   
286  C CA  . GLY A 35  ? 0.3654 0.4347 0.4304 0.0194  0.0044  0.0922  51   GLY A CA  
287  C C   . GLY A 35  ? 0.3690 0.4429 0.4398 0.0220  0.0085  0.0978  51   GLY A C   
288  O O   . GLY A 35  ? 0.3678 0.4410 0.4341 0.0226  0.0085  0.0950  51   GLY A O   
289  N N   . SER A 36  ? 0.3726 0.4512 0.4537 0.0237  0.0123  0.1059  52   SER A N   
290  C CA  . SER A 36  ? 0.3787 0.4620 0.4670 0.0266  0.0168  0.1125  52   SER A CA  
291  C C   . SER A 36  ? 0.3829 0.4791 0.4708 0.0267  0.0130  0.1192  52   SER A C   
292  O O   . SER A 36  ? 0.3849 0.4861 0.4769 0.0290  0.0158  0.1246  52   SER A O   
293  C CB  . SER A 36  ? 0.3771 0.4584 0.4778 0.0286  0.0237  0.1182  52   SER A CB  
294  O OG  . SER A 36  ? 0.3852 0.4729 0.4908 0.0282  0.0220  0.1242  52   SER A OG  
295  N N   . ASN A 37  ? 0.3878 0.4894 0.4705 0.0242  0.0067  0.1188  53   ASN A N   
296  C CA  . ASN A 37  ? 0.3951 0.5101 0.4770 0.0238  0.0024  0.1250  53   ASN A CA  
297  C C   . ASN A 37  ? 0.3942 0.5115 0.4666 0.0200  -0.0051 0.1198  53   ASN A C   
298  O O   . ASN A 37  ? 0.3917 0.5124 0.4665 0.0184  -0.0075 0.1219  53   ASN A O   
299  C CB  . ASN A 37  ? 0.3995 0.5225 0.4936 0.0256  0.0053  0.1358  53   ASN A CB  
300  C CG  . ASN A 37  ? 0.4222 0.5606 0.5163 0.0253  0.0010  0.1432  53   ASN A CG  
301  O OD1 . ASN A 37  ? 0.4268 0.5703 0.5137 0.0248  -0.0020 0.1419  53   ASN A OD1 
302  N ND2 . ASN A 37  ? 0.4583 0.6045 0.5609 0.0256  0.0010  0.1512  53   ASN A ND2 
303  N N   . ILE A 38  ? 0.3940 0.5093 0.4559 0.0186  -0.0084 0.1129  54   ILE A N   
304  C CA  . ILE A 38  ? 0.3953 0.5111 0.4478 0.0150  -0.0150 0.1067  54   ILE A CA  
305  C C   . ILE A 38  ? 0.4022 0.5319 0.4533 0.0132  -0.0200 0.1116  54   ILE A C   
306  O O   . ILE A 38  ? 0.4037 0.5409 0.4514 0.0137  -0.0213 0.1136  54   ILE A O   
307  C CB  . ILE A 38  ? 0.3955 0.5038 0.4374 0.0141  -0.0166 0.0974  54   ILE A CB  
308  C CG1 . ILE A 38  ? 0.3886 0.4837 0.4314 0.0153  -0.0124 0.0920  54   ILE A CG1 
309  C CG2 . ILE A 38  ? 0.3937 0.5031 0.4265 0.0104  -0.0231 0.0914  54   ILE A CG2 
310  C CD1 . ILE A 38  ? 0.3901 0.4785 0.4244 0.0152  -0.0130 0.0841  54   ILE A CD1 
311  N N   . THR A 39  ? 0.4058 0.5393 0.4597 0.0111  -0.0229 0.1137  55   THR A N   
312  C CA  . THR A 39  ? 0.4137 0.5605 0.4660 0.0085  -0.0284 0.1173  55   THR A CA  
313  C C   . THR A 39  ? 0.4196 0.5639 0.4682 0.0045  -0.0330 0.1119  55   THR A C   
314  O O   . THR A 39  ? 0.4160 0.5497 0.4661 0.0044  -0.0312 0.1081  55   THR A O   
315  C CB  . THR A 39  ? 0.4127 0.5712 0.4760 0.0104  -0.0266 0.1291  55   THR A CB  
316  O OG1 . THR A 39  ? 0.4072 0.5607 0.4793 0.0112  -0.0236 0.1316  55   THR A OG1 
317  C CG2 . THR A 39  ? 0.4117 0.5734 0.4796 0.0145  -0.0217 0.1353  55   THR A CG2 
318  N N   . ASP A 40  ? 0.4293 0.5835 0.4733 0.0012  -0.0389 0.1117  56   ASP A N   
319  C CA  . ASP A 40  ? 0.4374 0.5907 0.4788 -0.0029 -0.0434 0.1073  56   ASP A CA  
320  C C   . ASP A 40  ? 0.4366 0.5906 0.4883 -0.0026 -0.0418 0.1130  56   ASP A C   
321  O O   . ASP A 40  ? 0.4367 0.5832 0.4882 -0.0045 -0.0426 0.1085  56   ASP A O   
322  C CB  . ASP A 40  ? 0.4438 0.6093 0.4791 -0.0068 -0.0498 0.1066  56   ASP A CB  
323  C CG  . ASP A 40  ? 0.4557 0.6181 0.4793 -0.0081 -0.0519 0.0983  56   ASP A CG  
324  O OD1 . ASP A 40  ? 0.4598 0.6100 0.4799 -0.0062 -0.0489 0.0928  56   ASP A OD1 
325  O OD2 . ASP A 40  ? 0.4726 0.6448 0.4903 -0.0111 -0.0565 0.0973  56   ASP A OD2 
326  N N   . GLU A 41  ? 0.4387 0.6017 0.4997 0.0000  -0.0393 0.1231  57   GLU A N   
327  C CA  . GLU A 41  ? 0.4408 0.6054 0.5129 0.0007  -0.0370 0.1296  57   GLU A CA  
328  C C   . GLU A 41  ? 0.4350 0.5849 0.5107 0.0031  -0.0313 0.1269  57   GLU A C   
329  O O   . GLU A 41  ? 0.4332 0.5787 0.5124 0.0019  -0.0311 0.1260  57   GLU A O   
330  C CB  . GLU A 41  ? 0.4429 0.6204 0.5246 0.0035  -0.0349 0.1414  57   GLU A CB  
331  C CG  . GLU A 41  ? 0.4598 0.6414 0.5533 0.0042  -0.0332 0.1491  57   GLU A CG  
332  C CD  . GLU A 41  ? 0.4811 0.6746 0.5851 0.0076  -0.0302 0.1613  57   GLU A CD  
333  O OE1 . GLU A 41  ? 0.4940 0.6971 0.5954 0.0083  -0.0317 0.1647  57   GLU A OE1 
334  O OE2 . GLU A 41  ? 0.4911 0.6846 0.6063 0.0097  -0.0261 0.1677  57   GLU A OE2 
335  N N   . ASN A 42  ? 0.4325 0.5753 0.5075 0.0062  -0.0266 0.1255  58   ASN A N   
336  C CA  . ASN A 42  ? 0.4289 0.5583 0.5068 0.0084  -0.0210 0.1224  58   ASN A CA  
337  C C   . ASN A 42  ? 0.4292 0.5470 0.4987 0.0060  -0.0230 0.1122  58   ASN A C   
338  O O   . ASN A 42  ? 0.4261 0.5350 0.4985 0.0064  -0.0200 0.1102  58   ASN A O   
339  C CB  . ASN A 42  ? 0.4269 0.5525 0.5064 0.0121  -0.0156 0.1235  58   ASN A CB  
340  C CG  . ASN A 42  ? 0.4271 0.5612 0.5178 0.0153  -0.0114 0.1343  58   ASN A CG  
341  O OD1 . ASN A 42  ? 0.4244 0.5659 0.5228 0.0151  -0.0117 0.1412  58   ASN A OD1 
342  N ND2 . ASN A 42  ? 0.4256 0.5586 0.5178 0.0182  -0.0072 0.1361  58   ASN A ND2 
343  N N   . GLU A 43  ? 0.4332 0.5516 0.4927 0.0035  -0.0279 0.1060  59   GLU A N   
344  C CA  . GLU A 43  ? 0.4374 0.5461 0.4890 0.0010  -0.0304 0.0968  59   GLU A CA  
345  C C   . GLU A 43  ? 0.4370 0.5463 0.4914 -0.0017 -0.0329 0.0972  59   GLU A C   
346  O O   . GLU A 43  ? 0.4332 0.5328 0.4875 -0.0020 -0.0314 0.0932  59   GLU A O   
347  C CB  . GLU A 43  ? 0.4424 0.5530 0.4835 -0.0011 -0.0350 0.0909  59   GLU A CB  
348  C CG  . GLU A 43  ? 0.4604 0.5602 0.4935 -0.0031 -0.0369 0.0813  59   GLU A CG  
349  C CD  . GLU A 43  ? 0.4864 0.5887 0.5099 -0.0057 -0.0416 0.0756  59   GLU A CD  
350  O OE1 . GLU A 43  ? 0.5014 0.6125 0.5230 -0.0054 -0.0428 0.0782  59   GLU A OE1 
351  O OE2 . GLU A 43  ? 0.5034 0.5988 0.5211 -0.0080 -0.0439 0.0685  59   GLU A OE2 
352  N N   . LYS A 44  ? 0.4381 0.5594 0.4954 -0.0037 -0.0365 0.1022  60   LYS A N   
353  C CA  . LYS A 44  ? 0.4393 0.5635 0.5003 -0.0066 -0.0393 0.1035  60   LYS A CA  
354  C C   . LYS A 44  ? 0.4340 0.5536 0.5044 -0.0044 -0.0344 0.1078  60   LYS A C   
355  O O   . LYS A 44  ? 0.4338 0.5472 0.5046 -0.0060 -0.0347 0.1048  60   LYS A O   
356  C CB  . LYS A 44  ? 0.4435 0.5834 0.5069 -0.0087 -0.0437 0.1093  60   LYS A CB  
357  C CG  . LYS A 44  ? 0.4540 0.5978 0.5186 -0.0130 -0.0482 0.1085  60   LYS A CG  
358  C CD  . LYS A 44  ? 0.4681 0.6285 0.5343 -0.0154 -0.0529 0.1138  60   LYS A CD  
359  C CE  . LYS A 44  ? 0.4798 0.6445 0.5471 -0.0202 -0.0576 0.1125  60   LYS A CE  
360  N NZ  . LYS A 44  ? 0.4833 0.6470 0.5611 -0.0193 -0.0549 0.1179  60   LYS A NZ  
361  N N   . LYS A 45  ? 0.4289 0.5514 0.5069 -0.0007 -0.0296 0.1148  61   LYS A N   
362  C CA  . LYS A 45  ? 0.4240 0.5423 0.5116 0.0015  -0.0240 0.1191  61   LYS A CA  
363  C C   . LYS A 45  ? 0.4191 0.5225 0.5033 0.0025  -0.0204 0.1122  61   LYS A C   
364  O O   . LYS A 45  ? 0.4168 0.5151 0.5043 0.0020  -0.0188 0.1117  61   LYS A O   
365  C CB  . LYS A 45  ? 0.4233 0.5472 0.5196 0.0054  -0.0191 0.1276  61   LYS A CB  
366  C CG  . LYS A 45  ? 0.4326 0.5721 0.5354 0.0051  -0.0217 0.1367  61   LYS A CG  
367  C CD  . LYS A 45  ? 0.4446 0.5888 0.5561 0.0093  -0.0162 0.1452  61   LYS A CD  
368  C CE  . LYS A 45  ? 0.4547 0.6156 0.5718 0.0092  -0.0192 0.1546  61   LYS A CE  
369  N NZ  . LYS A 45  ? 0.4618 0.6270 0.5890 0.0137  -0.0133 0.1638  61   LYS A NZ  
370  N N   . LYS A 46  ? 0.4141 0.5113 0.4917 0.0038  -0.0191 0.1071  62   LYS A N   
371  C CA  . LYS A 46  ? 0.4109 0.4950 0.4844 0.0046  -0.0161 0.1003  62   LYS A CA  
372  C C   . LYS A 46  ? 0.4075 0.4857 0.4753 0.0016  -0.0196 0.0940  62   LYS A C   
373  O O   . LYS A 46  ? 0.4061 0.4765 0.4753 0.0019  -0.0169 0.0922  62   LYS A O   
374  C CB  . LYS A 46  ? 0.4121 0.4926 0.4792 0.0060  -0.0153 0.0960  62   LYS A CB  
375  C CG  . LYS A 46  ? 0.4224 0.4908 0.4827 0.0060  -0.0142 0.0876  62   LYS A CG  
376  C CD  . LYS A 46  ? 0.4368 0.5038 0.4901 0.0068  -0.0148 0.0834  62   LYS A CD  
377  C CE  . LYS A 46  ? 0.4546 0.5121 0.4993 0.0058  -0.0163 0.0747  62   LYS A CE  
378  N NZ  . LYS A 46  ? 0.4609 0.5091 0.5071 0.0074  -0.0115 0.0721  62   LYS A NZ  
379  N N   . ASN A 47  ? 0.4057 0.4879 0.4671 -0.0013 -0.0255 0.0909  63   ASN A N   
380  C CA  . ASN A 47  ? 0.4046 0.4811 0.4603 -0.0042 -0.0289 0.0848  63   ASN A CA  
381  C C   . ASN A 47  ? 0.4049 0.4838 0.4666 -0.0062 -0.0300 0.0879  63   ASN A C   
382  O O   . ASN A 47  ? 0.4047 0.4763 0.4644 -0.0076 -0.0303 0.0839  63   ASN A O   
383  C CB  . ASN A 47  ? 0.4057 0.4852 0.4530 -0.0069 -0.0344 0.0799  63   ASN A CB  
384  C CG  . ASN A 47  ? 0.4003 0.4743 0.4404 -0.0052 -0.0333 0.0748  63   ASN A CG  
385  O OD1 . ASN A 47  ? 0.3891 0.4556 0.4296 -0.0025 -0.0290 0.0735  63   ASN A OD1 
386  N ND2 . ASN A 47  ? 0.3971 0.4750 0.4306 -0.0068 -0.0372 0.0716  63   ASN A ND2 
387  N N   . GLU A 48  ? 0.4048 0.4943 0.4739 -0.0064 -0.0304 0.0954  64   GLU A N   
388  C CA  . GLU A 48  ? 0.4055 0.4984 0.4814 -0.0081 -0.0312 0.0993  64   GLU A CA  
389  C C   . GLU A 48  ? 0.3975 0.4834 0.4798 -0.0057 -0.0253 0.1015  64   GLU A C   
390  O O   . GLU A 48  ? 0.3983 0.4808 0.4825 -0.0071 -0.0254 0.1008  64   GLU A O   
391  C CB  . GLU A 48  ? 0.4090 0.5164 0.4915 -0.0090 -0.0336 0.1071  64   GLU A CB  
392  C CG  . GLU A 48  ? 0.4318 0.5468 0.5085 -0.0131 -0.0405 0.1043  64   GLU A CG  
393  C CD  . GLU A 48  ? 0.4599 0.5903 0.5431 -0.0145 -0.0434 0.1121  64   GLU A CD  
394  O OE1 . GLU A 48  ? 0.4684 0.6045 0.5602 -0.0115 -0.0400 0.1202  64   GLU A OE1 
395  O OE2 . GLU A 48  ? 0.4767 0.6137 0.5566 -0.0187 -0.0491 0.1099  64   GLU A OE2 
396  N N   . ILE A 49  ? 0.3898 0.4735 0.4753 -0.0020 -0.0200 0.1040  65   ILE A N   
397  C CA  . ILE A 49  ? 0.3833 0.4600 0.4743 0.0003  -0.0138 0.1053  65   ILE A CA  
398  C C   . ILE A 49  ? 0.3795 0.4439 0.4632 0.0000  -0.0129 0.0973  65   ILE A C   
399  O O   . ILE A 49  ? 0.3766 0.4355 0.4628 0.0001  -0.0102 0.0971  65   ILE A O   
400  C CB  . ILE A 49  ? 0.3834 0.4614 0.4807 0.0041  -0.0081 0.1102  65   ILE A CB  
401  C CG1 . ILE A 49  ? 0.3869 0.4776 0.4931 0.0046  -0.0087 0.1194  65   ILE A CG1 
402  C CG2 . ILE A 49  ? 0.3806 0.4503 0.4825 0.0062  -0.0014 0.1101  65   ILE A CG2 
403  C CD1 . ILE A 49  ? 0.3951 0.4894 0.5064 0.0080  -0.0044 0.1245  65   ILE A CD1 
404  N N   . SER A 50  ? 0.3749 0.4355 0.4496 -0.0003 -0.0152 0.0912  66   SER A N   
405  C CA  . SER A 50  ? 0.3715 0.4215 0.4388 -0.0007 -0.0150 0.0837  66   SER A CA  
406  C C   . SER A 50  ? 0.3704 0.4185 0.4359 -0.0036 -0.0184 0.0816  66   SER A C   
407  O O   . SER A 50  ? 0.3680 0.4084 0.4322 -0.0034 -0.0164 0.0789  66   SER A O   
408  C CB  . SER A 50  ? 0.3712 0.4188 0.4298 -0.0005 -0.0171 0.0781  66   SER A CB  
409  O OG  . SER A 50  ? 0.3714 0.4180 0.4314 0.0023  -0.0129 0.0790  66   SER A OG  
410  N N   . ALA A 51  ? 0.3698 0.4251 0.4352 -0.0064 -0.0235 0.0827  67   ALA A N   
411  C CA  . ALA A 51  ? 0.3706 0.4252 0.4354 -0.0096 -0.0269 0.0811  67   ALA A CA  
412  C C   . ALA A 51  ? 0.3691 0.4236 0.4421 -0.0093 -0.0239 0.0858  67   ALA A C   
413  O O   . ALA A 51  ? 0.3719 0.4208 0.4439 -0.0106 -0.0240 0.0835  67   ALA A O   
414  C CB  . ALA A 51  ? 0.3739 0.4378 0.4381 -0.0128 -0.0326 0.0819  67   ALA A CB  
415  N N   . GLU A 52  ? 0.3652 0.4259 0.4463 -0.0075 -0.0209 0.0927  68   GLU A N   
416  C CA  . GLU A 52  ? 0.3623 0.4233 0.4521 -0.0067 -0.0171 0.0978  68   GLU A CA  
417  C C   . GLU A 52  ? 0.3594 0.4099 0.4478 -0.0045 -0.0118 0.0949  68   GLU A C   
418  O O   . GLU A 52  ? 0.3590 0.4060 0.4497 -0.0052 -0.0105 0.0951  68   GLU A O   
419  C CB  . GLU A 52  ? 0.3595 0.4297 0.4586 -0.0048 -0.0147 0.1058  68   GLU A CB  
420  C CG  . GLU A 52  ? 0.3600 0.4322 0.4692 -0.0041 -0.0111 0.1120  68   GLU A CG  
421  C CD  . GLU A 52  ? 0.3595 0.4418 0.4785 -0.0022 -0.0092 0.1205  68   GLU A CD  
422  O OE1 . GLU A 52  ? 0.3581 0.4476 0.4757 -0.0023 -0.0121 0.1221  68   GLU A OE1 
423  O OE2 . GLU A 52  ? 0.3593 0.4424 0.4873 -0.0006 -0.0047 0.1259  68   GLU A OE2 
424  N N   . LEU A 53  ? 0.3566 0.4023 0.4412 -0.0021 -0.0089 0.0920  69   LEU A N   
425  C CA  . LEU A 53  ? 0.3562 0.3924 0.4387 -0.0003 -0.0040 0.0886  69   LEU A CA  
426  C C   . LEU A 53  ? 0.3574 0.3864 0.4319 -0.0020 -0.0065 0.0824  69   LEU A C   
427  O O   . LEU A 53  ? 0.3566 0.3799 0.4312 -0.0016 -0.0037 0.0814  69   LEU A O   
428  C CB  . LEU A 53  ? 0.3560 0.3896 0.4367 0.0022  -0.0005 0.0869  69   LEU A CB  
429  C CG  . LEU A 53  ? 0.3593 0.3837 0.4371 0.0039  0.0044  0.0827  69   LEU A CG  
430  C CD1 . LEU A 53  ? 0.3614 0.3842 0.4463 0.0049  0.0098  0.0862  69   LEU A CD1 
431  C CD2 . LEU A 53  ? 0.3643 0.3872 0.4405 0.0060  0.0072  0.0808  69   LEU A CD2 
432  N N   . ALA A 54  ? 0.3581 0.3874 0.4259 -0.0037 -0.0117 0.0784  70   ALA A N   
433  C CA  . ALA A 54  ? 0.3627 0.3855 0.4235 -0.0053 -0.0142 0.0728  70   ALA A CA  
434  C C   . ALA A 54  ? 0.3658 0.3885 0.4304 -0.0073 -0.0150 0.0749  70   ALA A C   
435  O O   . ALA A 54  ? 0.3654 0.3814 0.4273 -0.0073 -0.0138 0.0723  70   ALA A O   
436  C CB  . ALA A 54  ? 0.3624 0.3866 0.4168 -0.0070 -0.0194 0.0689  70   ALA A CB  
437  N N   . LYS A 55  ? 0.3686 0.3993 0.4396 -0.0089 -0.0170 0.0797  71   LYS A N   
438  C CA  . LYS A 55  ? 0.3743 0.4064 0.4504 -0.0110 -0.0177 0.0825  71   LYS A CA  
439  C C   . LYS A 55  ? 0.3730 0.4009 0.4534 -0.0090 -0.0121 0.0849  71   LYS A C   
440  O O   . LYS A 55  ? 0.3748 0.3983 0.4550 -0.0100 -0.0116 0.0841  71   LYS A O   
441  C CB  . LYS A 55  ? 0.3761 0.4190 0.4592 -0.0129 -0.0205 0.0879  71   LYS A CB  
442  C CG  . LYS A 55  ? 0.3920 0.4374 0.4788 -0.0162 -0.0234 0.0893  71   LYS A CG  
443  C CD  . LYS A 55  ? 0.4122 0.4694 0.5045 -0.0185 -0.0272 0.0937  71   LYS A CD  
444  C CE  . LYS A 55  ? 0.4306 0.4904 0.5247 -0.0228 -0.0314 0.0931  71   LYS A CE  
445  N NZ  . LYS A 55  ? 0.4419 0.5006 0.5433 -0.0229 -0.0285 0.0971  71   LYS A NZ  
446  N N   . PHE A 56  ? 0.3703 0.3995 0.4547 -0.0062 -0.0075 0.0879  72   PHE A N   
447  C CA  . PHE A 56  ? 0.3711 0.3962 0.4594 -0.0042 -0.0014 0.0898  72   PHE A CA  
448  C C   . PHE A 56  ? 0.3738 0.3895 0.4543 -0.0033 0.0004  0.0840  72   PHE A C   
449  O O   . PHE A 56  ? 0.3731 0.3848 0.4545 -0.0031 0.0032  0.0842  72   PHE A O   
450  C CB  . PHE A 56  ? 0.3673 0.3956 0.4618 -0.0015 0.0032  0.0939  72   PHE A CB  
451  C CG  . PHE A 56  ? 0.3661 0.3903 0.4649 0.0004  0.0100  0.0955  72   PHE A CG  
452  C CD1 . PHE A 56  ? 0.3668 0.3938 0.4735 0.0000  0.0119  0.1007  72   PHE A CD1 
453  C CD2 . PHE A 56  ? 0.3603 0.3781 0.4553 0.0024  0.0145  0.0917  72   PHE A CD2 
454  C CE1 . PHE A 56  ? 0.3682 0.3913 0.4788 0.0018  0.0184  0.1019  72   PHE A CE1 
455  C CE2 . PHE A 56  ? 0.3607 0.3748 0.4593 0.0040  0.0209  0.0927  72   PHE A CE2 
456  C CZ  . PHE A 56  ? 0.3645 0.3810 0.4707 0.0037  0.0230  0.0978  72   PHE A CZ  
457  N N   . MET A 57  ? 0.3760 0.3887 0.4491 -0.0027 -0.0010 0.0790  73   MET A N   
458  C CA  . MET A 57  ? 0.3841 0.3888 0.4494 -0.0019 0.0001  0.0735  73   MET A CA  
459  C C   . MET A 57  ? 0.3835 0.3845 0.4456 -0.0038 -0.0024 0.0717  73   MET A C   
460  O O   . MET A 57  ? 0.3848 0.3805 0.4444 -0.0030 0.0002  0.0701  73   MET A O   
461  C CB  . MET A 57  ? 0.3858 0.3889 0.4441 -0.0013 -0.0018 0.0688  73   MET A CB  
462  C CG  . MET A 57  ? 0.4060 0.4113 0.4666 0.0007  0.0013  0.0697  73   MET A CG  
463  S SD  . MET A 57  ? 0.4573 0.4599 0.5231 0.0029  0.0091  0.0717  73   MET A SD  
464  C CE  . MET A 57  ? 0.4513 0.4456 0.5083 0.0033  0.0105  0.0652  73   MET A CE  
465  N N   . LYS A 58  ? 0.3837 0.3878 0.4461 -0.0062 -0.0074 0.0720  74   LYS A N   
466  C CA  . LYS A 58  ? 0.3865 0.3877 0.4474 -0.0083 -0.0098 0.0708  74   LYS A CA  
467  C C   . LYS A 58  ? 0.3853 0.3857 0.4517 -0.0083 -0.0065 0.0746  74   LYS A C   
468  O O   . LYS A 58  ? 0.3868 0.3818 0.4504 -0.0083 -0.0055 0.0731  74   LYS A O   
469  C CB  . LYS A 58  ? 0.3885 0.3945 0.4508 -0.0114 -0.0152 0.0711  74   LYS A CB  
470  C CG  . LYS A 58  ? 0.3985 0.4025 0.4534 -0.0122 -0.0192 0.0658  74   LYS A CG  
471  C CD  . LYS A 58  ? 0.4113 0.4183 0.4673 -0.0159 -0.0241 0.0652  74   LYS A CD  
472  C CE  . LYS A 58  ? 0.4190 0.4249 0.4681 -0.0168 -0.0278 0.0600  74   LYS A CE  
473  N NZ  . LYS A 58  ? 0.4236 0.4348 0.4717 -0.0157 -0.0283 0.0603  74   LYS A NZ  
474  N N   . GLU A 59  ? 0.3810 0.3871 0.4556 -0.0081 -0.0045 0.0799  75   GLU A N   
475  C CA  . GLU A 59  ? 0.3831 0.3893 0.4639 -0.0079 -0.0008 0.0841  75   GLU A CA  
476  C C   . GLU A 59  ? 0.3827 0.3830 0.4608 -0.0054 0.0047  0.0826  75   GLU A C   
477  O O   . GLU A 59  ? 0.3842 0.3812 0.4626 -0.0054 0.0070  0.0834  75   GLU A O   
478  C CB  . GLU A 59  ? 0.3810 0.3951 0.4716 -0.0080 0.0002  0.0903  75   GLU A CB  
479  C CG  . GLU A 59  ? 0.3872 0.4083 0.4814 -0.0111 -0.0052 0.0924  75   GLU A CG  
480  C CD  . GLU A 59  ? 0.3939 0.4240 0.4980 -0.0109 -0.0043 0.0991  75   GLU A CD  
481  O OE1 . GLU A 59  ? 0.3965 0.4266 0.5064 -0.0088 0.0009  0.1029  75   GLU A OE1 
482  O OE2 . GLU A 59  ? 0.3946 0.4320 0.5007 -0.0129 -0.0089 0.1005  75   GLU A OE2 
483  N N   . VAL A 60  ? 0.3818 0.3810 0.4570 -0.0033 0.0070  0.0805  76   VAL A N   
484  C CA  . VAL A 60  ? 0.3845 0.3784 0.4563 -0.0012 0.0121  0.0781  76   VAL A CA  
485  C C   . VAL A 60  ? 0.3886 0.3765 0.4520 -0.0015 0.0108  0.0737  76   VAL A C   
486  O O   . VAL A 60  ? 0.3893 0.3740 0.4519 -0.0009 0.0142  0.0738  76   VAL A O   
487  C CB  . VAL A 60  ? 0.3825 0.3765 0.4527 0.0006  0.0143  0.0760  76   VAL A CB  
488  C CG1 . VAL A 60  ? 0.3862 0.3746 0.4513 0.0022  0.0187  0.0721  76   VAL A CG1 
489  C CG2 . VAL A 60  ? 0.3784 0.3779 0.4579 0.0014  0.0171  0.0812  76   VAL A CG2 
490  N N   . ALA A 61  ? 0.3911 0.3779 0.4486 -0.0022 0.0062  0.0700  77   ALA A N   
491  C CA  . ALA A 61  ? 0.3982 0.3797 0.4483 -0.0023 0.0046  0.0662  77   ALA A CA  
492  C C   . ALA A 61  ? 0.4041 0.3841 0.4562 -0.0036 0.0042  0.0685  77   ALA A C   
493  O O   . ALA A 61  ? 0.4085 0.3843 0.4564 -0.0029 0.0058  0.0672  77   ALA A O   
494  C CB  . ALA A 61  ? 0.3970 0.3780 0.4419 -0.0031 -0.0003 0.0625  77   ALA A CB  
495  N N   . SER A 62  ? 0.4085 0.3924 0.4670 -0.0056 0.0021  0.0720  78   SER A N   
496  C CA  . SER A 62  ? 0.4175 0.4007 0.4796 -0.0071 0.0020  0.0748  78   SER A CA  
497  C C   . SER A 62  ? 0.4201 0.4026 0.4856 -0.0057 0.0076  0.0780  78   SER A C   
498  O O   . SER A 62  ? 0.4249 0.4041 0.4892 -0.0058 0.0090  0.0786  78   SER A O   
499  C CB  . SER A 62  ? 0.4183 0.4069 0.4872 -0.0098 -0.0014 0.0778  78   SER A CB  
500  O OG  . SER A 62  ? 0.4296 0.4176 0.5026 -0.0115 -0.0015 0.0805  78   SER A OG  
501  N N   . ASP A 63  ? 0.4198 0.4054 0.4896 -0.0044 0.0111  0.0800  79   ASP A N   
502  C CA  . ASP A 63  ? 0.4236 0.4088 0.4971 -0.0031 0.0171  0.0828  79   ASP A CA  
503  C C   . ASP A 63  ? 0.4242 0.4041 0.4903 -0.0014 0.0207  0.0793  79   ASP A C   
504  O O   . ASP A 63  ? 0.4272 0.4058 0.4946 -0.0007 0.0249  0.0811  79   ASP A O   
505  C CB  . ASP A 63  ? 0.4230 0.4124 0.5033 -0.0020 0.0203  0.0857  79   ASP A CB  
506  C CG  . ASP A 63  ? 0.4310 0.4267 0.5207 -0.0035 0.0184  0.0911  79   ASP A CG  
507  O OD1 . ASP A 63  ? 0.4457 0.4424 0.5371 -0.0057 0.0150  0.0925  79   ASP A OD1 
508  O OD2 . ASP A 63  ? 0.4408 0.4410 0.5367 -0.0026 0.0203  0.0942  79   ASP A OD2 
509  N N   . THR A 64  ? 0.4225 0.4000 0.4810 -0.0007 0.0190  0.0744  80   THR A N   
510  C CA  . THR A 64  ? 0.4232 0.3967 0.4742 0.0006  0.0218  0.0709  80   THR A CA  
511  C C   . THR A 64  ? 0.4259 0.3965 0.4736 0.0002  0.0212  0.0714  80   THR A C   
512  O O   . THR A 64  ? 0.4290 0.3975 0.4725 0.0013  0.0246  0.0703  80   THR A O   
513  C CB  . THR A 64  ? 0.4225 0.3945 0.4663 0.0014  0.0197  0.0657  80   THR A CB  
514  O OG1 . THR A 64  ? 0.4206 0.3916 0.4611 0.0004  0.0141  0.0642  80   THR A OG1 
515  C CG2 . THR A 64  ? 0.4171 0.3916 0.4640 0.0020  0.0208  0.0652  80   THR A CG2 
516  N N   . THR A 65  ? 0.4245 0.3952 0.4743 -0.0013 0.0170  0.0731  81   THR A N   
517  C CA  . THR A 65  ? 0.4265 0.3944 0.4744 -0.0017 0.0165  0.0743  81   THR A CA  
518  C C   . THR A 65  ? 0.4258 0.3944 0.4789 -0.0017 0.0209  0.0787  81   THR A C   
519  O O   . THR A 65  ? 0.4323 0.3987 0.4835 -0.0016 0.0219  0.0799  81   THR A O   
520  C CB  . THR A 65  ? 0.4273 0.3948 0.4768 -0.0038 0.0112  0.0746  81   THR A CB  
521  O OG1 . THR A 65  ? 0.4298 0.4011 0.4879 -0.0056 0.0102  0.0782  81   THR A OG1 
522  C CG2 . THR A 65  ? 0.4242 0.3908 0.4686 -0.0038 0.0071  0.0702  81   THR A CG2 
523  N N   . LYS A 66  ? 0.4194 0.3914 0.4794 -0.0017 0.0235  0.0814  82   LYS A N   
524  C CA  . LYS A 66  ? 0.4161 0.3891 0.4817 -0.0015 0.0283  0.0856  82   LYS A CA  
525  C C   . LYS A 66  ? 0.4109 0.3819 0.4716 0.0004  0.0339  0.0837  82   LYS A C   
526  O O   . LYS A 66  ? 0.4123 0.3832 0.4754 0.0008  0.0383  0.0865  82   LYS A O   
527  C CB  . LYS A 66  ? 0.4156 0.3933 0.4910 -0.0020 0.0294  0.0893  82   LYS A CB  
528  C CG  . LYS A 66  ? 0.4278 0.4088 0.5085 -0.0043 0.0239  0.0914  82   LYS A CG  
529  C CD  . LYS A 66  ? 0.4497 0.4364 0.5399 -0.0045 0.0250  0.0955  82   LYS A CD  
530  C CE  . LYS A 66  ? 0.4595 0.4507 0.5542 -0.0071 0.0191  0.0970  82   LYS A CE  
531  N NZ  . LYS A 66  ? 0.4750 0.4662 0.5732 -0.0094 0.0169  0.0994  82   LYS A NZ  
532  N N   . PHE A 67  ? 0.3992 0.3688 0.4531 0.0014  0.0339  0.0790  83   PHE A N   
533  C CA  . PHE A 67  ? 0.3926 0.3607 0.4409 0.0028  0.0388  0.0762  83   PHE A CA  
534  C C   . PHE A 67  ? 0.3897 0.3553 0.4284 0.0033  0.0368  0.0730  83   PHE A C   
535  O O   . PHE A 67  ? 0.3856 0.3504 0.4205 0.0030  0.0320  0.0706  83   PHE A O   
536  C CB  . PHE A 67  ? 0.3906 0.3594 0.4390 0.0036  0.0410  0.0731  83   PHE A CB  
537  C CG  . PHE A 67  ? 0.3875 0.3589 0.4456 0.0037  0.0443  0.0766  83   PHE A CG  
538  C CD1 . PHE A 67  ? 0.3910 0.3622 0.4524 0.0045  0.0510  0.0780  83   PHE A CD1 
539  C CD2 . PHE A 67  ? 0.3814 0.3556 0.4454 0.0031  0.0408  0.0786  83   PHE A CD2 
540  C CE1 . PHE A 67  ? 0.3927 0.3664 0.4638 0.0049  0.0543  0.0817  83   PHE A CE1 
541  C CE2 . PHE A 67  ? 0.3789 0.3562 0.4524 0.0034  0.0438  0.0826  83   PHE A CE2 
542  C CZ  . PHE A 67  ? 0.3844 0.3614 0.4618 0.0044  0.0506  0.0842  83   PHE A CZ  
543  N N   . GLN A 68  ? 0.3853 0.3500 0.4200 0.0040  0.0406  0.0731  84   GLN A N   
544  C CA  . GLN A 68  ? 0.3829 0.3463 0.4084 0.0046  0.0394  0.0706  84   GLN A CA  
545  C C   . GLN A 68  ? 0.3738 0.3374 0.3926 0.0053  0.0404  0.0650  84   GLN A C   
546  O O   . GLN A 68  ? 0.3763 0.3402 0.3890 0.0059  0.0434  0.0629  84   GLN A O   
547  C CB  . GLN A 68  ? 0.3911 0.3544 0.4147 0.0051  0.0432  0.0732  84   GLN A CB  
548  C CG  . GLN A 68  ? 0.4035 0.3665 0.4337 0.0044  0.0426  0.0788  84   GLN A CG  
549  C CD  . GLN A 68  ? 0.4260 0.3874 0.4560 0.0037  0.0367  0.0797  84   GLN A CD  
550  O OE1 . GLN A 68  ? 0.4399 0.4003 0.4631 0.0044  0.0342  0.0775  84   GLN A OE1 
551  N NE2 . GLN A 68  ? 0.4333 0.3950 0.4714 0.0023  0.0345  0.0829  84   GLN A NE2 
552  N N   . TRP A 69  ? 0.3592 0.3230 0.3794 0.0051  0.0379  0.0625  85   TRP A N   
553  C CA  . TRP A 69  ? 0.3507 0.3149 0.3668 0.0055  0.0396  0.0575  85   TRP A CA  
554  C C   . TRP A 69  ? 0.3480 0.3121 0.3544 0.0060  0.0382  0.0535  85   TRP A C   
555  O O   . TRP A 69  ? 0.3482 0.3130 0.3505 0.0061  0.0414  0.0495  85   TRP A O   
556  C CB  . TRP A 69  ? 0.3459 0.3106 0.3662 0.0052  0.0374  0.0563  85   TRP A CB  
557  C CG  . TRP A 69  ? 0.3394 0.3037 0.3580 0.0049  0.0310  0.0558  85   TRP A CG  
558  C CD1 . TRP A 69  ? 0.3333 0.2978 0.3568 0.0041  0.0272  0.0590  85   TRP A CD1 
559  C CD2 . TRP A 69  ? 0.3367 0.3006 0.3485 0.0053  0.0279  0.0515  85   TRP A CD2 
560  N NE1 . TRP A 69  ? 0.3327 0.2965 0.3526 0.0040  0.0222  0.0568  85   TRP A NE1 
561  C CE2 . TRP A 69  ? 0.3339 0.2972 0.3468 0.0049  0.0225  0.0524  85   TRP A CE2 
562  C CE3 . TRP A 69  ? 0.3360 0.3001 0.3410 0.0059  0.0291  0.0470  85   TRP A CE3 
563  C CZ2 . TRP A 69  ? 0.3298 0.2926 0.3374 0.0052  0.0186  0.0491  85   TRP A CZ2 
564  C CZ3 . TRP A 69  ? 0.3346 0.2985 0.3346 0.0062  0.0250  0.0439  85   TRP A CZ3 
565  C CH2 . TRP A 69  ? 0.3312 0.2943 0.3326 0.0060  0.0199  0.0451  85   TRP A CH2 
566  N N   . ARG A 70  ? 0.3421 0.3055 0.3452 0.0062  0.0337  0.0545  86   ARG A N   
567  C CA  . ARG A 70  ? 0.3420 0.3060 0.3363 0.0069  0.0322  0.0517  86   ARG A CA  
568  C C   . ARG A 70  ? 0.3474 0.3128 0.3369 0.0073  0.0363  0.0519  86   ARG A C   
569  O O   . ARG A 70  ? 0.3517 0.3188 0.3338 0.0077  0.0360  0.0490  86   ARG A O   
570  C CB  . ARG A 70  ? 0.3403 0.3030 0.3333 0.0073  0.0268  0.0534  86   ARG A CB  
571  C CG  . ARG A 70  ? 0.3258 0.2875 0.3208 0.0069  0.0225  0.0516  86   ARG A CG  
572  C CD  . ARG A 70  ? 0.3185 0.2785 0.3124 0.0072  0.0178  0.0531  86   ARG A CD  
573  N NE  . ARG A 70  ? 0.3123 0.2714 0.3086 0.0067  0.0139  0.0514  86   ARG A NE  
574  C CZ  . ARG A 70  ? 0.3131 0.2716 0.3159 0.0055  0.0125  0.0534  86   ARG A CZ  
575  N NH1 . ARG A 70  ? 0.3130 0.2717 0.3212 0.0047  0.0146  0.0573  86   ARG A NH1 
576  N NH2 . ARG A 70  ? 0.3099 0.2682 0.3138 0.0050  0.0090  0.0516  86   ARG A NH2 
577  N N   . SER A 71  ? 0.3492 0.3143 0.3431 0.0071  0.0400  0.0555  87   SER A N   
578  C CA  . SER A 71  ? 0.3566 0.3232 0.3464 0.0074  0.0443  0.0562  87   SER A CA  
579  C C   . SER A 71  ? 0.3607 0.3283 0.3496 0.0069  0.0501  0.0526  87   SER A C   
580  O O   . SER A 71  ? 0.3666 0.3358 0.3512 0.0070  0.0541  0.0522  87   SER A O   
581  C CB  . SER A 71  ? 0.3565 0.3221 0.3515 0.0074  0.0456  0.0622  87   SER A CB  
582  O OG  . SER A 71  ? 0.3553 0.3197 0.3513 0.0076  0.0408  0.0654  87   SER A OG  
583  N N   . TYR A 72  ? 0.3594 0.3262 0.3524 0.0064  0.0507  0.0499  88   TYR A N   
584  C CA  . TYR A 72  ? 0.3644 0.3314 0.3588 0.0059  0.0568  0.0468  88   TYR A CA  
585  C C   . TYR A 72  ? 0.3706 0.3394 0.3564 0.0055  0.0585  0.0406  88   TYR A C   
586  O O   . TYR A 72  ? 0.3705 0.3406 0.3503 0.0056  0.0542  0.0382  88   TYR A O   
587  C CB  . TYR A 72  ? 0.3589 0.3245 0.3612 0.0058  0.0571  0.0465  88   TYR A CB  
588  C CG  . TYR A 72  ? 0.3555 0.3204 0.3674 0.0059  0.0569  0.0523  88   TYR A CG  
589  C CD1 . TYR A 72  ? 0.3606 0.3256 0.3746 0.0061  0.0581  0.0571  88   TYR A CD1 
590  C CD2 . TYR A 72  ? 0.3554 0.3200 0.3744 0.0059  0.0556  0.0532  88   TYR A CD2 
591  C CE1 . TYR A 72  ? 0.3604 0.3253 0.3836 0.0060  0.0577  0.0624  88   TYR A CE1 
592  C CE2 . TYR A 72  ? 0.3481 0.3131 0.3760 0.0058  0.0551  0.0587  88   TYR A CE2 
593  C CZ  . TYR A 72  ? 0.3528 0.3179 0.3828 0.0058  0.0561  0.0631  88   TYR A CZ  
594  O OH  . TYR A 72  ? 0.3567 0.3229 0.3959 0.0055  0.0555  0.0684  88   TYR A OH  
595  N N   . GLN A 73  ? 0.3780 0.3469 0.3634 0.0049  0.0649  0.0380  89   GLN A N   
596  C CA  . GLN A 73  ? 0.3868 0.3577 0.3646 0.0039  0.0674  0.0315  89   GLN A CA  
597  C C   . GLN A 73  ? 0.3855 0.3555 0.3649 0.0032  0.0670  0.0265  89   GLN A C   
598  O O   . GLN A 73  ? 0.3891 0.3612 0.3619 0.0025  0.0652  0.0217  89   GLN A O   
599  C CB  . GLN A 73  ? 0.3933 0.3645 0.3705 0.0032  0.0749  0.0300  89   GLN A CB  
600  C CG  . GLN A 73  ? 0.4022 0.3750 0.3757 0.0038  0.0759  0.0340  89   GLN A CG  
601  C CD  . GLN A 73  ? 0.4112 0.3881 0.3740 0.0036  0.0728  0.0323  89   GLN A CD  
602  O OE1 . GLN A 73  ? 0.4185 0.3978 0.3746 0.0025  0.0738  0.0263  89   GLN A OE1 
603  N NE2 . GLN A 73  ? 0.4048 0.3827 0.3660 0.0048  0.0692  0.0377  89   GLN A NE2 
604  N N   . SER A 74  ? 0.3837 0.3512 0.3722 0.0035  0.0687  0.0280  90   SER A N   
605  C CA  . SER A 74  ? 0.3831 0.3495 0.3743 0.0029  0.0694  0.0239  90   SER A CA  
606  C C   . SER A 74  ? 0.3804 0.3474 0.3703 0.0033  0.0624  0.0237  90   SER A C   
607  O O   . SER A 74  ? 0.3766 0.3428 0.3708 0.0042  0.0583  0.0284  90   SER A O   
608  C CB  . SER A 74  ? 0.3805 0.3445 0.3824 0.0033  0.0738  0.0263  90   SER A CB  
609  O OG  . SER A 74  ? 0.3730 0.3361 0.3783 0.0031  0.0740  0.0232  90   SER A OG  
610  N N   . GLU A 75  ? 0.3849 0.3534 0.3687 0.0025  0.0611  0.0182  91   GLU A N   
611  C CA  . GLU A 75  ? 0.3851 0.3542 0.3676 0.0029  0.0552  0.0172  91   GLU A CA  
612  C C   . GLU A 75  ? 0.3751 0.3420 0.3662 0.0033  0.0553  0.0186  91   GLU A C   
613  O O   . GLU A 75  ? 0.3702 0.3370 0.3628 0.0040  0.0501  0.0208  91   GLU A O   
614  C CB  . GLU A 75  ? 0.3927 0.3641 0.3680 0.0018  0.0549  0.0107  91   GLU A CB  
615  C CG  . GLU A 75  ? 0.4223 0.3973 0.3883 0.0015  0.0534  0.0097  91   GLU A CG  
616  C CD  . GLU A 75  ? 0.4524 0.4282 0.4161 0.0030  0.0471  0.0143  91   GLU A CD  
617  O OE1 . GLU A 75  ? 0.4657 0.4408 0.4308 0.0037  0.0424  0.0148  91   GLU A OE1 
618  O OE2 . GLU A 75  ? 0.4757 0.4526 0.4362 0.0035  0.0471  0.0175  91   GLU A OE2 
619  N N   . ASP A 76  ? 0.3725 0.3379 0.3692 0.0028  0.0614  0.0173  92   ASP A N   
620  C CA  . ASP A 76  ? 0.3654 0.3292 0.3710 0.0034  0.0624  0.0192  92   ASP A CA  
621  C C   . ASP A 76  ? 0.3564 0.3201 0.3683 0.0045  0.0598  0.0262  92   ASP A C   
622  O O   . ASP A 76  ? 0.3513 0.3153 0.3667 0.0051  0.0559  0.0283  92   ASP A O   
623  C CB  . ASP A 76  ? 0.3711 0.3331 0.3819 0.0028  0.0704  0.0169  92   ASP A CB  
624  C CG  . ASP A 76  ? 0.3763 0.3372 0.3968 0.0036  0.0719  0.0192  92   ASP A CG  
625  O OD1 . ASP A 76  ? 0.3894 0.3509 0.4100 0.0039  0.0676  0.0190  92   ASP A OD1 
626  O OD2 . ASP A 76  ? 0.3963 0.3557 0.4244 0.0041  0.0776  0.0215  92   ASP A OD2 
627  N N   . LEU A 77  ? 0.3529 0.3163 0.3662 0.0047  0.0619  0.0298  93   LEU A N   
628  C CA  . LEU A 77  ? 0.3441 0.3077 0.3635 0.0054  0.0596  0.0364  93   LEU A CA  
629  C C   . LEU A 77  ? 0.3360 0.3005 0.3517 0.0056  0.0519  0.0381  93   LEU A C   
630  O O   . LEU A 77  ? 0.3272 0.2923 0.3480 0.0059  0.0485  0.0415  93   LEU A O   
631  C CB  . LEU A 77  ? 0.3508 0.3142 0.3720 0.0055  0.0636  0.0395  93   LEU A CB  
632  C CG  . LEU A 77  ? 0.3585 0.3211 0.3889 0.0059  0.0701  0.0421  93   LEU A CG  
633  C CD1 . LEU A 77  ? 0.3713 0.3327 0.4042 0.0058  0.0754  0.0378  93   LEU A CD1 
634  C CD2 . LEU A 77  ? 0.3724 0.3348 0.4023 0.0059  0.0744  0.0439  93   LEU A CD2 
635  N N   . LYS A 78  ? 0.3329 0.2978 0.3400 0.0054  0.0495  0.0356  94   LYS A N   
636  C CA  . LYS A 78  ? 0.3284 0.2937 0.3318 0.0057  0.0428  0.0368  94   LYS A CA  
637  C C   . LYS A 78  ? 0.3235 0.2890 0.3274 0.0058  0.0390  0.0349  94   LYS A C   
638  O O   . LYS A 78  ? 0.3181 0.2835 0.3236 0.0059  0.0342  0.0373  94   LYS A O   
639  C CB  . LYS A 78  ? 0.3318 0.2980 0.3261 0.0057  0.0417  0.0344  94   LYS A CB  
640  C CG  . LYS A 78  ? 0.3339 0.3003 0.3270 0.0057  0.0444  0.0373  94   LYS A CG  
641  C CD  . LYS A 78  ? 0.3373 0.3052 0.3216 0.0060  0.0422  0.0363  94   LYS A CD  
642  C CE  . LYS A 78  ? 0.3435 0.3135 0.3212 0.0054  0.0451  0.0307  94   LYS A CE  
643  N NZ  . LYS A 78  ? 0.3444 0.3170 0.3136 0.0058  0.0424  0.0301  94   LYS A NZ  
644  N N   . ARG A 79  ? 0.3243 0.2900 0.3270 0.0055  0.0413  0.0303  95   ARG A N   
645  C CA  . ARG A 79  ? 0.3247 0.2907 0.3280 0.0057  0.0383  0.0283  95   ARG A CA  
646  C C   . ARG A 79  ? 0.3222 0.2883 0.3339 0.0060  0.0377  0.0323  95   ARG A C   
647  O O   . ARG A 79  ? 0.3203 0.2870 0.3323 0.0062  0.0331  0.0330  95   ARG A O   
648  C CB  . ARG A 79  ? 0.3254 0.2917 0.3266 0.0051  0.0416  0.0227  95   ARG A CB  
649  C CG  . ARG A 79  ? 0.3215 0.2882 0.3228 0.0053  0.0388  0.0204  95   ARG A CG  
650  C CD  . ARG A 79  ? 0.3196 0.2867 0.3181 0.0045  0.0417  0.0145  95   ARG A CD  
651  N NE  . ARG A 79  ? 0.3181 0.2857 0.3174 0.0048  0.0392  0.0127  95   ARG A NE  
652  C CZ  . ARG A 79  ? 0.3189 0.2876 0.3131 0.0051  0.0341  0.0111  95   ARG A CZ  
653  N NH1 . ARG A 79  ? 0.3104 0.2799 0.2983 0.0052  0.0308  0.0113  95   ARG A NH1 
654  N NH2 . ARG A 79  ? 0.3084 0.2776 0.3040 0.0053  0.0324  0.0097  95   ARG A NH2 
655  N N   . GLN A 80  ? 0.3263 0.2922 0.3447 0.0060  0.0426  0.0349  96   GLN A N   
656  C CA  . GLN A 80  ? 0.3266 0.2935 0.3536 0.0064  0.0425  0.0394  96   GLN A CA  
657  C C   . GLN A 80  ? 0.3277 0.2956 0.3561 0.0062  0.0375  0.0439  96   GLN A C   
658  O O   . GLN A 80  ? 0.3226 0.2921 0.3538 0.0062  0.0337  0.0459  96   GLN A O   
659  C CB  . GLN A 80  ? 0.3277 0.2943 0.3619 0.0067  0.0492  0.0416  96   GLN A CB  
660  C CG  . GLN A 80  ? 0.3290 0.2944 0.3644 0.0067  0.0547  0.0375  96   GLN A CG  
661  C CD  . GLN A 80  ? 0.3325 0.2974 0.3766 0.0072  0.0616  0.0401  96   GLN A CD  
662  O OE1 . GLN A 80  ? 0.3241 0.2906 0.3764 0.0080  0.0617  0.0454  96   GLN A OE1 
663  N NE2 . GLN A 80  ? 0.3367 0.2995 0.3790 0.0068  0.0675  0.0365  96   GLN A NE2 
664  N N   . PHE A 81  ? 0.3340 0.3012 0.3602 0.0060  0.0375  0.0455  97   PHE A N   
665  C CA  . PHE A 81  ? 0.3385 0.3062 0.3659 0.0055  0.0330  0.0493  97   PHE A CA  
666  C C   . PHE A 81  ? 0.3434 0.3108 0.3656 0.0053  0.0268  0.0474  97   PHE A C   
667  O O   . PHE A 81  ? 0.3389 0.3073 0.3640 0.0048  0.0228  0.0497  97   PHE A O   
668  C CB  . PHE A 81  ? 0.3408 0.3075 0.3666 0.0054  0.0346  0.0512  97   PHE A CB  
669  C CG  . PHE A 81  ? 0.3369 0.3045 0.3705 0.0053  0.0384  0.0558  97   PHE A CG  
670  C CD1 . PHE A 81  ? 0.3356 0.3049 0.3757 0.0047  0.0357  0.0606  97   PHE A CD1 
671  C CD2 . PHE A 81  ? 0.3408 0.3077 0.3756 0.0057  0.0449  0.0553  97   PHE A CD2 
672  C CE1 . PHE A 81  ? 0.3394 0.3101 0.3874 0.0046  0.0391  0.0652  97   PHE A CE1 
673  C CE2 . PHE A 81  ? 0.3419 0.3097 0.3844 0.0058  0.0487  0.0598  97   PHE A CE2 
674  C CZ  . PHE A 81  ? 0.3411 0.3110 0.3904 0.0053  0.0458  0.0650  97   PHE A CZ  
675  N N   . LYS A 82  ? 0.3538 0.3202 0.3686 0.0057  0.0262  0.0429  98   LYS A N   
676  C CA  . LYS A 82  ? 0.3661 0.3321 0.3761 0.0058  0.0209  0.0408  98   LYS A CA  
677  C C   . LYS A 82  ? 0.3648 0.3321 0.3779 0.0057  0.0186  0.0405  98   LYS A C   
678  O O   . LYS A 82  ? 0.3674 0.3349 0.3805 0.0053  0.0140  0.0414  98   LYS A O   
679  C CB  . LYS A 82  ? 0.3694 0.3349 0.3716 0.0063  0.0211  0.0362  98   LYS A CB  
680  C CG  . LYS A 82  ? 0.3893 0.3541 0.3862 0.0066  0.0160  0.0350  98   LYS A CG  
681  C CD  . LYS A 82  ? 0.4163 0.3817 0.4061 0.0072  0.0164  0.0309  98   LYS A CD  
682  C CE  . LYS A 82  ? 0.4303 0.3951 0.4153 0.0079  0.0117  0.0304  98   LYS A CE  
683  N NZ  . LYS A 82  ? 0.4398 0.4041 0.4265 0.0079  0.0079  0.0298  98   LYS A NZ  
684  N N   . ALA A 83  ? 0.3692 0.3375 0.3853 0.0060  0.0221  0.0394  99   ALA A N   
685  C CA  . ALA A 83  ? 0.3716 0.3416 0.3914 0.0061  0.0207  0.0398  99   ALA A CA  
686  C C   . ALA A 83  ? 0.3742 0.3463 0.4001 0.0055  0.0184  0.0447  99   ALA A C   
687  O O   . ALA A 83  ? 0.3714 0.3452 0.3976 0.0053  0.0144  0.0449  99   ALA A O   
688  C CB  . ALA A 83  ? 0.3717 0.3421 0.3950 0.0066  0.0258  0.0385  99   ALA A CB  
689  N N   . LEU A 84  ? 0.3790 0.3516 0.4097 0.0052  0.0208  0.0484  100  LEU A N   
690  C CA  . LEU A 84  ? 0.3835 0.3587 0.4206 0.0044  0.0188  0.0534  100  LEU A CA  
691  C C   . LEU A 84  ? 0.3874 0.3623 0.4218 0.0032  0.0132  0.0537  100  LEU A C   
692  O O   . LEU A 84  ? 0.3878 0.3655 0.4264 0.0022  0.0102  0.0566  100  LEU A O   
693  C CB  . LEU A 84  ? 0.3846 0.3604 0.4278 0.0044  0.0232  0.0573  100  LEU A CB  
694  C CG  . LEU A 84  ? 0.3868 0.3632 0.4352 0.0055  0.0293  0.0581  100  LEU A CG  
695  C CD1 . LEU A 84  ? 0.3918 0.3678 0.4447 0.0056  0.0338  0.0612  100  LEU A CD1 
696  C CD2 . LEU A 84  ? 0.3879 0.3681 0.4429 0.0058  0.0289  0.0610  100  LEU A CD2 
697  N N   . THR A 85  ? 0.3924 0.3641 0.4201 0.0033  0.0118  0.0509  101  THR A N   
698  C CA  . THR A 85  ? 0.3966 0.3671 0.4220 0.0023  0.0071  0.0510  101  THR A CA  
699  C C   . THR A 85  ? 0.3957 0.3667 0.4181 0.0021  0.0027  0.0482  101  THR A C   
700  O O   . THR A 85  ? 0.3994 0.3703 0.4217 0.0009  -0.0012 0.0485  101  THR A O   
701  C CB  . THR A 85  ? 0.4003 0.3673 0.4202 0.0027  0.0073  0.0496  101  THR A CB  
702  O OG1 . THR A 85  ? 0.4056 0.3714 0.4190 0.0039  0.0075  0.0453  101  THR A OG1 
703  C CG2 . THR A 85  ? 0.4004 0.3671 0.4227 0.0029  0.0116  0.0523  101  THR A CG2 
704  N N   . LYS A 86  ? 0.3923 0.3637 0.4124 0.0032  0.0038  0.0454  102  LYS A N   
705  C CA  . LYS A 86  ? 0.3913 0.3631 0.4081 0.0033  0.0003  0.0425  102  LYS A CA  
706  C C   . LYS A 86  ? 0.3821 0.3580 0.4037 0.0025  -0.0012 0.0447  102  LYS A C   
707  O O   . LYS A 86  ? 0.3841 0.3624 0.4091 0.0032  0.0013  0.0458  102  LYS A O   
708  C CB  . LYS A 86  ? 0.3937 0.3646 0.4060 0.0047  0.0021  0.0386  102  LYS A CB  
709  C CG  . LYS A 86  ? 0.4129 0.3808 0.4194 0.0053  0.0027  0.0362  102  LYS A CG  
710  C CD  . LYS A 86  ? 0.4386 0.4064 0.4413 0.0064  0.0047  0.0323  102  LYS A CD  
711  C CE  . LYS A 86  ? 0.4562 0.4223 0.4536 0.0069  0.0056  0.0305  102  LYS A CE  
712  N NZ  . LYS A 86  ? 0.4692 0.4359 0.4627 0.0076  0.0071  0.0264  102  LYS A NZ  
713  N N   . LEU A 87  ? 0.3735 0.3503 0.3955 0.0010  -0.0054 0.0454  103  LEU A N   
714  C CA  . LEU A 87  ? 0.3617 0.3433 0.3882 -0.0001 -0.0075 0.0479  103  LEU A CA  
715  C C   . LEU A 87  ? 0.3531 0.3366 0.3767 0.0001  -0.0098 0.0454  103  LEU A C   
716  O O   . LEU A 87  ? 0.3480 0.3363 0.3754 0.0000  -0.0101 0.0477  103  LEU A O   
717  C CB  . LEU A 87  ? 0.3630 0.3452 0.3915 -0.0024 -0.0108 0.0496  103  LEU A CB  
718  C CG  . LEU A 87  ? 0.3672 0.3502 0.4015 -0.0032 -0.0089 0.0539  103  LEU A CG  
719  C CD1 . LEU A 87  ? 0.3720 0.3548 0.4075 -0.0056 -0.0125 0.0545  103  LEU A CD1 
720  C CD2 . LEU A 87  ? 0.3666 0.3552 0.4080 -0.0030 -0.0068 0.0583  103  LEU A CD2 
721  N N   . GLY A 88  ? 0.3448 0.3248 0.3620 0.0007  -0.0113 0.0411  104  GLY A N   
722  C CA  . GLY A 88  ? 0.3356 0.3169 0.3495 0.0009  -0.0139 0.0384  104  GLY A CA  
723  C C   . GLY A 88  ? 0.3289 0.3134 0.3441 -0.0011 -0.0179 0.0393  104  GLY A C   
724  O O   . GLY A 88  ? 0.3284 0.3114 0.3439 -0.0028 -0.0199 0.0395  104  GLY A O   
725  N N   . TYR A 89  ? 0.3220 0.3112 0.3381 -0.0012 -0.0189 0.0399  105  TYR A N   
726  C CA  . TYR A 89  ? 0.3182 0.3117 0.3351 -0.0034 -0.0229 0.0405  105  TYR A CA  
727  C C   . TYR A 89  ? 0.3153 0.3121 0.3381 -0.0054 -0.0234 0.0448  105  TYR A C   
728  O O   . TYR A 89  ? 0.3163 0.3149 0.3392 -0.0079 -0.0270 0.0444  105  TYR A O   
729  C CB  . TYR A 89  ? 0.3164 0.3153 0.3334 -0.0029 -0.0234 0.0411  105  TYR A CB  
730  C CG  . TYR A 89  ? 0.3171 0.3135 0.3281 -0.0014 -0.0236 0.0367  105  TYR A CG  
731  C CD1 . TYR A 89  ? 0.3147 0.3052 0.3201 -0.0013 -0.0248 0.0322  105  TYR A CD1 
732  C CD2 . TYR A 89  ? 0.3109 0.3111 0.3223 -0.0001 -0.0226 0.0375  105  TYR A CD2 
733  C CE1 . TYR A 89  ? 0.3181 0.3067 0.3186 0.0000  -0.0250 0.0284  105  TYR A CE1 
734  C CE2 . TYR A 89  ? 0.3110 0.3092 0.3173 0.0011  -0.0227 0.0335  105  TYR A CE2 
735  C CZ  . TYR A 89  ? 0.3082 0.3007 0.3091 0.0012  -0.0240 0.0290  105  TYR A CZ  
736  O OH  . TYR A 89  ? 0.3066 0.2975 0.3029 0.0025  -0.0241 0.0253  105  TYR A OH  
737  N N   . ALA A 90  ? 0.3096 0.3071 0.3375 -0.0044 -0.0198 0.0486  106  ALA A N   
738  C CA  . ALA A 90  ? 0.3091 0.3101 0.3437 -0.0059 -0.0198 0.0532  106  ALA A CA  
739  C C   . ALA A 90  ? 0.3125 0.3099 0.3467 -0.0079 -0.0214 0.0523  106  ALA A C   
740  O O   . ALA A 90  ? 0.3125 0.3129 0.3520 -0.0097 -0.0221 0.0558  106  ALA A O   
741  C CB  . ALA A 90  ? 0.3065 0.3083 0.3466 -0.0041 -0.0148 0.0572  106  ALA A CB  
742  N N   . ALA A 91  ? 0.3141 0.3050 0.3423 -0.0074 -0.0220 0.0480  107  ALA A N   
743  C CA  . ALA A 91  ? 0.3186 0.3054 0.3462 -0.0091 -0.0234 0.0470  107  ALA A CA  
744  C C   . ALA A 91  ? 0.3231 0.3119 0.3503 -0.0121 -0.0279 0.0454  107  ALA A C   
745  O O   . ALA A 91  ? 0.3258 0.3128 0.3549 -0.0142 -0.0292 0.0455  107  ALA A O   
746  C CB  . ALA A 91  ? 0.3181 0.2979 0.3399 -0.0073 -0.0223 0.0434  107  ALA A CB  
747  N N   . LEU A 92  ? 0.3251 0.3177 0.3501 -0.0125 -0.0302 0.0437  108  LEU A N   
748  C CA  . LEU A 92  ? 0.3309 0.3260 0.3548 -0.0156 -0.0344 0.0414  108  LEU A CA  
749  C C   . LEU A 92  ? 0.3353 0.3367 0.3655 -0.0186 -0.0362 0.0451  108  LEU A C   
750  O O   . LEU A 92  ? 0.3315 0.3380 0.3671 -0.0179 -0.0345 0.0500  108  LEU A O   
751  C CB  . LEU A 92  ? 0.3298 0.3286 0.3498 -0.0150 -0.0360 0.0392  108  LEU A CB  
752  C CG  . LEU A 92  ? 0.3286 0.3220 0.3416 -0.0131 -0.0357 0.0343  108  LEU A CG  
753  C CD1 . LEU A 92  ? 0.3259 0.3242 0.3366 -0.0120 -0.0362 0.0338  108  LEU A CD1 
754  C CD2 . LEU A 92  ? 0.3320 0.3206 0.3414 -0.0150 -0.0381 0.0296  108  LEU A CD2 
755  N N   . PRO A 93  ? 0.3429 0.3442 0.3731 -0.0220 -0.0394 0.0428  109  PRO A N   
756  C CA  . PRO A 93  ? 0.3478 0.3563 0.3838 -0.0254 -0.0418 0.0458  109  PRO A CA  
757  C C   . PRO A 93  ? 0.3479 0.3661 0.3854 -0.0254 -0.0430 0.0486  109  PRO A C   
758  O O   . PRO A 93  ? 0.3463 0.3652 0.3790 -0.0239 -0.0433 0.0464  109  PRO A O   
759  C CB  . PRO A 93  ? 0.3542 0.3606 0.3876 -0.0291 -0.0453 0.0408  109  PRO A CB  
760  C CG  . PRO A 93  ? 0.3576 0.3537 0.3863 -0.0273 -0.0436 0.0369  109  PRO A CG  
761  C CD  . PRO A 93  ? 0.3485 0.3428 0.3736 -0.0230 -0.0409 0.0372  109  PRO A CD  
762  N N   . GLU A 94  ? 0.3500 0.3758 0.3946 -0.0270 -0.0436 0.0537  110  GLU A N   
763  C CA  . GLU A 94  ? 0.3511 0.3871 0.3986 -0.0268 -0.0445 0.0580  110  GLU A CA  
764  C C   . GLU A 94  ? 0.3556 0.3959 0.3974 -0.0278 -0.0478 0.0545  110  GLU A C   
765  O O   . GLU A 94  ? 0.3539 0.3974 0.3943 -0.0253 -0.0467 0.0559  110  GLU A O   
766  C CB  . GLU A 94  ? 0.3509 0.3952 0.4067 -0.0295 -0.0460 0.0631  110  GLU A CB  
767  C CG  . GLU A 94  ? 0.3518 0.4075 0.4121 -0.0289 -0.0465 0.0688  110  GLU A CG  
768  C CD  . GLU A 94  ? 0.3551 0.4193 0.4240 -0.0315 -0.0480 0.0743  110  GLU A CD  
769  O OE1 . GLU A 94  ? 0.3563 0.4165 0.4292 -0.0324 -0.0467 0.0751  110  GLU A OE1 
770  O OE2 . GLU A 94  ? 0.3593 0.4346 0.4311 -0.0327 -0.0504 0.0779  110  GLU A OE2 
771  N N   . ASP A 95  ? 0.3650 0.4051 0.4036 -0.0316 -0.0515 0.0498  111  ASP A N   
772  C CA  . ASP A 95  ? 0.3724 0.4166 0.4051 -0.0332 -0.0548 0.0459  111  ASP A CA  
773  C C   . ASP A 95  ? 0.3698 0.4070 0.3950 -0.0302 -0.0531 0.0414  111  ASP A C   
774  O O   . ASP A 95  ? 0.3687 0.4105 0.3904 -0.0293 -0.0540 0.0409  111  ASP A O   
775  C CB  . ASP A 95  ? 0.3816 0.4266 0.4129 -0.0383 -0.0588 0.0413  111  ASP A CB  
776  C CG  . ASP A 95  ? 0.3956 0.4501 0.4340 -0.0420 -0.0613 0.0455  111  ASP A CG  
777  O OD1 . ASP A 95  ? 0.4058 0.4691 0.4491 -0.0408 -0.0609 0.0520  111  ASP A OD1 
778  O OD2 . ASP A 95  ? 0.4178 0.4711 0.4572 -0.0461 -0.0635 0.0424  111  ASP A OD2 
779  N N   . ASP A 96  ? 0.3669 0.3935 0.3901 -0.0285 -0.0508 0.0385  112  ASP A N   
780  C CA  . ASP A 96  ? 0.3655 0.3852 0.3822 -0.0255 -0.0491 0.0345  112  ASP A CA  
781  C C   . ASP A 96  ? 0.3568 0.3783 0.3742 -0.0215 -0.0460 0.0380  112  ASP A C   
782  O O   . ASP A 96  ? 0.3547 0.3758 0.3673 -0.0197 -0.0456 0.0357  112  ASP A O   
783  C CB  . ASP A 96  ? 0.3674 0.3764 0.3825 -0.0246 -0.0473 0.0315  112  ASP A CB  
784  C CG  . ASP A 96  ? 0.3813 0.3866 0.3944 -0.0281 -0.0498 0.0265  112  ASP A CG  
785  O OD1 . ASP A 96  ? 0.3929 0.4033 0.4042 -0.0312 -0.0530 0.0240  112  ASP A OD1 
786  O OD2 . ASP A 96  ? 0.3940 0.3914 0.4073 -0.0279 -0.0485 0.0251  112  ASP A OD2 
787  N N   . TYR A 97  ? 0.3507 0.3739 0.3743 -0.0202 -0.0434 0.0435  113  TYR A N   
788  C CA  . TYR A 97  ? 0.3451 0.3700 0.3706 -0.0166 -0.0400 0.0471  113  TYR A CA  
789  C C   . TYR A 97  ? 0.3426 0.3772 0.3689 -0.0167 -0.0415 0.0497  113  TYR A C   
790  O O   . TYR A 97  ? 0.3390 0.3739 0.3632 -0.0141 -0.0396 0.0498  113  TYR A O   
791  C CB  . TYR A 97  ? 0.3436 0.3684 0.3762 -0.0154 -0.0366 0.0523  113  TYR A CB  
792  C CG  . TYR A 97  ? 0.3452 0.3701 0.3798 -0.0118 -0.0323 0.0551  113  TYR A CG  
793  C CD1 . TYR A 97  ? 0.3548 0.3721 0.3854 -0.0092 -0.0294 0.0519  113  TYR A CD1 
794  C CD2 . TYR A 97  ? 0.3514 0.3841 0.3922 -0.0110 -0.0311 0.0611  113  TYR A CD2 
795  C CE1 . TYR A 97  ? 0.3582 0.3755 0.3908 -0.0062 -0.0253 0.0540  113  TYR A CE1 
796  C CE2 . TYR A 97  ? 0.3518 0.3841 0.3951 -0.0077 -0.0266 0.0635  113  TYR A CE2 
797  C CZ  . TYR A 97  ? 0.3520 0.3763 0.3910 -0.0055 -0.0238 0.0597  113  TYR A CZ  
798  O OH  . TYR A 97  ? 0.3558 0.3795 0.3974 -0.0027 -0.0192 0.0615  113  TYR A OH  
799  N N   . ALA A 98  ? 0.3424 0.3851 0.3717 -0.0198 -0.0447 0.0520  114  ALA A N   
800  C CA  . ALA A 98  ? 0.3425 0.3957 0.3723 -0.0203 -0.0467 0.0550  114  ALA A CA  
801  C C   . ALA A 98  ? 0.3436 0.3964 0.3653 -0.0205 -0.0486 0.0496  114  ALA A C   
802  O O   . ALA A 98  ? 0.3433 0.4010 0.3640 -0.0187 -0.0480 0.0515  114  ALA A O   
803  C CB  . ALA A 98  ? 0.3432 0.4057 0.3776 -0.0240 -0.0502 0.0581  114  ALA A CB  
804  N N   . GLU A 99  ? 0.3467 0.3934 0.3629 -0.0227 -0.0507 0.0431  115  GLU A N   
805  C CA  . GLU A 99  ? 0.3508 0.3959 0.3591 -0.0229 -0.0522 0.0374  115  GLU A CA  
806  C C   . GLU A 99  ? 0.3461 0.3852 0.3513 -0.0187 -0.0488 0.0361  115  GLU A C   
807  O O   . GLU A 99  ? 0.3453 0.3874 0.3466 -0.0176 -0.0490 0.0350  115  GLU A O   
808  C CB  . GLU A 99  ? 0.3578 0.3968 0.3620 -0.0260 -0.0545 0.0308  115  GLU A CB  
809  C CG  . GLU A 99  ? 0.3714 0.4095 0.3678 -0.0268 -0.0562 0.0247  115  GLU A CG  
810  C CD  . GLU A 99  ? 0.3894 0.4203 0.3823 -0.0295 -0.0577 0.0181  115  GLU A CD  
811  O OE1 . GLU A 99  ? 0.4007 0.4272 0.3973 -0.0309 -0.0575 0.0182  115  GLU A OE1 
812  O OE2 . GLU A 99  ? 0.4039 0.4333 0.3906 -0.0302 -0.0588 0.0127  115  GLU A OE2 
813  N N   . LEU A 100 ? 0.3405 0.3717 0.3475 -0.0165 -0.0456 0.0363  116  LEU A N   
814  C CA  . LEU A 100 ? 0.3373 0.3631 0.3419 -0.0128 -0.0423 0.0350  116  LEU A CA  
815  C C   . LEU A 100 ? 0.3337 0.3657 0.3415 -0.0104 -0.0401 0.0399  116  LEU A C   
816  O O   . LEU A 100 ? 0.3321 0.3638 0.3364 -0.0085 -0.0390 0.0383  116  LEU A O   
817  C CB  . LEU A 100 ? 0.3337 0.3510 0.3397 -0.0112 -0.0394 0.0346  116  LEU A CB  
818  C CG  . LEU A 100 ? 0.3307 0.3426 0.3346 -0.0077 -0.0359 0.0332  116  LEU A CG  
819  C CD1 . LEU A 100 ? 0.3256 0.3345 0.3226 -0.0071 -0.0370 0.0278  116  LEU A CD1 
820  C CD2 . LEU A 100 ? 0.3226 0.3274 0.3278 -0.0067 -0.0336 0.0330  116  LEU A CD2 
821  N N   . LEU A 101 ? 0.3325 0.3700 0.3472 -0.0105 -0.0391 0.0460  117  LEU A N   
822  C CA  . LEU A 101 ? 0.3315 0.3755 0.3506 -0.0083 -0.0368 0.0514  117  LEU A CA  
823  C C   . LEU A 101 ? 0.3331 0.3850 0.3490 -0.0090 -0.0394 0.0517  117  LEU A C   
824  O O   . LEU A 101 ? 0.3308 0.3846 0.3466 -0.0065 -0.0372 0.0532  117  LEU A O   
825  C CB  . LEU A 101 ? 0.3310 0.3802 0.3587 -0.0085 -0.0356 0.0582  117  LEU A CB  
826  C CG  . LEU A 101 ? 0.3327 0.3757 0.3651 -0.0072 -0.0318 0.0597  117  LEU A CG  
827  C CD1 . LEU A 101 ? 0.3431 0.3929 0.3840 -0.0079 -0.0314 0.0665  117  LEU A CD1 
828  C CD2 . LEU A 101 ? 0.3361 0.3741 0.3689 -0.0037 -0.0269 0.0596  117  LEU A CD2 
829  N N   . ASP A 102 ? 0.3385 0.3952 0.3519 -0.0124 -0.0438 0.0500  118  ASP A N   
830  C CA  . ASP A 102 ? 0.3451 0.4097 0.3544 -0.0136 -0.0467 0.0495  118  ASP A CA  
831  C C   . ASP A 102 ? 0.3430 0.4019 0.3446 -0.0123 -0.0462 0.0436  118  ASP A C   
832  O O   . ASP A 102 ? 0.3425 0.4065 0.3419 -0.0111 -0.0461 0.0445  118  ASP A O   
833  C CB  . ASP A 102 ? 0.3537 0.4236 0.3613 -0.0182 -0.0516 0.0478  118  ASP A CB  
834  C CG  . ASP A 102 ? 0.3681 0.4472 0.3835 -0.0197 -0.0527 0.0546  118  ASP A CG  
835  O OD1 . ASP A 102 ? 0.3854 0.4695 0.4068 -0.0171 -0.0502 0.0614  118  ASP A OD1 
836  O OD2 . ASP A 102 ? 0.3929 0.4744 0.4087 -0.0235 -0.0561 0.0532  118  ASP A OD2 
837  N N   . THR A 103 ? 0.3412 0.3900 0.3393 -0.0123 -0.0458 0.0379  119  THR A N   
838  C CA  . THR A 103 ? 0.3394 0.3821 0.3308 -0.0110 -0.0452 0.0321  119  THR A CA  
839  C C   . THR A 103 ? 0.3319 0.3726 0.3247 -0.0070 -0.0411 0.0341  119  THR A C   
840  O O   . THR A 103 ? 0.3297 0.3718 0.3187 -0.0057 -0.0407 0.0325  119  THR A O   
841  C CB  . THR A 103 ? 0.3424 0.3752 0.3307 -0.0119 -0.0456 0.0264  119  THR A CB  
842  O OG1 . THR A 103 ? 0.3492 0.3837 0.3368 -0.0158 -0.0491 0.0244  119  THR A OG1 
843  C CG2 . THR A 103 ? 0.3434 0.3704 0.3252 -0.0104 -0.0450 0.0207  119  THR A CG2 
844  N N   . LEU A 104 ? 0.3252 0.3628 0.3235 -0.0053 -0.0380 0.0373  120  LEU A N   
845  C CA  . LEU A 104 ? 0.3206 0.3558 0.3210 -0.0019 -0.0337 0.0389  120  LEU A CA  
846  C C   . LEU A 104 ? 0.3215 0.3650 0.3249 -0.0005 -0.0325 0.0439  120  LEU A C   
847  O O   . LEU A 104 ? 0.3199 0.3626 0.3218 0.0016  -0.0303 0.0432  120  LEU A O   
848  C CB  . LEU A 104 ? 0.3164 0.3471 0.3223 -0.0008 -0.0305 0.0411  120  LEU A CB  
849  C CG  . LEU A 104 ? 0.3167 0.3384 0.3199 -0.0012 -0.0306 0.0367  120  LEU A CG  
850  C CD1 . LEU A 104 ? 0.3163 0.3352 0.3251 -0.0004 -0.0274 0.0397  120  LEU A CD1 
851  C CD2 . LEU A 104 ? 0.3144 0.3300 0.3120 0.0003  -0.0298 0.0314  120  LEU A CD2 
852  N N   . SER A 105 ? 0.3218 0.3736 0.3298 -0.0017 -0.0338 0.0494  121  SER A N   
853  C CA  . SER A 105 ? 0.3245 0.3852 0.3359 -0.0004 -0.0327 0.0551  121  SER A CA  
854  C C   . SER A 105 ? 0.3269 0.3923 0.3317 -0.0010 -0.0353 0.0526  121  SER A C   
855  O O   . SER A 105 ? 0.3261 0.3953 0.3314 0.0009  -0.0334 0.0552  121  SER A O   
856  C CB  . SER A 105 ? 0.3228 0.3919 0.3415 -0.0013 -0.0333 0.0622  121  SER A CB  
857  O OG  . SER A 105 ? 0.3377 0.4101 0.3542 -0.0049 -0.0380 0.0607  121  SER A OG  
858  N N   . ALA A 106 ? 0.3315 0.3963 0.3301 -0.0040 -0.0394 0.0475  122  ALA A N   
859  C CA  . ALA A 106 ? 0.3372 0.4054 0.3285 -0.0049 -0.0419 0.0439  122  ALA A CA  
860  C C   . ALA A 106 ? 0.3371 0.3990 0.3245 -0.0023 -0.0393 0.0401  122  ALA A C   
861  O O   . ALA A 106 ? 0.3373 0.4039 0.3220 -0.0013 -0.0390 0.0405  122  ALA A O   
862  C CB  . ALA A 106 ? 0.3424 0.4095 0.3283 -0.0087 -0.0462 0.0383  122  ALA A CB  
863  N N   . MET A 107 ? 0.3360 0.3879 0.3234 -0.0011 -0.0373 0.0365  123  MET A N   
864  C CA  . MET A 107 ? 0.3387 0.3845 0.3228 0.0012  -0.0348 0.0328  123  MET A CA  
865  C C   . MET A 107 ? 0.3363 0.3838 0.3255 0.0043  -0.0306 0.0373  123  MET A C   
866  O O   . MET A 107 ? 0.3328 0.3812 0.3197 0.0059  -0.0293 0.0364  123  MET A O   
867  C CB  . MET A 107 ? 0.3378 0.3732 0.3203 0.0014  -0.0342 0.0278  123  MET A CB  
868  C CG  . MET A 107 ? 0.3500 0.3822 0.3272 -0.0011 -0.0377 0.0225  123  MET A CG  
869  S SD  . MET A 107 ? 0.3728 0.3932 0.3476 -0.0001 -0.0366 0.0169  123  MET A SD  
870  C CE  . MET A 107 ? 0.3571 0.3748 0.3386 0.0002  -0.0346 0.0209  123  MET A CE  
871  N N   . GLU A 108 ? 0.3377 0.3856 0.3341 0.0050  -0.0283 0.0421  124  GLU A N   
872  C CA  . GLU A 108 ? 0.3401 0.3891 0.3424 0.0078  -0.0237 0.0464  124  GLU A CA  
873  C C   . GLU A 108 ? 0.3367 0.3956 0.3407 0.0085  -0.0236 0.0518  124  GLU A C   
874  O O   . GLU A 108 ? 0.3346 0.3942 0.3401 0.0107  -0.0206 0.0532  124  GLU A O   
875  C CB  . GLU A 108 ? 0.3415 0.3881 0.3512 0.0084  -0.0207 0.0501  124  GLU A CB  
876  C CG  . GLU A 108 ? 0.3629 0.4084 0.3785 0.0111  -0.0152 0.0530  124  GLU A CG  
877  C CD  . GLU A 108 ? 0.3937 0.4359 0.4164 0.0117  -0.0117 0.0557  124  GLU A CD  
878  O OE1 . GLU A 108 ? 0.4117 0.4568 0.4377 0.0105  -0.0129 0.0590  124  GLU A OE1 
879  O OE2 . GLU A 108 ? 0.4015 0.4385 0.4266 0.0133  -0.0074 0.0543  124  GLU A OE2 
880  N N   . SER A 109 ? 0.3375 0.4044 0.3415 0.0065  -0.0271 0.0549  125  SER A N   
881  C CA  . SER A 109 ? 0.3378 0.4154 0.3429 0.0069  -0.0275 0.0604  125  SER A CA  
882  C C   . SER A 109 ? 0.3377 0.4170 0.3352 0.0069  -0.0290 0.0565  125  SER A C   
883  O O   . SER A 109 ? 0.3381 0.4230 0.3367 0.0088  -0.0272 0.0603  125  SER A O   
884  C CB  . SER A 109 ? 0.3406 0.4274 0.3478 0.0045  -0.0311 0.0647  125  SER A CB  
885  O OG  . SER A 109 ? 0.3513 0.4379 0.3511 0.0012  -0.0360 0.0591  125  SER A OG  
886  N N   . ASN A 110 ? 0.3363 0.4106 0.3261 0.0050  -0.0320 0.0491  126  ASN A N   
887  C CA  . ASN A 110 ? 0.3376 0.4120 0.3199 0.0051  -0.0329 0.0445  126  ASN A CA  
888  C C   . ASN A 110 ? 0.3331 0.4033 0.3168 0.0084  -0.0286 0.0443  126  ASN A C   
889  O O   . ASN A 110 ? 0.3317 0.4071 0.3142 0.0097  -0.0276 0.0462  126  ASN A O   
890  C CB  . ASN A 110 ? 0.3407 0.4083 0.3159 0.0029  -0.0359 0.0364  126  ASN A CB  
891  C CG  . ASN A 110 ? 0.3437 0.4106 0.3114 0.0032  -0.0364 0.0313  126  ASN A CG  
892  O OD1 . ASN A 110 ? 0.3450 0.4046 0.3111 0.0050  -0.0342 0.0275  126  ASN A OD1 
893  N ND2 . ASN A 110 ? 0.3407 0.4156 0.3037 0.0013  -0.0391 0.0312  126  ASN A ND2 
894  N N   . PHE A 111 ? 0.3276 0.3887 0.3139 0.0095  -0.0260 0.0420  127  PHE A N   
895  C CA  . PHE A 111 ? 0.3263 0.3830 0.3148 0.0123  -0.0218 0.0414  127  PHE A CA  
896  C C   . PHE A 111 ? 0.3264 0.3893 0.3216 0.0143  -0.0183 0.0485  127  PHE A C   
897  O O   . PHE A 111 ? 0.3269 0.3912 0.3216 0.0161  -0.0161 0.0489  127  PHE A O   
898  C CB  . PHE A 111 ? 0.3229 0.3702 0.3139 0.0127  -0.0198 0.0386  127  PHE A CB  
899  C CG  . PHE A 111 ? 0.3191 0.3615 0.3114 0.0150  -0.0160 0.0366  127  PHE A CG  
900  C CD1 . PHE A 111 ? 0.3150 0.3585 0.3147 0.0168  -0.0115 0.0411  127  PHE A CD1 
901  C CD2 . PHE A 111 ? 0.3214 0.3583 0.3080 0.0152  -0.0167 0.0302  127  PHE A CD2 
902  C CE1 . PHE A 111 ? 0.3112 0.3504 0.3123 0.0185  -0.0079 0.0389  127  PHE A CE1 
903  C CE2 . PHE A 111 ? 0.3195 0.3527 0.3076 0.0170  -0.0134 0.0284  127  PHE A CE2 
904  C CZ  . PHE A 111 ? 0.3137 0.3480 0.3089 0.0185  -0.0090 0.0325  127  PHE A CZ  
905  N N   . ALA A 112 ? 0.3266 0.3931 0.3285 0.0142  -0.0175 0.0545  128  ALA A N   
906  C CA  . ALA A 112 ? 0.3286 0.4005 0.3384 0.0164  -0.0136 0.0620  128  ALA A CA  
907  C C   . ALA A 112 ? 0.3337 0.4161 0.3418 0.0168  -0.0148 0.0664  128  ALA A C   
908  O O   . ALA A 112 ? 0.3339 0.4199 0.3470 0.0191  -0.0111 0.0714  128  ALA A O   
909  C CB  . ALA A 112 ? 0.3257 0.3990 0.3433 0.0162  -0.0125 0.0672  128  ALA A CB  
910  N N   . LYS A 113 ? 0.3413 0.4286 0.3426 0.0144  -0.0198 0.0644  129  LYS A N   
911  C CA  . LYS A 113 ? 0.3507 0.4492 0.3495 0.0143  -0.0217 0.0684  129  LYS A CA  
912  C C   . LYS A 113 ? 0.3545 0.4528 0.3455 0.0147  -0.0221 0.0637  129  LYS A C   
913  O O   . LYS A 113 ? 0.3590 0.4667 0.3471 0.0147  -0.0234 0.0667  129  LYS A O   
914  C CB  . LYS A 113 ? 0.3553 0.4612 0.3513 0.0112  -0.0268 0.0693  129  LYS A CB  
915  C CG  . LYS A 113 ? 0.3649 0.4760 0.3696 0.0112  -0.0263 0.0769  129  LYS A CG  
916  C CD  . LYS A 113 ? 0.3917 0.5111 0.3934 0.0078  -0.0318 0.0775  129  LYS A CD  
917  C CE  . LYS A 113 ? 0.4013 0.5277 0.4120 0.0080  -0.0314 0.0859  129  LYS A CE  
918  N NZ  . LYS A 113 ? 0.4195 0.5568 0.4275 0.0047  -0.0369 0.0876  129  LYS A NZ  
919  N N   . VAL A 114 ? 0.3549 0.4432 0.3426 0.0151  -0.0210 0.0568  130  VAL A N   
920  C CA  . VAL A 114 ? 0.3597 0.4469 0.3402 0.0156  -0.0212 0.0520  130  VAL A CA  
921  C C   . VAL A 114 ? 0.3638 0.4571 0.3472 0.0182  -0.0178 0.0573  130  VAL A C   
922  O O   . VAL A 114 ? 0.3581 0.4494 0.3492 0.0205  -0.0133 0.0612  130  VAL A O   
923  C CB  . VAL A 114 ? 0.3573 0.4328 0.3355 0.0160  -0.0201 0.0444  130  VAL A CB  
924  C CG1 . VAL A 114 ? 0.3588 0.4336 0.3316 0.0173  -0.0191 0.0407  130  VAL A CG1 
925  C CG2 . VAL A 114 ? 0.3541 0.4243 0.3277 0.0134  -0.0238 0.0386  130  VAL A CG2 
926  N N   . LYS A 115 ? 0.3747 0.4755 0.3520 0.0177  -0.0197 0.0574  131  LYS A N   
927  C CA  . LYS A 115 ? 0.3835 0.4903 0.3621 0.0202  -0.0167 0.0619  131  LYS A CA  
928  C C   . LYS A 115 ? 0.3907 0.4968 0.3599 0.0198  -0.0180 0.0557  131  LYS A C   
929  O O   . LYS A 115 ? 0.3950 0.5023 0.3564 0.0172  -0.0221 0.0508  131  LYS A O   
930  C CB  . LYS A 115 ? 0.3868 0.5066 0.3679 0.0202  -0.0176 0.0706  131  LYS A CB  
931  C CG  . LYS A 115 ? 0.3909 0.5128 0.3820 0.0209  -0.0161 0.0779  131  LYS A CG  
932  C CD  . LYS A 115 ? 0.4030 0.5229 0.4036 0.0243  -0.0098 0.0834  131  LYS A CD  
933  C CE  . LYS A 115 ? 0.4082 0.5344 0.4187 0.0254  -0.0080 0.0929  131  LYS A CE  
934  N NZ  . LYS A 115 ? 0.4173 0.5372 0.4321 0.0242  -0.0085 0.0916  131  LYS A NZ  
935  N N   . VAL A 116 ? 0.3950 0.4993 0.3654 0.0223  -0.0142 0.0558  132  VAL A N   
936  C CA  . VAL A 116 ? 0.4064 0.5105 0.3686 0.0224  -0.0147 0.0506  132  VAL A CA  
937  C C   . VAL A 116 ? 0.4160 0.5295 0.3787 0.0244  -0.0123 0.0564  132  VAL A C   
938  O O   . VAL A 116 ? 0.4133 0.5314 0.3838 0.0262  -0.0094 0.0643  132  VAL A O   
939  C CB  . VAL A 116 ? 0.4024 0.4952 0.3642 0.0234  -0.0127 0.0437  132  VAL A CB  
940  C CG1 . VAL A 116 ? 0.3989 0.4829 0.3608 0.0217  -0.0147 0.0386  132  VAL A CG1 
941  C CG2 . VAL A 116 ? 0.3972 0.4879 0.3670 0.0263  -0.0074 0.0473  132  VAL A CG2 
942  N N   . CYS A 117 ? 0.4297 0.5457 0.3840 0.0241  -0.0133 0.0525  133  CYS A N   
943  C CA  . CYS A 117 ? 0.4441 0.5688 0.3977 0.0260  -0.0111 0.0575  133  CYS A CA  
944  C C   . CYS A 117 ? 0.4445 0.5634 0.4020 0.0288  -0.0061 0.0568  133  CYS A C   
945  O O   . CYS A 117 ? 0.4416 0.5507 0.3979 0.0288  -0.0056 0.0499  133  CYS A O   
946  C CB  . CYS A 117 ? 0.4531 0.5842 0.3956 0.0241  -0.0143 0.0538  133  CYS A CB  
947  S SG  . CYS A 117 ? 0.4766 0.6158 0.4141 0.0202  -0.0203 0.0541  133  CYS A SG  
948  N N   . ASP A 118 ? 0.4503 0.5756 0.4130 0.0313  -0.0024 0.0643  134  ASP A N   
949  C CA  . ASP A 118 ? 0.4551 0.5764 0.4223 0.0340  0.0025  0.0647  134  ASP A CA  
950  C C   . ASP A 118 ? 0.4616 0.5805 0.4204 0.0339  0.0020  0.0576  134  ASP A C   
951  O O   . ASP A 118 ? 0.4677 0.5932 0.4179 0.0329  -0.0003 0.0564  134  ASP A O   
952  C CB  . ASP A 118 ? 0.4577 0.5881 0.4313 0.0364  0.0063  0.0747  134  ASP A CB  
953  C CG  . ASP A 118 ? 0.4615 0.5870 0.4429 0.0391  0.0122  0.0761  134  ASP A CG  
954  O OD1 . ASP A 118 ? 0.4729 0.5940 0.4508 0.0396  0.0133  0.0706  134  ASP A OD1 
955  O OD2 . ASP A 118 ? 0.4683 0.5945 0.4599 0.0406  0.0159  0.0829  134  ASP A OD2 
956  N N   . TYR A 119 ? 0.4632 0.5729 0.4245 0.0349  0.0045  0.0528  135  TYR A N   
957  C CA  . TYR A 119 ? 0.4704 0.5769 0.4253 0.0353  0.0048  0.0463  135  TYR A CA  
958  C C   . TYR A 119 ? 0.4813 0.5964 0.4336 0.0369  0.0071  0.0501  135  TYR A C   
959  O O   . TYR A 119 ? 0.4859 0.6024 0.4296 0.0365  0.0059  0.0455  135  TYR A O   
960  C CB  . TYR A 119 ? 0.4630 0.5597 0.4234 0.0364  0.0077  0.0424  135  TYR A CB  
961  C CG  . TYR A 119 ? 0.4588 0.5518 0.4141 0.0371  0.0083  0.0360  135  TYR A CG  
962  C CD1 . TYR A 119 ? 0.4577 0.5478 0.4040 0.0355  0.0048  0.0289  135  TYR A CD1 
963  C CD2 . TYR A 119 ? 0.4538 0.5459 0.4137 0.0393  0.0128  0.0370  135  TYR A CD2 
964  C CE1 . TYR A 119 ? 0.4620 0.5486 0.4042 0.0363  0.0057  0.0232  135  TYR A CE1 
965  C CE2 . TYR A 119 ? 0.4574 0.5464 0.4132 0.0400  0.0135  0.0314  135  TYR A CE2 
966  C CZ  . TYR A 119 ? 0.4582 0.5445 0.4052 0.0386  0.0100  0.0246  135  TYR A CZ  
967  O OH  . TYR A 119 ? 0.4589 0.5421 0.4023 0.0396  0.0110  0.0193  135  TYR A OH  
968  N N   . LYS A 120 ? 0.4882 0.6088 0.4479 0.0389  0.0106  0.0586  136  LYS A N   
969  C CA  . LYS A 120 ? 0.5018 0.6308 0.4606 0.0409  0.0135  0.0636  136  LYS A CA  
970  C C   . LYS A 120 ? 0.5103 0.6518 0.4652 0.0403  0.0113  0.0700  136  LYS A C   
971  O O   . LYS A 120 ? 0.5163 0.6662 0.4674 0.0414  0.0125  0.0732  136  LYS A O   
972  C CB  . LYS A 120 ? 0.4990 0.6266 0.4691 0.0435  0.0194  0.0692  136  LYS A CB  
973  C CG  . LYS A 120 ? 0.5047 0.6215 0.4789 0.0440  0.0218  0.0632  136  LYS A CG  
974  C CD  . LYS A 120 ? 0.5181 0.6330 0.5047 0.0459  0.0274  0.0687  136  LYS A CD  
975  C CE  . LYS A 120 ? 0.5236 0.6292 0.5140 0.0462  0.0299  0.0626  136  LYS A CE  
976  N NZ  . LYS A 120 ? 0.5279 0.6245 0.5188 0.0443  0.0273  0.0564  136  LYS A NZ  
977  N N   . ASP A 121 ? 0.5132 0.6564 0.4693 0.0386  0.0081  0.0720  137  ASP A N   
978  C CA  . ASP A 121 ? 0.5215 0.6773 0.4751 0.0379  0.0057  0.0787  137  ASP A CA  
979  C C   . ASP A 121 ? 0.5250 0.6811 0.4723 0.0344  -0.0001 0.0744  137  ASP A C   
980  O O   . ASP A 121 ? 0.5217 0.6753 0.4745 0.0335  -0.0014 0.0761  137  ASP A O   
981  C CB  . ASP A 121 ? 0.5188 0.6792 0.4840 0.0401  0.0091  0.0895  137  ASP A CB  
982  C CG  . ASP A 121 ? 0.5276 0.7030 0.4911 0.0404  0.0079  0.0982  137  ASP A CG  
983  O OD1 . ASP A 121 ? 0.5406 0.7233 0.4934 0.0389  0.0046  0.0958  137  ASP A OD1 
984  O OD2 . ASP A 121 ? 0.5269 0.7071 0.4999 0.0422  0.0105  0.1077  137  ASP A OD2 
985  N N   . SER A 122 ? 0.5329 0.6923 0.4688 0.0323  -0.0035 0.0686  138  SER A N   
986  C CA  . SER A 122 ? 0.5372 0.6963 0.4664 0.0286  -0.0090 0.0631  138  SER A CA  
987  C C   . SER A 122 ? 0.5382 0.7081 0.4687 0.0271  -0.0122 0.0699  138  SER A C   
988  O O   . SER A 122 ? 0.5409 0.7106 0.4677 0.0239  -0.0166 0.0662  138  SER A O   
989  C CB  . SER A 122 ? 0.5448 0.7045 0.4617 0.0267  -0.0113 0.0549  138  SER A CB  
990  O OG  . SER A 122 ? 0.5557 0.7282 0.4672 0.0270  -0.0111 0.0592  138  SER A OG  
991  N N   . THR A 123 ? 0.5371 0.7166 0.4733 0.0294  -0.0097 0.0802  139  THR A N   
992  C CA  . THR A 123 ? 0.5370 0.7278 0.4761 0.0285  -0.0122 0.0882  139  THR A CA  
993  C C   . THR A 123 ? 0.5267 0.7130 0.4781 0.0297  -0.0104 0.0936  139  THR A C   
994  O O   . THR A 123 ? 0.5272 0.7203 0.4815 0.0286  -0.0130 0.0988  139  THR A O   
995  C CB  . THR A 123 ? 0.5423 0.7484 0.4803 0.0302  -0.0110 0.0972  139  THR A CB  
996  O OG1 . THR A 123 ? 0.5526 0.7707 0.4905 0.0285  -0.0148 0.1033  139  THR A OG1 
997  C CG2 . THR A 123 ? 0.5388 0.7444 0.4877 0.0347  -0.0046 0.1057  139  THR A CG2 
998  N N   . LYS A 124 ? 0.5158 0.6907 0.4743 0.0319  -0.0060 0.0921  140  LYS A N   
999  C CA  . LYS A 124 ? 0.5040 0.6731 0.4740 0.0331  -0.0037 0.0961  140  LYS A CA  
1000 C C   . LYS A 124 ? 0.4958 0.6531 0.4643 0.0307  -0.0062 0.0874  140  LYS A C   
1001 O O   . LYS A 124 ? 0.4913 0.6376 0.4594 0.0310  -0.0045 0.0807  140  LYS A O   
1002 C CB  . LYS A 124 ? 0.5014 0.6657 0.4805 0.0366  0.0029  0.0999  140  LYS A CB  
1003 C CG  . LYS A 124 ? 0.5027 0.6618 0.4944 0.0380  0.0062  0.1046  140  LYS A CG  
1004 C CD  . LYS A 124 ? 0.5106 0.6631 0.5107 0.0408  0.0127  0.1061  140  LYS A CD  
1005 C CE  . LYS A 124 ? 0.5084 0.6528 0.5196 0.0414  0.0159  0.1076  140  LYS A CE  
1006 N NZ  . LYS A 124 ? 0.5117 0.6636 0.5308 0.0423  0.0167  0.1175  140  LYS A NZ  
1007 N N   . CYS A 125 ? 0.4890 0.6491 0.4571 0.0283  -0.0103 0.0880  141  CYS A N   
1008 C CA  . CYS A 125 ? 0.4818 0.6321 0.4475 0.0257  -0.0133 0.0799  141  CYS A CA  
1009 C C   . CYS A 125 ? 0.4700 0.6168 0.4450 0.0256  -0.0127 0.0836  141  CYS A C   
1010 O O   . CYS A 125 ? 0.4696 0.6150 0.4426 0.0230  -0.0166 0.0806  141  CYS A O   
1011 C CB  . CYS A 125 ? 0.4888 0.6436 0.4435 0.0220  -0.0191 0.0744  141  CYS A CB  
1012 S SG  . CYS A 125 ? 0.5052 0.6622 0.4481 0.0216  -0.0196 0.0681  141  CYS A SG  
1013 N N   . ASP A 126 ? 0.4584 0.6034 0.4437 0.0286  -0.0076 0.0897  142  ASP A N   
1014 C CA  . ASP A 126 ? 0.4470 0.5888 0.4420 0.0290  -0.0060 0.0937  142  ASP A CA  
1015 C C   . ASP A 126 ? 0.4333 0.5621 0.4342 0.0303  -0.0016 0.0901  142  ASP A C   
1016 O O   . ASP A 126 ? 0.4285 0.5549 0.4393 0.0317  0.0018  0.0947  142  ASP A O   
1017 C CB  . ASP A 126 ? 0.4504 0.6031 0.4538 0.0310  -0.0038 0.1055  142  ASP A CB  
1018 C CG  . ASP A 126 ? 0.4597 0.6144 0.4681 0.0344  0.0017  0.1108  142  ASP A CG  
1019 O OD1 . ASP A 126 ? 0.4711 0.6213 0.4749 0.0350  0.0030  0.1056  142  ASP A OD1 
1020 O OD2 . ASP A 126 ? 0.4713 0.6324 0.4890 0.0367  0.0050  0.1206  142  ASP A OD2 
1021 N N   . LEU A 127 ? 0.4218 0.5428 0.4169 0.0299  -0.0018 0.0817  143  LEU A N   
1022 C CA  . LEU A 127 ? 0.4084 0.5179 0.4081 0.0309  0.0018  0.0775  143  LEU A CA  
1023 C C   . LEU A 127 ? 0.3974 0.4986 0.3962 0.0288  -0.0006 0.0719  143  LEU A C   
1024 O O   . LEU A 127 ? 0.3969 0.4957 0.3875 0.0267  -0.0049 0.0654  143  LEU A O   
1025 C CB  . LEU A 127 ? 0.4102 0.5157 0.4045 0.0316  0.0028  0.0716  143  LEU A CB  
1026 C CG  . LEU A 127 ? 0.4153 0.5260 0.4124 0.0342  0.0070  0.0766  143  LEU A CG  
1027 C CD1 . LEU A 127 ? 0.4206 0.5433 0.4116 0.0341  0.0044  0.0806  143  LEU A CD1 
1028 C CD2 . LEU A 127 ? 0.4197 0.5233 0.4145 0.0349  0.0090  0.0701  143  LEU A CD2 
1029 N N   . ALA A 128 ? 0.3847 0.4819 0.3924 0.0294  0.0023  0.0748  144  ALA A N   
1030 C CA  . ALA A 128 ? 0.3746 0.4639 0.3825 0.0277  0.0007  0.0701  144  ALA A CA  
1031 C C   . ALA A 128 ? 0.3668 0.4454 0.3755 0.0282  0.0034  0.0638  144  ALA A C   
1032 O O   . ALA A 128 ? 0.3631 0.4407 0.3751 0.0300  0.0074  0.0645  144  ALA A O   
1033 C CB  . ALA A 128 ? 0.3711 0.4623 0.3879 0.0280  0.0024  0.0766  144  ALA A CB  
1034 N N   . LEU A 129 ? 0.3599 0.4312 0.3659 0.0266  0.0012  0.0579  145  LEU A N   
1035 C CA  . LEU A 129 ? 0.3544 0.4163 0.3611 0.0268  0.0033  0.0520  145  LEU A CA  
1036 C C   . LEU A 129 ? 0.3517 0.4115 0.3684 0.0284  0.0092  0.0555  145  LEU A C   
1037 O O   . LEU A 129 ? 0.3476 0.4045 0.3661 0.0295  0.0125  0.0535  145  LEU A O   
1038 C CB  . LEU A 129 ? 0.3508 0.4063 0.3543 0.0249  0.0003  0.0467  145  LEU A CB  
1039 C CG  . LEU A 129 ? 0.3463 0.3928 0.3500 0.0249  0.0018  0.0406  145  LEU A CG  
1040 C CD1 . LEU A 129 ? 0.3444 0.3888 0.3413 0.0251  0.0004  0.0349  145  LEU A CD1 
1041 C CD2 . LEU A 129 ? 0.3388 0.3803 0.3414 0.0232  -0.0003 0.0379  145  LEU A CD2 
1042 N N   . ASP A 130 ? 0.3530 0.4141 0.3764 0.0284  0.0108  0.0606  146  ASP A N   
1043 C CA  . ASP A 130 ? 0.3539 0.4130 0.3875 0.0298  0.0168  0.0644  146  ASP A CA  
1044 C C   . ASP A 130 ? 0.3551 0.4230 0.3948 0.0316  0.0191  0.0737  146  ASP A C   
1045 O O   . ASP A 130 ? 0.3566 0.4298 0.3976 0.0312  0.0171  0.0786  146  ASP A O   
1046 C CB  . ASP A 130 ? 0.3543 0.4080 0.3918 0.0288  0.0176  0.0634  146  ASP A CB  
1047 C CG  . ASP A 130 ? 0.3576 0.4074 0.4053 0.0299  0.0242  0.0655  146  ASP A CG  
1048 O OD1 . ASP A 130 ? 0.3664 0.4176 0.4189 0.0314  0.0284  0.0680  146  ASP A OD1 
1049 O OD2 . ASP A 130 ? 0.3601 0.4054 0.4111 0.0291  0.0255  0.0645  146  ASP A OD2 
1050 N N   . PRO A 131 ? 0.3559 0.4256 0.3997 0.0335  0.0232  0.0764  147  PRO A N   
1051 C CA  . PRO A 131 ? 0.3553 0.4192 0.3992 0.0339  0.0262  0.0713  147  PRO A CA  
1052 C C   . PRO A 131 ? 0.3580 0.4247 0.3945 0.0343  0.0241  0.0686  147  PRO A C   
1053 O O   . PRO A 131 ? 0.3564 0.4181 0.3923 0.0343  0.0258  0.0635  147  PRO A O   
1054 C CB  . PRO A 131 ? 0.3553 0.4197 0.4108 0.0358  0.0331  0.0773  147  PRO A CB  
1055 C CG  . PRO A 131 ? 0.3572 0.4313 0.4157 0.0372  0.0329  0.0867  147  PRO A CG  
1056 C CD  . PRO A 131 ? 0.3571 0.4348 0.4082 0.0355  0.0264  0.0860  147  PRO A CD  
1057 N N   . GLU A 132 ? 0.3633 0.4380 0.3945 0.0344  0.0206  0.0718  148  GLU A N   
1058 C CA  . GLU A 132 ? 0.3693 0.4480 0.3946 0.0352  0.0197  0.0708  148  GLU A CA  
1059 C C   . GLU A 132 ? 0.3715 0.4442 0.3889 0.0341  0.0172  0.0617  148  GLU A C   
1060 O O   . GLU A 132 ? 0.3709 0.4418 0.3889 0.0351  0.0199  0.0595  148  GLU A O   
1061 C CB  . GLU A 132 ? 0.3743 0.4633 0.3945 0.0351  0.0162  0.0756  148  GLU A CB  
1062 C CG  . GLU A 132 ? 0.3789 0.4763 0.4071 0.0370  0.0193  0.0860  148  GLU A CG  
1063 C CD  . GLU A 132 ? 0.3836 0.4819 0.4177 0.0365  0.0192  0.0905  148  GLU A CD  
1064 O OE1 . GLU A 132 ? 0.3851 0.4808 0.4146 0.0344  0.0149  0.0863  148  GLU A OE1 
1065 O OE2 . GLU A 132 ? 0.3902 0.4919 0.4340 0.0384  0.0235  0.0984  148  GLU A OE2 
1066 N N   . ILE A 133 ? 0.3734 0.4433 0.3838 0.0322  0.0124  0.0566  149  ILE A N   
1067 C CA  . ILE A 133 ? 0.3765 0.4412 0.3793 0.0313  0.0098  0.0484  149  ILE A CA  
1068 C C   . ILE A 133 ? 0.3763 0.4328 0.3831 0.0315  0.0127  0.0438  149  ILE A C   
1069 O O   . ILE A 133 ? 0.3756 0.4297 0.3802 0.0320  0.0135  0.0397  149  ILE A O   
1070 C CB  . ILE A 133 ? 0.3760 0.4396 0.3709 0.0292  0.0042  0.0443  149  ILE A CB  
1071 C CG1 . ILE A 133 ? 0.3746 0.4472 0.3656 0.0286  0.0012  0.0485  149  ILE A CG1 
1072 C CG2 . ILE A 133 ? 0.3799 0.4386 0.3674 0.0287  0.0021  0.0365  149  ILE A CG2 
1073 C CD1 . ILE A 133 ? 0.3655 0.4375 0.3508 0.0261  -0.0038 0.0456  149  ILE A CD1 
1074 N N   . GLU A 134 ? 0.3792 0.4317 0.3919 0.0309  0.0144  0.0446  150  GLU A N   
1075 C CA  . GLU A 134 ? 0.3824 0.4277 0.3991 0.0307  0.0172  0.0403  150  GLU A CA  
1076 C C   . GLU A 134 ? 0.3822 0.4278 0.4049 0.0321  0.0223  0.0416  150  GLU A C   
1077 O O   . GLU A 134 ? 0.3814 0.4225 0.4045 0.0318  0.0235  0.0365  150  GLU A O   
1078 C CB  . GLU A 134 ? 0.3824 0.4242 0.4046 0.0298  0.0185  0.0415  150  GLU A CB  
1079 C CG  . GLU A 134 ? 0.4006 0.4391 0.4170 0.0280  0.0139  0.0377  150  GLU A CG  
1080 C CD  . GLU A 134 ? 0.4212 0.4555 0.4428 0.0272  0.0157  0.0380  150  GLU A CD  
1081 O OE1 . GLU A 134 ? 0.4360 0.4701 0.4660 0.0279  0.0206  0.0414  150  GLU A OE1 
1082 O OE2 . GLU A 134 ? 0.4305 0.4615 0.4480 0.0258  0.0125  0.0347  150  GLU A OE2 
1083 N N   . GLU A 135 ? 0.3840 0.4353 0.4117 0.0335  0.0252  0.0485  151  GLU A N   
1084 C CA  . GLU A 135 ? 0.3858 0.4380 0.4198 0.0350  0.0303  0.0505  151  GLU A CA  
1085 C C   . GLU A 135 ? 0.3850 0.4381 0.4128 0.0355  0.0289  0.0465  151  GLU A C   
1086 O O   . GLU A 135 ? 0.3856 0.4356 0.4165 0.0357  0.0319  0.0436  151  GLU A O   
1087 C CB  . GLU A 135 ? 0.3879 0.4467 0.4283 0.0367  0.0336  0.0596  151  GLU A CB  
1088 C CG  . GLU A 135 ? 0.3945 0.4532 0.4438 0.0382  0.0400  0.0623  151  GLU A CG  
1089 C CD  . GLU A 135 ? 0.4063 0.4705 0.4639 0.0399  0.0440  0.0719  151  GLU A CD  
1090 O OE1 . GLU A 135 ? 0.4129 0.4851 0.4673 0.0410  0.0420  0.0773  151  GLU A OE1 
1091 O OE2 . GLU A 135 ? 0.4107 0.4715 0.4785 0.0402  0.0494  0.0741  151  GLU A OE2 
1092 N N   . VAL A 136 ? 0.3865 0.4437 0.4056 0.0355  0.0245  0.0462  152  VAL A N   
1093 C CA  . VAL A 136 ? 0.3862 0.4443 0.3989 0.0360  0.0231  0.0424  152  VAL A CA  
1094 C C   . VAL A 136 ? 0.3839 0.4349 0.3933 0.0349  0.0213  0.0342  152  VAL A C   
1095 O O   . VAL A 136 ? 0.3827 0.4321 0.3930 0.0355  0.0232  0.0312  152  VAL A O   
1096 C CB  . VAL A 136 ? 0.3900 0.4542 0.3939 0.0360  0.0189  0.0434  152  VAL A CB  
1097 C CG1 . VAL A 136 ? 0.3925 0.4571 0.3900 0.0366  0.0180  0.0391  152  VAL A CG1 
1098 C CG2 . VAL A 136 ? 0.3936 0.4660 0.4007 0.0371  0.0206  0.0520  152  VAL A CG2 
1099 N N   . ILE A 137 ? 0.3811 0.4284 0.3871 0.0334  0.0178  0.0311  153  ILE A N   
1100 C CA  . ILE A 137 ? 0.3796 0.4207 0.3824 0.0325  0.0159  0.0240  153  ILE A CA  
1101 C C   . ILE A 137 ? 0.3771 0.4143 0.3870 0.0324  0.0199  0.0221  153  ILE A C   
1102 O O   . ILE A 137 ? 0.3747 0.4092 0.3831 0.0324  0.0196  0.0171  153  ILE A O   
1103 C CB  . ILE A 137 ? 0.3798 0.4176 0.3787 0.0309  0.0120  0.0219  153  ILE A CB  
1104 C CG1 . ILE A 137 ? 0.3824 0.4240 0.3741 0.0305  0.0079  0.0229  153  ILE A CG1 
1105 C CG2 . ILE A 137 ? 0.3798 0.4117 0.3761 0.0302  0.0103  0.0153  153  ILE A CG2 
1106 C CD1 . ILE A 137 ? 0.3832 0.4254 0.3673 0.0309  0.0056  0.0188  153  ILE A CD1 
1107 N N   . SER A 138 ? 0.3768 0.4140 0.3948 0.0323  0.0237  0.0260  154  SER A N   
1108 C CA  . SER A 138 ? 0.3779 0.4114 0.4031 0.0318  0.0278  0.0240  154  SER A CA  
1109 C C   . SER A 138 ? 0.3772 0.4128 0.4069 0.0330  0.0318  0.0250  154  SER A C   
1110 O O   . SER A 138 ? 0.3752 0.4080 0.4088 0.0323  0.0340  0.0212  154  SER A O   
1111 C CB  . SER A 138 ? 0.3783 0.4103 0.4109 0.0312  0.0309  0.0274  154  SER A CB  
1112 O OG  . SER A 138 ? 0.3936 0.4304 0.4305 0.0325  0.0333  0.0347  154  SER A OG  
1113 N N   . LYS A 139 ? 0.3789 0.4200 0.4083 0.0346  0.0326  0.0300  155  LYS A N   
1114 C CA  . LYS A 139 ? 0.3794 0.4229 0.4145 0.0359  0.0372  0.0323  155  LYS A CA  
1115 C C   . LYS A 139 ? 0.3781 0.4249 0.4073 0.0371  0.0357  0.0309  155  LYS A C   
1116 O O   . LYS A 139 ? 0.3764 0.4233 0.4094 0.0376  0.0387  0.0298  155  LYS A O   
1117 C CB  . LYS A 139 ? 0.3831 0.4305 0.4254 0.0370  0.0413  0.0403  155  LYS A CB  
1118 C CG  . LYS A 139 ? 0.3952 0.4388 0.4460 0.0361  0.0448  0.0417  155  LYS A CG  
1119 C CD  . LYS A 139 ? 0.4188 0.4664 0.4778 0.0376  0.0494  0.0503  155  LYS A CD  
1120 C CE  . LYS A 139 ? 0.4319 0.4752 0.4996 0.0367  0.0532  0.0513  155  LYS A CE  
1121 N NZ  . LYS A 139 ? 0.4482 0.4950 0.5250 0.0385  0.0582  0.0601  155  LYS A NZ  
1122 N N   . SER A 140 ? 0.3768 0.4263 0.3973 0.0374  0.0313  0.0309  156  SER A N   
1123 C CA  . SER A 140 ? 0.3774 0.4300 0.3917 0.0386  0.0301  0.0295  156  SER A CA  
1124 C C   . SER A 140 ? 0.3749 0.4233 0.3868 0.0382  0.0288  0.0224  156  SER A C   
1125 O O   . SER A 140 ? 0.3709 0.4146 0.3808 0.0369  0.0263  0.0179  156  SER A O   
1126 C CB  . SER A 140 ? 0.3794 0.4356 0.3847 0.0386  0.0257  0.0304  156  SER A CB  
1127 O OG  . SER A 140 ? 0.3854 0.4442 0.3845 0.0396  0.0247  0.0283  156  SER A OG  
1128 N N   . ARG A 141 ? 0.3735 0.4240 0.3858 0.0394  0.0308  0.0218  157  ARG A N   
1129 C CA  . ARG A 141 ? 0.3734 0.4212 0.3831 0.0394  0.0296  0.0157  157  ARG A CA  
1130 C C   . ARG A 141 ? 0.3732 0.4240 0.3750 0.0408  0.0278  0.0148  157  ARG A C   
1131 O O   . ARG A 141 ? 0.3748 0.4251 0.3755 0.0415  0.0281  0.0112  157  ARG A O   
1132 C CB  . ARG A 141 ? 0.3747 0.4216 0.3929 0.0394  0.0339  0.0148  157  ARG A CB  
1133 C CG  . ARG A 141 ? 0.3825 0.4265 0.4090 0.0379  0.0365  0.0156  157  ARG A CG  
1134 C CD  . ARG A 141 ? 0.3991 0.4381 0.4240 0.0361  0.0337  0.0101  157  ARG A CD  
1135 N NE  . ARG A 141 ? 0.4101 0.4465 0.4430 0.0344  0.0367  0.0101  157  ARG A NE  
1136 C CZ  . ARG A 141 ? 0.4204 0.4543 0.4538 0.0333  0.0360  0.0110  157  ARG A CZ  
1137 N NH1 . ARG A 141 ? 0.4289 0.4629 0.4556 0.0335  0.0321  0.0121  157  ARG A NH1 
1138 N NH2 . ARG A 141 ? 0.4171 0.4485 0.4580 0.0318  0.0393  0.0105  157  ARG A NH2 
1139 N N   . ASP A 142 ? 0.3714 0.4259 0.3680 0.0410  0.0261  0.0180  158  ASP A N   
1140 C CA  . ASP A 142 ? 0.3710 0.4285 0.3590 0.0419  0.0240  0.0168  158  ASP A CA  
1141 C C   . ASP A 142 ? 0.3663 0.4200 0.3469 0.0406  0.0191  0.0121  158  ASP A C   
1142 O O   . ASP A 142 ? 0.3644 0.4187 0.3427 0.0395  0.0167  0.0138  158  ASP A O   
1143 C CB  . ASP A 142 ? 0.3770 0.4415 0.3635 0.0426  0.0250  0.0231  158  ASP A CB  
1144 C CG  . ASP A 142 ? 0.3921 0.4604 0.3691 0.0431  0.0229  0.0216  158  ASP A CG  
1145 O OD1 . ASP A 142 ? 0.4030 0.4678 0.3735 0.0425  0.0197  0.0159  158  ASP A OD1 
1146 O OD2 . ASP A 142 ? 0.4071 0.4821 0.3831 0.0442  0.0246  0.0263  158  ASP A OD2 
1147 N N   . HIS A 143 ? 0.3584 0.4085 0.3361 0.0409  0.0178  0.0064  159  HIS A N   
1148 C CA  . HIS A 143 ? 0.3535 0.3990 0.3256 0.0398  0.0137  0.0018  159  HIS A CA  
1149 C C   . HIS A 143 ? 0.3547 0.4022 0.3187 0.0391  0.0107  0.0018  159  HIS A C   
1150 O O   . HIS A 143 ? 0.3544 0.3989 0.3155 0.0377  0.0075  0.0001  159  HIS A O   
1151 C CB  . HIS A 143 ? 0.3513 0.3931 0.3224 0.0407  0.0134  -0.0035 159  HIS A CB  
1152 C CG  . HIS A 143 ? 0.3532 0.3978 0.3210 0.0424  0.0149  -0.0045 159  HIS A CG  
1153 N ND1 . HIS A 143 ? 0.3577 0.4018 0.3176 0.0426  0.0130  -0.0076 159  HIS A ND1 
1154 C CD2 . HIS A 143 ? 0.3481 0.3959 0.3198 0.0438  0.0186  -0.0029 159  HIS A CD2 
1155 C CE1 . HIS A 143 ? 0.3564 0.4034 0.3152 0.0443  0.0154  -0.0079 159  HIS A CE1 
1156 N NE2 . HIS A 143 ? 0.3562 0.4056 0.3221 0.0451  0.0187  -0.0049 159  HIS A NE2 
1157 N N   . GLU A 144 ? 0.3538 0.4066 0.3141 0.0400  0.0118  0.0037  160  GLU A N   
1158 C CA  . GLU A 144 ? 0.3561 0.4120 0.3085 0.0390  0.0091  0.0036  160  GLU A CA  
1159 C C   . GLU A 144 ? 0.3486 0.4083 0.3025 0.0377  0.0080  0.0088  160  GLU A C   
1160 O O   . GLU A 144 ? 0.3485 0.4083 0.2976 0.0360  0.0046  0.0077  160  GLU A O   
1161 C CB  . GLU A 144 ? 0.3638 0.4247 0.3111 0.0402  0.0106  0.0035  160  GLU A CB  
1162 C CG  . GLU A 144 ? 0.3797 0.4367 0.3247 0.0415  0.0113  -0.0020 160  GLU A CG  
1163 C CD  . GLU A 144 ? 0.4105 0.4703 0.3469 0.0417  0.0110  -0.0047 160  GLU A CD  
1164 O OE1 . GLU A 144 ? 0.4270 0.4937 0.3602 0.0416  0.0116  -0.0012 160  GLU A OE1 
1165 O OE2 . GLU A 144 ? 0.4243 0.4796 0.3573 0.0420  0.0104  -0.0103 160  GLU A OE2 
1166 N N   . GLU A 145 ? 0.3394 0.4023 0.3005 0.0385  0.0111  0.0145  161  GLU A N   
1167 C CA  . GLU A 145 ? 0.3332 0.3994 0.2975 0.0377  0.0107  0.0201  161  GLU A CA  
1168 C C   . GLU A 145 ? 0.3242 0.3846 0.2903 0.0360  0.0082  0.0180  161  GLU A C   
1169 O O   . GLU A 145 ? 0.3216 0.3836 0.2853 0.0345  0.0054  0.0194  161  GLU A O   
1170 C CB  . GLU A 145 ? 0.3317 0.4012 0.3048 0.0391  0.0152  0.0263  161  GLU A CB  
1171 C CG  . GLU A 145 ? 0.3395 0.4122 0.3174 0.0385  0.0155  0.0327  161  GLU A CG  
1172 C CD  . GLU A 145 ? 0.3516 0.4275 0.3387 0.0402  0.0206  0.0391  161  GLU A CD  
1173 O OE1 . GLU A 145 ? 0.3582 0.4305 0.3507 0.0410  0.0239  0.0376  161  GLU A OE1 
1174 O OE2 . GLU A 145 ? 0.3586 0.4407 0.3480 0.0405  0.0213  0.0459  161  GLU A OE2 
1175 N N   . LEU A 146 ? 0.3153 0.3694 0.2855 0.0362  0.0093  0.0148  162  LEU A N   
1176 C CA  . LEU A 146 ? 0.3093 0.3576 0.2810 0.0348  0.0073  0.0124  162  LEU A CA  
1177 C C   . LEU A 146 ? 0.3109 0.3570 0.2749 0.0334  0.0029  0.0083  162  LEU A C   
1178 O O   . LEU A 146 ? 0.3076 0.3525 0.2713 0.0319  0.0006  0.0090  162  LEU A O   
1179 C CB  . LEU A 146 ? 0.3040 0.3470 0.2803 0.0353  0.0091  0.0090  162  LEU A CB  
1180 C CG  . LEU A 146 ? 0.2979 0.3419 0.2832 0.0360  0.0136  0.0122  162  LEU A CG  
1181 C CD1 . LEU A 146 ? 0.2911 0.3313 0.2793 0.0363  0.0150  0.0079  162  LEU A CD1 
1182 C CD2 . LEU A 146 ? 0.2931 0.3363 0.2840 0.0349  0.0145  0.0157  162  LEU A CD2 
1183 N N   . ALA A 147 ? 0.3123 0.3577 0.2704 0.0340  0.0020  0.0041  163  ALA A N   
1184 C CA  . ALA A 147 ? 0.3135 0.3561 0.2644 0.0327  -0.0016 -0.0003 163  ALA A CA  
1185 C C   . ALA A 147 ? 0.3177 0.3654 0.2643 0.0311  -0.0039 0.0019  163  ALA A C   
1186 O O   . ALA A 147 ? 0.3191 0.3644 0.2626 0.0293  -0.0071 0.0000  163  ALA A O   
1187 C CB  . ALA A 147 ? 0.3171 0.3581 0.2633 0.0338  -0.0012 -0.0051 163  ALA A CB  
1188 N N   . TYR A 148 ? 0.3169 0.3719 0.2634 0.0317  -0.0024 0.0064  164  TYR A N   
1189 C CA  . TYR A 148 ? 0.3203 0.3818 0.2632 0.0302  -0.0046 0.0095  164  TYR A CA  
1190 C C   . TYR A 148 ? 0.3134 0.3746 0.2606 0.0288  -0.0060 0.0130  164  TYR A C   
1191 O O   . TYR A 148 ? 0.3148 0.3766 0.2583 0.0267  -0.0094 0.0119  164  TYR A O   
1192 C CB  . TYR A 148 ? 0.3226 0.3928 0.2657 0.0315  -0.0022 0.0148  164  TYR A CB  
1193 C CG  . TYR A 148 ? 0.3311 0.4093 0.2725 0.0301  -0.0042 0.0198  164  TYR A CG  
1194 C CD1 . TYR A 148 ? 0.3442 0.4268 0.2771 0.0283  -0.0072 0.0174  164  TYR A CD1 
1195 C CD2 . TYR A 148 ? 0.3318 0.4137 0.2806 0.0305  -0.0028 0.0269  164  TYR A CD2 
1196 C CE1 . TYR A 148 ? 0.3486 0.4396 0.2799 0.0268  -0.0094 0.0220  164  TYR A CE1 
1197 C CE2 . TYR A 148 ? 0.3346 0.4247 0.2824 0.0293  -0.0047 0.0320  164  TYR A CE2 
1198 C CZ  . TYR A 148 ? 0.3471 0.4421 0.2861 0.0274  -0.0082 0.0296  164  TYR A CZ  
1199 O OH  . TYR A 148 ? 0.3508 0.4548 0.2888 0.0261  -0.0103 0.0348  164  TYR A OH  
1200 N N   . TYR A 149 ? 0.3056 0.3660 0.2610 0.0299  -0.0032 0.0170  165  TYR A N   
1201 C CA  . TYR A 149 ? 0.3026 0.3629 0.2631 0.0289  -0.0038 0.0207  165  TYR A CA  
1202 C C   . TYR A 149 ? 0.2996 0.3524 0.2591 0.0274  -0.0064 0.0162  165  TYR A C   
1203 O O   . TYR A 149 ? 0.2987 0.3520 0.2587 0.0258  -0.0086 0.0178  165  TYR A O   
1204 C CB  . TYR A 149 ? 0.2976 0.3584 0.2674 0.0304  0.0004  0.0258  165  TYR A CB  
1205 C CG  . TYR A 149 ? 0.3068 0.3763 0.2790 0.0316  0.0026  0.0327  165  TYR A CG  
1206 C CD1 . TYR A 149 ? 0.3135 0.3896 0.2860 0.0308  0.0010  0.0381  165  TYR A CD1 
1207 C CD2 . TYR A 149 ? 0.3094 0.3808 0.2837 0.0336  0.0062  0.0341  165  TYR A CD2 
1208 C CE1 . TYR A 149 ? 0.3179 0.4027 0.2928 0.0321  0.0031  0.0451  165  TYR A CE1 
1209 C CE2 . TYR A 149 ? 0.3157 0.3953 0.2924 0.0349  0.0085  0.0409  165  TYR A CE2 
1210 C CZ  . TYR A 149 ? 0.3199 0.4063 0.2968 0.0342  0.0069  0.0465  165  TYR A CZ  
1211 O OH  . TYR A 149 ? 0.3240 0.4191 0.3034 0.0357  0.0091  0.0539  165  TYR A OH  
1212 N N   . TRP A 150 ? 0.2980 0.3444 0.2565 0.0280  -0.0060 0.0108  166  TRP A N   
1213 C CA  . TRP A 150 ? 0.2970 0.3365 0.2540 0.0268  -0.0084 0.0063  166  TRP A CA  
1214 C C   . TRP A 150 ? 0.3038 0.3439 0.2540 0.0248  -0.0123 0.0040  166  TRP A C   
1215 O O   . TRP A 150 ? 0.2984 0.3369 0.2491 0.0232  -0.0144 0.0043  166  TRP A O   
1216 C CB  . TRP A 150 ? 0.2956 0.3294 0.2520 0.0280  -0.0074 0.0013  166  TRP A CB  
1217 C CG  . TRP A 150 ? 0.2863 0.3133 0.2426 0.0272  -0.0093 -0.0022 166  TRP A CG  
1218 C CD1 . TRP A 150 ? 0.2812 0.3044 0.2425 0.0275  -0.0081 -0.0023 166  TRP A CD1 
1219 C CD2 . TRP A 150 ? 0.2845 0.3079 0.2354 0.0260  -0.0125 -0.0061 166  TRP A CD2 
1220 N NE1 . TRP A 150 ? 0.2786 0.2965 0.2377 0.0267  -0.0104 -0.0056 166  TRP A NE1 
1221 C CE2 . TRP A 150 ? 0.2819 0.2996 0.2351 0.0258  -0.0130 -0.0078 166  TRP A CE2 
1222 C CE3 . TRP A 150 ? 0.2908 0.3154 0.2353 0.0249  -0.0147 -0.0084 166  TRP A CE3 
1223 C CZ2 . TRP A 150 ? 0.2803 0.2933 0.2301 0.0249  -0.0156 -0.0113 166  TRP A CZ2 
1224 C CZ3 . TRP A 150 ? 0.2948 0.3142 0.2361 0.0237  -0.0172 -0.0124 166  TRP A CZ3 
1225 C CH2 . TRP A 150 ? 0.2901 0.3037 0.2343 0.0238  -0.0176 -0.0135 166  TRP A CH2 
1226 N N   . ARG A 151 ? 0.3123 0.3550 0.2565 0.0249  -0.0129 0.0015  167  ARG A N   
1227 C CA  . ARG A 151 ? 0.3244 0.3675 0.2618 0.0227  -0.0163 -0.0016 167  ARG A CA  
1228 C C   . ARG A 151 ? 0.3250 0.3745 0.2625 0.0207  -0.0184 0.0027  167  ARG A C   
1229 O O   . ARG A 151 ? 0.3260 0.3737 0.2618 0.0185  -0.0212 0.0011  167  ARG A O   
1230 C CB  . ARG A 151 ? 0.3329 0.3779 0.2638 0.0232  -0.0160 -0.0052 167  ARG A CB  
1231 C CG  . ARG A 151 ? 0.3574 0.4009 0.2812 0.0208  -0.0190 -0.0102 167  ARG A CG  
1232 C CD  . ARG A 151 ? 0.4028 0.4508 0.3198 0.0207  -0.0186 -0.0126 167  ARG A CD  
1233 N NE  . ARG A 151 ? 0.4365 0.4794 0.3516 0.0226  -0.0167 -0.0176 167  ARG A NE  
1234 C CZ  . ARG A 151 ? 0.4565 0.4928 0.3681 0.0219  -0.0176 -0.0237 167  ARG A CZ  
1235 N NH1 . ARG A 151 ? 0.4642 0.4979 0.3738 0.0192  -0.0204 -0.0260 167  ARG A NH1 
1236 N NH2 . ARG A 151 ? 0.4618 0.4940 0.3724 0.0239  -0.0154 -0.0274 167  ARG A NH2 
1237 N N   . GLU A 152 ? 0.3246 0.3817 0.2644 0.0216  -0.0168 0.0084  168  GLU A N   
1238 C CA  . GLU A 152 ? 0.3260 0.3907 0.2666 0.0200  -0.0186 0.0135  168  GLU A CA  
1239 C C   . GLU A 152 ? 0.3204 0.3821 0.2666 0.0191  -0.0194 0.0158  168  GLU A C   
1240 O O   . GLU A 152 ? 0.3209 0.3849 0.2655 0.0167  -0.0225 0.0162  168  GLU A O   
1241 C CB  . GLU A 152 ? 0.3288 0.4021 0.2722 0.0217  -0.0161 0.0202  168  GLU A CB  
1242 C CG  . GLU A 152 ? 0.3450 0.4237 0.2818 0.0221  -0.0158 0.0188  168  GLU A CG  
1243 C CD  . GLU A 152 ? 0.3720 0.4548 0.3005 0.0192  -0.0198 0.0156  168  GLU A CD  
1244 O OE1 . GLU A 152 ? 0.3810 0.4707 0.3098 0.0175  -0.0220 0.0196  168  GLU A OE1 
1245 O OE2 . GLU A 152 ? 0.3871 0.4664 0.3091 0.0186  -0.0205 0.0090  168  GLU A OE2 
1246 N N   . PHE A 153 ? 0.3120 0.3687 0.2646 0.0207  -0.0166 0.0170  169  PHE A N   
1247 C CA  . PHE A 153 ? 0.3093 0.3630 0.2674 0.0200  -0.0169 0.0191  169  PHE A CA  
1248 C C   . PHE A 153 ? 0.3080 0.3550 0.2630 0.0182  -0.0198 0.0140  169  PHE A C   
1249 O O   . PHE A 153 ? 0.3111 0.3590 0.2672 0.0164  -0.0219 0.0156  169  PHE A O   
1250 C CB  . PHE A 153 ? 0.3036 0.3538 0.2692 0.0220  -0.0128 0.0213  169  PHE A CB  
1251 C CG  . PHE A 153 ? 0.3079 0.3554 0.2792 0.0213  -0.0126 0.0236  169  PHE A CG  
1252 C CD1 . PHE A 153 ? 0.3034 0.3567 0.2792 0.0210  -0.0122 0.0301  169  PHE A CD1 
1253 C CD2 . PHE A 153 ? 0.3036 0.3432 0.2756 0.0211  -0.0126 0.0197  169  PHE A CD2 
1254 C CE1 . PHE A 153 ? 0.3103 0.3611 0.2915 0.0204  -0.0117 0.0322  169  PHE A CE1 
1255 C CE2 . PHE A 153 ? 0.3117 0.3489 0.2885 0.0204  -0.0122 0.0217  169  PHE A CE2 
1256 C CZ  . PHE A 153 ? 0.3042 0.3469 0.2857 0.0201  -0.0116 0.0279  169  PHE A CZ  
1257 N N   . TYR A 154 ? 0.3048 0.3453 0.2565 0.0187  -0.0198 0.0081  170  TYR A N   
1258 C CA  . TYR A 154 ? 0.3018 0.3357 0.2510 0.0173  -0.0222 0.0034  170  TYR A CA  
1259 C C   . TYR A 154 ? 0.3070 0.3433 0.2507 0.0146  -0.0257 0.0015  170  TYR A C   
1260 O O   . TYR A 154 ? 0.3072 0.3406 0.2512 0.0128  -0.0278 0.0005  170  TYR A O   
1261 C CB  . TYR A 154 ? 0.2975 0.3247 0.2446 0.0187  -0.0212 -0.0017 170  TYR A CB  
1262 C CG  . TYR A 154 ? 0.2859 0.3086 0.2383 0.0203  -0.0188 -0.0013 170  TYR A CG  
1263 C CD1 . TYR A 154 ? 0.2735 0.2987 0.2306 0.0220  -0.0156 0.0017  170  TYR A CD1 
1264 C CD2 . TYR A 154 ? 0.2737 0.2898 0.2265 0.0200  -0.0198 -0.0041 170  TYR A CD2 
1265 C CE1 . TYR A 154 ? 0.2678 0.2891 0.2297 0.0230  -0.0134 0.0015  170  TYR A CE1 
1266 C CE2 . TYR A 154 ? 0.2654 0.2781 0.2226 0.0212  -0.0178 -0.0039 170  TYR A CE2 
1267 C CZ  . TYR A 154 ? 0.2660 0.2813 0.2275 0.0225  -0.0146 -0.0014 170  TYR A CZ  
1268 O OH  . TYR A 154 ? 0.2506 0.2628 0.2163 0.0233  -0.0126 -0.0018 170  TYR A OH  
1269 N N   . ASP A 155 ? 0.3114 0.3533 0.2504 0.0142  -0.0263 0.0009  171  ASP A N   
1270 C CA  . ASP A 155 ? 0.3190 0.3644 0.2526 0.0113  -0.0296 -0.0010 171  ASP A CA  
1271 C C   . ASP A 155 ? 0.3185 0.3695 0.2553 0.0093  -0.0315 0.0039  171  ASP A C   
1272 O O   . ASP A 155 ? 0.3208 0.3712 0.2557 0.0066  -0.0344 0.0019  171  ASP A O   
1273 C CB  . ASP A 155 ? 0.3235 0.3750 0.2512 0.0113  -0.0295 -0.0022 171  ASP A CB  
1274 C CG  . ASP A 155 ? 0.3311 0.3767 0.2544 0.0125  -0.0282 -0.0085 171  ASP A CG  
1275 O OD1 . ASP A 155 ? 0.3273 0.3643 0.2519 0.0132  -0.0278 -0.0119 171  ASP A OD1 
1276 O OD2 . ASP A 155 ? 0.3369 0.3869 0.2556 0.0129  -0.0275 -0.0097 171  ASP A OD2 
1277 N N   . LYS A 156 ? 0.3158 0.3722 0.2581 0.0108  -0.0297 0.0106  172  LYS A N   
1278 C CA  . LYS A 156 ? 0.3192 0.3823 0.2653 0.0094  -0.0311 0.0165  172  LYS A CA  
1279 C C   . LYS A 156 ? 0.3125 0.3706 0.2649 0.0093  -0.0307 0.0183  172  LYS A C   
1280 O O   . LYS A 156 ? 0.3135 0.3744 0.2675 0.0072  -0.0330 0.0203  172  LYS A O   
1281 C CB  . LYS A 156 ? 0.3179 0.3897 0.2675 0.0113  -0.0289 0.0234  172  LYS A CB  
1282 C CG  . LYS A 156 ? 0.3338 0.4134 0.2772 0.0109  -0.0297 0.0232  172  LYS A CG  
1283 C CD  . LYS A 156 ? 0.3476 0.4350 0.2954 0.0133  -0.0269 0.0306  172  LYS A CD  
1284 C CE  . LYS A 156 ? 0.3646 0.4594 0.3059 0.0134  -0.0272 0.0303  172  LYS A CE  
1285 N NZ  . LYS A 156 ? 0.3826 0.4862 0.3188 0.0103  -0.0313 0.0306  172  LYS A NZ  
1286 N N   . ALA A 157 ? 0.3088 0.3600 0.2648 0.0115  -0.0277 0.0176  173  ALA A N   
1287 C CA  . ALA A 157 ? 0.3045 0.3510 0.2664 0.0117  -0.0268 0.0193  173  ALA A CA  
1288 C C   . ALA A 157 ? 0.3064 0.3445 0.2656 0.0104  -0.0286 0.0137  173  ALA A C   
1289 O O   . ALA A 157 ? 0.3050 0.3404 0.2675 0.0095  -0.0291 0.0147  173  ALA A O   
1290 C CB  . ALA A 157 ? 0.2993 0.3432 0.2667 0.0144  -0.0225 0.0215  173  ALA A CB  
1291 N N   . GLY A 158 ? 0.3094 0.3437 0.2630 0.0105  -0.0292 0.0080  174  GLY A N   
1292 C CA  . GLY A 158 ? 0.3101 0.3364 0.2613 0.0097  -0.0305 0.0029  174  GLY A CA  
1293 C C   . GLY A 158 ? 0.3161 0.3429 0.2624 0.0068  -0.0339 -0.0004 174  GLY A C   
1294 O O   . GLY A 158 ? 0.3143 0.3402 0.2621 0.0047  -0.0358 0.0000  174  GLY A O   
1295 N N   . THR A 159 ? 0.3208 0.3492 0.2615 0.0066  -0.0344 -0.0040 175  THR A N   
1296 C CA  . THR A 159 ? 0.3281 0.3557 0.2634 0.0037  -0.0372 -0.0088 175  THR A CA  
1297 C C   . THR A 159 ? 0.3333 0.3673 0.2689 0.0004  -0.0401 -0.0064 175  THR A C   
1298 O O   . THR A 159 ? 0.3371 0.3682 0.2715 -0.0021 -0.0423 -0.0095 175  THR A O   
1299 C CB  . THR A 159 ? 0.3328 0.3621 0.2620 0.0042  -0.0367 -0.0128 175  THR A CB  
1300 O OG1 . THR A 159 ? 0.3223 0.3459 0.2518 0.0073  -0.0340 -0.0147 175  THR A OG1 
1301 C CG2 . THR A 159 ? 0.3388 0.3657 0.2625 0.0012  -0.0389 -0.0188 175  THR A CG2 
1302 N N   . ALA A 160 ? 0.3345 0.3774 0.2724 0.0006  -0.0400 -0.0007 176  ALA A N   
1303 C CA  . ALA A 160 ? 0.3420 0.3930 0.2804 -0.0023 -0.0429 0.0023  176  ALA A CA  
1304 C C   . ALA A 160 ? 0.3428 0.3908 0.2859 -0.0040 -0.0442 0.0037  176  ALA A C   
1305 O O   . ALA A 160 ? 0.3453 0.3985 0.2884 -0.0071 -0.0471 0.0047  176  ALA A O   
1306 C CB  . ALA A 160 ? 0.3394 0.4003 0.2807 -0.0009 -0.0420 0.0093  176  ALA A CB  
1307 N N   . VAL A 161 ? 0.3397 0.3796 0.2865 -0.0020 -0.0422 0.0036  177  VAL A N   
1308 C CA  . VAL A 161 ? 0.3425 0.3794 0.2944 -0.0030 -0.0427 0.0058  177  VAL A CA  
1309 C C   . VAL A 161 ? 0.3450 0.3721 0.2955 -0.0038 -0.0432 0.0006  177  VAL A C   
1310 O O   . VAL A 161 ? 0.3421 0.3656 0.2969 -0.0041 -0.0430 0.0022  177  VAL A O   
1311 C CB  . VAL A 161 ? 0.3364 0.3738 0.2949 -0.0001 -0.0396 0.0117  177  VAL A CB  
1312 C CG1 . VAL A 161 ? 0.3432 0.3718 0.3048 0.0009  -0.0379 0.0107  177  VAL A CG1 
1313 C CG2 . VAL A 161 ? 0.3367 0.3830 0.3000 -0.0011 -0.0404 0.0183  177  VAL A CG2 
1314 N N   A ARG A 162 ? 0.3512 0.3744 0.2962 -0.0042 -0.0436 -0.0053 178  ARG A N   
1315 N N   B ARG A 162 ? 0.3503 0.3736 0.2953 -0.0042 -0.0436 -0.0053 178  ARG A N   
1316 C CA  A ARG A 162 ? 0.3549 0.3687 0.2989 -0.0046 -0.0436 -0.0101 178  ARG A CA  
1317 C CA  B ARG A 162 ? 0.3535 0.3673 0.2972 -0.0046 -0.0437 -0.0103 178  ARG A CA  
1318 C C   A ARG A 162 ? 0.3573 0.3696 0.3034 -0.0077 -0.0458 -0.0103 178  ARG A C   
1319 C C   B ARG A 162 ? 0.3565 0.3688 0.3025 -0.0077 -0.0458 -0.0103 178  ARG A C   
1320 O O   A ARG A 162 ? 0.3534 0.3592 0.3025 -0.0071 -0.0450 -0.0101 178  ARG A O   
1321 O O   B ARG A 162 ? 0.3526 0.3584 0.3016 -0.0071 -0.0450 -0.0102 178  ARG A O   
1322 C CB  A ARG A 162 ? 0.3616 0.3722 0.2995 -0.0047 -0.0437 -0.0165 178  ARG A CB  
1323 C CB  B ARG A 162 ? 0.3596 0.3709 0.2972 -0.0050 -0.0439 -0.0165 178  ARG A CB  
1324 C CG  A ARG A 162 ? 0.3683 0.3696 0.3056 -0.0054 -0.0437 -0.0212 178  ARG A CG  
1325 C CG  B ARG A 162 ? 0.3625 0.3651 0.2990 -0.0062 -0.0442 -0.0217 178  ARG A CG  
1326 C CD  A ARG A 162 ? 0.3797 0.3784 0.3113 -0.0063 -0.0438 -0.0276 178  ARG A CD  
1327 C CD  B ARG A 162 ? 0.3544 0.3489 0.2922 -0.0028 -0.0417 -0.0226 178  ARG A CD  
1328 N NE  A ARG A 162 ? 0.3865 0.3827 0.3162 -0.0028 -0.0413 -0.0291 178  ARG A NE  
1329 N NE  B ARG A 162 ? 0.3526 0.3390 0.2911 -0.0037 -0.0419 -0.0258 178  ARG A NE  
1330 C CZ  A ARG A 162 ? 0.3844 0.3726 0.3150 -0.0004 -0.0395 -0.0311 178  ARG A CZ  
1331 C CZ  B ARG A 162 ? 0.3440 0.3232 0.2818 -0.0015 -0.0402 -0.0288 178  ARG A CZ  
1332 N NH1 A ARG A 162 ? 0.3885 0.3704 0.3218 -0.0010 -0.0397 -0.0317 178  ARG A NH1 
1333 N NH1 B ARG A 162 ? 0.3390 0.3181 0.2753 0.0014  -0.0384 -0.0294 178  ARG A NH1 
1334 N NH2 A ARG A 162 ? 0.3801 0.3672 0.3092 0.0025  -0.0374 -0.0323 178  ARG A NH2 
1335 N NH2 B ARG A 162 ? 0.3464 0.3186 0.2854 -0.0024 -0.0403 -0.0309 178  ARG A NH2 
1336 N N   . SER A 163 ? 0.3613 0.3801 0.3060 -0.0112 -0.0485 -0.0105 179  SER A N   
1337 C CA  . SER A 163 ? 0.3671 0.3852 0.3139 -0.0147 -0.0507 -0.0110 179  SER A CA  
1338 C C   . SER A 163 ? 0.3598 0.3790 0.3134 -0.0142 -0.0504 -0.0049 179  SER A C   
1339 O O   . SER A 163 ? 0.3599 0.3737 0.3162 -0.0153 -0.0506 -0.0053 179  SER A O   
1340 C CB  . SER A 163 ? 0.3733 0.3993 0.3170 -0.0188 -0.0539 -0.0127 179  SER A CB  
1341 O OG  . SER A 163 ? 0.3833 0.4200 0.3289 -0.0189 -0.0548 -0.0068 179  SER A OG  
1342 N N   . GLN A 164 ? 0.3543 0.3801 0.3107 -0.0125 -0.0494 0.0006  180  GLN A N   
1343 C CA  . GLN A 164 ? 0.3492 0.3760 0.3123 -0.0115 -0.0483 0.0065  180  GLN A CA  
1344 C C   . GLN A 164 ? 0.3432 0.3607 0.3081 -0.0087 -0.0455 0.0059  180  GLN A C   
1345 O O   . GLN A 164 ? 0.3376 0.3520 0.3066 -0.0091 -0.0451 0.0077  180  GLN A O   
1346 C CB  . GLN A 164 ? 0.3475 0.3827 0.3135 -0.0097 -0.0471 0.0125  180  GLN A CB  
1347 C CG  . GLN A 164 ? 0.3622 0.4085 0.3279 -0.0124 -0.0500 0.0152  180  GLN A CG  
1348 C CD  . GLN A 164 ? 0.3855 0.4362 0.3448 -0.0126 -0.0509 0.0123  180  GLN A CD  
1349 O OE1 . GLN A 164 ? 0.3938 0.4384 0.3482 -0.0115 -0.0499 0.0070  180  GLN A OE1 
1350 N NE2 . GLN A 164 ? 0.4007 0.4625 0.3600 -0.0139 -0.0526 0.0160  180  GLN A NE2 
1351 N N   . PHE A 165 ? 0.3389 0.3525 0.3007 -0.0061 -0.0436 0.0033  181  PHE A N   
1352 C CA  . PHE A 165 ? 0.3359 0.3417 0.2990 -0.0035 -0.0411 0.0025  181  PHE A CA  
1353 C C   . PHE A 165 ? 0.3398 0.3382 0.3022 -0.0047 -0.0420 -0.0009 181  PHE A C   
1354 O O   . PHE A 165 ? 0.3380 0.3318 0.3033 -0.0038 -0.0407 0.0005  181  PHE A O   
1355 C CB  . PHE A 165 ? 0.3320 0.3359 0.2920 -0.0006 -0.0392 0.0002  181  PHE A CB  
1356 C CG  . PHE A 165 ? 0.3246 0.3228 0.2866 0.0020  -0.0366 0.0005  181  PHE A CG  
1357 C CD1 . PHE A 165 ? 0.3152 0.3156 0.2813 0.0037  -0.0342 0.0046  181  PHE A CD1 
1358 C CD2 . PHE A 165 ? 0.3214 0.3123 0.2813 0.0028  -0.0364 -0.0032 181  PHE A CD2 
1359 C CE1 . PHE A 165 ? 0.3140 0.3097 0.2816 0.0058  -0.0319 0.0044  181  PHE A CE1 
1360 C CE2 . PHE A 165 ? 0.3207 0.3074 0.2823 0.0051  -0.0342 -0.0028 181  PHE A CE2 
1361 C CZ  . PHE A 165 ? 0.3125 0.3018 0.2776 0.0065  -0.0321 0.0007  181  PHE A CZ  
1362 N N   . GLU A 166 ? 0.3465 0.3437 0.3050 -0.0069 -0.0440 -0.0054 182  GLU A N   
1363 C CA  . GLU A 166 ? 0.3528 0.3430 0.3111 -0.0084 -0.0447 -0.0087 182  GLU A CA  
1364 C C   . GLU A 166 ? 0.3478 0.3384 0.3108 -0.0106 -0.0456 -0.0056 182  GLU A C   
1365 O O   . GLU A 166 ? 0.3432 0.3274 0.3082 -0.0102 -0.0448 -0.0057 182  GLU A O   
1366 C CB  . GLU A 166 ? 0.3635 0.3531 0.3171 -0.0109 -0.0464 -0.0142 182  GLU A CB  
1367 C CG  . GLU A 166 ? 0.3875 0.3736 0.3367 -0.0086 -0.0450 -0.0184 182  GLU A CG  
1368 C CD  . GLU A 166 ? 0.4253 0.4098 0.3702 -0.0112 -0.0462 -0.0243 182  GLU A CD  
1369 O OE1 . GLU A 166 ? 0.4466 0.4323 0.3920 -0.0150 -0.0482 -0.0256 182  GLU A OE1 
1370 O OE2 . GLU A 166 ? 0.4433 0.4255 0.3844 -0.0096 -0.0449 -0.0279 182  GLU A OE2 
1371 N N   . ARG A 167 ? 0.3436 0.3420 0.3085 -0.0128 -0.0473 -0.0025 183  ARG A N   
1372 C CA  . ARG A 167 ? 0.3401 0.3403 0.3101 -0.0150 -0.0483 0.0008  183  ARG A CA  
1373 C C   . ARG A 167 ? 0.3305 0.3293 0.3051 -0.0123 -0.0457 0.0057  183  ARG A C   
1374 O O   . ARG A 167 ? 0.3310 0.3266 0.3091 -0.0129 -0.0454 0.0073  183  ARG A O   
1375 C CB  . ARG A 167 ? 0.3427 0.3529 0.3137 -0.0180 -0.0509 0.0031  183  ARG A CB  
1376 C CG  . ARG A 167 ? 0.3487 0.3614 0.3251 -0.0208 -0.0523 0.0063  183  ARG A CG  
1377 C CD  . ARG A 167 ? 0.3659 0.3711 0.3424 -0.0231 -0.0530 0.0024  183  ARG A CD  
1378 N NE  . ARG A 167 ? 0.3740 0.3820 0.3561 -0.0259 -0.0543 0.0055  183  ARG A NE  
1379 C CZ  . ARG A 167 ? 0.3804 0.3818 0.3653 -0.0269 -0.0538 0.0048  183  ARG A CZ  
1380 N NH1 . ARG A 167 ? 0.3807 0.3727 0.3635 -0.0252 -0.0520 0.0015  183  ARG A NH1 
1381 N NH2 . ARG A 167 ? 0.3855 0.3903 0.3757 -0.0295 -0.0550 0.0080  183  ARG A NH2 
1382 N N   . TYR A 168 ? 0.3208 0.3220 0.2953 -0.0094 -0.0438 0.0078  184  TYR A N   
1383 C CA  . TYR A 168 ? 0.3110 0.3105 0.2893 -0.0068 -0.0408 0.0115  184  TYR A CA  
1384 C C   . TYR A 168 ? 0.3090 0.2998 0.2864 -0.0053 -0.0394 0.0092  184  TYR A C   
1385 O O   . TYR A 168 ? 0.3046 0.2932 0.2856 -0.0050 -0.0381 0.0117  184  TYR A O   
1386 C CB  . TYR A 168 ? 0.3077 0.3108 0.2857 -0.0042 -0.0389 0.0131  184  TYR A CB  
1387 C CG  . TYR A 168 ? 0.2996 0.2985 0.2789 -0.0011 -0.0355 0.0139  184  TYR A CG  
1388 C CD1 . TYR A 168 ? 0.2942 0.2933 0.2787 -0.0005 -0.0334 0.0179  184  TYR A CD1 
1389 C CD2 . TYR A 168 ? 0.3000 0.2953 0.2757 0.0009  -0.0344 0.0104  184  TYR A CD2 
1390 C CE1 . TYR A 168 ? 0.2847 0.2803 0.2702 0.0018  -0.0302 0.0180  184  TYR A CE1 
1391 C CE2 . TYR A 168 ? 0.2965 0.2886 0.2733 0.0033  -0.0315 0.0108  184  TYR A CE2 
1392 C CZ  . TYR A 168 ? 0.2876 0.2800 0.2692 0.0036  -0.0294 0.0144  184  TYR A CZ  
1393 O OH  . TYR A 168 ? 0.2847 0.2742 0.2670 0.0057  -0.0265 0.0142  184  TYR A OH  
1394 N N   . VAL A 169 ? 0.3080 0.2943 0.2809 -0.0043 -0.0394 0.0046  185  VAL A N   
1395 C CA  . VAL A 169 ? 0.3088 0.2874 0.2808 -0.0028 -0.0383 0.0026  185  VAL A CA  
1396 C C   . VAL A 169 ? 0.3119 0.2870 0.2861 -0.0050 -0.0393 0.0028  185  VAL A C   
1397 O O   . VAL A 169 ? 0.3080 0.2794 0.2843 -0.0039 -0.0378 0.0045  185  VAL A O   
1398 C CB  . VAL A 169 ? 0.3106 0.2855 0.2778 -0.0016 -0.0384 -0.0022 185  VAL A CB  
1399 C CG1 . VAL A 169 ? 0.3105 0.2779 0.2772 -0.0001 -0.0373 -0.0037 185  VAL A CG1 
1400 C CG2 . VAL A 169 ? 0.3060 0.2839 0.2715 0.0007  -0.0370 -0.0021 185  VAL A CG2 
1401 N N   . GLU A 170 ? 0.3174 0.2942 0.2913 -0.0082 -0.0417 0.0012  186  GLU A N   
1402 C CA  . GLU A 170 ? 0.3244 0.2984 0.3011 -0.0107 -0.0427 0.0013  186  GLU A CA  
1403 C C   . GLU A 170 ? 0.3160 0.2923 0.2979 -0.0111 -0.0419 0.0065  186  GLU A C   
1404 O O   . GLU A 170 ? 0.3177 0.2894 0.3019 -0.0109 -0.0409 0.0076  186  GLU A O   
1405 C CB  . GLU A 170 ? 0.3326 0.3093 0.3081 -0.0146 -0.0455 -0.0015 186  GLU A CB  
1406 C CG  . GLU A 170 ? 0.3607 0.3327 0.3317 -0.0148 -0.0458 -0.0074 186  GLU A CG  
1407 C CD  . GLU A 170 ? 0.4011 0.3768 0.3701 -0.0188 -0.0485 -0.0108 186  GLU A CD  
1408 O OE1 . GLU A 170 ? 0.4072 0.3889 0.3790 -0.0218 -0.0504 -0.0085 186  GLU A OE1 
1409 O OE2 . GLU A 170 ? 0.4277 0.4005 0.3926 -0.0191 -0.0485 -0.0159 186  GLU A OE2 
1410 N N   . LEU A 171 ? 0.3075 0.2911 0.2916 -0.0114 -0.0422 0.0100  187  LEU A N   
1411 C CA  . LEU A 171 ? 0.3011 0.2876 0.2908 -0.0118 -0.0413 0.0151  187  LEU A CA  
1412 C C   . LEU A 171 ? 0.2948 0.2781 0.2857 -0.0086 -0.0379 0.0174  187  LEU A C   
1413 O O   . LEU A 171 ? 0.2918 0.2739 0.2865 -0.0086 -0.0366 0.0203  187  LEU A O   
1414 C CB  . LEU A 171 ? 0.2985 0.2942 0.2907 -0.0131 -0.0424 0.0185  187  LEU A CB  
1415 C CG  . LEU A 171 ? 0.3069 0.3070 0.2990 -0.0171 -0.0460 0.0170  187  LEU A CG  
1416 C CD1 . LEU A 171 ? 0.2954 0.3056 0.2888 -0.0179 -0.0473 0.0202  187  LEU A CD1 
1417 C CD2 . LEU A 171 ? 0.3110 0.3096 0.3074 -0.0198 -0.0469 0.0182  187  LEU A CD2 
1418 N N   . ASN A 172 ? 0.2901 0.2726 0.2779 -0.0059 -0.0364 0.0159  188  ASN A N   
1419 C CA  . ASN A 172 ? 0.2860 0.2655 0.2741 -0.0031 -0.0334 0.0169  188  ASN A CA  
1420 C C   . ASN A 172 ? 0.2881 0.2609 0.2752 -0.0026 -0.0329 0.0156  188  ASN A C   
1421 O O   . ASN A 172 ? 0.2869 0.2580 0.2761 -0.0017 -0.0308 0.0179  188  ASN A O   
1422 C CB  . ASN A 172 ? 0.2842 0.2641 0.2690 -0.0007 -0.0322 0.0149  188  ASN A CB  
1423 C CG  . ASN A 172 ? 0.2800 0.2569 0.2645 0.0017  -0.0293 0.0151  188  ASN A CG  
1424 O OD1 . ASN A 172 ? 0.2931 0.2650 0.2756 0.0026  -0.0291 0.0132  188  ASN A OD1 
1425 N ND2 . ASN A 172 ? 0.2762 0.2562 0.2630 0.0029  -0.0269 0.0172  188  ASN A ND2 
1426 N N   . THR A 173 ? 0.2918 0.2608 0.2758 -0.0032 -0.0346 0.0120  189  THR A N   
1427 C CA  . THR A 173 ? 0.2957 0.2583 0.2791 -0.0028 -0.0341 0.0110  189  THR A CA  
1428 C C   . THR A 173 ? 0.2983 0.2602 0.2860 -0.0049 -0.0343 0.0137  189  THR A C   
1429 O O   . THR A 173 ? 0.2956 0.2542 0.2844 -0.0038 -0.0326 0.0156  189  THR A O   
1430 C CB  . THR A 173 ? 0.3012 0.2599 0.2811 -0.0031 -0.0356 0.0065  189  THR A CB  
1431 O OG1 . THR A 173 ? 0.3016 0.2615 0.2779 -0.0011 -0.0353 0.0041  189  THR A OG1 
1432 C CG2 . THR A 173 ? 0.2992 0.2513 0.2790 -0.0020 -0.0347 0.0060  189  THR A CG2 
1433 N N   . LYS A 174 ? 0.3011 0.2663 0.2910 -0.0079 -0.0364 0.0141  190  LYS A N   
1434 C CA  . LYS A 174 ? 0.3049 0.2704 0.2995 -0.0102 -0.0367 0.0169  190  LYS A CA  
1435 C C   . LYS A 174 ? 0.2999 0.2674 0.2981 -0.0090 -0.0343 0.0216  190  LYS A C   
1436 O O   . LYS A 174 ? 0.3012 0.2660 0.3020 -0.0091 -0.0330 0.0237  190  LYS A O   
1437 C CB  . LYS A 174 ? 0.3083 0.2787 0.3048 -0.0139 -0.0395 0.0165  190  LYS A CB  
1438 C CG  . LYS A 174 ? 0.3186 0.2890 0.3201 -0.0167 -0.0402 0.0188  190  LYS A CG  
1439 C CD  . LYS A 174 ? 0.3362 0.3121 0.3394 -0.0207 -0.0433 0.0179  190  LYS A CD  
1440 C CE  . LYS A 174 ? 0.3477 0.3231 0.3563 -0.0237 -0.0439 0.0198  190  LYS A CE  
1441 N NZ  . LYS A 174 ? 0.3626 0.3432 0.3727 -0.0281 -0.0472 0.0182  190  LYS A NZ  
1442 N N   . ALA A 175 ? 0.2951 0.2675 0.2937 -0.0078 -0.0333 0.0232  191  ALA A N   
1443 C CA  . ALA A 175 ? 0.2910 0.2653 0.2930 -0.0064 -0.0304 0.0272  191  ALA A CA  
1444 C C   . ALA A 175 ? 0.2915 0.2608 0.2916 -0.0040 -0.0278 0.0269  191  ALA A C   
1445 O O   . ALA A 175 ? 0.2912 0.2595 0.2941 -0.0038 -0.0258 0.0298  191  ALA A O   
1446 C CB  . ALA A 175 ? 0.2869 0.2666 0.2896 -0.0053 -0.0295 0.0285  191  ALA A CB  
1447 N N   . ALA A 176 ? 0.2908 0.2574 0.2860 -0.0021 -0.0277 0.0236  192  ALA A N   
1448 C CA  . ALA A 176 ? 0.2939 0.2567 0.2867 0.0001  -0.0256 0.0231  192  ALA A CA  
1449 C C   . ALA A 176 ? 0.2986 0.2571 0.2922 -0.0003 -0.0256 0.0241  192  ALA A C   
1450 O O   . ALA A 176 ? 0.3000 0.2572 0.2941 0.0007  -0.0233 0.0261  192  ALA A O   
1451 C CB  . ALA A 176 ? 0.2926 0.2538 0.2806 0.0019  -0.0261 0.0194  192  ALA A CB  
1452 N N   . LYS A 177 ? 0.3033 0.2595 0.2970 -0.0020 -0.0279 0.0226  193  LYS A N   
1453 C CA  . LYS A 177 ? 0.3112 0.2629 0.3062 -0.0026 -0.0278 0.0236  193  LYS A CA  
1454 C C   . LYS A 177 ? 0.3113 0.2645 0.3114 -0.0042 -0.0269 0.0276  193  LYS A C   
1455 O O   . LYS A 177 ? 0.3111 0.2614 0.3124 -0.0037 -0.0254 0.0296  193  LYS A O   
1456 C CB  . LYS A 177 ? 0.3179 0.2664 0.3122 -0.0042 -0.0302 0.0205  193  LYS A CB  
1457 C CG  . LYS A 177 ? 0.3247 0.2704 0.3143 -0.0021 -0.0305 0.0169  193  LYS A CG  
1458 C CD  . LYS A 177 ? 0.3457 0.2870 0.3350 -0.0035 -0.0320 0.0139  193  LYS A CD  
1459 C CE  . LYS A 177 ? 0.3534 0.2923 0.3385 -0.0012 -0.0321 0.0104  193  LYS A CE  
1460 N NZ  . LYS A 177 ? 0.3587 0.2950 0.3424 0.0020  -0.0302 0.0118  193  LYS A NZ  
1461 N N   . LEU A 178 ? 0.3094 0.2675 0.3128 -0.0060 -0.0276 0.0290  194  LEU A N   
1462 C CA  . LEU A 178 ? 0.3116 0.2721 0.3205 -0.0074 -0.0265 0.0332  194  LEU A CA  
1463 C C   . LEU A 178 ? 0.3113 0.2722 0.3205 -0.0051 -0.0229 0.0359  194  LEU A C   
1464 O O   . LEU A 178 ? 0.3116 0.2727 0.3246 -0.0056 -0.0211 0.0393  194  LEU A O   
1465 C CB  . LEU A 178 ? 0.3083 0.2749 0.3208 -0.0097 -0.0282 0.0345  194  LEU A CB  
1466 C CG  . LEU A 178 ? 0.3141 0.2812 0.3281 -0.0131 -0.0316 0.0329  194  LEU A CG  
1467 C CD1 . LEU A 178 ? 0.3085 0.2829 0.3242 -0.0148 -0.0336 0.0334  194  LEU A CD1 
1468 C CD2 . LEU A 178 ? 0.3226 0.2880 0.3415 -0.0151 -0.0313 0.0354  194  LEU A CD2 
1469 N N   . ASN A 179 ? 0.3100 0.2711 0.3153 -0.0028 -0.0216 0.0341  195  ASN A N   
1470 C CA  . ASN A 179 ? 0.3125 0.2735 0.3170 -0.0008 -0.0182 0.0353  195  ASN A CA  
1471 C C   . ASN A 179 ? 0.3136 0.2703 0.3138 0.0008  -0.0175 0.0341  195  ASN A C   
1472 O O   . ASN A 179 ? 0.3122 0.2690 0.3105 0.0025  -0.0148 0.0344  195  ASN A O   
1473 C CB  . ASN A 179 ? 0.3108 0.2749 0.3141 0.0004  -0.0169 0.0341  195  ASN A CB  
1474 C CG  . ASN A 179 ? 0.3190 0.2880 0.3275 -0.0007 -0.0166 0.0367  195  ASN A CG  
1475 O OD1 . ASN A 179 ? 0.3410 0.3115 0.3537 -0.0009 -0.0142 0.0400  195  ASN A OD1 
1476 N ND2 . ASN A 179 ? 0.3254 0.2971 0.3335 -0.0013 -0.0189 0.0353  195  ASN A ND2 
1477 N N   . ASN A 180 ? 0.3171 0.2705 0.3161 0.0003  -0.0197 0.0327  196  ASN A N   
1478 C CA  . ASN A 180 ? 0.3213 0.2707 0.3169 0.0020  -0.0194 0.0321  196  ASN A CA  
1479 C C   . ASN A 180 ? 0.3168 0.2663 0.3072 0.0044  -0.0190 0.0293  196  ASN A C   
1480 O O   . ASN A 180 ? 0.3171 0.2652 0.3048 0.0062  -0.0180 0.0297  196  ASN A O   
1481 C CB  . ASN A 180 ? 0.3241 0.2723 0.3213 0.0024  -0.0170 0.0357  196  ASN A CB  
1482 C CG  . ASN A 180 ? 0.3403 0.2870 0.3425 0.0001  -0.0177 0.0381  196  ASN A CG  
1483 O OD1 . ASN A 180 ? 0.3347 0.2801 0.3383 -0.0016 -0.0202 0.0365  196  ASN A OD1 
1484 N ND2 . ASN A 180 ? 0.3648 0.3116 0.3696 0.0000  -0.0154 0.0417  196  ASN A ND2 
1485 N N   . PHE A 181 ? 0.3116 0.2635 0.3008 0.0044  -0.0199 0.0268  197  PHE A N   
1486 C CA  . PHE A 181 ? 0.3098 0.2617 0.2946 0.0064  -0.0203 0.0237  197  PHE A CA  
1487 C C   . PHE A 181 ? 0.3118 0.2608 0.2955 0.0062  -0.0229 0.0214  197  PHE A C   
1488 O O   . PHE A 181 ? 0.3125 0.2608 0.2986 0.0041  -0.0245 0.0213  197  PHE A O   
1489 C CB  . PHE A 181 ? 0.3064 0.2621 0.2909 0.0065  -0.0197 0.0222  197  PHE A CB  
1490 C CG  . PHE A 181 ? 0.3077 0.2658 0.2934 0.0069  -0.0166 0.0238  197  PHE A CG  
1491 C CD1 . PHE A 181 ? 0.3103 0.2684 0.2931 0.0084  -0.0147 0.0232  197  PHE A CD1 
1492 C CD2 . PHE A 181 ? 0.3105 0.2713 0.3005 0.0056  -0.0155 0.0259  197  PHE A CD2 
1493 C CE1 . PHE A 181 ? 0.3096 0.2698 0.2934 0.0085  -0.0115 0.0241  197  PHE A CE1 
1494 C CE2 . PHE A 181 ? 0.3156 0.2781 0.3072 0.0060  -0.0121 0.0272  197  PHE A CE2 
1495 C CZ  . PHE A 181 ? 0.3135 0.2755 0.3019 0.0073  -0.0100 0.0260  197  PHE A CZ  
1496 N N   . THR A 182 ? 0.3113 0.2587 0.2914 0.0082  -0.0232 0.0195  198  THR A N   
1497 C CA  . THR A 182 ? 0.3131 0.2574 0.2921 0.0083  -0.0251 0.0170  198  THR A CA  
1498 C C   . THR A 182 ? 0.3094 0.2556 0.2883 0.0070  -0.0267 0.0143  198  THR A C   
1499 O O   . THR A 182 ? 0.3109 0.2551 0.2905 0.0054  -0.0283 0.0128  198  THR A O   
1500 C CB  . THR A 182 ? 0.3160 0.2592 0.2916 0.0111  -0.0248 0.0158  198  THR A CB  
1501 O OG1 . THR A 182 ? 0.3214 0.2642 0.2968 0.0124  -0.0233 0.0187  198  THR A OG1 
1502 C CG2 . THR A 182 ? 0.3283 0.2675 0.3036 0.0115  -0.0262 0.0137  198  THR A CG2 
1503 N N   . SER A 183 ? 0.2999 0.2501 0.2778 0.0075  -0.0260 0.0137  199  SER A N   
1504 C CA  . SER A 183 ? 0.2943 0.2472 0.2719 0.0065  -0.0273 0.0117  199  SER A CA  
1505 C C   . SER A 183 ? 0.2865 0.2440 0.2651 0.0068  -0.0257 0.0128  199  SER A C   
1506 O O   . SER A 183 ? 0.2804 0.2386 0.2597 0.0075  -0.0236 0.0146  199  SER A O   
1507 C CB  . SER A 183 ? 0.2971 0.2486 0.2713 0.0080  -0.0282 0.0082  199  SER A CB  
1508 O OG  . SER A 183 ? 0.2927 0.2459 0.2648 0.0102  -0.0269 0.0074  199  SER A OG  
1509 N N   . GLY A 184 ? 0.2826 0.2431 0.2612 0.0062  -0.0266 0.0117  200  GLY A N   
1510 C CA  . GLY A 184 ? 0.2774 0.2421 0.2574 0.0065  -0.0248 0.0127  200  GLY A CA  
1511 C C   . GLY A 184 ? 0.2757 0.2405 0.2536 0.0087  -0.0229 0.0113  200  GLY A C   
1512 O O   . GLY A 184 ? 0.2717 0.2390 0.2515 0.0090  -0.0206 0.0123  200  GLY A O   
1513 N N   . ALA A 185 ? 0.2783 0.2406 0.2529 0.0100  -0.0237 0.0089  201  ALA A N   
1514 C CA  . ALA A 185 ? 0.2788 0.2416 0.2513 0.0119  -0.0222 0.0074  201  ALA A CA  
1515 C C   . ALA A 185 ? 0.2798 0.2426 0.2531 0.0120  -0.0200 0.0093  201  ALA A C   
1516 O O   . ALA A 185 ? 0.2774 0.2425 0.2513 0.0123  -0.0178 0.0090  201  ALA A O   
1517 C CB  . ALA A 185 ? 0.2788 0.2393 0.2482 0.0134  -0.0236 0.0052  201  ALA A CB  
1518 N N   . GLU A 186 ? 0.2854 0.2456 0.2590 0.0117  -0.0205 0.0110  202  GLU A N   
1519 C CA  . GLU A 186 ? 0.2906 0.2508 0.2646 0.0118  -0.0185 0.0130  202  GLU A CA  
1520 C C   . GLU A 186 ? 0.2865 0.2487 0.2641 0.0105  -0.0164 0.0150  202  GLU A C   
1521 O O   . GLU A 186 ? 0.2845 0.2479 0.2622 0.0107  -0.0138 0.0154  202  GLU A O   
1522 C CB  . GLU A 186 ? 0.2949 0.2518 0.2688 0.0118  -0.0195 0.0149  202  GLU A CB  
1523 C CG  . GLU A 186 ? 0.3109 0.2660 0.2817 0.0136  -0.0207 0.0136  202  GLU A CG  
1524 C CD  . GLU A 186 ? 0.3302 0.2836 0.3003 0.0138  -0.0229 0.0113  202  GLU A CD  
1525 O OE1 . GLU A 186 ? 0.3319 0.2848 0.3038 0.0122  -0.0239 0.0110  202  GLU A OE1 
1526 O OE2 . GLU A 186 ? 0.3475 0.3004 0.3153 0.0156  -0.0234 0.0097  202  GLU A OE2 
1527 N N   . ALA A 187 ? 0.2850 0.2478 0.2656 0.0091  -0.0174 0.0163  203  ALA A N   
1528 C CA  . ALA A 187 ? 0.2832 0.2485 0.2680 0.0081  -0.0155 0.0187  203  ALA A CA  
1529 C C   . ALA A 187 ? 0.2806 0.2485 0.2659 0.0089  -0.0130 0.0175  203  ALA A C   
1530 O O   . ALA A 187 ? 0.2813 0.2501 0.2689 0.0088  -0.0098 0.0187  203  ALA A O   
1531 C CB  . ALA A 187 ? 0.2831 0.2497 0.2708 0.0065  -0.0175 0.0202  203  ALA A CB  
1532 N N   . TRP A 188 ? 0.2771 0.2459 0.2605 0.0095  -0.0141 0.0150  204  TRP A N   
1533 C CA  . TRP A 188 ? 0.2730 0.2440 0.2570 0.0102  -0.0116 0.0135  204  TRP A CA  
1534 C C   . TRP A 188 ? 0.2723 0.2426 0.2540 0.0110  -0.0095 0.0116  204  TRP A C   
1535 O O   . TRP A 188 ? 0.2683 0.2399 0.2521 0.0108  -0.0062 0.0114  204  TRP A O   
1536 C CB  . TRP A 188 ? 0.2729 0.2450 0.2551 0.0109  -0.0134 0.0112  204  TRP A CB  
1537 C CG  . TRP A 188 ? 0.2725 0.2470 0.2573 0.0101  -0.0144 0.0130  204  TRP A CG  
1538 C CD1 . TRP A 188 ? 0.2738 0.2502 0.2630 0.0091  -0.0136 0.0165  204  TRP A CD1 
1539 C CD2 . TRP A 188 ? 0.2719 0.2479 0.2552 0.0105  -0.0162 0.0115  204  TRP A CD2 
1540 N NE1 . TRP A 188 ? 0.2686 0.2481 0.2589 0.0087  -0.0151 0.0174  204  TRP A NE1 
1541 C CE2 . TRP A 188 ? 0.2689 0.2480 0.2553 0.0095  -0.0166 0.0142  204  TRP A CE2 
1542 C CE3 . TRP A 188 ? 0.2726 0.2479 0.2521 0.0115  -0.0174 0.0082  204  TRP A CE3 
1543 C CZ2 . TRP A 188 ? 0.2725 0.2543 0.2580 0.0094  -0.0183 0.0137  204  TRP A CZ2 
1544 C CZ3 . TRP A 188 ? 0.2747 0.2521 0.2535 0.0116  -0.0188 0.0075  204  TRP A CZ3 
1545 C CH2 . TRP A 188 ? 0.2735 0.2542 0.2550 0.0105  -0.0193 0.0102  204  TRP A CH2 
1546 N N   . LEU A 189 ? 0.2733 0.2420 0.2509 0.0117  -0.0113 0.0102  205  LEU A N   
1547 C CA  . LEU A 189 ? 0.2761 0.2453 0.2510 0.0124  -0.0099 0.0083  205  LEU A CA  
1548 C C   . LEU A 189 ? 0.2806 0.2496 0.2563 0.0117  -0.0072 0.0099  205  LEU A C   
1549 O O   . LEU A 189 ? 0.2808 0.2512 0.2549 0.0117  -0.0050 0.0081  205  LEU A O   
1550 C CB  . LEU A 189 ? 0.2757 0.2437 0.2465 0.0136  -0.0126 0.0072  205  LEU A CB  
1551 C CG  . LEU A 189 ? 0.2693 0.2381 0.2386 0.0145  -0.0143 0.0046  205  LEU A CG  
1552 C CD1 . LEU A 189 ? 0.2677 0.2345 0.2343 0.0157  -0.0170 0.0045  205  LEU A CD1 
1553 C CD2 . LEU A 189 ? 0.2691 0.2408 0.2374 0.0149  -0.0125 0.0019  205  LEU A CD2 
1554 N N   . ASP A 190 ? 0.2857 0.2533 0.2639 0.0110  -0.0073 0.0131  206  ASP A N   
1555 C CA  . ASP A 190 ? 0.2927 0.2602 0.2724 0.0103  -0.0045 0.0150  206  ASP A CA  
1556 C C   . ASP A 190 ? 0.2932 0.2623 0.2756 0.0098  -0.0004 0.0142  206  ASP A C   
1557 O O   . ASP A 190 ? 0.2934 0.2627 0.2754 0.0095  0.0024  0.0141  206  ASP A O   
1558 C CB  . ASP A 190 ? 0.2957 0.2618 0.2788 0.0095  -0.0054 0.0188  206  ASP A CB  
1559 C CG  . ASP A 190 ? 0.3035 0.2692 0.2880 0.0090  -0.0026 0.0211  206  ASP A CG  
1560 O OD1 . ASP A 190 ? 0.3134 0.2784 0.2945 0.0095  -0.0025 0.0210  206  ASP A OD1 
1561 O OD2 . ASP A 190 ? 0.3198 0.2862 0.3090 0.0083  -0.0005 0.0233  206  ASP A OD2 
1562 N N   . GLU A 191 ? 0.2939 0.2642 0.2791 0.0098  0.0000  0.0136  207  GLU A N   
1563 C CA  . GLU A 191 ? 0.2975 0.2690 0.2863 0.0094  0.0042  0.0129  207  GLU A CA  
1564 C C   . GLU A 191 ? 0.2952 0.2675 0.2810 0.0094  0.0064  0.0088  207  GLU A C   
1565 O O   . GLU A 191 ? 0.2936 0.2663 0.2821 0.0088  0.0106  0.0078  207  GLU A O   
1566 C CB  . GLU A 191 ? 0.2984 0.2713 0.2908 0.0096  0.0040  0.0135  207  GLU A CB  
1567 C CG  . GLU A 191 ? 0.3207 0.2941 0.3164 0.0093  0.0018  0.0174  207  GLU A CG  
1568 C CD  . GLU A 191 ? 0.3576 0.3311 0.3582 0.0087  0.0044  0.0211  207  GLU A CD  
1569 O OE1 . GLU A 191 ? 0.3726 0.3461 0.3759 0.0086  0.0089  0.0210  207  GLU A OE1 
1570 O OE2 . GLU A 191 ? 0.3863 0.3599 0.3883 0.0082  0.0021  0.0242  207  GLU A OE2 
1571 N N   . TYR A 192 ? 0.2932 0.2658 0.2738 0.0099  0.0037  0.0066  208  TYR A N   
1572 C CA  . TYR A 192 ? 0.2957 0.2700 0.2730 0.0097  0.0051  0.0026  208  TYR A CA  
1573 C C   . TYR A 192 ? 0.3014 0.2762 0.2749 0.0094  0.0059  0.0024  208  TYR A C   
1574 O O   . TYR A 192 ? 0.3014 0.2783 0.2719 0.0089  0.0072  -0.0008 208  TYR A O   
1575 C CB  . TYR A 192 ? 0.2915 0.2671 0.2660 0.0106  0.0021  0.0002  208  TYR A CB  
1576 C CG  . TYR A 192 ? 0.2838 0.2595 0.2617 0.0108  0.0019  0.0001  208  TYR A CG  
1577 C CD1 . TYR A 192 ? 0.2803 0.2571 0.2613 0.0102  0.0052  -0.0018 208  TYR A CD1 
1578 C CD2 . TYR A 192 ? 0.2844 0.2591 0.2626 0.0116  -0.0013 0.0021  208  TYR A CD2 
1579 C CE1 . TYR A 192 ? 0.2720 0.2492 0.2564 0.0106  0.0053  -0.0014 208  TYR A CE1 
1580 C CE2 . TYR A 192 ? 0.2764 0.2518 0.2573 0.0118  -0.0015 0.0023  208  TYR A CE2 
1581 C CZ  . TYR A 192 ? 0.2792 0.2560 0.2632 0.0114  0.0018  0.0008  208  TYR A CZ  
1582 O OH  . TYR A 192 ? 0.2716 0.2494 0.2585 0.0118  0.0018  0.0014  208  TYR A OH  
1583 N N   . GLU A 193 ? 0.3066 0.2797 0.2804 0.0096  0.0051  0.0060  209  GLU A N   
1584 C CA  . GLU A 193 ? 0.3167 0.2902 0.2875 0.0094  0.0063  0.0067  209  GLU A CA  
1585 C C   . GLU A 193 ? 0.3187 0.2949 0.2836 0.0098  0.0049  0.0042  209  GLU A C   
1586 O O   . GLU A 193 ? 0.3184 0.2967 0.2807 0.0089  0.0073  0.0023  209  GLU A O   
1587 C CB  . GLU A 193 ? 0.3211 0.2946 0.2945 0.0081  0.0114  0.0063  209  GLU A CB  
1588 C CG  . GLU A 193 ? 0.3407 0.3122 0.3204 0.0079  0.0132  0.0095  209  GLU A CG  
1589 C CD  . GLU A 193 ? 0.3670 0.3383 0.3495 0.0069  0.0188  0.0091  209  GLU A CD  
1590 O OE1 . GLU A 193 ? 0.3753 0.3468 0.3550 0.0065  0.0204  0.0093  209  GLU A OE1 
1591 O OE2 . GLU A 193 ? 0.3832 0.3541 0.3708 0.0066  0.0217  0.0088  209  GLU A OE2 
1592 N N   . ASP A 194 ? 0.3184 0.2948 0.2813 0.0110  0.0010  0.0042  210  ASP A N   
1593 C CA  . ASP A 194 ? 0.3231 0.3028 0.2811 0.0116  -0.0006 0.0023  210  ASP A CA  
1594 C C   . ASP A 194 ? 0.3220 0.3005 0.2790 0.0134  -0.0048 0.0042  210  ASP A C   
1595 O O   . ASP A 194 ? 0.3164 0.2936 0.2751 0.0139  -0.0065 0.0035  210  ASP A O   
1596 C CB  . ASP A 194 ? 0.3240 0.3066 0.2817 0.0109  0.0004  -0.0022 210  ASP A CB  
1597 C CG  . ASP A 194 ? 0.3348 0.3220 0.2876 0.0111  -0.0008 -0.0044 210  ASP A CG  
1598 O OD1 . ASP A 194 ? 0.3471 0.3351 0.2971 0.0126  -0.0037 -0.0021 210  ASP A OD1 
1599 O OD2 . ASP A 194 ? 0.3512 0.3416 0.3032 0.0097  0.0009  -0.0085 210  ASP A OD2 
1600 N N   . ASP A 195 ? 0.3247 0.3035 0.2790 0.0144  -0.0061 0.0067  211  ASP A N   
1601 C CA  . ASP A 195 ? 0.3265 0.3034 0.2805 0.0161  -0.0094 0.0090  211  ASP A CA  
1602 C C   . ASP A 195 ? 0.3238 0.3034 0.2755 0.0175  -0.0117 0.0070  211  ASP A C   
1603 O O   . ASP A 195 ? 0.3300 0.3078 0.2818 0.0190  -0.0141 0.0086  211  ASP A O   
1604 C CB  . ASP A 195 ? 0.3317 0.3075 0.2846 0.0168  -0.0096 0.0131  211  ASP A CB  
1605 C CG  . ASP A 195 ? 0.3368 0.3172 0.2853 0.0171  -0.0088 0.0132  211  ASP A CG  
1606 O OD1 . ASP A 195 ? 0.3408 0.3255 0.2870 0.0165  -0.0080 0.0098  211  ASP A OD1 
1607 O OD2 . ASP A 195 ? 0.3524 0.3326 0.2997 0.0180  -0.0090 0.0168  211  ASP A OD2 
1608 N N   . THR A 196 ? 0.3183 0.3021 0.2684 0.0168  -0.0107 0.0035  212  THR A N   
1609 C CA  . THR A 196 ? 0.3118 0.2987 0.2605 0.0178  -0.0127 0.0015  212  THR A CA  
1610 C C   . THR A 196 ? 0.3042 0.2910 0.2552 0.0170  -0.0121 -0.0020 212  THR A C   
1611 O O   . THR A 196 ? 0.3016 0.2919 0.2518 0.0174  -0.0130 -0.0045 212  THR A O   
1612 C CB  . THR A 196 ? 0.3158 0.3091 0.2605 0.0178  -0.0127 0.0003  212  THR A CB  
1613 O OG1 . THR A 196 ? 0.3167 0.3123 0.2609 0.0154  -0.0098 -0.0031 212  THR A OG1 
1614 C CG2 . THR A 196 ? 0.3201 0.3143 0.2622 0.0188  -0.0131 0.0043  212  THR A CG2 
1615 N N   . PHE A 197 ? 0.2970 0.2804 0.2514 0.0159  -0.0105 -0.0018 213  PHE A N   
1616 C CA  . PHE A 197 ? 0.2912 0.2747 0.2482 0.0150  -0.0092 -0.0046 213  PHE A CA  
1617 C C   . PHE A 197 ? 0.2895 0.2731 0.2470 0.0163  -0.0115 -0.0057 213  PHE A C   
1618 O O   . PHE A 197 ? 0.2861 0.2722 0.2442 0.0160  -0.0109 -0.0087 213  PHE A O   
1619 C CB  . PHE A 197 ? 0.2868 0.2671 0.2477 0.0139  -0.0071 -0.0033 213  PHE A CB  
1620 C CG  . PHE A 197 ? 0.2810 0.2621 0.2449 0.0127  -0.0042 -0.0058 213  PHE A CG  
1621 C CD1 . PHE A 197 ? 0.2845 0.2679 0.2482 0.0113  -0.0010 -0.0084 213  PHE A CD1 
1622 C CD2 . PHE A 197 ? 0.2730 0.2528 0.2401 0.0130  -0.0046 -0.0056 213  PHE A CD2 
1623 C CE1 . PHE A 197 ? 0.2832 0.2669 0.2505 0.0101  0.0019  -0.0108 213  PHE A CE1 
1624 C CE2 . PHE A 197 ? 0.2708 0.2515 0.2413 0.0121  -0.0017 -0.0075 213  PHE A CE2 
1625 C CZ  . PHE A 197 ? 0.2761 0.2584 0.2470 0.0106  0.0017  -0.0100 213  PHE A CZ  
1626 N N   . GLU A 198 ? 0.2914 0.2721 0.2488 0.0177  -0.0140 -0.0035 214  GLU A N   
1627 C CA  . GLU A 198 ? 0.2930 0.2733 0.2506 0.0191  -0.0160 -0.0045 214  GLU A CA  
1628 C C   . GLU A 198 ? 0.2927 0.2773 0.2482 0.0202  -0.0171 -0.0062 214  GLU A C   
1629 O O   . GLU A 198 ? 0.2892 0.2755 0.2454 0.0205  -0.0173 -0.0085 214  GLU A O   
1630 C CB  . GLU A 198 ? 0.2947 0.2710 0.2524 0.0203  -0.0182 -0.0020 214  GLU A CB  
1631 C CG  . GLU A 198 ? 0.2981 0.2709 0.2583 0.0191  -0.0179 -0.0007 214  GLU A CG  
1632 C CD  . GLU A 198 ? 0.3106 0.2794 0.2707 0.0197  -0.0197 0.0015  214  GLU A CD  
1633 O OE1 . GLU A 198 ? 0.3141 0.2819 0.2739 0.0196  -0.0194 0.0038  214  GLU A OE1 
1634 O OE2 . GLU A 198 ? 0.3113 0.2782 0.2719 0.0202  -0.0212 0.0008  214  GLU A OE2 
1635 N N   . GLN A 199 ? 0.2974 0.2840 0.2504 0.0208  -0.0177 -0.0047 215  GLN A N   
1636 C CA  . GLN A 199 ? 0.3028 0.2945 0.2538 0.0219  -0.0190 -0.0057 215  GLN A CA  
1637 C C   . GLN A 199 ? 0.3003 0.2967 0.2511 0.0201  -0.0173 -0.0095 215  GLN A C   
1638 O O   . GLN A 199 ? 0.2963 0.2965 0.2472 0.0207  -0.0182 -0.0115 215  GLN A O   
1639 C CB  . GLN A 199 ? 0.3072 0.3008 0.2556 0.0229  -0.0199 -0.0027 215  GLN A CB  
1640 C CG  . GLN A 199 ? 0.3269 0.3258 0.2738 0.0247  -0.0218 -0.0025 215  GLN A CG  
1641 C CD  . GLN A 199 ? 0.3455 0.3426 0.2942 0.0268  -0.0234 -0.0026 215  GLN A CD  
1642 O OE1 . GLN A 199 ? 0.3553 0.3469 0.3054 0.0279  -0.0240 -0.0007 215  GLN A OE1 
1643 N NE2 . GLN A 199 ? 0.3497 0.3516 0.2986 0.0271  -0.0240 -0.0049 215  GLN A NE2 
1644 N N   . GLN A 200 ? 0.2998 0.2960 0.2509 0.0180  -0.0147 -0.0105 216  GLN A N   
1645 C CA  . GLN A 200 ? 0.3032 0.3030 0.2549 0.0159  -0.0125 -0.0145 216  GLN A CA  
1646 C C   . GLN A 200 ? 0.2998 0.2990 0.2547 0.0158  -0.0120 -0.0168 216  GLN A C   
1647 O O   . GLN A 200 ? 0.2978 0.3011 0.2530 0.0151  -0.0117 -0.0200 216  GLN A O   
1648 C CB  . GLN A 200 ? 0.3025 0.3007 0.2549 0.0138  -0.0091 -0.0149 216  GLN A CB  
1649 C CG  . GLN A 200 ? 0.3136 0.3142 0.2623 0.0132  -0.0087 -0.0140 216  GLN A CG  
1650 C CD  . GLN A 200 ? 0.3223 0.3209 0.2722 0.0113  -0.0050 -0.0146 216  GLN A CD  
1651 O OE1 . GLN A 200 ? 0.3314 0.3305 0.2833 0.0094  -0.0020 -0.0180 216  GLN A OE1 
1652 N NE2 . GLN A 200 ? 0.3250 0.3210 0.2741 0.0117  -0.0048 -0.0111 216  GLN A NE2 
1653 N N   . LEU A 201 ? 0.2995 0.2939 0.2568 0.0164  -0.0120 -0.0151 217  LEU A N   
1654 C CA  . LEU A 201 ? 0.2979 0.2916 0.2581 0.0166  -0.0116 -0.0166 217  LEU A CA  
1655 C C   . LEU A 201 ? 0.2994 0.2950 0.2588 0.0185  -0.0142 -0.0171 217  LEU A C   
1656 O O   . LEU A 201 ? 0.2969 0.2947 0.2580 0.0183  -0.0136 -0.0195 217  LEU A O   
1657 C CB  . LEU A 201 ? 0.2957 0.2847 0.2583 0.0167  -0.0111 -0.0144 217  LEU A CB  
1658 C CG  . LEU A 201 ? 0.2933 0.2809 0.2584 0.0149  -0.0078 -0.0141 217  LEU A CG  
1659 C CD1 . LEU A 201 ? 0.2957 0.2794 0.2627 0.0151  -0.0081 -0.0110 217  LEU A CD1 
1660 C CD2 . LEU A 201 ? 0.2923 0.2818 0.2606 0.0135  -0.0048 -0.0170 217  LEU A CD2 
1661 N N   . GLU A 202 ? 0.3050 0.2996 0.2623 0.0203  -0.0167 -0.0147 218  GLU A N   
1662 C CA  . GLU A 202 ? 0.3108 0.3074 0.2676 0.0224  -0.0189 -0.0149 218  GLU A CA  
1663 C C   . GLU A 202 ? 0.3121 0.3152 0.2682 0.0219  -0.0190 -0.0173 218  GLU A C   
1664 O O   . GLU A 202 ? 0.3096 0.3152 0.2671 0.0226  -0.0195 -0.0190 218  GLU A O   
1665 C CB  . GLU A 202 ? 0.3158 0.3102 0.2709 0.0245  -0.0211 -0.0117 218  GLU A CB  
1666 C CG  . GLU A 202 ? 0.3246 0.3126 0.2805 0.0249  -0.0215 -0.0097 218  GLU A CG  
1667 C CD  . GLU A 202 ? 0.3437 0.3295 0.3009 0.0259  -0.0221 -0.0108 218  GLU A CD  
1668 O OE1 . GLU A 202 ? 0.3530 0.3420 0.3108 0.0267  -0.0222 -0.0127 218  GLU A OE1 
1669 O OE2 . GLU A 202 ? 0.3403 0.3216 0.2979 0.0259  -0.0225 -0.0097 218  GLU A OE2 
1670 N N   . ASP A 203 ? 0.3148 0.3211 0.2690 0.0206  -0.0185 -0.0174 219  ASP A N   
1671 C CA  . ASP A 203 ? 0.3177 0.3311 0.2708 0.0197  -0.0186 -0.0199 219  ASP A CA  
1672 C C   . ASP A 203 ? 0.3139 0.3291 0.2696 0.0175  -0.0164 -0.0241 219  ASP A C   
1673 O O   . ASP A 203 ? 0.3132 0.3332 0.2699 0.0175  -0.0171 -0.0261 219  ASP A O   
1674 C CB  . ASP A 203 ? 0.3228 0.3392 0.2726 0.0185  -0.0183 -0.0193 219  ASP A CB  
1675 C CG  . ASP A 203 ? 0.3350 0.3512 0.2824 0.0208  -0.0206 -0.0149 219  ASP A CG  
1676 O OD1 . ASP A 203 ? 0.3437 0.3580 0.2922 0.0234  -0.0225 -0.0127 219  ASP A OD1 
1677 O OD2 . ASP A 203 ? 0.3515 0.3694 0.2962 0.0201  -0.0202 -0.0136 219  ASP A OD2 
1678 N N   . ILE A 204 ? 0.3116 0.3231 0.2690 0.0157  -0.0135 -0.0251 220  ILE A N   
1679 C CA  . ILE A 204 ? 0.3100 0.3224 0.2708 0.0137  -0.0108 -0.0286 220  ILE A CA  
1680 C C   . ILE A 204 ? 0.3068 0.3182 0.2705 0.0152  -0.0114 -0.0287 220  ILE A C   
1681 O O   . ILE A 204 ? 0.3050 0.3199 0.2707 0.0144  -0.0107 -0.0316 220  ILE A O   
1682 C CB  . ILE A 204 ? 0.3091 0.3174 0.2720 0.0119  -0.0072 -0.0289 220  ILE A CB  
1683 C CG1 . ILE A 204 ? 0.3121 0.3222 0.2723 0.0100  -0.0058 -0.0300 220  ILE A CG1 
1684 C CG2 . ILE A 204 ? 0.3100 0.3182 0.2775 0.0104  -0.0041 -0.0318 220  ILE A CG2 
1685 C CD1 . ILE A 204 ? 0.3056 0.3111 0.2674 0.0088  -0.0026 -0.0290 220  ILE A CD1 
1686 N N   . PHE A 205 ? 0.3047 0.3115 0.2684 0.0172  -0.0126 -0.0257 221  PHE A N   
1687 C CA  . PHE A 205 ? 0.3046 0.3103 0.2703 0.0187  -0.0132 -0.0257 221  PHE A CA  
1688 C C   . PHE A 205 ? 0.3055 0.3157 0.2707 0.0201  -0.0153 -0.0266 221  PHE A C   
1689 O O   . PHE A 205 ? 0.3033 0.3155 0.2710 0.0202  -0.0147 -0.0284 221  PHE A O   
1690 C CB  . PHE A 205 ? 0.3038 0.3042 0.2689 0.0203  -0.0143 -0.0226 221  PHE A CB  
1691 C CG  . PHE A 205 ? 0.3092 0.3086 0.2758 0.0217  -0.0147 -0.0227 221  PHE A CG  
1692 C CD1 . PHE A 205 ? 0.3101 0.3093 0.2799 0.0208  -0.0124 -0.0237 221  PHE A CD1 
1693 C CD2 . PHE A 205 ? 0.3159 0.3148 0.2810 0.0240  -0.0171 -0.0218 221  PHE A CD2 
1694 C CE1 . PHE A 205 ? 0.3173 0.3161 0.2881 0.0221  -0.0127 -0.0237 221  PHE A CE1 
1695 C CE2 . PHE A 205 ? 0.3228 0.3209 0.2890 0.0253  -0.0173 -0.0222 221  PHE A CE2 
1696 C CZ  . PHE A 205 ? 0.3183 0.3166 0.2871 0.0243  -0.0151 -0.0232 221  PHE A CZ  
1697 N N   . ALA A 206 ? 0.3091 0.3213 0.2714 0.0213  -0.0177 -0.0250 222  ALA A N   
1698 C CA  . ALA A 206 ? 0.3137 0.3310 0.2759 0.0229  -0.0198 -0.0252 222  ALA A CA  
1699 C C   . ALA A 206 ? 0.3160 0.3398 0.2798 0.0209  -0.0189 -0.0288 222  ALA A C   
1700 O O   . ALA A 206 ? 0.3134 0.3409 0.2789 0.0219  -0.0198 -0.0297 222  ALA A O   
1701 C CB  . ALA A 206 ? 0.3166 0.3353 0.2758 0.0245  -0.0221 -0.0224 222  ALA A CB  
1702 N N   . ASP A 207 ? 0.3208 0.3461 0.2843 0.0180  -0.0170 -0.0310 223  ASP A N   
1703 C CA  . ASP A 207 ? 0.3268 0.3580 0.2919 0.0155  -0.0157 -0.0350 223  ASP A CA  
1704 C C   . ASP A 207 ? 0.3242 0.3542 0.2939 0.0146  -0.0134 -0.0374 223  ASP A C   
1705 O O   . ASP A 207 ? 0.3252 0.3603 0.2971 0.0137  -0.0132 -0.0400 223  ASP A O   
1706 C CB  . ASP A 207 ? 0.3302 0.3627 0.2937 0.0125  -0.0139 -0.0371 223  ASP A CB  
1707 C CG  . ASP A 207 ? 0.3468 0.3830 0.3056 0.0129  -0.0162 -0.0353 223  ASP A CG  
1708 O OD1 . ASP A 207 ? 0.3563 0.3959 0.3139 0.0152  -0.0192 -0.0330 223  ASP A OD1 
1709 O OD2 . ASP A 207 ? 0.3630 0.3989 0.3196 0.0110  -0.0147 -0.0361 223  ASP A OD2 
1710 N N   . ILE A 208 ? 0.3227 0.3462 0.2939 0.0150  -0.0115 -0.0361 224  ILE A N   
1711 C CA  . ILE A 208 ? 0.3226 0.3447 0.2983 0.0143  -0.0088 -0.0376 224  ILE A CA  
1712 C C   . ILE A 208 ? 0.3202 0.3413 0.2969 0.0170  -0.0102 -0.0359 224  ILE A C   
1713 O O   . ILE A 208 ? 0.3185 0.3404 0.2988 0.0168  -0.0085 -0.0373 224  ILE A O   
1714 C CB  . ILE A 208 ? 0.3231 0.3395 0.3004 0.0132  -0.0057 -0.0368 224  ILE A CB  
1715 C CG1 . ILE A 208 ? 0.3335 0.3500 0.3096 0.0108  -0.0040 -0.0381 224  ILE A CG1 
1716 C CG2 . ILE A 208 ? 0.3252 0.3408 0.3077 0.0124  -0.0025 -0.0381 224  ILE A CG2 
1717 C CD1 . ILE A 208 ? 0.3609 0.3822 0.3387 0.0078  -0.0019 -0.0428 224  ILE A CD1 
1718 N N   . ARG A 209 ? 0.3185 0.3378 0.2922 0.0196  -0.0130 -0.0331 225  ARG A N   
1719 C CA  . ARG A 209 ? 0.3176 0.3353 0.2917 0.0222  -0.0142 -0.0316 225  ARG A CA  
1720 C C   . ARG A 209 ? 0.3131 0.3357 0.2898 0.0228  -0.0143 -0.0334 225  ARG A C   
1721 O O   . ARG A 209 ? 0.3112 0.3325 0.2900 0.0238  -0.0133 -0.0334 225  ARG A O   
1722 C CB  . ARG A 209 ? 0.3213 0.3367 0.2920 0.0246  -0.0170 -0.0287 225  ARG A CB  
1723 C CG  . ARG A 209 ? 0.3308 0.3425 0.3014 0.0270  -0.0176 -0.0273 225  ARG A CG  
1724 C CD  . ARG A 209 ? 0.3489 0.3570 0.3166 0.0289  -0.0197 -0.0247 225  ARG A CD  
1725 N NE  . ARG A 209 ? 0.3544 0.3582 0.3218 0.0306  -0.0199 -0.0239 225  ARG A NE  
1726 C CZ  . ARG A 209 ? 0.3650 0.3642 0.3302 0.0318  -0.0211 -0.0221 225  ARG A CZ  
1727 N NH1 . ARG A 209 ? 0.3598 0.3581 0.3234 0.0318  -0.0223 -0.0204 225  ARG A NH1 
1728 N NH2 . ARG A 209 ? 0.3618 0.3575 0.3267 0.0329  -0.0210 -0.0221 225  ARG A NH2 
1729 N N   . PRO A 210 ? 0.3099 0.3388 0.2867 0.0221  -0.0155 -0.0349 226  PRO A N   
1730 C CA  . PRO A 210 ? 0.3064 0.3406 0.2864 0.0224  -0.0156 -0.0366 226  PRO A CA  
1731 C C   . PRO A 210 ? 0.3016 0.3358 0.2859 0.0204  -0.0123 -0.0391 226  PRO A C   
1732 O O   . PRO A 210 ? 0.3014 0.3367 0.2885 0.0216  -0.0118 -0.0393 226  PRO A O   
1733 C CB  . PRO A 210 ? 0.3099 0.3514 0.2892 0.0211  -0.0173 -0.0380 226  PRO A CB  
1734 C CG  . PRO A 210 ? 0.3119 0.3514 0.2867 0.0220  -0.0191 -0.0355 226  PRO A CG  
1735 C CD  . PRO A 210 ? 0.3117 0.3438 0.2856 0.0212  -0.0171 -0.0348 226  PRO A CD  
1736 N N   . LEU A 211 ? 0.2952 0.3281 0.2805 0.0176  -0.0099 -0.0409 227  LEU A N   
1737 C CA  . LEU A 211 ? 0.2891 0.3212 0.2791 0.0158  -0.0062 -0.0428 227  LEU A CA  
1738 C C   . LEU A 211 ? 0.2835 0.3105 0.2744 0.0178  -0.0050 -0.0402 227  LEU A C   
1739 O O   . LEU A 211 ? 0.2782 0.3061 0.2729 0.0180  -0.0032 -0.0407 227  LEU A O   
1740 C CB  . LEU A 211 ? 0.2909 0.3219 0.2820 0.0125  -0.0033 -0.0449 227  LEU A CB  
1741 C CG  . LEU A 211 ? 0.2898 0.3192 0.2865 0.0105  0.0011  -0.0466 227  LEU A CG  
1742 C CD1 . LEU A 211 ? 0.2913 0.3256 0.2926 0.0097  0.0020  -0.0492 227  LEU A CD1 
1743 C CD2 . LEU A 211 ? 0.2935 0.3214 0.2911 0.0074  0.0040  -0.0488 227  LEU A CD2 
1744 N N   . TYR A 212 ? 0.2786 0.3007 0.2661 0.0191  -0.0061 -0.0373 228  TYR A N   
1745 C CA  . TYR A 212 ? 0.2744 0.2924 0.2619 0.0210  -0.0055 -0.0349 228  TYR A CA  
1746 C C   . TYR A 212 ? 0.2729 0.2926 0.2606 0.0234  -0.0068 -0.0346 228  TYR A C   
1747 O O   . TYR A 212 ? 0.2755 0.2946 0.2654 0.0240  -0.0050 -0.0340 228  TYR A O   
1748 C CB  . TYR A 212 ? 0.2745 0.2877 0.2582 0.0219  -0.0070 -0.0321 228  TYR A CB  
1749 C CG  . TYR A 212 ? 0.2697 0.2797 0.2530 0.0235  -0.0068 -0.0299 228  TYR A CG  
1750 C CD1 . TYR A 212 ? 0.2698 0.2788 0.2563 0.0227  -0.0039 -0.0291 228  TYR A CD1 
1751 C CD2 . TYR A 212 ? 0.2659 0.2743 0.2459 0.0258  -0.0093 -0.0287 228  TYR A CD2 
1752 C CE1 . TYR A 212 ? 0.2659 0.2730 0.2516 0.0241  -0.0038 -0.0270 228  TYR A CE1 
1753 C CE2 . TYR A 212 ? 0.2665 0.2725 0.2457 0.0270  -0.0091 -0.0272 228  TYR A CE2 
1754 C CZ  . TYR A 212 ? 0.2603 0.2661 0.2422 0.0261  -0.0065 -0.0263 228  TYR A CZ  
1755 O OH  . TYR A 212 ? 0.2587 0.2631 0.2395 0.0271  -0.0063 -0.0246 228  TYR A OH  
1756 N N   . GLN A 213 ? 0.2719 0.2939 0.2574 0.0248  -0.0096 -0.0346 229  GLN A N   
1757 C CA  . GLN A 213 ? 0.2732 0.2969 0.2591 0.0274  -0.0107 -0.0343 229  GLN A CA  
1758 C C   . GLN A 213 ? 0.2690 0.2969 0.2596 0.0267  -0.0086 -0.0361 229  GLN A C   
1759 O O   . GLN A 213 ? 0.2689 0.2965 0.2606 0.0284  -0.0079 -0.0356 229  GLN A O   
1760 C CB  . GLN A 213 ? 0.2755 0.3018 0.2593 0.0289  -0.0137 -0.0338 229  GLN A CB  
1761 C CG  . GLN A 213 ? 0.2869 0.3094 0.2665 0.0297  -0.0157 -0.0318 229  GLN A CG  
1762 C CD  . GLN A 213 ? 0.3027 0.3196 0.2801 0.0318  -0.0161 -0.0299 229  GLN A CD  
1763 O OE1 . GLN A 213 ? 0.3090 0.3257 0.2859 0.0343  -0.0172 -0.0293 229  GLN A OE1 
1764 N NE2 . GLN A 213 ? 0.3237 0.3361 0.2998 0.0307  -0.0152 -0.0292 229  GLN A NE2 
1765 N N   . GLN A 214 ? 0.2648 0.2966 0.2583 0.0240  -0.0076 -0.0385 230  GLN A N   
1766 C CA  . GLN A 214 ? 0.2601 0.2961 0.2587 0.0228  -0.0054 -0.0407 230  GLN A CA  
1767 C C   . GLN A 214 ? 0.2584 0.2911 0.2600 0.0223  -0.0018 -0.0401 230  GLN A C   
1768 O O   . GLN A 214 ? 0.2570 0.2913 0.2618 0.0231  -0.0003 -0.0401 230  GLN A O   
1769 C CB  . GLN A 214 ? 0.2620 0.3028 0.2628 0.0196  -0.0050 -0.0439 230  GLN A CB  
1770 C CG  . GLN A 214 ? 0.2595 0.3054 0.2578 0.0199  -0.0085 -0.0443 230  GLN A CG  
1771 C CD  . GLN A 214 ? 0.2600 0.3110 0.2603 0.0219  -0.0100 -0.0440 230  GLN A CD  
1772 O OE1 . GLN A 214 ? 0.2685 0.3228 0.2736 0.0210  -0.0083 -0.0458 230  GLN A OE1 
1773 N NE2 . GLN A 214 ? 0.2514 0.3032 0.2487 0.0247  -0.0131 -0.0418 230  GLN A NE2 
1774 N N   . ILE A 215 ? 0.2552 0.2837 0.2559 0.0211  -0.0005 -0.0392 231  ILE A N   
1775 C CA  . ILE A 215 ? 0.2543 0.2799 0.2579 0.0209  0.0028  -0.0377 231  ILE A CA  
1776 C C   . ILE A 215 ? 0.2527 0.2762 0.2540 0.0238  0.0020  -0.0350 231  ILE A C   
1777 O O   . ILE A 215 ? 0.2521 0.2764 0.2565 0.0244  0.0043  -0.0343 231  ILE A O   
1778 C CB  . ILE A 215 ? 0.2544 0.2760 0.2574 0.0193  0.0042  -0.0368 231  ILE A CB  
1779 C CG1 . ILE A 215 ? 0.2604 0.2840 0.2662 0.0161  0.0059  -0.0400 231  ILE A CG1 
1780 C CG2 . ILE A 215 ? 0.2536 0.2725 0.2593 0.0196  0.0072  -0.0341 231  ILE A CG2 
1781 C CD1 . ILE A 215 ? 0.2718 0.2918 0.2765 0.0146  0.0070  -0.0395 231  ILE A CD1 
1782 N N   . HIS A 216 ? 0.2524 0.2734 0.2484 0.0255  -0.0009 -0.0336 232  HIS A N   
1783 C CA  . HIS A 216 ? 0.2522 0.2712 0.2453 0.0280  -0.0020 -0.0317 232  HIS A CA  
1784 C C   . HIS A 216 ? 0.2514 0.2737 0.2464 0.0296  -0.0016 -0.0325 232  HIS A C   
1785 O O   . HIS A 216 ? 0.2514 0.2735 0.2471 0.0307  0.0000  -0.0314 232  HIS A O   
1786 C CB  . HIS A 216 ? 0.2525 0.2687 0.2402 0.0292  -0.0053 -0.0309 232  HIS A CB  
1787 C CG  . HIS A 216 ? 0.2596 0.2735 0.2441 0.0316  -0.0064 -0.0297 232  HIS A CG  
1788 N ND1 . HIS A 216 ? 0.2653 0.2807 0.2496 0.0337  -0.0070 -0.0304 232  HIS A ND1 
1789 C CD2 . HIS A 216 ? 0.2656 0.2758 0.2469 0.0319  -0.0069 -0.0280 232  HIS A CD2 
1790 C CE1 . HIS A 216 ? 0.2715 0.2840 0.2525 0.0352  -0.0075 -0.0296 232  HIS A CE1 
1791 N NE2 . HIS A 216 ? 0.2691 0.2785 0.2480 0.0341  -0.0076 -0.0282 232  HIS A NE2 
1792 N N   . GLY A 217 ? 0.2521 0.2779 0.2480 0.0298  -0.0030 -0.0343 233  GLY A N   
1793 C CA  . GLY A 217 ? 0.2511 0.2807 0.2494 0.0314  -0.0028 -0.0350 233  GLY A CA  
1794 C C   . GLY A 217 ? 0.2515 0.2835 0.2551 0.0304  0.0006  -0.0356 233  GLY A C   
1795 O O   . GLY A 217 ? 0.2486 0.2812 0.2531 0.0321  0.0018  -0.0348 233  GLY A O   
1796 N N   . TYR A 218 ? 0.2516 0.2848 0.2588 0.0276  0.0024  -0.0369 234  TYR A N   
1797 C CA  . TYR A 218 ? 0.2544 0.2897 0.2677 0.0263  0.0061  -0.0375 234  TYR A CA  
1798 C C   . TYR A 218 ? 0.2534 0.2856 0.2669 0.0272  0.0087  -0.0347 234  TYR A C   
1799 O O   . TYR A 218 ? 0.2534 0.2873 0.2701 0.0280  0.0110  -0.0340 234  TYR A O   
1800 C CB  . TYR A 218 ? 0.2549 0.2917 0.2722 0.0227  0.0078  -0.0399 234  TYR A CB  
1801 C CG  . TYR A 218 ? 0.2662 0.3052 0.2907 0.0212  0.0119  -0.0409 234  TYR A CG  
1802 C CD1 . TYR A 218 ? 0.2685 0.3128 0.2970 0.0209  0.0121  -0.0429 234  TYR A CD1 
1803 C CD2 . TYR A 218 ? 0.2741 0.3101 0.3018 0.0201  0.0157  -0.0395 234  TYR A CD2 
1804 C CE1 . TYR A 218 ? 0.2815 0.3276 0.3170 0.0193  0.0160  -0.0438 234  TYR A CE1 
1805 C CE2 . TYR A 218 ? 0.2857 0.3234 0.3206 0.0188  0.0198  -0.0401 234  TYR A CE2 
1806 C CZ  . TYR A 218 ? 0.2883 0.3310 0.3271 0.0183  0.0200  -0.0424 234  TYR A CZ  
1807 O OH  . TYR A 218 ? 0.3051 0.3494 0.3516 0.0168  0.0243  -0.0430 234  TYR A OH  
1808 N N   . VAL A 219 ? 0.2518 0.2799 0.2619 0.0270  0.0082  -0.0329 235  VAL A N   
1809 C CA  . VAL A 219 ? 0.2513 0.2771 0.2611 0.0279  0.0101  -0.0297 235  VAL A CA  
1810 C C   . VAL A 219 ? 0.2541 0.2802 0.2604 0.0307  0.0091  -0.0285 235  VAL A C   
1811 O O   . VAL A 219 ? 0.2515 0.2787 0.2598 0.0315  0.0115  -0.0267 235  VAL A O   
1812 C CB  . VAL A 219 ? 0.2520 0.2739 0.2587 0.0272  0.0093  -0.0279 235  VAL A CB  
1813 C CG1 . VAL A 219 ? 0.2517 0.2722 0.2567 0.0285  0.0102  -0.0244 235  VAL A CG1 
1814 C CG2 . VAL A 219 ? 0.2467 0.2682 0.2579 0.0245  0.0118  -0.0287 235  VAL A CG2 
1815 N N   . ARG A 220 ? 0.2550 0.2803 0.2566 0.0321  0.0057  -0.0294 236  ARG A N   
1816 C CA  . ARG A 220 ? 0.2585 0.2836 0.2566 0.0347  0.0048  -0.0290 236  ARG A CA  
1817 C C   . ARG A 220 ? 0.2602 0.2893 0.2625 0.0357  0.0070  -0.0297 236  ARG A C   
1818 O O   . ARG A 220 ? 0.2598 0.2894 0.2614 0.0372  0.0085  -0.0284 236  ARG A O   
1819 C CB  . ARG A 220 ? 0.2602 0.2834 0.2537 0.0360  0.0013  -0.0301 236  ARG A CB  
1820 C CG  . ARG A 220 ? 0.2611 0.2837 0.2514 0.0387  0.0007  -0.0301 236  ARG A CG  
1821 C CD  . ARG A 220 ? 0.2592 0.2790 0.2454 0.0398  -0.0022 -0.0308 236  ARG A CD  
1822 N NE  . ARG A 220 ? 0.2511 0.2731 0.2396 0.0395  -0.0037 -0.0319 236  ARG A NE  
1823 C CZ  . ARG A 220 ? 0.2484 0.2686 0.2344 0.0403  -0.0063 -0.0320 236  ARG A CZ  
1824 N NH1 . ARG A 220 ? 0.2362 0.2519 0.2176 0.0415  -0.0075 -0.0315 236  ARG A NH1 
1825 N NH2 . ARG A 220 ? 0.2410 0.2643 0.2291 0.0399  -0.0075 -0.0327 236  ARG A NH2 
1826 N N   . PHE A 221 ? 0.2609 0.2932 0.2675 0.0346  0.0071  -0.0317 237  PHE A N   
1827 C CA  . PHE A 221 ? 0.2644 0.3010 0.2762 0.0350  0.0091  -0.0325 237  PHE A CA  
1828 C C   . PHE A 221 ? 0.2641 0.3014 0.2800 0.0344  0.0132  -0.0308 237  PHE A C   
1829 O O   . PHE A 221 ? 0.2627 0.3017 0.2797 0.0361  0.0150  -0.0298 237  PHE A O   
1830 C CB  . PHE A 221 ? 0.2636 0.3040 0.2795 0.0332  0.0083  -0.0351 237  PHE A CB  
1831 C CG  . PHE A 221 ? 0.2690 0.3142 0.2919 0.0323  0.0111  -0.0362 237  PHE A CG  
1832 C CD1 . PHE A 221 ? 0.2769 0.3251 0.3014 0.0345  0.0115  -0.0361 237  PHE A CD1 
1833 C CD2 . PHE A 221 ? 0.2695 0.3160 0.2979 0.0292  0.0134  -0.0375 237  PHE A CD2 
1834 C CE1 . PHE A 221 ? 0.2732 0.3260 0.3046 0.0336  0.0140  -0.0370 237  PHE A CE1 
1835 C CE2 . PHE A 221 ? 0.2742 0.3250 0.3096 0.0281  0.0161  -0.0387 237  PHE A CE2 
1836 C CZ  . PHE A 221 ? 0.2704 0.3246 0.3074 0.0303  0.0163  -0.0384 237  PHE A CZ  
1837 N N   . ARG A 222 ? 0.2634 0.2992 0.2816 0.0322  0.0147  -0.0302 238  ARG A N   
1838 C CA  . ARG A 222 ? 0.2659 0.3021 0.2888 0.0316  0.0189  -0.0280 238  ARG A CA  
1839 C C   . ARG A 222 ? 0.2675 0.3023 0.2866 0.0335  0.0195  -0.0245 238  ARG A C   
1840 O O   . ARG A 222 ? 0.2697 0.3064 0.2920 0.0342  0.0227  -0.0224 238  ARG A O   
1841 C CB  . ARG A 222 ? 0.2654 0.3003 0.2923 0.0287  0.0207  -0.0284 238  ARG A CB  
1842 C CG  . ARG A 222 ? 0.2725 0.3098 0.3042 0.0262  0.0211  -0.0322 238  ARG A CG  
1843 C CD  . ARG A 222 ? 0.2818 0.3230 0.3205 0.0258  0.0242  -0.0330 238  ARG A CD  
1844 N NE  . ARG A 222 ? 0.2946 0.3349 0.3386 0.0253  0.0289  -0.0304 238  ARG A NE  
1845 C CZ  . ARG A 222 ? 0.3056 0.3449 0.3556 0.0226  0.0322  -0.0312 238  ARG A CZ  
1846 N NH1 . ARG A 222 ? 0.3063 0.3458 0.3574 0.0198  0.0313  -0.0351 238  ARG A NH1 
1847 N NH2 . ARG A 222 ? 0.3154 0.3537 0.3705 0.0226  0.0367  -0.0281 238  ARG A NH2 
1848 N N   . LEU A 223 ? 0.2655 0.2974 0.2778 0.0343  0.0165  -0.0239 239  LEU A N   
1849 C CA  . LEU A 223 ? 0.2677 0.2988 0.2755 0.0359  0.0165  -0.0210 239  LEU A CA  
1850 C C   . LEU A 223 ? 0.2704 0.3034 0.2759 0.0383  0.0166  -0.0214 239  LEU A C   
1851 O O   . LEU A 223 ? 0.2709 0.3052 0.2751 0.0394  0.0184  -0.0190 239  LEU A O   
1852 C CB  . LEU A 223 ? 0.2669 0.2945 0.2684 0.0358  0.0132  -0.0208 239  LEU A CB  
1853 C CG  . LEU A 223 ? 0.2606 0.2863 0.2635 0.0338  0.0135  -0.0191 239  LEU A CG  
1854 C CD1 . LEU A 223 ? 0.2569 0.2792 0.2537 0.0337  0.0099  -0.0193 239  LEU A CD1 
1855 C CD2 . LEU A 223 ? 0.2547 0.2818 0.2605 0.0338  0.0167  -0.0151 239  LEU A CD2 
1856 N N   . ARG A 224 ? 0.2720 0.3055 0.2770 0.0391  0.0149  -0.0243 240  ARG A N   
1857 C CA  . ARG A 224 ? 0.2774 0.3128 0.2812 0.0414  0.0154  -0.0249 240  ARG A CA  
1858 C C   . ARG A 224 ? 0.2813 0.3205 0.2909 0.0417  0.0194  -0.0236 240  ARG A C   
1859 O O   . ARG A 224 ? 0.2826 0.3233 0.2906 0.0435  0.0209  -0.0225 240  ARG A O   
1860 C CB  . ARG A 224 ? 0.2772 0.3128 0.2808 0.0422  0.0131  -0.0278 240  ARG A CB  
1861 C CG  . ARG A 224 ? 0.2755 0.3072 0.2730 0.0428  0.0095  -0.0287 240  ARG A CG  
1862 C CD  . ARG A 224 ? 0.2707 0.3033 0.2692 0.0437  0.0075  -0.0308 240  ARG A CD  
1863 N NE  . ARG A 224 ? 0.2695 0.3046 0.2693 0.0461  0.0087  -0.0314 240  ARG A NE  
1864 C CZ  . ARG A 224 ? 0.2674 0.3060 0.2715 0.0467  0.0084  -0.0326 240  ARG A CZ  
1865 N NH1 . ARG A 224 ? 0.2544 0.2948 0.2615 0.0450  0.0068  -0.0334 240  ARG A NH1 
1866 N NH2 . ARG A 224 ? 0.2568 0.2975 0.2623 0.0491  0.0099  -0.0328 240  ARG A NH2 
1867 N N   . LYS A 225 ? 0.2837 0.3246 0.3003 0.0397  0.0212  -0.0240 241  LYS A N   
1868 C CA  . LYS A 225 ? 0.2902 0.3345 0.3135 0.0396  0.0253  -0.0227 241  LYS A CA  
1869 C C   . LYS A 225 ? 0.2912 0.3354 0.3144 0.0400  0.0281  -0.0187 241  LYS A C   
1870 O O   . LYS A 225 ? 0.2936 0.3406 0.3197 0.0411  0.0313  -0.0168 241  LYS A O   
1871 C CB  . LYS A 225 ? 0.2898 0.3354 0.3207 0.0369  0.0266  -0.0246 241  LYS A CB  
1872 C CG  . LYS A 225 ? 0.3044 0.3521 0.3364 0.0365  0.0241  -0.0282 241  LYS A CG  
1873 C CD  . LYS A 225 ? 0.3361 0.3860 0.3756 0.0335  0.0256  -0.0304 241  LYS A CD  
1874 C CE  . LYS A 225 ? 0.3551 0.4086 0.4022 0.0332  0.0297  -0.0298 241  LYS A CE  
1875 N NZ  . LYS A 225 ? 0.3734 0.4294 0.4279 0.0299  0.0310  -0.0327 241  LYS A NZ  
1876 N N   . HIS A 226 ? 0.2880 0.3295 0.3083 0.0391  0.0270  -0.0171 242  HIS A N   
1877 C CA  . HIS A 226 ? 0.2864 0.3284 0.3066 0.0394  0.0293  -0.0127 242  HIS A CA  
1878 C C   . HIS A 226 ? 0.2886 0.3313 0.3012 0.0416  0.0281  -0.0111 242  HIS A C   
1879 O O   . HIS A 226 ? 0.2915 0.3372 0.3048 0.0428  0.0309  -0.0081 242  HIS A O   
1880 C CB  . HIS A 226 ? 0.2834 0.3228 0.3043 0.0376  0.0289  -0.0114 242  HIS A CB  
1881 C CG  . HIS A 226 ? 0.2855 0.3261 0.3083 0.0379  0.0318  -0.0063 242  HIS A CG  
1882 N ND1 . HIS A 226 ? 0.2896 0.3314 0.3209 0.0371  0.0363  -0.0039 242  HIS A ND1 
1883 C CD2 . HIS A 226 ? 0.2878 0.3290 0.3054 0.0389  0.0308  -0.0029 242  HIS A CD2 
1884 C CE1 . HIS A 226 ? 0.2834 0.3265 0.3148 0.0378  0.0381  0.0011  242  HIS A CE1 
1885 N NE2 . HIS A 226 ? 0.2832 0.3264 0.3062 0.0389  0.0346  0.0018  242  HIS A NE2 
1886 N N   . TYR A 227 ? 0.2885 0.3287 0.2940 0.0419  0.0242  -0.0131 243  TYR A N   
1887 C CA  . TYR A 227 ? 0.2918 0.3321 0.2895 0.0433  0.0227  -0.0123 243  TYR A CA  
1888 C C   . TYR A 227 ? 0.2956 0.3366 0.2899 0.0453  0.0224  -0.0149 243  TYR A C   
1889 O O   . TYR A 227 ? 0.2988 0.3409 0.2876 0.0465  0.0225  -0.0142 243  TYR A O   
1890 C CB  . TYR A 227 ? 0.2903 0.3272 0.2824 0.0423  0.0190  -0.0130 243  TYR A CB  
1891 C CG  . TYR A 227 ? 0.2861 0.3230 0.2801 0.0408  0.0195  -0.0094 243  TYR A CG  
1892 C CD1 . TYR A 227 ? 0.2842 0.3240 0.2762 0.0413  0.0206  -0.0054 243  TYR A CD1 
1893 C CD2 . TYR A 227 ? 0.2796 0.3140 0.2774 0.0390  0.0190  -0.0100 243  TYR A CD2 
1894 C CE1 . TYR A 227 ? 0.2823 0.3226 0.2767 0.0401  0.0213  -0.0016 243  TYR A CE1 
1895 C CE2 . TYR A 227 ? 0.2729 0.3072 0.2730 0.0378  0.0199  -0.0066 243  TYR A CE2 
1896 C CZ  . TYR A 227 ? 0.2758 0.3130 0.2744 0.0385  0.0210  -0.0022 243  TYR A CZ  
1897 O OH  . TYR A 227 ? 0.2671 0.3047 0.2685 0.0376  0.0220  0.0016  243  TYR A OH  
1898 N N   . GLY A 228 ? 0.2957 0.3362 0.2931 0.0455  0.0220  -0.0179 244  GLY A N   
1899 C CA  . GLY A 228 ? 0.3023 0.3432 0.2973 0.0476  0.0217  -0.0203 244  GLY A CA  
1900 C C   . GLY A 228 ? 0.3057 0.3427 0.2950 0.0480  0.0180  -0.0232 244  GLY A C   
1901 O O   . GLY A 228 ? 0.3061 0.3402 0.2918 0.0467  0.0156  -0.0230 244  GLY A O   
1902 N N   . ASP A 229 ? 0.3094 0.3462 0.2983 0.0497  0.0177  -0.0256 245  ASP A N   
1903 C CA  . ASP A 229 ? 0.3157 0.3487 0.3006 0.0504  0.0147  -0.0282 245  ASP A CA  
1904 C C   . ASP A 229 ? 0.3176 0.3476 0.2945 0.0509  0.0136  -0.0290 245  ASP A C   
1905 O O   . ASP A 229 ? 0.3188 0.3448 0.2922 0.0509  0.0111  -0.0308 245  ASP A O   
1906 C CB  . ASP A 229 ? 0.3195 0.3536 0.3076 0.0523  0.0150  -0.0301 245  ASP A CB  
1907 C CG  . ASP A 229 ? 0.3313 0.3676 0.3261 0.0511  0.0143  -0.0303 245  ASP A CG  
1908 O OD1 . ASP A 229 ? 0.3547 0.3937 0.3543 0.0495  0.0160  -0.0289 245  ASP A OD1 
1909 O OD2 . ASP A 229 ? 0.3583 0.3937 0.3537 0.0517  0.0122  -0.0318 245  ASP A OD2 
1910 N N   . ALA A 230 ? 0.3179 0.3499 0.2918 0.0512  0.0156  -0.0275 246  ALA A N   
1911 C CA  . ALA A 230 ? 0.3225 0.3527 0.2887 0.0511  0.0146  -0.0283 246  ALA A CA  
1912 C C   . ALA A 230 ? 0.3215 0.3495 0.2853 0.0488  0.0118  -0.0272 246  ALA A C   
1913 O O   . ALA A 230 ? 0.3259 0.3508 0.2840 0.0482  0.0098  -0.0289 246  ALA A O   
1914 C CB  . ALA A 230 ? 0.3269 0.3610 0.2906 0.0518  0.0173  -0.0268 246  ALA A CB  
1915 N N   . VAL A 231 ? 0.3151 0.3447 0.2837 0.0473  0.0121  -0.0245 247  VAL A N   
1916 C CA  . VAL A 231 ? 0.3141 0.3423 0.2816 0.0452  0.0100  -0.0229 247  VAL A CA  
1917 C C   . VAL A 231 ? 0.3105 0.3349 0.2800 0.0443  0.0076  -0.0244 247  VAL A C   
1918 O O   . VAL A 231 ? 0.3124 0.3338 0.2785 0.0432  0.0051  -0.0248 247  VAL A O   
1919 C CB  . VAL A 231 ? 0.3098 0.3416 0.2815 0.0443  0.0122  -0.0188 247  VAL A CB  
1920 C CG1 . VAL A 231 ? 0.3096 0.3401 0.2806 0.0423  0.0103  -0.0168 247  VAL A CG1 
1921 C CG2 . VAL A 231 ? 0.3160 0.3522 0.2856 0.0453  0.0146  -0.0166 247  VAL A CG2 
1922 N N   . VAL A 232 ? 0.3075 0.3327 0.2825 0.0448  0.0084  -0.0252 248  VAL A N   
1923 C CA  . VAL A 232 ? 0.3045 0.3274 0.2818 0.0439  0.0063  -0.0264 248  VAL A CA  
1924 C C   . VAL A 232 ? 0.3067 0.3294 0.2854 0.0456  0.0059  -0.0288 248  VAL A C   
1925 O O   . VAL A 232 ? 0.3073 0.3332 0.2901 0.0466  0.0079  -0.0290 248  VAL A O   
1926 C CB  . VAL A 232 ? 0.3017 0.3266 0.2852 0.0421  0.0076  -0.0248 248  VAL A CB  
1927 C CG1 . VAL A 232 ? 0.2943 0.3170 0.2790 0.0409  0.0053  -0.0261 248  VAL A CG1 
1928 C CG2 . VAL A 232 ? 0.2944 0.3200 0.2779 0.0409  0.0088  -0.0217 248  VAL A CG2 
1929 N N   . SER A 233 ? 0.3083 0.3274 0.2839 0.0460  0.0033  -0.0304 249  SER A N   
1930 C CA  . SER A 233 ? 0.3088 0.3278 0.2861 0.0478  0.0028  -0.0322 249  SER A CA  
1931 C C   . SER A 233 ? 0.3025 0.3231 0.2844 0.0468  0.0016  -0.0321 249  SER A C   
1932 O O   . SER A 233 ? 0.2976 0.3175 0.2798 0.0447  0.0006  -0.0313 249  SER A O   
1933 C CB  . SER A 233 ? 0.3158 0.3301 0.2882 0.0490  0.0011  -0.0337 249  SER A CB  
1934 O OG  . SER A 233 ? 0.3204 0.3316 0.2913 0.0477  -0.0014 -0.0335 249  SER A OG  
1935 N N   . GLU A 234 ? 0.2993 0.3224 0.2847 0.0483  0.0017  -0.0329 250  GLU A N   
1936 C CA  . GLU A 234 ? 0.2946 0.3204 0.2842 0.0473  0.0004  -0.0331 250  GLU A CA  
1937 C C   . GLU A 234 ? 0.2930 0.3156 0.2798 0.0471  -0.0025 -0.0331 250  GLU A C   
1938 O O   . GLU A 234 ? 0.2880 0.3117 0.2763 0.0452  -0.0038 -0.0330 250  GLU A O   
1939 C CB  . GLU A 234 ? 0.2967 0.3269 0.2908 0.0491  0.0011  -0.0337 250  GLU A CB  
1940 C CG  . GLU A 234 ? 0.2966 0.3312 0.2954 0.0478  -0.0001 -0.0340 250  GLU A CG  
1941 C CD  . GLU A 234 ? 0.3112 0.3508 0.3145 0.0498  0.0001  -0.0343 250  GLU A CD  
1942 O OE1 . GLU A 234 ? 0.3221 0.3604 0.3244 0.0526  0.0007  -0.0342 250  GLU A OE1 
1943 O OE2 . GLU A 234 ? 0.3155 0.3604 0.3237 0.0483  -0.0001 -0.0348 250  GLU A OE2 
1944 N N   . THR A 235 ? 0.2935 0.3120 0.2764 0.0489  -0.0034 -0.0334 251  THR A N   
1945 C CA  . THR A 235 ? 0.2949 0.3105 0.2761 0.0492  -0.0059 -0.0332 251  THR A CA  
1946 C C   . THR A 235 ? 0.2930 0.3032 0.2693 0.0480  -0.0072 -0.0330 251  THR A C   
1947 O O   . THR A 235 ? 0.2935 0.3012 0.2685 0.0478  -0.0091 -0.0325 251  THR A O   
1948 C CB  . THR A 235 ? 0.2995 0.3144 0.2812 0.0524  -0.0059 -0.0336 251  THR A CB  
1949 O OG1 . THR A 235 ? 0.3114 0.3231 0.2901 0.0537  -0.0042 -0.0346 251  THR A OG1 
1950 C CG2 . THR A 235 ? 0.2983 0.3195 0.2857 0.0536  -0.0053 -0.0334 251  THR A CG2 
1951 N N   . GLY A 236 ? 0.2884 0.2972 0.2620 0.0470  -0.0060 -0.0331 252  GLY A N   
1952 C CA  . GLY A 236 ? 0.2859 0.2902 0.2549 0.0457  -0.0072 -0.0329 252  GLY A CA  
1953 C C   . GLY A 236 ? 0.2771 0.2821 0.2467 0.0430  -0.0078 -0.0314 252  GLY A C   
1954 O O   . GLY A 236 ? 0.2695 0.2782 0.2429 0.0421  -0.0068 -0.0309 252  GLY A O   
1955 N N   . PRO A 237 ? 0.2775 0.2788 0.2437 0.0417  -0.0092 -0.0309 253  PRO A N   
1956 C CA  . PRO A 237 ? 0.2740 0.2758 0.2407 0.0393  -0.0094 -0.0293 253  PRO A CA  
1957 C C   . PRO A 237 ? 0.2727 0.2776 0.2406 0.0387  -0.0071 -0.0283 253  PRO A C   
1958 O O   . PRO A 237 ? 0.2776 0.2832 0.2437 0.0398  -0.0061 -0.0288 253  PRO A O   
1959 C CB  . PRO A 237 ? 0.2771 0.2745 0.2395 0.0384  -0.0112 -0.0291 253  PRO A CB  
1960 C CG  . PRO A 237 ? 0.2812 0.2754 0.2418 0.0402  -0.0122 -0.0307 253  PRO A CG  
1961 C CD  . PRO A 237 ? 0.2817 0.2783 0.2438 0.0423  -0.0105 -0.0319 253  PRO A CD  
1962 N N   . ILE A 238 ? 0.2681 0.2748 0.2391 0.0370  -0.0062 -0.0268 254  ILE A N   
1963 C CA  . ILE A 238 ? 0.2669 0.2767 0.2401 0.0365  -0.0038 -0.0251 254  ILE A CA  
1964 C C   . ILE A 238 ? 0.2694 0.2783 0.2388 0.0359  -0.0042 -0.0235 254  ILE A C   
1965 O O   . ILE A 238 ? 0.2670 0.2736 0.2347 0.0346  -0.0059 -0.0227 254  ILE A O   
1966 C CB  . ILE A 238 ? 0.2646 0.2761 0.2429 0.0348  -0.0022 -0.0240 254  ILE A CB  
1967 C CG1 . ILE A 238 ? 0.2609 0.2742 0.2428 0.0350  -0.0019 -0.0260 254  ILE A CG1 
1968 C CG2 . ILE A 238 ? 0.2599 0.2743 0.2412 0.0345  0.0007  -0.0218 254  ILE A CG2 
1969 C CD1 . ILE A 238 ? 0.2636 0.2780 0.2499 0.0329  -0.0007 -0.0259 254  ILE A CD1 
1970 N N   . PRO A 239 ? 0.2721 0.2833 0.2402 0.0367  -0.0028 -0.0229 255  PRO A N   
1971 C CA  . PRO A 239 ? 0.2758 0.2878 0.2406 0.0359  -0.0031 -0.0210 255  PRO A CA  
1972 C C   . PRO A 239 ? 0.2732 0.2866 0.2417 0.0343  -0.0022 -0.0177 255  PRO A C   
1973 O O   . PRO A 239 ? 0.2728 0.2888 0.2463 0.0344  0.0004  -0.0161 255  PRO A O   
1974 C CB  . PRO A 239 ? 0.2775 0.2930 0.2414 0.0372  -0.0011 -0.0207 255  PRO A CB  
1975 C CG  . PRO A 239 ? 0.2760 0.2906 0.2406 0.0390  -0.0006 -0.0236 255  PRO A CG  
1976 C CD  . PRO A 239 ? 0.2733 0.2870 0.2425 0.0385  -0.0009 -0.0240 255  PRO A CD  
1977 N N   . MET A 240 ? 0.2737 0.2853 0.2403 0.0329  -0.0042 -0.0167 256  MET A N   
1978 C CA  . MET A 240 ? 0.2692 0.2810 0.2396 0.0315  -0.0035 -0.0139 256  MET A CA  
1979 C C   . MET A 240 ? 0.2683 0.2843 0.2419 0.0313  -0.0010 -0.0099 256  MET A C   
1980 O O   . MET A 240 ? 0.2650 0.2814 0.2436 0.0306  0.0008  -0.0078 256  MET A O   
1981 C CB  . MET A 240 ? 0.2689 0.2777 0.2366 0.0302  -0.0063 -0.0138 256  MET A CB  
1982 C CG  . MET A 240 ? 0.2744 0.2845 0.2378 0.0295  -0.0079 -0.0126 256  MET A CG  
1983 S SD  . MET A 240 ? 0.2741 0.2805 0.2347 0.0278  -0.0112 -0.0130 256  MET A SD  
1984 C CE  . MET A 240 ? 0.2700 0.2769 0.2363 0.0266  -0.0099 -0.0094 256  MET A CE  
1985 N N   . HIS A 241 ? 0.2701 0.2891 0.2406 0.0320  -0.0009 -0.0089 257  HIS A N   
1986 C CA  . HIS A 241 ? 0.2706 0.2944 0.2438 0.0321  0.0013  -0.0044 257  HIS A CA  
1987 C C   . HIS A 241 ? 0.2686 0.2943 0.2482 0.0330  0.0052  -0.0032 257  HIS A C   
1988 O O   . HIS A 241 ? 0.2708 0.2998 0.2543 0.0331  0.0078  0.0009  257  HIS A O   
1989 C CB  . HIS A 241 ? 0.2726 0.2999 0.2402 0.0325  0.0003  -0.0037 257  HIS A CB  
1990 C CG  . HIS A 241 ? 0.2768 0.3046 0.2417 0.0341  0.0010  -0.0066 257  HIS A CG  
1991 N ND1 . HIS A 241 ? 0.2723 0.2960 0.2357 0.0347  0.0001  -0.0111 257  HIS A ND1 
1992 C CD2 . HIS A 241 ? 0.2773 0.3094 0.2406 0.0352  0.0027  -0.0054 257  HIS A CD2 
1993 C CE1 . HIS A 241 ? 0.2750 0.3003 0.2364 0.0362  0.0013  -0.0126 257  HIS A CE1 
1994 N NE2 . HIS A 241 ? 0.2765 0.3068 0.2377 0.0365  0.0030  -0.0094 257  HIS A NE2 
1995 N N   . LEU A 242 ? 0.2688 0.2924 0.2497 0.0335  0.0058  -0.0067 258  LEU A N   
1996 C CA  . LEU A 242 ? 0.2678 0.2930 0.2548 0.0341  0.0094  -0.0064 258  LEU A CA  
1997 C C   . LEU A 242 ? 0.2661 0.2894 0.2592 0.0327  0.0109  -0.0065 258  LEU A C   
1998 O O   . LEU A 242 ? 0.2662 0.2906 0.2651 0.0327  0.0140  -0.0067 258  LEU A O   
1999 C CB  . LEU A 242 ? 0.2677 0.2926 0.2533 0.0353  0.0091  -0.0101 258  LEU A CB  
2000 C CG  . LEU A 242 ? 0.2726 0.2987 0.2521 0.0367  0.0079  -0.0111 258  LEU A CG  
2001 C CD1 . LEU A 242 ? 0.2677 0.2930 0.2471 0.0380  0.0079  -0.0148 258  LEU A CD1 
2002 C CD2 . LEU A 242 ? 0.2735 0.3043 0.2533 0.0375  0.0103  -0.0075 258  LEU A CD2 
2003 N N   . LEU A 243 ? 0.2677 0.2882 0.2595 0.0315  0.0089  -0.0066 259  LEU A N   
2004 C CA  . LEU A 243 ? 0.2667 0.2850 0.2631 0.0300  0.0101  -0.0076 259  LEU A CA  
2005 C C   . LEU A 243 ? 0.2673 0.2861 0.2690 0.0291  0.0129  -0.0037 259  LEU A C   
2006 O O   . LEU A 243 ? 0.2671 0.2837 0.2721 0.0278  0.0139  -0.0045 259  LEU A O   
2007 C CB  . LEU A 243 ? 0.2666 0.2815 0.2588 0.0294  0.0065  -0.0106 259  LEU A CB  
2008 C CG  . LEU A 243 ? 0.2660 0.2803 0.2552 0.0303  0.0046  -0.0145 259  LEU A CG  
2009 C CD1 . LEU A 243 ? 0.2676 0.2786 0.2520 0.0300  0.0010  -0.0164 259  LEU A CD1 
2010 C CD2 . LEU A 243 ? 0.2603 0.2756 0.2544 0.0299  0.0067  -0.0168 259  LEU A CD2 
2011 N N   . GLY A 244 ? 0.2687 0.2907 0.2713 0.0300  0.0143  0.0005  260  GLY A N   
2012 C CA  . GLY A 244 ? 0.2710 0.2942 0.2799 0.0296  0.0177  0.0051  260  GLY A CA  
2013 C C   . GLY A 244 ? 0.2722 0.2940 0.2804 0.0287  0.0162  0.0073  260  GLY A C   
2014 O O   . GLY A 244 ? 0.2740 0.2962 0.2882 0.0283  0.0193  0.0108  260  GLY A O   
2015 N N   . ASN A 245 ? 0.2733 0.2936 0.2749 0.0283  0.0118  0.0053  261  ASN A N   
2016 C CA  . ASN A 245 ? 0.2737 0.2927 0.2743 0.0273  0.0100  0.0070  261  ASN A CA  
2017 C C   . ASN A 245 ? 0.2745 0.2940 0.2675 0.0273  0.0055  0.0064  261  ASN A C   
2018 O O   . ASN A 245 ? 0.2741 0.2921 0.2622 0.0276  0.0033  0.0025  261  ASN A O   
2019 C CB  . ASN A 245 ? 0.2733 0.2878 0.2752 0.0260  0.0101  0.0038  261  ASN A CB  
2020 C CG  . ASN A 245 ? 0.2775 0.2905 0.2790 0.0249  0.0086  0.0056  261  ASN A CG  
2021 O OD1 . ASN A 245 ? 0.2860 0.2977 0.2820 0.0246  0.0048  0.0043  261  ASN A OD1 
2022 N ND2 . ASN A 245 ? 0.2768 0.2897 0.2845 0.0244  0.0120  0.0085  261  ASN A ND2 
2023 N N   . MET A 246 ? 0.2753 0.2970 0.2677 0.0268  0.0043  0.0102  262  MET A N   
2024 C CA  . MET A 246 ? 0.2797 0.3026 0.2653 0.0264  0.0002  0.0097  262  MET A CA  
2025 C C   . MET A 246 ? 0.2812 0.2991 0.2620 0.0256  -0.0029 0.0049  262  MET A C   
2026 O O   . MET A 246 ? 0.2855 0.3031 0.2604 0.0255  -0.0058 0.0025  262  MET A O   
2027 C CB  . MET A 246 ? 0.2781 0.3045 0.2650 0.0256  -0.0004 0.0147  262  MET A CB  
2028 C CG  . MET A 246 ? 0.2822 0.3108 0.2624 0.0247  -0.0046 0.0142  262  MET A CG  
2029 S SD  . MET A 246 ? 0.2838 0.3168 0.2586 0.0258  -0.0051 0.0132  262  MET A SD  
2030 C CE  . MET A 246 ? 0.2897 0.3308 0.2690 0.0264  -0.0027 0.0208  262  MET A CE  
2031 N N   . TRP A 247 ? 0.2796 0.2936 0.2631 0.0250  -0.0022 0.0035  263  TRP A N   
2032 C CA  . TRP A 247 ? 0.2809 0.2905 0.2607 0.0244  -0.0050 0.0000  263  TRP A CA  
2033 C C   . TRP A 247 ? 0.2827 0.2897 0.2631 0.0250  -0.0041 -0.0039 263  TRP A C   
2034 O O   . TRP A 247 ? 0.2802 0.2839 0.2581 0.0247  -0.0060 -0.0066 263  TRP A O   
2035 C CB  . TRP A 247 ? 0.2798 0.2878 0.2615 0.0230  -0.0055 0.0018  263  TRP A CB  
2036 C CG  . TRP A 247 ? 0.2782 0.2899 0.2607 0.0225  -0.0060 0.0062  263  TRP A CG  
2037 C CD1 . TRP A 247 ? 0.2776 0.2905 0.2557 0.0216  -0.0093 0.0066  263  TRP A CD1 
2038 C CD2 . TRP A 247 ? 0.2768 0.2921 0.2650 0.0227  -0.0030 0.0111  263  TRP A CD2 
2039 N NE1 . TRP A 247 ? 0.2789 0.2967 0.2595 0.0212  -0.0090 0.0114  263  TRP A NE1 
2040 C CE2 . TRP A 247 ? 0.2753 0.2946 0.2622 0.0221  -0.0050 0.0146  263  TRP A CE2 
2041 C CE3 . TRP A 247 ? 0.2756 0.2914 0.2705 0.0233  0.0012  0.0129  263  TRP A CE3 
2042 C CZ2 . TRP A 247 ? 0.2782 0.3023 0.2702 0.0223  -0.0030 0.0203  263  TRP A CZ2 
2043 C CZ3 . TRP A 247 ? 0.2773 0.2970 0.2775 0.0236  0.0037  0.0185  263  TRP A CZ3 
2044 C CH2 . TRP A 247 ? 0.2757 0.2997 0.2745 0.0233  0.0015  0.0224  263  TRP A CH2 
2045 N N   . ALA A 248 ? 0.2835 0.2925 0.2673 0.0258  -0.0012 -0.0039 264  ALA A N   
2046 C CA  . ALA A 248 ? 0.2865 0.2944 0.2719 0.0262  0.0000  -0.0073 264  ALA A CA  
2047 C C   . ALA A 248 ? 0.2875 0.2926 0.2748 0.0250  0.0002  -0.0087 264  ALA A C   
2048 O O   . ALA A 248 ? 0.2913 0.2952 0.2777 0.0250  -0.0004 -0.0119 264  ALA A O   
2049 C CB  . ALA A 248 ? 0.2870 0.2940 0.2673 0.0273  -0.0024 -0.0106 264  ALA A CB  
2050 N N   . GLN A 249 ? 0.2889 0.2936 0.2791 0.0239  0.0014  -0.0060 265  GLN A N   
2051 C CA  . GLN A 249 ? 0.2913 0.2933 0.2828 0.0227  0.0018  -0.0072 265  GLN A CA  
2052 C C   . GLN A 249 ? 0.2912 0.2936 0.2878 0.0220  0.0055  -0.0088 265  GLN A C   
2053 O O   . GLN A 249 ? 0.2935 0.2943 0.2900 0.0211  0.0055  -0.0115 265  GLN A O   
2054 C CB  . GLN A 249 ? 0.2912 0.2925 0.2839 0.0219  0.0019  -0.0037 265  GLN A CB  
2055 C CG  . GLN A 249 ? 0.2968 0.3004 0.2956 0.0218  0.0056  0.0002  265  GLN A CG  
2056 C CD  . GLN A 249 ? 0.3160 0.3195 0.3160 0.0212  0.0052  0.0039  265  GLN A CD  
2057 O OE1 . GLN A 249 ? 0.3273 0.3319 0.3238 0.0213  0.0022  0.0056  265  GLN A OE1 
2058 N NE2 . GLN A 249 ? 0.3189 0.3211 0.3240 0.0204  0.0085  0.0050  265  GLN A NE2 
2059 N N   . GLN A 250 ? 0.2915 0.2961 0.2927 0.0225  0.0087  -0.0071 266  GLN A N   
2060 C CA  . GLN A 250 ? 0.2938 0.2988 0.3008 0.0217  0.0128  -0.0086 266  GLN A CA  
2061 C C   . GLN A 250 ? 0.2904 0.2982 0.2998 0.0228  0.0145  -0.0079 266  GLN A C   
2062 O O   . GLN A 250 ? 0.2904 0.3001 0.2995 0.0240  0.0146  -0.0042 266  GLN A O   
2063 C CB  . GLN A 250 ? 0.2957 0.2996 0.3084 0.0206  0.0165  -0.0062 266  GLN A CB  
2064 C CG  . GLN A 250 ? 0.3153 0.3164 0.3268 0.0191  0.0158  -0.0081 266  GLN A CG  
2065 C CD  . GLN A 250 ? 0.3443 0.3441 0.3598 0.0186  0.0183  -0.0046 266  GLN A CD  
2066 O OE1 . GLN A 250 ? 0.3588 0.3594 0.3736 0.0194  0.0171  -0.0004 266  GLN A OE1 
2067 N NE2 . GLN A 250 ? 0.3410 0.3391 0.3607 0.0171  0.0220  -0.0063 266  GLN A NE2 
2068 N N   . TRP A 251 ? 0.2858 0.2943 0.2972 0.0224  0.0159  -0.0113 267  TRP A N   
2069 C CA  . TRP A 251 ? 0.2850 0.2963 0.2979 0.0236  0.0171  -0.0111 267  TRP A CA  
2070 C C   . TRP A 251 ? 0.2880 0.3004 0.3090 0.0230  0.0223  -0.0102 267  TRP A C   
2071 O O   . TRP A 251 ? 0.2845 0.2992 0.3075 0.0238  0.0237  -0.0106 267  TRP A O   
2072 C CB  . TRP A 251 ? 0.2812 0.2933 0.2905 0.0240  0.0145  -0.0152 267  TRP A CB  
2073 C CG  . TRP A 251 ? 0.2747 0.2854 0.2768 0.0248  0.0097  -0.0162 267  TRP A CG  
2074 C CD1 . TRP A 251 ? 0.2678 0.2770 0.2657 0.0253  0.0074  -0.0139 267  TRP A CD1 
2075 C CD2 . TRP A 251 ? 0.2708 0.2816 0.2695 0.0252  0.0070  -0.0197 267  TRP A CD2 
2076 N NE1 . TRP A 251 ? 0.2715 0.2793 0.2637 0.0259  0.0036  -0.0160 267  TRP A NE1 
2077 C CE2 . TRP A 251 ? 0.2693 0.2781 0.2620 0.0261  0.0033  -0.0192 267  TRP A CE2 
2078 C CE3 . TRP A 251 ? 0.2660 0.2788 0.2665 0.0250  0.0073  -0.0229 267  TRP A CE3 
2079 C CZ2 . TRP A 251 ? 0.2724 0.2807 0.2613 0.0269  0.0003  -0.0216 267  TRP A CZ2 
2080 C CZ3 . TRP A 251 ? 0.2666 0.2796 0.2631 0.0258  0.0040  -0.0251 267  TRP A CZ3 
2081 C CH2 . TRP A 251 ? 0.2670 0.2775 0.2578 0.0269  0.0007  -0.0243 267  TRP A CH2 
2082 N N   . SER A 252 ? 0.2937 0.3043 0.3196 0.0217  0.0255  -0.0091 268  SER A N   
2083 C CA  . SER A 252 ? 0.3018 0.3127 0.3362 0.0208  0.0311  -0.0089 268  SER A CA  
2084 C C   . SER A 252 ? 0.3030 0.3165 0.3414 0.0225  0.0338  -0.0044 268  SER A C   
2085 O O   . SER A 252 ? 0.3031 0.3172 0.3479 0.0221  0.0379  -0.0049 268  SER A O   
2086 C CB  . SER A 252 ? 0.3034 0.3115 0.3425 0.0193  0.0344  -0.0084 268  SER A CB  
2087 O OG  . SER A 252 ? 0.3212 0.3291 0.3605 0.0204  0.0344  -0.0030 268  SER A OG  
2088 N N   . GLU A 253 ? 0.3050 0.3202 0.3395 0.0243  0.0316  -0.0001 269  GLU A N   
2089 C CA  . GLU A 253 ? 0.3110 0.3295 0.3486 0.0261  0.0340  0.0047  269  GLU A CA  
2090 C C   . GLU A 253 ? 0.3089 0.3298 0.3456 0.0270  0.0339  0.0029  269  GLU A C   
2091 O O   . GLU A 253 ? 0.3089 0.3325 0.3496 0.0282  0.0370  0.0064  269  GLU A O   
2092 C CB  . GLU A 253 ? 0.3130 0.3335 0.3461 0.0274  0.0313  0.0095  269  GLU A CB  
2093 C CG  . GLU A 253 ? 0.3364 0.3556 0.3724 0.0269  0.0324  0.0129  269  GLU A CG  
2094 C CD  . GLU A 253 ? 0.3665 0.3862 0.4124 0.0271  0.0385  0.0172  269  GLU A CD  
2095 O OE1 . GLU A 253 ? 0.3855 0.4082 0.4348 0.0284  0.0411  0.0204  269  GLU A OE1 
2096 O OE2 . GLU A 253 ? 0.3952 0.4120 0.4457 0.0260  0.0409  0.0175  269  GLU A OE2 
2097 N N   . ILE A 254 ? 0.3082 0.3285 0.3400 0.0266  0.0306  -0.0020 270  ILE A N   
2098 C CA  . ILE A 254 ? 0.3081 0.3307 0.3396 0.0274  0.0307  -0.0040 270  ILE A CA  
2099 C C   . ILE A 254 ? 0.3089 0.3310 0.3458 0.0257  0.0330  -0.0084 270  ILE A C   
2100 O O   . ILE A 254 ? 0.3078 0.3318 0.3445 0.0261  0.0326  -0.0109 270  ILE A O   
2101 C CB  . ILE A 254 ? 0.3078 0.3309 0.3304 0.0287  0.0255  -0.0061 270  ILE A CB  
2102 C CG1 . ILE A 254 ? 0.3070 0.3275 0.3259 0.0275  0.0221  -0.0106 270  ILE A CG1 
2103 C CG2 . ILE A 254 ? 0.3073 0.3316 0.3247 0.0301  0.0234  -0.0022 270  ILE A CG2 
2104 C CD1 . ILE A 254 ? 0.3087 0.3298 0.3215 0.0286  0.0183  -0.0135 270  ILE A CD1 
2105 N N   . ALA A 255 ? 0.3108 0.3305 0.3527 0.0237  0.0357  -0.0095 271  ALA A N   
2106 C CA  . ALA A 255 ? 0.3146 0.3340 0.3617 0.0214  0.0381  -0.0141 271  ALA A CA  
2107 C C   . ALA A 255 ? 0.3181 0.3400 0.3715 0.0217  0.0419  -0.0138 271  ALA A C   
2108 O O   . ALA A 255 ? 0.3172 0.3404 0.3725 0.0204  0.0420  -0.0181 271  ALA A O   
2109 C CB  . ALA A 255 ? 0.3153 0.3317 0.3675 0.0192  0.0414  -0.0148 271  ALA A CB  
2110 N N   . ASP A 256 ? 0.3233 0.3463 0.3802 0.0234  0.0449  -0.0084 272  ASP A N   
2111 C CA  . ASP A 256 ? 0.3314 0.3567 0.3948 0.0238  0.0490  -0.0072 272  ASP A CA  
2112 C C   . ASP A 256 ? 0.3311 0.3596 0.3905 0.0251  0.0463  -0.0092 272  ASP A C   
2113 O O   . ASP A 256 ? 0.3335 0.3640 0.3985 0.0248  0.0493  -0.0099 272  ASP A O   
2114 C CB  . ASP A 256 ? 0.3350 0.3613 0.4023 0.0257  0.0526  -0.0002 272  ASP A CB  
2115 C CG  . ASP A 256 ? 0.3475 0.3762 0.4068 0.0284  0.0488  0.0036  272  ASP A CG  
2116 O OD1 . ASP A 256 ? 0.3608 0.3882 0.4140 0.0284  0.0451  0.0037  272  ASP A OD1 
2117 O OD2 . ASP A 256 ? 0.3650 0.3971 0.4243 0.0302  0.0497  0.0064  272  ASP A OD2 
2118 N N   . ILE A 257 ? 0.3297 0.3586 0.3801 0.0264  0.0410  -0.0099 273  ILE A N   
2119 C CA  . ILE A 257 ? 0.3321 0.3637 0.3786 0.0278  0.0386  -0.0119 273  ILE A CA  
2120 C C   . ILE A 257 ? 0.3286 0.3599 0.3713 0.0267  0.0346  -0.0173 273  ILE A C   
2121 O O   . ILE A 257 ? 0.3304 0.3640 0.3712 0.0277  0.0329  -0.0192 273  ILE A O   
2122 C CB  . ILE A 257 ? 0.3348 0.3679 0.3745 0.0306  0.0363  -0.0083 273  ILE A CB  
2123 C CG1 . ILE A 257 ? 0.3364 0.3672 0.3688 0.0308  0.0323  -0.0077 273  ILE A CG1 
2124 C CG2 . ILE A 257 ? 0.3394 0.3748 0.3836 0.0319  0.0406  -0.0027 273  ILE A CG2 
2125 C CD1 . ILE A 257 ? 0.3488 0.3809 0.3734 0.0330  0.0293  -0.0059 273  ILE A CD1 
2126 N N   . VAL A 258 ? 0.3255 0.3543 0.3676 0.0247  0.0333  -0.0196 274  VAL A N   
2127 C CA  . VAL A 258 ? 0.3244 0.3534 0.3629 0.0237  0.0296  -0.0243 274  VAL A CA  
2128 C C   . VAL A 258 ? 0.3260 0.3549 0.3697 0.0204  0.0314  -0.0283 274  VAL A C   
2129 O O   . VAL A 258 ? 0.3274 0.3573 0.3685 0.0193  0.0284  -0.0320 274  VAL A O   
2130 C CB  . VAL A 258 ? 0.3237 0.3502 0.3538 0.0245  0.0249  -0.0240 274  VAL A CB  
2131 C CG1 . VAL A 258 ? 0.3189 0.3458 0.3434 0.0274  0.0228  -0.0212 274  VAL A CG1 
2132 C CG2 . VAL A 258 ? 0.3206 0.3439 0.3513 0.0232  0.0260  -0.0226 274  VAL A CG2 
2133 N N   . SER A 259 ? 0.3276 0.3558 0.3790 0.0189  0.0365  -0.0275 275  SER A N   
2134 C CA  . SER A 259 ? 0.3326 0.3604 0.3894 0.0154  0.0389  -0.0317 275  SER A CA  
2135 C C   . SER A 259 ? 0.3322 0.3641 0.3911 0.0140  0.0381  -0.0363 275  SER A C   
2136 O O   . SER A 259 ? 0.3329 0.3676 0.3943 0.0152  0.0390  -0.0355 275  SER A O   
2137 C CB  . SER A 259 ? 0.3333 0.3591 0.3988 0.0143  0.0452  -0.0297 275  SER A CB  
2138 O OG  . SER A 259 ? 0.3507 0.3788 0.4219 0.0151  0.0484  -0.0281 275  SER A OG  
2139 N N   . PRO A 260 ? 0.3324 0.3653 0.3901 0.0114  0.0362  -0.0410 276  PRO A N   
2140 C CA  . PRO A 260 ? 0.3332 0.3709 0.3929 0.0095  0.0350  -0.0456 276  PRO A CA  
2141 C C   . PRO A 260 ? 0.3354 0.3753 0.4041 0.0082  0.0396  -0.0465 276  PRO A C   
2142 O O   . PRO A 260 ? 0.3336 0.3778 0.4035 0.0088  0.0384  -0.0473 276  PRO A O   
2143 C CB  . PRO A 260 ? 0.3359 0.3734 0.3946 0.0061  0.0343  -0.0500 276  PRO A CB  
2144 C CG  . PRO A 260 ? 0.3343 0.3677 0.3865 0.0077  0.0322  -0.0474 276  PRO A CG  
2145 C CD  . PRO A 260 ? 0.3321 0.3620 0.3859 0.0101  0.0349  -0.0420 276  PRO A CD  
2146 N N   . PHE A 261 ? 0.3371 0.3739 0.4126 0.0064  0.0450  -0.0462 277  PHE A N   
2147 C CA  . PHE A 261 ? 0.3407 0.3790 0.4259 0.0047  0.0501  -0.0470 277  PHE A CA  
2148 C C   . PHE A 261 ? 0.3439 0.3788 0.4339 0.0067  0.0549  -0.0414 277  PHE A C   
2149 O O   . PHE A 261 ? 0.3443 0.3754 0.4393 0.0051  0.0594  -0.0410 277  PHE A O   
2150 C CB  . PHE A 261 ? 0.3415 0.3802 0.4324 0.0000  0.0527  -0.0531 277  PHE A CB  
2151 C CG  . PHE A 261 ? 0.3435 0.3869 0.4299 -0.0021 0.0479  -0.0584 277  PHE A CG  
2152 C CD1 . PHE A 261 ? 0.3462 0.3957 0.4347 -0.0028 0.0462  -0.0608 277  PHE A CD1 
2153 C CD2 . PHE A 261 ? 0.3415 0.3836 0.4217 -0.0033 0.0451  -0.0605 277  PHE A CD2 
2154 C CE1 . PHE A 261 ? 0.3461 0.4009 0.4307 -0.0046 0.0417  -0.0651 277  PHE A CE1 
2155 C CE2 . PHE A 261 ? 0.3449 0.3920 0.4209 -0.0051 0.0407  -0.0649 277  PHE A CE2 
2156 C CZ  . PHE A 261 ? 0.3481 0.4018 0.4264 -0.0057 0.0389  -0.0671 277  PHE A CZ  
2157 N N   . PRO A 262 ? 0.3468 0.3832 0.4351 0.0102  0.0543  -0.0370 278  PRO A N   
2158 C CA  . PRO A 262 ? 0.3518 0.3862 0.4433 0.0126  0.0581  -0.0308 278  PRO A CA  
2159 C C   . PRO A 262 ? 0.3577 0.3913 0.4607 0.0108  0.0652  -0.0302 278  PRO A C   
2160 O O   . PRO A 262 ? 0.3609 0.3920 0.4677 0.0122  0.0692  -0.0252 278  PRO A O   
2161 C CB  . PRO A 262 ? 0.3503 0.3878 0.4372 0.0161  0.0555  -0.0278 278  PRO A CB  
2162 C CG  . PRO A 262 ? 0.3480 0.3877 0.4274 0.0162  0.0494  -0.0315 278  PRO A CG  
2163 C CD  . PRO A 262 ? 0.3466 0.3871 0.4296 0.0122  0.0497  -0.0374 278  PRO A CD  
2164 N N   . GLU A 263 ? 0.3640 0.3999 0.4729 0.0078  0.0667  -0.0353 279  GLU A N   
2165 C CA  . GLU A 263 ? 0.3716 0.4066 0.4923 0.0056  0.0737  -0.0356 279  GLU A CA  
2166 C C   . GLU A 263 ? 0.3768 0.4074 0.5023 0.0020  0.0774  -0.0388 279  GLU A C   
2167 O O   . GLU A 263 ? 0.3806 0.4091 0.5163 0.0003  0.0839  -0.0386 279  GLU A O   
2168 C CB  . GLU A 263 ? 0.3724 0.4122 0.4980 0.0036  0.0739  -0.0397 279  GLU A CB  
2169 C CG  . GLU A 263 ? 0.3740 0.4176 0.4976 0.0071  0.0724  -0.0359 279  GLU A CG  
2170 C CD  . GLU A 263 ? 0.3798 0.4286 0.5084 0.0052  0.0724  -0.0400 279  GLU A CD  
2171 O OE1 . GLU A 263 ? 0.3839 0.4330 0.5206 0.0011  0.0757  -0.0445 279  GLU A OE1 
2172 O OE2 . GLU A 263 ? 0.3817 0.4345 0.5063 0.0078  0.0692  -0.0387 279  GLU A OE2 
2173 N N   . LYS A 264 ? 0.3782 0.4075 0.4966 0.0010  0.0735  -0.0417 280  LYS A N   
2174 C CA  . LYS A 264 ? 0.3828 0.4080 0.5044 -0.0021 0.0766  -0.0451 280  LYS A CA  
2175 C C   . LYS A 264 ? 0.3824 0.4030 0.5011 0.0002  0.0772  -0.0398 280  LYS A C   
2176 O O   . LYS A 264 ? 0.3794 0.4008 0.4912 0.0040  0.0734  -0.0348 280  LYS A O   
2177 C CB  . LYS A 264 ? 0.3837 0.4111 0.5000 -0.0054 0.0723  -0.0524 280  LYS A CB  
2178 C CG  . LYS A 264 ? 0.3918 0.4240 0.5129 -0.0089 0.0726  -0.0584 280  LYS A CG  
2179 C CD  . LYS A 264 ? 0.4047 0.4345 0.5379 -0.0126 0.0802  -0.0612 280  LYS A CD  
2180 C CE  . LYS A 264 ? 0.4135 0.4486 0.5520 -0.0161 0.0805  -0.0669 280  LYS A CE  
2181 N NZ  . LYS A 264 ? 0.4193 0.4582 0.5532 -0.0200 0.0765  -0.0744 280  LYS A NZ  
2182 N N   . PRO A 265 ? 0.3852 0.4012 0.5096 -0.0018 0.0822  -0.0408 281  PRO A N   
2183 C CA  . PRO A 265 ? 0.3858 0.3977 0.5094 0.0004  0.0838  -0.0352 281  PRO A CA  
2184 C C   . PRO A 265 ? 0.3839 0.3960 0.4959 0.0023  0.0772  -0.0340 281  PRO A C   
2185 O O   . PRO A 265 ? 0.3823 0.3955 0.4881 0.0004  0.0729  -0.0393 281  PRO A O   
2186 C CB  . PRO A 265 ? 0.3893 0.3965 0.5207 -0.0030 0.0900  -0.0387 281  PRO A CB  
2187 C CG  . PRO A 265 ? 0.3933 0.4026 0.5261 -0.0075 0.0897  -0.0474 281  PRO A CG  
2188 C CD  . PRO A 265 ? 0.3888 0.4033 0.5214 -0.0066 0.0872  -0.0472 281  PRO A CD  
2189 N N   . LEU A 266 ? 0.3825 0.3938 0.4921 0.0060  0.0765  -0.0269 282  LEU A N   
2190 C CA  . LEU A 266 ? 0.3795 0.3903 0.4797 0.0077  0.0712  -0.0250 282  LEU A CA  
2191 C C   . LEU A 266 ? 0.3784 0.3855 0.4824 0.0089  0.0750  -0.0198 282  LEU A C   
2192 O O   . LEU A 266 ? 0.3780 0.3852 0.4874 0.0111  0.0786  -0.0136 282  LEU A O   
2193 C CB  . LEU A 266 ? 0.3784 0.3928 0.4709 0.0111  0.0659  -0.0215 282  LEU A CB  
2194 C CG  . LEU A 266 ? 0.3796 0.3938 0.4620 0.0130  0.0600  -0.0195 282  LEU A CG  
2195 C CD1 . LEU A 266 ? 0.3779 0.3920 0.4536 0.0110  0.0554  -0.0256 282  LEU A CD1 
2196 C CD2 . LEU A 266 ? 0.3824 0.3997 0.4595 0.0163  0.0566  -0.0154 282  LEU A CD2 
2197 N N   . VAL A 267 ? 0.3764 0.3806 0.4778 0.0074  0.0744  -0.0221 283  VAL A N   
2198 C CA  . VAL A 267 ? 0.3759 0.3764 0.4819 0.0081  0.0786  -0.0178 283  VAL A CA  
2199 C C   . VAL A 267 ? 0.3730 0.3750 0.4748 0.0119  0.0757  -0.0100 283  VAL A C   
2200 O O   . VAL A 267 ? 0.3697 0.3729 0.4620 0.0129  0.0695  -0.0100 283  VAL A O   
2201 C CB  . VAL A 267 ? 0.3774 0.3745 0.4817 0.0054  0.0788  -0.0226 283  VAL A CB  
2202 C CG1 . VAL A 267 ? 0.3765 0.3699 0.4859 0.0064  0.0832  -0.0177 283  VAL A CG1 
2203 C CG2 . VAL A 267 ? 0.3798 0.3759 0.4889 0.0012  0.0823  -0.0305 283  VAL A CG2 
2204 N N   . ASP A 268 ? 0.3723 0.3744 0.4814 0.0139  0.0803  -0.0034 284  ASP A N   
2205 C CA  . ASP A 268 ? 0.3716 0.3757 0.4783 0.0174  0.0785  0.0045  284  ASP A CA  
2206 C C   . ASP A 268 ? 0.3713 0.3737 0.4891 0.0184  0.0858  0.0106  284  ASP A C   
2207 O O   . ASP A 268 ? 0.3705 0.3746 0.4949 0.0198  0.0897  0.0146  284  ASP A O   
2208 C CB  . ASP A 268 ? 0.3727 0.3817 0.4745 0.0197  0.0748  0.0072  284  ASP A CB  
2209 C CG  . ASP A 268 ? 0.3791 0.3910 0.4756 0.0227  0.0714  0.0141  284  ASP A CG  
2210 O OD1 . ASP A 268 ? 0.3862 0.3973 0.4862 0.0236  0.0736  0.0191  284  ASP A OD1 
2211 O OD2 . ASP A 268 ? 0.3977 0.4132 0.4866 0.0242  0.0665  0.0145  284  ASP A OD2 
2212 N N   . VAL A 269 ? 0.3690 0.3682 0.4891 0.0179  0.0878  0.0115  285  VAL A N   
2213 C CA  . VAL A 269 ? 0.3688 0.3654 0.5006 0.0185  0.0956  0.0164  285  VAL A CA  
2214 C C   . VAL A 269 ? 0.3665 0.3664 0.5000 0.0222  0.0958  0.0266  285  VAL A C   
2215 O O   . VAL A 269 ? 0.3662 0.3645 0.5098 0.0233  0.1021  0.0318  285  VAL A O   
2216 C CB  . VAL A 269 ? 0.3718 0.3629 0.5070 0.0159  0.0990  0.0119  285  VAL A CB  
2217 C CG1 . VAL A 269 ? 0.3729 0.3615 0.5075 0.0120  0.0996  0.0019  285  VAL A CG1 
2218 C CG2 . VAL A 269 ? 0.3683 0.3594 0.4955 0.0165  0.0940  0.0129  285  VAL A CG2 
2219 N N   . SER A 270 ? 0.3636 0.3682 0.4876 0.0241  0.0890  0.0293  286  SER A N   
2220 C CA  . SER A 270 ? 0.3632 0.3723 0.4872 0.0273  0.0880  0.0386  286  SER A CA  
2221 C C   . SER A 270 ? 0.3655 0.3769 0.5000 0.0295  0.0943  0.0459  286  SER A C   
2222 O O   . SER A 270 ? 0.3662 0.3788 0.5070 0.0315  0.0976  0.0535  286  SER A O   
2223 C CB  . SER A 270 ? 0.3614 0.3754 0.4734 0.0285  0.0799  0.0390  286  SER A CB  
2224 O OG  . SER A 270 ? 0.3623 0.3744 0.4653 0.0269  0.0744  0.0335  286  SER A OG  
2225 N N   . ALA A 271 ? 0.3666 0.3787 0.5031 0.0292  0.0960  0.0440  287  ALA A N   
2226 C CA  . ALA A 271 ? 0.3686 0.3828 0.5152 0.0312  0.1022  0.0507  287  ALA A CA  
2227 C C   . ALA A 271 ? 0.3718 0.3810 0.5322 0.0306  0.1111  0.0522  287  ALA A C   
2228 O O   . ALA A 271 ? 0.3722 0.3832 0.5414 0.0331  0.1160  0.0609  287  ALA A O   
2229 C CB  . ALA A 271 ? 0.3681 0.3838 0.5138 0.0307  0.1021  0.0473  287  ALA A CB  
2230 N N   . GLU A 272 ? 0.3750 0.3779 0.5373 0.0272  0.1131  0.0440  288  GLU A N   
2231 C CA  . GLU A 272 ? 0.3823 0.3795 0.5574 0.0261  0.1217  0.0439  288  GLU A CA  
2232 C C   . GLU A 272 ? 0.3854 0.3816 0.5631 0.0276  0.1231  0.0494  288  GLU A C   
2233 O O   . GLU A 272 ? 0.3865 0.3800 0.5763 0.0285  0.1308  0.0541  288  GLU A O   
2234 C CB  . GLU A 272 ? 0.3837 0.3751 0.5592 0.0216  0.1232  0.0328  288  GLU A CB  
2235 C CG  . GLU A 272 ? 0.3931 0.3841 0.5734 0.0199  0.1263  0.0286  288  GLU A CG  
2236 C CD  . GLU A 272 ? 0.4059 0.3951 0.6013 0.0210  0.1358  0.0342  288  GLU A CD  
2237 O OE1 . GLU A 272 ? 0.4116 0.3975 0.6157 0.0218  0.1417  0.0384  288  GLU A OE1 
2238 O OE2 . GLU A 272 ? 0.4162 0.4073 0.6152 0.0211  0.1376  0.0346  288  GLU A OE2 
2239 N N   . MET A 273 ? 0.3843 0.3825 0.5512 0.0278  0.1159  0.0487  289  MET A N   
2240 C CA  . MET A 273 ? 0.3877 0.3862 0.5560 0.0294  0.1161  0.0544  289  MET A CA  
2241 C C   . MET A 273 ? 0.3941 0.3983 0.5686 0.0334  0.1183  0.0663  289  MET A C   
2242 O O   . MET A 273 ? 0.3981 0.4011 0.5828 0.0349  0.1242  0.0724  289  MET A O   
2243 C CB  . MET A 273 ? 0.3814 0.3817 0.5364 0.0288  0.1073  0.0515  289  MET A CB  
2244 C CG  . MET A 273 ? 0.3718 0.3669 0.5215 0.0252  0.1055  0.0411  289  MET A CG  
2245 S SD  . MET A 273 ? 0.3577 0.3552 0.4917 0.0248  0.0951  0.0380  289  MET A SD  
2246 C CE  . MET A 273 ? 0.3524 0.3501 0.4898 0.0265  0.0962  0.0452  289  MET A CE  
2247 N N   . GLU A 274 ? 0.4003 0.4110 0.5686 0.0351  0.1137  0.0696  290  GLU A N   
2248 C CA  . GLU A 274 ? 0.4097 0.4272 0.5825 0.0388  0.1152  0.0808  290  GLU A CA  
2249 C C   . GLU A 274 ? 0.4138 0.4294 0.6016 0.0401  0.1248  0.0856  290  GLU A C   
2250 O O   . GLU A 274 ? 0.4163 0.4344 0.6130 0.0428  0.1292  0.0952  290  GLU A O   
2251 C CB  . GLU A 274 ? 0.4099 0.4343 0.5723 0.0400  0.1086  0.0819  290  GLU A CB  
2252 C CG  . GLU A 274 ? 0.4277 0.4557 0.5766 0.0397  0.0994  0.0803  290  GLU A CG  
2253 C CD  . GLU A 274 ? 0.4552 0.4903 0.5948 0.0411  0.0938  0.0822  290  GLU A CD  
2254 O OE1 . GLU A 274 ? 0.4747 0.5162 0.6180 0.0438  0.0956  0.0909  290  GLU A OE1 
2255 O OE2 . GLU A 274 ? 0.4662 0.5008 0.5950 0.0395  0.0877  0.0751  290  GLU A OE2 
2256 N N   . LYS A 275 ? 0.4162 0.4276 0.6070 0.0379  0.1280  0.0792  291  LYS A N   
2257 C CA  . LYS A 275 ? 0.4213 0.4300 0.6266 0.0385  0.1375  0.0824  291  LYS A CA  
2258 C C   . LYS A 275 ? 0.4216 0.4242 0.6392 0.0383  0.1453  0.0840  291  LYS A C   
2259 O O   . LYS A 275 ? 0.4256 0.4284 0.6559 0.0407  0.1528  0.0921  291  LYS A O   
2260 C CB  . LYS A 275 ? 0.4235 0.4284 0.6289 0.0355  0.1388  0.0734  291  LYS A CB  
2261 C CG  . LYS A 275 ? 0.4376 0.4408 0.6572 0.0361  0.1479  0.0769  291  LYS A CG  
2262 C CD  . LYS A 275 ? 0.4526 0.4530 0.6717 0.0329  0.1484  0.0679  291  LYS A CD  
2263 C CE  . LYS A 275 ? 0.4638 0.4613 0.6984 0.0330  0.1582  0.0706  291  LYS A CE  
2264 N NZ  . LYS A 275 ? 0.4726 0.4683 0.7072 0.0298  0.1586  0.0623  291  LYS A NZ  
2265 N N   . GLN A 276 ? 0.4167 0.4141 0.6305 0.0356  0.1438  0.0767  292  GLN A N   
2266 C CA  . GLN A 276 ? 0.4157 0.4069 0.6401 0.0351  0.1510  0.0772  292  GLN A CA  
2267 C C   . GLN A 276 ? 0.4086 0.4035 0.6343 0.0383  0.1502  0.0864  292  GLN A C   
2268 O O   . GLN A 276 ? 0.4108 0.4011 0.6446 0.0382  0.1558  0.0875  292  GLN A O   
2269 C CB  . GLN A 276 ? 0.4182 0.4023 0.6385 0.0306  0.1505  0.0649  292  GLN A CB  
2270 C CG  . GLN A 276 ? 0.4299 0.4093 0.6537 0.0272  0.1542  0.0562  292  GLN A CG  
2271 C CD  . GLN A 276 ? 0.4387 0.4124 0.6574 0.0226  0.1531  0.0441  292  GLN A CD  
2272 O OE1 . GLN A 276 ? 0.4443 0.4140 0.6645 0.0217  0.1552  0.0424  292  GLN A OE1 
2273 N NE2 . GLN A 276 ? 0.4477 0.4214 0.6605 0.0196  0.1498  0.0357  292  GLN A NE2 
2274 N N   . GLY A 277 ? 0.3981 0.4015 0.6157 0.0408  0.1434  0.0929  293  GLY A N   
2275 C CA  . GLY A 277 ? 0.3879 0.3966 0.6069 0.0440  0.1421  0.1027  293  GLY A CA  
2276 C C   . GLY A 277 ? 0.3801 0.3869 0.5922 0.0425  0.1376  0.0988  293  GLY A C   
2277 O O   . GLY A 277 ? 0.3782 0.3861 0.5962 0.0443  0.1399  0.1054  293  GLY A O   
2278 N N   . TYR A 278 ? 0.3711 0.3754 0.5711 0.0393  0.1313  0.0886  294  TYR A N   
2279 C CA  . TYR A 278 ? 0.3641 0.3670 0.5561 0.0378  0.1263  0.0844  294  TYR A CA  
2280 C C   . TYR A 278 ? 0.3562 0.3672 0.5429 0.0404  0.1202  0.0926  294  TYR A C   
2281 O O   . TYR A 278 ? 0.3516 0.3699 0.5339 0.0422  0.1161  0.0975  294  TYR A O   
2282 C CB  . TYR A 278 ? 0.3633 0.3637 0.5426 0.0344  0.1199  0.0731  294  TYR A CB  
2283 C CG  . TYR A 278 ? 0.3715 0.3634 0.5533 0.0309  0.1241  0.0631  294  TYR A CG  
2284 C CD1 . TYR A 278 ? 0.3836 0.3709 0.5766 0.0300  0.1325  0.0616  294  TYR A CD1 
2285 C CD2 . TYR A 278 ? 0.3826 0.3714 0.5554 0.0282  0.1197  0.0551  294  TYR A CD2 
2286 C CE1 . TYR A 278 ? 0.3928 0.3728 0.5877 0.0263  0.1363  0.0518  294  TYR A CE1 
2287 C CE2 . TYR A 278 ? 0.3884 0.3703 0.5627 0.0247  0.1233  0.0458  294  TYR A CE2 
2288 C CZ  . TYR A 278 ? 0.3960 0.3737 0.5813 0.0237  0.1315  0.0439  294  TYR A CZ  
2289 O OH  . TYR A 278 ? 0.4039 0.3753 0.5905 0.0198  0.1350  0.0342  294  TYR A OH  
2290 N N   . THR A 279 ? 0.3500 0.3597 0.5374 0.0403  0.1199  0.0938  295  THR A N   
2291 C CA  . THR A 279 ? 0.3431 0.3602 0.5254 0.0421  0.1139  0.1004  295  THR A CA  
2292 C C   . THR A 279 ? 0.3392 0.3534 0.5115 0.0395  0.1082  0.0932  295  THR A C   
2293 O O   . THR A 279 ? 0.3378 0.3443 0.5097 0.0369  0.1104  0.0847  295  THR A O   
2294 C CB  . THR A 279 ? 0.3444 0.3642 0.5394 0.0451  0.1197  0.1113  295  THR A CB  
2295 O OG1 . THR A 279 ? 0.3428 0.3544 0.5457 0.0439  0.1262  0.1079  295  THR A OG1 
2296 C CG2 . THR A 279 ? 0.3457 0.3693 0.5510 0.0480  0.1254  0.1198  295  THR A CG2 
2297 N N   . PRO A 280 ? 0.3351 0.3555 0.4992 0.0401  0.1007  0.0964  296  PRO A N   
2298 C CA  . PRO A 280 ? 0.3332 0.3509 0.4894 0.0380  0.0960  0.0908  296  PRO A CA  
2299 C C   . PRO A 280 ? 0.3341 0.3457 0.4989 0.0376  0.1022  0.0904  296  PRO A C   
2300 O O   . PRO A 280 ? 0.3353 0.3409 0.4954 0.0350  0.1014  0.0822  296  PRO A O   
2301 C CB  . PRO A 280 ? 0.3320 0.3585 0.4825 0.0393  0.0890  0.0972  296  PRO A CB  
2302 C CG  . PRO A 280 ? 0.3313 0.3641 0.4795 0.0408  0.0870  0.1009  296  PRO A CG  
2303 C CD  . PRO A 280 ? 0.3332 0.3636 0.4935 0.0423  0.0957  0.1039  296  PRO A CD  
2304 N N   . LEU A 281 ? 0.3343 0.3476 0.5116 0.0401  0.1086  0.0992  297  LEU A N   
2305 C CA  . LEU A 281 ? 0.3352 0.3427 0.5220 0.0400  0.1155  0.0994  297  LEU A CA  
2306 C C   . LEU A 281 ? 0.3354 0.3332 0.5251 0.0375  0.1215  0.0900  297  LEU A C   
2307 O O   . LEU A 281 ? 0.3352 0.3272 0.5239 0.0355  0.1231  0.0841  297  LEU A O   
2308 C CB  . LEU A 281 ? 0.3383 0.3497 0.5392 0.0436  0.1219  0.1113  297  LEU A CB  
2309 C CG  . LEU A 281 ? 0.3440 0.3501 0.5563 0.0442  0.1297  0.1131  297  LEU A CG  
2310 C CD1 . LEU A 281 ? 0.3468 0.3537 0.5534 0.0433  0.1251  0.1123  297  LEU A CD1 
2311 C CD2 . LEU A 281 ? 0.3524 0.3624 0.5797 0.0481  0.1367  0.1252  297  LEU A CD2 
2312 N N   . LYS A 282 ? 0.3358 0.3323 0.5289 0.0375  0.1249  0.0887  298  LYS A N   
2313 C CA  . LYS A 282 ? 0.3383 0.3265 0.5342 0.0347  0.1303  0.0795  298  LYS A CA  
2314 C C   . LYS A 282 ? 0.3328 0.3179 0.5156 0.0311  0.1242  0.0681  298  LYS A C   
2315 O O   . LYS A 282 ? 0.3341 0.3123 0.5176 0.0284  0.1278  0.0604  298  LYS A O   
2316 C CB  . LYS A 282 ? 0.3420 0.3306 0.5435 0.0354  0.1341  0.0807  298  LYS A CB  
2317 C CG  . LYS A 282 ? 0.3594 0.3400 0.5649 0.0323  0.1401  0.0713  298  LYS A CG  
2318 C CD  . LYS A 282 ? 0.3941 0.3675 0.6115 0.0318  0.1496  0.0707  298  LYS A CD  
2319 C CE  . LYS A 282 ? 0.4149 0.3809 0.6376 0.0286  0.1563  0.0619  298  LYS A CE  
2320 N NZ  . LYS A 282 ? 0.4274 0.3863 0.6627 0.0282  0.1664  0.0616  298  LYS A NZ  
2321 N N   . MET A 283 ? 0.3246 0.3148 0.4954 0.0310  0.1153  0.0674  299  MET A N   
2322 C CA  . MET A 283 ? 0.3204 0.3087 0.4785 0.0281  0.1089  0.0578  299  MET A CA  
2323 C C   . MET A 283 ? 0.3181 0.3033 0.4730 0.0267  0.1077  0.0549  299  MET A C   
2324 O O   . MET A 283 ? 0.3184 0.2986 0.4691 0.0239  0.1080  0.0461  299  MET A O   
2325 C CB  . MET A 283 ? 0.3151 0.3098 0.4622 0.0288  0.0999  0.0588  299  MET A CB  
2326 C CG  . MET A 283 ? 0.3161 0.3132 0.4644 0.0295  0.1005  0.0596  299  MET A CG  
2327 S SD  . MET A 283 ? 0.3148 0.3207 0.4528 0.0313  0.0916  0.0639  299  MET A SD  
2328 C CE  . MET A 283 ? 0.3084 0.3120 0.4317 0.0284  0.0837  0.0535  299  MET A CE  
2329 N N   . PHE A 284 ? 0.3164 0.3052 0.4735 0.0288  0.1067  0.0625  300  PHE A N   
2330 C CA  . PHE A 284 ? 0.3181 0.3043 0.4733 0.0279  0.1062  0.0609  300  PHE A CA  
2331 C C   . PHE A 284 ? 0.3224 0.3015 0.4874 0.0269  0.1154  0.0583  300  PHE A C   
2332 O O   . PHE A 284 ? 0.3250 0.2997 0.4862 0.0247  0.1156  0.0519  300  PHE A O   
2333 C CB  . PHE A 284 ? 0.3158 0.3083 0.4716 0.0303  0.1028  0.0700  300  PHE A CB  
2334 C CG  . PHE A 284 ? 0.3147 0.3122 0.4578 0.0299  0.0928  0.0694  300  PHE A CG  
2335 C CD1 . PHE A 284 ? 0.3105 0.3143 0.4502 0.0312  0.0885  0.0730  300  PHE A CD1 
2336 C CD2 . PHE A 284 ? 0.3148 0.3108 0.4496 0.0281  0.0880  0.0649  300  PHE A CD2 
2337 C CE1 . PHE A 284 ? 0.3094 0.3174 0.4376 0.0307  0.0797  0.0719  300  PHE A CE1 
2338 C CE2 . PHE A 284 ? 0.3127 0.3128 0.4364 0.0277  0.0792  0.0641  300  PHE A CE2 
2339 C CZ  . PHE A 284 ? 0.3111 0.3171 0.4315 0.0289  0.0751  0.0674  300  PHE A CZ  
2340 N N   . GLN A 285 ? 0.3250 0.3031 0.5025 0.0286  0.1232  0.0631  301  GLN A N   
2341 C CA  . GLN A 285 ? 0.3304 0.3012 0.5185 0.0277  0.1330  0.0604  301  GLN A CA  
2342 C C   . GLN A 285 ? 0.3333 0.2981 0.5171 0.0237  0.1344  0.0484  301  GLN A C   
2343 O O   . GLN A 285 ? 0.3352 0.2941 0.5208 0.0216  0.1390  0.0425  301  GLN A O   
2344 C CB  . GLN A 285 ? 0.3335 0.3047 0.5364 0.0304  0.1411  0.0684  301  GLN A CB  
2345 C CG  . GLN A 285 ? 0.3316 0.3077 0.5420 0.0342  0.1423  0.0803  301  GLN A CG  
2346 C CD  . GLN A 285 ? 0.3377 0.3162 0.5615 0.0374  0.1488  0.0896  301  GLN A CD  
2347 O OE1 . GLN A 285 ? 0.3396 0.3175 0.5653 0.0372  0.1506  0.0882  301  GLN A OE1 
2348 N NE2 . GLN A 285 ? 0.3416 0.3230 0.5750 0.0406  0.1523  0.0996  301  GLN A NE2 
2349 N N   . MET A 286 ? 0.3338 0.3006 0.5118 0.0228  0.1304  0.0451  302  MET A N   
2350 C CA  . MET A 286 ? 0.3394 0.3022 0.5123 0.0191  0.1304  0.0340  302  MET A CA  
2351 C C   . MET A 286 ? 0.3354 0.2976 0.4956 0.0166  0.1239  0.0269  302  MET A C   
2352 O O   . MET A 286 ? 0.3375 0.2953 0.4956 0.0134  0.1261  0.0180  302  MET A O   
2353 C CB  . MET A 286 ? 0.3405 0.3065 0.5105 0.0191  0.1272  0.0332  302  MET A CB  
2354 C CG  . MET A 286 ? 0.3622 0.3267 0.5450 0.0201  0.1351  0.0365  302  MET A CG  
2355 S SD  . MET A 286 ? 0.4087 0.3786 0.5877 0.0210  0.1306  0.0378  302  MET A SD  
2356 C CE  . MET A 286 ? 0.3976 0.3654 0.5652 0.0165  0.1257  0.0247  302  MET A CE  
2357 N N   . GLY A 287 ? 0.3311 0.2983 0.4830 0.0182  0.1161  0.0309  303  GLY A N   
2358 C CA  . GLY A 287 ? 0.3298 0.2968 0.4705 0.0164  0.1101  0.0257  303  GLY A CA  
2359 C C   . GLY A 287 ? 0.3336 0.2960 0.4780 0.0155  0.1151  0.0243  303  GLY A C   
2360 O O   . GLY A 287 ? 0.3334 0.2925 0.4725 0.0126  0.1151  0.0163  303  GLY A O   
2361 N N   . ASP A 288 ? 0.3352 0.2979 0.4893 0.0181  0.1197  0.0323  304  ASP A N   
2362 C CA  . ASP A 288 ? 0.3430 0.3013 0.5027 0.0177  0.1257  0.0322  304  ASP A CA  
2363 C C   . ASP A 288 ? 0.3499 0.3014 0.5143 0.0148  0.1335  0.0238  304  ASP A C   
2364 O O   . ASP A 288 ? 0.3549 0.3026 0.5163 0.0125  0.1353  0.0178  304  ASP A O   
2365 C CB  . ASP A 288 ? 0.3422 0.3024 0.5137 0.0213  0.1303  0.0431  304  ASP A CB  
2366 C CG  . ASP A 288 ? 0.3502 0.3067 0.5276 0.0215  0.1359  0.0441  304  ASP A CG  
2367 O OD1 . ASP A 288 ? 0.3454 0.2999 0.5149 0.0194  0.1334  0.0385  304  ASP A OD1 
2368 O OD2 . ASP A 288 ? 0.3593 0.3149 0.5494 0.0238  0.1431  0.0509  304  ASP A OD2 
2369 N N   . ASP A 289 ? 0.3540 0.3042 0.5255 0.0146  0.1381  0.0233  305  ASP A N   
2370 C CA  . ASP A 289 ? 0.3617 0.3057 0.5381 0.0115  0.1455  0.0150  305  ASP A CA  
2371 C C   . ASP A 289 ? 0.3600 0.3031 0.5246 0.0074  0.1411  0.0039  305  ASP A C   
2372 O O   . ASP A 289 ? 0.3637 0.3020 0.5292 0.0044  0.1460  -0.0035 305  ASP A O   
2373 C CB  . ASP A 289 ? 0.3658 0.3097 0.5512 0.0122  0.1498  0.0171  305  ASP A CB  
2374 C CG  . ASP A 289 ? 0.3810 0.3191 0.5706 0.0084  0.1565  0.0076  305  ASP A CG  
2375 O OD1 . ASP A 289 ? 0.3959 0.3284 0.5891 0.0062  0.1628  0.0024  305  ASP A OD1 
2376 O OD2 . ASP A 289 ? 0.4049 0.3441 0.5945 0.0074  0.1556  0.0051  305  ASP A OD2 
2377 N N   . PHE A 290 ? 0.3541 0.3021 0.5079 0.0073  0.1319  0.0029  306  PHE A N   
2378 C CA  . PHE A 290 ? 0.3524 0.3007 0.4949 0.0038  0.1271  -0.0066 306  PHE A CA  
2379 C C   . PHE A 290 ? 0.3546 0.3013 0.4910 0.0025  0.1261  -0.0099 306  PHE A C   
2380 O O   . PHE A 290 ? 0.3582 0.3021 0.4917 -0.0009 0.1284  -0.0185 306  PHE A O   
2381 C CB  . PHE A 290 ? 0.3462 0.3003 0.4788 0.0047  0.1175  -0.0058 306  PHE A CB  
2382 C CG  . PHE A 290 ? 0.3432 0.2979 0.4680 0.0013  0.1142  -0.0152 306  PHE A CG  
2383 C CD1 . PHE A 290 ? 0.3374 0.2912 0.4542 -0.0015 0.1123  -0.0223 306  PHE A CD1 
2384 C CD2 . PHE A 290 ? 0.3366 0.2933 0.4622 0.0009  0.1132  -0.0165 306  PHE A CD2 
2385 C CE1 . PHE A 290 ? 0.3405 0.2959 0.4503 -0.0046 0.1091  -0.0305 306  PHE A CE1 
2386 C CE2 . PHE A 290 ? 0.3369 0.2949 0.4559 -0.0021 0.1101  -0.0249 306  PHE A CE2 
2387 C CZ  . PHE A 290 ? 0.3368 0.2944 0.4479 -0.0049 0.1080  -0.0318 306  PHE A CZ  
2388 N N   . PHE A 291 ? 0.3525 0.3014 0.4870 0.0052  0.1227  -0.0030 307  PHE A N   
2389 C CA  . PHE A 291 ? 0.3577 0.3052 0.4871 0.0044  0.1219  -0.0048 307  PHE A CA  
2390 C C   . PHE A 291 ? 0.3658 0.3075 0.5035 0.0030  0.1316  -0.0077 307  PHE A C   
2391 O O   . PHE A 291 ? 0.3724 0.3118 0.5049 0.0001  0.1327  -0.0151 307  PHE A O   
2392 C CB  . PHE A 291 ? 0.3523 0.3035 0.4797 0.0075  0.1169  0.0038  307  PHE A CB  
2393 C CG  . PHE A 291 ? 0.3475 0.3036 0.4633 0.0079  0.1067  0.0041  307  PHE A CG  
2394 C CD1 . PHE A 291 ? 0.3462 0.3028 0.4512 0.0062  0.1015  -0.0008 307  PHE A CD1 
2395 C CD2 . PHE A 291 ? 0.3411 0.3014 0.4571 0.0101  0.1025  0.0094  307  PHE A CD2 
2396 C CE1 . PHE A 291 ? 0.3371 0.2978 0.4321 0.0066  0.0926  -0.0004 307  PHE A CE1 
2397 C CE2 . PHE A 291 ? 0.3348 0.2993 0.4404 0.0104  0.0935  0.0094  307  PHE A CE2 
2398 C CZ  . PHE A 291 ? 0.3332 0.2976 0.4286 0.0087  0.0887  0.0044  307  PHE A CZ  
2399 N N   . THR A 292 ? 0.3688 0.3081 0.5194 0.0051  0.1389  -0.0019 308  THR A N   
2400 C CA  . THR A 292 ? 0.3777 0.3109 0.5376 0.0040  0.1491  -0.0042 308  THR A CA  
2401 C C   . THR A 292 ? 0.3826 0.3116 0.5428 -0.0002 0.1540  -0.0151 308  THR A C   
2402 O O   . THR A 292 ? 0.3877 0.3121 0.5493 -0.0026 0.1599  -0.0209 308  THR A O   
2403 C CB  . THR A 292 ? 0.3786 0.3103 0.5535 0.0075  0.1563  0.0049  308  THR A CB  
2404 O OG1 . THR A 292 ? 0.3853 0.3181 0.5658 0.0082  0.1574  0.0069  308  THR A OG1 
2405 C CG2 . THR A 292 ? 0.3730 0.3093 0.5480 0.0113  0.1519  0.0153  308  THR A CG2 
2406 N N   . SER A 293 ? 0.3835 0.3143 0.5424 -0.0013 0.1516  -0.0179 309  SER A N   
2407 C CA  . SER A 293 ? 0.3893 0.3171 0.5481 -0.0057 0.1554  -0.0284 309  SER A CA  
2408 C C   . SER A 293 ? 0.3934 0.3222 0.5397 -0.0094 0.1513  -0.0376 309  SER A C   
2409 O O   . SER A 293 ? 0.3974 0.3233 0.5439 -0.0135 0.1559  -0.0469 309  SER A O   
2410 C CB  . SER A 293 ? 0.3887 0.3194 0.5479 -0.0059 0.1526  -0.0288 309  SER A CB  
2411 O OG  . SER A 293 ? 0.3793 0.3155 0.5255 -0.0065 0.1424  -0.0309 309  SER A OG  
2412 N N   . MET A 294 ? 0.3902 0.3235 0.5259 -0.0080 0.1426  -0.0349 310  MET A N   
2413 C CA  . MET A 294 ? 0.3960 0.3310 0.5195 -0.0108 0.1380  -0.0420 310  MET A CA  
2414 C C   . MET A 294 ? 0.4015 0.3335 0.5246 -0.0109 0.1416  -0.0419 310  MET A C   
2415 O O   . MET A 294 ? 0.4010 0.3350 0.5138 -0.0123 0.1373  -0.0456 310  MET A O   
2416 C CB  . MET A 294 ? 0.3897 0.3308 0.5019 -0.0093 0.1269  -0.0392 310  MET A CB  
2417 C CG  . MET A 294 ? 0.3938 0.3382 0.5039 -0.0098 0.1226  -0.0408 310  MET A CG  
2418 S SD  . MET A 294 ? 0.4073 0.3582 0.5057 -0.0074 0.1105  -0.0365 310  MET A SD  
2419 C CE  . MET A 294 ? 0.4057 0.3582 0.4914 -0.0103 0.1062  -0.0436 310  MET A CE  
2420 N N   . ASN A 295 ? 0.4075 0.3351 0.5424 -0.0091 0.1497  -0.0374 311  ASN A N   
2421 C CA  . ASN A 295 ? 0.4160 0.3406 0.5527 -0.0085 0.1541  -0.0361 311  ASN A CA  
2422 C C   . ASN A 295 ? 0.4089 0.3375 0.5391 -0.0055 0.1468  -0.0287 311  ASN A C   
2423 O O   . ASN A 295 ? 0.4110 0.3389 0.5373 -0.0058 0.1471  -0.0295 311  ASN A O   
2424 C CB  . ASN A 295 ? 0.4269 0.3488 0.5585 -0.0131 0.1579  -0.0470 311  ASN A CB  
2425 C CG  . ASN A 295 ? 0.4494 0.3667 0.5858 -0.0127 0.1653  -0.0464 311  ASN A CG  
2426 O OD1 . ASN A 295 ? 0.4544 0.3688 0.6022 -0.0097 0.1711  -0.0393 311  ASN A OD1 
2427 N ND2 . ASN A 295 ? 0.4791 0.3963 0.6069 -0.0158 0.1653  -0.0537 311  ASN A ND2 
2428 N N   . LEU A 296 ? 0.3998 0.3327 0.5292 -0.0026 0.1402  -0.0216 312  LEU A N   
2429 C CA  . LEU A 296 ? 0.3923 0.3291 0.5171 0.0002  0.1335  -0.0141 312  LEU A CA  
2430 C C   . LEU A 296 ? 0.3903 0.3268 0.5266 0.0040  0.1373  -0.0039 312  LEU A C   
2431 O O   . LEU A 296 ? 0.3937 0.3268 0.5415 0.0045  0.1453  -0.0025 312  LEU A O   
2432 C CB  . LEU A 296 ? 0.3863 0.3286 0.5014 0.0006  0.1232  -0.0134 312  LEU A CB  
2433 C CG  . LEU A 296 ? 0.3834 0.3273 0.4860 -0.0024 0.1180  -0.0219 312  LEU A CG  
2434 C CD1 . LEU A 296 ? 0.3775 0.3263 0.4732 -0.0017 0.1093  -0.0208 312  LEU A CD1 
2435 C CD2 . LEU A 296 ? 0.3843 0.3284 0.4794 -0.0031 0.1158  -0.0232 312  LEU A CD2 
2436 N N   . THR A 297 ? 0.3853 0.3256 0.5189 0.0065  0.1318  0.0032  313  THR A N   
2437 C CA  . THR A 297 ? 0.3833 0.3243 0.5272 0.0099  0.1350  0.0131  313  THR A CA  
2438 C C   . THR A 297 ? 0.3804 0.3245 0.5313 0.0126  0.1344  0.0204  313  THR A C   
2439 O O   . THR A 297 ? 0.3740 0.3224 0.5185 0.0130  0.1270  0.0213  313  THR A O   
2440 C CB  . THR A 297 ? 0.3806 0.3249 0.5189 0.0113  0.1292  0.0179  313  THR A CB  
2441 O OG1 . THR A 297 ? 0.3839 0.3259 0.5142 0.0087  0.1290  0.0108  313  THR A OG1 
2442 C CG2 . THR A 297 ? 0.3797 0.3244 0.5293 0.0143  0.1339  0.0271  313  THR A CG2 
2443 N N   . LYS A 298 ? 0.3818 0.3238 0.5462 0.0146  0.1425  0.0258  314  LYS A N   
2444 C CA  . LYS A 298 ? 0.3801 0.3255 0.5527 0.0176  0.1428  0.0342  314  LYS A CA  
2445 C C   . LYS A 298 ? 0.3720 0.3244 0.5430 0.0205  0.1360  0.0438  314  LYS A C   
2446 O O   . LYS A 298 ? 0.3709 0.3243 0.5396 0.0209  0.1342  0.0458  314  LYS A O   
2447 C CB  . LYS A 298 ? 0.3860 0.3272 0.5744 0.0191  0.1540  0.0377  314  LYS A CB  
2448 C CG  . LYS A 298 ? 0.4023 0.3422 0.5987 0.0210  0.1593  0.0434  314  LYS A CG  
2449 C CD  . LYS A 298 ? 0.4246 0.3606 0.6376 0.0229  0.1705  0.0476  314  LYS A CD  
2450 C CE  . LYS A 298 ? 0.4373 0.3716 0.6585 0.0247  0.1764  0.0525  314  LYS A CE  
2451 N NZ  . LYS A 298 ? 0.4550 0.3842 0.6926 0.0263  0.1883  0.0556  314  LYS A NZ  
2452 N N   . LEU A 299 ? 0.3645 0.3220 0.5366 0.0224  0.1323  0.0494  315  LEU A N   
2453 C CA  . LEU A 299 ? 0.3591 0.3239 0.5302 0.0250  0.1260  0.0585  315  LEU A CA  
2454 C C   . LEU A 299 ? 0.3616 0.3274 0.5452 0.0278  0.1318  0.0676  315  LEU A C   
2455 O O   . LEU A 299 ? 0.3620 0.3254 0.5577 0.0293  0.1401  0.0708  315  LEU A O   
2456 C CB  . LEU A 299 ? 0.3547 0.3249 0.5243 0.0263  0.1214  0.0622  315  LEU A CB  
2457 C CG  . LEU A 299 ? 0.3481 0.3185 0.5051 0.0240  0.1146  0.0545  315  LEU A CG  
2458 C CD1 . LEU A 299 ? 0.3455 0.3201 0.5036 0.0254  0.1125  0.0581  315  LEU A CD1 
2459 C CD2 . LEU A 299 ? 0.3404 0.3136 0.4853 0.0230  0.1056  0.0528  315  LEU A CD2 
2460 N N   . PRO A 300 ? 0.3617 0.3311 0.5428 0.0286  0.1278  0.0719  316  PRO A N   
2461 C CA  . PRO A 300 ? 0.3647 0.3363 0.5576 0.0313  0.1326  0.0810  316  PRO A CA  
2462 C C   . PRO A 300 ? 0.3654 0.3445 0.5658 0.0345  0.1316  0.0918  316  PRO A C   
2463 O O   . PRO A 300 ? 0.3617 0.3450 0.5562 0.0345  0.1257  0.0922  316  PRO A O   
2464 C CB  . PRO A 300 ? 0.3624 0.3365 0.5482 0.0306  0.1267  0.0815  316  PRO A CB  
2465 C CG  . PRO A 300 ? 0.3572 0.3337 0.5286 0.0286  0.1169  0.0765  316  PRO A CG  
2466 C CD  . PRO A 300 ? 0.3576 0.3291 0.5253 0.0268  0.1187  0.0681  316  PRO A CD  
2467 N N   . GLN A 301 ? 0.3687 0.3497 0.5820 0.0374  0.1374  0.1007  317  GLN A N   
2468 C CA  . GLN A 301 ? 0.3707 0.3594 0.5927 0.0407  0.1375  0.1119  317  GLN A CA  
2469 C C   . GLN A 301 ? 0.3641 0.3626 0.5780 0.0411  0.1268  0.1168  317  GLN A C   
2470 O O   . GLN A 301 ? 0.3598 0.3648 0.5744 0.0426  0.1239  0.1221  317  GLN A O   
2471 C CB  . GLN A 301 ? 0.3780 0.3668 0.6159 0.0438  0.1461  0.1206  317  GLN A CB  
2472 C CG  . GLN A 301 ? 0.3930 0.3875 0.6431 0.0474  0.1498  0.1313  317  GLN A CG  
2473 C CD  . GLN A 301 ? 0.4206 0.4109 0.6721 0.0471  0.1535  0.1275  317  GLN A CD  
2474 O OE1 . GLN A 301 ? 0.4387 0.4196 0.6903 0.0450  0.1592  0.1186  317  GLN A OE1 
2475 N NE2 . GLN A 301 ? 0.4258 0.4235 0.6783 0.0490  0.1504  0.1343  317  GLN A NE2 
2476 N N   . ASP A 302 ? 0.3600 0.3597 0.5662 0.0396  0.1211  0.1147  318  ASP A N   
2477 C CA  . ASP A 302 ? 0.3574 0.3656 0.5549 0.0392  0.1108  0.1177  318  ASP A CA  
2478 C C   . ASP A 302 ? 0.3511 0.3608 0.5378 0.0378  0.1044  0.1130  318  ASP A C   
2479 O O   . ASP A 302 ? 0.3486 0.3666 0.5325 0.0386  0.0983  0.1181  318  ASP A O   
2480 C CB  . ASP A 302 ? 0.3579 0.3650 0.5479 0.0371  0.1063  0.1139  318  ASP A CB  
2481 C CG  . ASP A 302 ? 0.3698 0.3809 0.5691 0.0389  0.1086  0.1223  318  ASP A CG  
2482 O OD1 . ASP A 302 ? 0.3818 0.3963 0.5939 0.0418  0.1142  0.1310  318  ASP A OD1 
2483 O OD2 . ASP A 302 ? 0.3808 0.3920 0.5748 0.0374  0.1048  0.1205  318  ASP A OD2 
2484 N N   . PHE A 303 ? 0.3487 0.3507 0.5294 0.0357  0.1058  0.1031  319  PHE A N   
2485 C CA  . PHE A 303 ? 0.3469 0.3495 0.5181 0.0344  0.1005  0.0981  319  PHE A CA  
2486 C C   . PHE A 303 ? 0.3448 0.3524 0.5226 0.0368  0.1023  0.1048  319  PHE A C   
2487 O O   . PHE A 303 ? 0.3428 0.3570 0.5146 0.0371  0.0957  0.1071  319  PHE A O   
2488 C CB  . PHE A 303 ? 0.3468 0.3406 0.5125 0.0319  0.1029  0.0869  319  PHE A CB  
2489 C CG  . PHE A 303 ? 0.3496 0.3440 0.5062 0.0307  0.0979  0.0819  319  PHE A CG  
2490 C CD1 . PHE A 303 ? 0.3512 0.3453 0.5130 0.0316  0.1018  0.0826  319  PHE A CD1 
2491 C CD2 . PHE A 303 ? 0.3467 0.3422 0.4902 0.0287  0.0895  0.0766  319  PHE A CD2 
2492 C CE1 . PHE A 303 ? 0.3492 0.3442 0.5029 0.0306  0.0973  0.0782  319  PHE A CE1 
2493 C CE2 . PHE A 303 ? 0.3440 0.3402 0.4796 0.0278  0.0850  0.0722  319  PHE A CE2 
2494 C CZ  . PHE A 303 ? 0.3482 0.3443 0.4888 0.0288  0.0889  0.0729  319  PHE A CZ  
2495 N N   . TRP A 304 ? 0.3465 0.3510 0.5367 0.0385  0.1114  0.1079  320  TRP A N   
2496 C CA  . TRP A 304 ? 0.3451 0.3539 0.5428 0.0410  0.1142  0.1147  320  TRP A CA  
2497 C C   . TRP A 304 ? 0.3453 0.3648 0.5476 0.0438  0.1112  0.1266  320  TRP A C   
2498 O O   . TRP A 304 ? 0.3440 0.3703 0.5459 0.0451  0.1085  0.1315  320  TRP A O   
2499 C CB  . TRP A 304 ? 0.3485 0.3506 0.5592 0.0421  0.1254  0.1151  320  TRP A CB  
2500 C CG  . TRP A 304 ? 0.3461 0.3382 0.5528 0.0392  0.1288  0.1033  320  TRP A CG  
2501 C CD1 . TRP A 304 ? 0.3483 0.3323 0.5583 0.0377  0.1350  0.0975  320  TRP A CD1 
2502 C CD2 . TRP A 304 ? 0.3436 0.3337 0.5426 0.0373  0.1262  0.0960  320  TRP A CD2 
2503 N NE1 . TRP A 304 ? 0.3476 0.3248 0.5520 0.0347  0.1362  0.0869  320  TRP A NE1 
2504 C CE2 . TRP A 304 ? 0.3424 0.3232 0.5404 0.0345  0.1308  0.0859  320  TRP A CE2 
2505 C CE3 . TRP A 304 ? 0.3370 0.3323 0.5299 0.0376  0.1205  0.0969  320  TRP A CE3 
2506 C CZ2 . TRP A 304 ? 0.3444 0.3216 0.5358 0.0320  0.1297  0.0770  320  TRP A CZ2 
2507 C CZ3 . TRP A 304 ? 0.3369 0.3280 0.5233 0.0353  0.1196  0.0881  320  TRP A CZ3 
2508 C CH2 . TRP A 304 ? 0.3380 0.3204 0.5240 0.0325  0.1241  0.0784  320  TRP A CH2 
2509 N N   . ASP A 305 ? 0.3445 0.3661 0.5511 0.0444  0.1116  0.1312  321  ASP A N   
2510 C CA  . ASP A 305 ? 0.3450 0.3776 0.5570 0.0469  0.1089  0.1427  321  ASP A CA  
2511 C C   . ASP A 305 ? 0.3399 0.3808 0.5398 0.0455  0.0979  0.1428  321  ASP A C   
2512 O O   . ASP A 305 ? 0.3370 0.3879 0.5388 0.0473  0.0948  0.1511  321  ASP A O   
2513 C CB  . ASP A 305 ? 0.3474 0.3797 0.5676 0.0477  0.1125  0.1470  321  ASP A CB  
2514 C CG  . ASP A 305 ? 0.3594 0.3860 0.5947 0.0500  0.1241  0.1503  321  ASP A CG  
2515 O OD1 . ASP A 305 ? 0.3712 0.3947 0.6119 0.0511  0.1296  0.1502  321  ASP A OD1 
2516 O OD2 . ASP A 305 ? 0.3741 0.3992 0.6164 0.0507  0.1281  0.1530  321  ASP A OD2 
2517 N N   . LYS A 306 ? 0.3380 0.3748 0.5256 0.0424  0.0922  0.1337  322  LYS A N   
2518 C CA  . LYS A 306 ? 0.3362 0.3798 0.5130 0.0408  0.0821  0.1335  322  LYS A CA  
2519 C C   . LYS A 306 ? 0.3349 0.3774 0.4985 0.0388  0.0759  0.1259  322  LYS A C   
2520 O O   . LYS A 306 ? 0.3333 0.3825 0.4888 0.0378  0.0680  0.1266  322  LYS A O   
2521 C CB  . LYS A 306 ? 0.3373 0.3787 0.5110 0.0390  0.0797  0.1308  322  LYS A CB  
2522 C CG  . LYS A 306 ? 0.3404 0.3845 0.5264 0.0410  0.0845  0.1390  322  LYS A CG  
2523 C CD  . LYS A 306 ? 0.3462 0.3870 0.5282 0.0389  0.0823  0.1350  322  LYS A CD  
2524 C CE  . LYS A 306 ? 0.3512 0.3946 0.5454 0.0408  0.0871  0.1430  322  LYS A CE  
2525 N NZ  . LYS A 306 ? 0.3561 0.3984 0.5457 0.0388  0.0835  0.1403  322  LYS A NZ  
2526 N N   . SER A 307 ? 0.3346 0.3691 0.4962 0.0380  0.0794  0.1185  323  SER A N   
2527 C CA  . SER A 307 ? 0.3346 0.3676 0.4844 0.0363  0.0741  0.1111  323  SER A CA  
2528 C C   . SER A 307 ? 0.3368 0.3780 0.4858 0.0377  0.0713  0.1164  323  SER A C   
2529 O O   . SER A 307 ? 0.3331 0.3792 0.4921 0.0403  0.0756  0.1249  323  SER A O   
2530 C CB  . SER A 307 ? 0.3350 0.3583 0.4841 0.0352  0.0790  0.1025  323  SER A CB  
2531 O OG  . SER A 307 ? 0.3340 0.3502 0.4798 0.0331  0.0797  0.0958  323  SER A OG  
2532 N N   . ILE A 308 ? 0.3380 0.3809 0.4752 0.0361  0.0642  0.1115  324  ILE A N   
2533 C CA  . ILE A 308 ? 0.3437 0.3932 0.4782 0.0371  0.0616  0.1145  324  ILE A CA  
2534 C C   . ILE A 308 ? 0.3470 0.3898 0.4762 0.0362  0.0626  0.1062  324  ILE A C   
2535 O O   . ILE A 308 ? 0.3436 0.3822 0.4627 0.0339  0.0581  0.0979  324  ILE A O   
2536 C CB  . ILE A 308 ? 0.3430 0.4006 0.4683 0.0360  0.0527  0.1158  324  ILE A CB  
2537 C CG1 . ILE A 308 ? 0.3482 0.4133 0.4795 0.0368  0.0517  0.1242  324  ILE A CG1 
2538 C CG2 . ILE A 308 ? 0.3477 0.4118 0.4692 0.0369  0.0502  0.1180  324  ILE A CG2 
2539 C CD1 . ILE A 308 ? 0.3462 0.4176 0.4684 0.0348  0.0430  0.1237  324  ILE A CD1 
2540 N N   . ILE A 309 ? 0.3528 0.3948 0.4895 0.0379  0.0686  0.1087  325  ILE A N   
2541 C CA  . ILE A 309 ? 0.3614 0.3970 0.4949 0.0370  0.0706  0.1012  325  ILE A CA  
2542 C C   . ILE A 309 ? 0.3661 0.4073 0.4973 0.0382  0.0690  0.1036  325  ILE A C   
2543 O O   . ILE A 309 ? 0.3667 0.4037 0.4966 0.0377  0.0710  0.0986  325  ILE A O   
2544 C CB  . ILE A 309 ? 0.3626 0.3903 0.5063 0.0372  0.0797  0.0994  325  ILE A CB  
2545 C CG1 . ILE A 309 ? 0.3660 0.3973 0.5234 0.0403  0.0865  0.1095  325  ILE A CG1 
2546 C CG2 . ILE A 309 ? 0.3635 0.3848 0.5069 0.0355  0.0808  0.0947  325  ILE A CG2 
2547 C CD1 . ILE A 309 ? 0.3713 0.3949 0.5392 0.0406  0.0960  0.1075  325  ILE A CD1 
2548 N N   . GLU A 310 ? 0.3751 0.4259 0.5056 0.0396  0.0653  0.1112  326  GLU A N   
2549 C CA  . GLU A 310 ? 0.3849 0.4423 0.5118 0.0406  0.0629  0.1138  326  GLU A CA  
2550 C C   . GLU A 310 ? 0.3865 0.4525 0.5045 0.0399  0.0547  0.1160  326  GLU A C   
2551 O O   . GLU A 310 ? 0.3832 0.4531 0.5029 0.0398  0.0527  0.1202  326  GLU A O   
2552 C CB  . GLU A 310 ? 0.3901 0.4521 0.5289 0.0437  0.0693  0.1235  326  GLU A CB  
2553 C CG  . GLU A 310 ? 0.4110 0.4652 0.5581 0.0443  0.0775  0.1211  326  GLU A CG  
2554 C CD  . GLU A 310 ? 0.4403 0.4993 0.5993 0.0476  0.0839  0.1311  326  GLU A CD  
2555 O OE1 . GLU A 310 ? 0.4535 0.5229 0.6123 0.0494  0.0811  0.1393  326  GLU A OE1 
2556 O OE2 . GLU A 310 ? 0.4526 0.5052 0.6215 0.0482  0.0918  0.1307  326  GLU A OE2 
2557 N N   . LYS A 311 ? 0.3902 0.4592 0.4990 0.0394  0.0502  0.1130  327  LYS A N   
2558 C CA  . LYS A 311 ? 0.3960 0.4736 0.4963 0.0386  0.0427  0.1148  327  LYS A CA  
2559 C C   . LYS A 311 ? 0.4030 0.4917 0.5105 0.0409  0.0438  0.1265  327  LYS A C   
2560 O O   . LYS A 311 ? 0.4027 0.4945 0.5167 0.0432  0.0484  0.1321  327  LYS A O   
2561 C CB  . LYS A 311 ? 0.3960 0.4744 0.4858 0.0378  0.0387  0.1094  327  LYS A CB  
2562 C CG  . LYS A 311 ? 0.3969 0.4826 0.4765 0.0363  0.0308  0.1090  327  LYS A CG  
2563 C CD  . LYS A 311 ? 0.4045 0.4903 0.4739 0.0355  0.0274  0.1032  327  LYS A CD  
2564 C CE  . LYS A 311 ? 0.4118 0.5045 0.4713 0.0338  0.0199  0.1024  327  LYS A CE  
2565 N NZ  . LYS A 311 ? 0.4216 0.5136 0.4708 0.0329  0.0167  0.0959  327  LYS A NZ  
2566 N N   . PRO A 312 ? 0.4093 0.5042 0.5162 0.0401  0.0397  0.1303  328  PRO A N   
2567 C CA  . PRO A 312 ? 0.4163 0.5231 0.5296 0.0421  0.0399  0.1417  328  PRO A CA  
2568 C C   . PRO A 312 ? 0.4246 0.5407 0.5335 0.0431  0.0376  0.1454  328  PRO A C   
2569 O O   . PRO A 312 ? 0.4263 0.5421 0.5238 0.0413  0.0328  0.1387  328  PRO A O   
2570 C CB  . PRO A 312 ? 0.4160 0.5272 0.5251 0.0399  0.0337  0.1417  328  PRO A CB  
2571 C CG  . PRO A 312 ? 0.4112 0.5106 0.5175 0.0379  0.0337  0.1328  328  PRO A CG  
2572 C CD  . PRO A 312 ? 0.4077 0.4987 0.5085 0.0374  0.0350  0.1244  328  PRO A CD  
2573 N N   . THR A 313 ? 0.4331 0.5576 0.5511 0.0460  0.0414  0.1560  329  THR A N   
2574 C CA  . THR A 313 ? 0.4432 0.5770 0.5585 0.0474  0.0405  0.1608  329  THR A CA  
2575 C C   . THR A 313 ? 0.4491 0.5974 0.5598 0.0469  0.0342  0.1670  329  THR A C   
2576 O O   . THR A 313 ? 0.4535 0.6110 0.5608 0.0478  0.0328  0.1711  329  THR A O   
2577 C CB  . THR A 313 ? 0.4443 0.5788 0.5721 0.0512  0.0489  0.1690  329  THR A CB  
2578 O OG1 . THR A 313 ? 0.4483 0.5847 0.5888 0.0530  0.0531  0.1773  329  THR A OG1 
2579 C CG2 . THR A 313 ? 0.4446 0.5662 0.5742 0.0512  0.0542  0.1616  329  THR A CG2 
2580 N N   . ASP A 314 ? 0.4510 0.6018 0.5617 0.0452  0.0305  0.1677  330  ASP A N   
2581 C CA  . ASP A 314 ? 0.4559 0.6199 0.5605 0.0436  0.0234  0.1712  330  ASP A CA  
2582 C C   . ASP A 314 ? 0.4563 0.6178 0.5456 0.0400  0.0164  0.1603  330  ASP A C   
2583 O O   . ASP A 314 ? 0.4579 0.6075 0.5423 0.0390  0.0172  0.1509  330  ASP A O   
2584 C CB  . ASP A 314 ? 0.4554 0.6235 0.5667 0.0432  0.0223  0.1764  330  ASP A CB  
2585 C CG  . ASP A 314 ? 0.4604 0.6154 0.5724 0.0415  0.0233  0.1687  330  ASP A CG  
2586 O OD1 . ASP A 314 ? 0.4657 0.6097 0.5704 0.0399  0.0228  0.1584  330  ASP A OD1 
2587 O OD2 . ASP A 314 ? 0.4664 0.6225 0.5866 0.0418  0.0246  0.1733  330  ASP A OD2 
2588 N N   . GLY A 315 ? 0.4579 0.6306 0.5398 0.0380  0.0098  0.1617  331  GLY A N   
2589 C CA  . GLY A 315 ? 0.4555 0.6266 0.5231 0.0346  0.0036  0.1518  331  GLY A CA  
2590 C C   . GLY A 315 ? 0.4498 0.6124 0.5122 0.0313  -0.0002 0.1429  331  GLY A C   
2591 O O   . GLY A 315 ? 0.4529 0.6147 0.5041 0.0283  -0.0055 0.1351  331  GLY A O   
2592 N N   . ARG A 316 ? 0.4414 0.5974 0.5122 0.0318  0.0028  0.1439  332  ARG A N   
2593 C CA  . ARG A 316 ? 0.4345 0.5840 0.5019 0.0288  -0.0006 0.1373  332  ARG A CA  
2594 C C   . ARG A 316 ? 0.4285 0.5648 0.4874 0.0271  -0.0014 0.1255  332  ARG A C   
2595 O O   . ARG A 316 ? 0.4268 0.5562 0.4857 0.0287  0.0024  0.1224  332  ARG A O   
2596 C CB  . ARG A 316 ? 0.4330 0.5798 0.5120 0.0300  0.0032  0.1424  332  ARG A CB  
2597 C CG  . ARG A 316 ? 0.4348 0.5678 0.5192 0.0315  0.0096  0.1385  332  ARG A CG  
2598 C CD  . ARG A 316 ? 0.4508 0.5847 0.5490 0.0339  0.0152  0.1469  332  ARG A CD  
2599 N NE  . ARG A 316 ? 0.4601 0.5809 0.5623 0.0340  0.0197  0.1420  332  ARG A NE  
2600 C CZ  . ARG A 316 ? 0.4620 0.5796 0.5762 0.0365  0.0267  0.1470  332  ARG A CZ  
2601 N NH1 . ARG A 316 ? 0.4645 0.5905 0.5884 0.0394  0.0304  0.1575  332  ARG A NH1 
2602 N NH2 . ARG A 316 ? 0.4634 0.5693 0.5798 0.0361  0.0304  0.1414  332  ARG A NH2 
2603 N N   . ASP A 317 ? 0.4215 0.5551 0.4739 0.0239  -0.0064 0.1192  333  ASP A N   
2604 C CA  . ASP A 317 ? 0.4135 0.5349 0.4588 0.0223  -0.0073 0.1086  333  ASP A CA  
2605 C C   . ASP A 317 ? 0.4032 0.5146 0.4548 0.0227  -0.0038 0.1070  333  ASP A C   
2606 O O   . ASP A 317 ? 0.4010 0.5153 0.4593 0.0226  -0.0034 0.1120  333  ASP A O   
2607 C CB  . ASP A 317 ? 0.4174 0.5405 0.4524 0.0186  -0.0143 0.1024  333  ASP A CB  
2608 C CG  . ASP A 317 ? 0.4265 0.5583 0.4536 0.0179  -0.0177 0.1022  333  ASP A CG  
2609 O OD1 . ASP A 317 ? 0.4337 0.5624 0.4571 0.0193  -0.0158 0.0992  333  ASP A OD1 
2610 O OD2 . ASP A 317 ? 0.4368 0.5789 0.4615 0.0158  -0.0222 0.1049  333  ASP A OD2 
2611 N N   . LEU A 318 ? 0.3930 0.4933 0.4426 0.0232  -0.0011 0.1003  334  LEU A N   
2612 C CA  . LEU A 318 ? 0.3830 0.4733 0.4371 0.0233  0.0021  0.0975  334  LEU A CA  
2613 C C   . LEU A 318 ? 0.3765 0.4563 0.4234 0.0224  0.0017  0.0877  334  LEU A C   
2614 O O   . LEU A 318 ? 0.3774 0.4569 0.4176 0.0223  0.0002  0.0838  334  LEU A O   
2615 C CB  . LEU A 318 ? 0.3813 0.4706 0.4470 0.0262  0.0093  0.1036  334  LEU A CB  
2616 C CG  . LEU A 318 ? 0.3824 0.4668 0.4497 0.0282  0.0143  0.1019  334  LEU A CG  
2617 C CD1 . LEU A 318 ? 0.3846 0.4630 0.4625 0.0299  0.0215  0.1040  334  LEU A CD1 
2618 C CD2 . LEU A 318 ? 0.3859 0.4795 0.4538 0.0299  0.0146  0.1076  334  LEU A CD2 
2619 N N   . VAL A 319 ? 0.3677 0.4391 0.4161 0.0217  0.0031  0.0840  335  VAL A N   
2620 C CA  . VAL A 319 ? 0.3610 0.4224 0.4042 0.0212  0.0036  0.0756  335  VAL A CA  
2621 C C   . VAL A 319 ? 0.3574 0.4146 0.4066 0.0234  0.0101  0.0761  335  VAL A C   
2622 O O   . VAL A 319 ? 0.3541 0.4090 0.4116 0.0243  0.0147  0.0792  335  VAL A O   
2623 C CB  . VAL A 319 ? 0.3608 0.4156 0.4025 0.0195  0.0023  0.0715  335  VAL A CB  
2624 C CG1 . VAL A 319 ? 0.3541 0.3996 0.3909 0.0192  0.0030  0.0634  335  VAL A CG1 
2625 C CG2 . VAL A 319 ? 0.3583 0.4171 0.3947 0.0171  -0.0037 0.0708  335  VAL A CG2 
2626 N N   . CYS A 320 ? 0.3531 0.4094 0.3987 0.0241  0.0105  0.0731  336  CYS A N   
2627 C CA  . CYS A 320 ? 0.3520 0.4046 0.4034 0.0259  0.0166  0.0731  336  CYS A CA  
2628 C C   . CYS A 320 ? 0.3445 0.3873 0.3937 0.0252  0.0182  0.0654  336  CYS A C   
2629 O O   . CYS A 320 ? 0.3478 0.3868 0.4029 0.0261  0.0236  0.0651  336  CYS A O   
2630 C CB  . CYS A 320 ? 0.3536 0.4108 0.4036 0.0273  0.0171  0.0747  336  CYS A CB  
2631 S SG  . CYS A 320 ? 0.3742 0.4404 0.4344 0.0299  0.0215  0.0859  336  CYS A SG  
2632 N N   . HIS A 321 ? 0.3361 0.3753 0.3774 0.0234  0.0137  0.0594  337  HIS A N   
2633 C CA  . HIS A 321 ? 0.3275 0.3583 0.3668 0.0227  0.0150  0.0526  337  HIS A CA  
2634 C C   . HIS A 321 ? 0.3230 0.3503 0.3698 0.0227  0.0194  0.0543  337  HIS A C   
2635 O O   . HIS A 321 ? 0.3207 0.3493 0.3694 0.0221  0.0184  0.0573  337  HIS A O   
2636 C CB  . HIS A 321 ? 0.3269 0.3548 0.3572 0.0210  0.0095  0.0469  337  HIS A CB  
2637 C CG  . HIS A 321 ? 0.3223 0.3430 0.3495 0.0205  0.0103  0.0401  337  HIS A CG  
2638 N ND1 . HIS A 321 ? 0.3177 0.3369 0.3397 0.0207  0.0091  0.0353  337  HIS A ND1 
2639 C CD2 . HIS A 321 ? 0.3198 0.3350 0.3485 0.0198  0.0123  0.0374  337  HIS A CD2 
2640 C CE1 . HIS A 321 ? 0.3181 0.3316 0.3387 0.0202  0.0100  0.0302  337  HIS A CE1 
2641 N NE2 . HIS A 321 ? 0.3153 0.3263 0.3396 0.0195  0.0120  0.0313  337  HIS A NE2 
2642 N N   . ALA A 322 ? 0.3181 0.3412 0.3694 0.0233  0.0246  0.0524  338  ALA A N   
2643 C CA  . ALA A 322 ? 0.3166 0.3365 0.3762 0.0235  0.0302  0.0543  338  ALA A CA  
2644 C C   . ALA A 322 ? 0.3165 0.3327 0.3741 0.0221  0.0288  0.0519  338  ALA A C   
2645 O O   . ALA A 322 ? 0.3144 0.3276 0.3642 0.0208  0.0249  0.0464  338  ALA A O   
2646 C CB  . ALA A 322 ? 0.3158 0.3312 0.3792 0.0238  0.0356  0.0508  338  ALA A CB  
2647 N N   . SER A 323 ? 0.3178 0.3343 0.3828 0.0225  0.0323  0.0564  339  SER A N   
2648 C CA  . SER A 323 ? 0.3188 0.3321 0.3830 0.0213  0.0316  0.0551  339  SER A CA  
2649 C C   . SER A 323 ? 0.3210 0.3321 0.3948 0.0219  0.0383  0.0581  339  SER A C   
2650 O O   . SER A 323 ? 0.3193 0.3332 0.4014 0.0235  0.0426  0.0636  339  SER A O   
2651 C CB  . SER A 323 ? 0.3197 0.3377 0.3807 0.0207  0.0260  0.0585  339  SER A CB  
2652 O OG  . SER A 323 ? 0.3201 0.3452 0.3873 0.0220  0.0267  0.0663  339  SER A OG  
2653 N N   . ALA A 324 ? 0.3208 0.3268 0.3934 0.0207  0.0394  0.0544  340  ALA A N   
2654 C CA  . ALA A 324 ? 0.3240 0.3275 0.4050 0.0211  0.0457  0.0566  340  ALA A CA  
2655 C C   . ALA A 324 ? 0.3251 0.3298 0.4060 0.0206  0.0434  0.0595  340  ALA A C   
2656 O O   . ALA A 324 ? 0.3260 0.3306 0.3991 0.0193  0.0378  0.0567  340  ALA A O   
2657 C CB  . ALA A 324 ? 0.3253 0.3219 0.4052 0.0199  0.0497  0.0495  340  ALA A CB  
2658 N N   . TRP A 325 ? 0.3248 0.3306 0.4150 0.0216  0.0480  0.0651  341  TRP A N   
2659 C CA  . TRP A 325 ? 0.3258 0.3345 0.4175 0.0214  0.0458  0.0695  341  TRP A CA  
2660 C C   . TRP A 325 ? 0.3270 0.3316 0.4251 0.0215  0.0517  0.0700  341  TRP A C   
2661 O O   . TRP A 325 ? 0.3268 0.3300 0.4337 0.0228  0.0586  0.0724  341  TRP A O   
2662 C CB  . TRP A 325 ? 0.3241 0.3412 0.4213 0.0228  0.0442  0.0780  341  TRP A CB  
2663 C CG  . TRP A 325 ? 0.3273 0.3493 0.4174 0.0224  0.0377  0.0777  341  TRP A CG  
2664 C CD1 . TRP A 325 ? 0.3308 0.3532 0.4185 0.0231  0.0377  0.0758  341  TRP A CD1 
2665 C CD2 . TRP A 325 ? 0.3318 0.3589 0.4165 0.0213  0.0307  0.0791  341  TRP A CD2 
2666 N NE1 . TRP A 325 ? 0.3358 0.3631 0.4166 0.0224  0.0312  0.0759  341  TRP A NE1 
2667 C CE2 . TRP A 325 ? 0.3348 0.3650 0.4136 0.0212  0.0268  0.0777  341  TRP A CE2 
2668 C CE3 . TRP A 325 ? 0.3312 0.3605 0.4155 0.0201  0.0275  0.0812  341  TRP A CE3 
2669 C CZ2 . TRP A 325 ? 0.3371 0.3724 0.4095 0.0200  0.0199  0.0780  341  TRP A CZ2 
2670 C CZ3 . TRP A 325 ? 0.3382 0.3727 0.4166 0.0187  0.0205  0.0816  341  TRP A CZ3 
2671 C CH2 . TRP A 325 ? 0.3389 0.3762 0.4113 0.0186  0.0169  0.0798  341  TRP A CH2 
2672 N N   . ASP A 326 ? 0.3267 0.3292 0.4203 0.0201  0.0493  0.0676  342  ASP A N   
2673 C CA  . ASP A 326 ? 0.3300 0.3290 0.4287 0.0200  0.0543  0.0682  342  ASP A CA  
2674 C C   . ASP A 326 ? 0.3294 0.3336 0.4322 0.0204  0.0521  0.0751  342  ASP A C   
2675 O O   . ASP A 326 ? 0.3287 0.3353 0.4253 0.0191  0.0457  0.0748  342  ASP A O   
2676 C CB  . ASP A 326 ? 0.3309 0.3239 0.4214 0.0182  0.0536  0.0604  342  ASP A CB  
2677 C CG  . ASP A 326 ? 0.3357 0.3244 0.4309 0.0180  0.0599  0.0597  342  ASP A CG  
2678 O OD1 . ASP A 326 ? 0.3378 0.3279 0.4429 0.0194  0.0649  0.0654  342  ASP A OD1 
2679 O OD2 . ASP A 326 ? 0.3364 0.3206 0.4253 0.0166  0.0600  0.0535  342  ASP A OD2 
2680 N N   . PHE A 327 ? 0.3313 0.3373 0.4449 0.0220  0.0576  0.0813  343  PHE A N   
2681 C CA  . PHE A 327 ? 0.3317 0.3436 0.4506 0.0224  0.0559  0.0887  343  PHE A CA  
2682 C C   . PHE A 327 ? 0.3353 0.3437 0.4564 0.0219  0.0587  0.0883  343  PHE A C   
2683 O O   . PHE A 327 ? 0.3337 0.3466 0.4604 0.0223  0.0582  0.0945  343  PHE A O   
2684 C CB  . PHE A 327 ? 0.3309 0.3490 0.4609 0.0248  0.0591  0.0973  343  PHE A CB  
2685 C CG  . PHE A 327 ? 0.3277 0.3515 0.4547 0.0252  0.0546  0.0991  343  PHE A CG  
2686 C CD1 . PHE A 327 ? 0.3289 0.3496 0.4538 0.0257  0.0566  0.0953  343  PHE A CD1 
2687 C CD2 . PHE A 327 ? 0.3266 0.3590 0.4527 0.0249  0.0483  0.1043  343  PHE A CD2 
2688 C CE1 . PHE A 327 ? 0.3195 0.3455 0.4414 0.0261  0.0526  0.0969  343  PHE A CE1 
2689 C CE2 . PHE A 327 ? 0.3233 0.3613 0.4460 0.0251  0.0442  0.1056  343  PHE A CE2 
2690 C CZ  . PHE A 327 ? 0.3214 0.3561 0.4420 0.0258  0.0464  0.1020  343  PHE A CZ  
2691 N N   . TYR A 328 ? 0.3408 0.3417 0.4571 0.0208  0.0615  0.0810  344  TYR A N   
2692 C CA  . TYR A 328 ? 0.3473 0.3443 0.4627 0.0199  0.0635  0.0790  344  TYR A CA  
2693 C C   . TYR A 328 ? 0.3490 0.3464 0.4760 0.0214  0.0703  0.0847  344  TYR A C   
2694 O O   . TYR A 328 ? 0.3496 0.3464 0.4773 0.0209  0.0708  0.0858  344  TYR A O   
2695 C CB  . TYR A 328 ? 0.3488 0.3479 0.4566 0.0182  0.0559  0.0784  344  TYR A CB  
2696 C CG  . TYR A 328 ? 0.3625 0.3594 0.4587 0.0167  0.0504  0.0716  344  TYR A CG  
2697 C CD1 . TYR A 328 ? 0.3804 0.3711 0.4696 0.0156  0.0515  0.0643  344  TYR A CD1 
2698 C CD2 . TYR A 328 ? 0.3744 0.3757 0.4667 0.0165  0.0441  0.0725  344  TYR A CD2 
2699 C CE1 . TYR A 328 ? 0.3948 0.3839 0.4739 0.0144  0.0465  0.0586  344  TYR A CE1 
2700 C CE2 . TYR A 328 ? 0.3850 0.3841 0.4671 0.0153  0.0394  0.0664  344  TYR A CE2 
2701 C CZ  . TYR A 328 ? 0.3982 0.3913 0.4741 0.0144  0.0406  0.0597  344  TYR A CZ  
2702 O OH  . TYR A 328 ? 0.4269 0.4182 0.4934 0.0134  0.0360  0.0541  344  TYR A OH  
2703 N N   . LEU A 329 ? 0.3497 0.3480 0.4860 0.0234  0.0760  0.0886  345  LEU A N   
2704 C CA  . LEU A 329 ? 0.3528 0.3501 0.5006 0.0250  0.0839  0.0932  345  LEU A CA  
2705 C C   . LEU A 329 ? 0.3561 0.3453 0.5050 0.0249  0.0917  0.0869  345  LEU A C   
2706 O O   . LEU A 329 ? 0.3569 0.3409 0.4967 0.0229  0.0909  0.0786  345  LEU A O   
2707 C CB  . LEU A 329 ? 0.3508 0.3553 0.5099 0.0275  0.0852  0.1031  345  LEU A CB  
2708 C CG  . LEU A 329 ? 0.3499 0.3638 0.5085 0.0275  0.0774  0.1096  345  LEU A CG  
2709 C CD1 . LEU A 329 ? 0.3517 0.3730 0.5215 0.0301  0.0795  0.1192  345  LEU A CD1 
2710 C CD2 . LEU A 329 ? 0.3520 0.3673 0.5104 0.0264  0.0752  0.1114  345  LEU A CD2 
2711 N N   . THR A 330 ? 0.3557 0.3442 0.5159 0.0269  0.0993  0.0908  346  THR A N   
2712 C CA  . THR A 330 ? 0.3599 0.3412 0.5219 0.0267  0.1068  0.0848  346  THR A CA  
2713 C C   . THR A 330 ? 0.3583 0.3414 0.5256 0.0281  0.1085  0.0874  346  THR A C   
2714 O O   . THR A 330 ? 0.3566 0.3446 0.5342 0.0306  0.1105  0.0962  346  THR A O   
2715 C CB  . THR A 330 ? 0.3656 0.3426 0.5372 0.0276  0.1164  0.0859  346  THR A CB  
2716 O OG1 . THR A 330 ? 0.3750 0.3509 0.5417 0.0263  0.1147  0.0841  346  THR A OG1 
2717 C CG2 . THR A 330 ? 0.3686 0.3377 0.5415 0.0267  0.1243  0.0785  346  THR A CG2 
2718 N N   . ASP A 331 ? 0.3586 0.3383 0.5189 0.0266  0.1073  0.0801  347  ASP A N   
2719 C CA  . ASP A 331 ? 0.3596 0.3399 0.5242 0.0278  0.1094  0.0812  347  ASP A CA  
2720 C C   . ASP A 331 ? 0.3554 0.3441 0.5205 0.0293  0.1032  0.0885  347  ASP A C   
2721 O O   . ASP A 331 ? 0.3564 0.3465 0.5265 0.0307  0.1055  0.0912  347  ASP A O   
2722 C CB  . ASP A 331 ? 0.3637 0.3402 0.5420 0.0295  0.1203  0.0839  347  ASP A CB  
2723 C CG  . ASP A 331 ? 0.3717 0.3393 0.5485 0.0274  0.1269  0.0746  347  ASP A CG  
2724 O OD1 . ASP A 331 ? 0.3707 0.3356 0.5358 0.0247  0.1230  0.0660  347  ASP A OD1 
2725 O OD2 . ASP A 331 ? 0.3810 0.3446 0.5686 0.0285  0.1362  0.0760  347  ASP A OD2 
2726 N N   . ASP A 332 ? 0.3518 0.3460 0.5114 0.0289  0.0956  0.0915  348  ASP A N   
2727 C CA  . ASP A 332 ? 0.3485 0.3510 0.5066 0.0298  0.0889  0.0972  348  ASP A CA  
2728 C C   . ASP A 332 ? 0.3438 0.3456 0.4888 0.0278  0.0818  0.0900  348  ASP A C   
2729 O O   . ASP A 332 ? 0.3411 0.3440 0.4771 0.0261  0.0750  0.0875  348  ASP A O   
2730 C CB  . ASP A 332 ? 0.3508 0.3605 0.5111 0.0303  0.0846  0.1044  348  ASP A CB  
2731 C CG  . ASP A 332 ? 0.3584 0.3778 0.5203 0.0316  0.0795  0.1119  348  ASP A CG  
2732 O OD1 . ASP A 332 ? 0.3717 0.3923 0.5305 0.0318  0.0778  0.1107  348  ASP A OD1 
2733 O OD2 . ASP A 332 ? 0.3824 0.4088 0.5487 0.0323  0.0771  0.1192  348  ASP A OD2 
2734 N N   . VAL A 333 ? 0.3396 0.3391 0.4841 0.0279  0.0838  0.0868  349  VAL A N   
2735 C CA  . VAL A 333 ? 0.3339 0.3326 0.4671 0.0263  0.0780  0.0803  349  VAL A CA  
2736 C C   . VAL A 333 ? 0.3316 0.3351 0.4674 0.0278  0.0773  0.0842  349  VAL A C   
2737 O O   . VAL A 333 ? 0.3306 0.3347 0.4768 0.0298  0.0836  0.0892  349  VAL A O   
2738 C CB  . VAL A 333 ? 0.3361 0.3267 0.4643 0.0244  0.0811  0.0704  349  VAL A CB  
2739 C CG1 . VAL A 333 ? 0.3370 0.3239 0.4600 0.0226  0.0802  0.0661  349  VAL A CG1 
2740 C CG2 . VAL A 333 ? 0.3387 0.3249 0.4768 0.0252  0.0905  0.0700  349  VAL A CG2 
2741 N N   . ARG A 334 ? 0.3260 0.3328 0.4525 0.0270  0.0700  0.0822  350  ARG A N   
2742 C CA  . ARG A 334 ? 0.3239 0.3361 0.4516 0.0284  0.0684  0.0862  350  ARG A CA  
2743 C C   . ARG A 334 ? 0.3192 0.3304 0.4362 0.0270  0.0633  0.0795  350  ARG A C   
2744 O O   . ARG A 334 ? 0.3159 0.3246 0.4233 0.0251  0.0585  0.0735  350  ARG A O   
2745 C CB  . ARG A 334 ? 0.3238 0.3453 0.4529 0.0294  0.0636  0.0946  350  ARG A CB  
2746 C CG  . ARG A 334 ? 0.3325 0.3575 0.4738 0.0315  0.0684  0.1034  350  ARG A CG  
2747 C CD  . ARG A 334 ? 0.3339 0.3686 0.4747 0.0317  0.0623  0.1104  350  ARG A CD  
2748 N NE  . ARG A 334 ? 0.3403 0.3762 0.4879 0.0321  0.0643  0.1150  350  ARG A NE  
2749 C CZ  . ARG A 334 ? 0.3431 0.3873 0.4921 0.0322  0.0599  0.1213  350  ARG A CZ  
2750 N NH1 . ARG A 334 ? 0.3441 0.3962 0.4877 0.0317  0.0531  0.1236  350  ARG A NH1 
2751 N NH2 . ARG A 334 ? 0.3529 0.3976 0.5087 0.0325  0.0623  0.1253  350  ARG A NH2 
2752 N N   . ILE A 335 ? 0.3164 0.3297 0.4354 0.0282  0.0645  0.0811  351  ILE A N   
2753 C CA  . ILE A 335 ? 0.3107 0.3248 0.4204 0.0273  0.0594  0.0764  351  ILE A CA  
2754 C C   . ILE A 335 ? 0.3096 0.3324 0.4195 0.0288  0.0558  0.0832  351  ILE A C   
2755 O O   . ILE A 335 ? 0.3080 0.3353 0.4272 0.0309  0.0595  0.0910  351  ILE A O   
2756 C CB  . ILE A 335 ? 0.3129 0.3214 0.4233 0.0270  0.0639  0.0706  351  ILE A CB  
2757 C CG1 . ILE A 335 ? 0.3092 0.3105 0.4142 0.0247  0.0642  0.0617  351  ILE A CG1 
2758 C CG2 . ILE A 335 ? 0.3103 0.3218 0.4149 0.0271  0.0601  0.0691  351  ILE A CG2 
2759 C CD1 . ILE A 335 ? 0.3062 0.3019 0.4136 0.0239  0.0697  0.0560  351  ILE A CD1 
2760 N N   . LYS A 336 ? 0.3055 0.3309 0.4052 0.0277  0.0486  0.0803  352  LYS A N   
2761 C CA  . LYS A 336 ? 0.3036 0.3370 0.4014 0.0287  0.0450  0.0849  352  LYS A CA  
2762 C C   . LYS A 336 ? 0.3041 0.3353 0.3948 0.0282  0.0432  0.0788  352  LYS A C   
2763 O O   . LYS A 336 ? 0.3026 0.3310 0.3837 0.0265  0.0384  0.0722  352  LYS A O   
2764 C CB  . LYS A 336 ? 0.3029 0.3422 0.3952 0.0277  0.0379  0.0872  352  LYS A CB  
2765 C CG  . LYS A 336 ? 0.3015 0.3497 0.3908 0.0284  0.0337  0.0914  352  LYS A CG  
2766 C CD  . LYS A 336 ? 0.3035 0.3591 0.3910 0.0275  0.0283  0.0958  352  LYS A CD  
2767 C CE  . LYS A 336 ? 0.3040 0.3558 0.3827 0.0248  0.0229  0.0892  352  LYS A CE  
2768 N NZ  . LYS A 336 ? 0.2946 0.3447 0.3626 0.0236  0.0184  0.0825  352  LYS A NZ  
2769 N N   . GLN A 337 ? 0.3036 0.3359 0.3995 0.0298  0.0474  0.0812  353  GLN A N   
2770 C CA  . GLN A 337 ? 0.3065 0.3372 0.3972 0.0296  0.0466  0.0762  353  GLN A CA  
2771 C C   . GLN A 337 ? 0.3097 0.3473 0.4038 0.0316  0.0475  0.0826  353  GLN A C   
2772 O O   . GLN A 337 ? 0.3095 0.3497 0.4137 0.0335  0.0528  0.0896  353  GLN A O   
2773 C CB  . GLN A 337 ? 0.3049 0.3275 0.3987 0.0289  0.0521  0.0702  353  GLN A CB  
2774 C CG  . GLN A 337 ? 0.3061 0.3268 0.3947 0.0285  0.0513  0.0646  353  GLN A CG  
2775 C CD  . GLN A 337 ? 0.3030 0.3161 0.3933 0.0271  0.0555  0.0575  353  GLN A CD  
2776 O OE1 . GLN A 337 ? 0.3072 0.3157 0.3991 0.0260  0.0576  0.0549  353  GLN A OE1 
2777 N NE2 . GLN A 337 ? 0.3057 0.3177 0.3954 0.0271  0.0569  0.0542  353  GLN A NE2 
2778 N N   . CYS A 338 ? 0.3132 0.3540 0.3989 0.0313  0.0427  0.0803  354  CYS A N   
2779 C CA  . CYS A 338 ? 0.3189 0.3662 0.4064 0.0331  0.0434  0.0855  354  CYS A CA  
2780 C C   . CYS A 338 ? 0.3181 0.3606 0.4084 0.0336  0.0482  0.0820  354  CYS A C   
2781 O O   . CYS A 338 ? 0.3172 0.3599 0.4011 0.0333  0.0458  0.0780  354  CYS A O   
2782 C CB  . CYS A 338 ? 0.3209 0.3741 0.3979 0.0324  0.0361  0.0848  354  CYS A CB  
2783 S SG  . CYS A 338 ? 0.3362 0.3955 0.4106 0.0314  0.0305  0.0888  354  CYS A SG  
2784 N N   . THR A 339 ? 0.3188 0.3570 0.4193 0.0342  0.0553  0.0834  355  THR A N   
2785 C CA  . THR A 339 ? 0.3189 0.3508 0.4230 0.0339  0.0604  0.0785  355  THR A CA  
2786 C C   . THR A 339 ? 0.3241 0.3597 0.4304 0.0355  0.0625  0.0814  355  THR A C   
2787 O O   . THR A 339 ? 0.3217 0.3637 0.4336 0.0377  0.0643  0.0900  355  THR A O   
2788 C CB  . THR A 339 ? 0.3198 0.3462 0.4350 0.0340  0.0681  0.0794  355  THR A CB  
2789 O OG1 . THR A 339 ? 0.3156 0.3403 0.4302 0.0332  0.0668  0.0792  355  THR A OG1 
2790 C CG2 . THR A 339 ? 0.3166 0.3353 0.4327 0.0324  0.0720  0.0712  355  THR A CG2 
2791 N N   . ARG A 340 ? 0.3282 0.3600 0.4302 0.0344  0.0622  0.0744  356  ARG A N   
2792 C CA  . ARG A 340 ? 0.3372 0.3711 0.4421 0.0357  0.0650  0.0760  356  ARG A CA  
2793 C C   . ARG A 340 ? 0.3383 0.3650 0.4500 0.0347  0.0714  0.0711  356  ARG A C   
2794 O O   . ARG A 340 ? 0.3382 0.3586 0.4486 0.0326  0.0717  0.0644  356  ARG A O   
2795 C CB  . ARG A 340 ? 0.3391 0.3759 0.4329 0.0353  0.0589  0.0723  356  ARG A CB  
2796 C CG  . ARG A 340 ? 0.3544 0.3992 0.4418 0.0361  0.0531  0.0771  356  ARG A CG  
2797 C CD  . ARG A 340 ? 0.3769 0.4226 0.4521 0.0351  0.0467  0.0713  356  ARG A CD  
2798 N NE  . ARG A 340 ? 0.3943 0.4344 0.4628 0.0329  0.0428  0.0637  356  ARG A NE  
2799 C CZ  . ARG A 340 ? 0.4079 0.4422 0.4733 0.0316  0.0427  0.0559  356  ARG A CZ  
2800 N NH1 . ARG A 340 ? 0.4120 0.4451 0.4804 0.0320  0.0462  0.0543  356  ARG A NH1 
2801 N NH2 . ARG A 340 ? 0.4117 0.4417 0.4711 0.0298  0.0391  0.0501  356  ARG A NH2 
2802 N N   . VAL A 341 ? 0.3409 0.3687 0.4599 0.0361  0.0765  0.0744  357  VAL A N   
2803 C CA  . VAL A 341 ? 0.3432 0.3646 0.4699 0.0350  0.0832  0.0701  357  VAL A CA  
2804 C C   . VAL A 341 ? 0.3434 0.3627 0.4632 0.0333  0.0805  0.0618  357  VAL A C   
2805 O O   . VAL A 341 ? 0.3437 0.3652 0.4653 0.0341  0.0822  0.0630  357  VAL A O   
2806 C CB  . VAL A 341 ? 0.3453 0.3684 0.4850 0.0373  0.0909  0.0779  357  VAL A CB  
2807 C CG1 . VAL A 341 ? 0.3461 0.3618 0.4945 0.0357  0.0983  0.0730  357  VAL A CG1 
2808 C CG2 . VAL A 341 ? 0.3462 0.3721 0.4928 0.0393  0.0932  0.0868  357  VAL A CG2 
2809 N N   . THR A 342 ? 0.3436 0.3591 0.4554 0.0309  0.0763  0.0538  358  THR A N   
2810 C CA  . THR A 342 ? 0.3452 0.3586 0.4506 0.0291  0.0737  0.0457  358  THR A CA  
2811 C C   . THR A 342 ? 0.3482 0.3553 0.4529 0.0263  0.0744  0.0376  358  THR A C   
2812 O O   . THR A 342 ? 0.3462 0.3507 0.4528 0.0257  0.0756  0.0380  358  THR A O   
2813 C CB  . THR A 342 ? 0.3427 0.3601 0.4358 0.0295  0.0655  0.0442  358  THR A CB  
2814 O OG1 . THR A 342 ? 0.3439 0.3601 0.4305 0.0285  0.0609  0.0424  358  THR A OG1 
2815 C CG2 . THR A 342 ? 0.3419 0.3663 0.4342 0.0320  0.0641  0.0517  358  THR A CG2 
2816 N N   . GLN A 343 ? 0.3526 0.3577 0.4544 0.0244  0.0737  0.0303  359  GLN A N   
2817 C CA  . GLN A 343 ? 0.3575 0.3577 0.4572 0.0215  0.0737  0.0222  359  GLN A CA  
2818 C C   . GLN A 343 ? 0.3567 0.3566 0.4468 0.0210  0.0674  0.0201  359  GLN A C   
2819 O O   . GLN A 343 ? 0.3563 0.3527 0.4471 0.0195  0.0687  0.0176  359  GLN A O   
2820 C CB  . GLN A 343 ? 0.3593 0.3591 0.4571 0.0198  0.0732  0.0154  359  GLN A CB  
2821 C CG  . GLN A 343 ? 0.3696 0.3656 0.4649 0.0166  0.0728  0.0069  359  GLN A CG  
2822 C CD  . GLN A 343 ? 0.3842 0.3808 0.4780 0.0148  0.0721  0.0005  359  GLN A CD  
2823 O OE1 . GLN A 343 ? 0.3976 0.3942 0.4839 0.0133  0.0675  -0.0051 359  GLN A OE1 
2824 N NE2 . GLN A 343 ? 0.3833 0.3804 0.4846 0.0151  0.0767  0.0017  359  GLN A NE2 
2825 N N   . ASP A 344 ? 0.3550 0.3587 0.4364 0.0221  0.0610  0.0210  360  ASP A N   
2826 C CA  . ASP A 344 ? 0.3566 0.3601 0.4290 0.0217  0.0549  0.0193  360  ASP A CA  
2827 C C   . ASP A 344 ? 0.3509 0.3540 0.4260 0.0223  0.0559  0.0243  360  ASP A C   
2828 O O   . ASP A 344 ? 0.3483 0.3490 0.4201 0.0211  0.0540  0.0217  360  ASP A O   
2829 C CB  . ASP A 344 ? 0.3609 0.3684 0.4247 0.0230  0.0487  0.0201  360  ASP A CB  
2830 C CG  . ASP A 344 ? 0.3829 0.3895 0.4375 0.0222  0.0426  0.0172  360  ASP A CG  
2831 O OD1 . ASP A 344 ? 0.4165 0.4201 0.4680 0.0205  0.0415  0.0111  360  ASP A OD1 
2832 O OD2 . ASP A 344 ? 0.4052 0.4143 0.4558 0.0233  0.0389  0.0210  360  ASP A OD2 
2833 N N   . GLN A 345 ? 0.3460 0.3521 0.4275 0.0242  0.0588  0.0317  361  GLN A N   
2834 C CA  . GLN A 345 ? 0.3425 0.3492 0.4281 0.0251  0.0602  0.0375  361  GLN A CA  
2835 C C   . GLN A 345 ? 0.3422 0.3437 0.4354 0.0238  0.0662  0.0357  361  GLN A C   
2836 O O   . GLN A 345 ? 0.3398 0.3402 0.4337 0.0237  0.0663  0.0375  361  GLN A O   
2837 C CB  . GLN A 345 ? 0.3435 0.3557 0.4346 0.0276  0.0619  0.0463  361  GLN A CB  
2838 C CG  . GLN A 345 ? 0.3437 0.3618 0.4266 0.0287  0.0553  0.0493  361  GLN A CG  
2839 C CD  . GLN A 345 ? 0.3519 0.3714 0.4307 0.0285  0.0511  0.0513  361  GLN A CD  
2840 O OE1 . GLN A 345 ? 0.3489 0.3713 0.4332 0.0297  0.0528  0.0581  361  GLN A OE1 
2841 N NE2 . GLN A 345 ? 0.3517 0.3692 0.4212 0.0270  0.0456  0.0457  361  GLN A NE2 
2842 N N   . LEU A 346 ? 0.3403 0.3385 0.4390 0.0228  0.0714  0.0320  362  LEU A N   
2843 C CA  . LEU A 346 ? 0.3412 0.3339 0.4464 0.0210  0.0774  0.0286  362  LEU A CA  
2844 C C   . LEU A 346 ? 0.3395 0.3293 0.4370 0.0187  0.0738  0.0219  362  LEU A C   
2845 O O   . LEU A 346 ? 0.3386 0.3252 0.4390 0.0179  0.0767  0.0213  362  LEU A O   
2846 C CB  . LEU A 346 ? 0.3444 0.3345 0.4565 0.0198  0.0832  0.0250  362  LEU A CB  
2847 C CG  . LEU A 346 ? 0.3505 0.3349 0.4713 0.0180  0.0909  0.0218  362  LEU A CG  
2848 C CD1 . LEU A 346 ? 0.3566 0.3405 0.4877 0.0200  0.0967  0.0295  362  LEU A CD1 
2849 C CD2 . LEU A 346 ? 0.3580 0.3404 0.4839 0.0162  0.0953  0.0169  362  LEU A CD2 
2850 N N   . PHE A 347 ? 0.3344 0.3255 0.4222 0.0179  0.0676  0.0172  363  PHE A N   
2851 C CA  . PHE A 347 ? 0.3317 0.3209 0.4113 0.0161  0.0635  0.0117  363  PHE A CA  
2852 C C   . PHE A 347 ? 0.3275 0.3179 0.4032 0.0172  0.0597  0.0159  363  PHE A C   
2853 O O   . PHE A 347 ? 0.3299 0.3176 0.4040 0.0160  0.0598  0.0138  363  PHE A O   
2854 C CB  . PHE A 347 ? 0.3308 0.3215 0.4018 0.0153  0.0580  0.0064  363  PHE A CB  
2855 C CG  . PHE A 347 ? 0.3337 0.3239 0.4080 0.0141  0.0611  0.0019  363  PHE A CG  
2856 C CD1 . PHE A 347 ? 0.3377 0.3247 0.4200 0.0123  0.0679  -0.0008 363  PHE A CD1 
2857 C CD2 . PHE A 347 ? 0.3354 0.3285 0.4051 0.0145  0.0573  0.0001  363  PHE A CD2 
2858 C CE1 . PHE A 347 ? 0.3435 0.3302 0.4292 0.0108  0.0707  -0.0051 363  PHE A CE1 
2859 C CE2 . PHE A 347 ? 0.3328 0.3258 0.4059 0.0133  0.0601  -0.0038 363  PHE A CE2 
2860 C CZ  . PHE A 347 ? 0.3399 0.3299 0.4211 0.0113  0.0666  -0.0065 363  PHE A CZ  
2861 N N   . THR A 348 ? 0.3224 0.3171 0.3968 0.0193  0.0565  0.0218  364  THR A N   
2862 C CA  . THR A 348 ? 0.3200 0.3166 0.3914 0.0201  0.0528  0.0263  364  THR A CA  
2863 C C   . THR A 348 ? 0.3198 0.3148 0.3992 0.0205  0.0579  0.0304  364  THR A C   
2864 O O   . THR A 348 ? 0.3203 0.3143 0.3974 0.0199  0.0561  0.0306  364  THR A O   
2865 C CB  . THR A 348 ? 0.3189 0.3211 0.3879 0.0221  0.0489  0.0318  364  THR A CB  
2866 O OG1 . THR A 348 ? 0.3197 0.3230 0.3809 0.0218  0.0444  0.0276  364  THR A OG1 
2867 C CG2 . THR A 348 ? 0.3198 0.3246 0.3859 0.0226  0.0450  0.0361  364  THR A CG2 
2868 N N   . VAL A 349 ? 0.3173 0.3120 0.4067 0.0214  0.0643  0.0338  365  VAL A N   
2869 C CA  . VAL A 349 ? 0.3165 0.3092 0.4151 0.0218  0.0703  0.0377  365  VAL A CA  
2870 C C   . VAL A 349 ? 0.3172 0.3043 0.4146 0.0195  0.0724  0.0313  365  VAL A C   
2871 O O   . VAL A 349 ? 0.3170 0.3032 0.4154 0.0195  0.0728  0.0333  365  VAL A O   
2872 C CB  . VAL A 349 ? 0.3173 0.3099 0.4275 0.0231  0.0777  0.0417  365  VAL A CB  
2873 C CG1 . VAL A 349 ? 0.3178 0.3067 0.4379 0.0232  0.0849  0.0440  365  VAL A CG1 
2874 C CG2 . VAL A 349 ? 0.3150 0.3140 0.4270 0.0258  0.0760  0.0499  365  VAL A CG2 
2875 N N   . HIS A 350 ? 0.3164 0.3004 0.4115 0.0175  0.0735  0.0237  366  HIS A N   
2876 C CA  . HIS A 350 ? 0.3187 0.2982 0.4115 0.0150  0.0751  0.0169  366  HIS A CA  
2877 C C   . HIS A 350 ? 0.3172 0.2973 0.3999 0.0143  0.0685  0.0149  366  HIS A C   
2878 O O   . HIS A 350 ? 0.3156 0.2930 0.3978 0.0132  0.0700  0.0130  366  HIS A O   
2879 C CB  . HIS A 350 ? 0.3200 0.2973 0.4123 0.0127  0.0772  0.0093  366  HIS A CB  
2880 C CG  . HIS A 350 ? 0.3261 0.3009 0.4295 0.0125  0.0853  0.0097  366  HIS A CG  
2881 N ND1 . HIS A 350 ? 0.3332 0.3033 0.4420 0.0105  0.0919  0.0053  366  HIS A ND1 
2882 C CD2 . HIS A 350 ? 0.3201 0.2965 0.4305 0.0142  0.0883  0.0140  366  HIS A CD2 
2883 C CE1 . HIS A 350 ? 0.3286 0.2970 0.4476 0.0108  0.0987  0.0068  366  HIS A CE1 
2884 N NE2 . HIS A 350 ? 0.3314 0.3037 0.4518 0.0131  0.0967  0.0123  366  HIS A NE2 
2885 N N   . HIS A 351 ? 0.3133 0.2968 0.3883 0.0150  0.0616  0.0153  367  HIS A N   
2886 C CA  . HIS A 351 ? 0.3136 0.2977 0.3795 0.0147  0.0553  0.0142  367  HIS A CA  
2887 C C   . HIS A 351 ? 0.3131 0.2977 0.3816 0.0156  0.0555  0.0198  367  HIS A C   
2888 O O   . HIS A 351 ? 0.3158 0.2983 0.3815 0.0145  0.0549  0.0179  367  HIS A O   
2889 C CB  . HIS A 351 ? 0.3096 0.2973 0.3682 0.0155  0.0486  0.0146  367  HIS A CB  
2890 C CG  . HIS A 351 ? 0.3054 0.2937 0.3558 0.0153  0.0424  0.0142  367  HIS A CG  
2891 N ND1 . HIS A 351 ? 0.3020 0.2890 0.3447 0.0141  0.0388  0.0085  367  HIS A ND1 
2892 C CD2 . HIS A 351 ? 0.3048 0.2948 0.3539 0.0162  0.0393  0.0189  367  HIS A CD2 
2893 C CE1 . HIS A 351 ? 0.3012 0.2887 0.3384 0.0143  0.0340  0.0098  367  HIS A CE1 
2894 N NE2 . HIS A 351 ? 0.3033 0.2925 0.3442 0.0154  0.0342  0.0158  367  HIS A NE2 
2895 N N   . GLU A 352 ? 0.3122 0.3001 0.3863 0.0175  0.0564  0.0270  368  GLU A N   
2896 C CA  . GLU A 352 ? 0.3113 0.3008 0.3885 0.0186  0.0562  0.0332  368  GLU A CA  
2897 C C   . GLU A 352 ? 0.3094 0.2952 0.3943 0.0182  0.0630  0.0337  368  GLU A C   
2898 O O   . GLU A 352 ? 0.3083 0.2939 0.3933 0.0181  0.0625  0.0357  368  GLU A O   
2899 C CB  . GLU A 352 ? 0.3123 0.3074 0.3937 0.0207  0.0554  0.0409  368  GLU A CB  
2900 C CG  . GLU A 352 ? 0.3232 0.3224 0.3962 0.0210  0.0481  0.0410  368  GLU A CG  
2901 C CD  . GLU A 352 ? 0.3330 0.3320 0.3977 0.0199  0.0421  0.0391  368  GLU A CD  
2902 O OE1 . GLU A 352 ? 0.3386 0.3378 0.4057 0.0199  0.0424  0.0422  368  GLU A OE1 
2903 O OE2 . GLU A 352 ? 0.3466 0.3454 0.4031 0.0192  0.0374  0.0346  368  GLU A OE2 
2904 N N   . LEU A 353 ? 0.3072 0.2901 0.3988 0.0179  0.0696  0.0317  369  LEU A N   
2905 C CA  . LEU A 353 ? 0.3075 0.2862 0.4067 0.0173  0.0768  0.0311  369  LEU A CA  
2906 C C   . LEU A 353 ? 0.3066 0.2815 0.3993 0.0149  0.0762  0.0238  369  LEU A C   
2907 O O   . LEU A 353 ? 0.3086 0.2805 0.4051 0.0144  0.0806  0.0237  369  LEU A O   
2908 C CB  . LEU A 353 ? 0.3096 0.2859 0.4178 0.0174  0.0842  0.0304  369  LEU A CB  
2909 C CG  . LEU A 353 ? 0.3078 0.2875 0.4254 0.0201  0.0872  0.0389  369  LEU A CG  
2910 C CD1 . LEU A 353 ? 0.3108 0.2875 0.4366 0.0199  0.0943  0.0371  369  LEU A CD1 
2911 C CD2 . LEU A 353 ? 0.3042 0.2850 0.4293 0.0219  0.0902  0.0464  369  LEU A CD2 
2912 N N   . GLY A 354 ? 0.3022 0.2774 0.3853 0.0135  0.0709  0.0182  370  GLY A N   
2913 C CA  . GLY A 354 ? 0.2986 0.2716 0.3742 0.0115  0.0689  0.0120  370  GLY A CA  
2914 C C   . GLY A 354 ? 0.2971 0.2708 0.3695 0.0120  0.0656  0.0155  370  GLY A C   
2915 O O   . GLY A 354 ? 0.2987 0.2699 0.3701 0.0108  0.0676  0.0130  370  GLY A O   
2916 N N   . HIS A 355 ? 0.2916 0.2692 0.3625 0.0137  0.0606  0.0211  371  HIS A N   
2917 C CA  . HIS A 355 ? 0.2877 0.2667 0.3569 0.0142  0.0575  0.0252  371  HIS A CA  
2918 C C   . HIS A 355 ? 0.2882 0.2661 0.3667 0.0149  0.0635  0.0298  371  HIS A C   
2919 O O   . HIS A 355 ? 0.2883 0.2646 0.3659 0.0144  0.0641  0.0296  371  HIS A O   
2920 C CB  . HIS A 355 ? 0.2846 0.2684 0.3514 0.0155  0.0514  0.0301  371  HIS A CB  
2921 C CG  . HIS A 355 ? 0.2848 0.2695 0.3420 0.0149  0.0450  0.0261  371  HIS A CG  
2922 N ND1 . HIS A 355 ? 0.2824 0.2654 0.3317 0.0137  0.0414  0.0218  371  HIS A ND1 
2923 C CD2 . HIS A 355 ? 0.2743 0.2616 0.3288 0.0156  0.0419  0.0261  371  HIS A CD2 
2924 C CE1 . HIS A 355 ? 0.2823 0.2665 0.3248 0.0137  0.0363  0.0193  371  HIS A CE1 
2925 N NE2 . HIS A 355 ? 0.2795 0.2663 0.3250 0.0147  0.0365  0.0216  371  HIS A NE2 
2926 N N   . ILE A 356 ? 0.2861 0.2651 0.3737 0.0164  0.0681  0.0341  372  ILE A N   
2927 C CA  . ILE A 356 ? 0.2856 0.2637 0.3835 0.0175  0.0745  0.0392  372  ILE A CA  
2928 C C   . ILE A 356 ? 0.2874 0.2598 0.3870 0.0159  0.0805  0.0338  372  ILE A C   
2929 O O   . ILE A 356 ? 0.2899 0.2612 0.3927 0.0161  0.0831  0.0361  372  ILE A O   
2930 C CB  . ILE A 356 ? 0.2859 0.2659 0.3938 0.0195  0.0790  0.0446  372  ILE A CB  
2931 C CG1 . ILE A 356 ? 0.2804 0.2671 0.3868 0.0211  0.0732  0.0507  372  ILE A CG1 
2932 C CG2 . ILE A 356 ? 0.2881 0.2665 0.4077 0.0207  0.0868  0.0494  372  ILE A CG2 
2933 C CD1 . ILE A 356 ? 0.2811 0.2723 0.3891 0.0222  0.0702  0.0579  372  ILE A CD1 
2934 N N   . GLN A 357 ? 0.2870 0.2562 0.3843 0.0142  0.0828  0.0266  373  GLN A N   
2935 C CA  . GLN A 357 ? 0.2919 0.2561 0.3894 0.0121  0.0882  0.0203  373  GLN A CA  
2936 C C   . GLN A 357 ? 0.2924 0.2561 0.3820 0.0110  0.0847  0.0179  373  GLN A C   
2937 O O   . GLN A 357 ? 0.2943 0.2553 0.3868 0.0105  0.0894  0.0174  373  GLN A O   
2938 C CB  . GLN A 357 ? 0.2946 0.2566 0.3895 0.0100  0.0897  0.0124  373  GLN A CB  
2939 C CG  . GLN A 357 ? 0.3034 0.2606 0.3993 0.0076  0.0961  0.0054  373  GLN A CG  
2940 C CD  . GLN A 357 ? 0.3188 0.2725 0.4270 0.0083  0.1055  0.0080  373  GLN A CD  
2941 O OE1 . GLN A 357 ? 0.3275 0.2819 0.4446 0.0102  0.1085  0.0133  373  GLN A OE1 
2942 N NE2 . GLN A 357 ? 0.3135 0.2635 0.4225 0.0068  0.1104  0.0044  373  GLN A NE2 
2943 N N   . TYR A 358 ? 0.2878 0.2542 0.3678 0.0107  0.0767  0.0168  374  TYR A N   
2944 C CA  . TYR A 358 ? 0.2885 0.2549 0.3608 0.0099  0.0727  0.0154  374  TYR A CA  
2945 C C   . TYR A 358 ? 0.2884 0.2555 0.3657 0.0113  0.0738  0.0221  374  TYR A C   
2946 O O   . TYR A 358 ? 0.2886 0.2536 0.3650 0.0105  0.0760  0.0209  374  TYR A O   
2947 C CB  . TYR A 358 ? 0.2850 0.2543 0.3478 0.0098  0.0642  0.0145  374  TYR A CB  
2948 C CG  . TYR A 358 ? 0.2831 0.2515 0.3362 0.0082  0.0608  0.0089  374  TYR A CG  
2949 C CD1 . TYR A 358 ? 0.2851 0.2512 0.3372 0.0071  0.0638  0.0069  374  TYR A CD1 
2950 C CD2 . TYR A 358 ? 0.2781 0.2482 0.3231 0.0078  0.0547  0.0059  374  TYR A CD2 
2951 C CE1 . TYR A 358 ? 0.2857 0.2517 0.3287 0.0057  0.0607  0.0024  374  TYR A CE1 
2952 C CE2 . TYR A 358 ? 0.2802 0.2501 0.3167 0.0065  0.0516  0.0015  374  TYR A CE2 
2953 C CZ  . TYR A 358 ? 0.2880 0.2560 0.3235 0.0055  0.0545  0.0000  374  TYR A CZ  
2954 O OH  . TYR A 358 ? 0.2869 0.2553 0.3140 0.0043  0.0515  -0.0038 374  TYR A OH  
2955 N N   . PHE A 359 ? 0.2870 0.2576 0.3696 0.0133  0.0723  0.0293  375  PHE A N   
2956 C CA  . PHE A 359 ? 0.2893 0.2617 0.3778 0.0146  0.0732  0.0365  375  PHE A CA  
2957 C C   . PHE A 359 ? 0.2954 0.2643 0.3923 0.0148  0.0818  0.0369  375  PHE A C   
2958 O O   . PHE A 359 ? 0.2964 0.2645 0.3941 0.0147  0.0830  0.0384  375  PHE A O   
2959 C CB  . PHE A 359 ? 0.2864 0.2638 0.3808 0.0167  0.0714  0.0442  375  PHE A CB  
2960 C CG  . PHE A 359 ? 0.2851 0.2666 0.3721 0.0167  0.0632  0.0446  375  PHE A CG  
2961 C CD1 . PHE A 359 ? 0.2868 0.2679 0.3636 0.0154  0.0571  0.0406  375  PHE A CD1 
2962 C CD2 . PHE A 359 ? 0.2848 0.2706 0.3755 0.0182  0.0619  0.0493  375  PHE A CD2 
2963 C CE1 . PHE A 359 ? 0.2845 0.2689 0.3550 0.0154  0.0501  0.0409  375  PHE A CE1 
2964 C CE2 . PHE A 359 ? 0.2825 0.2721 0.3663 0.0181  0.0548  0.0495  375  PHE A CE2 
2965 C CZ  . PHE A 359 ? 0.2823 0.2709 0.3561 0.0167  0.0489  0.0450  375  PHE A CZ  
2966 N N   . LEU A 360 ? 0.2995 0.2660 0.4031 0.0149  0.0881  0.0354  376  LEU A N   
2967 C CA  . LEU A 360 ? 0.3068 0.2694 0.4195 0.0151  0.0973  0.0356  376  LEU A CA  
2968 C C   . LEU A 360 ? 0.3120 0.2701 0.4192 0.0127  0.0999  0.0279  376  LEU A C   
2969 O O   . LEU A 360 ? 0.3156 0.2712 0.4273 0.0128  0.1052  0.0287  376  LEU A O   
2970 C CB  . LEU A 360 ? 0.3075 0.2683 0.4285 0.0157  0.1034  0.0355  376  LEU A CB  
2971 C CG  . LEU A 360 ? 0.3073 0.2726 0.4359 0.0184  0.1027  0.0439  376  LEU A CG  
2972 C CD1 . LEU A 360 ? 0.3114 0.2746 0.4463 0.0186  0.1081  0.0423  376  LEU A CD1 
2973 C CD2 . LEU A 360 ? 0.3072 0.2747 0.4456 0.0207  0.1059  0.0528  376  LEU A CD2 
2974 N N   . GLN A 361 ? 0.3123 0.2697 0.4095 0.0106  0.0960  0.0206  377  GLN A N   
2975 C CA  . GLN A 361 ? 0.3193 0.2736 0.4101 0.0082  0.0978  0.0130  377  GLN A CA  
2976 C C   . GLN A 361 ? 0.3199 0.2750 0.4055 0.0081  0.0949  0.0144  377  GLN A C   
2977 O O   . GLN A 361 ? 0.3229 0.2752 0.4074 0.0068  0.0992  0.0108  377  GLN A O   
2978 C CB  . GLN A 361 ? 0.3200 0.2747 0.4018 0.0061  0.0939  0.0056  377  GLN A CB  
2979 C CG  . GLN A 361 ? 0.3336 0.2864 0.4203 0.0052  0.0985  0.0017  377  GLN A CG  
2980 C CD  . GLN A 361 ? 0.3487 0.2968 0.4399 0.0033  0.1074  -0.0037 377  GLN A CD  
2981 O OE1 . GLN A 361 ? 0.3641 0.3097 0.4642 0.0034  0.1138  -0.0039 377  GLN A OE1 
2982 N NE2 . GLN A 361 ? 0.3516 0.2985 0.4367 0.0015  0.1080  -0.0083 377  GLN A NE2 
2983 N N   . TYR A 362 ? 0.3156 0.2745 0.3979 0.0093  0.0877  0.0195  378  TYR A N   
2984 C CA  . TYR A 362 ? 0.3176 0.2773 0.3952 0.0092  0.0846  0.0212  378  TYR A CA  
2985 C C   . TYR A 362 ? 0.3175 0.2791 0.4025 0.0111  0.0852  0.0296  378  TYR A C   
2986 O O   . TYR A 362 ? 0.3172 0.2801 0.3987 0.0111  0.0818  0.0317  378  TYR A O   
2987 C CB  . TYR A 362 ? 0.3124 0.2743 0.3787 0.0085  0.0760  0.0189  378  TYR A CB  
2988 C CG  . TYR A 362 ? 0.3016 0.2672 0.3668 0.0097  0.0693  0.0228  378  TYR A CG  
2989 C CD1 . TYR A 362 ? 0.2944 0.2630 0.3661 0.0114  0.0681  0.0305  378  TYR A CD1 
2990 C CD2 . TYR A 362 ? 0.2980 0.2646 0.3554 0.0089  0.0640  0.0187  378  TYR A CD2 
2991 C CE1 . TYR A 362 ? 0.2839 0.2562 0.3537 0.0122  0.0619  0.0335  378  TYR A CE1 
2992 C CE2 . TYR A 362 ? 0.2863 0.2561 0.3421 0.0099  0.0581  0.0218  378  TYR A CE2 
2993 C CZ  . TYR A 362 ? 0.2877 0.2603 0.3495 0.0114  0.0571  0.0289  378  TYR A CZ  
2994 O OH  . TYR A 362 ? 0.2798 0.2559 0.3395 0.0122  0.0513  0.0314  378  TYR A OH  
2995 N N   . GLN A 363 ? 0.3196 0.2818 0.4153 0.0128  0.0897  0.0346  379  GLN A N   
2996 C CA  . GLN A 363 ? 0.3226 0.2877 0.4261 0.0148  0.0900  0.0432  379  GLN A CA  
2997 C C   . GLN A 363 ? 0.3244 0.2875 0.4309 0.0147  0.0946  0.0443  379  GLN A C   
2998 O O   . GLN A 363 ? 0.3227 0.2887 0.4338 0.0159  0.0936  0.0510  379  GLN A O   
2999 C CB  . GLN A 363 ? 0.3213 0.2883 0.4360 0.0168  0.0938  0.0490  379  GLN A CB  
3000 C CG  . GLN A 363 ? 0.3376 0.2999 0.4611 0.0171  0.1038  0.0473  379  GLN A CG  
3001 C CD  . GLN A 363 ? 0.3487 0.3131 0.4836 0.0194  0.1075  0.0538  379  GLN A CD  
3002 O OE1 . GLN A 363 ? 0.3522 0.3221 0.4881 0.0208  0.1023  0.0598  379  GLN A OE1 
3003 N NE2 . GLN A 363 ? 0.3568 0.3168 0.5003 0.0198  0.1166  0.0526  379  GLN A NE2 
3004 N N   . HIS A 364 ? 0.3300 0.2883 0.4335 0.0131  0.0996  0.0374  380  HIS A N   
3005 C CA  . HIS A 364 ? 0.3367 0.2927 0.4417 0.0128  0.1044  0.0372  380  HIS A CA  
3006 C C   . HIS A 364 ? 0.3367 0.2939 0.4317 0.0116  0.0984  0.0358  380  HIS A C   
3007 O O   . HIS A 364 ? 0.3372 0.2936 0.4332 0.0117  0.1010  0.0373  380  HIS A O   
3008 C CB  . HIS A 364 ? 0.3436 0.2942 0.4493 0.0113  0.1125  0.0300  380  HIS A CB  
3009 C CG  . HIS A 364 ? 0.3499 0.2993 0.4444 0.0088  0.1097  0.0211  380  HIS A CG  
3010 N ND1 . HIS A 364 ? 0.3627 0.3104 0.4493 0.0068  0.1105  0.0153  380  HIS A ND1 
3011 C CD2 . HIS A 364 ? 0.3450 0.2952 0.4349 0.0080  0.1057  0.0175  380  HIS A CD2 
3012 C CE1 . HIS A 364 ? 0.3597 0.3076 0.4374 0.0048  0.1071  0.0085  380  HIS A CE1 
3013 N NE2 . HIS A 364 ? 0.3541 0.3034 0.4339 0.0055  0.1043  0.0097  380  HIS A NE2 
3014 N N   . GLN A 365 ? 0.3335 0.2924 0.4191 0.0107  0.0909  0.0330  381  GLN A N   
3015 C CA  . GLN A 365 ? 0.3340 0.2940 0.4100 0.0097  0.0850  0.0318  381  GLN A CA  
3016 C C   . GLN A 365 ? 0.3314 0.2948 0.4105 0.0109  0.0810  0.0394  381  GLN A C   
3017 O O   . GLN A 365 ? 0.3271 0.2933 0.4136 0.0124  0.0803  0.0453  381  GLN A O   
3018 C CB  . GLN A 365 ? 0.3307 0.2918 0.3971 0.0087  0.0783  0.0273  381  GLN A CB  
3019 C CG  . GLN A 365 ? 0.3381 0.2967 0.3998 0.0071  0.0811  0.0191  381  GLN A CG  
3020 C CD  . GLN A 365 ? 0.3553 0.3124 0.4094 0.0054  0.0824  0.0139  381  GLN A CD  
3021 O OE1 . GLN A 365 ? 0.3646 0.3199 0.4159 0.0037  0.0861  0.0073  381  GLN A OE1 
3022 N NE2 . GLN A 365 ? 0.3499 0.3081 0.4006 0.0056  0.0794  0.0167  381  GLN A NE2 
3023 N N   . PRO A 366 ? 0.3331 0.2967 0.4066 0.0102  0.0782  0.0393  382  PRO A N   
3024 C CA  . PRO A 366 ? 0.3306 0.2977 0.4056 0.0108  0.0730  0.0456  382  PRO A CA  
3025 C C   . PRO A 366 ? 0.3252 0.2953 0.3977 0.0110  0.0658  0.0470  382  PRO A C   
3026 O O   . PRO A 366 ? 0.3260 0.2953 0.3918 0.0103  0.0632  0.0420  382  PRO A O   
3027 C CB  . PRO A 366 ? 0.3326 0.2985 0.3993 0.0097  0.0707  0.0432  382  PRO A CB  
3028 C CG  . PRO A 366 ? 0.3384 0.3007 0.4029 0.0089  0.0771  0.0378  382  PRO A CG  
3029 C CD  . PRO A 366 ? 0.3381 0.2990 0.4042 0.0088  0.0802  0.0337  382  PRO A CD  
3030 N N   . PHE A 367 ? 0.3213 0.2954 0.3992 0.0118  0.0627  0.0535  383  PHE A N   
3031 C CA  . PHE A 367 ? 0.3171 0.2948 0.3934 0.0119  0.0563  0.0552  383  PHE A CA  
3032 C C   . PHE A 367 ? 0.3141 0.2907 0.3795 0.0107  0.0502  0.0499  383  PHE A C   
3033 O O   . PHE A 367 ? 0.3091 0.2863 0.3718 0.0108  0.0478  0.0477  383  PHE A O   
3034 C CB  . PHE A 367 ? 0.3173 0.2999 0.3989 0.0122  0.0528  0.0623  383  PHE A CB  
3035 C CG  . PHE A 367 ? 0.3216 0.3079 0.4001 0.0118  0.0457  0.0634  383  PHE A CG  
3036 C CD1 . PHE A 367 ? 0.3292 0.3186 0.4118 0.0129  0.0457  0.0656  383  PHE A CD1 
3037 C CD2 . PHE A 367 ? 0.3267 0.3135 0.3984 0.0105  0.0392  0.0622  383  PHE A CD2 
3038 C CE1 . PHE A 367 ? 0.3316 0.3248 0.4110 0.0125  0.0394  0.0663  383  PHE A CE1 
3039 C CE2 . PHE A 367 ? 0.3347 0.3247 0.4034 0.0101  0.0330  0.0626  383  PHE A CE2 
3040 C CZ  . PHE A 367 ? 0.3281 0.3216 0.4004 0.0110  0.0330  0.0645  383  PHE A CZ  
3041 N N   . VAL A 368 ? 0.3132 0.2883 0.3726 0.0098  0.0480  0.0483  384  VAL A N   
3042 C CA  . VAL A 368 ? 0.3118 0.2860 0.3614 0.0089  0.0422  0.0441  384  VAL A CA  
3043 C C   . VAL A 368 ? 0.3104 0.2822 0.3545 0.0087  0.0438  0.0376  384  VAL A C   
3044 O O   . VAL A 368 ? 0.3090 0.2809 0.3466 0.0084  0.0392  0.0345  384  VAL A O   
3045 C CB  . VAL A 368 ? 0.3142 0.2874 0.3591 0.0082  0.0398  0.0443  384  VAL A CB  
3046 C CG1 . VAL A 368 ? 0.3144 0.2905 0.3640 0.0080  0.0366  0.0502  384  VAL A CG1 
3047 C CG2 . VAL A 368 ? 0.3228 0.2933 0.3673 0.0080  0.0455  0.0426  384  VAL A CG2 
3048 N N   . TYR A 369 ? 0.3096 0.2795 0.3569 0.0088  0.0503  0.0356  385  TYR A N   
3049 C CA  . TYR A 369 ? 0.3093 0.2772 0.3523 0.0082  0.0524  0.0292  385  TYR A CA  
3050 C C   . TYR A 369 ? 0.3076 0.2762 0.3556 0.0088  0.0541  0.0291  385  TYR A C   
3051 O O   . TYR A 369 ? 0.3099 0.2772 0.3552 0.0082  0.0557  0.0240  385  TYR A O   
3052 C CB  . TYR A 369 ? 0.3142 0.2794 0.3570 0.0074  0.0588  0.0258  385  TYR A CB  
3053 C CG  . TYR A 369 ? 0.3135 0.2781 0.3497 0.0066  0.0574  0.0246  385  TYR A CG  
3054 C CD1 . TYR A 369 ? 0.3110 0.2768 0.3401 0.0065  0.0507  0.0246  385  TYR A CD1 
3055 C CD2 . TYR A 369 ? 0.3197 0.2825 0.3567 0.0061  0.0632  0.0235  385  TYR A CD2 
3056 C CE1 . TYR A 369 ? 0.3150 0.2804 0.3384 0.0060  0.0497  0.0240  385  TYR A CE1 
3057 C CE2 . TYR A 369 ? 0.3225 0.2852 0.3533 0.0055  0.0621  0.0227  385  TYR A CE2 
3058 C CZ  . TYR A 369 ? 0.3189 0.2830 0.3431 0.0055  0.0553  0.0232  385  TYR A CZ  
3059 O OH  . TYR A 369 ? 0.3218 0.2859 0.3403 0.0051  0.0545  0.0229  385  TYR A OH  
3060 N N   . ARG A 370 ? 0.3041 0.2752 0.3594 0.0100  0.0538  0.0350  386  ARG A N   
3061 C CA  . ARG A 370 ? 0.3031 0.2753 0.3639 0.0109  0.0556  0.0362  386  ARG A CA  
3062 C C   . ARG A 370 ? 0.2987 0.2730 0.3543 0.0109  0.0494  0.0350  386  ARG A C   
3063 O O   . ARG A 370 ? 0.2978 0.2755 0.3566 0.0118  0.0465  0.0395  386  ARG A O   
3064 C CB  . ARG A 370 ? 0.3007 0.2754 0.3721 0.0123  0.0586  0.0435  386  ARG A CB  
3065 C CG  . ARG A 370 ? 0.3088 0.2808 0.3868 0.0125  0.0664  0.0442  386  ARG A CG  
3066 C CD  . ARG A 370 ? 0.3113 0.2864 0.4003 0.0142  0.0690  0.0522  386  ARG A CD  
3067 N NE  . ARG A 370 ? 0.3130 0.2897 0.4088 0.0155  0.0715  0.0547  386  ARG A NE  
3068 C CZ  . ARG A 370 ? 0.3178 0.2969 0.4244 0.0172  0.0754  0.0615  386  ARG A CZ  
3069 N NH1 . ARG A 370 ? 0.3162 0.2965 0.4283 0.0178  0.0773  0.0663  386  ARG A NH1 
3070 N NH2 . ARG A 370 ? 0.3116 0.2922 0.4240 0.0185  0.0775  0.0638  386  ARG A NH2 
3071 N N   . THR A 371 ? 0.3011 0.2737 0.3486 0.0099  0.0473  0.0290  387  THR A N   
3072 C CA  . THR A 371 ? 0.2995 0.2735 0.3417 0.0100  0.0420  0.0268  387  THR A CA  
3073 C C   . THR A 371 ? 0.2988 0.2707 0.3349 0.0089  0.0428  0.0198  387  THR A C   
3074 O O   . THR A 371 ? 0.3007 0.2704 0.3362 0.0080  0.0469  0.0168  387  THR A O   
3075 C CB  . THR A 371 ? 0.2986 0.2744 0.3359 0.0099  0.0350  0.0289  387  THR A CB  
3076 O OG1 . THR A 371 ? 0.3064 0.2836 0.3394 0.0101  0.0306  0.0270  387  THR A OG1 
3077 C CG2 . THR A 371 ? 0.3053 0.2792 0.3364 0.0090  0.0334  0.0266  387  THR A CG2 
3078 N N   . GLY A 372 ? 0.2951 0.2680 0.3269 0.0090  0.0391  0.0172  388  GLY A N   
3079 C CA  . GLY A 372 ? 0.2955 0.2673 0.3220 0.0079  0.0396  0.0107  388  GLY A CA  
3080 C C   . GLY A 372 ? 0.2969 0.2680 0.3158 0.0071  0.0373  0.0078  388  GLY A C   
3081 O O   . GLY A 372 ? 0.2949 0.2662 0.3113 0.0074  0.0338  0.0106  388  GLY A O   
3082 N N   . ALA A 373 ? 0.2985 0.2690 0.3140 0.0058  0.0394  0.0022  389  ALA A N   
3083 C CA  . ALA A 373 ? 0.3013 0.2721 0.3091 0.0050  0.0373  -0.0006 389  ALA A CA  
3084 C C   . ALA A 373 ? 0.2968 0.2690 0.2989 0.0059  0.0304  0.0003  389  ALA A C   
3085 O O   . ALA A 373 ? 0.2989 0.2710 0.2968 0.0060  0.0278  0.0016  389  ALA A O   
3086 C CB  . ALA A 373 ? 0.3044 0.2756 0.3094 0.0034  0.0401  -0.0070 389  ALA A CB  
3087 N N   . ASN A 374 ? 0.2926 0.2659 0.2948 0.0065  0.0279  -0.0002 390  ASN A N   
3088 C CA  . ASN A 374 ? 0.2889 0.2630 0.2881 0.0076  0.0220  0.0018  390  ASN A CA  
3089 C C   . ASN A 374 ? 0.2845 0.2596 0.2878 0.0083  0.0216  0.0030  390  ASN A C   
3090 O O   . ASN A 374 ? 0.2867 0.2618 0.2944 0.0080  0.0257  0.0018  390  ASN A O   
3091 C CB  . ASN A 374 ? 0.2914 0.2665 0.2831 0.0076  0.0181  -0.0012 390  ASN A CB  
3092 C CG  . ASN A 374 ? 0.2934 0.2701 0.2834 0.0073  0.0181  -0.0057 390  ASN A CG  
3093 O OD1 . ASN A 374 ? 0.3016 0.2789 0.2949 0.0077  0.0184  -0.0057 390  ASN A OD1 
3094 N ND2 . ASN A 374 ? 0.2981 0.2763 0.2831 0.0066  0.0175  -0.0093 390  ASN A ND2 
3095 N N   . PRO A 375 ? 0.2817 0.2576 0.2837 0.0093  0.0171  0.0055  391  PRO A N   
3096 C CA  . PRO A 375 ? 0.2759 0.2532 0.2817 0.0100  0.0169  0.0072  391  PRO A CA  
3097 C C   . PRO A 375 ? 0.2741 0.2522 0.2801 0.0100  0.0186  0.0035  391  PRO A C   
3098 O O   . PRO A 375 ? 0.2718 0.2508 0.2830 0.0104  0.0210  0.0049  391  PRO A O   
3099 C CB  . PRO A 375 ? 0.2745 0.2526 0.2767 0.0107  0.0113  0.0089  391  PRO A CB  
3100 C CG  . PRO A 375 ? 0.2803 0.2570 0.2804 0.0103  0.0098  0.0104  391  PRO A CG  
3101 C CD  . PRO A 375 ? 0.2800 0.2554 0.2778 0.0096  0.0124  0.0073  391  PRO A CD  
3102 N N   . GLY A 376 ? 0.2726 0.2508 0.2736 0.0095  0.0174  -0.0009 392  GLY A N   
3103 C CA  . GLY A 376 ? 0.2705 0.2497 0.2716 0.0092  0.0188  -0.0048 392  GLY A CA  
3104 C C   . GLY A 376 ? 0.2734 0.2518 0.2797 0.0080  0.0249  -0.0067 392  GLY A C   
3105 O O   . GLY A 376 ? 0.2685 0.2476 0.2782 0.0079  0.0271  -0.0082 392  GLY A O   
3106 N N   . PHE A 377 ? 0.2766 0.2535 0.2837 0.0071  0.0278  -0.0067 393  PHE A N   
3107 C CA  . PHE A 377 ? 0.2806 0.2563 0.2930 0.0059  0.0342  -0.0086 393  PHE A CA  
3108 C C   . PHE A 377 ? 0.2807 0.2559 0.3014 0.0068  0.0376  -0.0047 393  PHE A C   
3109 O O   . PHE A 377 ? 0.2848 0.2595 0.3102 0.0063  0.0419  -0.0067 393  PHE A O   
3110 C CB  . PHE A 377 ? 0.2826 0.2567 0.2943 0.0050  0.0367  -0.0086 393  PHE A CB  
3111 C CG  . PHE A 377 ? 0.2858 0.2607 0.2910 0.0035  0.0362  -0.0137 393  PHE A CG  
3112 C CD1 . PHE A 377 ? 0.2855 0.2623 0.2835 0.0039  0.0306  -0.0145 393  PHE A CD1 
3113 C CD2 . PHE A 377 ? 0.2908 0.2648 0.2972 0.0016  0.0415  -0.0177 393  PHE A CD2 
3114 C CE1 . PHE A 377 ? 0.2917 0.2703 0.2839 0.0026  0.0299  -0.0186 393  PHE A CE1 
3115 C CE2 . PHE A 377 ? 0.2918 0.2675 0.2918 0.0000  0.0408  -0.0223 393  PHE A CE2 
3116 C CZ  . PHE A 377 ? 0.2941 0.2724 0.2870 0.0006  0.0349  -0.0225 393  PHE A CZ  
3117 N N   . HIS A 378 ? 0.2816 0.2571 0.3040 0.0082  0.0356  0.0008  394  HIS A N   
3118 C CA  . HIS A 378 ? 0.2834 0.2596 0.3136 0.0093  0.0382  0.0056  394  HIS A CA  
3119 C C   . HIS A 378 ? 0.2827 0.2605 0.3143 0.0100  0.0377  0.0051  394  HIS A C   
3120 O O   . HIS A 378 ? 0.2819 0.2596 0.3205 0.0103  0.0422  0.0065  394  HIS A O   
3121 C CB  . HIS A 378 ? 0.2806 0.2581 0.3114 0.0104  0.0350  0.0115  394  HIS A CB  
3122 C CG  . HIS A 378 ? 0.2873 0.2645 0.3259 0.0109  0.0394  0.0162  394  HIS A CG  
3123 N ND1 . HIS A 378 ? 0.2859 0.2639 0.3326 0.0118  0.0437  0.0192  394  HIS A ND1 
3124 C CD2 . HIS A 378 ? 0.2896 0.2660 0.3298 0.0107  0.0405  0.0188  394  HIS A CD2 
3125 C CE1 . HIS A 378 ? 0.2940 0.2717 0.3470 0.0122  0.0472  0.0235  394  HIS A CE1 
3126 N NE2 . HIS A 378 ? 0.2925 0.2692 0.3417 0.0116  0.0454  0.0232  394  HIS A NE2 
3127 N N   . GLU A 379 ? 0.2818 0.2611 0.3071 0.0102  0.0324  0.0034  395  GLU A N   
3128 C CA  . GLU A 379 ? 0.2811 0.2622 0.3069 0.0109  0.0315  0.0028  395  GLU A CA  
3129 C C   . GLU A 379 ? 0.2831 0.2635 0.3104 0.0098  0.0351  -0.0023 395  GLU A C   
3130 O O   . GLU A 379 ? 0.2841 0.2655 0.3150 0.0102  0.0367  -0.0022 395  GLU A O   
3131 C CB  . GLU A 379 ? 0.2784 0.2611 0.2972 0.0116  0.0250  0.0023  395  GLU A CB  
3132 C CG  . GLU A 379 ? 0.2805 0.2642 0.2979 0.0124  0.0212  0.0069  395  GLU A CG  
3133 C CD  . GLU A 379 ? 0.2814 0.2672 0.3050 0.0134  0.0228  0.0124  395  GLU A CD  
3134 O OE1 . GLU A 379 ? 0.2845 0.2717 0.3118 0.0140  0.0251  0.0129  395  GLU A OE1 
3135 O OE2 . GLU A 379 ? 0.2832 0.2697 0.3082 0.0136  0.0218  0.0165  395  GLU A OE2 
3136 N N   . ALA A 380 ? 0.2846 0.2636 0.3093 0.0081  0.0364  -0.0068 396  ALA A N   
3137 C CA  . ALA A 380 ? 0.2875 0.2663 0.3126 0.0065  0.0392  -0.0126 396  ALA A CA  
3138 C C   . ALA A 380 ? 0.2910 0.2678 0.3244 0.0055  0.0466  -0.0133 396  ALA A C   
3139 O O   . ALA A 380 ? 0.2926 0.2697 0.3286 0.0045  0.0491  -0.0169 396  ALA A O   
3140 C CB  . ALA A 380 ? 0.2873 0.2663 0.3057 0.0049  0.0375  -0.0174 396  ALA A CB  
3141 N N   . VAL A 381 ? 0.2938 0.2686 0.3319 0.0058  0.0501  -0.0100 397  VAL A N   
3142 C CA  . VAL A 381 ? 0.2999 0.2722 0.3462 0.0049  0.0578  -0.0109 397  VAL A CA  
3143 C C   . VAL A 381 ? 0.3000 0.2725 0.3533 0.0054  0.0611  -0.0100 397  VAL A C   
3144 O O   . VAL A 381 ? 0.3029 0.2741 0.3592 0.0037  0.0653  -0.0148 397  VAL A O   
3145 C CB  . VAL A 381 ? 0.3002 0.2706 0.3515 0.0058  0.0611  -0.0060 397  VAL A CB  
3146 C CG1 . VAL A 381 ? 0.3039 0.2710 0.3637 0.0047  0.0696  -0.0076 397  VAL A CG1 
3147 C CG2 . VAL A 381 ? 0.2997 0.2698 0.3445 0.0053  0.0581  -0.0065 397  VAL A CG2 
3148 N N   . GLY A 382 ? 0.2997 0.2741 0.3557 0.0078  0.0592  -0.0038 398  GLY A N   
3149 C CA  . GLY A 382 ? 0.3018 0.2769 0.3647 0.0087  0.0623  -0.0016 398  GLY A CA  
3150 C C   . GLY A 382 ? 0.3038 0.2804 0.3636 0.0079  0.0603  -0.0062 398  GLY A C   
3151 O O   . GLY A 382 ? 0.3061 0.2821 0.3720 0.0075  0.0647  -0.0074 398  GLY A O   
3152 N N   . ASP A 383 ? 0.3056 0.2841 0.3563 0.0077  0.0539  -0.0088 399  ASP A N   
3153 C CA  . ASP A 383 ? 0.3077 0.2881 0.3548 0.0070  0.0514  -0.0130 399  ASP A CA  
3154 C C   . ASP A 383 ? 0.3115 0.2907 0.3596 0.0042  0.0550  -0.0201 399  ASP A C   
3155 O O   . ASP A 383 ? 0.3069 0.2875 0.3561 0.0034  0.0554  -0.0232 399  ASP A O   
3156 C CB  . ASP A 383 ? 0.3068 0.2894 0.3444 0.0077  0.0439  -0.0136 399  ASP A CB  
3157 C CG  . ASP A 383 ? 0.3109 0.2956 0.3474 0.0101  0.0401  -0.0080 399  ASP A CG  
3158 O OD1 . ASP A 383 ? 0.3199 0.3047 0.3622 0.0114  0.0426  -0.0028 399  ASP A OD1 
3159 O OD2 . ASP A 383 ? 0.3025 0.2890 0.3324 0.0107  0.0347  -0.0089 399  ASP A OD2 
3160 N N   . VAL A 384 ? 0.3170 0.2940 0.3645 0.0025  0.0575  -0.0229 400  VAL A N   
3161 C CA  . VAL A 384 ? 0.3234 0.2995 0.3722 -0.0005 0.0615  -0.0300 400  VAL A CA  
3162 C C   . VAL A 384 ? 0.3276 0.3016 0.3866 -0.0012 0.0685  -0.0302 400  VAL A C   
3163 O O   . VAL A 384 ? 0.3301 0.3047 0.3908 -0.0032 0.0704  -0.0354 400  VAL A O   
3164 C CB  . VAL A 384 ? 0.3270 0.3013 0.3731 -0.0023 0.0633  -0.0327 400  VAL A CB  
3165 C CG1 . VAL A 384 ? 0.3306 0.3043 0.3776 -0.0058 0.0675  -0.0406 400  VAL A CG1 
3166 C CG2 . VAL A 384 ? 0.3231 0.2995 0.3594 -0.0016 0.0565  -0.0323 400  VAL A CG2 
3167 N N   . LEU A 385 ? 0.3305 0.3022 0.3966 0.0006  0.0724  -0.0244 401  LEU A N   
3168 C CA  . LEU A 385 ? 0.3370 0.3066 0.4139 0.0005  0.0795  -0.0233 401  LEU A CA  
3169 C C   . LEU A 385 ? 0.3350 0.3073 0.4136 0.0019  0.0777  -0.0213 401  LEU A C   
3170 O O   . LEU A 385 ? 0.3396 0.3111 0.4244 0.0007  0.0822  -0.0238 401  LEU A O   
3171 C CB  . LEU A 385 ? 0.3370 0.3041 0.4215 0.0025  0.0841  -0.0167 401  LEU A CB  
3172 C CG  . LEU A 385 ? 0.3496 0.3137 0.4346 0.0019  0.0870  -0.0167 401  LEU A CG  
3173 C CD1 . LEU A 385 ? 0.3476 0.3084 0.4447 0.0028  0.0953  -0.0128 401  LEU A CD1 
3174 C CD2 . LEU A 385 ? 0.3536 0.3162 0.4333 -0.0014 0.0879  -0.0252 401  LEU A CD2 
3175 N N   . SER A 386 ? 0.3321 0.3076 0.4052 0.0043  0.0712  -0.0169 402  SER A N   
3176 C CA  . SER A 386 ? 0.3300 0.3085 0.4035 0.0058  0.0690  -0.0147 402  SER A CA  
3177 C C   . SER A 386 ? 0.3295 0.3095 0.4000 0.0037  0.0675  -0.0215 402  SER A C   
3178 O O   . SER A 386 ? 0.3283 0.3095 0.4031 0.0040  0.0692  -0.0212 402  SER A O   
3179 C CB  . SER A 386 ? 0.3254 0.3070 0.3925 0.0083  0.0622  -0.0096 402  SER A CB  
3180 O OG  . SER A 386 ? 0.3333 0.3149 0.4051 0.0105  0.0638  -0.0023 402  SER A OG  
3181 N N   . LEU A 387 ? 0.3296 0.3101 0.3930 0.0016  0.0645  -0.0271 403  LEU A N   
3182 C CA  . LEU A 387 ? 0.3307 0.3134 0.3915 -0.0006 0.0632  -0.0338 403  LEU A CA  
3183 C C   . LEU A 387 ? 0.3361 0.3168 0.4053 -0.0032 0.0703  -0.0380 403  LEU A C   
3184 O O   . LEU A 387 ? 0.3351 0.3177 0.4066 -0.0040 0.0706  -0.0405 403  LEU A O   
3185 C CB  . LEU A 387 ? 0.3293 0.3133 0.3812 -0.0023 0.0590  -0.0385 403  LEU A CB  
3186 C CG  . LEU A 387 ? 0.3248 0.3117 0.3675 -0.0004 0.0512  -0.0367 403  LEU A CG  
3187 C CD1 . LEU A 387 ? 0.3222 0.3098 0.3577 -0.0020 0.0485  -0.0404 403  LEU A CD1 
3188 C CD2 . LEU A 387 ? 0.3160 0.3066 0.3569 0.0002  0.0477  -0.0377 403  LEU A CD2 
3189 N N   . SER A 388 ? 0.3412 0.3180 0.4156 -0.0045 0.0761  -0.0388 404  SER A N   
3190 C CA  . SER A 388 ? 0.3483 0.3224 0.4317 -0.0070 0.0837  -0.0429 404  SER A CA  
3191 C C   . SER A 388 ? 0.3444 0.3172 0.4376 -0.0049 0.0882  -0.0373 404  SER A C   
3192 O O   . SER A 388 ? 0.3469 0.3192 0.4465 -0.0066 0.0923  -0.0402 404  SER A O   
3193 C CB  . SER A 388 ? 0.3545 0.3244 0.4403 -0.0091 0.0891  -0.0458 404  SER A CB  
3194 O OG  . SER A 388 ? 0.3754 0.3428 0.4640 -0.0063 0.0907  -0.0389 404  SER A OG  
3195 N N   . VAL A 389 ? 0.3389 0.3116 0.4334 -0.0014 0.0873  -0.0291 405  VAL A N   
3196 C CA  . VAL A 389 ? 0.3337 0.3064 0.4366 0.0010  0.0907  -0.0226 405  VAL A CA  
3197 C C   . VAL A 389 ? 0.3292 0.3057 0.4305 0.0015  0.0875  -0.0231 405  VAL A C   
3198 O O   . VAL A 389 ? 0.3294 0.3055 0.4390 0.0018  0.0921  -0.0216 405  VAL A O   
3199 C CB  . VAL A 389 ? 0.3309 0.3045 0.4340 0.0047  0.0890  -0.0135 405  VAL A CB  
3200 C CG1 . VAL A 389 ? 0.3293 0.3045 0.4397 0.0075  0.0913  -0.0064 405  VAL A CG1 
3201 C CG2 . VAL A 389 ? 0.3320 0.3017 0.4395 0.0046  0.0936  -0.0120 405  VAL A CG2 
3202 N N   . SER A 390 ? 0.3226 0.3026 0.4138 0.0015  0.0800  -0.0253 406  SER A N   
3203 C CA  . SER A 390 ? 0.3175 0.3014 0.4061 0.0022  0.0763  -0.0257 406  SER A CA  
3204 C C   . SER A 390 ? 0.3202 0.3045 0.4120 -0.0008 0.0788  -0.0326 406  SER A C   
3205 O O   . SER A 390 ? 0.3176 0.3047 0.4105 -0.0002 0.0778  -0.0323 406  SER A O   
3206 C CB  . SER A 390 ? 0.3138 0.3009 0.3909 0.0033  0.0678  -0.0259 406  SER A CB  
3207 O OG  . SER A 390 ? 0.3069 0.2944 0.3783 0.0006  0.0655  -0.0330 406  SER A OG  
3208 N N   . THR A 391 ? 0.3244 0.3064 0.4175 -0.0043 0.0820  -0.0390 407  THR A N   
3209 C CA  . THR A 391 ? 0.3266 0.3095 0.4224 -0.0079 0.0842  -0.0465 407  THR A CA  
3210 C C   . THR A 391 ? 0.3301 0.3113 0.4376 -0.0082 0.0911  -0.0452 407  THR A C   
3211 O O   . THR A 391 ? 0.3300 0.3075 0.4451 -0.0067 0.0966  -0.0403 407  THR A O   
3212 C CB  . THR A 391 ? 0.3314 0.3124 0.4263 -0.0120 0.0868  -0.0540 407  THR A CB  
3213 O OG1 . THR A 391 ? 0.3272 0.3028 0.4301 -0.0123 0.0942  -0.0525 407  THR A OG1 
3214 C CG2 . THR A 391 ? 0.3294 0.3125 0.4130 -0.0119 0.0803  -0.0553 407  THR A CG2 
3215 N N   . PRO A 392 ? 0.3327 0.3167 0.4420 -0.0100 0.0909  -0.0492 408  PRO A N   
3216 C CA  . PRO A 392 ? 0.3357 0.3178 0.4566 -0.0110 0.0980  -0.0493 408  PRO A CA  
3217 C C   . PRO A 392 ? 0.3430 0.3196 0.4722 -0.0138 0.1062  -0.0526 408  PRO A C   
3218 O O   . PRO A 392 ? 0.3437 0.3167 0.4834 -0.0128 0.1130  -0.0488 408  PRO A O   
3219 C CB  . PRO A 392 ? 0.3359 0.3224 0.4554 -0.0137 0.0956  -0.0556 408  PRO A CB  
3220 C CG  . PRO A 392 ? 0.3313 0.3226 0.4393 -0.0116 0.0866  -0.0544 408  PRO A CG  
3221 C CD  . PRO A 392 ? 0.3301 0.3195 0.4311 -0.0107 0.0839  -0.0529 408  PRO A CD  
3222 N N   . LYS A 393 ? 0.3474 0.3232 0.4719 -0.0171 0.1056  -0.0595 409  LYS A N   
3223 C CA  . LYS A 393 ? 0.3569 0.3273 0.4880 -0.0200 0.1132  -0.0636 409  LYS A CA  
3224 C C   . LYS A 393 ? 0.3566 0.3220 0.4942 -0.0168 0.1182  -0.0560 409  LYS A C   
3225 O O   . LYS A 393 ? 0.3569 0.3178 0.5060 -0.0175 0.1266  -0.0554 409  LYS A O   
3226 C CB  . LYS A 393 ? 0.3590 0.3303 0.4817 -0.0234 0.1105  -0.0710 409  LYS A CB  
3227 C CG  . LYS A 393 ? 0.3767 0.3425 0.5054 -0.0268 0.1185  -0.0762 409  LYS A CG  
3228 C CD  . LYS A 393 ? 0.3911 0.3588 0.5106 -0.0303 0.1155  -0.0839 409  LYS A CD  
3229 C CE  . LYS A 393 ? 0.4009 0.3734 0.5182 -0.0350 0.1138  -0.0929 409  LYS A CE  
3230 N NZ  . LYS A 393 ? 0.4001 0.3767 0.5061 -0.0375 0.1086  -0.0987 409  LYS A NZ  
3231 N N   . HIS A 394 ? 0.3535 0.3200 0.4843 -0.0133 0.1133  -0.0500 410  HIS A N   
3232 C CA  . HIS A 394 ? 0.3553 0.3182 0.4918 -0.0102 0.1173  -0.0423 410  HIS A CA  
3233 C C   . HIS A 394 ? 0.3560 0.3193 0.5007 -0.0067 0.1200  -0.0340 410  HIS A C   
3234 O O   . HIS A 394 ? 0.3587 0.3181 0.5139 -0.0055 0.1273  -0.0297 410  HIS A O   
3235 C CB  . HIS A 394 ? 0.3529 0.3172 0.4798 -0.0077 0.1111  -0.0384 410  HIS A CB  
3236 C CG  . HIS A 394 ? 0.3531 0.3143 0.4858 -0.0049 0.1151  -0.0311 410  HIS A CG  
3237 N ND1 . HIS A 394 ? 0.3613 0.3176 0.4984 -0.0065 0.1212  -0.0334 410  HIS A ND1 
3238 C CD2 . HIS A 394 ? 0.3541 0.3166 0.4891 -0.0007 0.1142  -0.0215 410  HIS A CD2 
3239 C CE1 . HIS A 394 ? 0.3628 0.3176 0.5053 -0.0031 0.1238  -0.0252 410  HIS A CE1 
3240 N NE2 . HIS A 394 ? 0.3594 0.3182 0.5006 0.0002  0.1195  -0.0178 410  HIS A NE2 
3241 N N   . LEU A 395 ? 0.3541 0.3222 0.4941 -0.0049 0.1142  -0.0315 411  LEU A N   
3242 C CA  . LEU A 395 ? 0.3563 0.3259 0.5024 -0.0013 0.1158  -0.0231 411  LEU A CA  
3243 C C   . LEU A 395 ? 0.3640 0.3308 0.5231 -0.0027 0.1242  -0.0240 411  LEU A C   
3244 O O   . LEU A 395 ? 0.3625 0.3287 0.5302 0.0001  0.1287  -0.0164 411  LEU A O   
3245 C CB  . LEU A 395 ? 0.3489 0.3244 0.4864 0.0006  0.1077  -0.0210 411  LEU A CB  
3246 C CG  . LEU A 395 ? 0.3445 0.3225 0.4709 0.0029  0.1000  -0.0178 411  LEU A CG  
3247 C CD1 . LEU A 395 ? 0.3390 0.3221 0.4561 0.0038  0.0923  -0.0185 411  LEU A CD1 
3248 C CD2 . LEU A 395 ? 0.3345 0.3125 0.4641 0.0067  0.1013  -0.0081 411  LEU A CD2 
3249 N N   . GLU A 396 ? 0.3737 0.3392 0.5343 -0.0071 0.1264  -0.0332 412  GLU A N   
3250 C CA  . GLU A 396 ? 0.3880 0.3499 0.5614 -0.0093 0.1352  -0.0355 412  GLU A CA  
3251 C C   . GLU A 396 ? 0.3931 0.3485 0.5763 -0.0097 0.1439  -0.0345 412  GLU A C   
3252 O O   . GLU A 396 ? 0.3978 0.3500 0.5934 -0.0089 0.1517  -0.0307 412  GLU A O   
3253 C CB  . GLU A 396 ? 0.3932 0.3562 0.5651 -0.0144 0.1347  -0.0462 412  GLU A CB  
3254 C CG  . GLU A 396 ? 0.4098 0.3786 0.5779 -0.0140 0.1293  -0.0465 412  GLU A CG  
3255 C CD  . GLU A 396 ? 0.4406 0.4102 0.6113 -0.0192 0.1310  -0.0561 412  GLU A CD  
3256 O OE1 . GLU A 396 ? 0.4607 0.4319 0.6243 -0.0227 0.1276  -0.0640 412  GLU A OE1 
3257 O OE2 . GLU A 396 ? 0.4507 0.4200 0.6309 -0.0197 0.1357  -0.0555 412  GLU A OE2 
3258 N N   . LYS A 397 ? 0.3972 0.3505 0.5749 -0.0109 0.1429  -0.0377 413  LYS A N   
3259 C CA  . LYS A 397 ? 0.4030 0.3501 0.5892 -0.0112 0.1510  -0.0369 413  LYS A CA  
3260 C C   . LYS A 397 ? 0.4012 0.3474 0.5949 -0.0060 0.1542  -0.0250 413  LYS A C   
3261 O O   . LYS A 397 ? 0.4033 0.3445 0.6095 -0.0056 0.1633  -0.0225 413  LYS A O   
3262 C CB  . LYS A 397 ? 0.4065 0.3525 0.5839 -0.0128 0.1482  -0.0417 413  LYS A CB  
3263 C CG  . LYS A 397 ? 0.4178 0.3638 0.5900 -0.0184 0.1474  -0.0538 413  LYS A CG  
3264 C CD  . LYS A 397 ? 0.4257 0.3706 0.5895 -0.0196 0.1452  -0.0573 413  LYS A CD  
3265 C CE  . LYS A 397 ? 0.4356 0.3828 0.5914 -0.0248 0.1422  -0.0686 413  LYS A CE  
3266 N NZ  . LYS A 397 ? 0.4390 0.3865 0.5853 -0.0256 0.1390  -0.0714 413  LYS A NZ  
3267 N N   . ILE A 398 ? 0.3931 0.3444 0.5792 -0.0022 0.1468  -0.0178 414  ILE A N   
3268 C CA  . ILE A 398 ? 0.3913 0.3436 0.5831 0.0026  0.1485  -0.0062 414  ILE A CA  
3269 C C   . ILE A 398 ? 0.3919 0.3472 0.5897 0.0052  0.1498  0.0002  414  ILE A C   
3270 O O   . ILE A 398 ? 0.3917 0.3497 0.5927 0.0094  0.1498  0.0104  414  ILE A O   
3271 C CB  . ILE A 398 ? 0.3874 0.3436 0.5683 0.0053  0.1404  -0.0014 414  ILE A CB  
3272 C CG1 . ILE A 398 ? 0.3783 0.3403 0.5463 0.0053  0.1304  -0.0035 414  ILE A CG1 
3273 C CG2 . ILE A 398 ? 0.3861 0.3387 0.5639 0.0035  0.1412  -0.0058 414  ILE A CG2 
3274 C CD1 . ILE A 398 ? 0.3764 0.3423 0.5343 0.0080  0.1226  0.0013  414  ILE A CD1 
3275 N N   . GLY A 399 ? 0.3927 0.3481 0.5923 0.0025  0.1508  -0.0056 415  GLY A N   
3276 C CA  . GLY A 399 ? 0.3933 0.3510 0.5999 0.0043  0.1532  -0.0004 415  GLY A CA  
3277 C C   . GLY A 399 ? 0.3898 0.3546 0.5881 0.0078  0.1453  0.0058  415  GLY A C   
3278 O O   . GLY A 399 ? 0.3903 0.3576 0.5946 0.0105  0.1475  0.0127  415  GLY A O   
3279 N N   . LEU A 400 ? 0.3864 0.3546 0.5711 0.0078  0.1363  0.0034  416  LEU A N   
3280 C CA  . LEU A 400 ? 0.3829 0.3576 0.5587 0.0108  0.1286  0.0085  416  LEU A CA  
3281 C C   . LEU A 400 ? 0.3839 0.3616 0.5542 0.0091  0.1244  0.0028  416  LEU A C   
3282 O O   . LEU A 400 ? 0.3819 0.3646 0.5480 0.0115  0.1201  0.0071  416  LEU A O   
3283 C CB  . LEU A 400 ? 0.3780 0.3547 0.5426 0.0121  0.1213  0.0099  416  LEU A CB  
3284 C CG  . LEU A 400 ? 0.3788 0.3549 0.5472 0.0150  0.1234  0.0181  416  LEU A CG  
3285 C CD1 . LEU A 400 ? 0.3731 0.3520 0.5294 0.0158  0.1152  0.0187  416  LEU A CD1 
3286 C CD2 . LEU A 400 ? 0.3720 0.3515 0.5482 0.0188  0.1265  0.0286  416  LEU A CD2 
3287 N N   . LEU A 401 ? 0.3891 0.3642 0.5595 0.0048  0.1256  -0.0068 417  LEU A N   
3288 C CA  . LEU A 401 ? 0.3920 0.3701 0.5586 0.0027  0.1222  -0.0127 417  LEU A CA  
3289 C C   . LEU A 401 ? 0.4005 0.3756 0.5790 -0.0002 0.1301  -0.0168 417  LEU A C   
3290 O O   . LEU A 401 ? 0.4051 0.3754 0.5884 -0.0037 0.1351  -0.0228 417  LEU A O   
3291 C CB  . LEU A 401 ? 0.3894 0.3687 0.5444 0.0000  0.1155  -0.0208 417  LEU A CB  
3292 C CG  . LEU A 401 ? 0.3865 0.3697 0.5360 -0.0021 0.1107  -0.0272 417  LEU A CG  
3293 C CD1 . LEU A 401 ? 0.3816 0.3700 0.5265 0.0013  0.1058  -0.0217 417  LEU A CD1 
3294 C CD2 . LEU A 401 ? 0.3807 0.3648 0.5198 -0.0046 0.1049  -0.0343 417  LEU A CD2 
3295 N N   . LYS A 402 ? 0.4057 0.3834 0.5888 0.0009  0.1315  -0.0137 418  LYS A N   
3296 C CA  . LYS A 402 ? 0.4163 0.3912 0.6121 -0.0014 0.1395  -0.0163 418  LYS A CA  
3297 C C   . LYS A 402 ? 0.4176 0.3962 0.6110 -0.0039 0.1365  -0.0225 418  LYS A C   
3298 O O   . LYS A 402 ? 0.4127 0.3966 0.5972 -0.0020 0.1294  -0.0210 418  LYS A O   
3299 C CB  . LYS A 402 ? 0.4191 0.3935 0.6256 0.0023  0.1457  -0.0062 418  LYS A CB  
3300 C CG  . LYS A 402 ? 0.4271 0.3988 0.6372 0.0052  0.1489  0.0012  418  LYS A CG  
3301 C CD  . LYS A 402 ? 0.4445 0.4159 0.6671 0.0086  0.1561  0.0110  418  LYS A CD  
3302 C CE  . LYS A 402 ? 0.4418 0.4131 0.6660 0.0125  0.1572  0.0204  418  LYS A CE  
3303 N NZ  . LYS A 402 ? 0.4535 0.4185 0.6820 0.0107  0.1618  0.0172  418  LYS A NZ  
3304 N N   . ASP A 403 ? 0.4248 0.4005 0.6266 -0.0084 0.1421  -0.0297 419  ASP A N   
3305 C CA  . ASP A 403 ? 0.4288 0.4079 0.6309 -0.0114 0.1407  -0.0359 419  ASP A CA  
3306 C C   . ASP A 403 ? 0.4235 0.4079 0.6117 -0.0124 0.1309  -0.0412 419  ASP A C   
3307 O O   . ASP A 403 ? 0.4200 0.4096 0.6049 -0.0117 0.1267  -0.0411 419  ASP A O   
3308 C CB  . ASP A 403 ? 0.4313 0.4129 0.6402 -0.0086 0.1431  -0.0292 419  ASP A CB  
3309 C CG  . ASP A 403 ? 0.4468 0.4235 0.6704 -0.0074 0.1531  -0.0234 419  ASP A CG  
3310 O OD1 . ASP A 403 ? 0.4644 0.4356 0.6970 -0.0110 0.1601  -0.0285 419  ASP A OD1 
3311 O OD2 . ASP A 403 ? 0.4633 0.4418 0.6895 -0.0029 0.1542  -0.0137 419  ASP A OD2 
3312 N N   . TYR A 404 ? 0.4210 0.4042 0.6016 -0.0139 0.1276  -0.0454 420  TYR A N   
3313 C CA  . TYR A 404 ? 0.4172 0.4051 0.5845 -0.0146 0.1185  -0.0497 420  TYR A CA  
3314 C C   . TYR A 404 ? 0.4212 0.4106 0.5884 -0.0202 0.1182  -0.0605 420  TYR A C   
3315 O O   . TYR A 404 ? 0.4262 0.4116 0.5979 -0.0240 0.1232  -0.0661 420  TYR A O   
3316 C CB  . TYR A 404 ? 0.4138 0.4001 0.5725 -0.0128 0.1149  -0.0476 420  TYR A CB  
3317 C CG  . TYR A 404 ? 0.4059 0.3968 0.5509 -0.0125 0.1055  -0.0503 420  TYR A CG  
3318 C CD1 . TYR A 404 ? 0.3950 0.3898 0.5326 -0.0084 0.0992  -0.0446 420  TYR A CD1 
3319 C CD2 . TYR A 404 ? 0.3997 0.3910 0.5392 -0.0162 0.1031  -0.0582 420  TYR A CD2 
3320 C CE1 . TYR A 404 ? 0.3899 0.3884 0.5157 -0.0080 0.0911  -0.0469 420  TYR A CE1 
3321 C CE2 . TYR A 404 ? 0.3966 0.3922 0.5240 -0.0158 0.0948  -0.0600 420  TYR A CE2 
3322 C CZ  . TYR A 404 ? 0.3895 0.3884 0.5105 -0.0116 0.0889  -0.0542 420  TYR A CZ  
3323 O OH  . TYR A 404 ? 0.3873 0.3900 0.4972 -0.0110 0.0812  -0.0558 420  TYR A OH  
3324 N N   . VAL A 405 ? 0.4196 0.4151 0.5816 -0.0209 0.1126  -0.0633 421  VAL A N   
3325 C CA  . VAL A 405 ? 0.4252 0.4240 0.5859 -0.0261 0.1109  -0.0731 421  VAL A CA  
3326 C C   . VAL A 405 ? 0.4228 0.4261 0.5698 -0.0257 0.1020  -0.0753 421  VAL A C   
3327 O O   . VAL A 405 ? 0.4175 0.4252 0.5577 -0.0225 0.0958  -0.0717 421  VAL A O   
3328 C CB  . VAL A 405 ? 0.4256 0.4288 0.5924 -0.0276 0.1117  -0.0751 421  VAL A CB  
3329 C CG1 . VAL A 405 ? 0.4303 0.4380 0.5952 -0.0332 0.1093  -0.0852 421  VAL A CG1 
3330 C CG2 . VAL A 405 ? 0.4312 0.4298 0.6123 -0.0281 0.1210  -0.0727 421  VAL A CG2 
3331 N N   . ARG A 406 ? 0.4268 0.4288 0.5699 -0.0289 0.1017  -0.0811 422  ARG A N   
3332 C CA  . ARG A 406 ? 0.4265 0.4323 0.5570 -0.0284 0.0939  -0.0828 422  ARG A CA  
3333 C C   . ARG A 406 ? 0.4243 0.4373 0.5511 -0.0320 0.0894  -0.0899 422  ARG A C   
3334 O O   . ARG A 406 ? 0.4302 0.4447 0.5546 -0.0363 0.0891  -0.0972 422  ARG A O   
3335 C CB  . ARG A 406 ? 0.4312 0.4325 0.5587 -0.0297 0.0956  -0.0847 422  ARG A CB  
3336 C CG  . ARG A 406 ? 0.4388 0.4431 0.5533 -0.0284 0.0879  -0.0847 422  ARG A CG  
3337 C CD  . ARG A 406 ? 0.4618 0.4637 0.5736 -0.0317 0.0897  -0.0902 422  ARG A CD  
3338 N NE  . ARG A 406 ? 0.4692 0.4762 0.5693 -0.0320 0.0823  -0.0926 422  ARG A NE  
3339 C CZ  . ARG A 406 ? 0.4683 0.4752 0.5600 -0.0282 0.0771  -0.0873 422  ARG A CZ  
3340 N NH1 . ARG A 406 ? 0.4767 0.4792 0.5700 -0.0239 0.0782  -0.0796 422  ARG A NH1 
3341 N NH2 . ARG A 406 ? 0.4675 0.4790 0.5494 -0.0286 0.0708  -0.0895 422  ARG A NH2 
3342 N N   . ASP A 407 ? 0.4154 0.4333 0.5421 -0.0303 0.0860  -0.0878 423  ASP A N   
3343 C CA  . ASP A 407 ? 0.4099 0.4357 0.5327 -0.0329 0.0808  -0.0932 423  ASP A CA  
3344 C C   . ASP A 407 ? 0.4022 0.4320 0.5126 -0.0298 0.0723  -0.0909 423  ASP A C   
3345 O O   . ASP A 407 ? 0.3979 0.4240 0.5029 -0.0263 0.0708  -0.0858 423  ASP A O   
3346 C CB  . ASP A 407 ? 0.4093 0.4388 0.5394 -0.0329 0.0820  -0.0926 423  ASP A CB  
3347 C CG  . ASP A 407 ? 0.4050 0.4335 0.5345 -0.0270 0.0807  -0.0838 423  ASP A CG  
3348 O OD1 . ASP A 407 ? 0.3959 0.4230 0.5174 -0.0230 0.0768  -0.0787 423  ASP A OD1 
3349 O OD2 . ASP A 407 ? 0.4103 0.4397 0.5475 -0.0266 0.0838  -0.0821 423  ASP A OD2 
3350 N N   . ASP A 408 ? 0.3968 0.4344 0.5034 -0.0312 0.0671  -0.0944 424  ASP A N   
3351 C CA  . ASP A 408 ? 0.3905 0.4323 0.4861 -0.0286 0.0592  -0.0924 424  ASP A CA  
3352 C C   . ASP A 408 ? 0.3793 0.4191 0.4713 -0.0225 0.0565  -0.0842 424  ASP A C   
3353 O O   . ASP A 408 ? 0.3753 0.4141 0.4590 -0.0197 0.0523  -0.0810 424  ASP A O   
3354 C CB  . ASP A 408 ? 0.3946 0.4458 0.4886 -0.0309 0.0547  -0.0969 424  ASP A CB  
3355 C CG  . ASP A 408 ? 0.4104 0.4652 0.5051 -0.0370 0.0557  -0.1054 424  ASP A CG  
3356 O OD1 . ASP A 408 ? 0.4273 0.4769 0.5230 -0.0394 0.0599  -0.1081 424  ASP A OD1 
3357 O OD2 . ASP A 408 ? 0.4324 0.4956 0.5266 -0.0395 0.0523  -0.1094 424  ASP A OD2 
3358 N N   . GLU A 409 ? 0.3702 0.4095 0.4687 -0.0207 0.0591  -0.0809 425  GLU A N   
3359 C CA  . GLU A 409 ? 0.3602 0.3984 0.4555 -0.0153 0.0568  -0.0735 425  GLU A CA  
3360 C C   . GLU A 409 ? 0.3519 0.3830 0.4463 -0.0125 0.0593  -0.0681 425  GLU A C   
3361 O O   . GLU A 409 ? 0.3471 0.3773 0.4342 -0.0088 0.0553  -0.0635 425  GLU A O   
3362 C CB  . GLU A 409 ? 0.3603 0.4009 0.4626 -0.0143 0.0589  -0.0718 425  GLU A CB  
3363 C CG  . GLU A 409 ? 0.3733 0.4219 0.4749 -0.0158 0.0550  -0.0756 425  GLU A CG  
3364 C CD  . GLU A 409 ? 0.3904 0.4417 0.4993 -0.0150 0.0572  -0.0740 425  GLU A CD  
3365 O OE1 . GLU A 409 ? 0.4026 0.4496 0.5176 -0.0137 0.0623  -0.0702 425  GLU A OE1 
3366 O OE2 . GLU A 409 ? 0.4001 0.4582 0.5088 -0.0157 0.0539  -0.0763 425  GLU A OE2 
3367 N N   . ALA A 410 ? 0.3449 0.3713 0.4471 -0.0145 0.0659  -0.0686 426  ALA A N   
3368 C CA  . ALA A 410 ? 0.3376 0.3577 0.4400 -0.0122 0.0687  -0.0636 426  ALA A CA  
3369 C C   . ALA A 410 ? 0.3325 0.3512 0.4262 -0.0122 0.0651  -0.0644 426  ALA A C   
3370 O O   . ALA A 410 ? 0.3283 0.3439 0.4181 -0.0089 0.0639  -0.0590 426  ALA A O   
3371 C CB  . ALA A 410 ? 0.3408 0.3563 0.4541 -0.0146 0.0770  -0.0645 426  ALA A CB  
3372 N N   . ARG A 411 ? 0.3277 0.3491 0.4185 -0.0158 0.0633  -0.0710 427  ARG A N   
3373 C CA  . ARG A 411 ? 0.3246 0.3453 0.4070 -0.0160 0.0597  -0.0722 427  ARG A CA  
3374 C C   . ARG A 411 ? 0.3158 0.3390 0.3888 -0.0121 0.0526  -0.0681 427  ARG A C   
3375 O O   . ARG A 411 ? 0.3130 0.3333 0.3806 -0.0100 0.0506  -0.0647 427  ARG A O   
3376 C CB  . ARG A 411 ? 0.3278 0.3520 0.4089 -0.0209 0.0592  -0.0802 427  ARG A CB  
3377 C CG  . ARG A 411 ? 0.3367 0.3597 0.4103 -0.0214 0.0570  -0.0814 427  ARG A CG  
3378 C CD  . ARG A 411 ? 0.3514 0.3807 0.4200 -0.0250 0.0535  -0.0880 427  ARG A CD  
3379 N NE  . ARG A 411 ? 0.3554 0.3833 0.4172 -0.0257 0.0521  -0.0891 427  ARG A NE  
3380 C CZ  . ARG A 411 ? 0.3612 0.3945 0.4173 -0.0284 0.0488  -0.0940 427  ARG A CZ  
3381 N NH1 . ARG A 411 ? 0.3599 0.4006 0.4162 -0.0309 0.0464  -0.0983 427  ARG A NH1 
3382 N NH2 . ARG A 411 ? 0.3562 0.3877 0.4062 -0.0287 0.0480  -0.0944 427  ARG A NH2 
3383 N N   . ILE A 412 ? 0.3101 0.3387 0.3817 -0.0113 0.0489  -0.0685 428  ILE A N   
3384 C CA  . ILE A 412 ? 0.3028 0.3336 0.3665 -0.0075 0.0426  -0.0647 428  ILE A CA  
3385 C C   . ILE A 412 ? 0.2979 0.3244 0.3610 -0.0033 0.0432  -0.0577 428  ILE A C   
3386 O O   . ILE A 412 ? 0.2969 0.3221 0.3530 -0.0007 0.0393  -0.0546 428  ILE A O   
3387 C CB  . ILE A 412 ? 0.3018 0.3393 0.3656 -0.0073 0.0394  -0.0664 428  ILE A CB  
3388 C CG1 . ILE A 412 ? 0.3060 0.3491 0.3686 -0.0112 0.0375  -0.0729 428  ILE A CG1 
3389 C CG2 . ILE A 412 ? 0.2922 0.3309 0.3492 -0.0029 0.0341  -0.0620 428  ILE A CG2 
3390 C CD1 . ILE A 412 ? 0.3120 0.3559 0.3660 -0.0113 0.0331  -0.0737 428  ILE A CD1 
3391 N N   . ASN A 413 ? 0.2946 0.3193 0.3653 -0.0028 0.0480  -0.0553 429  ASN A N   
3392 C CA  . ASN A 413 ? 0.2900 0.3113 0.3609 0.0007  0.0492  -0.0486 429  ASN A CA  
3393 C C   . ASN A 413 ? 0.2894 0.3061 0.3574 0.0013  0.0495  -0.0462 429  ASN A C   
3394 O O   . ASN A 413 ? 0.2829 0.2985 0.3455 0.0043  0.0465  -0.0416 429  ASN A O   
3395 C CB  . ASN A 413 ? 0.2915 0.3115 0.3722 0.0006  0.0554  -0.0465 429  ASN A CB  
3396 C CG  . ASN A 413 ? 0.2926 0.3167 0.3752 0.0021  0.0547  -0.0455 429  ASN A CG  
3397 O OD1 . ASN A 413 ? 0.3008 0.3244 0.3912 0.0021  0.0595  -0.0437 429  ASN A OD1 
3398 N ND2 . ASN A 413 ? 0.2752 0.3030 0.3510 0.0034  0.0490  -0.0465 429  ASN A ND2 
3399 N N   . GLN A 414 ? 0.2908 0.3050 0.3626 -0.0017 0.0533  -0.0495 430  GLN A N   
3400 C CA  . GLN A 414 ? 0.2931 0.3029 0.3635 -0.0015 0.0546  -0.0476 430  GLN A CA  
3401 C C   . GLN A 414 ? 0.2915 0.3019 0.3520 -0.0010 0.0488  -0.0484 430  GLN A C   
3402 O O   . GLN A 414 ? 0.2901 0.2980 0.3471 0.0010  0.0474  -0.0442 430  GLN A O   
3403 C CB  . GLN A 414 ? 0.2983 0.3051 0.3761 -0.0051 0.0610  -0.0514 430  GLN A CB  
3404 C CG  . GLN A 414 ? 0.3056 0.3079 0.3824 -0.0053 0.0629  -0.0502 430  GLN A CG  
3405 C CD  . GLN A 414 ? 0.3173 0.3165 0.3959 -0.0017 0.0643  -0.0423 430  GLN A CD  
3406 O OE1 . GLN A 414 ? 0.3155 0.3152 0.3988 0.0002  0.0661  -0.0380 430  GLN A OE1 
3407 N NE2 . GLN A 414 ? 0.3202 0.3169 0.3954 -0.0010 0.0635  -0.0403 430  GLN A NE2 
3408 N N   . LEU A 415 ? 0.2915 0.3058 0.3483 -0.0030 0.0456  -0.0536 431  LEU A N   
3409 C CA  . LEU A 415 ? 0.2910 0.3067 0.3387 -0.0024 0.0399  -0.0541 431  LEU A CA  
3410 C C   . LEU A 415 ? 0.2874 0.3036 0.3295 0.0015  0.0351  -0.0491 431  LEU A C   
3411 O O   . LEU A 415 ? 0.2853 0.2996 0.3216 0.0031  0.0322  -0.0466 431  LEU A O   
3412 C CB  . LEU A 415 ? 0.2901 0.3111 0.3353 -0.0051 0.0373  -0.0600 431  LEU A CB  
3413 C CG  . LEU A 415 ? 0.2996 0.3206 0.3462 -0.0094 0.0401  -0.0658 431  LEU A CG  
3414 C CD1 . LEU A 415 ? 0.3002 0.3277 0.3468 -0.0124 0.0385  -0.0716 431  LEU A CD1 
3415 C CD2 . LEU A 415 ? 0.2916 0.3106 0.3315 -0.0092 0.0381  -0.0652 431  LEU A CD2 
3416 N N   . PHE A 416 ? 0.2852 0.3038 0.3292 0.0030  0.0346  -0.0479 432  PHE A N   
3417 C CA  . PHE A 416 ? 0.2838 0.3029 0.3230 0.0067  0.0306  -0.0437 432  PHE A CA  
3418 C C   . PHE A 416 ? 0.2827 0.2978 0.3219 0.0089  0.0319  -0.0382 432  PHE A C   
3419 O O   . PHE A 416 ? 0.2824 0.2965 0.3155 0.0110  0.0282  -0.0354 432  PHE A O   
3420 C CB  . PHE A 416 ? 0.2850 0.3076 0.3270 0.0077  0.0307  -0.0437 432  PHE A CB  
3421 C CG  . PHE A 416 ? 0.2880 0.3119 0.3241 0.0111  0.0262  -0.0410 432  PHE A CG  
3422 C CD1 . PHE A 416 ? 0.2932 0.3198 0.3237 0.0115  0.0214  -0.0430 432  PHE A CD1 
3423 C CD2 . PHE A 416 ? 0.2935 0.3161 0.3298 0.0137  0.0269  -0.0364 432  PHE A CD2 
3424 C CE1 . PHE A 416 ? 0.3013 0.3285 0.3269 0.0146  0.0177  -0.0406 432  PHE A CE1 
3425 C CE2 . PHE A 416 ? 0.2914 0.3150 0.3222 0.0166  0.0231  -0.0345 432  PHE A CE2 
3426 C CZ  . PHE A 416 ? 0.2972 0.3227 0.3229 0.0171  0.0186  -0.0367 432  PHE A CZ  
3427 N N   . LEU A 417 ? 0.2817 0.2949 0.3281 0.0083  0.0373  -0.0365 433  LEU A N   
3428 C CA  . LEU A 417 ? 0.2822 0.2923 0.3298 0.0101  0.0391  -0.0309 433  LEU A CA  
3429 C C   . LEU A 417 ? 0.2805 0.2880 0.3237 0.0099  0.0373  -0.0302 433  LEU A C   
3430 O O   . LEU A 417 ? 0.2758 0.2823 0.3151 0.0121  0.0349  -0.0260 433  LEU A O   
3431 C CB  . LEU A 417 ? 0.2832 0.2917 0.3405 0.0092  0.0458  -0.0296 433  LEU A CB  
3432 C CG  . LEU A 417 ? 0.2878 0.2937 0.3483 0.0109  0.0487  -0.0235 433  LEU A CG  
3433 C CD1 . LEU A 417 ? 0.2906 0.2985 0.3483 0.0142  0.0463  -0.0179 433  LEU A CD1 
3434 C CD2 . LEU A 417 ? 0.2913 0.2952 0.3623 0.0095  0.0560  -0.0230 433  LEU A CD2 
3435 N N   . THR A 418 ? 0.2806 0.2871 0.3242 0.0072  0.0385  -0.0345 434  THR A N   
3436 C CA  . THR A 418 ? 0.2821 0.2862 0.3215 0.0068  0.0371  -0.0344 434  THR A CA  
3437 C C   . THR A 418 ? 0.2796 0.2850 0.3101 0.0083  0.0306  -0.0340 434  THR A C   
3438 O O   . THR A 418 ? 0.2793 0.2827 0.3062 0.0096  0.0286  -0.0309 434  THR A O   
3439 C CB  . THR A 418 ? 0.2841 0.2874 0.3257 0.0033  0.0400  -0.0397 434  THR A CB  
3440 O OG1 . THR A 418 ? 0.2894 0.2909 0.3399 0.0018  0.0465  -0.0403 434  THR A OG1 
3441 C CG2 . THR A 418 ? 0.2901 0.2907 0.3279 0.0029  0.0393  -0.0390 434  THR A CG2 
3442 N N   . ALA A 419 ? 0.2794 0.2882 0.3070 0.0082  0.0275  -0.0370 435  ALA A N   
3443 C CA  . ALA A 419 ? 0.2817 0.2918 0.3016 0.0098  0.0218  -0.0367 435  ALA A CA  
3444 C C   . ALA A 419 ? 0.2831 0.2922 0.3003 0.0129  0.0195  -0.0320 435  ALA A C   
3445 O O   . ALA A 419 ? 0.2805 0.2886 0.2920 0.0141  0.0157  -0.0305 435  ALA A O   
3446 C CB  . ALA A 419 ? 0.2792 0.2938 0.2979 0.0093  0.0196  -0.0404 435  ALA A CB  
3447 N N   . LEU A 420 ? 0.2876 0.2972 0.3089 0.0140  0.0218  -0.0297 436  LEU A N   
3448 C CA  . LEU A 420 ? 0.2940 0.3032 0.3129 0.0166  0.0201  -0.0253 436  LEU A CA  
3449 C C   . LEU A 420 ? 0.3002 0.3065 0.3178 0.0170  0.0200  -0.0217 436  LEU A C   
3450 O O   . LEU A 420 ? 0.3013 0.3074 0.3149 0.0187  0.0172  -0.0188 436  LEU A O   
3451 C CB  . LEU A 420 ? 0.2900 0.3008 0.3142 0.0175  0.0233  -0.0234 436  LEU A CB  
3452 C CG  . LEU A 420 ? 0.2918 0.3058 0.3172 0.0177  0.0232  -0.0259 436  LEU A CG  
3453 C CD1 . LEU A 420 ? 0.2901 0.3052 0.3217 0.0183  0.0274  -0.0234 436  LEU A CD1 
3454 C CD2 . LEU A 420 ? 0.2893 0.3047 0.3081 0.0197  0.0184  -0.0261 436  LEU A CD2 
3455 N N   . ASP A 421 ? 0.3098 0.3142 0.3309 0.0152  0.0230  -0.0221 437  ASP A N   
3456 C CA  . ASP A 421 ? 0.3188 0.3207 0.3394 0.0153  0.0232  -0.0189 437  ASP A CA  
3457 C C   . ASP A 421 ? 0.3166 0.3171 0.3321 0.0144  0.0204  -0.0209 437  ASP A C   
3458 O O   . ASP A 421 ? 0.3257 0.3248 0.3377 0.0153  0.0179  -0.0182 437  ASP A O   
3459 C CB  . ASP A 421 ? 0.3264 0.3268 0.3547 0.0142  0.0290  -0.0175 437  ASP A CB  
3460 C CG  . ASP A 421 ? 0.3508 0.3522 0.3837 0.0159  0.0314  -0.0124 437  ASP A CG  
3461 O OD1 . ASP A 421 ? 0.3901 0.3933 0.4194 0.0178  0.0284  -0.0099 437  ASP A OD1 
3462 O OD2 . ASP A 421 ? 0.3915 0.3917 0.4316 0.0153  0.0365  -0.0107 437  ASP A OD2 
3463 N N   . LYS A 422 ? 0.3088 0.3100 0.3240 0.0126  0.0207  -0.0255 438  LYS A N   
3464 C CA  . LYS A 422 ? 0.3010 0.3010 0.3121 0.0115  0.0190  -0.0273 438  LYS A CA  
3465 C C   . LYS A 422 ? 0.2967 0.2983 0.3010 0.0123  0.0138  -0.0288 438  LYS A C   
3466 O O   . LYS A 422 ? 0.2973 0.2975 0.2974 0.0125  0.0114  -0.0278 438  LYS A O   
3467 C CB  . LYS A 422 ? 0.3033 0.3032 0.3179 0.0086  0.0229  -0.0313 438  LYS A CB  
3468 C CG  . LYS A 422 ? 0.3017 0.2992 0.3237 0.0078  0.0287  -0.0299 438  LYS A CG  
3469 C CD  . LYS A 422 ? 0.2991 0.2938 0.3209 0.0088  0.0290  -0.0254 438  LYS A CD  
3470 C CE  . LYS A 422 ? 0.3081 0.3006 0.3379 0.0082  0.0350  -0.0234 438  LYS A CE  
3471 N NZ  . LYS A 422 ? 0.3126 0.3029 0.3426 0.0091  0.0353  -0.0189 438  LYS A NZ  
3472 N N   . ILE A 423 ? 0.2866 0.2912 0.2903 0.0127  0.0124  -0.0309 439  ILE A N   
3473 C CA  . ILE A 423 ? 0.2791 0.2854 0.2772 0.0138  0.0078  -0.0319 439  ILE A CA  
3474 C C   . ILE A 423 ? 0.2765 0.2815 0.2714 0.0164  0.0048  -0.0288 439  ILE A C   
3475 O O   . ILE A 423 ? 0.2733 0.2772 0.2635 0.0174  0.0015  -0.0278 439  ILE A O   
3476 C CB  . ILE A 423 ? 0.2804 0.2911 0.2796 0.0131  0.0074  -0.0356 439  ILE A CB  
3477 C CG1 . ILE A 423 ? 0.2804 0.2928 0.2823 0.0100  0.0102  -0.0396 439  ILE A CG1 
3478 C CG2 . ILE A 423 ? 0.2727 0.2855 0.2666 0.0147  0.0028  -0.0359 439  ILE A CG2 
3479 C CD1 . ILE A 423 ? 0.2906 0.3026 0.2885 0.0088  0.0090  -0.0405 439  ILE A CD1 
3480 N N   . VAL A 424 ? 0.2687 0.2741 0.2663 0.0174  0.0062  -0.0273 440  VAL A N   
3481 C CA  . VAL A 424 ? 0.2655 0.2701 0.2603 0.0196  0.0039  -0.0246 440  VAL A CA  
3482 C C   . VAL A 424 ? 0.2619 0.2635 0.2538 0.0199  0.0024  -0.0217 440  VAL A C   
3483 O O   . VAL A 424 ? 0.2657 0.2662 0.2533 0.0212  -0.0007 -0.0208 440  VAL A O   
3484 C CB  . VAL A 424 ? 0.2638 0.2695 0.2625 0.0203  0.0066  -0.0229 440  VAL A CB  
3485 C CG1 . VAL A 424 ? 0.2669 0.2718 0.2626 0.0221  0.0048  -0.0198 440  VAL A CG1 
3486 C CG2 . VAL A 424 ? 0.2620 0.2708 0.2626 0.0206  0.0072  -0.0255 440  VAL A CG2 
3487 N N   . PHE A 425 ? 0.2571 0.2572 0.2518 0.0185  0.0049  -0.0205 441  PHE A N   
3488 C CA  . PHE A 425 ? 0.2529 0.2506 0.2460 0.0186  0.0039  -0.0175 441  PHE A CA  
3489 C C   . PHE A 425 ? 0.2528 0.2488 0.2410 0.0185  0.0007  -0.0182 441  PHE A C   
3490 O O   . PHE A 425 ? 0.2504 0.2446 0.2362 0.0190  -0.0013 -0.0159 441  PHE A O   
3491 C CB  . PHE A 425 ? 0.2531 0.2499 0.2513 0.0172  0.0079  -0.0160 441  PHE A CB  
3492 C CG  . PHE A 425 ? 0.2502 0.2451 0.2479 0.0172  0.0072  -0.0125 441  PHE A CG  
3493 C CD1 . PHE A 425 ? 0.2483 0.2438 0.2463 0.0182  0.0065  -0.0088 441  PHE A CD1 
3494 C CD2 . PHE A 425 ? 0.2467 0.2398 0.2436 0.0161  0.0074  -0.0129 441  PHE A CD2 
3495 C CE1 . PHE A 425 ? 0.2544 0.2488 0.2522 0.0180  0.0057  -0.0055 441  PHE A CE1 
3496 C CE2 . PHE A 425 ? 0.2470 0.2385 0.2439 0.0160  0.0069  -0.0096 441  PHE A CE2 
3497 C CZ  . PHE A 425 ? 0.2537 0.2460 0.2512 0.0169  0.0060  -0.0058 441  PHE A CZ  
3498 N N   . LEU A 426 ? 0.2520 0.2491 0.2392 0.0178  0.0003  -0.0212 442  LEU A N   
3499 C CA  . LEU A 426 ? 0.2548 0.2508 0.2378 0.0177  -0.0021 -0.0215 442  LEU A CA  
3500 C C   . LEU A 426 ? 0.2540 0.2485 0.2327 0.0195  -0.0060 -0.0202 442  LEU A C   
3501 O O   . LEU A 426 ? 0.2535 0.2456 0.2303 0.0194  -0.0073 -0.0182 442  LEU A O   
3502 C CB  . LEU A 426 ? 0.2553 0.2538 0.2377 0.0167  -0.0020 -0.0249 442  LEU A CB  
3503 C CG  . LEU A 426 ? 0.2592 0.2588 0.2456 0.0144  0.0019  -0.0270 442  LEU A CG  
3504 C CD1 . LEU A 426 ? 0.2687 0.2719 0.2540 0.0132  0.0015  -0.0308 442  LEU A CD1 
3505 C CD2 . LEU A 426 ? 0.2598 0.2566 0.2472 0.0133  0.0039  -0.0254 442  LEU A CD2 
3506 N N   . PRO A 427 ? 0.2533 0.2492 0.2308 0.0209  -0.0075 -0.0213 443  PRO A N   
3507 C CA  . PRO A 427 ? 0.2550 0.2489 0.2289 0.0225  -0.0106 -0.0202 443  PRO A CA  
3508 C C   . PRO A 427 ? 0.2549 0.2467 0.2285 0.0226  -0.0108 -0.0178 443  PRO A C   
3509 O O   . PRO A 427 ? 0.2591 0.2483 0.2300 0.0229  -0.0129 -0.0166 443  PRO A O   
3510 C CB  . PRO A 427 ? 0.2550 0.2510 0.2285 0.0241  -0.0113 -0.0219 443  PRO A CB  
3511 C CG  . PRO A 427 ? 0.2561 0.2551 0.2335 0.0232  -0.0085 -0.0233 443  PRO A CG  
3512 C CD  . PRO A 427 ? 0.2522 0.2515 0.2318 0.0212  -0.0065 -0.0236 443  PRO A CD  
3513 N N   . PHE A 428 ? 0.2517 0.2447 0.2283 0.0222  -0.0086 -0.0168 444  PHE A N   
3514 C CA  . PHE A 428 ? 0.2490 0.2412 0.2255 0.0221  -0.0088 -0.0141 444  PHE A CA  
3515 C C   . PHE A 428 ? 0.2469 0.2370 0.2234 0.0209  -0.0093 -0.0121 444  PHE A C   
3516 O O   . PHE A 428 ? 0.2454 0.2339 0.2194 0.0209  -0.0115 -0.0109 444  PHE A O   
3517 C CB  . PHE A 428 ? 0.2488 0.2434 0.2294 0.0219  -0.0059 -0.0127 444  PHE A CB  
3518 C CG  . PHE A 428 ? 0.2458 0.2407 0.2269 0.0216  -0.0061 -0.0093 444  PHE A CG  
3519 C CD1 . PHE A 428 ? 0.2519 0.2477 0.2303 0.0223  -0.0078 -0.0086 444  PHE A CD1 
3520 C CD2 . PHE A 428 ? 0.2458 0.2403 0.2299 0.0204  -0.0045 -0.0067 444  PHE A CD2 
3521 C CE1 . PHE A 428 ? 0.2441 0.2412 0.2226 0.0218  -0.0083 -0.0055 444  PHE A CE1 
3522 C CE2 . PHE A 428 ? 0.2515 0.2471 0.2365 0.0202  -0.0048 -0.0032 444  PHE A CE2 
3523 C CZ  . PHE A 428 ? 0.2493 0.2465 0.2313 0.0208  -0.0069 -0.0025 444  PHE A CZ  
3524 N N   . ALA A 429 ? 0.2450 0.2352 0.2243 0.0198  -0.0070 -0.0120 445  ALA A N   
3525 C CA  . ALA A 429 ? 0.2462 0.2347 0.2261 0.0187  -0.0067 -0.0100 445  ALA A CA  
3526 C C   . ALA A 429 ? 0.2491 0.2352 0.2249 0.0189  -0.0097 -0.0103 445  ALA A C   
3527 O O   . ALA A 429 ? 0.2503 0.2348 0.2255 0.0184  -0.0110 -0.0081 445  ALA A O   
3528 C CB  . ALA A 429 ? 0.2417 0.2305 0.2251 0.0175  -0.0033 -0.0105 445  ALA A CB  
3529 N N   . PHE A 430 ? 0.2513 0.2376 0.2248 0.0196  -0.0108 -0.0127 446  PHE A N   
3530 C CA  . PHE A 430 ? 0.2554 0.2396 0.2255 0.0201  -0.0134 -0.0127 446  PHE A CA  
3531 C C   . PHE A 430 ? 0.2566 0.2386 0.2246 0.0208  -0.0158 -0.0117 446  PHE A C   
3532 O O   . PHE A 430 ? 0.2592 0.2387 0.2259 0.0204  -0.0173 -0.0103 446  PHE A O   
3533 C CB  . PHE A 430 ? 0.2580 0.2438 0.2264 0.0210  -0.0141 -0.0150 446  PHE A CB  
3534 C CG  . PHE A 430 ? 0.2658 0.2508 0.2321 0.0210  -0.0152 -0.0145 446  PHE A CG  
3535 C CD1 . PHE A 430 ? 0.2732 0.2554 0.2390 0.0203  -0.0157 -0.0123 446  PHE A CD1 
3536 C CD2 . PHE A 430 ? 0.2782 0.2657 0.2432 0.0216  -0.0158 -0.0161 446  PHE A CD2 
3537 C CE1 . PHE A 430 ? 0.2848 0.2665 0.2487 0.0204  -0.0164 -0.0115 446  PHE A CE1 
3538 C CE2 . PHE A 430 ? 0.2887 0.2762 0.2516 0.0217  -0.0167 -0.0153 446  PHE A CE2 
3539 C CZ  . PHE A 430 ? 0.2867 0.2711 0.2490 0.0212  -0.0170 -0.0129 446  PHE A CZ  
3540 N N   . THR A 431 ? 0.2528 0.2358 0.2205 0.0216  -0.0161 -0.0126 447  THR A N   
3541 C CA  . THR A 431 ? 0.2537 0.2349 0.2190 0.0221  -0.0183 -0.0125 447  THR A CA  
3542 C C   . THR A 431 ? 0.2548 0.2354 0.2206 0.0207  -0.0187 -0.0103 447  THR A C   
3543 O O   . THR A 431 ? 0.2582 0.2366 0.2220 0.0205  -0.0207 -0.0103 447  THR A O   
3544 C CB  . THR A 431 ? 0.2540 0.2368 0.2185 0.0234  -0.0182 -0.0143 447  THR A CB  
3545 O OG1 . THR A 431 ? 0.2449 0.2306 0.2119 0.0229  -0.0162 -0.0135 447  THR A OG1 
3546 C CG2 . THR A 431 ? 0.2505 0.2340 0.2145 0.0249  -0.0182 -0.0164 447  THR A CG2 
3547 N N   . MET A 432 ? 0.2543 0.2371 0.2232 0.0198  -0.0168 -0.0084 448  MET A N   
3548 C CA  . MET A 432 ? 0.2562 0.2395 0.2264 0.0185  -0.0172 -0.0057 448  MET A CA  
3549 C C   . MET A 432 ? 0.2605 0.2409 0.2299 0.0176  -0.0186 -0.0047 448  MET A C   
3550 O O   . MET A 432 ? 0.2602 0.2397 0.2284 0.0167  -0.0206 -0.0039 448  MET A O   
3551 C CB  . MET A 432 ? 0.2554 0.2415 0.2300 0.0180  -0.0143 -0.0033 448  MET A CB  
3552 C CG  . MET A 432 ? 0.2550 0.2443 0.2312 0.0187  -0.0126 -0.0034 448  MET A CG  
3553 S SD  . MET A 432 ? 0.2725 0.2639 0.2457 0.0190  -0.0148 -0.0031 448  MET A SD  
3554 C CE  . MET A 432 ? 0.2586 0.2483 0.2279 0.0205  -0.0159 -0.0074 448  MET A CE  
3555 N N   . ASP A 433 ? 0.2569 0.2360 0.2269 0.0176  -0.0177 -0.0047 449  ASP A N   
3556 C CA  . ASP A 433 ? 0.2596 0.2360 0.2291 0.0169  -0.0188 -0.0035 449  ASP A CA  
3557 C C   . ASP A 433 ? 0.2598 0.2332 0.2261 0.0177  -0.0209 -0.0051 449  ASP A C   
3558 O O   . ASP A 433 ? 0.2643 0.2352 0.2300 0.0170  -0.0223 -0.0040 449  ASP A O   
3559 C CB  . ASP A 433 ? 0.2590 0.2357 0.2309 0.0163  -0.0165 -0.0022 449  ASP A CB  
3560 C CG  . ASP A 433 ? 0.2666 0.2449 0.2423 0.0151  -0.0149 0.0006  449  ASP A CG  
3561 O OD1 . ASP A 433 ? 0.2759 0.2559 0.2524 0.0148  -0.0156 0.0017  449  ASP A OD1 
3562 O OD2 . ASP A 433 ? 0.2681 0.2461 0.2460 0.0145  -0.0129 0.0020  449  ASP A OD2 
3563 N N   . LYS A 434 ? 0.2584 0.2321 0.2230 0.0193  -0.0210 -0.0073 450  LYS A N   
3564 C CA  . LYS A 434 ? 0.2581 0.2291 0.2203 0.0204  -0.0228 -0.0085 450  LYS A CA  
3565 C C   . LYS A 434 ? 0.2600 0.2288 0.2209 0.0199  -0.0244 -0.0090 450  LYS A C   
3566 O O   . LYS A 434 ? 0.2579 0.2234 0.2180 0.0199  -0.0257 -0.0089 450  LYS A O   
3567 C CB  . LYS A 434 ? 0.2577 0.2301 0.2188 0.0223  -0.0225 -0.0107 450  LYS A CB  
3568 C CG  . LYS A 434 ? 0.2585 0.2326 0.2198 0.0228  -0.0217 -0.0106 450  LYS A CG  
3569 C CD  . LYS A 434 ? 0.2553 0.2318 0.2161 0.0244  -0.0216 -0.0126 450  LYS A CD  
3570 C CE  . LYS A 434 ? 0.2629 0.2416 0.2234 0.0249  -0.0214 -0.0126 450  LYS A CE  
3571 N NZ  . LYS A 434 ? 0.2662 0.2427 0.2252 0.0261  -0.0229 -0.0111 450  LYS A NZ  
3572 N N   . TYR A 435 ? 0.2560 0.2272 0.2172 0.0194  -0.0242 -0.0094 451  TYR A N   
3573 C CA  . TYR A 435 ? 0.2587 0.2289 0.2184 0.0185  -0.0258 -0.0102 451  TYR A CA  
3574 C C   . TYR A 435 ? 0.2581 0.2271 0.2188 0.0165  -0.0268 -0.0082 451  TYR A C   
3575 O O   . TYR A 435 ? 0.2603 0.2261 0.2199 0.0158  -0.0282 -0.0090 451  TYR A O   
3576 C CB  . TYR A 435 ? 0.2581 0.2321 0.2177 0.0184  -0.0252 -0.0106 451  TYR A CB  
3577 C CG  . TYR A 435 ? 0.2673 0.2413 0.2248 0.0172  -0.0269 -0.0116 451  TYR A CG  
3578 C CD1 . TYR A 435 ? 0.2774 0.2482 0.2321 0.0177  -0.0279 -0.0145 451  TYR A CD1 
3579 C CD2 . TYR A 435 ? 0.2771 0.2545 0.2355 0.0154  -0.0273 -0.0095 451  TYR A CD2 
3580 C CE1 . TYR A 435 ? 0.2834 0.2543 0.2359 0.0162  -0.0292 -0.0160 451  TYR A CE1 
3581 C CE2 . TYR A 435 ? 0.2810 0.2593 0.2372 0.0139  -0.0290 -0.0107 451  TYR A CE2 
3582 C CZ  . TYR A 435 ? 0.2862 0.2611 0.2392 0.0142  -0.0299 -0.0142 451  TYR A CZ  
3583 O OH  . TYR A 435 ? 0.3058 0.2816 0.2562 0.0124  -0.0315 -0.0160 451  TYR A OH  
3584 N N   . ARG A 436 ? 0.2565 0.2282 0.2199 0.0154  -0.0258 -0.0056 452  ARG A N   
3585 C CA  . ARG A 436 ? 0.2594 0.2309 0.2245 0.0134  -0.0267 -0.0033 452  ARG A CA  
3586 C C   . ARG A 436 ? 0.2606 0.2281 0.2259 0.0133  -0.0271 -0.0027 452  ARG A C   
3587 O O   . ARG A 436 ? 0.2628 0.2284 0.2283 0.0117  -0.0285 -0.0022 452  ARG A O   
3588 C CB  . ARG A 436 ? 0.2571 0.2325 0.2256 0.0127  -0.0251 -0.0002 452  ARG A CB  
3589 C CG  . ARG A 436 ? 0.2609 0.2407 0.2296 0.0124  -0.0251 0.0001  452  ARG A CG  
3590 C CD  . ARG A 436 ? 0.2639 0.2476 0.2369 0.0117  -0.0235 0.0039  452  ARG A CD  
3591 N NE  . ARG A 436 ? 0.2616 0.2454 0.2370 0.0129  -0.0205 0.0045  452  ARG A NE  
3592 C CZ  . ARG A 436 ? 0.2620 0.2487 0.2418 0.0128  -0.0181 0.0075  452  ARG A CZ  
3593 N NH1 . ARG A 436 ? 0.2649 0.2551 0.2472 0.0118  -0.0185 0.0108  452  ARG A NH1 
3594 N NH2 . ARG A 436 ? 0.2636 0.2498 0.2455 0.0136  -0.0151 0.0071  452  ARG A NH2 
3595 N N   . TRP A 437 ? 0.2600 0.2265 0.2252 0.0147  -0.0258 -0.0027 453  TRP A N   
3596 C CA  . TRP A 437 ? 0.2640 0.2270 0.2290 0.0150  -0.0260 -0.0019 453  TRP A CA  
3597 C C   . TRP A 437 ? 0.2678 0.2269 0.2311 0.0152  -0.0277 -0.0035 453  TRP A C   
3598 O O   . TRP A 437 ? 0.2698 0.2261 0.2340 0.0142  -0.0284 -0.0024 453  TRP A O   
3599 C CB  . TRP A 437 ? 0.2614 0.2249 0.2258 0.0167  -0.0247 -0.0021 453  TRP A CB  
3600 C CG  . TRP A 437 ? 0.2644 0.2307 0.2305 0.0163  -0.0225 -0.0009 453  TRP A CG  
3601 C CD1 . TRP A 437 ? 0.2649 0.2327 0.2337 0.0148  -0.0214 0.0011  453  TRP A CD1 
3602 C CD2 . TRP A 437 ? 0.2672 0.2353 0.2327 0.0174  -0.0210 -0.0017 453  TRP A CD2 
3603 N NE1 . TRP A 437 ? 0.2679 0.2377 0.2380 0.0150  -0.0190 0.0014  453  TRP A NE1 
3604 C CE2 . TRP A 437 ? 0.2693 0.2394 0.2372 0.0163  -0.0187 -0.0005 453  TRP A CE2 
3605 C CE3 . TRP A 437 ? 0.2718 0.2404 0.2352 0.0190  -0.0213 -0.0035 453  TRP A CE3 
3606 C CZ2 . TRP A 437 ? 0.2680 0.2402 0.2360 0.0166  -0.0166 -0.0016 453  TRP A CZ2 
3607 C CZ3 . TRP A 437 ? 0.2716 0.2431 0.2350 0.0192  -0.0196 -0.0043 453  TRP A CZ3 
3608 C CH2 . TRP A 437 ? 0.2726 0.2456 0.2381 0.0178  -0.0173 -0.0036 453  TRP A CH2 
3609 N N   . SER A 438 ? 0.2721 0.2310 0.2334 0.0165  -0.0281 -0.0062 454  SER A N   
3610 C CA  . SER A 438 ? 0.2797 0.2346 0.2397 0.0170  -0.0291 -0.0081 454  SER A CA  
3611 C C   . SER A 438 ? 0.2851 0.2384 0.2452 0.0146  -0.0304 -0.0088 454  SER A C   
3612 O O   . SER A 438 ? 0.2887 0.2377 0.2490 0.0141  -0.0310 -0.0095 454  SER A O   
3613 C CB  . SER A 438 ? 0.2812 0.2365 0.2393 0.0190  -0.0288 -0.0108 454  SER A CB  
3614 O OG  . SER A 438 ? 0.2854 0.2434 0.2424 0.0181  -0.0291 -0.0124 454  SER A OG  
3615 N N   . LEU A 439 ? 0.2838 0.2409 0.2441 0.0129  -0.0309 -0.0086 455  LEU A N   
3616 C CA  . LEU A 439 ? 0.2900 0.2472 0.2505 0.0102  -0.0324 -0.0090 455  LEU A CA  
3617 C C   . LEU A 439 ? 0.2910 0.2472 0.2544 0.0085  -0.0327 -0.0062 455  LEU A C   
3618 O O   . LEU A 439 ? 0.2951 0.2483 0.2590 0.0067  -0.0338 -0.0069 455  LEU A O   
3619 C CB  . LEU A 439 ? 0.2880 0.2508 0.2480 0.0091  -0.0328 -0.0089 455  LEU A CB  
3620 C CG  . LEU A 439 ? 0.2930 0.2579 0.2503 0.0106  -0.0323 -0.0113 455  LEU A CG  
3621 C CD1 . LEU A 439 ? 0.2965 0.2670 0.2534 0.0090  -0.0331 -0.0107 455  LEU A CD1 
3622 C CD2 . LEU A 439 ? 0.3028 0.2634 0.2574 0.0114  -0.0326 -0.0152 455  LEU A CD2 
3623 N N   . PHE A 440 ? 0.2871 0.2456 0.2526 0.0089  -0.0315 -0.0031 456  PHE A N   
3624 C CA  . PHE A 440 ? 0.2921 0.2499 0.2605 0.0076  -0.0314 0.0000  456  PHE A CA  
3625 C C   . PHE A 440 ? 0.2986 0.2510 0.2672 0.0081  -0.0313 0.0000  456  PHE A C   
3626 O O   . PHE A 440 ? 0.3008 0.2513 0.2715 0.0062  -0.0320 0.0011  456  PHE A O   
3627 C CB  . PHE A 440 ? 0.2855 0.2462 0.2557 0.0084  -0.0294 0.0027  456  PHE A CB  
3628 C CG  . PHE A 440 ? 0.2895 0.2555 0.2613 0.0077  -0.0290 0.0039  456  PHE A CG  
3629 C CD1 . PHE A 440 ? 0.2886 0.2573 0.2605 0.0059  -0.0307 0.0037  456  PHE A CD1 
3630 C CD2 . PHE A 440 ? 0.2881 0.2565 0.2613 0.0089  -0.0267 0.0055  456  PHE A CD2 
3631 C CE1 . PHE A 440 ? 0.2881 0.2622 0.2618 0.0055  -0.0302 0.0056  456  PHE A CE1 
3632 C CE2 . PHE A 440 ? 0.2855 0.2585 0.2610 0.0084  -0.0258 0.0071  456  PHE A CE2 
3633 C CZ  . PHE A 440 ? 0.2885 0.2645 0.2643 0.0069  -0.0276 0.0075  456  PHE A CZ  
3634 N N   . ARG A 441 ? 0.3035 0.2539 0.2703 0.0106  -0.0305 -0.0011 457  ARG A N   
3635 C CA  . ARG A 441 ? 0.3118 0.2576 0.2789 0.0117  -0.0302 -0.0005 457  ARG A CA  
3636 C C   . ARG A 441 ? 0.3219 0.2630 0.2887 0.0111  -0.0311 -0.0030 457  ARG A C   
3637 O O   . ARG A 441 ? 0.3254 0.2622 0.2932 0.0119  -0.0306 -0.0023 457  ARG A O   
3638 C CB  . ARG A 441 ? 0.3077 0.2540 0.2733 0.0146  -0.0290 -0.0003 457  ARG A CB  
3639 C CG  . ARG A 441 ? 0.3025 0.2520 0.2686 0.0150  -0.0277 0.0022  457  ARG A CG  
3640 C CD  . ARG A 441 ? 0.2949 0.2467 0.2591 0.0173  -0.0268 0.0014  457  ARG A CD  
3641 N NE  . ARG A 441 ? 0.2895 0.2439 0.2542 0.0174  -0.0253 0.0035  457  ARG A NE  
3642 C CZ  . ARG A 441 ? 0.2908 0.2485 0.2542 0.0185  -0.0243 0.0028  457  ARG A CZ  
3643 N NH1 . ARG A 441 ? 0.2885 0.2476 0.2505 0.0198  -0.0246 0.0004  457  ARG A NH1 
3644 N NH2 . ARG A 441 ? 0.2896 0.2492 0.2532 0.0182  -0.0227 0.0043  457  ARG A NH2 
3645 N N   . GLY A 442 ? 0.3292 0.2713 0.2947 0.0097  -0.0322 -0.0059 458  GLY A N   
3646 C CA  . GLY A 442 ? 0.3427 0.2806 0.3078 0.0087  -0.0328 -0.0091 458  GLY A CA  
3647 C C   . GLY A 442 ? 0.3517 0.2864 0.3152 0.0116  -0.0318 -0.0111 458  GLY A C   
3648 O O   . GLY A 442 ? 0.3570 0.2864 0.3212 0.0117  -0.0314 -0.0127 458  GLY A O   
3649 N N   . GLU A 443 ? 0.3522 0.2901 0.3140 0.0140  -0.0312 -0.0109 459  GLU A N   
3650 C CA  . GLU A 443 ? 0.3624 0.2984 0.3233 0.0171  -0.0302 -0.0121 459  GLU A CA  
3651 C C   . GLU A 443 ? 0.3679 0.3038 0.3265 0.0173  -0.0302 -0.0161 459  GLU A C   
3652 O O   . GLU A 443 ? 0.3687 0.3022 0.3270 0.0196  -0.0293 -0.0176 459  GLU A O   
3653 C CB  . GLU A 443 ? 0.3581 0.2979 0.3186 0.0195  -0.0295 -0.0099 459  GLU A CB  
3654 C CG  . GLU A 443 ? 0.3675 0.3070 0.3298 0.0199  -0.0290 -0.0061 459  GLU A CG  
3655 C CD  . GLU A 443 ? 0.3790 0.3233 0.3405 0.0212  -0.0284 -0.0045 459  GLU A CD  
3656 O OE1 . GLU A 443 ? 0.3795 0.3274 0.3398 0.0215  -0.0283 -0.0061 459  GLU A OE1 
3657 O OE2 . GLU A 443 ? 0.3841 0.3286 0.3464 0.0219  -0.0279 -0.0017 459  GLU A OE2 
3658 N N   . VAL A 444 ? 0.3722 0.3112 0.3294 0.0150  -0.0312 -0.0177 460  VAL A N   
3659 C CA  . VAL A 444 ? 0.3816 0.3212 0.3361 0.0148  -0.0313 -0.0216 460  VAL A CA  
3660 C C   . VAL A 444 ? 0.3922 0.3304 0.3462 0.0113  -0.0324 -0.0241 460  VAL A C   
3661 O O   . VAL A 444 ? 0.3929 0.3340 0.3475 0.0087  -0.0337 -0.0227 460  VAL A O   
3662 C CB  . VAL A 444 ? 0.3755 0.3215 0.3284 0.0153  -0.0313 -0.0213 460  VAL A CB  
3663 C CG1 . VAL A 444 ? 0.3779 0.3245 0.3279 0.0156  -0.0311 -0.0251 460  VAL A CG1 
3664 C CG2 . VAL A 444 ? 0.3713 0.3192 0.3251 0.0180  -0.0303 -0.0190 460  VAL A CG2 
3665 N N   . ASP A 445 ? 0.4063 0.3402 0.3591 0.0113  -0.0318 -0.0280 461  ASP A N   
3666 C CA  . ASP A 445 ? 0.4208 0.3537 0.3724 0.0077  -0.0327 -0.0315 461  ASP A CA  
3667 C C   . ASP A 445 ? 0.4178 0.3574 0.3661 0.0061  -0.0340 -0.0327 461  ASP A C   
3668 O O   . ASP A 445 ? 0.4124 0.3552 0.3588 0.0083  -0.0333 -0.0327 461  ASP A O   
3669 C CB  . ASP A 445 ? 0.4346 0.3611 0.3857 0.0082  -0.0312 -0.0359 461  ASP A CB  
3670 C CG  . ASP A 445 ? 0.4587 0.3783 0.4137 0.0094  -0.0298 -0.0344 461  ASP A CG  
3671 O OD1 . ASP A 445 ? 0.4848 0.4038 0.4425 0.0080  -0.0306 -0.0314 461  ASP A OD1 
3672 O OD2 . ASP A 445 ? 0.4915 0.4065 0.4471 0.0120  -0.0278 -0.0359 461  ASP A OD2 
3673 N N   . LYS A 446 ? 0.4186 0.3607 0.3666 0.0023  -0.0358 -0.0333 462  LYS A N   
3674 C CA  . LYS A 446 ? 0.4177 0.3673 0.3629 0.0005  -0.0372 -0.0336 462  LYS A CA  
3675 C C   . LYS A 446 ? 0.4149 0.3656 0.3558 0.0014  -0.0364 -0.0375 462  LYS A C   
3676 O O   . LYS A 446 ? 0.4124 0.3694 0.3512 0.0018  -0.0367 -0.0366 462  LYS A O   
3677 C CB  . LYS A 446 ? 0.4235 0.3758 0.3692 -0.0038 -0.0394 -0.0340 462  LYS A CB  
3678 C CG  . LYS A 446 ? 0.4344 0.3899 0.3838 -0.0046 -0.0404 -0.0287 462  LYS A CG  
3679 C CD  . LYS A 446 ? 0.4648 0.4254 0.4147 -0.0089 -0.0428 -0.0284 462  LYS A CD  
3680 C CE  . LYS A 446 ? 0.4887 0.4444 0.4416 -0.0116 -0.0434 -0.0295 462  LYS A CE  
3681 N NZ  . LYS A 446 ? 0.5092 0.4708 0.4643 -0.0152 -0.0457 -0.0271 462  LYS A NZ  
3682 N N   . ALA A 447 ? 0.4161 0.3606 0.3561 0.0019  -0.0350 -0.0418 463  ALA A N   
3683 C CA  . ALA A 447 ? 0.4142 0.3588 0.3503 0.0030  -0.0337 -0.0459 463  ALA A CA  
3684 C C   . ALA A 447 ? 0.4045 0.3504 0.3406 0.0072  -0.0322 -0.0440 463  ALA A C   
3685 O O   . ALA A 447 ? 0.4041 0.3516 0.3372 0.0084  -0.0311 -0.0465 463  ALA A O   
3686 C CB  . ALA A 447 ? 0.4233 0.3601 0.3593 0.0024  -0.0322 -0.0509 463  ALA A CB  
3687 N N   . ASN A 448 ? 0.3902 0.3359 0.3297 0.0094  -0.0319 -0.0396 464  ASN A N   
3688 C CA  . ASN A 448 ? 0.3816 0.3287 0.3217 0.0132  -0.0305 -0.0378 464  ASN A CA  
3689 C C   . ASN A 448 ? 0.3676 0.3209 0.3089 0.0136  -0.0312 -0.0334 464  ASN A C   
3690 O O   . ASN A 448 ? 0.3612 0.3158 0.3035 0.0164  -0.0301 -0.0317 464  ASN A O   
3691 C CB  . ASN A 448 ? 0.3834 0.3247 0.3264 0.0160  -0.0292 -0.0369 464  ASN A CB  
3692 C CG  . ASN A 448 ? 0.4019 0.3364 0.3448 0.0161  -0.0278 -0.0409 464  ASN A CG  
3693 O OD1 . ASN A 448 ? 0.4205 0.3496 0.3662 0.0163  -0.0274 -0.0402 464  ASN A OD1 
3694 N ND2 . ASN A 448 ? 0.4047 0.3395 0.3444 0.0160  -0.0269 -0.0450 464  ASN A ND2 
3695 N N   . TRP A 449 ? 0.3596 0.3168 0.3009 0.0109  -0.0328 -0.0317 465  TRP A N   
3696 C CA  . TRP A 449 ? 0.3465 0.3088 0.2899 0.0111  -0.0330 -0.0273 465  TRP A CA  
3697 C C   . TRP A 449 ? 0.3400 0.3073 0.2826 0.0130  -0.0319 -0.0264 465  TRP A C   
3698 O O   . TRP A 449 ? 0.3320 0.3009 0.2771 0.0147  -0.0309 -0.0236 465  TRP A O   
3699 C CB  . TRP A 449 ? 0.3482 0.3143 0.2924 0.0078  -0.0349 -0.0254 465  TRP A CB  
3700 C CG  . TRP A 449 ? 0.3431 0.3056 0.2903 0.0065  -0.0356 -0.0237 465  TRP A CG  
3701 C CD1 . TRP A 449 ? 0.3417 0.2977 0.2903 0.0075  -0.0349 -0.0244 465  TRP A CD1 
3702 C CD2 . TRP A 449 ? 0.3402 0.3059 0.2898 0.0040  -0.0370 -0.0206 465  TRP A CD2 
3703 N NE1 . TRP A 449 ? 0.3427 0.2974 0.2941 0.0058  -0.0357 -0.0220 465  TRP A NE1 
3704 C CE2 . TRP A 449 ? 0.3434 0.3039 0.2955 0.0036  -0.0370 -0.0198 465  TRP A CE2 
3705 C CE3 . TRP A 449 ? 0.3398 0.3123 0.2898 0.0023  -0.0380 -0.0181 465  TRP A CE3 
3706 C CZ2 . TRP A 449 ? 0.3446 0.3065 0.2997 0.0013  -0.0380 -0.0169 465  TRP A CZ2 
3707 C CZ3 . TRP A 449 ? 0.3393 0.3134 0.2926 0.0001  -0.0391 -0.0151 465  TRP A CZ3 
3708 C CH2 . TRP A 449 ? 0.3397 0.3084 0.2954 -0.0003 -0.0391 -0.0146 465  TRP A CH2 
3709 N N   . ASN A 450 ? 0.3388 0.3087 0.2781 0.0127  -0.0318 -0.0289 466  ASN A N   
3710 C CA  . ASN A 450 ? 0.3347 0.3095 0.2735 0.0144  -0.0305 -0.0278 466  ASN A CA  
3711 C C   . ASN A 450 ? 0.3335 0.3060 0.2731 0.0177  -0.0286 -0.0287 466  ASN A C   
3712 O O   . ASN A 450 ? 0.3302 0.3054 0.2719 0.0193  -0.0275 -0.0264 466  ASN A O   
3713 C CB  . ASN A 450 ? 0.3362 0.3156 0.2712 0.0132  -0.0309 -0.0296 466  ASN A CB  
3714 C CG  . ASN A 450 ? 0.3287 0.3143 0.2641 0.0145  -0.0297 -0.0269 466  ASN A CG  
3715 O OD1 . ASN A 450 ? 0.3288 0.3166 0.2615 0.0155  -0.0287 -0.0286 466  ASN A OD1 
3716 N ND2 . ASN A 450 ? 0.3045 0.2928 0.2439 0.0147  -0.0295 -0.0225 466  ASN A ND2 
3717 N N   . CYS A 451 ? 0.3403 0.3077 0.2785 0.0187  -0.0281 -0.0321 467  CYS A N   
3718 C CA  . CYS A 451 ? 0.3408 0.3066 0.2801 0.0219  -0.0264 -0.0327 467  CYS A CA  
3719 C C   . CYS A 451 ? 0.3273 0.2912 0.2702 0.0232  -0.0264 -0.0301 467  CYS A C   
3720 O O   . CYS A 451 ? 0.3192 0.2843 0.2637 0.0255  -0.0252 -0.0294 467  CYS A O   
3721 C CB  . CYS A 451 ? 0.3539 0.3152 0.2911 0.0229  -0.0255 -0.0369 467  CYS A CB  
3722 S SG  . CYS A 451 ? 0.4008 0.3655 0.3333 0.0221  -0.0248 -0.0403 467  CYS A SG  
3723 N N   . ALA A 452 ? 0.3204 0.2821 0.2645 0.0215  -0.0276 -0.0286 468  ALA A N   
3724 C CA  . ALA A 452 ? 0.3099 0.2709 0.2571 0.0223  -0.0276 -0.0256 468  ALA A CA  
3725 C C   . ALA A 452 ? 0.2993 0.2654 0.2481 0.0225  -0.0269 -0.0231 468  ALA A C   
3726 O O   . ALA A 452 ? 0.2937 0.2604 0.2445 0.0240  -0.0262 -0.0217 468  ALA A O   
3727 C CB  . ALA A 452 ? 0.3119 0.2700 0.2601 0.0203  -0.0288 -0.0244 468  ALA A CB  
3728 N N   . PHE A 453 ? 0.2919 0.2621 0.2401 0.0211  -0.0271 -0.0224 469  PHE A N   
3729 C CA  . PHE A 453 ? 0.2836 0.2586 0.2340 0.0212  -0.0260 -0.0199 469  PHE A CA  
3730 C C   . PHE A 453 ? 0.2793 0.2561 0.2299 0.0235  -0.0243 -0.0210 469  PHE A C   
3731 O O   . PHE A 453 ? 0.2704 0.2482 0.2234 0.0245  -0.0232 -0.0199 469  PHE A O   
3732 C CB  . PHE A 453 ? 0.2811 0.2603 0.2311 0.0193  -0.0264 -0.0183 469  PHE A CB  
3733 C CG  . PHE A 453 ? 0.2834 0.2672 0.2364 0.0196  -0.0248 -0.0153 469  PHE A CG  
3734 C CD1 . PHE A 453 ? 0.2773 0.2612 0.2337 0.0191  -0.0242 -0.0126 469  PHE A CD1 
3735 C CD2 . PHE A 453 ? 0.2864 0.2742 0.2391 0.0205  -0.0235 -0.0153 469  PHE A CD2 
3736 C CE1 . PHE A 453 ? 0.2772 0.2648 0.2369 0.0193  -0.0222 -0.0101 469  PHE A CE1 
3737 C CE2 . PHE A 453 ? 0.2809 0.2726 0.2370 0.0208  -0.0216 -0.0124 469  PHE A CE2 
3738 C CZ  . PHE A 453 ? 0.2819 0.2732 0.2416 0.0202  -0.0208 -0.0099 469  PHE A CZ  
3739 N N   . TRP A 454 ? 0.2794 0.2567 0.2274 0.0241  -0.0241 -0.0233 470  TRP A N   
3740 C CA  . TRP A 454 ? 0.2794 0.2587 0.2278 0.0262  -0.0224 -0.0244 470  TRP A CA  
3741 C C   . TRP A 454 ? 0.2833 0.2600 0.2329 0.0283  -0.0220 -0.0255 470  TRP A C   
3742 O O   . TRP A 454 ? 0.2789 0.2581 0.2304 0.0298  -0.0207 -0.0253 470  TRP A O   
3743 C CB  . TRP A 454 ? 0.2806 0.2612 0.2257 0.0263  -0.0221 -0.0265 470  TRP A CB  
3744 C CG  . TRP A 454 ? 0.2708 0.2562 0.2153 0.0246  -0.0222 -0.0246 470  TRP A CG  
3745 C CD1 . TRP A 454 ? 0.2710 0.2573 0.2124 0.0227  -0.0236 -0.0252 470  TRP A CD1 
3746 C CD2 . TRP A 454 ? 0.2594 0.2495 0.2069 0.0247  -0.0209 -0.0215 470  TRP A CD2 
3747 N NE1 . TRP A 454 ? 0.2636 0.2556 0.2057 0.0217  -0.0233 -0.0222 470  TRP A NE1 
3748 C CE2 . TRP A 454 ? 0.2581 0.2520 0.2041 0.0231  -0.0215 -0.0198 470  TRP A CE2 
3749 C CE3 . TRP A 454 ? 0.2582 0.2497 0.2095 0.0259  -0.0191 -0.0200 470  TRP A CE3 
3750 C CZ2 . TRP A 454 ? 0.2540 0.2530 0.2029 0.0230  -0.0201 -0.0162 470  TRP A CZ2 
3751 C CZ3 . TRP A 454 ? 0.2568 0.2527 0.2109 0.0256  -0.0175 -0.0170 470  TRP A CZ3 
3752 C CH2 . TRP A 454 ? 0.2514 0.2509 0.2046 0.0243  -0.0180 -0.0149 470  TRP A CH2 
3753 N N   . LYS A 455 ? 0.2901 0.2621 0.2390 0.0284  -0.0231 -0.0263 471  LYS A N   
3754 C CA  . LYS A 455 ? 0.2968 0.2668 0.2472 0.0305  -0.0229 -0.0264 471  LYS A CA  
3755 C C   . LYS A 455 ? 0.2898 0.2624 0.2430 0.0306  -0.0227 -0.0242 471  LYS A C   
3756 O O   . LYS A 455 ? 0.2873 0.2619 0.2421 0.0322  -0.0220 -0.0243 471  LYS A O   
3757 C CB  . LYS A 455 ? 0.3042 0.2688 0.2540 0.0305  -0.0238 -0.0269 471  LYS A CB  
3758 C CG  . LYS A 455 ? 0.3334 0.2947 0.2814 0.0314  -0.0233 -0.0299 471  LYS A CG  
3759 C CD  . LYS A 455 ? 0.3725 0.3279 0.3205 0.0309  -0.0239 -0.0304 471  LYS A CD  
3760 C CE  . LYS A 455 ? 0.4046 0.3561 0.3508 0.0313  -0.0230 -0.0339 471  LYS A CE  
3761 N NZ  . LYS A 455 ? 0.4323 0.3829 0.3801 0.0347  -0.0215 -0.0346 471  LYS A NZ  
3762 N N   . LEU A 456 ? 0.2890 0.2620 0.2428 0.0286  -0.0232 -0.0222 472  LEU A N   
3763 C CA  . LEU A 456 ? 0.2870 0.2622 0.2431 0.0283  -0.0226 -0.0204 472  LEU A CA  
3764 C C   . LEU A 456 ? 0.2838 0.2636 0.2418 0.0284  -0.0210 -0.0205 472  LEU A C   
3765 O O   . LEU A 456 ? 0.2790 0.2608 0.2387 0.0291  -0.0202 -0.0206 472  LEU A O   
3766 C CB  . LEU A 456 ? 0.2877 0.2620 0.2443 0.0262  -0.0232 -0.0183 472  LEU A CB  
3767 C CG  . LEU A 456 ? 0.2959 0.2661 0.2520 0.0259  -0.0245 -0.0175 472  LEU A CG  
3768 C CD1 . LEU A 456 ? 0.2926 0.2623 0.2492 0.0237  -0.0249 -0.0156 472  LEU A CD1 
3769 C CD2 . LEU A 456 ? 0.2971 0.2675 0.2541 0.0272  -0.0243 -0.0168 472  LEU A CD2 
3770 N N   . ARG A 457 ? 0.2853 0.2668 0.2428 0.0278  -0.0203 -0.0205 473  ARG A N   
3771 C CA  . ARG A 457 ? 0.2855 0.2711 0.2452 0.0280  -0.0184 -0.0203 473  ARG A CA  
3772 C C   . ARG A 457 ? 0.2880 0.2748 0.2481 0.0300  -0.0177 -0.0222 473  ARG A C   
3773 O O   . ARG A 457 ? 0.2856 0.2755 0.2485 0.0302  -0.0162 -0.0223 473  ARG A O   
3774 C CB  . ARG A 457 ? 0.2863 0.2738 0.2451 0.0272  -0.0180 -0.0194 473  ARG A CB  
3775 C CG  . ARG A 457 ? 0.2885 0.2757 0.2473 0.0252  -0.0188 -0.0171 473  ARG A CG  
3776 C CD  . ARG A 457 ? 0.2976 0.2861 0.2602 0.0243  -0.0174 -0.0148 473  ARG A CD  
3777 N NE  . ARG A 457 ? 0.2994 0.2914 0.2651 0.0247  -0.0149 -0.0142 473  ARG A NE  
3778 C CZ  . ARG A 457 ? 0.3043 0.2970 0.2726 0.0252  -0.0132 -0.0150 473  ARG A CZ  
3779 N NH1 . ARG A 457 ? 0.2980 0.2888 0.2660 0.0253  -0.0140 -0.0163 473  ARG A NH1 
3780 N NH2 . ARG A 457 ? 0.3106 0.3063 0.2822 0.0254  -0.0107 -0.0146 473  ARG A NH2 
3781 N N   . ASP A 458 ? 0.2905 0.2751 0.2483 0.0313  -0.0186 -0.0238 474  ASP A N   
3782 C CA  . ASP A 458 ? 0.2952 0.2807 0.2536 0.0335  -0.0180 -0.0255 474  ASP A CA  
3783 C C   . ASP A 458 ? 0.2945 0.2806 0.2549 0.0341  -0.0185 -0.0250 474  ASP A C   
3784 O O   . ASP A 458 ? 0.2936 0.2834 0.2565 0.0345  -0.0175 -0.0253 474  ASP A O   
3785 C CB  . ASP A 458 ? 0.2995 0.2817 0.2552 0.0348  -0.0186 -0.0272 474  ASP A CB  
3786 C CG  . ASP A 458 ? 0.3082 0.2908 0.2650 0.0373  -0.0180 -0.0285 474  ASP A CG  
3787 O OD1 . ASP A 458 ? 0.3158 0.3018 0.2754 0.0381  -0.0175 -0.0281 474  ASP A OD1 
3788 O OD2 . ASP A 458 ? 0.3187 0.2984 0.2738 0.0385  -0.0179 -0.0301 474  ASP A OD2 
3789 N N   . GLU A 459 ? 0.2979 0.2807 0.2572 0.0341  -0.0200 -0.0243 475  GLU A N   
3790 C CA  . GLU A 459 ? 0.3012 0.2849 0.2617 0.0348  -0.0207 -0.0236 475  GLU A CA  
3791 C C   . GLU A 459 ? 0.2913 0.2791 0.2540 0.0335  -0.0199 -0.0231 475  GLU A C   
3792 O O   . GLU A 459 ? 0.2858 0.2769 0.2500 0.0343  -0.0199 -0.0235 475  GLU A O   
3793 C CB  . GLU A 459 ? 0.3091 0.2886 0.2682 0.0346  -0.0221 -0.0223 475  GLU A CB  
3794 C CG  . GLU A 459 ? 0.3479 0.3285 0.3079 0.0356  -0.0228 -0.0209 475  GLU A CG  
3795 C CD  . GLU A 459 ? 0.3958 0.3722 0.3548 0.0352  -0.0239 -0.0192 475  GLU A CD  
3796 O OE1 . GLU A 459 ? 0.4221 0.3944 0.3798 0.0342  -0.0242 -0.0193 475  GLU A OE1 
3797 O OE2 . GLU A 459 ? 0.4204 0.3981 0.3799 0.0359  -0.0245 -0.0176 475  GLU A OE2 
3798 N N   . TYR A 460 ? 0.2827 0.2704 0.2457 0.0315  -0.0192 -0.0224 476  TYR A N   
3799 C CA  . TYR A 460 ? 0.2781 0.2687 0.2432 0.0300  -0.0181 -0.0221 476  TYR A CA  
3800 C C   . TYR A 460 ? 0.2702 0.2643 0.2380 0.0294  -0.0159 -0.0231 476  TYR A C   
3801 O O   . TYR A 460 ? 0.2704 0.2678 0.2404 0.0289  -0.0150 -0.0241 476  TYR A O   
3802 C CB  . TYR A 460 ? 0.2775 0.2659 0.2422 0.0281  -0.0181 -0.0205 476  TYR A CB  
3803 C CG  . TYR A 460 ? 0.2877 0.2737 0.2506 0.0284  -0.0198 -0.0194 476  TYR A CG  
3804 C CD1 . TYR A 460 ? 0.2888 0.2707 0.2497 0.0291  -0.0213 -0.0187 476  TYR A CD1 
3805 C CD2 . TYR A 460 ? 0.2957 0.2836 0.2589 0.0280  -0.0198 -0.0192 476  TYR A CD2 
3806 C CE1 . TYR A 460 ? 0.2949 0.2745 0.2548 0.0295  -0.0226 -0.0174 476  TYR A CE1 
3807 C CE2 . TYR A 460 ? 0.2964 0.2825 0.2580 0.0284  -0.0212 -0.0177 476  TYR A CE2 
3808 C CZ  . TYR A 460 ? 0.3036 0.2854 0.2639 0.0293  -0.0225 -0.0166 476  TYR A CZ  
3809 O OH  . TYR A 460 ? 0.3054 0.2853 0.2646 0.0298  -0.0236 -0.0149 476  TYR A OH  
3810 N N   . SER A 461 ? 0.2661 0.2597 0.2339 0.0294  -0.0151 -0.0228 477  SER A N   
3811 C CA  . SER A 461 ? 0.2602 0.2568 0.2310 0.0289  -0.0127 -0.0230 477  SER A CA  
3812 C C   . SER A 461 ? 0.2588 0.2575 0.2300 0.0306  -0.0121 -0.0243 477  SER A C   
3813 O O   . SER A 461 ? 0.2563 0.2580 0.2307 0.0303  -0.0100 -0.0248 477  SER A O   
3814 C CB  . SER A 461 ? 0.2577 0.2536 0.2289 0.0278  -0.0117 -0.0210 477  SER A CB  
3815 O OG  . SER A 461 ? 0.2582 0.2533 0.2308 0.0261  -0.0111 -0.0197 477  SER A OG  
3816 N N   . GLY A 462 ? 0.2595 0.2564 0.2280 0.0323  -0.0137 -0.0250 478  GLY A N   
3817 C CA  . GLY A 462 ? 0.2583 0.2569 0.2271 0.0340  -0.0129 -0.0262 478  GLY A CA  
3818 C C   . GLY A 462 ? 0.2575 0.2573 0.2264 0.0338  -0.0112 -0.0257 478  GLY A C   
3819 O O   . GLY A 462 ? 0.2531 0.2559 0.2242 0.0346  -0.0095 -0.0262 478  GLY A O   
3820 N N   . ILE A 463 ? 0.2578 0.2558 0.2247 0.0328  -0.0117 -0.0243 479  ILE A N   
3821 C CA  . ILE A 463 ? 0.2582 0.2577 0.2245 0.0326  -0.0105 -0.0232 479  ILE A CA  
3822 C C   . ILE A 463 ? 0.2636 0.2606 0.2251 0.0327  -0.0122 -0.0238 479  ILE A C   
3823 O O   . ILE A 463 ? 0.2645 0.2580 0.2240 0.0326  -0.0141 -0.0245 479  ILE A O   
3824 C CB  . ILE A 463 ? 0.2561 0.2572 0.2252 0.0308  -0.0090 -0.0207 479  ILE A CB  
3825 C CG1 . ILE A 463 ? 0.2521 0.2505 0.2199 0.0294  -0.0107 -0.0194 479  ILE A CG1 
3826 C CG2 . ILE A 463 ? 0.2518 0.2552 0.2259 0.0304  -0.0068 -0.0208 479  ILE A CG2 
3827 C CD1 . ILE A 463 ? 0.2604 0.2581 0.2249 0.0288  -0.0120 -0.0182 479  ILE A CD1 
3828 N N   . GLU A 464 ? 0.2674 0.2662 0.2272 0.0329  -0.0113 -0.0234 480  GLU A N   
3829 C CA  . GLU A 464 ? 0.2749 0.2720 0.2299 0.0327  -0.0127 -0.0244 480  GLU A CA  
3830 C C   . GLU A 464 ? 0.2771 0.2779 0.2309 0.0319  -0.0119 -0.0226 480  GLU A C   
3831 O O   . GLU A 464 ? 0.2741 0.2787 0.2310 0.0323  -0.0098 -0.0208 480  GLU A O   
3832 C CB  . GLU A 464 ? 0.2789 0.2744 0.2319 0.0346  -0.0126 -0.0274 480  GLU A CB  
3833 C CG  . GLU A 464 ? 0.2862 0.2853 0.2405 0.0362  -0.0102 -0.0278 480  GLU A CG  
3834 C CD  . GLU A 464 ? 0.3010 0.2983 0.2533 0.0382  -0.0098 -0.0307 480  GLU A CD  
3835 O OE1 . GLU A 464 ? 0.3066 0.3000 0.2583 0.0388  -0.0110 -0.0322 480  GLU A OE1 
3836 O OE2 . GLU A 464 ? 0.3102 0.3102 0.2620 0.0392  -0.0080 -0.0312 480  GLU A OE2 
3837 N N   . PRO A 465 ? 0.2827 0.2829 0.2324 0.0307  -0.0135 -0.0230 481  PRO A N   
3838 C CA  . PRO A 465 ? 0.2859 0.2906 0.2337 0.0300  -0.0131 -0.0212 481  PRO A CA  
3839 C C   . PRO A 465 ? 0.2907 0.2982 0.2373 0.0316  -0.0110 -0.0222 481  PRO A C   
3840 O O   . PRO A 465 ? 0.2923 0.2974 0.2380 0.0332  -0.0106 -0.0252 481  PRO A O   
3841 C CB  . PRO A 465 ? 0.2889 0.2917 0.2317 0.0283  -0.0155 -0.0228 481  PRO A CB  
3842 C CG  . PRO A 465 ? 0.2912 0.2889 0.2351 0.0277  -0.0171 -0.0237 481  PRO A CG  
3843 C CD  . PRO A 465 ? 0.2858 0.2815 0.2326 0.0298  -0.0159 -0.0248 481  PRO A CD  
3844 N N   . PRO A 466 ? 0.2950 0.3078 0.2419 0.0315  -0.0097 -0.0193 482  PRO A N   
3845 C CA  . PRO A 466 ? 0.2996 0.3158 0.2454 0.0330  -0.0075 -0.0197 482  PRO A CA  
3846 C C   . PRO A 466 ? 0.3104 0.3262 0.2496 0.0329  -0.0084 -0.0231 482  PRO A C   
3847 O O   . PRO A 466 ? 0.3159 0.3327 0.2536 0.0345  -0.0066 -0.0248 482  PRO A O   
3848 C CB  . PRO A 466 ? 0.2977 0.3199 0.2456 0.0326  -0.0061 -0.0150 482  PRO A CB  
3849 C CG  . PRO A 466 ? 0.2972 0.3194 0.2446 0.0305  -0.0084 -0.0129 482  PRO A CG  
3850 C CD  . PRO A 466 ? 0.2917 0.3080 0.2408 0.0301  -0.0098 -0.0150 482  PRO A CD  
3851 N N   . VAL A 467 ? 0.3156 0.3299 0.2510 0.0310  -0.0110 -0.0242 483  VAL A N   
3852 C CA  . VAL A 467 ? 0.3236 0.3370 0.2525 0.0303  -0.0119 -0.0280 483  VAL A CA  
3853 C C   . VAL A 467 ? 0.3269 0.3338 0.2546 0.0292  -0.0140 -0.0313 483  VAL A C   
3854 O O   . VAL A 467 ? 0.3224 0.3266 0.2534 0.0287  -0.0152 -0.0299 483  VAL A O   
3855 C CB  . VAL A 467 ? 0.3279 0.3474 0.2529 0.0283  -0.0129 -0.0261 483  VAL A CB  
3856 C CG1 . VAL A 467 ? 0.3293 0.3554 0.2550 0.0296  -0.0105 -0.0228 483  VAL A CG1 
3857 C CG2 . VAL A 467 ? 0.3274 0.3479 0.2545 0.0261  -0.0152 -0.0229 483  VAL A CG2 
3858 N N   . VAL A 468 ? 0.3329 0.3370 0.2557 0.0290  -0.0141 -0.0357 484  VAL A N   
3859 C CA  . VAL A 468 ? 0.3370 0.3347 0.2587 0.0280  -0.0157 -0.0391 484  VAL A CA  
3860 C C   . VAL A 468 ? 0.3369 0.3353 0.2572 0.0249  -0.0184 -0.0381 484  VAL A C   
3861 O O   . VAL A 468 ? 0.3408 0.3440 0.2573 0.0229  -0.0193 -0.0379 484  VAL A O   
3862 C CB  . VAL A 468 ? 0.3460 0.3404 0.2634 0.0285  -0.0145 -0.0444 484  VAL A CB  
3863 C CG1 . VAL A 468 ? 0.3510 0.3382 0.2678 0.0274  -0.0158 -0.0476 484  VAL A CG1 
3864 C CG2 . VAL A 468 ? 0.3446 0.3382 0.2640 0.0319  -0.0117 -0.0451 484  VAL A CG2 
3865 N N   . ARG A 469 ? 0.3299 0.3242 0.2534 0.0243  -0.0198 -0.0371 485  ARG A N   
3866 C CA  . ARG A 469 ? 0.3302 0.3243 0.2531 0.0214  -0.0223 -0.0363 485  ARG A CA  
3867 C C   . ARG A 469 ? 0.3368 0.3240 0.2581 0.0204  -0.0232 -0.0406 485  ARG A C   
3868 O O   . ARG A 469 ? 0.3380 0.3203 0.2598 0.0224  -0.0217 -0.0433 485  ARG A O   
3869 C CB  . ARG A 469 ? 0.3210 0.3159 0.2491 0.0213  -0.0230 -0.0317 485  ARG A CB  
3870 C CG  . ARG A 469 ? 0.3095 0.3099 0.2407 0.0226  -0.0215 -0.0275 485  ARG A CG  
3871 C CD  . ARG A 469 ? 0.2969 0.3046 0.2258 0.0213  -0.0217 -0.0253 485  ARG A CD  
3872 N NE  . ARG A 469 ? 0.2873 0.2978 0.2176 0.0190  -0.0237 -0.0220 485  ARG A NE  
3873 C CZ  . ARG A 469 ? 0.2914 0.3087 0.2198 0.0175  -0.0246 -0.0196 485  ARG A CZ  
3874 N NH1 . ARG A 469 ? 0.2870 0.3090 0.2117 0.0179  -0.0237 -0.0202 485  ARG A NH1 
3875 N NH2 . ARG A 469 ? 0.2769 0.2968 0.2073 0.0156  -0.0263 -0.0163 485  ARG A NH2 
3876 N N   . SER A 470 ? 0.3411 0.3280 0.2611 0.0174  -0.0254 -0.0410 486  SER A N   
3877 C CA  . SER A 470 ? 0.3497 0.3299 0.2688 0.0160  -0.0261 -0.0449 486  SER A CA  
3878 C C   . SER A 470 ? 0.3518 0.3319 0.2727 0.0133  -0.0286 -0.0428 486  SER A C   
3879 O O   . SER A 470 ? 0.3481 0.3326 0.2714 0.0129  -0.0295 -0.0382 486  SER A O   
3880 C CB  . SER A 470 ? 0.3584 0.3383 0.2719 0.0145  -0.0257 -0.0502 486  SER A CB  
3881 O OG  . SER A 470 ? 0.3577 0.3437 0.2679 0.0111  -0.0277 -0.0499 486  SER A OG  
3882 N N   . GLU A 471 ? 0.3607 0.3354 0.2808 0.0113  -0.0294 -0.0461 487  GLU A N   
3883 C CA  . GLU A 471 ? 0.3626 0.3370 0.2846 0.0085  -0.0317 -0.0445 487  GLU A CA  
3884 C C   . GLU A 471 ? 0.3667 0.3480 0.2855 0.0049  -0.0338 -0.0446 487  GLU A C   
3885 O O   . GLU A 471 ? 0.3672 0.3497 0.2875 0.0022  -0.0358 -0.0430 487  GLU A O   
3886 C CB  . GLU A 471 ? 0.3674 0.3334 0.2905 0.0077  -0.0315 -0.0477 487  GLU A CB  
3887 C CG  . GLU A 471 ? 0.3720 0.3322 0.2989 0.0112  -0.0298 -0.0465 487  GLU A CG  
3888 C CD  . GLU A 471 ? 0.3677 0.3293 0.2989 0.0122  -0.0305 -0.0410 487  GLU A CD  
3889 O OE1 . GLU A 471 ? 0.3610 0.3265 0.2930 0.0099  -0.0323 -0.0384 487  GLU A OE1 
3890 O OE2 . GLU A 471 ? 0.3734 0.3326 0.3072 0.0152  -0.0292 -0.0395 487  GLU A OE2 
3891 N N   . LYS A 472 ? 0.3690 0.3553 0.2835 0.0049  -0.0332 -0.0461 488  LYS A N   
3892 C CA  . LYS A 472 ? 0.3725 0.3674 0.2839 0.0021  -0.0351 -0.0450 488  LYS A CA  
3893 C C   . LYS A 472 ? 0.3602 0.3620 0.2751 0.0032  -0.0355 -0.0382 488  LYS A C   
3894 O O   . LYS A 472 ? 0.3589 0.3678 0.2733 0.0009  -0.0375 -0.0354 488  LYS A O   
3895 C CB  . LYS A 472 ? 0.3814 0.3798 0.2868 0.0019  -0.0341 -0.0489 488  LYS A CB  
3896 C CG  . LYS A 472 ? 0.4059 0.3986 0.3074 0.0000  -0.0337 -0.0561 488  LYS A CG  
3897 C CD  . LYS A 472 ? 0.4365 0.4321 0.3321 0.0003  -0.0320 -0.0600 488  LYS A CD  
3898 C CE  . LYS A 472 ? 0.4636 0.4520 0.3560 -0.0010 -0.0307 -0.0676 488  LYS A CE  
3899 N NZ  . LYS A 472 ? 0.4828 0.4714 0.3710 0.0010  -0.0278 -0.0710 488  LYS A NZ  
3900 N N   . ASP A 473 ? 0.3492 0.3488 0.2677 0.0067  -0.0336 -0.0354 489  ASP A N   
3901 C CA  . ASP A 473 ? 0.3383 0.3428 0.2610 0.0079  -0.0333 -0.0292 489  ASP A CA  
3902 C C   . ASP A 473 ? 0.3312 0.3316 0.2590 0.0078  -0.0338 -0.0267 489  ASP A C   
3903 O O   . ASP A 473 ? 0.3295 0.3228 0.2579 0.0078  -0.0339 -0.0295 489  ASP A O   
3904 C CB  . ASP A 473 ? 0.3350 0.3402 0.2588 0.0114  -0.0305 -0.0280 489  ASP A CB  
3905 C CG  . ASP A 473 ? 0.3409 0.3490 0.2596 0.0119  -0.0295 -0.0310 489  ASP A CG  
3906 O OD1 . ASP A 473 ? 0.3369 0.3521 0.2526 0.0102  -0.0304 -0.0300 489  ASP A OD1 
3907 O OD2 . ASP A 473 ? 0.3375 0.3409 0.2553 0.0139  -0.0277 -0.0343 489  ASP A OD2 
3908 N N   . PHE A 474 ? 0.3229 0.3278 0.2548 0.0079  -0.0339 -0.0213 490  PHE A N   
3909 C CA  . PHE A 474 ? 0.3153 0.3166 0.2521 0.0082  -0.0338 -0.0186 490  PHE A CA  
3910 C C   . PHE A 474 ? 0.3073 0.3123 0.2486 0.0101  -0.0320 -0.0136 490  PHE A C   
3911 O O   . PHE A 474 ? 0.3040 0.3150 0.2473 0.0092  -0.0324 -0.0094 490  PHE A O   
3912 C CB  . PHE A 474 ? 0.3156 0.3176 0.2533 0.0050  -0.0363 -0.0178 490  PHE A CB  
3913 C CG  . PHE A 474 ? 0.3141 0.3112 0.2562 0.0052  -0.0362 -0.0160 490  PHE A CG  
3914 C CD1 . PHE A 474 ? 0.3152 0.3044 0.2572 0.0063  -0.0355 -0.0190 490  PHE A CD1 
3915 C CD2 . PHE A 474 ? 0.3089 0.3094 0.2554 0.0045  -0.0365 -0.0111 490  PHE A CD2 
3916 C CE1 . PHE A 474 ? 0.3158 0.3010 0.2615 0.0066  -0.0353 -0.0171 490  PHE A CE1 
3917 C CE2 . PHE A 474 ? 0.3054 0.3014 0.2555 0.0047  -0.0361 -0.0096 490  PHE A CE2 
3918 C CZ  . PHE A 474 ? 0.3029 0.2915 0.2524 0.0057  -0.0356 -0.0126 490  PHE A CZ  
3919 N N   . ASP A 475 ? 0.3007 0.3020 0.2437 0.0127  -0.0298 -0.0141 491  ASP A N   
3920 C CA  . ASP A 475 ? 0.2950 0.2996 0.2415 0.0146  -0.0274 -0.0106 491  ASP A CA  
3921 C C   . ASP A 475 ? 0.2879 0.2915 0.2399 0.0150  -0.0263 -0.0071 491  ASP A C   
3922 O O   . ASP A 475 ? 0.2842 0.2915 0.2399 0.0159  -0.0243 -0.0036 491  ASP A O   
3923 C CB  . ASP A 475 ? 0.2935 0.2961 0.2388 0.0171  -0.0255 -0.0133 491  ASP A CB  
3924 C CG  . ASP A 475 ? 0.3013 0.3066 0.2417 0.0171  -0.0258 -0.0159 491  ASP A CG  
3925 O OD1 . ASP A 475 ? 0.3000 0.3116 0.2394 0.0161  -0.0261 -0.0135 491  ASP A OD1 
3926 O OD2 . ASP A 475 ? 0.3038 0.3052 0.2414 0.0180  -0.0255 -0.0201 491  ASP A OD2 
3927 N N   . ALA A 476 ? 0.2868 0.2855 0.2396 0.0143  -0.0273 -0.0080 492  ALA A N   
3928 C CA  . ALA A 476 ? 0.2804 0.2779 0.2380 0.0145  -0.0261 -0.0051 492  ALA A CA  
3929 C C   . ALA A 476 ? 0.2770 0.2796 0.2386 0.0137  -0.0254 -0.0001 492  ALA A C   
3930 O O   . ALA A 476 ? 0.2716 0.2750 0.2374 0.0148  -0.0229 0.0022  492  ALA A O   
3931 C CB  . ALA A 476 ? 0.2823 0.2742 0.2396 0.0137  -0.0274 -0.0065 492  ALA A CB  
3932 N N   . PRO A 477 ? 0.2797 0.2862 0.2404 0.0117  -0.0275 0.0014  493  PRO A N   
3933 C CA  . PRO A 477 ? 0.2771 0.2891 0.2423 0.0111  -0.0269 0.0067  493  PRO A CA  
3934 C C   . PRO A 477 ? 0.2761 0.2936 0.2434 0.0126  -0.0245 0.0098  493  PRO A C   
3935 O O   . PRO A 477 ? 0.2722 0.2943 0.2441 0.0125  -0.0234 0.0148  493  PRO A O   
3936 C CB  . PRO A 477 ? 0.2809 0.2964 0.2438 0.0084  -0.0302 0.0070  493  PRO A CB  
3937 C CG  . PRO A 477 ? 0.2837 0.2933 0.2424 0.0074  -0.0321 0.0018  493  PRO A CG  
3938 C CD  . PRO A 477 ? 0.2836 0.2895 0.2398 0.0097  -0.0305 -0.0016 493  PRO A CD  
3939 N N   . ALA A 478 ? 0.2772 0.2943 0.2417 0.0141  -0.0236 0.0072  494  ALA A N   
3940 C CA  . ALA A 478 ? 0.2769 0.2986 0.2438 0.0157  -0.0209 0.0101  494  ALA A CA  
3941 C C   . ALA A 478 ? 0.2737 0.2934 0.2469 0.0171  -0.0173 0.0122  494  ALA A C   
3942 O O   . ALA A 478 ? 0.2729 0.2962 0.2500 0.0183  -0.0145 0.0156  494  ALA A O   
3943 C CB  . ALA A 478 ? 0.2795 0.3011 0.2420 0.0169  -0.0206 0.0066  494  ALA A CB  
3944 N N   . LYS A 479 ? 0.2721 0.2861 0.2462 0.0168  -0.0173 0.0103  495  LYS A N   
3945 C CA  . LYS A 479 ? 0.2694 0.2814 0.2491 0.0175  -0.0141 0.0118  495  LYS A CA  
3946 C C   . LYS A 479 ? 0.2681 0.2816 0.2519 0.0164  -0.0140 0.0161  495  LYS A C   
3947 O O   . LYS A 479 ? 0.2650 0.2773 0.2469 0.0149  -0.0167 0.0157  495  LYS A O   
3948 C CB  . LYS A 479 ? 0.2715 0.2772 0.2495 0.0178  -0.0142 0.0075  495  LYS A CB  
3949 C CG  . LYS A 479 ? 0.2733 0.2768 0.2562 0.0181  -0.0110 0.0082  495  LYS A CG  
3950 C CD  . LYS A 479 ? 0.2836 0.2890 0.2703 0.0193  -0.0074 0.0090  495  LYS A CD  
3951 C CE  . LYS A 479 ? 0.2917 0.2955 0.2840 0.0192  -0.0038 0.0101  495  LYS A CE  
3952 N NZ  . LYS A 479 ? 0.2951 0.3015 0.2928 0.0200  0.0001  0.0124  495  LYS A NZ  
3953 N N   . TYR A 480 ? 0.2644 0.2805 0.2544 0.0171  -0.0106 0.0203  496  TYR A N   
3954 C CA  . TYR A 480 ? 0.2652 0.2838 0.2601 0.0164  -0.0100 0.0252  496  TYR A CA  
3955 C C   . TYR A 480 ? 0.2644 0.2787 0.2590 0.0151  -0.0113 0.0239  496  TYR A C   
3956 O O   . TYR A 480 ? 0.2649 0.2811 0.2592 0.0137  -0.0138 0.0258  496  TYR A O   
3957 C CB  . TYR A 480 ? 0.2635 0.2836 0.2660 0.0177  -0.0051 0.0292  496  TYR A CB  
3958 C CG  . TYR A 480 ? 0.2694 0.2910 0.2777 0.0171  -0.0039 0.0339  496  TYR A CG  
3959 C CD1 . TYR A 480 ? 0.2735 0.3016 0.2839 0.0168  -0.0053 0.0392  496  TYR A CD1 
3960 C CD2 . TYR A 480 ? 0.2750 0.2918 0.2867 0.0169  -0.0014 0.0331  496  TYR A CD2 
3961 C CE1 . TYR A 480 ? 0.2785 0.3083 0.2947 0.0164  -0.0041 0.0439  496  TYR A CE1 
3962 C CE2 . TYR A 480 ? 0.2814 0.2994 0.2986 0.0166  0.0000  0.0375  496  TYR A CE2 
3963 C CZ  . TYR A 480 ? 0.2791 0.3035 0.2988 0.0164  -0.0013 0.0430  496  TYR A CZ  
3964 O OH  . TYR A 480 ? 0.2910 0.3169 0.3167 0.0161  0.0001  0.0476  496  TYR A OH  
3965 N N   . HIS A 481 ? 0.2628 0.2717 0.2575 0.0155  -0.0096 0.0207  497  HIS A N   
3966 C CA  . HIS A 481 ? 0.2633 0.2680 0.2581 0.0146  -0.0101 0.0197  497  HIS A CA  
3967 C C   . HIS A 481 ? 0.2669 0.2700 0.2564 0.0132  -0.0145 0.0177  497  HIS A C   
3968 O O   . HIS A 481 ? 0.2671 0.2687 0.2576 0.0121  -0.0154 0.0187  497  HIS A O   
3969 C CB  . HIS A 481 ? 0.2609 0.2608 0.2554 0.0152  -0.0079 0.0162  497  HIS A CB  
3970 C CG  . HIS A 481 ? 0.2637 0.2643 0.2638 0.0161  -0.0032 0.0176  497  HIS A CG  
3971 N ND1 . HIS A 481 ? 0.2585 0.2619 0.2603 0.0171  -0.0014 0.0181  497  HIS A ND1 
3972 C CD2 . HIS A 481 ? 0.2612 0.2600 0.2660 0.0159  0.0003  0.0184  497  HIS A CD2 
3973 C CE1 . HIS A 481 ? 0.2626 0.2656 0.2701 0.0176  0.0031  0.0192  497  HIS A CE1 
3974 N NE2 . HIS A 481 ? 0.2642 0.2643 0.2735 0.0168  0.0043  0.0192  497  HIS A NE2 
3975 N N   . ILE A 482 ? 0.2695 0.2728 0.2540 0.0134  -0.0169 0.0147  498  ILE A N   
3976 C CA  . ILE A 482 ? 0.2757 0.2773 0.2555 0.0120  -0.0206 0.0123  498  ILE A CA  
3977 C C   . ILE A 482 ? 0.2759 0.2824 0.2564 0.0103  -0.0228 0.0154  498  ILE A C   
3978 O O   . ILE A 482 ? 0.2782 0.2834 0.2582 0.0086  -0.0250 0.0154  498  ILE A O   
3979 C CB  . ILE A 482 ? 0.2793 0.2788 0.2536 0.0128  -0.0219 0.0077  498  ILE A CB  
3980 C CG1 . ILE A 482 ? 0.2844 0.2794 0.2584 0.0143  -0.0202 0.0048  498  ILE A CG1 
3981 C CG2 . ILE A 482 ? 0.2818 0.2794 0.2518 0.0113  -0.0254 0.0051  498  ILE A CG2 
3982 C CD1 . ILE A 482 ? 0.3110 0.3039 0.2805 0.0153  -0.0212 0.0006  498  ILE A CD1 
3983 N N   . SER A 483 ? 0.2758 0.2884 0.2577 0.0106  -0.0223 0.0183  499  SER A N   
3984 C CA  . SER A 483 ? 0.2765 0.2953 0.2598 0.0090  -0.0242 0.0221  499  SER A CA  
3985 C C   . SER A 483 ? 0.2740 0.2939 0.2635 0.0085  -0.0230 0.0267  499  SER A C   
3986 O O   . SER A 483 ? 0.2771 0.3000 0.2675 0.0066  -0.0253 0.0287  499  SER A O   
3987 C CB  . SER A 483 ? 0.2781 0.3039 0.2618 0.0098  -0.0236 0.0249  499  SER A CB  
3988 O OG  . SER A 483 ? 0.2808 0.3075 0.2580 0.0093  -0.0260 0.0211  499  SER A OG  
3989 N N   . ALA A 484 ? 0.2682 0.2857 0.2623 0.0101  -0.0191 0.0282  500  ALA A N   
3990 C CA  . ALA A 484 ? 0.2647 0.2833 0.2654 0.0100  -0.0170 0.0328  500  ALA A CA  
3991 C C   . ALA A 484 ? 0.2638 0.2765 0.2646 0.0093  -0.0169 0.0310  500  ALA A C   
3992 O O   . ALA A 484 ? 0.2598 0.2727 0.2660 0.0092  -0.0147 0.0344  500  ALA A O   
3993 C CB  . ALA A 484 ? 0.2621 0.2818 0.2684 0.0120  -0.0122 0.0357  500  ALA A CB  
3994 N N   . ASP A 485 ? 0.2638 0.2715 0.2590 0.0088  -0.0190 0.0260  501  ASP A N   
3995 C CA  . ASP A 485 ? 0.2667 0.2689 0.2615 0.0082  -0.0191 0.0243  501  ASP A CA  
3996 C C   . ASP A 485 ? 0.2654 0.2650 0.2639 0.0095  -0.0148 0.0251  501  ASP A C   
3997 O O   . ASP A 485 ? 0.2661 0.2647 0.2682 0.0090  -0.0135 0.0274  501  ASP A O   
3998 C CB  . ASP A 485 ? 0.2654 0.2692 0.2617 0.0061  -0.0215 0.0267  501  ASP A CB  
3999 C CG  . ASP A 485 ? 0.2704 0.2687 0.2663 0.0056  -0.0215 0.0254  501  ASP A CG  
4000 O OD1 . ASP A 485 ? 0.2619 0.2551 0.2540 0.0063  -0.0215 0.0215  501  ASP A OD1 
4001 O OD2 . ASP A 485 ? 0.2685 0.2680 0.2684 0.0044  -0.0214 0.0286  501  ASP A OD2 
4002 N N   . VAL A 486 ? 0.2638 0.2623 0.2617 0.0109  -0.0126 0.0230  502  VAL A N   
4003 C CA  . VAL A 486 ? 0.2608 0.2567 0.2616 0.0118  -0.0085 0.0226  502  VAL A CA  
4004 C C   . VAL A 486 ? 0.2617 0.2530 0.2575 0.0122  -0.0091 0.0175  502  VAL A C   
4005 O O   . VAL A 486 ? 0.2638 0.2552 0.2562 0.0129  -0.0102 0.0147  502  VAL A O   
4006 C CB  . VAL A 486 ? 0.2602 0.2588 0.2655 0.0130  -0.0048 0.0244  502  VAL A CB  
4007 C CG1 . VAL A 486 ? 0.2560 0.2515 0.2642 0.0135  -0.0004 0.0230  502  VAL A CG1 
4008 C CG2 . VAL A 486 ? 0.2599 0.2636 0.2707 0.0129  -0.0040 0.0303  502  VAL A CG2 
4009 N N   . GLU A 487 ? 0.2602 0.2482 0.2557 0.0119  -0.0084 0.0166  503  GLU A N   
4010 C CA  . GLU A 487 ? 0.2607 0.2451 0.2519 0.0123  -0.0088 0.0125  503  GLU A CA  
4011 C C   . GLU A 487 ? 0.2566 0.2416 0.2480 0.0133  -0.0064 0.0101  503  GLU A C   
4012 O O   . GLU A 487 ? 0.2549 0.2414 0.2509 0.0135  -0.0029 0.0116  503  GLU A O   
4013 C CB  . GLU A 487 ? 0.2633 0.2451 0.2551 0.0118  -0.0075 0.0128  503  GLU A CB  
4014 C CG  . GLU A 487 ? 0.2694 0.2483 0.2567 0.0122  -0.0082 0.0093  503  GLU A CG  
4015 C CD  . GLU A 487 ? 0.2832 0.2620 0.2713 0.0125  -0.0046 0.0073  503  GLU A CD  
4016 O OE1 . GLU A 487 ? 0.2763 0.2567 0.2679 0.0126  -0.0018 0.0076  503  GLU A OE1 
4017 O OE2 . GLU A 487 ? 0.2838 0.2610 0.2691 0.0125  -0.0046 0.0054  503  GLU A OE2 
4018 N N   . TYR A 488 ? 0.2528 0.2366 0.2399 0.0140  -0.0080 0.0065  504  TYR A N   
4019 C CA  . TYR A 488 ? 0.2495 0.2344 0.2369 0.0148  -0.0061 0.0041  504  TYR A CA  
4020 C C   . TYR A 488 ? 0.2491 0.2325 0.2352 0.0148  -0.0047 0.0009  504  TYR A C   
4021 O O   . TYR A 488 ? 0.2509 0.2353 0.2388 0.0150  -0.0022 -0.0007 504  TYR A O   
4022 C CB  . TYR A 488 ? 0.2479 0.2339 0.2322 0.0156  -0.0086 0.0027  504  TYR A CB  
4023 C CG  . TYR A 488 ? 0.2415 0.2302 0.2285 0.0163  -0.0061 0.0025  504  TYR A CG  
4024 C CD1 . TYR A 488 ? 0.2333 0.2249 0.2239 0.0163  -0.0049 0.0060  504  TYR A CD1 
4025 C CD2 . TYR A 488 ? 0.2403 0.2288 0.2266 0.0169  -0.0050 -0.0007 504  TYR A CD2 
4026 C CE1 . TYR A 488 ? 0.2403 0.2342 0.2338 0.0171  -0.0024 0.0063  504  TYR A CE1 
4027 C CE2 . TYR A 488 ? 0.2421 0.2329 0.2314 0.0175  -0.0025 -0.0008 504  TYR A CE2 
4028 C CZ  . TYR A 488 ? 0.2420 0.2352 0.2349 0.0176  -0.0011 0.0027  504  TYR A CZ  
4029 O OH  . TYR A 488 ? 0.2379 0.2334 0.2342 0.0182  0.0015  0.0031  504  TYR A OH  
4030 N N   . LEU A 489 ? 0.2502 0.2314 0.2334 0.0146  -0.0062 0.0002  505  LEU A N   
4031 C CA  . LEU A 489 ? 0.2520 0.2327 0.2333 0.0146  -0.0053 -0.0025 505  LEU A CA  
4032 C C   . LEU A 489 ? 0.2518 0.2331 0.2368 0.0137  -0.0009 -0.0030 505  LEU A C   
4033 O O   . LEU A 489 ? 0.2531 0.2352 0.2373 0.0134  0.0004  -0.0062 505  LEU A O   
4034 C CB  . LEU A 489 ? 0.2542 0.2328 0.2322 0.0145  -0.0072 -0.0021 505  LEU A CB  
4035 C CG  . LEU A 489 ? 0.2522 0.2312 0.2269 0.0148  -0.0077 -0.0048 505  LEU A CG  
4036 C CD1 . LEU A 489 ? 0.2570 0.2364 0.2288 0.0162  -0.0104 -0.0066 505  LEU A CD1 
4037 C CD2 . LEU A 489 ? 0.2557 0.2330 0.2284 0.0146  -0.0084 -0.0035 505  LEU A CD2 
4038 N N   . ARG A 490 ? 0.2493 0.2305 0.2386 0.0131  0.0012  0.0000  506  ARG A N   
4039 C CA  . ARG A 490 ? 0.2507 0.2321 0.2447 0.0124  0.0060  -0.0002 506  ARG A CA  
4040 C C   . ARG A 490 ? 0.2492 0.2321 0.2450 0.0125  0.0082  -0.0030 506  ARG A C   
4041 O O   . ARG A 490 ? 0.2498 0.2325 0.2474 0.0116  0.0117  -0.0054 506  ARG A O   
4042 C CB  . ARG A 490 ? 0.2480 0.2297 0.2474 0.0123  0.0080  0.0042  506  ARG A CB  
4043 C CG  . ARG A 490 ? 0.2507 0.2346 0.2519 0.0131  0.0066  0.0068  506  ARG A CG  
4044 C CD  . ARG A 490 ? 0.2468 0.2320 0.2534 0.0131  0.0081  0.0118  506  ARG A CD  
4045 N NE  . ARG A 490 ? 0.2447 0.2291 0.2497 0.0126  0.0056  0.0139  506  ARG A NE  
4046 C CZ  . ARG A 490 ? 0.2511 0.2369 0.2603 0.0123  0.0061  0.0184  506  ARG A CZ  
4047 N NH1 . ARG A 490 ? 0.2489 0.2371 0.2642 0.0128  0.0091  0.0217  506  ARG A NH1 
4048 N NH2 . ARG A 490 ? 0.2573 0.2423 0.2651 0.0117  0.0037  0.0199  506  ARG A NH2 
4049 N N   . TYR A 491 ? 0.2475 0.2318 0.2426 0.0134  0.0062  -0.0028 507  TYR A N   
4050 C CA  . TYR A 491 ? 0.2460 0.2318 0.2433 0.0136  0.0083  -0.0049 507  TYR A CA  
4051 C C   . TYR A 491 ? 0.2469 0.2333 0.2404 0.0134  0.0071  -0.0095 507  TYR A C   
4052 O O   . TYR A 491 ? 0.2469 0.2342 0.2427 0.0126  0.0100  -0.0123 507  TYR A O   
4053 C CB  . TYR A 491 ? 0.2461 0.2337 0.2442 0.0148  0.0069  -0.0028 507  TYR A CB  
4054 C CG  . TYR A 491 ? 0.2463 0.2347 0.2489 0.0150  0.0084  0.0020  507  TYR A CG  
4055 C CD1 . TYR A 491 ? 0.2548 0.2436 0.2640 0.0147  0.0132  0.0036  507  TYR A CD1 
4056 C CD2 . TYR A 491 ? 0.2489 0.2379 0.2495 0.0153  0.0050  0.0049  507  TYR A CD2 
4057 C CE1 . TYR A 491 ? 0.2584 0.2486 0.2723 0.0151  0.0146  0.0087  507  TYR A CE1 
4058 C CE2 . TYR A 491 ? 0.2558 0.2465 0.2607 0.0153  0.0061  0.0097  507  TYR A CE2 
4059 C CZ  . TYR A 491 ? 0.2612 0.2527 0.2728 0.0154  0.0109  0.0118  507  TYR A CZ  
4060 O OH  . TYR A 491 ? 0.2769 0.2708 0.2932 0.0158  0.0120  0.0171  507  TYR A OH  
4061 N N   . LEU A 492 ? 0.2447 0.2307 0.2328 0.0140  0.0031  -0.0102 508  LEU A N   
4062 C CA  . LEU A 492 ? 0.2449 0.2321 0.2296 0.0139  0.0019  -0.0139 508  LEU A CA  
4063 C C   . LEU A 492 ? 0.2465 0.2338 0.2314 0.0123  0.0044  -0.0159 508  LEU A C   
4064 O O   . LEU A 492 ? 0.2447 0.2339 0.2299 0.0114  0.0059  -0.0194 508  LEU A O   
4065 C CB  . LEU A 492 ? 0.2450 0.2316 0.2246 0.0151  -0.0025 -0.0135 508  LEU A CB  
4066 C CG  . LEU A 492 ? 0.2516 0.2400 0.2276 0.0153  -0.0041 -0.0163 508  LEU A CG  
4067 C CD1 . LEU A 492 ? 0.2552 0.2464 0.2324 0.0155  -0.0035 -0.0192 508  LEU A CD1 
4068 C CD2 . LEU A 492 ? 0.2497 0.2368 0.2217 0.0167  -0.0080 -0.0151 508  LEU A CD2 
4069 N N   . VAL A 493 ? 0.2474 0.2328 0.2322 0.0118  0.0050  -0.0138 509  VAL A N   
4070 C CA  . VAL A 493 ? 0.2505 0.2358 0.2356 0.0102  0.0079  -0.0156 509  VAL A CA  
4071 C C   . VAL A 493 ? 0.2530 0.2385 0.2434 0.0090  0.0129  -0.0175 509  VAL A C   
4072 O O   . VAL A 493 ? 0.2512 0.2382 0.2412 0.0075  0.0148  -0.0215 509  VAL A O   
4073 C CB  . VAL A 493 ? 0.2527 0.2357 0.2376 0.0101  0.0082  -0.0124 509  VAL A CB  
4074 C CG1 . VAL A 493 ? 0.2506 0.2336 0.2357 0.0085  0.0116  -0.0144 509  VAL A CG1 
4075 C CG2 . VAL A 493 ? 0.2468 0.2292 0.2270 0.0112  0.0036  -0.0107 509  VAL A CG2 
4076 N N   . SER A 494 ? 0.2550 0.2395 0.2505 0.0095  0.0149  -0.0146 510  SER A N   
4077 C CA  . SER A 494 ? 0.2622 0.2465 0.2638 0.0086  0.0200  -0.0157 510  SER A CA  
4078 C C   . SER A 494 ? 0.2641 0.2505 0.2661 0.0078  0.0208  -0.0200 510  SER A C   
4079 O O   . SER A 494 ? 0.2656 0.2520 0.2700 0.0060  0.0246  -0.0235 510  SER A O   
4080 C CB  . SER A 494 ? 0.2591 0.2429 0.2660 0.0098  0.0213  -0.0110 510  SER A CB  
4081 O OG  . SER A 494 ? 0.2705 0.2542 0.2836 0.0092  0.0261  -0.0118 510  SER A OG  
4082 N N   . PHE A 495 ? 0.2657 0.2537 0.2655 0.0091  0.0173  -0.0198 511  PHE A N   
4083 C CA  . PHE A 495 ? 0.2699 0.2603 0.2706 0.0086  0.0178  -0.0234 511  PHE A CA  
4084 C C   . PHE A 495 ? 0.2746 0.2672 0.2717 0.0070  0.0171  -0.0282 511  PHE A C   
4085 O O   . PHE A 495 ? 0.2788 0.2733 0.2780 0.0057  0.0191  -0.0320 511  PHE A O   
4086 C CB  . PHE A 495 ? 0.2668 0.2586 0.2658 0.0106  0.0143  -0.0219 511  PHE A CB  
4087 C CG  . PHE A 495 ? 0.2671 0.2586 0.2712 0.0116  0.0164  -0.0187 511  PHE A CG  
4088 C CD1 . PHE A 495 ? 0.2697 0.2594 0.2767 0.0120  0.0180  -0.0145 511  PHE A CD1 
4089 C CD2 . PHE A 495 ? 0.2707 0.2641 0.2766 0.0121  0.0167  -0.0196 511  PHE A CD2 
4090 C CE1 . PHE A 495 ? 0.2709 0.2612 0.2826 0.0130  0.0198  -0.0110 511  PHE A CE1 
4091 C CE2 . PHE A 495 ? 0.2660 0.2596 0.2764 0.0132  0.0187  -0.0163 511  PHE A CE2 
4092 C CZ  . PHE A 495 ? 0.2743 0.2666 0.2875 0.0136  0.0202  -0.0119 511  PHE A CZ  
4093 N N   . ILE A 496 ? 0.2771 0.2697 0.2690 0.0071  0.0144  -0.0280 512  ILE A N   
4094 C CA  . ILE A 496 ? 0.2804 0.2757 0.2687 0.0055  0.0139  -0.0320 512  ILE A CA  
4095 C C   . ILE A 496 ? 0.2846 0.2789 0.2752 0.0031  0.0187  -0.0345 512  ILE A C   
4096 O O   . ILE A 496 ? 0.2869 0.2833 0.2786 0.0009  0.0211  -0.0391 512  ILE A O   
4097 C CB  . ILE A 496 ? 0.2820 0.2779 0.2639 0.0067  0.0094  -0.0303 512  ILE A CB  
4098 C CG1 . ILE A 496 ? 0.2809 0.2778 0.2606 0.0090  0.0051  -0.0287 512  ILE A CG1 
4099 C CG2 . ILE A 496 ? 0.2838 0.2832 0.2619 0.0050  0.0092  -0.0339 512  ILE A CG2 
4100 C CD1 . ILE A 496 ? 0.2951 0.2908 0.2702 0.0106  0.0012  -0.0257 512  ILE A CD1 
4101 N N   . ILE A 497 ? 0.2858 0.2769 0.2773 0.0033  0.0204  -0.0316 513  ILE A N   
4102 C CA  . ILE A 497 ? 0.2912 0.2811 0.2844 0.0011  0.0251  -0.0339 513  ILE A CA  
4103 C C   . ILE A 497 ? 0.2925 0.2807 0.2931 -0.0002 0.0309  -0.0357 513  ILE A C   
4104 O O   . ILE A 497 ? 0.2949 0.2829 0.2969 -0.0026 0.0351  -0.0397 513  ILE A O   
4105 C CB  . ILE A 497 ? 0.2913 0.2784 0.2835 0.0018  0.0254  -0.0302 513  ILE A CB  
4106 C CG1 . ILE A 497 ? 0.2923 0.2763 0.2895 0.0035  0.0263  -0.0249 513  ILE A CG1 
4107 C CG2 . ILE A 497 ? 0.2930 0.2817 0.2781 0.0027  0.0203  -0.0289 513  ILE A CG2 
4108 C CD1 . ILE A 497 ? 0.2883 0.2697 0.2865 0.0037  0.0278  -0.0215 513  ILE A CD1 
4109 N N   . GLN A 498 ? 0.2895 0.2766 0.2948 0.0012  0.0314  -0.0329 514  GLN A N   
4110 C CA  . GLN A 498 ? 0.2913 0.2768 0.3043 0.0002  0.0371  -0.0340 514  GLN A CA  
4111 C C   . GLN A 498 ? 0.2940 0.2818 0.3078 -0.0023 0.0391  -0.0404 514  GLN A C   
4112 O O   . GLN A 498 ? 0.2970 0.2832 0.3166 -0.0041 0.0447  -0.0430 514  GLN A O   
4113 C CB  . GLN A 498 ? 0.2871 0.2719 0.3048 0.0024  0.0371  -0.0293 514  GLN A CB  
4114 C CG  . GLN A 498 ? 0.2864 0.2741 0.3023 0.0034  0.0334  -0.0299 514  GLN A CG  
4115 C CD  . GLN A 498 ? 0.2841 0.2714 0.3041 0.0055  0.0335  -0.0251 514  GLN A CD  
4116 O OE1 . GLN A 498 ? 0.2975 0.2856 0.3219 0.0055  0.0357  -0.0258 514  GLN A OE1 
4117 N NE2 . GLN A 498 ? 0.2795 0.2659 0.2982 0.0073  0.0312  -0.0201 514  GLN A NE2 
4118 N N   . PHE A 499 ? 0.2944 0.2862 0.3027 -0.0024 0.0345  -0.0428 515  PHE A N   
4119 C CA  . PHE A 499 ? 0.2967 0.2918 0.3051 -0.0051 0.0355  -0.0490 515  PHE A CA  
4120 C C   . PHE A 499 ? 0.3018 0.2982 0.3066 -0.0079 0.0370  -0.0536 515  PHE A C   
4121 O O   . PHE A 499 ? 0.3037 0.3017 0.3105 -0.0109 0.0402  -0.0592 515  PHE A O   
4122 C CB  . PHE A 499 ? 0.2949 0.2944 0.2996 -0.0040 0.0303  -0.0495 515  PHE A CB  
4123 C CG  . PHE A 499 ? 0.2933 0.2922 0.3025 -0.0022 0.0303  -0.0469 515  PHE A CG  
4124 C CD1 . PHE A 499 ? 0.2897 0.2869 0.2978 0.0008  0.0274  -0.0413 515  PHE A CD1 
4125 C CD2 . PHE A 499 ? 0.2972 0.2973 0.3118 -0.0037 0.0333  -0.0501 515  PHE A CD2 
4126 C CE1 . PHE A 499 ? 0.2906 0.2878 0.3024 0.0025  0.0275  -0.0389 515  PHE A CE1 
4127 C CE2 . PHE A 499 ? 0.2961 0.2959 0.3148 -0.0019 0.0335  -0.0474 515  PHE A CE2 
4128 C CZ  . PHE A 499 ? 0.2919 0.2904 0.3089 0.0012  0.0306  -0.0417 515  PHE A CZ  
4129 N N   . GLN A 500 ? 0.3022 0.2981 0.3017 -0.0070 0.0347  -0.0513 516  GLN A N   
4130 C CA  . GLN A 500 ? 0.3098 0.3066 0.3059 -0.0094 0.0366  -0.0549 516  GLN A CA  
4131 C C   . GLN A 500 ? 0.3132 0.3056 0.3157 -0.0111 0.0438  -0.0564 516  GLN A C   
4132 O O   . GLN A 500 ? 0.3203 0.3136 0.3231 -0.0143 0.0476  -0.0622 516  GLN A O   
4133 C CB  . GLN A 500 ? 0.3097 0.3065 0.2995 -0.0077 0.0329  -0.0512 516  GLN A CB  
4134 C CG  . GLN A 500 ? 0.3124 0.3134 0.2960 -0.0060 0.0263  -0.0497 516  GLN A CG  
4135 C CD  . GLN A 500 ? 0.3249 0.3259 0.3028 -0.0047 0.0233  -0.0464 516  GLN A CD  
4136 O OE1 . GLN A 500 ? 0.3399 0.3426 0.3140 -0.0064 0.0244  -0.0486 516  GLN A OE1 
4137 N NE2 . GLN A 500 ? 0.3083 0.3075 0.2854 -0.0017 0.0197  -0.0411 516  GLN A NE2 
4138 N N   . PHE A 501 ? 0.3118 0.2996 0.3194 -0.0089 0.0459  -0.0512 517  PHE A N   
4139 C CA  . PHE A 501 ? 0.3169 0.3002 0.3319 -0.0099 0.0530  -0.0514 517  PHE A CA  
4140 C C   . PHE A 501 ? 0.3212 0.3040 0.3429 -0.0119 0.0577  -0.0557 517  PHE A C   
4141 O O   . PHE A 501 ? 0.3253 0.3063 0.3505 -0.0146 0.0636  -0.0602 517  PHE A O   
4142 C CB  . PHE A 501 ? 0.3134 0.2930 0.3330 -0.0068 0.0536  -0.0441 517  PHE A CB  
4143 C CG  . PHE A 501 ? 0.3136 0.2928 0.3282 -0.0051 0.0501  -0.0398 517  PHE A CG  
4144 C CD1 . PHE A 501 ? 0.3203 0.3003 0.3295 -0.0066 0.0501  -0.0423 517  PHE A CD1 
4145 C CD2 . PHE A 501 ? 0.3089 0.2873 0.3245 -0.0022 0.0470  -0.0332 517  PHE A CD2 
4146 C CE1 . PHE A 501 ? 0.3181 0.2976 0.3233 -0.0049 0.0471  -0.0380 517  PHE A CE1 
4147 C CE2 . PHE A 501 ? 0.3085 0.2864 0.3201 -0.0008 0.0440  -0.0293 517  PHE A CE2 
4148 C CZ  . PHE A 501 ? 0.3161 0.2944 0.3228 -0.0021 0.0441  -0.0316 517  PHE A CZ  
4149 N N   . TYR A 502 ? 0.3184 0.3028 0.3420 -0.0107 0.0552  -0.0543 518  TYR A N   
4150 C CA  . TYR A 502 ? 0.3236 0.3078 0.3540 -0.0123 0.0593  -0.0576 518  TYR A CA  
4151 C C   . TYR A 502 ? 0.3279 0.3153 0.3562 -0.0164 0.0605  -0.0659 518  TYR A C   
4152 O O   . TYR A 502 ? 0.3323 0.3175 0.3665 -0.0191 0.0668  -0.0703 518  TYR A O   
4153 C CB  . TYR A 502 ? 0.3190 0.3051 0.3506 -0.0100 0.0557  -0.0543 518  TYR A CB  
4154 C CG  . TYR A 502 ? 0.3279 0.3137 0.3672 -0.0112 0.0598  -0.0566 518  TYR A CG  
4155 C CD1 . TYR A 502 ? 0.3351 0.3166 0.3838 -0.0108 0.0663  -0.0542 518  TYR A CD1 
4156 C CD2 . TYR A 502 ? 0.3352 0.3254 0.3731 -0.0127 0.0574  -0.0607 518  TYR A CD2 
4157 C CE1 . TYR A 502 ? 0.3378 0.3188 0.3941 -0.0119 0.0704  -0.0560 518  TYR A CE1 
4158 C CE2 . TYR A 502 ? 0.3394 0.3293 0.3847 -0.0139 0.0613  -0.0627 518  TYR A CE2 
4159 C CZ  . TYR A 502 ? 0.3409 0.3261 0.3954 -0.0135 0.0679  -0.0604 518  TYR A CZ  
4160 O OH  . TYR A 502 ? 0.3454 0.3302 0.4078 -0.0146 0.0720  -0.0621 518  TYR A OH  
4161 N N   . LYS A 503 ? 0.3279 0.3205 0.3480 -0.0169 0.0547  -0.0679 519  LYS A N   
4162 C CA  . LYS A 503 ? 0.3346 0.3318 0.3516 -0.0208 0.0548  -0.0755 519  LYS A CA  
4163 C C   . LYS A 503 ? 0.3417 0.3368 0.3586 -0.0239 0.0601  -0.0801 519  LYS A C   
4164 O O   . LYS A 503 ? 0.3434 0.3390 0.3635 -0.0277 0.0646  -0.0867 519  LYS A O   
4165 C CB  . LYS A 503 ? 0.3336 0.3372 0.3415 -0.0201 0.0473  -0.0755 519  LYS A CB  
4166 C CG  . LYS A 503 ? 0.3431 0.3531 0.3472 -0.0241 0.0467  -0.0828 519  LYS A CG  
4167 C CD  . LYS A 503 ? 0.3467 0.3631 0.3419 -0.0229 0.0395  -0.0816 519  LYS A CD  
4168 C CE  . LYS A 503 ? 0.3632 0.3863 0.3536 -0.0270 0.0392  -0.0884 519  LYS A CE  
4169 N NZ  . LYS A 503 ? 0.3696 0.3999 0.3520 -0.0258 0.0322  -0.0867 519  LYS A NZ  
4170 N N   . SER A 504 ? 0.3422 0.3350 0.3556 -0.0223 0.0598  -0.0767 520  SER A N   
4171 C CA  . SER A 504 ? 0.3509 0.3418 0.3637 -0.0249 0.0648  -0.0805 520  SER A CA  
4172 C C   . SER A 504 ? 0.3541 0.3386 0.3768 -0.0259 0.0732  -0.0816 520  SER A C   
4173 O O   . SER A 504 ? 0.3613 0.3450 0.3856 -0.0296 0.0786  -0.0882 520  SER A O   
4174 C CB  . SER A 504 ? 0.3487 0.3388 0.3557 -0.0227 0.0623  -0.0759 520  SER A CB  
4175 O OG  . SER A 504 ? 0.3535 0.3497 0.3512 -0.0225 0.0556  -0.0761 520  SER A OG  
4176 N N   . ALA A 505 ? 0.3523 0.3326 0.3816 -0.0226 0.0744  -0.0751 521  ALA A N   
4177 C CA  . ALA A 505 ? 0.3573 0.3318 0.3972 -0.0229 0.0824  -0.0747 521  ALA A CA  
4178 C C   . ALA A 505 ? 0.3631 0.3381 0.4085 -0.0262 0.0863  -0.0811 521  ALA A C   
4179 O O   . ALA A 505 ? 0.3675 0.3386 0.4191 -0.0288 0.0938  -0.0854 521  ALA A O   
4180 C CB  . ALA A 505 ? 0.3517 0.3233 0.3971 -0.0186 0.0819  -0.0659 521  ALA A CB  
4181 N N   . CYS A 506 ? 0.3639 0.3434 0.4072 -0.0261 0.0813  -0.0817 522  CYS A N   
4182 C CA  . CYS A 506 ? 0.3719 0.3528 0.4201 -0.0292 0.0841  -0.0876 522  CYS A CA  
4183 C C   . CYS A 506 ? 0.3823 0.3658 0.4272 -0.0345 0.0863  -0.0972 522  CYS A C   
4184 O O   . CYS A 506 ? 0.3885 0.3698 0.4402 -0.0379 0.0927  -0.1029 522  CYS A O   
4185 C CB  . CYS A 506 ? 0.3668 0.3528 0.4127 -0.0278 0.0776  -0.0858 522  CYS A CB  
4186 S SG  . CYS A 506 ? 0.3640 0.3469 0.4156 -0.0226 0.0766  -0.0762 522  CYS A SG  
4187 N N   . ILE A 507 ? 0.3875 0.3759 0.4221 -0.0352 0.0812  -0.0989 523  ILE A N   
4188 C CA  . ILE A 507 ? 0.3988 0.3907 0.4289 -0.0401 0.0829  -0.1076 523  ILE A CA  
4189 C C   . ILE A 507 ? 0.4074 0.3930 0.4419 -0.0420 0.0914  -0.1107 523  ILE A C   
4190 O O   . ILE A 507 ? 0.4131 0.3984 0.4504 -0.0466 0.0967  -0.1188 523  ILE A O   
4191 C CB  . ILE A 507 ? 0.3991 0.3978 0.4171 -0.0398 0.0755  -0.1075 523  ILE A CB  
4192 C CG1 . ILE A 507 ? 0.3966 0.4024 0.4111 -0.0389 0.0682  -0.1066 523  ILE A CG1 
4193 C CG2 . ILE A 507 ? 0.4090 0.4111 0.4218 -0.0447 0.0780  -0.1158 523  ILE A CG2 
4194 C CD1 . ILE A 507 ? 0.3957 0.4073 0.3997 -0.0369 0.0605  -0.1034 523  ILE A CD1 
4195 N N   . LYS A 508 ? 0.4082 0.3888 0.4437 -0.0386 0.0927  -0.1042 524  LYS A N   
4196 C CA  . LYS A 508 ? 0.4175 0.3917 0.4578 -0.0396 0.1009  -0.1058 524  LYS A CA  
4197 C C   . LYS A 508 ? 0.4219 0.3901 0.4749 -0.0407 0.1091  -0.1073 524  LYS A C   
4198 O O   . LYS A 508 ? 0.4282 0.3920 0.4859 -0.0435 0.1170  -0.1124 524  LYS A O   
4199 C CB  . LYS A 508 ? 0.4137 0.3844 0.4532 -0.0353 0.1000  -0.0974 524  LYS A CB  
4200 C CG  . LYS A 508 ? 0.4140 0.3894 0.4420 -0.0346 0.0939  -0.0963 524  LYS A CG  
4201 C CD  . LYS A 508 ? 0.4147 0.3872 0.4425 -0.0298 0.0915  -0.0870 524  LYS A CD  
4202 C CE  . LYS A 508 ? 0.4208 0.3981 0.4375 -0.0288 0.0846  -0.0850 524  LYS A CE  
4203 N NZ  . LYS A 508 ? 0.4296 0.4077 0.4410 -0.0315 0.0875  -0.0899 524  LYS A NZ  
4204 N N   . ALA A 509 ? 0.4183 0.3863 0.4770 -0.0383 0.1075  -0.1028 525  ALA A N   
4205 C CA  . ALA A 509 ? 0.4238 0.3864 0.4949 -0.0388 0.1149  -0.1031 525  ALA A CA  
4206 C C   . ALA A 509 ? 0.4312 0.3960 0.5048 -0.0439 0.1175  -0.1125 525  ALA A C   
4207 O O   . ALA A 509 ? 0.4337 0.3939 0.5180 -0.0453 0.1247  -0.1144 525  ALA A O   
4208 C CB  . ALA A 509 ? 0.4151 0.3772 0.4910 -0.0341 0.1120  -0.0940 525  ALA A CB  
4209 N N   . GLY A 510 ? 0.4355 0.4075 0.4997 -0.0468 0.1118  -0.1181 526  GLY A N   
4210 C CA  . GLY A 510 ? 0.4443 0.4202 0.5099 -0.0518 0.1127  -0.1267 526  GLY A CA  
4211 C C   . GLY A 510 ? 0.4419 0.4195 0.5125 -0.0500 0.1100  -0.1233 526  GLY A C   
4212 O O   . GLY A 510 ? 0.4437 0.4218 0.5205 -0.0535 0.1133  -0.1289 526  GLY A O   
4213 N N   . GLN A 511 ? 0.4365 0.4151 0.5046 -0.0448 0.1041  -0.1144 527  GLN A N   
4214 C CA  . GLN A 511 ? 0.4355 0.4153 0.5081 -0.0423 0.1015  -0.1098 527  GLN A CA  
4215 C C   . GLN A 511 ? 0.4349 0.4232 0.4989 -0.0420 0.0923  -0.1100 527  GLN A C   
4216 O O   . GLN A 511 ? 0.4308 0.4211 0.4977 -0.0405 0.0899  -0.1074 527  GLN A O   
4217 C CB  . GLN A 511 ? 0.4298 0.4049 0.5065 -0.0367 0.1018  -0.0995 527  GLN A CB  
4218 C CG  . GLN A 511 ? 0.4340 0.4014 0.5228 -0.0363 0.1112  -0.0977 527  GLN A CG  
4219 C CD  . GLN A 511 ? 0.4421 0.4083 0.5409 -0.0373 0.1152  -0.0985 527  GLN A CD  
4220 O OE1 . GLN A 511 ? 0.4469 0.4090 0.5542 -0.0405 0.1232  -0.1036 527  GLN A OE1 
4221 N NE2 . GLN A 511 ? 0.4300 0.3998 0.5282 -0.0345 0.1099  -0.0937 527  GLN A NE2 
4222 N N   . TYR A 512 ? 0.4406 0.4337 0.4942 -0.0432 0.0876  -0.1128 528  TYR A N   
4223 C CA  . TYR A 512 ? 0.4426 0.4441 0.4881 -0.0429 0.0791  -0.1129 528  TYR A CA  
4224 C C   . TYR A 512 ? 0.4540 0.4623 0.4920 -0.0475 0.0771  -0.1208 528  TYR A C   
4225 O O   . TYR A 512 ? 0.4566 0.4642 0.4895 -0.0486 0.0782  -0.1227 528  TYR A O   
4226 C CB  . TYR A 512 ? 0.4342 0.4362 0.4733 -0.0376 0.0726  -0.1043 528  TYR A CB  
4227 C CG  . TYR A 512 ? 0.4293 0.4395 0.4600 -0.0369 0.0642  -0.1041 528  TYR A CG  
4228 C CD1 . TYR A 512 ? 0.4233 0.4384 0.4563 -0.0375 0.0616  -0.1056 528  TYR A CD1 
4229 C CD2 . TYR A 512 ? 0.4262 0.4394 0.4474 -0.0354 0.0590  -0.1019 528  TYR A CD2 
4230 C CE1 . TYR A 512 ? 0.4185 0.4413 0.4444 -0.0367 0.0542  -0.1050 528  TYR A CE1 
4231 C CE2 . TYR A 512 ? 0.4206 0.4414 0.4348 -0.0345 0.0516  -0.1012 528  TYR A CE2 
4232 C CZ  . TYR A 512 ? 0.4157 0.4412 0.4324 -0.0351 0.0493  -0.1027 528  TYR A CZ  
4233 O OH  . TYR A 512 ? 0.4120 0.4451 0.4226 -0.0340 0.0423  -0.1016 528  TYR A OH  
4234 N N   . ASP A 513 ? 0.4631 0.4784 0.5006 -0.0501 0.0741  -0.1252 529  ASP A N   
4235 C CA  . ASP A 513 ? 0.4773 0.5012 0.5074 -0.0543 0.0708  -0.1321 529  ASP A CA  
4236 C C   . ASP A 513 ? 0.4780 0.5100 0.5055 -0.0532 0.0636  -0.1305 529  ASP A C   
4237 O O   . ASP A 513 ? 0.4768 0.5092 0.5114 -0.0538 0.0647  -0.1313 529  ASP A O   
4238 C CB  . ASP A 513 ? 0.4860 0.5097 0.5212 -0.0607 0.0776  -0.1421 529  ASP A CB  
4239 C CG  . ASP A 513 ? 0.4981 0.5310 0.5250 -0.0656 0.0748  -0.1499 529  ASP A CG  
4240 O OD1 . ASP A 513 ? 0.4984 0.5400 0.5176 -0.0645 0.0670  -0.1481 529  ASP A OD1 
4241 O OD2 . ASP A 513 ? 0.5157 0.5474 0.5439 -0.0706 0.0805  -0.1578 529  ASP A OD2 
4242 N N   . PRO A 514 ? 0.4828 0.5214 0.5007 -0.0513 0.0564  -0.1278 530  PRO A N   
4243 C CA  . PRO A 514 ? 0.4833 0.5296 0.4986 -0.0495 0.0493  -0.1253 530  PRO A CA  
4244 C C   . PRO A 514 ? 0.4918 0.5467 0.5086 -0.0546 0.0486  -0.1328 530  PRO A C   
4245 O O   . PRO A 514 ? 0.4884 0.5489 0.5061 -0.0533 0.0441  -0.1310 530  PRO A O   
4246 C CB  . PRO A 514 ? 0.4824 0.5331 0.4872 -0.0470 0.0431  -0.1214 530  PRO A CB  
4247 C CG  . PRO A 514 ? 0.4871 0.5360 0.4881 -0.0498 0.0467  -0.1253 530  PRO A CG  
4248 C CD  . PRO A 514 ? 0.4853 0.5241 0.4946 -0.0505 0.0547  -0.1264 530  PRO A CD  
4249 N N   . ASP A 515 ? 0.5045 0.5607 0.5219 -0.0602 0.0530  -0.1412 531  ASP A N   
4250 C CA  . ASP A 515 ? 0.5149 0.5795 0.5339 -0.0658 0.0528  -0.1493 531  ASP A CA  
4251 C C   . ASP A 515 ? 0.5175 0.5767 0.5480 -0.0691 0.0599  -0.1540 531  ASP A C   
4252 O O   . ASP A 515 ? 0.5248 0.5901 0.5584 -0.0742 0.0608  -0.1613 531  ASP A O   
4253 C CB  . ASP A 515 ? 0.5252 0.5965 0.5366 -0.0707 0.0524  -0.1563 531  ASP A CB  
4254 C CG  . ASP A 515 ? 0.5312 0.6095 0.5315 -0.0678 0.0450  -0.1516 531  ASP A CG  
4255 O OD1 . ASP A 515 ? 0.5347 0.6175 0.5334 -0.0640 0.0388  -0.1457 531  ASP A OD1 
4256 O OD2 . ASP A 515 ? 0.5461 0.6254 0.5396 -0.0693 0.0457  -0.1538 531  ASP A OD2 
4257 N N   . ASN A 516 ? 0.5149 0.5632 0.5520 -0.0660 0.0651  -0.1497 532  ASN A N   
4258 C CA  . ASN A 516 ? 0.5151 0.5572 0.5639 -0.0682 0.0725  -0.1527 532  ASN A CA  
4259 C C   . ASN A 516 ? 0.5054 0.5442 0.5604 -0.0633 0.0714  -0.1450 532  ASN A C   
4260 O O   . ASN A 516 ? 0.4994 0.5323 0.5539 -0.0580 0.0710  -0.1370 532  ASN A O   
4261 C CB  . ASN A 516 ? 0.5208 0.5529 0.5736 -0.0692 0.0807  -0.1544 532  ASN A CB  
4262 C CG  . ASN A 516 ? 0.5277 0.5539 0.5929 -0.0725 0.0893  -0.1591 532  ASN A CG  
4263 O OD1 . ASN A 516 ? 0.5339 0.5625 0.6054 -0.0735 0.0891  -0.1600 532  ASN A OD1 
4264 N ND2 . ASN A 516 ? 0.5338 0.5519 0.6030 -0.0742 0.0970  -0.1618 532  ASN A ND2 
4265 N N   . VAL A 517 ? 0.5019 0.5450 0.5627 -0.0653 0.0712  -0.1476 533  VAL A N   
4266 C CA  . VAL A 517 ? 0.4926 0.5338 0.5594 -0.0612 0.0703  -0.1411 533  VAL A CA  
4267 C C   . VAL A 517 ? 0.4882 0.5183 0.5643 -0.0590 0.0777  -0.1373 533  VAL A C   
4268 O O   . VAL A 517 ? 0.4829 0.5100 0.5621 -0.0543 0.0769  -0.1298 533  VAL A O   
4269 C CB  . VAL A 517 ? 0.4945 0.5434 0.5658 -0.0644 0.0687  -0.1454 533  VAL A CB  
4270 C CG1 . VAL A 517 ? 0.5027 0.5487 0.5842 -0.0701 0.0767  -0.1532 533  VAL A CG1 
4271 C CG2 . VAL A 517 ? 0.4889 0.5382 0.5631 -0.0594 0.0655  -0.1379 533  VAL A CG2 
4272 N N   . GLU A 518 ? 0.4904 0.5147 0.5707 -0.0624 0.0850  -0.1422 534  GLU A N   
4273 C CA  . GLU A 518 ? 0.4864 0.5005 0.5765 -0.0607 0.0929  -0.1389 534  GLU A CA  
4274 C C   . GLU A 518 ? 0.4755 0.4834 0.5619 -0.0558 0.0928  -0.1315 534  GLU A C   
4275 O O   . GLU A 518 ? 0.4738 0.4740 0.5676 -0.0531 0.0981  -0.1265 534  GLU A O   
4276 C CB  . GLU A 518 ? 0.4971 0.5073 0.5948 -0.0667 0.1015  -0.1477 534  GLU A CB  
4277 C CG  . GLU A 518 ? 0.5169 0.5328 0.6194 -0.0723 0.1024  -0.1558 534  GLU A CG  
4278 C CD  . GLU A 518 ? 0.5357 0.5521 0.6463 -0.0701 0.1023  -0.1514 534  GLU A CD  
4279 O OE1 . GLU A 518 ? 0.5424 0.5513 0.6601 -0.0662 0.1064  -0.1446 534  GLU A OE1 
4280 O OE2 . GLU A 518 ? 0.5514 0.5760 0.6611 -0.0724 0.0980  -0.1546 534  GLU A OE2 
4281 N N   . LEU A 519 ? 0.4649 0.4766 0.5402 -0.0547 0.0869  -0.1306 535  LEU A N   
4282 C CA  . LEU A 519 ? 0.4527 0.4593 0.5239 -0.0503 0.0864  -0.1239 535  LEU A CA  
4283 C C   . LEU A 519 ? 0.4395 0.4505 0.5016 -0.0457 0.0774  -0.1172 535  LEU A C   
4284 O O   . LEU A 519 ? 0.4391 0.4528 0.4921 -0.0453 0.0734  -0.1172 535  LEU A O   
4285 C CB  . LEU A 519 ? 0.4596 0.4642 0.5269 -0.0534 0.0896  -0.1291 535  LEU A CB  
4286 C CG  . LEU A 519 ? 0.4658 0.4648 0.5416 -0.0579 0.0992  -0.1359 535  LEU A CG  
4287 C CD1 . LEU A 519 ? 0.4698 0.4694 0.5391 -0.0615 0.1008  -0.1423 535  LEU A CD1 
4288 C CD2 . LEU A 519 ? 0.4636 0.4530 0.5496 -0.0547 0.1061  -0.1300 535  LEU A CD2 
4289 N N   . PRO A 520 ? 0.4261 0.4377 0.4908 -0.0420 0.0747  -0.1114 536  PRO A N   
4290 C CA  . PRO A 520 ? 0.4146 0.4297 0.4714 -0.0376 0.0668  -0.1052 536  PRO A CA  
4291 C C   . PRO A 520 ? 0.4046 0.4136 0.4594 -0.0332 0.0669  -0.0979 536  PRO A C   
4292 O O   . PRO A 520 ? 0.4036 0.4059 0.4654 -0.0324 0.0728  -0.0955 536  PRO A O   
4293 C CB  . PRO A 520 ? 0.4101 0.4274 0.4715 -0.0357 0.0652  -0.1023 536  PRO A CB  
4294 C CG  . PRO A 520 ? 0.4151 0.4266 0.4878 -0.0369 0.0731  -0.1030 536  PRO A CG  
4295 C CD  . PRO A 520 ? 0.4242 0.4331 0.4994 -0.0417 0.0790  -0.1101 536  PRO A CD  
4296 N N   . LEU A 521 ? 0.3963 0.4079 0.4421 -0.0304 0.0604  -0.0942 537  LEU A N   
4297 C CA  . LEU A 521 ? 0.3874 0.3941 0.4308 -0.0266 0.0598  -0.0875 537  LEU A CA  
4298 C C   . LEU A 521 ? 0.3812 0.3838 0.4304 -0.0227 0.0611  -0.0806 537  LEU A C   
4299 O O   . LEU A 521 ? 0.3779 0.3751 0.4302 -0.0208 0.0644  -0.0762 537  LEU A O   
4300 C CB  . LEU A 521 ? 0.3864 0.3972 0.4194 -0.0245 0.0524  -0.0851 537  LEU A CB  
4301 C CG  . LEU A 521 ? 0.3802 0.3869 0.4093 -0.0213 0.0512  -0.0792 537  LEU A CG  
4302 C CD1 . LEU A 521 ? 0.3807 0.3826 0.4118 -0.0232 0.0570  -0.0813 537  LEU A CD1 
4303 C CD2 . LEU A 521 ? 0.3793 0.3905 0.3986 -0.0198 0.0441  -0.0778 537  LEU A CD2 
4304 N N   . ASP A 522 ? 0.3740 0.3798 0.4251 -0.0217 0.0588  -0.0795 538  ASP A N   
4305 C CA  . ASP A 522 ? 0.3684 0.3717 0.4240 -0.0179 0.0593  -0.0729 538  ASP A CA  
4306 C C   . ASP A 522 ? 0.3696 0.3682 0.4362 -0.0186 0.0669  -0.0723 538  ASP A C   
4307 O O   . ASP A 522 ? 0.3665 0.3634 0.4373 -0.0156 0.0679  -0.0667 538  ASP A O   
4308 C CB  . ASP A 522 ? 0.3633 0.3716 0.4162 -0.0161 0.0539  -0.0716 538  ASP A CB  
4309 C CG  . ASP A 522 ? 0.3641 0.3777 0.4191 -0.0198 0.0541  -0.0783 538  ASP A CG  
4310 O OD1 . ASP A 522 ? 0.3635 0.3810 0.4136 -0.0226 0.0519  -0.0834 538  ASP A OD1 
4311 O OD2 . ASP A 522 ? 0.3509 0.3652 0.4123 -0.0199 0.0562  -0.0782 538  ASP A OD2 
4312 N N   . ASN A 523 ? 0.3734 0.3700 0.4446 -0.0226 0.0726  -0.0782 539  ASN A N   
4313 C CA  . ASN A 523 ? 0.3738 0.3650 0.4560 -0.0232 0.0808  -0.0775 539  ASN A CA  
4314 C C   . ASN A 523 ? 0.3771 0.3632 0.4615 -0.0249 0.0863  -0.0793 539  ASN A C   
4315 O O   . ASN A 523 ? 0.3808 0.3627 0.4742 -0.0270 0.0939  -0.0818 539  ASN A O   
4316 C CB  . ASN A 523 ? 0.3771 0.3701 0.4664 -0.0266 0.0842  -0.0829 539  ASN A CB  
4317 C CG  . ASN A 523 ? 0.3784 0.3669 0.4793 -0.0254 0.0910  -0.0791 539  ASN A CG  
4318 O OD1 . ASN A 523 ? 0.3744 0.3608 0.4769 -0.0211 0.0908  -0.0711 539  ASN A OD1 
4319 N ND2 . ASN A 523 ? 0.3761 0.3633 0.4854 -0.0293 0.0971  -0.0847 539  ASN A ND2 
4320 N N   . CYS A 524 ? 0.3734 0.3595 0.4498 -0.0238 0.0828  -0.0780 540  CYS A N   
4321 C CA  . CYS A 524 ? 0.3752 0.3566 0.4527 -0.0250 0.0875  -0.0793 540  CYS A CA  
4322 C C   . CYS A 524 ? 0.3707 0.3466 0.4549 -0.0215 0.0917  -0.0716 540  CYS A C   
4323 O O   . CYS A 524 ? 0.3643 0.3408 0.4460 -0.0175 0.0875  -0.0643 540  CYS A O   
4324 C CB  . CYS A 524 ? 0.3750 0.3591 0.4415 -0.0252 0.0822  -0.0807 540  CYS A CB  
4325 S SG  . CYS A 524 ? 0.3862 0.3646 0.4528 -0.0245 0.0863  -0.0783 540  CYS A SG  
4326 N N   . ASP A 525 ? 0.3710 0.3416 0.4638 -0.0232 0.1000  -0.0734 541  ASP A N   
4327 C CA  . ASP A 525 ? 0.3672 0.3328 0.4670 -0.0201 0.1047  -0.0662 541  ASP A CA  
4328 C C   . ASP A 525 ? 0.3709 0.3325 0.4705 -0.0215 0.1088  -0.0684 541  ASP A C   
4329 O O   . ASP A 525 ? 0.3737 0.3325 0.4776 -0.0252 0.1151  -0.0752 541  ASP A O   
4330 C CB  . ASP A 525 ? 0.3683 0.3306 0.4807 -0.0199 0.1118  -0.0645 541  ASP A CB  
4331 C CG  . ASP A 525 ? 0.3670 0.3252 0.4872 -0.0161 0.1162  -0.0557 541  ASP A CG  
4332 O OD1 . ASP A 525 ? 0.3550 0.3136 0.4704 -0.0132 0.1126  -0.0502 541  ASP A OD1 
4333 O OD2 . ASP A 525 ? 0.3669 0.3218 0.4985 -0.0160 0.1233  -0.0540 541  ASP A OD2 
4334 N N   . ILE A 526 ? 0.3660 0.3274 0.4606 -0.0186 0.1055  -0.0629 542  ILE A N   
4335 C CA  . ILE A 526 ? 0.3702 0.3282 0.4643 -0.0194 0.1092  -0.0642 542  ILE A CA  
4336 C C   . ILE A 526 ? 0.3713 0.3234 0.4766 -0.0175 0.1171  -0.0590 542  ILE A C   
4337 O O   . ILE A 526 ? 0.3709 0.3199 0.4768 -0.0176 0.1205  -0.0588 542  ILE A O   
4338 C CB  . ILE A 526 ? 0.3670 0.3277 0.4500 -0.0177 0.1020  -0.0617 542  ILE A CB  
4339 C CG1 . ILE A 526 ? 0.3589 0.3209 0.4411 -0.0130 0.0971  -0.0521 542  ILE A CG1 
4340 C CG2 . ILE A 526 ? 0.3653 0.3313 0.4378 -0.0203 0.0958  -0.0681 542  ILE A CG2 
4341 C CD1 . ILE A 526 ? 0.3510 0.3143 0.4249 -0.0112 0.0917  -0.0486 542  ILE A CD1 
4342 N N   . TYR A 527 ? 0.3701 0.3210 0.4846 -0.0158 0.1203  -0.0546 543  TYR A N   
4343 C CA  . TYR A 527 ? 0.3738 0.3197 0.5004 -0.0139 0.1285  -0.0493 543  TYR A CA  
4344 C C   . TYR A 527 ? 0.3824 0.3230 0.5144 -0.0176 0.1371  -0.0565 543  TYR A C   
4345 O O   . TYR A 527 ? 0.3877 0.3282 0.5193 -0.0218 0.1390  -0.0653 543  TYR A O   
4346 C CB  . TYR A 527 ? 0.3718 0.3177 0.5078 -0.0120 0.1311  -0.0445 543  TYR A CB  
4347 C CG  . TYR A 527 ? 0.3769 0.3181 0.5259 -0.0096 0.1395  -0.0379 543  TYR A CG  
4348 C CD1 . TYR A 527 ? 0.3794 0.3220 0.5301 -0.0050 0.1377  -0.0275 543  TYR A CD1 
4349 C CD2 . TYR A 527 ? 0.3895 0.3251 0.5493 -0.0120 0.1494  -0.0420 543  TYR A CD2 
4350 C CE1 . TYR A 527 ? 0.3804 0.3194 0.5434 -0.0026 0.1453  -0.0208 543  TYR A CE1 
4351 C CE2 . TYR A 527 ? 0.3911 0.3223 0.5637 -0.0095 0.1575  -0.0355 543  TYR A CE2 
4352 C CZ  . TYR A 527 ? 0.3910 0.3242 0.5650 -0.0047 0.1553  -0.0246 543  TYR A CZ  
4353 O OH  . TYR A 527 ? 0.3932 0.3230 0.5802 -0.0020 0.1632  -0.0175 543  TYR A OH  
4354 N N   . GLY A 528 ? 0.3852 0.3216 0.5222 -0.0161 0.1423  -0.0529 544  GLY A N   
4355 C CA  . GLY A 528 ? 0.3937 0.3243 0.5371 -0.0191 0.1516  -0.0590 544  GLY A CA  
4356 C C   . GLY A 528 ? 0.3979 0.3289 0.5315 -0.0228 0.1502  -0.0676 544  GLY A C   
4357 O O   . GLY A 528 ? 0.4044 0.3308 0.5423 -0.0256 0.1578  -0.0733 544  GLY A O   
4358 N N   . SER A 529 ? 0.3928 0.3295 0.5136 -0.0228 0.1407  -0.0684 545  SER A N   
4359 C CA  . SER A 529 ? 0.3963 0.3348 0.5069 -0.0262 0.1385  -0.0761 545  SER A CA  
4360 C C   . SER A 529 ? 0.3955 0.3323 0.5031 -0.0243 0.1389  -0.0724 545  SER A C   
4361 O O   . SER A 529 ? 0.3886 0.3282 0.4911 -0.0209 0.1324  -0.0653 545  SER A O   
4362 C CB  . SER A 529 ? 0.3928 0.3384 0.4916 -0.0272 0.1287  -0.0787 545  SER A CB  
4363 O OG  . SER A 529 ? 0.3983 0.3464 0.4868 -0.0299 0.1260  -0.0847 545  SER A OG  
4364 N N   . ALA A 530 ? 0.4018 0.3341 0.5130 -0.0267 0.1466  -0.0773 546  ALA A N   
4365 C CA  . ALA A 530 ? 0.4023 0.3327 0.5107 -0.0254 0.1478  -0.0749 546  ALA A CA  
4366 C C   . ALA A 530 ? 0.4009 0.3366 0.4949 -0.0269 0.1403  -0.0785 546  ALA A C   
4367 O O   . ALA A 530 ? 0.3973 0.3337 0.4867 -0.0246 0.1373  -0.0736 546  ALA A O   
4368 C CB  . ALA A 530 ? 0.4114 0.3353 0.5280 -0.0277 0.1590  -0.0797 546  ALA A CB  
4369 N N   . ALA A 531 ? 0.4032 0.3426 0.4903 -0.0308 0.1374  -0.0868 547  ALA A N   
4370 C CA  . ALA A 531 ? 0.4038 0.3490 0.4772 -0.0323 0.1301  -0.0903 547  ALA A CA  
4371 C C   . ALA A 531 ? 0.3955 0.3454 0.4623 -0.0285 0.1202  -0.0827 547  ALA A C   
4372 O O   . ALA A 531 ? 0.3958 0.3482 0.4543 -0.0274 0.1156  -0.0806 547  ALA A O   
4373 C CB  . ALA A 531 ? 0.4083 0.3574 0.4773 -0.0374 0.1294  -0.1005 547  ALA A CB  
4374 N N   . ALA A 532 ? 0.3883 0.3393 0.4590 -0.0265 0.1173  -0.0785 548  ALA A N   
4375 C CA  . ALA A 532 ? 0.3800 0.3348 0.4456 -0.0227 0.1087  -0.0712 548  ALA A CA  
4376 C C   . ALA A 532 ? 0.3753 0.3275 0.4436 -0.0188 0.1090  -0.0625 548  ALA A C   
4377 O O   . ALA A 532 ? 0.3721 0.3271 0.4332 -0.0168 0.1025  -0.0583 548  ALA A O   
4378 C CB  . ALA A 532 ? 0.3736 0.3299 0.4435 -0.0215 0.1066  -0.0689 548  ALA A CB  
4379 N N   . GLY A 533 ? 0.3759 0.3229 0.4551 -0.0179 0.1167  -0.0597 549  GLY A N   
4380 C CA  . GLY A 533 ? 0.3723 0.3171 0.4557 -0.0143 0.1180  -0.0513 549  GLY A CA  
4381 C C   . GLY A 533 ? 0.3739 0.3184 0.4513 -0.0147 0.1178  -0.0521 549  GLY A C   
4382 O O   . GLY A 533 ? 0.3692 0.3146 0.4448 -0.0118 0.1143  -0.0452 549  GLY A O   
4383 N N   . ALA A 534 ? 0.3792 0.3226 0.4533 -0.0185 0.1216  -0.0606 550  ALA A N   
4384 C CA  . ALA A 534 ? 0.3832 0.3267 0.4508 -0.0193 0.1219  -0.0623 550  ALA A CA  
4385 C C   . ALA A 534 ? 0.3787 0.3277 0.4345 -0.0183 0.1121  -0.0602 550  ALA A C   
4386 O O   . ALA A 534 ? 0.3771 0.3263 0.4299 -0.0165 0.1103  -0.0558 550  ALA A O   
4387 C CB  . ALA A 534 ? 0.3927 0.3349 0.4583 -0.0240 0.1276  -0.0726 550  ALA A CB  
4388 N N   . ALA A 535 ? 0.3745 0.3279 0.4245 -0.0194 0.1061  -0.0631 551  ALA A N   
4389 C CA  . ALA A 535 ? 0.3702 0.3287 0.4099 -0.0182 0.0969  -0.0609 551  ALA A CA  
4390 C C   . ALA A 535 ? 0.3633 0.3216 0.4049 -0.0139 0.0927  -0.0512 551  ALA A C   
4391 O O   . ALA A 535 ? 0.3612 0.3211 0.3970 -0.0125 0.0883  -0.0478 551  ALA A O   
4392 C CB  . ALA A 535 ? 0.3679 0.3310 0.4029 -0.0198 0.0920  -0.0653 551  ALA A CB  
4393 N N   . PHE A 536 ? 0.3588 0.3154 0.4088 -0.0120 0.0941  -0.0470 552  PHE A N   
4394 C CA  . PHE A 536 ? 0.3551 0.3118 0.4079 -0.0082 0.0909  -0.0379 552  PHE A CA  
4395 C C   . PHE A 536 ? 0.3552 0.3093 0.4111 -0.0068 0.0942  -0.0333 552  PHE A C   
4396 O O   . PHE A 536 ? 0.3513 0.3070 0.4036 -0.0048 0.0892  -0.0280 552  PHE A O   
4397 C CB  . PHE A 536 ? 0.3540 0.3097 0.4157 -0.0066 0.0928  -0.0342 552  PHE A CB  
4398 C CG  . PHE A 536 ? 0.3575 0.3169 0.4153 -0.0063 0.0867  -0.0348 552  PHE A CG  
4399 C CD1 . PHE A 536 ? 0.3606 0.3231 0.4130 -0.0039 0.0791  -0.0299 552  PHE A CD1 
4400 C CD2 . PHE A 536 ? 0.3658 0.3254 0.4256 -0.0084 0.0889  -0.0404 552  PHE A CD2 
4401 C CE1 . PHE A 536 ? 0.3630 0.3287 0.4119 -0.0035 0.0738  -0.0305 552  PHE A CE1 
4402 C CE2 . PHE A 536 ? 0.3662 0.3293 0.4226 -0.0080 0.0834  -0.0408 552  PHE A CE2 
4403 C CZ  . PHE A 536 ? 0.3624 0.3285 0.4133 -0.0055 0.0760  -0.0358 552  PHE A CZ  
4404 N N   . HIS A 537 ? 0.3588 0.3089 0.4218 -0.0079 0.1026  -0.0354 553  HIS A N   
4405 C CA  . HIS A 537 ? 0.3610 0.3085 0.4276 -0.0066 0.1065  -0.0313 553  HIS A CA  
4406 C C   . HIS A 537 ? 0.3611 0.3106 0.4178 -0.0073 0.1026  -0.0326 553  HIS A C   
4407 O O   . HIS A 537 ? 0.3594 0.3095 0.4157 -0.0051 0.1000  -0.0264 553  HIS A O   
4408 C CB  . HIS A 537 ? 0.3678 0.3104 0.4433 -0.0080 0.1168  -0.0345 553  HIS A CB  
4409 C CG  . HIS A 537 ? 0.3749 0.3150 0.4529 -0.0072 0.1212  -0.0319 553  HIS A CG  
4410 N ND1 . HIS A 537 ? 0.3920 0.3304 0.4662 -0.0098 0.1255  -0.0383 553  HIS A ND1 
4411 C CD2 . HIS A 537 ? 0.3736 0.3132 0.4573 -0.0041 0.1218  -0.0234 553  HIS A CD2 
4412 C CE1 . HIS A 537 ? 0.3931 0.3295 0.4708 -0.0083 0.1289  -0.0339 553  HIS A CE1 
4413 N NE2 . HIS A 537 ? 0.3918 0.3291 0.4756 -0.0048 0.1266  -0.0248 553  HIS A NE2 
4414 N N   . ASN A 538 ? 0.3642 0.3150 0.4130 -0.0104 0.1021  -0.0405 554  ASN A N   
4415 C CA  . ASN A 538 ? 0.3673 0.3206 0.4063 -0.0112 0.0986  -0.0421 554  ASN A CA  
4416 C C   . ASN A 538 ? 0.3581 0.3149 0.3910 -0.0089 0.0896  -0.0364 554  ASN A C   
4417 O O   . ASN A 538 ? 0.3577 0.3151 0.3866 -0.0080 0.0877  -0.0336 554  ASN A O   
4418 C CB  . ASN A 538 ? 0.3747 0.3303 0.4061 -0.0150 0.0986  -0.0513 554  ASN A CB  
4419 C CG  . ASN A 538 ? 0.3941 0.3462 0.4297 -0.0179 0.1077  -0.0580 554  ASN A CG  
4420 O OD1 . ASN A 538 ? 0.4122 0.3600 0.4550 -0.0170 0.1142  -0.0556 554  ASN A OD1 
4421 N ND2 . ASN A 538 ? 0.4093 0.3635 0.4409 -0.0215 0.1085  -0.0664 554  ASN A ND2 
4422 N N   . MET A 539 ? 0.3486 0.3075 0.3812 -0.0078 0.0846  -0.0349 555  MET A N   
4423 C CA  . MET A 539 ? 0.3406 0.3025 0.3676 -0.0058 0.0763  -0.0302 555  MET A CA  
4424 C C   . MET A 539 ? 0.3330 0.2938 0.3660 -0.0028 0.0752  -0.0217 555  MET A C   
4425 O O   . MET A 539 ? 0.3308 0.2924 0.3606 -0.0015 0.0715  -0.0175 555  MET A O   
4426 C CB  . MET A 539 ? 0.3371 0.3020 0.3605 -0.0061 0.0713  -0.0327 555  MET A CB  
4427 C CG  . MET A 539 ? 0.3379 0.3056 0.3563 -0.0040 0.0631  -0.0282 555  MET A CG  
4428 S SD  . MET A 539 ? 0.3431 0.3143 0.3574 -0.0043 0.0579  -0.0315 555  MET A SD  
4429 C CE  . MET A 539 ? 0.3417 0.3109 0.3661 -0.0032 0.0611  -0.0289 555  MET A CE  
4430 N N   . LEU A 540 ? 0.3267 0.2860 0.3685 -0.0018 0.0784  -0.0192 556  LEU A N   
4431 C CA  . LEU A 540 ? 0.3208 0.2803 0.3684 0.0009  0.0770  -0.0111 556  LEU A CA  
4432 C C   . LEU A 540 ? 0.3215 0.2794 0.3732 0.0019  0.0803  -0.0066 556  LEU A C   
4433 O O   . LEU A 540 ? 0.3162 0.2756 0.3685 0.0037  0.0766  -0.0003 556  LEU A O   
4434 C CB  . LEU A 540 ? 0.3174 0.2762 0.3737 0.0018  0.0803  -0.0092 556  LEU A CB  
4435 C CG  . LEU A 540 ? 0.3170 0.2774 0.3711 0.0012  0.0776  -0.0127 556  LEU A CG  
4436 C CD1 . LEU A 540 ? 0.3145 0.2744 0.3783 0.0027  0.0810  -0.0089 556  LEU A CD1 
4437 C CD2 . LEU A 540 ? 0.3083 0.2722 0.3539 0.0019  0.0688  -0.0118 556  LEU A CD2 
4438 N N   . SER A 541 ? 0.3253 0.2801 0.3798 0.0005  0.0874  -0.0100 557  SER A N   
4439 C CA  . SER A 541 ? 0.3292 0.2823 0.3883 0.0014  0.0915  -0.0060 557  SER A CA  
4440 C C   . SER A 541 ? 0.3277 0.2826 0.3793 0.0015  0.0865  -0.0043 557  SER A C   
4441 O O   . SER A 541 ? 0.3304 0.2848 0.3856 0.0028  0.0879  0.0006  557  SER A O   
4442 C CB  . SER A 541 ? 0.3363 0.2855 0.3997 -0.0003 0.1005  -0.0109 557  SER A CB  
4443 O OG  . SER A 541 ? 0.3433 0.2928 0.3978 -0.0030 0.1002  -0.0188 557  SER A OG  
4444 N N   . MET A 542 ? 0.3263 0.2833 0.3678 0.0004  0.0809  -0.0083 558  MET A N   
4445 C CA  . MET A 542 ? 0.3246 0.2834 0.3586 0.0005  0.0759  -0.0068 558  MET A CA  
4446 C C   . MET A 542 ? 0.3150 0.2756 0.3497 0.0027  0.0699  0.0001  558  MET A C   
4447 O O   . MET A 542 ? 0.3136 0.2749 0.3460 0.0032  0.0675  0.0034  558  MET A O   
4448 C CB  . MET A 542 ? 0.3260 0.2870 0.3496 -0.0010 0.0718  -0.0127 558  MET A CB  
4449 C CG  . MET A 542 ? 0.3414 0.3016 0.3621 -0.0037 0.0770  -0.0201 558  MET A CG  
4450 S SD  . MET A 542 ? 0.3612 0.3256 0.3706 -0.0056 0.0717  -0.0266 558  MET A SD  
4451 C CE  . MET A 542 ? 0.3527 0.3193 0.3541 -0.0045 0.0660  -0.0226 558  MET A CE  
4452 N N   . GLY A 543 ? 0.3079 0.2696 0.3459 0.0037  0.0675  0.0023  559  GLY A N   
4453 C CA  . GLY A 543 ? 0.2994 0.2634 0.3370 0.0054  0.0612  0.0079  559  GLY A CA  
4454 C C   . GLY A 543 ? 0.2987 0.2641 0.3268 0.0050  0.0548  0.0066  559  GLY A C   
4455 O O   . GLY A 543 ? 0.2980 0.2640 0.3196 0.0039  0.0530  0.0014  559  GLY A O   
4456 N N   . ALA A 544 ? 0.2964 0.2627 0.3242 0.0058  0.0515  0.0114  560  ALA A N   
4457 C CA  . ALA A 544 ? 0.2970 0.2642 0.3167 0.0056  0.0459  0.0110  560  ALA A CA  
4458 C C   . ALA A 544 ? 0.3024 0.2686 0.3196 0.0050  0.0480  0.0110  560  ALA A C   
4459 O O   . ALA A 544 ? 0.3040 0.2708 0.3171 0.0053  0.0440  0.0130  560  ALA A O   
4460 C CB  . ALA A 544 ? 0.2908 0.2595 0.3111 0.0067  0.0402  0.0159  560  ALA A CB  
4461 N N   . SER A 545 ? 0.3068 0.2715 0.3267 0.0042  0.0546  0.0086  561  SER A N   
4462 C CA  . SER A 545 ? 0.3121 0.2759 0.3297 0.0036  0.0575  0.0083  561  SER A CA  
4463 C C   . SER A 545 ? 0.3164 0.2816 0.3240 0.0026  0.0545  0.0044  561  SER A C   
4464 O O   . SER A 545 ? 0.3182 0.2835 0.3227 0.0025  0.0548  0.0056  561  SER A O   
4465 C CB  . SER A 545 ? 0.3145 0.2762 0.3372 0.0028  0.0657  0.0059  561  SER A CB  
4466 O OG  . SER A 545 ? 0.3159 0.2773 0.3363 0.0013  0.0679  -0.0006 561  SER A OG  
4467 N N   . LYS A 546 ? 0.3167 0.2833 0.3197 0.0020  0.0518  0.0001  562  LYS A N   
4468 C CA  . LYS A 546 ? 0.3216 0.2904 0.3154 0.0013  0.0487  -0.0033 562  LYS A CA  
4469 C C   . LYS A 546 ? 0.3160 0.2865 0.3064 0.0020  0.0423  -0.0034 562  LYS A C   
4470 O O   . LYS A 546 ? 0.3105 0.2806 0.3052 0.0025  0.0415  -0.0030 562  LYS A O   
4471 C CB  . LYS A 546 ? 0.3289 0.2985 0.3199 -0.0007 0.0532  -0.0100 562  LYS A CB  
4472 C CG  . LYS A 546 ? 0.3493 0.3171 0.3427 -0.0017 0.0601  -0.0109 562  LYS A CG  
4473 C CD  . LYS A 546 ? 0.3858 0.3545 0.3744 -0.0014 0.0591  -0.0083 562  LYS A CD  
4474 C CE  . LYS A 546 ? 0.4142 0.3860 0.3938 -0.0031 0.0594  -0.0135 562  LYS A CE  
4475 N NZ  . LYS A 546 ? 0.4408 0.4116 0.4213 -0.0049 0.0669  -0.0177 562  LYS A NZ  
4476 N N   . PRO A 547 ? 0.3154 0.2880 0.2986 0.0022  0.0379  -0.0038 563  PRO A N   
4477 C CA  . PRO A 547 ? 0.3113 0.2856 0.2912 0.0029  0.0323  -0.0045 563  PRO A CA  
4478 C C   . PRO A 547 ? 0.3089 0.2844 0.2892 0.0019  0.0336  -0.0096 563  PRO A C   
4479 O O   . PRO A 547 ? 0.3100 0.2860 0.2899 0.0002  0.0380  -0.0139 563  PRO A O   
4480 C CB  . PRO A 547 ? 0.3146 0.2914 0.2868 0.0030  0.0292  -0.0048 563  PRO A CB  
4481 C CG  . PRO A 547 ? 0.3199 0.2955 0.2924 0.0030  0.0316  -0.0018 563  PRO A CG  
4482 C CD  . PRO A 547 ? 0.3192 0.2929 0.2973 0.0020  0.0379  -0.0030 563  PRO A CD  
4483 N N   . TRP A 548 ? 0.3036 0.2795 0.2848 0.0028  0.0300  -0.0093 564  TRP A N   
4484 C CA  . TRP A 548 ? 0.3024 0.2791 0.2855 0.0021  0.0315  -0.0133 564  TRP A CA  
4485 C C   . TRP A 548 ? 0.3084 0.2881 0.2868 0.0002  0.0326  -0.0195 564  TRP A C   
4486 O O   . TRP A 548 ? 0.3097 0.2893 0.2912 -0.0011 0.0362  -0.0234 564  TRP A O   
4487 C CB  . TRP A 548 ? 0.2948 0.2718 0.2791 0.0035  0.0271  -0.0117 564  TRP A CB  
4488 C CG  . TRP A 548 ? 0.2890 0.2680 0.2670 0.0044  0.0215  -0.0118 564  TRP A CG  
4489 C CD1 . TRP A 548 ? 0.2799 0.2583 0.2560 0.0058  0.0173  -0.0078 564  TRP A CD1 
4490 C CD2 . TRP A 548 ? 0.2821 0.2645 0.2557 0.0039  0.0196  -0.0159 564  TRP A CD2 
4491 N NE1 . TRP A 548 ? 0.2778 0.2584 0.2487 0.0065  0.0133  -0.0091 564  TRP A NE1 
4492 C CE2 . TRP A 548 ? 0.2766 0.2600 0.2459 0.0054  0.0144  -0.0138 564  TRP A CE2 
4493 C CE3 . TRP A 548 ? 0.2869 0.2716 0.2603 0.0022  0.0219  -0.0212 564  TRP A CE3 
4494 C CZ2 . TRP A 548 ? 0.2776 0.2647 0.2425 0.0055  0.0115  -0.0163 564  TRP A CZ2 
4495 C CZ3 . TRP A 548 ? 0.2868 0.2754 0.2554 0.0021  0.0187  -0.0239 564  TRP A CZ3 
4496 C CH2 . TRP A 548 ? 0.2856 0.2755 0.2501 0.0039  0.0135  -0.0213 564  TRP A CH2 
4497 N N   . PRO A 549 ? 0.3149 0.2975 0.2862 0.0001  0.0297  -0.0203 565  PRO A N   
4498 C CA  . PRO A 549 ? 0.3214 0.3079 0.2884 -0.0019 0.0309  -0.0261 565  PRO A CA  
4499 C C   . PRO A 549 ? 0.3296 0.3151 0.2981 -0.0042 0.0374  -0.0298 565  PRO A C   
4500 O O   . PRO A 549 ? 0.3297 0.3175 0.2974 -0.0064 0.0397  -0.0355 565  PRO A O   
4501 C CB  . PRO A 549 ? 0.3239 0.3139 0.2834 -0.0012 0.0268  -0.0248 565  PRO A CB  
4502 C CG  . PRO A 549 ? 0.3168 0.3048 0.2772 0.0012  0.0223  -0.0193 565  PRO A CG  
4503 C CD  . PRO A 549 ? 0.3156 0.2988 0.2827 0.0017  0.0250  -0.0162 565  PRO A CD  
4504 N N   . ASP A 550 ? 0.3333 0.3157 0.3044 -0.0037 0.0404  -0.0266 566  ASP A N   
4505 C CA  . ASP A 550 ? 0.3442 0.3248 0.3180 -0.0056 0.0473  -0.0295 566  ASP A CA  
4506 C C   . ASP A 550 ? 0.3418 0.3192 0.3236 -0.0061 0.0517  -0.0312 566  ASP A C   
4507 O O   . ASP A 550 ? 0.3467 0.3235 0.3305 -0.0083 0.0572  -0.0361 566  ASP A O   
4508 C CB  . ASP A 550 ? 0.3472 0.3252 0.3223 -0.0046 0.0493  -0.0249 566  ASP A CB  
4509 C CG  . ASP A 550 ? 0.3672 0.3483 0.3346 -0.0043 0.0463  -0.0235 566  ASP A CG  
4510 O OD1 . ASP A 550 ? 0.3836 0.3689 0.3443 -0.0058 0.0455  -0.0278 566  ASP A OD1 
4511 O OD2 . ASP A 550 ? 0.3800 0.3595 0.3481 -0.0027 0.0449  -0.0180 566  ASP A OD2 
4512 N N   . ALA A 551 ? 0.3360 0.3117 0.3228 -0.0042 0.0494  -0.0270 567  ALA A N   
4513 C CA  . ALA A 551 ? 0.3364 0.3096 0.3312 -0.0043 0.0531  -0.0276 567  ALA A CA  
4514 C C   . ALA A 551 ? 0.3395 0.3148 0.3332 -0.0060 0.0530  -0.0334 567  ALA A C   
4515 O O   . ALA A 551 ? 0.3412 0.3149 0.3400 -0.0075 0.0584  -0.0370 567  ALA A O   
4516 C CB  . ALA A 551 ? 0.3294 0.3011 0.3289 -0.0018 0.0502  -0.0212 567  ALA A CB  
4517 N N   . LEU A 552 ? 0.3404 0.3195 0.3281 -0.0056 0.0471  -0.0342 568  LEU A N   
4518 C CA  . LEU A 552 ? 0.3454 0.3276 0.3313 -0.0073 0.0463  -0.0397 568  LEU A CA  
4519 C C   . LEU A 552 ? 0.3541 0.3382 0.3369 -0.0106 0.0503  -0.0464 568  LEU A C   
4520 O O   . LEU A 552 ? 0.3554 0.3399 0.3409 -0.0128 0.0536  -0.0517 568  LEU A O   
4521 C CB  . LEU A 552 ? 0.3432 0.3294 0.3231 -0.0061 0.0391  -0.0387 568  LEU A CB  
4522 C CG  . LEU A 552 ? 0.3467 0.3371 0.3245 -0.0075 0.0374  -0.0438 568  LEU A CG  
4523 C CD1 . LEU A 552 ? 0.3497 0.3382 0.3346 -0.0078 0.0400  -0.0451 568  LEU A CD1 
4524 C CD2 . LEU A 552 ? 0.3432 0.3373 0.3153 -0.0058 0.0305  -0.0417 568  LEU A CD2 
4525 N N   . GLU A 553 ? 0.3615 0.3469 0.3388 -0.0110 0.0502  -0.0462 569  GLU A N   
4526 C CA  . GLU A 553 ? 0.3728 0.3606 0.3463 -0.0141 0.0539  -0.0524 569  GLU A CA  
4527 C C   . GLU A 553 ? 0.3757 0.3590 0.3560 -0.0160 0.0620  -0.0558 569  GLU A C   
4528 O O   . GLU A 553 ? 0.3809 0.3657 0.3606 -0.0192 0.0656  -0.0628 569  GLU A O   
4529 C CB  . GLU A 553 ? 0.3776 0.3674 0.3442 -0.0138 0.0525  -0.0505 569  GLU A CB  
4530 C CG  . GLU A 553 ? 0.3999 0.3945 0.3598 -0.0170 0.0544  -0.0570 569  GLU A CG  
4531 C CD  . GLU A 553 ? 0.4261 0.4236 0.3786 -0.0164 0.0525  -0.0544 569  GLU A CD  
4532 O OE1 . GLU A 553 ? 0.4331 0.4281 0.3864 -0.0136 0.0504  -0.0478 569  GLU A OE1 
4533 O OE2 . GLU A 553 ? 0.4495 0.4521 0.3955 -0.0189 0.0532  -0.0592 569  GLU A OE2 
4534 N N   . ALA A 554 ? 0.3742 0.3523 0.3614 -0.0140 0.0649  -0.0508 570  ALA A N   
4535 C CA  . ALA A 554 ? 0.3780 0.3514 0.3733 -0.0151 0.0729  -0.0527 570  ALA A CA  
4536 C C   . ALA A 554 ? 0.3779 0.3504 0.3791 -0.0163 0.0751  -0.0562 570  ALA A C   
4537 O O   . ALA A 554 ? 0.3814 0.3513 0.3874 -0.0186 0.0820  -0.0610 570  ALA A O   
4538 C CB  . ALA A 554 ? 0.3746 0.3436 0.3763 -0.0123 0.0746  -0.0454 570  ALA A CB  
4539 N N   . PHE A 555 ? 0.3722 0.3467 0.3732 -0.0148 0.0697  -0.0540 571  PHE A N   
4540 C CA  . PHE A 555 ? 0.3732 0.3473 0.3795 -0.0158 0.0712  -0.0569 571  PHE A CA  
4541 C C   . PHE A 555 ? 0.3789 0.3571 0.3809 -0.0194 0.0714  -0.0652 571  PHE A C   
4542 O O   . PHE A 555 ? 0.3830 0.3594 0.3899 -0.0220 0.0771  -0.0705 571  PHE A O   
4543 C CB  . PHE A 555 ? 0.3654 0.3404 0.3729 -0.0129 0.0655  -0.0516 571  PHE A CB  
4544 C CG  . PHE A 555 ? 0.3639 0.3377 0.3786 -0.0131 0.0679  -0.0528 571  PHE A CG  
4545 C CD1 . PHE A 555 ? 0.3705 0.3479 0.3830 -0.0150 0.0659  -0.0580 571  PHE A CD1 
4546 C CD2 . PHE A 555 ? 0.3641 0.3336 0.3880 -0.0115 0.0720  -0.0485 571  PHE A CD2 
4547 C CE1 . PHE A 555 ? 0.3664 0.3427 0.3859 -0.0153 0.0683  -0.0590 571  PHE A CE1 
4548 C CE2 . PHE A 555 ? 0.3625 0.3311 0.3934 -0.0116 0.0744  -0.0491 571  PHE A CE2 
4549 C CZ  . PHE A 555 ? 0.3604 0.3322 0.3891 -0.0135 0.0726  -0.0545 571  PHE A CZ  
4550 N N   . ASN A 556 ? 0.3799 0.3637 0.3729 -0.0197 0.0652  -0.0663 572  ASN A N   
4551 C CA  . ASN A 556 ? 0.3861 0.3753 0.3750 -0.0229 0.0640  -0.0734 572  ASN A CA  
4552 C C   . ASN A 556 ? 0.3907 0.3861 0.3693 -0.0243 0.0604  -0.0760 572  ASN A C   
4553 O O   . ASN A 556 ? 0.3927 0.3940 0.3672 -0.0268 0.0583  -0.0811 572  ASN A O   
4554 C CB  . ASN A 556 ? 0.3797 0.3712 0.3703 -0.0219 0.0596  -0.0725 572  ASN A CB  
4555 C CG  . ASN A 556 ? 0.3773 0.3715 0.3628 -0.0185 0.0519  -0.0665 572  ASN A CG  
4556 O OD1 . ASN A 556 ? 0.3763 0.3708 0.3567 -0.0170 0.0494  -0.0631 572  ASN A OD1 
4557 N ND2 . ASN A 556 ? 0.3651 0.3609 0.3522 -0.0172 0.0482  -0.0654 572  ASN A ND2 
4558 N N   . GLY A 557 ? 0.3930 0.3875 0.3677 -0.0228 0.0598  -0.0721 573  GLY A N   
4559 C CA  . GLY A 557 ? 0.3984 0.3988 0.3635 -0.0239 0.0568  -0.0736 573  GLY A CA  
4560 C C   . GLY A 557 ? 0.3966 0.4019 0.3559 -0.0214 0.0487  -0.0693 573  GLY A C   
4561 O O   . GLY A 557 ? 0.3992 0.4101 0.3507 -0.0219 0.0458  -0.0697 573  GLY A O   
4562 N N   . GLU A 558 ? 0.3905 0.3940 0.3536 -0.0187 0.0453  -0.0649 574  GLU A N   
4563 C CA  . GLU A 558 ? 0.3894 0.3967 0.3480 -0.0161 0.0380  -0.0607 574  GLU A CA  
4564 C C   . GLU A 558 ? 0.3811 0.3844 0.3399 -0.0126 0.0359  -0.0531 574  GLU A C   
4565 O O   . GLU A 558 ? 0.3784 0.3760 0.3424 -0.0118 0.0394  -0.0506 574  GLU A O   
4566 C CB  . GLU A 558 ? 0.3881 0.3965 0.3501 -0.0156 0.0354  -0.0613 574  GLU A CB  
4567 C CG  . GLU A 558 ? 0.4099 0.4229 0.3721 -0.0192 0.0371  -0.0688 574  GLU A CG  
4568 C CD  . GLU A 558 ? 0.4311 0.4461 0.3962 -0.0186 0.0341  -0.0692 574  GLU A CD  
4569 O OE1 . GLU A 558 ? 0.4284 0.4403 0.3962 -0.0154 0.0315  -0.0639 574  GLU A OE1 
4570 O OE2 . GLU A 558 ? 0.4489 0.4688 0.4135 -0.0215 0.0343  -0.0750 574  GLU A OE2 
4571 N N   . ARG A 559 ? 0.3777 0.3843 0.3312 -0.0106 0.0302  -0.0494 575  ARG A N   
4572 C CA  . ARG A 559 ? 0.3721 0.3755 0.3252 -0.0076 0.0279  -0.0426 575  ARG A CA  
4573 C C   . ARG A 559 ? 0.3673 0.3710 0.3202 -0.0048 0.0221  -0.0384 575  ARG A C   
4574 O O   . ARG A 559 ? 0.3656 0.3664 0.3186 -0.0024 0.0199  -0.0330 575  ARG A O   
4575 C CB  . ARG A 559 ? 0.3773 0.3835 0.3239 -0.0079 0.0276  -0.0416 575  ARG A CB  
4576 C CG  . ARG A 559 ? 0.3814 0.3864 0.3281 -0.0104 0.0337  -0.0450 575  ARG A CG  
4577 C CD  . ARG A 559 ? 0.3897 0.3974 0.3299 -0.0102 0.0333  -0.0431 575  ARG A CD  
4578 N NE  . ARG A 559 ? 0.3873 0.3918 0.3281 -0.0071 0.0307  -0.0358 575  ARG A NE  
4579 C CZ  . ARG A 559 ? 0.3883 0.3870 0.3338 -0.0062 0.0336  -0.0324 575  ARG A CZ  
4580 N NH1 . ARG A 559 ? 0.3893 0.3845 0.3394 -0.0078 0.0395  -0.0352 575  ARG A NH1 
4581 N NH2 . ARG A 559 ? 0.3829 0.3794 0.3288 -0.0037 0.0307  -0.0261 575  ARG A NH2 
4582 N N   . ILE A 560 ? 0.3626 0.3698 0.3155 -0.0051 0.0199  -0.0412 576  ILE A N   
4583 C CA  . ILE A 560 ? 0.3591 0.3674 0.3112 -0.0025 0.0145  -0.0379 576  ILE A CA  
4584 C C   . ILE A 560 ? 0.3512 0.3568 0.3090 -0.0020 0.0147  -0.0383 576  ILE A C   
4585 O O   . ILE A 560 ? 0.3492 0.3557 0.3099 -0.0040 0.0175  -0.0428 576  ILE A O   
4586 C CB  . ILE A 560 ? 0.3630 0.3790 0.3094 -0.0029 0.0108  -0.0398 576  ILE A CB  
4587 C CG1 . ILE A 560 ? 0.3738 0.3930 0.3142 -0.0032 0.0105  -0.0386 576  ILE A CG1 
4588 C CG2 . ILE A 560 ? 0.3626 0.3794 0.3088 0.0000  0.0057  -0.0364 576  ILE A CG2 
4589 C CD1 . ILE A 560 ? 0.3907 0.4187 0.3257 -0.0048 0.0086  -0.0420 576  ILE A CD1 
4590 N N   . MET A 561 ? 0.3435 0.3459 0.3029 0.0006  0.0119  -0.0337 577  MET A N   
4591 C CA  . MET A 561 ? 0.3357 0.3366 0.2994 0.0016  0.0111  -0.0335 577  MET A CA  
4592 C C   . MET A 561 ? 0.3345 0.3408 0.2958 0.0018  0.0079  -0.0358 577  MET A C   
4593 O O   . MET A 561 ? 0.3345 0.3436 0.2915 0.0032  0.0039  -0.0339 577  MET A O   
4594 C CB  . MET A 561 ? 0.3331 0.3298 0.2983 0.0042  0.0088  -0.0281 577  MET A CB  
4595 C CG  . MET A 561 ? 0.3281 0.3235 0.2971 0.0054  0.0079  -0.0274 577  MET A CG  
4596 S SD  . MET A 561 ? 0.3329 0.3238 0.3031 0.0079  0.0053  -0.0216 577  MET A SD  
4597 C CE  . MET A 561 ? 0.3248 0.3174 0.2891 0.0096  0.0004  -0.0197 577  MET A CE  
4598 N N   . SER A 562 ? 0.3316 0.3393 0.2963 0.0003  0.0097  -0.0396 578  SER A N   
4599 C CA  . SER A 562 ? 0.3334 0.3469 0.2964 0.0000  0.0072  -0.0426 578  SER A CA  
4600 C C   . SER A 562 ? 0.3281 0.3410 0.2960 0.0002  0.0077  -0.0437 578  SER A C   
4601 O O   . SER A 562 ? 0.3248 0.3344 0.2979 -0.0007 0.0116  -0.0447 578  SER A O   
4602 C CB  . SER A 562 ? 0.3381 0.3567 0.2988 -0.0034 0.0092  -0.0478 578  SER A CB  
4603 O OG  . SER A 562 ? 0.3464 0.3714 0.3063 -0.0042 0.0070  -0.0509 578  SER A OG  
4604 N N   . GLY A 563 ? 0.3267 0.3431 0.2934 0.0017  0.0039  -0.0432 579  GLY A N   
4605 C CA  . GLY A 563 ? 0.3237 0.3406 0.2946 0.0020  0.0040  -0.0444 579  GLY A CA  
4606 C C   . GLY A 563 ? 0.3258 0.3478 0.2982 -0.0008 0.0056  -0.0500 579  GLY A C   
4607 O O   . GLY A 563 ? 0.3226 0.3460 0.2985 -0.0007 0.0056  -0.0512 579  GLY A O   
4608 N N   . LYS A 564 ? 0.3294 0.3546 0.2992 -0.0035 0.0070  -0.0534 580  LYS A N   
4609 C CA  . LYS A 564 ? 0.3340 0.3649 0.3049 -0.0069 0.0084  -0.0593 580  LYS A CA  
4610 C C   . LYS A 564 ? 0.3291 0.3567 0.3070 -0.0088 0.0133  -0.0623 580  LYS A C   
4611 O O   . LYS A 564 ? 0.3276 0.3586 0.3086 -0.0100 0.0135  -0.0654 580  LYS A O   
4612 C CB  . LYS A 564 ? 0.3420 0.3767 0.3083 -0.0097 0.0093  -0.0625 580  LYS A CB  
4613 C CG  . LYS A 564 ? 0.3635 0.4050 0.3301 -0.0136 0.0105  -0.0691 580  LYS A CG  
4614 C CD  . LYS A 564 ? 0.3965 0.4415 0.3582 -0.0166 0.0118  -0.0725 580  LYS A CD  
4615 C CE  . LYS A 564 ? 0.4152 0.4670 0.3773 -0.0211 0.0132  -0.0798 580  LYS A CE  
4616 N NZ  . LYS A 564 ? 0.4437 0.4993 0.4003 -0.0242 0.0146  -0.0834 580  LYS A NZ  
4617 N N   . ALA A 565 ? 0.3236 0.3447 0.3045 -0.0088 0.0174  -0.0611 581  ALA A N   
4618 C CA  . ALA A 565 ? 0.3191 0.3366 0.3072 -0.0105 0.0227  -0.0635 581  ALA A CA  
4619 C C   . ALA A 565 ? 0.3121 0.3282 0.3050 -0.0084 0.0222  -0.0611 581  ALA A C   
4620 O O   . ALA A 565 ? 0.3099 0.3270 0.3079 -0.0102 0.0249  -0.0643 581  ALA A O   
4621 C CB  . ALA A 565 ? 0.3200 0.3313 0.3104 -0.0107 0.0272  -0.0619 581  ALA A CB  
4622 N N   . ILE A 566 ? 0.3061 0.3200 0.2975 -0.0049 0.0189  -0.0555 582  ILE A N   
4623 C CA  . ILE A 566 ? 0.3013 0.3141 0.2963 -0.0027 0.0182  -0.0531 582  ILE A CA  
4624 C C   . ILE A 566 ? 0.3033 0.3220 0.2978 -0.0030 0.0155  -0.0556 582  ILE A C   
4625 O O   . ILE A 566 ? 0.3022 0.3212 0.3016 -0.0031 0.0170  -0.0564 582  ILE A O   
4626 C CB  . ILE A 566 ? 0.2974 0.3066 0.2904 0.0008  0.0154  -0.0470 582  ILE A CB  
4627 C CG1 . ILE A 566 ? 0.2885 0.2964 0.2857 0.0026  0.0157  -0.0447 582  ILE A CG1 
4628 C CG2 . ILE A 566 ? 0.2958 0.3075 0.2821 0.0025  0.0100  -0.0454 582  ILE A CG2 
4629 C CD1 . ILE A 566 ? 0.2779 0.2823 0.2738 0.0056  0.0137  -0.0392 582  ILE A CD1 
4630 N N   . ALA A 567 ? 0.3073 0.3309 0.2963 -0.0031 0.0116  -0.0567 583  ALA A N   
4631 C CA  . ALA A 567 ? 0.3111 0.3413 0.2998 -0.0034 0.0088  -0.0589 583  ALA A CA  
4632 C C   . ALA A 567 ? 0.3159 0.3497 0.3085 -0.0074 0.0121  -0.0650 583  ALA A C   
4633 O O   . ALA A 567 ? 0.3142 0.3515 0.3100 -0.0079 0.0118  -0.0667 583  ALA A O   
4634 C CB  . ALA A 567 ? 0.3151 0.3501 0.2973 -0.0025 0.0041  -0.0579 583  ALA A CB  
4635 N N   . GLU A 568 ? 0.3212 0.3538 0.3136 -0.0104 0.0155  -0.0682 584  GLU A N   
4636 C CA  . GLU A 568 ? 0.3278 0.3630 0.3241 -0.0148 0.0194  -0.0746 584  GLU A CA  
4637 C C   . GLU A 568 ? 0.3250 0.3560 0.3295 -0.0150 0.0238  -0.0749 584  GLU A C   
4638 O O   . GLU A 568 ? 0.3276 0.3620 0.3364 -0.0172 0.0252  -0.0787 584  GLU A O   
4639 C CB  . GLU A 568 ? 0.3333 0.3670 0.3275 -0.0176 0.0226  -0.0776 584  GLU A CB  
4640 C CG  . GLU A 568 ? 0.3471 0.3844 0.3435 -0.0226 0.0261  -0.0852 584  GLU A CG  
4641 C CD  . GLU A 568 ? 0.3655 0.4024 0.3580 -0.0252 0.0284  -0.0883 584  GLU A CD  
4642 O OE1 . GLU A 568 ? 0.3730 0.4107 0.3590 -0.0235 0.0253  -0.0851 584  GLU A OE1 
4643 O OE2 . GLU A 568 ? 0.3711 0.4068 0.3672 -0.0291 0.0337  -0.0939 584  GLU A OE2 
4644 N N   . TYR A 569 ? 0.3201 0.3441 0.3270 -0.0127 0.0261  -0.0705 585  TYR A N   
4645 C CA  . TYR A 569 ? 0.3182 0.3380 0.3329 -0.0123 0.0303  -0.0693 585  TYR A CA  
4646 C C   . TYR A 569 ? 0.3157 0.3387 0.3326 -0.0107 0.0280  -0.0683 585  TYR A C   
4647 O O   . TYR A 569 ? 0.3136 0.3371 0.3369 -0.0123 0.0314  -0.0707 585  TYR A O   
4648 C CB  . TYR A 569 ? 0.3142 0.3275 0.3298 -0.0094 0.0316  -0.0635 585  TYR A CB  
4649 C CG  . TYR A 569 ? 0.3128 0.3218 0.3366 -0.0088 0.0366  -0.0615 585  TYR A CG  
4650 C CD1 . TYR A 569 ? 0.3080 0.3175 0.3345 -0.0065 0.0355  -0.0585 585  TYR A CD1 
4651 C CD2 . TYR A 569 ? 0.3077 0.3123 0.3368 -0.0105 0.0426  -0.0624 585  TYR A CD2 
4652 C CE1 . TYR A 569 ? 0.3070 0.3132 0.3410 -0.0059 0.0400  -0.0561 585  TYR A CE1 
4653 C CE2 . TYR A 569 ? 0.3091 0.3101 0.3463 -0.0098 0.0474  -0.0599 585  TYR A CE2 
4654 C CZ  . TYR A 569 ? 0.3035 0.3055 0.3430 -0.0074 0.0460  -0.0566 585  TYR A CZ  
4655 O OH  . TYR A 569 ? 0.3066 0.3056 0.3540 -0.0065 0.0507  -0.0536 585  TYR A OH  
4656 N N   . PHE A 570 ? 0.3144 0.3395 0.3263 -0.0076 0.0226  -0.0648 586  PHE A N   
4657 C CA  . PHE A 570 ? 0.3132 0.3406 0.3268 -0.0055 0.0204  -0.0631 586  PHE A CA  
4658 C C   . PHE A 570 ? 0.3167 0.3518 0.3286 -0.0067 0.0171  -0.0664 586  PHE A C   
4659 O O   . PHE A 570 ? 0.3171 0.3546 0.3305 -0.0049 0.0153  -0.0652 586  PHE A O   
4660 C CB  . PHE A 570 ? 0.3069 0.3314 0.3168 -0.0012 0.0171  -0.0571 586  PHE A CB  
4661 C CG  . PHE A 570 ? 0.3037 0.3219 0.3165 0.0001  0.0201  -0.0533 586  PHE A CG  
4662 C CD1 . PHE A 570 ? 0.2943 0.3110 0.3133 0.0006  0.0234  -0.0519 586  PHE A CD1 
4663 C CD2 . PHE A 570 ? 0.2963 0.3108 0.3060 0.0008  0.0199  -0.0507 586  PHE A CD2 
4664 C CE1 . PHE A 570 ? 0.2926 0.3044 0.3145 0.0020  0.0261  -0.0479 586  PHE A CE1 
4665 C CE2 . PHE A 570 ? 0.3012 0.3107 0.3139 0.0020  0.0226  -0.0469 586  PHE A CE2 
4666 C CZ  . PHE A 570 ? 0.2948 0.3032 0.3136 0.0027  0.0256  -0.0453 586  PHE A CZ  
4667 N N   . GLU A 571 ? 0.3248 0.3640 0.3338 -0.0096 0.0164  -0.0706 587  GLU A N   
4668 C CA  . GLU A 571 ? 0.3309 0.3787 0.3384 -0.0110 0.0131  -0.0736 587  GLU A CA  
4669 C C   . GLU A 571 ? 0.3291 0.3803 0.3431 -0.0123 0.0146  -0.0762 587  GLU A C   
4670 O O   . GLU A 571 ? 0.3264 0.3828 0.3399 -0.0108 0.0110  -0.0752 587  GLU A O   
4671 C CB  . GLU A 571 ? 0.3383 0.3905 0.3419 -0.0146 0.0128  -0.0781 587  GLU A CB  
4672 C CG  . GLU A 571 ? 0.3570 0.4193 0.3591 -0.0166 0.0094  -0.0815 587  GLU A CG  
4673 C CD  . GLU A 571 ? 0.3770 0.4438 0.3744 -0.0128 0.0034  -0.0771 587  GLU A CD  
4674 O OE1 . GLU A 571 ? 0.3855 0.4474 0.3795 -0.0091 0.0017  -0.0719 587  GLU A OE1 
4675 O OE2 . GLU A 571 ? 0.3840 0.4594 0.3813 -0.0138 0.0005  -0.0788 587  GLU A OE2 
4676 N N   . PRO A 572 ? 0.3311 0.3793 0.3517 -0.0151 0.0201  -0.0793 588  PRO A N   
4677 C CA  . PRO A 572 ? 0.3294 0.3805 0.3568 -0.0162 0.0218  -0.0813 588  PRO A CA  
4678 C C   . PRO A 572 ? 0.3234 0.3726 0.3525 -0.0119 0.0205  -0.0761 588  PRO A C   
4679 O O   . PRO A 572 ? 0.3218 0.3758 0.3540 -0.0118 0.0194  -0.0768 588  PRO A O   
4680 C CB  . PRO A 572 ? 0.3328 0.3793 0.3672 -0.0195 0.0286  -0.0847 588  PRO A CB  
4681 C CG  . PRO A 572 ? 0.3368 0.3767 0.3684 -0.0188 0.0305  -0.0826 588  PRO A CG  
4682 C CD  . PRO A 572 ? 0.3349 0.3779 0.3576 -0.0177 0.0252  -0.0816 588  PRO A CD  
4683 N N   . LEU A 573 ? 0.3189 0.3618 0.3461 -0.0086 0.0206  -0.0709 589  LEU A N   
4684 C CA  . LEU A 573 ? 0.3139 0.3552 0.3413 -0.0044 0.0191  -0.0660 589  LEU A CA  
4685 C C   . LEU A 573 ? 0.3140 0.3600 0.3358 -0.0019 0.0132  -0.0643 589  LEU A C   
4686 O O   . LEU A 573 ? 0.3103 0.3589 0.3339 -0.0001 0.0119  -0.0630 589  LEU A O   
4687 C CB  . LEU A 573 ? 0.3099 0.3439 0.3362 -0.0019 0.0205  -0.0611 589  LEU A CB  
4688 C CG  . LEU A 573 ? 0.3058 0.3381 0.3313 0.0022  0.0188  -0.0561 589  LEU A CG  
4689 C CD1 . LEU A 573 ? 0.3042 0.3371 0.3366 0.0022  0.0221  -0.0560 589  LEU A CD1 
4690 C CD2 . LEU A 573 ? 0.2950 0.3213 0.3178 0.0043  0.0191  -0.0517 589  LEU A CD2 
4691 N N   . ARG A 574 ? 0.3174 0.3644 0.3329 -0.0018 0.0101  -0.0642 590  ARG A N   
4692 C CA  . ARG A 574 ? 0.3192 0.3705 0.3297 0.0005  0.0048  -0.0623 590  ARG A CA  
4693 C C   . ARG A 574 ? 0.3196 0.3792 0.3329 -0.0005 0.0032  -0.0650 590  ARG A C   
4694 O O   . ARG A 574 ? 0.3169 0.3788 0.3301 0.0023  0.0007  -0.0626 590  ARG A O   
4695 C CB  . ARG A 574 ? 0.3232 0.3752 0.3274 0.0002  0.0022  -0.0621 590  ARG A CB  
4696 C CG  . ARG A 574 ? 0.3295 0.3849 0.3288 0.0033  -0.0028 -0.0591 590  ARG A CG  
4697 C CD  . ARG A 574 ? 0.3464 0.4046 0.3400 0.0023  -0.0052 -0.0594 590  ARG A CD  
4698 N NE  . ARG A 574 ? 0.3649 0.4306 0.3593 -0.0016 -0.0051 -0.0643 590  ARG A NE  
4699 C CZ  . ARG A 574 ? 0.3769 0.4514 0.3717 -0.0020 -0.0079 -0.0656 590  ARG A CZ  
4700 N NH1 . ARG A 574 ? 0.3821 0.4587 0.3771 0.0015  -0.0108 -0.0621 590  ARG A NH1 
4701 N NH2 . ARG A 574 ? 0.3864 0.4678 0.3815 -0.0061 -0.0076 -0.0704 590  ARG A NH2 
4702 N N   . VAL A 575 ? 0.3215 0.3855 0.3373 -0.0048 0.0048  -0.0701 591  VAL A N   
4703 C CA  . VAL A 575 ? 0.3230 0.3957 0.3420 -0.0066 0.0035  -0.0732 591  VAL A CA  
4704 C C   . VAL A 575 ? 0.3177 0.3900 0.3429 -0.0052 0.0053  -0.0721 591  VAL A C   
4705 O O   . VAL A 575 ? 0.3169 0.3943 0.3427 -0.0033 0.0024  -0.0708 591  VAL A O   
4706 C CB  . VAL A 575 ? 0.3281 0.4051 0.3492 -0.0123 0.0056  -0.0797 591  VAL A CB  
4707 C CG1 . VAL A 575 ? 0.3338 0.4202 0.3592 -0.0145 0.0044  -0.0830 591  VAL A CG1 
4708 C CG2 . VAL A 575 ? 0.3369 0.4160 0.3512 -0.0136 0.0035  -0.0807 591  VAL A CG2 
4709 N N   . TRP A 576 ? 0.3148 0.3811 0.3448 -0.0060 0.0101  -0.0724 592  TRP A N   
4710 C CA  . TRP A 576 ? 0.3134 0.3790 0.3494 -0.0047 0.0123  -0.0711 592  TRP A CA  
4711 C C   . TRP A 576 ? 0.3064 0.3700 0.3396 0.0003  0.0098  -0.0657 592  TRP A C   
4712 O O   . TRP A 576 ? 0.3037 0.3710 0.3396 0.0018  0.0090  -0.0649 592  TRP A O   
4713 C CB  . TRP A 576 ? 0.3143 0.3736 0.3560 -0.0063 0.0183  -0.0716 592  TRP A CB  
4714 C CG  . TRP A 576 ? 0.3206 0.3795 0.3684 -0.0048 0.0208  -0.0698 592  TRP A CG  
4715 C CD1 . TRP A 576 ? 0.3264 0.3896 0.3814 -0.0073 0.0231  -0.0730 592  TRP A CD1 
4716 C CD2 . TRP A 576 ? 0.3269 0.3813 0.3742 -0.0006 0.0212  -0.0645 592  TRP A CD2 
4717 N NE1 . TRP A 576 ? 0.3310 0.3924 0.3901 -0.0047 0.0251  -0.0696 592  TRP A NE1 
4718 C CE2 . TRP A 576 ? 0.3295 0.3857 0.3836 -0.0006 0.0240  -0.0644 592  TRP A CE2 
4719 C CE3 . TRP A 576 ? 0.3330 0.3823 0.3747 0.0028  0.0196  -0.0599 592  TRP A CE3 
4720 C CZ2 . TRP A 576 ? 0.3333 0.3866 0.3884 0.0028  0.0251  -0.0599 592  TRP A CZ2 
4721 C CZ3 . TRP A 576 ? 0.3375 0.3841 0.3801 0.0061  0.0206  -0.0556 592  TRP A CZ3 
4722 C CH2 . TRP A 576 ? 0.3390 0.3876 0.3880 0.0061  0.0233  -0.0556 592  TRP A CH2 
4723 N N   . LEU A 577 ? 0.3033 0.3611 0.3311 0.0028  0.0087  -0.0622 593  LEU A N   
4724 C CA  . LEU A 577 ? 0.2989 0.3536 0.3239 0.0073  0.0070  -0.0574 593  LEU A CA  
4725 C C   . LEU A 577 ? 0.2985 0.3581 0.3202 0.0098  0.0023  -0.0562 593  LEU A C   
4726 O O   . LEU A 577 ? 0.2960 0.3561 0.3186 0.0127  0.0017  -0.0540 593  LEU A O   
4727 C CB  . LEU A 577 ? 0.2984 0.3459 0.3188 0.0088  0.0071  -0.0544 593  LEU A CB  
4728 C CG  . LEU A 577 ? 0.2980 0.3414 0.3154 0.0129  0.0058  -0.0498 593  LEU A CG  
4729 C CD1 . LEU A 577 ? 0.2981 0.3405 0.3201 0.0140  0.0087  -0.0485 593  LEU A CD1 
4730 C CD2 . LEU A 577 ? 0.2988 0.3361 0.3122 0.0135  0.0058  -0.0475 593  LEU A CD2 
4731 N N   . GLU A 578 ? 0.2991 0.3624 0.3170 0.0087  -0.0006 -0.0575 594  GLU A N   
4732 C CA  . GLU A 578 ? 0.3007 0.3696 0.3162 0.0109  -0.0049 -0.0561 594  GLU A CA  
4733 C C   . GLU A 578 ? 0.2995 0.3753 0.3206 0.0106  -0.0048 -0.0576 594  GLU A C   
4734 O O   . GLU A 578 ? 0.3000 0.3775 0.3211 0.0139  -0.0066 -0.0551 594  GLU A O   
4735 C CB  . GLU A 578 ? 0.3027 0.3759 0.3141 0.0092  -0.0077 -0.0574 594  GLU A CB  
4736 C CG  . GLU A 578 ? 0.3132 0.3805 0.3184 0.0108  -0.0089 -0.0547 594  GLU A CG  
4737 C CD  . GLU A 578 ? 0.3320 0.4041 0.3330 0.0095  -0.0117 -0.0555 594  GLU A CD  
4738 O OE1 . GLU A 578 ? 0.3419 0.4227 0.3439 0.0083  -0.0138 -0.0571 594  GLU A OE1 
4739 O OE2 . GLU A 578 ? 0.3405 0.4080 0.3371 0.0095  -0.0118 -0.0543 594  GLU A OE2 
4740 N N   . ALA A 579 ? 0.2987 0.3780 0.3248 0.0066  -0.0023 -0.0617 595  ALA A N   
4741 C CA  . ALA A 579 ? 0.2989 0.3850 0.3311 0.0056  -0.0018 -0.0636 595  ALA A CA  
4742 C C   . ALA A 579 ? 0.2961 0.3783 0.3322 0.0081  0.0007  -0.0613 595  ALA A C   
4743 O O   . ALA A 579 ? 0.2958 0.3825 0.3348 0.0100  -0.0001 -0.0603 595  ALA A O   
4744 C CB  . ALA A 579 ? 0.3009 0.3911 0.3376 0.0002  0.0004  -0.0690 595  ALA A CB  
4745 N N   . GLU A 580 ? 0.2944 0.3689 0.3307 0.0083  0.0041  -0.0602 596  GLU A N   
4746 C CA  . GLU A 580 ? 0.2954 0.3663 0.3350 0.0106  0.0070  -0.0578 596  GLU A CA  
4747 C C   . GLU A 580 ? 0.2916 0.3607 0.3270 0.0154  0.0045  -0.0537 596  GLU A C   
4748 O O   . GLU A 580 ? 0.2907 0.3611 0.3290 0.0175  0.0055  -0.0523 596  GLU A O   
4749 C CB  . GLU A 580 ? 0.2961 0.3598 0.3369 0.0096  0.0111  -0.0572 596  GLU A CB  
4750 C CG  . GLU A 580 ? 0.3106 0.3720 0.3561 0.0111  0.0148  -0.0550 596  GLU A CG  
4751 C CD  . GLU A 580 ? 0.3327 0.3988 0.3867 0.0084  0.0178  -0.0579 596  GLU A CD  
4752 O OE1 . GLU A 580 ? 0.3409 0.4114 0.3973 0.0047  0.0176  -0.0622 596  GLU A OE1 
4753 O OE2 . GLU A 580 ? 0.3501 0.4156 0.4082 0.0098  0.0206  -0.0560 596  GLU A OE2 
4754 N N   . ASN A 581 ? 0.2891 0.3552 0.3179 0.0171  0.0016  -0.0519 597  ASN A N   
4755 C CA  . ASN A 581 ? 0.2883 0.3524 0.3129 0.0214  -0.0006 -0.0485 597  ASN A CA  
4756 C C   . ASN A 581 ? 0.2914 0.3624 0.3176 0.0231  -0.0032 -0.0484 597  ASN A C   
4757 O O   . ASN A 581 ? 0.2889 0.3593 0.3151 0.0264  -0.0033 -0.0462 597  ASN A O   
4758 C CB  . ASN A 581 ? 0.2863 0.3456 0.3041 0.0224  -0.0029 -0.0468 597  ASN A CB  
4759 C CG  . ASN A 581 ? 0.2863 0.3381 0.3022 0.0225  -0.0007 -0.0453 597  ASN A CG  
4760 O OD1 . ASN A 581 ? 0.2777 0.3274 0.2962 0.0231  0.0020  -0.0444 597  ASN A OD1 
4761 N ND2 . ASN A 581 ? 0.2882 0.3363 0.2997 0.0219  -0.0019 -0.0448 597  ASN A ND2 
4762 N N   . ILE A 582 ? 0.2941 0.3719 0.3215 0.0208  -0.0051 -0.0506 598  ILE A N   
4763 C CA  . ILE A 582 ? 0.2990 0.3849 0.3289 0.0220  -0.0075 -0.0504 598  ILE A CA  
4764 C C   . ILE A 582 ? 0.3003 0.3898 0.3372 0.0216  -0.0050 -0.0514 598  ILE A C   
4765 O O   . ILE A 582 ? 0.3001 0.3920 0.3387 0.0247  -0.0056 -0.0494 598  ILE A O   
4766 C CB  . ILE A 582 ? 0.3003 0.3937 0.3298 0.0192  -0.0103 -0.0525 598  ILE A CB  
4767 C CG1 . ILE A 582 ? 0.3029 0.3935 0.3254 0.0205  -0.0132 -0.0505 598  ILE A CG1 
4768 C CG2 . ILE A 582 ? 0.3018 0.4052 0.3355 0.0198  -0.0124 -0.0524 598  ILE A CG2 
4769 C CD1 . ILE A 582 ? 0.3128 0.4096 0.3337 0.0171  -0.0153 -0.0529 598  ILE A CD1 
4770 N N   . LYS A 583 ? 0.3044 0.3940 0.3456 0.0179  -0.0019 -0.0544 599  LYS A N   
4771 C CA  . LYS A 583 ? 0.3093 0.4017 0.3577 0.0171  0.0011  -0.0554 599  LYS A CA  
4772 C C   . LYS A 583 ? 0.3059 0.3937 0.3543 0.0211  0.0030  -0.0521 599  LYS A C   
4773 O O   . LYS A 583 ? 0.3030 0.3948 0.3558 0.0225  0.0037  -0.0515 599  LYS A O   
4774 C CB  . LYS A 583 ? 0.3127 0.4033 0.3651 0.0127  0.0048  -0.0587 599  LYS A CB  
4775 C CG  . LYS A 583 ? 0.3339 0.4288 0.3949 0.0106  0.0080  -0.0607 599  LYS A CG  
4776 C CD  . LYS A 583 ? 0.3659 0.4588 0.4310 0.0059  0.0118  -0.0643 599  LYS A CD  
4777 C CE  . LYS A 583 ? 0.3860 0.4847 0.4510 0.0015  0.0098  -0.0688 599  LYS A CE  
4778 N NZ  . LYS A 583 ? 0.4036 0.4991 0.4718 -0.0029 0.0138  -0.0726 599  LYS A NZ  
4779 N N   . ASN A 584 ? 0.3026 0.3822 0.3458 0.0228  0.0037  -0.0500 600  ASN A N   
4780 C CA  . ASN A 584 ? 0.3009 0.3759 0.3429 0.0263  0.0055  -0.0471 600  ASN A CA  
4781 C C   . ASN A 584 ? 0.2990 0.3720 0.3354 0.0304  0.0027  -0.0445 600  ASN A C   
4782 O O   . ASN A 584 ? 0.2992 0.3677 0.3332 0.0332  0.0039  -0.0424 600  ASN A O   
4783 C CB  . ASN A 584 ? 0.3000 0.3679 0.3405 0.0255  0.0084  -0.0462 600  ASN A CB  
4784 C CG  . ASN A 584 ? 0.3038 0.3728 0.3512 0.0225  0.0126  -0.0477 600  ASN A CG  
4785 O OD1 . ASN A 584 ? 0.3040 0.3735 0.3553 0.0236  0.0154  -0.0465 600  ASN A OD1 
4786 N ND2 . ASN A 584 ? 0.3054 0.3744 0.3546 0.0187  0.0134  -0.0504 600  ASN A ND2 
4787 N N   . ASN A 585 ? 0.2976 0.3742 0.3322 0.0308  -0.0008 -0.0447 601  ASN A N   
4788 C CA  . ASN A 585 ? 0.2961 0.3712 0.3264 0.0347  -0.0033 -0.0422 601  ASN A CA  
4789 C C   . ASN A 585 ? 0.2936 0.3598 0.3177 0.0364  -0.0030 -0.0405 601  ASN A C   
4790 O O   . ASN A 585 ? 0.2930 0.3559 0.3147 0.0396  -0.0028 -0.0387 601  ASN A O   
4791 C CB  . ASN A 585 ? 0.2980 0.3767 0.3321 0.0377  -0.0026 -0.0411 601  ASN A CB  
4792 C CG  . ASN A 585 ? 0.3047 0.3836 0.3362 0.0415  -0.0051 -0.0389 601  ASN A CG  
4793 O OD1 . ASN A 585 ? 0.3193 0.3984 0.3523 0.0447  -0.0040 -0.0375 601  ASN A OD1 
4794 N ND2 . ASN A 585 ? 0.3045 0.3835 0.3326 0.0413  -0.0082 -0.0383 601  ASN A ND2 
4795 N N   . VAL A 586 ? 0.2883 0.3508 0.3098 0.0339  -0.0028 -0.0412 602  VAL A N   
4796 C CA  . VAL A 586 ? 0.2858 0.3406 0.3021 0.0347  -0.0023 -0.0397 602  VAL A CA  
4797 C C   . VAL A 586 ? 0.2856 0.3374 0.2964 0.0368  -0.0054 -0.0382 602  VAL A C   
4798 O O   . VAL A 586 ? 0.2837 0.3380 0.2936 0.0360  -0.0079 -0.0385 602  VAL A O   
4799 C CB  . VAL A 586 ? 0.2864 0.3385 0.3027 0.0314  -0.0008 -0.0407 602  VAL A CB  
4800 C CG1 . VAL A 586 ? 0.2810 0.3261 0.2921 0.0322  -0.0008 -0.0388 602  VAL A CG1 
4801 C CG2 . VAL A 586 ? 0.2840 0.3380 0.3063 0.0295  0.0028  -0.0417 602  VAL A CG2 
4802 N N   . HIS A 587 ? 0.2814 0.3282 0.2887 0.0395  -0.0052 -0.0366 603  HIS A N   
4803 C CA  . HIS A 587 ? 0.2823 0.3252 0.2847 0.0415  -0.0076 -0.0353 603  HIS A CA  
4804 C C   . HIS A 587 ? 0.2803 0.3189 0.2789 0.0395  -0.0085 -0.0351 603  HIS A C   
4805 O O   . HIS A 587 ? 0.2783 0.3138 0.2761 0.0380  -0.0068 -0.0351 603  HIS A O   
4806 C CB  . HIS A 587 ? 0.2839 0.3224 0.2838 0.0445  -0.0066 -0.0343 603  HIS A CB  
4807 C CG  . HIS A 587 ? 0.2893 0.3239 0.2852 0.0466  -0.0087 -0.0332 603  HIS A CG  
4808 N ND1 . HIS A 587 ? 0.2963 0.3245 0.2873 0.0465  -0.0091 -0.0327 603  HIS A ND1 
4809 C CD2 . HIS A 587 ? 0.2842 0.3205 0.2809 0.0490  -0.0102 -0.0323 603  HIS A CD2 
4810 C CE1 . HIS A 587 ? 0.2914 0.3170 0.2803 0.0485  -0.0107 -0.0318 603  HIS A CE1 
4811 N NE2 . HIS A 587 ? 0.3008 0.3311 0.2932 0.0502  -0.0113 -0.0313 603  HIS A NE2 
4812 N N   . ILE A 588 ? 0.2802 0.3191 0.2767 0.0397  -0.0111 -0.0345 604  ILE A N   
4813 C CA  . ILE A 588 ? 0.2796 0.3148 0.2726 0.0380  -0.0122 -0.0341 604  ILE A CA  
4814 C C   . ILE A 588 ? 0.2822 0.3121 0.2708 0.0403  -0.0138 -0.0323 604  ILE A C   
4815 O O   . ILE A 588 ? 0.2842 0.3152 0.2729 0.0428  -0.0151 -0.0313 604  ILE A O   
4816 C CB  . ILE A 588 ? 0.2793 0.3194 0.2732 0.0358  -0.0136 -0.0349 604  ILE A CB  
4817 C CG1 . ILE A 588 ? 0.2766 0.3225 0.2755 0.0333  -0.0120 -0.0373 604  ILE A CG1 
4818 C CG2 . ILE A 588 ? 0.2778 0.3140 0.2683 0.0339  -0.0142 -0.0346 604  ILE A CG2 
4819 C CD1 . ILE A 588 ? 0.2770 0.3201 0.2775 0.0311  -0.0089 -0.0384 604  ILE A CD1 
4820 N N   . GLY A 589 ? 0.2833 0.3076 0.2685 0.0393  -0.0136 -0.0317 605  GLY A N   
4821 C CA  . GLY A 589 ? 0.2870 0.3058 0.2683 0.0410  -0.0149 -0.0304 605  GLY A CA  
4822 C C   . GLY A 589 ? 0.2903 0.3052 0.2700 0.0424  -0.0136 -0.0305 605  GLY A C   
4823 O O   . GLY A 589 ? 0.2904 0.3073 0.2720 0.0426  -0.0117 -0.0313 605  GLY A O   
4824 N N   . TRP A 590 ? 0.2921 0.3016 0.2682 0.0433  -0.0145 -0.0298 606  TRP A N   
4825 C CA  . TRP A 590 ? 0.2971 0.3028 0.2708 0.0442  -0.0133 -0.0304 606  TRP A CA  
4826 C C   . TRP A 590 ? 0.3046 0.3055 0.2758 0.0461  -0.0143 -0.0302 606  TRP A C   
4827 O O   . TRP A 590 ? 0.3057 0.3046 0.2761 0.0461  -0.0159 -0.0291 606  TRP A O   
4828 C CB  . TRP A 590 ? 0.2915 0.2953 0.2633 0.0419  -0.0127 -0.0302 606  TRP A CB  
4829 C CG  . TRP A 590 ? 0.2904 0.2915 0.2604 0.0402  -0.0142 -0.0291 606  TRP A CG  
4830 C CD1 . TRP A 590 ? 0.2898 0.2860 0.2565 0.0402  -0.0155 -0.0286 606  TRP A CD1 
4831 C CD2 . TRP A 590 ? 0.2772 0.2804 0.2489 0.0382  -0.0145 -0.0286 606  TRP A CD2 
4832 N NE1 . TRP A 590 ? 0.2885 0.2838 0.2549 0.0384  -0.0165 -0.0275 606  TRP A NE1 
4833 C CE2 . TRP A 590 ? 0.2808 0.2803 0.2499 0.0372  -0.0159 -0.0275 606  TRP A CE2 
4834 C CE3 . TRP A 590 ? 0.2698 0.2776 0.2449 0.0369  -0.0134 -0.0291 606  TRP A CE3 
4835 C CZ2 . TRP A 590 ? 0.2727 0.2729 0.2424 0.0352  -0.0161 -0.0268 606  TRP A CZ2 
4836 C CZ3 . TRP A 590 ? 0.2656 0.2741 0.2413 0.0348  -0.0136 -0.0289 606  TRP A CZ3 
4837 C CH2 . TRP A 590 ? 0.2764 0.2810 0.2492 0.0340  -0.0150 -0.0276 606  TRP A CH2 
4838 N N   . THR A 591 ? 0.3113 0.3102 0.2814 0.0476  -0.0130 -0.0313 607  THR A N   
4839 C CA  . THR A 591 ? 0.3200 0.3134 0.2875 0.0491  -0.0132 -0.0318 607  THR A CA  
4840 C C   . THR A 591 ? 0.3227 0.3116 0.2863 0.0469  -0.0140 -0.0320 607  THR A C   
4841 O O   . THR A 591 ? 0.3174 0.3078 0.2802 0.0447  -0.0139 -0.0317 607  THR A O   
4842 C CB  . THR A 591 ? 0.3241 0.3169 0.2915 0.0512  -0.0112 -0.0335 607  THR A CB  
4843 O OG1 . THR A 591 ? 0.3234 0.3183 0.2896 0.0500  -0.0098 -0.0344 607  THR A OG1 
4844 C CG2 . THR A 591 ? 0.3321 0.3287 0.3038 0.0538  -0.0105 -0.0329 607  THR A CG2 
4845 N N   . THR A 592 ? 0.3280 0.3116 0.2897 0.0475  -0.0146 -0.0324 608  THR A N   
4846 C CA  . THR A 592 ? 0.3329 0.3123 0.2911 0.0453  -0.0154 -0.0328 608  THR A CA  
4847 C C   . THR A 592 ? 0.3333 0.3127 0.2885 0.0443  -0.0143 -0.0346 608  THR A C   
4848 O O   . THR A 592 ? 0.3327 0.3119 0.2874 0.0459  -0.0127 -0.0364 608  THR A O   
4849 C CB  . THR A 592 ? 0.3402 0.3138 0.2977 0.0461  -0.0160 -0.0329 608  THR A CB  
4850 O OG1 . THR A 592 ? 0.3473 0.3217 0.3075 0.0472  -0.0170 -0.0306 608  THR A OG1 
4851 C CG2 . THR A 592 ? 0.3440 0.3137 0.2983 0.0434  -0.0171 -0.0333 608  THR A CG2 
4852 N N   . SER A 593 ? 0.3311 0.3112 0.2845 0.0417  -0.0150 -0.0340 609  SER A N   
4853 C CA  . SER A 593 ? 0.3343 0.3156 0.2848 0.0406  -0.0142 -0.0350 609  SER A CA  
4854 C C   . SER A 593 ? 0.3460 0.3232 0.2927 0.0405  -0.0140 -0.0377 609  SER A C   
4855 O O   . SER A 593 ? 0.3454 0.3178 0.2915 0.0403  -0.0149 -0.0384 609  SER A O   
4856 C CB  . SER A 593 ? 0.3296 0.3126 0.2796 0.0379  -0.0152 -0.0330 609  SER A CB  
4857 O OG  . SER A 593 ? 0.3205 0.3054 0.2677 0.0367  -0.0147 -0.0335 609  SER A OG  
4858 N N   . ASN A 594 ? 0.3536 0.3326 0.2979 0.0406  -0.0126 -0.0393 610  ASN A N   
4859 C CA  A ASN A 594 ? 0.3668 0.3428 0.3068 0.0401  -0.0121 -0.0425 610  ASN A CA  
4860 C CA  B ASN A 594 ? 0.3682 0.3437 0.3082 0.0400  -0.0122 -0.0425 610  ASN A CA  
4861 C C   . ASN A 594 ? 0.3687 0.3467 0.3048 0.0372  -0.0131 -0.0424 610  ASN A C   
4862 O O   . ASN A 594 ? 0.3728 0.3499 0.3048 0.0363  -0.0126 -0.0452 610  ASN A O   
4863 C CB  A ASN A 594 ? 0.3674 0.3441 0.3070 0.0425  -0.0095 -0.0447 610  ASN A CB  
4864 C CB  B ASN A 594 ? 0.3709 0.3464 0.3105 0.0425  -0.0096 -0.0450 610  ASN A CB  
4865 C CG  A ASN A 594 ? 0.3643 0.3471 0.3032 0.0425  -0.0081 -0.0438 610  ASN A CG  
4866 C CG  B ASN A 594 ? 0.3752 0.3492 0.3192 0.0455  -0.0088 -0.0445 610  ASN A CG  
4867 O OD1 A ASN A 594 ? 0.3587 0.3455 0.2991 0.0414  -0.0088 -0.0410 610  ASN A OD1 
4868 O OD1 B ASN A 594 ? 0.3814 0.3509 0.3268 0.0462  -0.0094 -0.0446 610  ASN A OD1 
4869 N ND2 A ASN A 594 ? 0.3701 0.3534 0.3070 0.0439  -0.0059 -0.0461 610  ASN A ND2 
4870 N ND2 B ASN A 594 ? 0.3776 0.3558 0.3243 0.0475  -0.0073 -0.0437 610  ASN A ND2 
4871 N N   . LYS A 595 ? 0.3678 0.3491 0.3055 0.0357  -0.0143 -0.0392 611  LYS A N   
4872 C CA  . LYS A 595 ? 0.3761 0.3611 0.3111 0.0333  -0.0150 -0.0381 611  LYS A CA  
4873 C C   . LYS A 595 ? 0.3834 0.3663 0.3164 0.0305  -0.0173 -0.0381 611  LYS A C   
4874 O O   . LYS A 595 ? 0.3840 0.3706 0.3153 0.0285  -0.0182 -0.0366 611  LYS A O   
4875 C CB  . LYS A 595 ? 0.3687 0.3589 0.3070 0.0334  -0.0144 -0.0343 611  LYS A CB  
4876 C CG  . LYS A 595 ? 0.3710 0.3648 0.3109 0.0354  -0.0120 -0.0342 611  LYS A CG  
4877 C CD  . LYS A 595 ? 0.3853 0.3818 0.3208 0.0354  -0.0108 -0.0357 611  LYS A CD  
4878 C CE  . LYS A 595 ? 0.3922 0.3930 0.3297 0.0373  -0.0082 -0.0346 611  LYS A CE  
4879 N NZ  . LYS A 595 ? 0.4034 0.4022 0.3439 0.0398  -0.0069 -0.0362 611  LYS A NZ  
4880 N N   . CYS A 596 ? 0.3924 0.3696 0.3259 0.0305  -0.0182 -0.0395 612  CYS A N   
4881 C CA  . CYS A 596 ? 0.4042 0.3788 0.3358 0.0277  -0.0202 -0.0403 612  CYS A CA  
4882 C C   . CYS A 596 ? 0.4192 0.3875 0.3491 0.0279  -0.0198 -0.0443 612  CYS A C   
4883 O O   . CYS A 596 ? 0.4189 0.3828 0.3515 0.0297  -0.0193 -0.0444 612  CYS A O   
4884 C CB  . CYS A 596 ? 0.3976 0.3715 0.3326 0.0268  -0.0217 -0.0370 612  CYS A CB  
4885 S SG  . CYS A 596 ? 0.3926 0.3664 0.3258 0.0229  -0.0242 -0.0364 612  CYS A SG  
4886 N N   . VAL A 597 ? 0.4357 0.4041 0.3612 0.0260  -0.0199 -0.0476 613  VAL A N   
4887 C CA  . VAL A 597 ? 0.4548 0.4172 0.3784 0.0257  -0.0190 -0.0522 613  VAL A CA  
4888 C C   . VAL A 597 ? 0.4651 0.4231 0.3893 0.0231  -0.0208 -0.0526 613  VAL A C   
4889 O O   . VAL A 597 ? 0.4663 0.4273 0.3887 0.0200  -0.0228 -0.0520 613  VAL A O   
4890 C CB  . VAL A 597 ? 0.4609 0.4255 0.3791 0.0245  -0.0180 -0.0562 613  VAL A CB  
4891 C CG1 . VAL A 597 ? 0.4729 0.4309 0.3890 0.0234  -0.0170 -0.0616 613  VAL A CG1 
4892 C CG2 . VAL A 597 ? 0.4608 0.4285 0.3789 0.0275  -0.0157 -0.0560 613  VAL A CG2 
4893 N N   . SER A 598 ? 0.4774 0.4288 0.4044 0.0245  -0.0200 -0.0534 614  SER A N   
4894 C CA  . SER A 598 ? 0.4887 0.4353 0.4172 0.0224  -0.0213 -0.0535 614  SER A CA  
4895 C C   . SER A 598 ? 0.4988 0.4422 0.4239 0.0193  -0.0212 -0.0586 614  SER A C   
4896 O O   . SER A 598 ? 0.5095 0.4523 0.4316 0.0196  -0.0194 -0.0627 614  SER A O   
4897 C CB  . SER A 598 ? 0.4893 0.4302 0.4224 0.0252  -0.0202 -0.0521 614  SER A CB  
4898 O OG  . SER A 598 ? 0.4973 0.4416 0.4334 0.0271  -0.0209 -0.0474 614  SER A OG  
5039 O O   . HOH H .   ? 0.5747 0.5414 0.5790 0.0061  0.0760  0.0543  2001 HOH A O   
5040 O O   . HOH H .   ? 0.5534 0.5161 0.5743 0.0058  0.0966  0.0486  2002 HOH A O   
5041 O O   . HOH H .   ? 0.5269 0.4938 0.5811 0.0020  0.0433  0.0874  2003 HOH A O   
5042 O O   . HOH H .   ? 0.5665 0.5328 0.5657 0.0047  0.0883  0.0421  2004 HOH A O   
5043 O O   . HOH H .   ? 0.6177 0.5801 0.6264 0.0036  0.0892  0.0315  2005 HOH A O   
5044 O O   . HOH H .   ? 0.4594 0.4299 0.4469 0.0062  0.0763  0.0528  2006 HOH A O   
5045 O O   . HOH H .   ? 0.6751 0.6425 0.6587 0.0004  0.0879  0.0158  2007 HOH A O   
5046 O O   . HOH H .   ? 0.4381 0.4314 0.5485 0.0085  0.0541  0.0944  2008 HOH A O   
5047 O O   . HOH H .   ? 0.3232 0.2893 0.3931 0.0095  0.0743  0.0519  2009 HOH A O   
5048 O O   . HOH H .   ? 0.4366 0.5502 0.5526 0.0166  0.0010  0.1380  2010 HOH A O   
5049 O O   . HOH H .   ? 0.4282 0.4609 0.4569 0.0024  -0.0198 0.0564  2011 HOH A O   
5050 O O   . HOH H .   ? 0.4140 0.4627 0.5838 0.0262  0.0573  0.1361  2012 HOH A O   
5051 O O   . HOH H .   ? 0.4739 0.5232 0.5827 0.0077  0.0108  0.1068  2013 HOH A O   
5052 O O   . HOH H .   ? 0.4540 0.5016 0.5629 0.0035  0.0066  0.1063  2014 HOH A O   
5053 O O   . HOH H .   ? 0.3612 0.3642 0.4268 0.0087  0.0177  0.0670  2015 HOH A O   
5054 O O   . HOH H .   ? 0.4588 0.4915 0.5280 -0.0232 -0.0335 0.0732  2016 HOH A O   
5055 O O   . HOH H .   ? 0.3769 0.4157 0.5371 0.0300  0.0639  0.1248  2017 HOH A O   
5056 O O   . HOH H .   ? 0.3712 0.4580 0.5011 0.0172  0.0144  0.1333  2018 HOH A O   
5057 O O   . HOH H .   ? 0.4696 0.4921 0.5420 0.0122  0.0144  0.0758  2019 HOH A O   
5058 O O   . HOH H .   ? 0.6415 0.6568 0.6854 0.0062  -0.0035 0.0595  2020 HOH A O   
5059 O O   . HOH H .   ? 0.4712 0.5570 0.6071 0.0270  0.0289  0.1380  2021 HOH A O   
5060 O O   . HOH H .   ? 0.4709 0.5688 0.6000 0.0199  0.0135  0.1386  2022 HOH A O   
5061 O O   . HOH H .   ? 0.3606 0.4656 0.4526 0.0126  -0.0072 0.1211  2023 HOH A O   
5062 O O   . HOH H .   ? 0.3879 0.4421 0.4432 0.0138  -0.0018 0.0797  2024 HOH A O   
5063 O O   . HOH H .   ? 0.4987 0.5653 0.6588 0.0383  0.0606  0.1406  2025 HOH A O   
5064 O O   . HOH H .   ? 0.4827 0.5898 0.5044 0.0013  -0.0351 0.0803  2026 HOH A O   
5065 O O   . HOH H .   ? 0.4794 0.4607 0.4834 0.0034  -0.0159 0.0303  2027 HOH A O   
5066 O O   . HOH H .   ? 0.4983 0.4939 0.5108 0.0068  -0.0103 0.0347  2028 HOH A O   
5067 O O   . HOH H .   ? 0.4099 0.5571 0.4684 0.0205  -0.0128 0.1274  2029 HOH A O   
5068 O O   . HOH H .   ? 0.4840 0.5577 0.5421 -0.0248 -0.0472 0.0748  2030 HOH A O   
5069 O O   . HOH H .   ? 0.4568 0.6332 0.4947 0.0022  -0.0418 0.1189  2031 HOH A O   
5070 O O   . HOH H .   ? 0.5390 0.7286 0.5993 0.0015  -0.0420 0.1349  2032 HOH A O   
5071 O O   . HOH H .   ? 0.5179 0.6247 0.4927 0.0018  -0.0399 0.0531  2033 HOH A O   
5072 O O   . HOH H .   ? 0.4012 0.4543 0.4172 0.0226  0.0004  0.0540  2034 HOH A O   
5073 O O   . HOH H .   ? 0.5746 0.6727 0.5746 -0.0068 -0.0456 0.0599  2035 HOH A O   
5074 O O   . HOH H .   ? 0.3024 0.3514 0.3300 -0.0004 -0.0269 0.0605  2036 HOH A O   
5075 O O   . HOH H .   ? 0.4049 0.4746 0.4897 0.0391  0.0447  0.0984  2037 HOH A O   
5076 O O   . HOH H .   ? 0.5172 0.6102 0.6016 -0.0149 -0.0355 0.1003  2038 HOH A O   
5077 O O   . HOH H .   ? 0.6014 0.6189 0.6429 0.0250  0.0288  0.0330  2039 HOH A O   
5078 O O   . HOH H .   ? 0.4792 0.4944 0.5117 0.0230  0.0212  0.0312  2040 HOH A O   
5079 O O   . HOH H .   ? 0.3934 0.4384 0.4557 -0.0167 -0.0325 0.0745  2041 HOH A O   
5080 O O   . HOH H .   ? 0.3353 0.3902 0.4419 -0.0068 -0.0089 0.1054  2042 HOH A O   
5081 O O   . HOH H .   ? 0.5819 0.6065 0.6639 -0.0162 -0.0186 0.0835  2043 HOH A O   
5082 O O   . HOH H .   ? 0.4402 0.4843 0.3520 0.0029  -0.0367 -0.0195 2044 HOH A O   
5083 O O   . HOH H .   ? 0.4706 0.4580 0.5240 -0.0110 -0.0124 0.0659  2045 HOH A O   
5084 O O   . HOH H .   ? 0.3916 0.4210 0.4517 -0.0175 -0.0303 0.0698  2046 HOH A O   
5085 O O   . HOH H .   ? 0.5077 0.4641 0.4710 -0.0057 -0.0407 -0.0140 2047 HOH A O   
5086 O O   . HOH H .   ? 0.5012 0.4516 0.4778 -0.0098 -0.0405 -0.0049 2048 HOH A O   
5087 O O   . HOH H .   ? 0.4621 0.4119 0.4498 -0.0101 -0.0379 0.0067  2049 HOH A O   
5088 O O   . HOH H .   ? 0.6473 0.6123 0.6373 -0.0219 -0.0460 0.0022  2050 HOH A O   
5089 O O   . HOH H .   ? 0.6242 0.5637 0.6061 -0.0066 -0.0368 0.0002  2051 HOH A O   
5090 O O   . HOH H .   ? 0.6204 0.5593 0.5909 0.0006  -0.0355 -0.0074 2052 HOH A O   
5091 O O   . HOH H .   ? 0.4252 0.3849 0.4376 -0.0199 -0.0380 0.0236  2053 HOH A O   
5092 O O   . HOH H .   ? 0.3988 0.3471 0.3956 -0.0133 -0.0372 0.0127  2054 HOH A O   
5093 O O   . HOH H .   ? 0.4158 0.3802 0.4432 0.0015  0.0132  0.0605  2055 HOH A O   
5094 O O   . HOH H .   ? 0.5084 0.4837 0.5109 0.0051  -0.0105 0.0292  2056 HOH A O   
5095 O O   . HOH H .   ? 0.3821 0.3394 0.3535 0.0132  -0.0151 0.0198  2057 HOH A O   
5096 O O   . HOH H .   ? 0.6153 0.5703 0.5819 0.0167  -0.0182 0.0190  2058 HOH A O   
5097 O O   . HOH H .   ? 0.3567 0.3181 0.3833 0.0025  0.0228  0.0683  2059 HOH A O   
5098 O O   . HOH H .   ? 0.4330 0.3980 0.3980 0.0153  -0.0142 0.0112  2060 HOH A O   
5099 O O   . HOH H .   ? 0.5102 0.4582 0.4737 0.0221  -0.0257 0.0071  2061 HOH A O   
5100 O O   . HOH H .   ? 0.5072 0.4462 0.4761 0.0163  -0.0274 0.0065  2062 HOH A O   
5101 O O   . HOH H .   ? 0.4246 0.3858 0.4310 0.0063  0.0325  0.0669  2063 HOH A O   
5102 O O   . HOH H .   ? 0.3443 0.3275 0.3476 0.0094  -0.0044 0.0235  2064 HOH A O   
5103 O O   . HOH H .   ? 0.4675 0.4392 0.4812 0.0079  0.0234  0.0229  2065 HOH A O   
5104 O O   . HOH H .   ? 0.3760 0.3366 0.3873 0.0051  0.0255  0.0627  2066 HOH A O   
5105 O O   . HOH H .   ? 0.4706 0.4554 0.4269 0.0039  0.0204  -0.0073 2067 HOH A O   
5106 O O   . HOH H .   ? 0.3085 0.2767 0.2833 0.0082  0.0290  0.0416  2068 HOH A O   
5107 O O   . HOH H .   ? 0.3557 0.3280 0.3243 0.0074  0.0402  0.0406  2069 HOH A O   
5108 O O   . HOH H .   ? 0.3923 0.3528 0.4171 0.0015  0.0140  0.0642  2070 HOH A O   
5109 O O   . HOH H .   ? 0.4964 0.4566 0.5120 0.0021  0.0052  0.0539  2071 HOH A O   
5110 O O   . HOH H .   ? 0.4010 0.3754 0.3550 0.0249  -0.0221 0.0042  2072 HOH A O   
5111 O O   . HOH H .   ? 0.4881 0.4840 0.4312 0.0248  -0.0204 0.0062  2073 HOH A O   
5112 O O   . HOH H .   ? 0.5499 0.5683 0.4878 0.0133  -0.0124 -0.0153 2074 HOH A O   
5113 O O   . HOH H .   ? 1.1697 1.1319 1.1270 0.0274  -0.0243 0.0100  2075 HOH A O   
5114 O O   . HOH H .   ? 0.5504 0.5083 0.5093 0.0261  -0.0264 -0.0028 2076 HOH A O   
5115 O O   . HOH H .   ? 0.5524 0.5352 0.4571 0.0264  -0.0123 -0.0604 2077 HOH A O   
5116 O O   . HOH H .   ? 0.4921 0.4690 0.4073 0.0341  -0.0084 -0.0580 2078 HOH A O   
5117 O O   . HOH H .   ? 0.4078 0.3804 0.3845 0.0067  0.0643  0.0506  2079 HOH A O   
5118 O O   . HOH H .   ? 0.4068 0.4316 0.3568 0.0088  -0.0098 -0.0318 2080 HOH A O   
5119 O O   . HOH H .   ? 0.4975 0.5027 0.4529 0.0298  -0.0253 -0.0124 2081 HOH A O   
5120 O O   . HOH H .   ? 0.5317 0.5383 0.4720 0.0215  -0.0188 -0.0013 2082 HOH A O   
5121 O O   . HOH H .   ? 0.6563 0.6766 0.6153 0.0330  -0.0278 -0.0148 2083 HOH A O   
5122 O O   . HOH H .   ? 0.5281 0.4998 0.5007 -0.0004 0.0703  0.0069  2084 HOH A O   
5123 O O   . HOH H .   ? 0.6540 0.6324 0.6114 0.0023  0.0571  0.0175  2085 HOH A O   
5124 O O   . HOH H .   ? 0.4564 0.4720 0.4194 0.0314  -0.0248 -0.0201 2086 HOH A O   
5125 O O   . HOH H .   ? 0.5230 0.5615 0.5081 0.0047  -0.0028 -0.0521 2087 HOH A O   
5126 O O   . HOH H .   ? 0.4543 0.5064 0.4384 0.0114  -0.0125 -0.0483 2088 HOH A O   
5127 O O   . HOH H .   ? 0.4655 0.5030 0.4479 0.0320  -0.0198 -0.0322 2089 HOH A O   
5128 O O   . HOH H .   ? 0.5213 0.4908 0.5022 0.0048  0.0391  0.0199  2090 HOH A O   
5129 O O   . HOH H .   ? 0.3534 0.3254 0.3220 0.0067  0.0323  0.0282  2091 HOH A O   
5130 O O   . HOH H .   ? 0.3639 0.4435 0.3690 0.0199  -0.0174 -0.0476 2092 HOH A O   
5131 O O   . HOH H .   ? 0.4659 0.5359 0.4751 0.0284  -0.0145 -0.0425 2093 HOH A O   
5132 O O   . HOH H .   ? 0.6016 0.5594 0.6439 0.0050  0.0819  0.0220  2094 HOH A O   
5133 O O   . HOH H .   ? 0.4389 0.4023 0.4456 0.0019  0.0638  0.0074  2095 HOH A O   
5134 O O   . HOH H .   ? 0.6092 0.5684 0.6280 0.0009  0.0780  0.0037  2096 HOH A O   
5135 O O   . HOH H .   ? 0.4815 0.4389 0.5166 0.0045  0.0882  0.0255  2097 HOH A O   
5136 O O   . HOH H .   ? 0.4996 0.4664 0.4881 0.0064  0.0286  0.0293  2098 HOH A O   
5137 O O   . HOH H .   ? 0.4234 0.3906 0.4255 0.0065  0.0253  0.0271  2099 HOH A O   
5138 O O   . HOH H .   ? 0.4232 0.3914 0.4366 0.0066  0.0340  0.0227  2100 HOH A O   
5139 O O   . HOH H .   ? 0.4822 0.4526 0.4630 0.0047  0.0339  0.0128  2101 HOH A O   
5140 O O   . HOH H .   ? 0.3157 0.2856 0.3163 0.0051  0.0342  0.0045  2102 HOH A O   
5141 O O   . HOH H .   ? 0.4513 0.4645 0.4356 0.0569  -0.0103 -0.0307 2103 HOH A O   
5142 O O   . HOH H .   ? 0.7103 0.6780 0.6962 0.0079  0.0118  0.0208  2104 HOH A O   
5143 O O   . HOH H .   ? 0.4377 0.3998 0.4216 0.0087  -0.0022 0.0277  2105 HOH A O   
5144 O O   . HOH H .   ? 0.5385 0.5053 0.5521 0.0004  -0.0085 0.0431  2106 HOH A O   
5145 O O   . HOH H .   ? 0.5676 0.5364 0.5946 -0.0019 -0.0040 0.0533  2107 HOH A O   
5146 O O   . HOH H .   ? 0.4824 0.4515 0.4741 0.0081  0.0100  0.0189  2108 HOH A O   
5147 O O   . HOH H .   ? 0.4814 0.4524 0.4886 0.0030  -0.0092 0.0354  2109 HOH A O   
5148 O O   . HOH H .   ? 0.5547 0.5448 0.6041 0.0120  0.0458  -0.0073 2110 HOH A O   
5149 O O   . HOH H .   ? 0.3815 0.3724 0.3982 0.0027  -0.0128 0.0394  2111 HOH A O   
5150 O O   . HOH H .   ? 0.4051 0.3868 0.4025 0.0055  -0.0168 0.0246  2112 HOH A O   
5151 O O   . HOH H .   ? 0.3296 0.3184 0.3280 0.0068  -0.0160 0.0247  2113 HOH A O   
5152 O O   . HOH H .   ? 0.5072 0.4971 0.5435 -0.0208 -0.0339 0.0468  2114 HOH A O   
5153 O O   . HOH H .   ? 0.5033 0.4824 0.5360 -0.0127 -0.0238 0.0494  2115 HOH A O   
5154 O O   . HOH H .   ? 0.5451 0.5672 0.6014 -0.0286 -0.0405 0.0598  2116 HOH A O   
5155 O O   . HOH H .   ? 0.5265 0.5584 0.5695 -0.0382 -0.0538 0.0458  2117 HOH A O   
5156 O O   . HOH H .   ? 0.3460 0.3963 0.3969 -0.0193 -0.0397 0.0676  2118 HOH A O   
5157 O O   . HOH H .   ? 0.4725 0.5009 0.4808 -0.0350 -0.0585 0.0239  2119 HOH A O   
5158 O O   . HOH H .   ? 0.4834 0.5455 0.5037 -0.0346 -0.0609 0.0421  2120 HOH A O   
5159 O O   . HOH H .   ? 0.4981 0.4928 0.4971 -0.0312 -0.0533 0.0103  2121 HOH A O   
5160 O O   . HOH H .   ? 0.4018 0.4770 0.4354 -0.0163 -0.0458 0.0660  2122 HOH A O   
5161 O O   . HOH H .   ? 0.5808 0.6123 0.7974 0.0520  0.1255  0.1376  2123 HOH A O   
5162 O O   . HOH H .   ? 0.4197 0.4225 0.6532 0.0471  0.1400  0.1255  2124 HOH A O   
5163 O O   . HOH H .   ? 0.5097 0.4298 0.7080 0.0103  0.1781  0.0119  2125 HOH A O   
5164 O O   . HOH H .   ? 0.3113 0.3388 0.3123 0.0047  -0.0250 0.0373  2126 HOH A O   
5165 O O   . HOH H .   ? 0.4284 0.5143 0.4075 -0.0046 -0.0446 0.0435  2127 HOH A O   
5166 O O   . HOH H .   ? 0.2959 0.3388 0.2689 0.0083  -0.0288 0.0252  2128 HOH A O   
5167 O O   . HOH H .   ? 0.6502 0.6988 0.6956 0.0152  -0.0012 0.0712  2129 HOH A O   
5168 O O   . HOH H .   ? 0.5370 0.6395 0.5229 -0.0002 -0.0408 0.0568  2130 HOH A O   
5169 O O   . HOH H .   ? 0.3553 0.4478 0.3275 0.0073  -0.0329 0.0472  2131 HOH A O   
5170 O O   . HOH H .   ? 0.4146 0.4953 0.3662 0.0037  -0.0376 0.0272  2132 HOH A O   
5171 O O   . HOH H .   ? 0.5896 0.6755 0.5531 -0.0050 -0.0462 0.0336  2133 HOH A O   
5172 O O   . HOH H .   ? 0.3432 0.4008 0.3409 0.0201  -0.0089 0.0465  2134 HOH A O   
5173 O O   . HOH H .   ? 0.4280 0.5254 0.4378 0.0220  -0.0091 0.0759  2135 HOH A O   
5174 O O   . HOH H .   ? 0.4210 0.5209 0.4510 0.0222  -0.0060 0.0889  2136 HOH A O   
5175 O O   . HOH H .   ? 0.5983 0.7226 0.5715 0.0103  -0.0316 0.0644  2137 HOH A O   
5176 O O   . HOH H .   ? 0.3245 0.3988 0.3259 0.0225  -0.0067 0.0578  2138 HOH A O   
5177 O O   . HOH H .   ? 0.5134 0.6118 0.5456 0.0273  0.0025  0.0901  2139 HOH A O   
5178 O O   . HOH H .   ? 0.4571 0.5638 0.3957 0.0192  -0.0202 0.0361  2140 HOH A O   
5179 O O   . HOH H .   ? 0.6982 0.8229 0.6284 0.0286  -0.0073 0.0425  2141 HOH A O   
5180 O O   . HOH H .   ? 0.3737 0.4680 0.3618 0.0396  0.0179  0.0566  2142 HOH A O   
5181 O O   . HOH H .   ? 0.4252 0.5058 0.3817 0.0433  0.0190  0.0217  2143 HOH A O   
5182 O O   . HOH H .   ? 0.5631 0.6414 0.4894 0.0382  0.0071  0.0056  2144 HOH A O   
5183 O O   . HOH H .   ? 0.5086 0.5023 0.5546 0.0169  0.0385  0.0110  2145 HOH A O   
5184 O O   . HOH H .   ? 0.4481 0.5157 0.4710 0.0258  0.0045  0.0661  2146 HOH A O   
5185 O O   . HOH H .   ? 0.3966 0.4321 0.4614 0.0300  0.0371  0.0621  2147 HOH A O   
5186 O O   . HOH H .   ? 0.4412 0.4842 0.4849 0.0307  0.0277  0.0550  2148 HOH A O   
5187 O O   . HOH H .   ? 0.3932 0.4499 0.4658 0.0347  0.0384  0.0827  2149 HOH A O   
5188 O O   . HOH H .   ? 0.3727 0.4067 0.4112 0.0257  0.0194  0.0507  2150 HOH A O   
5189 O O   . HOH H .   ? 0.4222 0.4698 0.4689 0.0333  0.0328  0.0569  2151 HOH A O   
5190 O O   . HOH H .   ? 0.4118 0.4954 0.4366 0.0390  0.0262  0.0716  2152 HOH A O   
5191 O O   . HOH H .   ? 0.4196 0.5108 0.4994 0.0412  0.0388  0.1118  2153 HOH A O   
5192 O O   . HOH H .   ? 0.4999 0.5273 0.5179 0.0287  0.0199  0.0224  2154 HOH A O   
5193 O O   . HOH H .   ? 0.5178 0.5467 0.5599 0.0271  0.0263  0.0445  2155 HOH A O   
5194 O O   . HOH H .   ? 0.4482 0.4693 0.4678 0.0236  0.0129  0.0300  2156 HOH A O   
5195 O O   . HOH H .   ? 0.4997 0.4940 0.5465 0.0080  0.0449  -0.0233 2157 HOH A O   
5196 O O   . HOH H .   ? 0.5197 0.5995 0.5709 0.0402  0.0358  0.0844  2158 HOH A O   
5197 O O   . HOH H .   ? 0.4681 0.5021 0.4774 0.0341  0.0226  0.0087  2159 HOH A O   
5198 O O   . HOH H .   ? 0.3306 0.3607 0.3288 0.0327  0.0149  0.0059  2160 HOH A O   
5199 O O   . HOH H .   ? 0.4616 0.5025 0.5119 0.0358  0.0474  0.0273  2161 HOH A O   
5200 O O   . HOH H .   ? 0.5909 0.6215 0.6845 0.0342  0.0673  0.0520  2162 HOH A O   
5201 O O   . HOH H .   ? 0.4511 0.5128 0.4686 0.0426  0.0374  0.0332  2163 HOH A O   
5202 O O   . HOH H .   ? 0.4259 0.4598 0.3798 0.0394  0.0052  -0.0130 2164 HOH A O   
5203 O O   . HOH H .   ? 0.3955 0.4568 0.3284 0.0345  0.0005  0.0003  2165 HOH A O   
5204 O O   . HOH H .   ? 0.4743 0.5505 0.4188 0.0445  0.0184  0.0099  2166 HOH A O   
5205 O O   . HOH H .   ? 0.4151 0.4680 0.3582 0.0459  0.0161  -0.0112 2167 HOH A O   
5206 O O   . HOH H .   ? 0.4651 0.4247 0.4221 0.0253  -0.0268 -0.0124 2168 HOH A O   
5207 O O   . HOH H .   ? 0.6477 0.6129 0.6055 0.0282  -0.0259 -0.0067 2169 HOH A O   
5208 O O   . HOH H .   ? 0.3353 0.3534 0.3098 0.0285  -0.0026 -0.0023 2170 HOH A O   
5209 O O   . HOH H .   ? 0.3505 0.3676 0.2651 0.0193  -0.0217 -0.0310 2171 HOH A O   
5210 O O   . HOH H .   ? 0.4327 0.4717 0.3430 0.0138  -0.0261 -0.0220 2172 HOH A O   
5211 O O   . HOH H .   ? 0.5717 0.5218 0.5229 0.0270  -0.0267 -0.0247 2173 HOH A O   
5212 O O   . HOH H .   ? 0.2938 0.2970 0.2597 0.0222  -0.0148 -0.0050 2174 HOH A O   
5213 O O   . HOH H .   ? 0.5328 0.5903 0.4553 0.0011  -0.0395 -0.0050 2175 HOH A O   
5214 O O   . HOH H .   ? 0.3346 0.3634 0.2547 0.0084  -0.0324 -0.0195 2176 HOH A O   
5215 O O   . HOH H .   ? 0.4823 0.4585 0.4414 0.0405  -0.0211 -0.0256 2177 HOH A O   
5216 O O   . HOH H .   ? 0.4629 0.5443 0.3859 0.0092  -0.0317 0.0095  2178 HOH A O   
5217 O O   . HOH H .   ? 0.4407 0.4768 0.3765 -0.0132 -0.0508 -0.0112 2179 HOH A O   
5218 O O   . HOH H .   ? 0.4800 0.4461 0.4118 0.0030  -0.0360 -0.0394 2180 HOH A O   
5219 O O   . HOH H .   ? 0.5000 0.5072 0.4543 -0.0215 -0.0537 -0.0135 2181 HOH A O   
5220 O O   . HOH H .   ? 0.5356 0.6100 0.5063 -0.0175 -0.0558 0.0264  2182 HOH A O   
5221 O O   . HOH H .   ? 0.5549 0.5516 0.5708 0.0108  -0.0016 0.0325  2183 HOH A O   
5222 O O   . HOH H .   ? 0.5121 0.4817 0.4727 -0.0086 -0.0434 -0.0137 2184 HOH A O   
5223 O O   . HOH H .   ? 0.2390 0.2333 0.2184 0.0086  -0.0246 0.0120  2185 HOH A O   
5224 O O   . HOH H .   ? 0.3856 0.3455 0.3696 -0.0128 -0.0414 0.0029  2186 HOH A O   
5225 O O   . HOH H .   ? 0.5354 0.5269 0.5047 -0.0302 -0.0557 -0.0139 2187 HOH A O   
5226 O O   . HOH H .   ? 0.3017 0.2743 0.2929 0.0021  -0.0246 0.0211  2188 HOH A O   
5227 O O   . HOH H .   ? 0.3058 0.2675 0.2828 0.0034  -0.0309 0.0080  2189 HOH A O   
5228 O O   . HOH H .   ? 0.2819 0.2561 0.2697 0.0059  -0.0209 0.0179  2190 HOH A O   
5229 O O   . HOH H .   ? 0.3962 0.3480 0.3659 0.0009  -0.0359 -0.0037 2191 HOH A O   
5230 O O   . HOH H .   ? 0.4907 0.4474 0.4614 -0.0056 -0.0397 -0.0058 2192 HOH A O   
5231 O O   . HOH H .   ? 0.3220 0.2778 0.3255 -0.0127 -0.0348 0.0219  2193 HOH A O   
5232 O O   . HOH H .   ? 0.5157 0.4964 0.5379 -0.0325 -0.0470 0.0241  2194 HOH A O   
5233 O O   . HOH H .   ? 0.7254 0.7029 0.8592 -0.0429 0.1197  -0.1047 2195 HOH A O   
5234 O O   . HOH H .   ? 0.3785 0.3539 0.3787 0.0009  -0.0211 0.0284  2196 HOH A O   
5235 O O   . HOH H .   ? 0.3886 0.3338 0.3957 -0.0062 -0.0251 0.0331  2197 HOH A O   
5236 O O   . HOH H .   ? 0.4743 0.4128 0.4731 -0.0024 -0.0258 0.0275  2198 HOH A O   
5237 O O   . HOH H .   ? 0.4490 0.3971 0.4567 -0.0107 -0.0304 0.0277  2199 HOH A O   
5238 O O   . HOH H .   ? 0.5528 0.5230 0.5770 -0.0071 -0.0182 0.0469  2200 HOH A O   
5239 O O   . HOH H .   ? 0.4455 0.4151 0.4449 0.0029  -0.0162 0.0293  2201 HOH A O   
5240 O O   . HOH H .   ? 0.4352 0.3817 0.4151 0.0105  -0.0179 0.0275  2202 HOH A O   
5241 O O   . HOH H .   ? 0.2848 0.2355 0.2604 0.0117  -0.0191 0.0213  2203 HOH A O   
5242 O O   . HOH H .   ? 0.4555 0.3972 0.4301 0.0052  -0.0316 0.0040  2204 HOH A O   
5243 O O   . HOH H .   ? 0.2993 0.2617 0.2713 0.0125  -0.0128 0.0154  2205 HOH A O   
5244 O O   . HOH H .   ? 0.4746 0.4302 0.4386 0.0188  -0.0216 0.0122  2206 HOH A O   
5245 O O   . HOH H .   ? 0.4126 0.3586 0.3799 0.0176  -0.0253 0.0097  2207 HOH A O   
5246 O O   . HOH H .   ? 0.6537 0.6277 0.6503 0.0079  -0.0067 0.0226  2208 HOH A O   
5247 O O   . HOH H .   ? 0.3070 0.2825 0.2967 0.0110  -0.0025 0.0109  2209 HOH A O   
5248 O O   . HOH H .   ? 0.4273 0.4083 0.4295 0.0074  -0.0088 0.0260  2210 HOH A O   
5249 O O   . HOH H .   ? 0.3367 0.3081 0.3042 0.0123  -0.0045 0.0080  2211 HOH A O   
5250 O O   . HOH H .   ? 0.4599 0.4237 0.4331 0.0116  -0.0074 0.0185  2212 HOH A O   
5251 O O   . HOH H .   ? 0.6628 0.6339 0.6581 0.0077  0.0179  0.0119  2213 HOH A O   
5252 O O   . HOH H .   ? 0.5429 0.5137 0.5458 0.0079  0.0141  0.0219  2214 HOH A O   
5253 O O   . HOH H .   ? 0.4085 0.4680 0.4249 -0.0289 0.0239  -0.0975 2215 HOH A O   
5254 O O   . HOH H .   ? 0.3582 0.3403 0.3202 0.0059  0.0146  -0.0058 2216 HOH A O   
5255 O O   . HOH H .   ? 0.5760 0.5587 0.5291 0.0093  0.0070  0.0038  2217 HOH A O   
5256 O O   . HOH H .   ? 0.3660 0.3393 0.3517 0.0061  0.0219  0.0010  2218 HOH A O   
5257 O O   . HOH H .   ? 0.3234 0.2952 0.2854 0.0154  -0.0115 0.0056  2219 HOH A O   
5258 O O   . HOH H .   ? 0.4946 0.4943 0.4370 0.0093  0.0000  -0.0099 2220 HOH A O   
5259 O O   . HOH H .   ? 0.3729 0.3629 0.3270 0.0060  0.0095  -0.0121 2221 HOH A O   
5260 O O   . HOH H .   ? 0.4403 0.4209 0.3917 0.0129  -0.0011 0.0096  2222 HOH A O   
5261 O O   . HOH H .   ? 0.3132 0.2872 0.2705 0.0185  -0.0157 0.0036  2223 HOH A O   
5262 O O   . HOH H .   ? 0.2947 0.2750 0.2468 0.0215  -0.0182 0.0027  2224 HOH A O   
5263 O O   . HOH H .   ? 0.4524 0.4212 0.4090 0.0198  -0.0169 0.0116  2225 HOH A O   
5264 O O   . HOH H .   ? 0.3889 0.3728 0.3367 0.0234  -0.0189 0.0083  2226 HOH A O   
5265 O O   . HOH H .   ? 0.4333 0.5467 0.4665 0.0041  -0.0117 -0.0658 2227 HOH A O   
5266 O O   . HOH H .   ? 0.6660 0.6743 0.6039 0.0136  -0.0094 -0.0086 2228 HOH A O   
5267 O O   . HOH H .   ? 0.5086 0.4731 0.4666 0.0231  -0.0226 0.0054  2229 HOH A O   
5268 O O   . HOH H .   ? 0.4752 0.4376 0.4380 0.0178  -0.0189 0.0092  2230 HOH A O   
5269 O O   . HOH H .   ? 0.3412 0.3090 0.3002 0.0230  -0.0232 -0.0029 2231 HOH A O   
5270 O O   . HOH H .   ? 0.5329 0.4945 0.4916 0.0247  -0.0249 0.0012  2232 HOH A O   
5271 O O   . HOH H .   ? 0.5026 0.5561 0.5105 0.0486  -0.0112 -0.0328 2233 HOH A O   
5272 O O   . HOH H .   ? 0.6473 0.6389 0.5950 0.0300  -0.0247 0.0070  2234 HOH A O   
5273 O O   . HOH H .   ? 1.0065 0.9862 0.9586 0.0313  -0.0253 0.0080  2235 HOH A O   
5274 O O   . HOH H .   ? 0.4093 0.3882 0.3633 0.0264  -0.0233 -0.0008 2236 HOH A O   
5275 O O   . HOH H .   ? 0.3080 0.3210 0.2583 0.0115  -0.0097 -0.0242 2237 HOH A O   
5276 O O   . HOH H .   ? 0.3434 0.3518 0.2942 0.0078  -0.0029 -0.0255 2238 HOH A O   
5277 O O   . HOH H .   ? 0.3364 0.3377 0.2890 0.0046  0.0056  -0.0246 2239 HOH A O   
5278 O O   . HOH H .   ? 0.2967 0.2969 0.2556 0.0267  -0.0219 -0.0169 2240 HOH A O   
5279 O O   . HOH H .   ? 0.3754 0.3612 0.3340 0.0303  -0.0241 -0.0133 2241 HOH A O   
5280 O O   . HOH H .   ? 0.3999 0.3755 0.3567 0.0252  -0.0229 -0.0048 2242 HOH A O   
5281 O O   . HOH H .   ? 0.4942 0.5263 0.4441 0.0127  -0.0160 -0.0298 2243 HOH A O   
5282 O O   . HOH H .   ? 0.3923 0.4242 0.3452 0.0199  -0.0221 -0.0242 2244 HOH A O   
5283 O O   . HOH H .   ? 0.6091 0.6253 0.5612 0.0270  -0.0251 -0.0133 2245 HOH A O   
5284 O O   . HOH H .   ? 0.6090 0.6298 0.5487 0.0229  -0.0226 -0.0061 2246 HOH A O   
5285 O O   . HOH H .   ? 0.4133 0.4325 0.3564 0.0145  -0.0148 -0.0187 2247 HOH A O   
5286 O O   . HOH H .   ? 0.4229 0.4487 0.3892 0.0279  -0.0231 -0.0256 2248 HOH A O   
5287 O O   . HOH H .   ? 0.5077 0.5459 0.4827 0.0056  -0.0064 -0.0488 2249 HOH A O   
5288 O O   . HOH H .   ? 0.4415 0.4795 0.4223 0.0121  -0.0098 -0.0447 2250 HOH A O   
5289 O O   . HOH H .   ? 0.5193 0.5696 0.4885 0.0141  -0.0185 -0.0407 2251 HOH A O   
5290 O O   . HOH H .   ? 0.5198 0.5469 0.4818 0.0068  -0.0070 -0.0403 2252 HOH A O   
5291 O O   . HOH H .   ? 0.3440 0.3474 0.3147 0.0305  -0.0168 -0.0259 2253 HOH A O   
5292 O O   . HOH H .   ? 0.5609 0.5760 0.5317 0.0342  -0.0217 -0.0253 2254 HOH A O   
5293 O O   . HOH H .   ? 0.4386 0.4432 0.4005 0.0290  -0.0225 -0.0198 2255 HOH A O   
5294 O O   . HOH H .   ? 0.5086 0.4969 0.4701 0.0351  -0.0239 -0.0182 2256 HOH A O   
5295 O O   . HOH H .   ? 0.4737 0.4991 0.4455 0.0299  -0.0215 -0.0280 2257 HOH A O   
5296 O O   . HOH H .   ? 0.3084 0.3520 0.2959 0.0260  -0.0163 -0.0378 2258 HOH A O   
5297 O O   . HOH H .   ? 0.3749 0.4267 0.3668 0.0139  -0.0109 -0.0481 2259 HOH A O   
5298 O O   . HOH H .   ? 0.3055 0.3059 0.2866 0.0246  -0.0053 -0.0207 2260 HOH A O   
5299 O O   . HOH H .   ? 0.2371 0.2600 0.2243 0.0342  -0.0097 -0.0329 2261 HOH A O   
5300 O O   . HOH H .   ? 0.2988 0.3688 0.3094 0.0208  -0.0114 -0.0480 2262 HOH A O   
5301 O O   . HOH H .   ? 0.5427 0.6027 0.5414 0.0309  -0.0176 -0.0383 2263 HOH A O   
5302 O O   . HOH H .   ? 0.3776 0.4337 0.3665 0.0211  -0.0173 -0.0422 2264 HOH A O   
5303 O O   . HOH H .   ? 0.2530 0.2856 0.2528 0.0375  -0.0012 -0.0343 2265 HOH A O   
5304 O O   . HOH H .   ? 0.4680 0.5233 0.5211 0.0156  0.0229  -0.0480 2266 HOH A O   
5305 O O   . HOH H .   ? 0.4448 0.4852 0.4835 0.0308  0.0303  -0.0231 2267 HOH A O   
5306 O O   . HOH H .   ? 0.4863 0.5185 0.5508 0.0212  0.0455  -0.0214 2268 HOH A O   
5307 O O   . HOH H .   ? 0.4204 0.4599 0.4718 0.0292  0.0398  -0.0169 2269 HOH A O   
5308 O O   . HOH H .   ? 0.2946 0.3316 0.2992 0.0405  0.0029  -0.0340 2270 HOH A O   
5309 O O   . HOH H .   ? 0.4837 0.5314 0.5290 0.0360  0.0395  -0.0144 2271 HOH A O   
5310 O O   . HOH H .   ? 0.3590 0.4021 0.4060 0.0341  0.0417  -0.0091 2272 HOH A O   
5311 O O   . HOH H .   ? 0.2819 0.3130 0.2878 0.0345  0.0206  -0.0006 2273 HOH A O   
5312 O O   . HOH H .   ? 0.4229 0.4493 0.4095 0.0526  0.0062  -0.0339 2274 HOH A O   
5313 O O   . HOH H .   ? 0.4846 0.5019 0.4362 0.0501  0.0081  -0.0355 2275 HOH A O   
5314 O O   . HOH H .   ? 0.4979 0.5109 0.4573 0.0446  0.0010  -0.0307 2276 HOH A O   
5315 O O   . HOH H .   ? 0.3943 0.4164 0.3514 0.0407  0.0028  -0.0220 2277 HOH A O   
5316 O O   . HOH H .   ? 0.2834 0.2976 0.2593 0.0416  -0.0016 -0.0292 2278 HOH A O   
5317 O O   . HOH H .   ? 0.2543 0.3005 0.2650 0.0417  0.0002  -0.0361 2279 HOH A O   
5318 O O   . HOH H .   ? 0.3447 0.3569 0.3247 0.0504  -0.0117 -0.0312 2280 HOH A O   
5319 O O   . HOH H .   ? 0.4123 0.4131 0.3816 0.0527  -0.0056 -0.0359 2281 HOH A O   
5320 O O   . HOH H .   ? 0.5094 0.5125 0.4691 0.0426  -0.0055 -0.0320 2282 HOH A O   
5321 O O   . HOH H .   ? 0.3176 0.3322 0.3371 0.0254  0.0218  0.0012  2283 HOH A O   
5322 O O   . HOH H .   ? 0.5505 0.5647 0.5728 0.0250  0.0224  0.0096  2284 HOH A O   
5323 O O   . HOH H .   ? 0.3820 0.3931 0.3955 0.0229  0.0135  0.0141  2285 HOH A O   
5324 O O   . HOH H .   ? 0.2586 0.2843 0.2654 0.0269  0.0112  0.0205  2286 HOH A O   
5325 O O   . HOH H .   ? 0.2973 0.2958 0.2654 0.0241  -0.0127 -0.0096 2287 HOH A O   
5326 O O   . HOH H .   ? 0.3377 0.3373 0.3162 0.0256  -0.0061 -0.0161 2288 HOH A O   
5327 O O   . HOH H .   ? 0.3637 0.3747 0.3755 0.0216  0.0095  0.0190  2289 HOH A O   
5328 O O   . HOH H .   ? 0.4128 0.4064 0.4431 0.0136  0.0315  -0.0094 2290 HOH A O   
5329 O O   . HOH H .   ? 0.5040 0.5166 0.5661 0.0212  0.0492  0.0000  2291 HOH A O   
5330 O O   . HOH H .   ? 0.6615 0.6658 0.6926 0.0201  0.0286  0.0009  2292 HOH A O   
5331 O O   . HOH H .   ? 0.7467 0.7563 0.7916 0.0227  0.0373  0.0091  2293 HOH A O   
5332 O O   . HOH H .   ? 0.4798 0.5002 0.5400 0.0246  0.0482  0.0018  2294 HOH A O   
5333 O O   . HOH H .   ? 0.5585 0.5799 0.6191 0.0274  0.0488  0.0155  2295 HOH A O   
5334 O O   . HOH H .   ? 0.5300 0.5504 0.5957 0.0283  0.0496  0.0310  2296 HOH A O   
5335 O O   . HOH H .   ? 0.4021 0.4410 0.4751 0.0284  0.0552  -0.0055 2297 HOH A O   
5336 O O   . HOH H .   ? 0.3605 0.4047 0.4650 0.0031  0.0589  -0.0475 2298 HOH A O   
5337 O O   . HOH H .   ? 0.2857 0.2943 0.3854 -0.0037 0.0717  -0.0463 2299 HOH A O   
5338 O O   . HOH H .   ? 0.5439 0.5542 0.6713 0.0094  0.0882  -0.0151 2300 HOH A O   
5339 O O   . HOH H .   ? 0.5512 0.5635 0.6660 0.0165  0.0817  -0.0019 2301 HOH A O   
5340 O O   . HOH H .   ? 0.3940 0.3938 0.5322 0.0063  0.0977  -0.0155 2302 HOH A O   
5341 O O   . HOH H .   ? 0.2956 0.3014 0.3822 0.0029  0.0649  -0.0350 2303 HOH A O   
5342 O O   . HOH H .   ? 0.4579 0.4633 0.5351 0.0170  0.0597  -0.0029 2304 HOH A O   
5343 O O   . HOH H .   ? 0.3113 0.3096 0.4444 0.0116  0.0957  -0.0033 2305 HOH A O   
5344 O O   . HOH H .   ? 0.4217 0.4284 0.5531 0.0175  0.0934  0.0076  2306 HOH A O   
5345 O O   . HOH H .   ? 0.2993 0.3011 0.4474 0.0216  0.1048  0.0249  2307 HOH A O   
5346 O O   . HOH H .   ? 0.4080 0.4219 0.5343 0.0245  0.0903  0.0233  2308 HOH A O   
5347 O O   . HOH H .   ? 0.4010 0.4155 0.5190 0.0268  0.0849  0.0307  2309 HOH A O   
5348 O O   . HOH H .   ? 0.3678 0.3789 0.4455 0.0248  0.0582  0.0233  2310 HOH A O   
5349 O O   . HOH H .   ? 0.5277 0.5493 0.6122 0.0297  0.0624  0.0356  2311 HOH A O   
5350 O O   . HOH H .   ? 0.5259 0.5174 0.7127 0.0149  0.1299  0.0166  2312 HOH A O   
5351 O O   . HOH H .   ? 0.3430 0.3761 0.5301 0.0470  0.1076  0.1233  2313 HOH A O   
5352 O O   . HOH H .   ? 0.4245 0.4091 0.6505 0.0407  0.1453  0.1026  2314 HOH A O   
5353 O O   . HOH H .   ? 0.4673 0.4293 0.6113 0.0104  0.1166  0.0081  2315 HOH A O   
5354 O O   . HOH H .   ? 0.3306 0.2868 0.4746 0.0155  0.1193  0.0276  2316 HOH A O   
5355 O O   . HOH H .   ? 0.5292 0.4855 0.7391 0.0272  0.1531  0.0598  2317 HOH A O   
5356 O O   . HOH H .   ? 0.3668 0.3253 0.5710 0.0287  0.1482  0.0663  2318 HOH A O   
5357 O O   . HOH H .   ? 0.4666 0.3920 0.6609 0.0043  0.1698  -0.0025 2319 HOH A O   
5358 O O   . HOH H .   ? 0.5339 0.4546 0.7019 0.0008  0.1667  -0.0125 2320 HOH A O   
5359 O O   . HOH H .   ? 0.4541 0.3823 0.5553 -0.0203 0.1479  -0.0640 2321 HOH A O   
5360 O O   . HOH H .   ? 0.4641 0.4097 0.5850 0.0097  0.1216  0.0159  2322 HOH A O   
5361 O O   . HOH H .   ? 0.4807 0.4102 0.6581 0.0124  0.1614  0.0188  2323 HOH A O   
5362 O O   . HOH H .   ? 0.4299 0.3811 0.6080 0.0227  0.1413  0.0523  2324 HOH A O   
5363 O O   . HOH H .   ? 0.4132 0.4111 0.6635 0.0489  0.1505  0.1315  2325 HOH A O   
5364 O O   . HOH H .   ? 0.3528 0.4103 0.5101 0.0439  0.0754  0.1314  2326 HOH A O   
5365 O O   . HOH H .   ? 0.3649 0.4242 0.4689 0.0391  0.0540  0.1015  2327 HOH A O   
5366 O O   . HOH H .   ? 0.6458 0.7722 0.7871 0.0488  0.0491  0.1699  2328 HOH A O   
5367 O O   . HOH H .   ? 0.5042 0.5689 0.5331 0.0226  0.0013  0.0688  2329 HOH A O   
5368 O O   . HOH H .   ? 0.3492 0.3839 0.4151 0.0240  0.0250  0.0706  2330 HOH A O   
5369 O O   . HOH H .   ? 0.4055 0.4372 0.4727 0.0276  0.0346  0.0641  2331 HOH A O   
5370 O O   . HOH H .   ? 0.4688 0.5077 0.4915 0.0230  0.0066  0.0484  2332 HOH A O   
5371 O O   . HOH H .   ? 0.4114 0.4349 0.4522 0.0189  0.0118  0.0525  2333 HOH A O   
5372 O O   . HOH H .   ? 0.2591 0.2847 0.2713 0.0216  0.0041  0.0337  2334 HOH A O   
5373 O O   . HOH H .   ? 0.3095 0.3307 0.3538 0.0240  0.0246  0.0443  2335 HOH A O   
5374 O O   . HOH H .   ? 0.5097 0.5130 0.5840 0.0170  0.0351  0.0611  2336 HOH A O   
5375 O O   . HOH H .   ? 0.4367 0.4193 0.5591 0.0209  0.0823  0.0665  2337 HOH A O   
5376 O O   . HOH H .   ? 0.3014 0.2775 0.3963 0.0159  0.0720  0.0496  2338 HOH A O   
5377 O O   . HOH H .   ? 0.2643 0.2478 0.3337 0.0142  0.0480  0.0451  2339 HOH A O   
5378 O O   . HOH H .   ? 0.3395 0.3339 0.4778 0.0247  0.0817  0.0839  2340 HOH A O   
5379 O O   . HOH H .   ? 0.3972 0.3881 0.4601 0.0146  0.0368  0.0479  2341 HOH A O   
5380 O O   . HOH H .   ? 0.5195 0.4722 0.6803 0.0204  0.1319  0.0484  2342 HOH A O   
5381 O O   . HOH H .   ? 0.3676 0.4119 0.4234 0.0194  0.0099  0.0737  2343 HOH A O   
5382 O O   . HOH H .   ? 0.4927 0.5143 0.5591 0.0288  0.0478  0.0390  2344 HOH A O   
5383 O O   . HOH H .   ? 0.4100 0.4537 0.5331 0.0412  0.0765  0.0921  2345 HOH A O   
5384 O O   . HOH H .   ? 0.3825 0.3787 0.4524 0.0088  0.0582  -0.0194 2346 HOH A O   
5385 O O   . HOH H .   ? 0.4839 0.4853 0.5474 0.0145  0.0517  -0.0095 2347 HOH A O   
5386 O O   . HOH H .   ? 0.6118 0.6111 0.6636 0.0191  0.0417  0.0125  2348 HOH A O   
5387 O O   . HOH H .   ? 0.4483 0.4493 0.5012 0.0176  0.0441  -0.0002 2349 HOH A O   
5388 O O   . HOH H .   ? 0.5447 0.5558 0.6007 0.0242  0.0399  0.0310  2350 HOH A O   
5389 O O   . HOH H .   ? 0.4410 0.4634 0.5025 0.0265  0.0366  0.0508  2351 HOH A O   
5390 O O   . HOH H .   ? 0.3663 0.3532 0.4210 0.0129  0.0493  0.0007  2352 HOH A O   
5391 O O   . HOH H .   ? 0.2836 0.2618 0.3358 0.0112  0.0508  0.0078  2353 HOH A O   
5392 O O   . HOH H .   ? 0.3363 0.3006 0.4551 0.0149  0.0992  0.0263  2354 HOH A O   
5393 O O   . HOH H .   ? 0.2873 0.2531 0.3120 0.0023  0.0577  -0.0070 2355 HOH A O   
5394 O O   . HOH H .   ? 0.5241 0.4741 0.6609 0.0152  0.1235  0.0338  2356 HOH A O   
5395 O O   . HOH H .   ? 0.3225 0.2722 0.4335 0.0110  0.1137  0.0243  2357 HOH A O   
5396 O O   . HOH H .   ? 0.3764 0.3204 0.4689 0.0038  0.1154  0.0007  2358 HOH A O   
5397 O O   . HOH H .   ? 0.4366 0.3715 0.5472 -0.0009 0.1334  -0.0158 2359 HOH A O   
5398 O O   . HOH H .   ? 0.4718 0.4107 0.5835 0.0045  0.1283  0.0009  2360 HOH A O   
5399 O O   . HOH H .   ? 0.5146 0.4642 0.6504 0.0158  0.1254  0.0394  2361 HOH A O   
5400 O O   . HOH H .   ? 0.5209 0.4678 0.5779 -0.0007 0.1069  -0.0086 2362 HOH A O   
5401 O O   . HOH H .   ? 0.4593 0.4156 0.5009 0.0037  0.0840  0.0126  2363 HOH A O   
5402 O O   . HOH H .   ? 0.4354 0.4114 0.5353 0.0143  0.0747  0.0649  2364 HOH A O   
5403 O O   . HOH H .   ? 0.3989 0.3813 0.4563 0.0109  0.0371  0.0482  2365 HOH A O   
5404 O O   . HOH H .   ? 0.5863 0.5665 0.6927 0.0160  0.0734  0.0677  2366 HOH A O   
5405 O O   . HOH H .   ? 0.3426 0.3192 0.3645 0.0099  0.0268  0.0162  2367 HOH A O   
5406 O O   . HOH H .   ? 0.4154 0.3868 0.4234 0.0076  0.0254  0.0139  2368 HOH A O   
5407 O O   . HOH H .   ? 0.4061 0.3804 0.4181 0.0088  0.0227  0.0142  2369 HOH A O   
5408 O O   . HOH H .   ? 0.3368 0.3209 0.3143 0.0058  0.0145  -0.0178 2370 HOH A O   
5409 O O   . HOH H .   ? 0.2860 0.2684 0.3054 0.0119  0.0200  0.0150  2371 HOH A O   
5410 O O   . HOH H .   ? 0.2934 0.2791 0.3149 0.0118  0.0276  -0.0042 2372 HOH A O   
5411 O O   . HOH H .   ? 0.3822 0.3750 0.4059 0.0147  0.0148  0.0238  2373 HOH A O   
5412 O O   . HOH H .   ? 0.4929 0.4789 0.5383 0.0071  0.0478  -0.0183 2374 HOH A O   
5413 O O   . HOH H .   ? 0.3966 0.3875 0.4269 0.0143  0.0308  -0.0015 2375 HOH A O   
5414 O O   . HOH H .   ? 0.4715 0.4598 0.5273 0.0077  0.0528  -0.0181 2376 HOH A O   
5415 O O   . HOH H .   ? 0.3760 0.3664 0.4347 -0.0087 0.0625  -0.0535 2377 HOH A O   
5416 O O   . HOH H .   ? 0.3253 0.3195 0.4112 0.0048  0.0693  -0.0254 2378 HOH A O   
5417 O O   . HOH H .   ? 0.3727 0.3680 0.4308 0.0045  0.0526  -0.0303 2379 HOH A O   
5418 O O   . HOH H .   ? 0.5616 0.5422 0.6956 -0.0280 0.1106  -0.0789 2380 HOH A O   
5419 O O   . HOH H .   ? 0.4020 0.3583 0.5671 -0.0253 0.1391  -0.0683 2381 HOH A O   
5420 O O   . HOH H .   ? 0.4143 0.4058 0.4934 -0.0370 0.0892  -0.1010 2382 HOH A O   
5421 O O   . HOH H .   ? 0.4549 0.4007 0.6801 -0.0065 0.1695  -0.0209 2383 HOH A O   
5422 O O   . HOH H .   ? 0.5576 0.5345 0.7295 -0.0292 0.1293  -0.0749 2384 HOH A O   
5423 O O   . HOH H .   ? 0.3956 0.3879 0.5494 0.0136  0.1100  0.0076  2385 HOH A O   
5424 O O   . HOH H .   ? 0.3333 0.3220 0.5045 0.0088  0.1209  -0.0002 2386 HOH A O   
5425 O O   . HOH H .   ? 0.4338 0.4283 0.5901 -0.0013 0.1095  -0.0270 2387 HOH A O   
5426 O O   . HOH H .   ? 0.3925 0.3939 0.5568 -0.0125 0.1103  -0.0486 2388 HOH A O   
5427 O O   . HOH H .   ? 0.4323 0.4490 0.5736 -0.0189 0.0911  -0.0671 2389 HOH A O   
5428 O O   . HOH H .   ? 0.7024 0.7149 0.8192 -0.0443 0.0911  -0.1104 2390 HOH A O   
5429 O O   . HOH H .   ? 0.4380 0.4388 0.5208 -0.0160 0.0710  -0.0674 2391 HOH A O   
5430 O O   . HOH H .   ? 0.5041 0.5324 0.6630 -0.0345 0.0958  -0.0903 2392 HOH A O   
5431 O O   . HOH H .   ? 0.5298 0.5774 0.6483 -0.0285 0.0662  -0.0903 2393 HOH A O   
5432 O O   . HOH H .   ? 0.4858 0.5323 0.5566 -0.0246 0.0450  -0.0900 2394 HOH A O   
5433 O O   . HOH H .   ? 0.5501 0.5987 0.6240 -0.0348 0.0504  -0.1035 2395 HOH A O   
5434 O O   . HOH H .   ? 0.5172 0.5649 0.6365 -0.0060 0.0645  -0.0589 2396 HOH A O   
5435 O O   . HOH H .   ? 0.4695 0.4802 0.5380 -0.0131 0.0574  -0.0666 2397 HOH A O   
5436 O O   . HOH H .   ? 0.5271 0.5243 0.5934 -0.0073 0.0612  -0.0530 2398 HOH A O   
5437 O O   . HOH H .   ? 0.4638 0.4662 0.5112 0.0134  0.0412  -0.0171 2399 HOH A O   
5438 O O   . HOH H .   ? 0.2684 0.2426 0.2451 0.0137  -0.0126 0.0034  2400 HOH A O   
5439 O O   . HOH H .   ? 0.2757 0.2383 0.2351 0.0223  -0.0257 -0.0078 2401 HOH A O   
5440 O O   . HOH H .   ? 0.3170 0.2847 0.2760 0.0242  -0.0242 -0.0070 2402 HOH A O   
5441 O O   . HOH H .   ? 0.6039 0.5738 0.5617 0.0297  -0.0253 -0.0122 2403 HOH A O   
5442 O O   . HOH H .   ? 0.2686 0.2554 0.2156 0.0136  -0.0300 -0.0162 2404 HOH A O   
5443 O O   . HOH H .   ? 0.6080 0.5535 0.5669 0.0079  -0.0341 -0.0152 2405 HOH A O   
5444 O O   . HOH H .   ? 0.3942 0.3519 0.3490 0.0232  -0.0277 -0.0162 2406 HOH A O   
5445 O O   . HOH H .   ? 0.6011 0.5376 0.5734 0.0110  -0.0293 0.0049  2407 HOH A O   
5446 O O   . HOH H .   ? 0.3686 0.3249 0.3289 0.0216  -0.0266 -0.0040 2408 HOH A O   
5447 O O   . HOH H .   ? 0.6091 0.5323 0.5701 0.0126  -0.0303 -0.0217 2409 HOH A O   
5448 O O   . HOH H .   ? 0.4031 0.3525 0.3613 0.0251  -0.0279 -0.0100 2410 HOH A O   
5449 O O   . HOH H .   ? 0.4312 0.3680 0.3974 0.0203  -0.0278 0.0022  2411 HOH A O   
5450 O O   . HOH H .   ? 0.4848 0.4357 0.4459 0.0241  -0.0266 0.0016  2412 HOH A O   
5451 O O   . HOH H .   ? 0.4853 0.4148 0.4370 0.0181  -0.0283 -0.0309 2413 HOH A O   
5452 O O   . HOH H .   ? 0.5599 0.4899 0.5055 -0.0014 -0.0342 -0.0452 2414 HOH A O   
5453 O O   . HOH H .   ? 0.5678 0.5029 0.5230 -0.0023 -0.0369 -0.0309 2415 HOH A O   
5454 O O   . HOH H .   ? 0.4635 0.4101 0.3981 0.0184  -0.0262 -0.0452 2416 HOH A O   
5455 O O   . HOH H .   ? 0.6666 0.6134 0.6131 0.0237  -0.0270 -0.0311 2417 HOH A O   
5456 O O   . HOH H .   ? 0.2982 0.2576 0.2506 0.0259  -0.0267 -0.0209 2418 HOH A O   
5457 O O   . HOH H .   ? 0.2781 0.2650 0.2307 0.0310  -0.0176 -0.0254 2419 HOH A O   
5458 O O   . HOH H .   ? 0.3354 0.3088 0.2804 0.0323  -0.0201 -0.0324 2420 HOH A O   
5459 O O   . HOH H .   ? 0.5026 0.4719 0.4567 0.0369  -0.0215 -0.0274 2421 HOH A O   
5460 O O   . HOH H .   ? 0.4364 0.3986 0.3836 0.0375  -0.0190 -0.0357 2422 HOH A O   
5461 O O   . HOH H .   ? 0.3734 0.3578 0.3350 0.0418  -0.0187 -0.0277 2423 HOH A O   
5462 O O   . HOH H .   ? 0.3305 0.3018 0.2808 0.0362  -0.0198 -0.0311 2424 HOH A O   
5463 O O   . HOH H .   ? 0.4449 0.4387 0.4106 0.0388  -0.0207 -0.0242 2425 HOH A O   
5464 O O   . HOH H .   ? 0.3021 0.2919 0.2517 0.0428  -0.0092 -0.0369 2426 HOH A O   
5465 O O   . HOH H .   ? 0.3217 0.3291 0.2721 0.0372  -0.0062 -0.0269 2427 HOH A O   
5466 O O   . HOH H .   ? 0.4884 0.5034 0.4361 0.0388  -0.0024 -0.0260 2428 HOH A O   
5467 O O   . HOH H .   ? 0.4511 0.4624 0.3664 0.0306  -0.0104 -0.0387 2429 HOH A O   
5468 O O   . HOH H .   ? 0.4242 0.4462 0.3333 0.0128  -0.0271 -0.0320 2430 HOH A O   
5469 O O   . HOH H .   ? 0.3508 0.3519 0.2583 0.0125  -0.0268 -0.0444 2431 HOH A O   
5470 O O   . HOH H .   ? 0.3809 0.3420 0.2980 0.0128  -0.0258 -0.0567 2432 HOH A O   
5471 O O   . HOH H .   ? 0.2876 0.2920 0.2519 0.0186  -0.0192 -0.0012 2433 HOH A O   
5472 O O   . HOH H .   ? 0.2956 0.3130 0.2944 0.0203  -0.0018 0.0219  2434 HOH A O   
5473 O O   . HOH H .   ? 0.4434 0.4503 0.4581 0.0094  -0.0090 0.0373  2435 HOH A O   
5474 O O   . HOH H .   ? 0.5319 0.5594 0.5460 0.0061  -0.0190 0.0455  2436 HOH A O   
5475 O O   . HOH H .   ? 0.3386 0.3279 0.3416 0.0099  -0.0076 0.0241  2437 HOH A O   
5476 O O   . HOH H .   ? 0.3872 0.3950 0.3989 0.0052  -0.0168 0.0380  2438 HOH A O   
5477 O O   . HOH H .   ? 0.5077 0.5035 0.5339 0.0126  0.0085  0.0346  2439 HOH A O   
5478 O O   . HOH H .   ? 0.3449 0.3242 0.3448 0.0106  0.0004  0.0170  2440 HOH A O   
5479 O O   . HOH H .   ? 0.5372 0.5176 0.5494 0.0102  0.0094  0.0227  2441 HOH A O   
5480 O O   . HOH H .   ? 0.5306 0.5198 0.5485 0.0109  0.0049  0.0298  2442 HOH A O   
5481 O O   . HOH H .   ? 0.2889 0.2958 0.2735 -0.0015 0.0167  -0.0472 2443 HOH A O   
5482 O O   . HOH H .   ? 0.4504 0.4565 0.4402 -0.0183 0.0409  -0.0712 2444 HOH A O   
5483 O O   . HOH H .   ? 0.5472 0.5575 0.5247 -0.0139 0.0306  -0.0636 2445 HOH A O   
5484 O O   . HOH H .   ? 0.3825 0.3988 0.3397 -0.0099 0.0204  -0.0542 2446 HOH A O   
5485 O O   . HOH H .   ? 0.6574 0.7040 0.6273 -0.0326 0.0292  -0.0970 2447 HOH A O   
5486 O O   . HOH H .   ? 0.5383 0.5436 0.5284 -0.0308 0.0584  -0.0912 2448 HOH A O   
5487 O O   . HOH H .   ? 0.4981 0.4643 0.5427 -0.0497 0.1207  -0.1243 2449 HOH A O   
5488 O O   . HOH H .   ? 0.8092 0.8046 0.8064 -0.0345 0.0726  -0.0967 2450 HOH A O   
5489 O O   . HOH H .   ? 0.3953 0.4364 0.4115 -0.0328 0.0372  -0.1010 2451 HOH A O   
5490 O O   . HOH H .   ? 0.4881 0.5230 0.5542 -0.0451 0.0623  -0.1175 2452 HOH A O   
5491 O O   . HOH H .   ? 0.5103 0.5033 0.6163 -0.0402 0.0982  -0.1040 2453 HOH A O   
5492 O O   . HOH H .   ? 0.4379 0.4654 0.4712 -0.0300 0.0467  -0.0958 2454 HOH A O   
5493 O O   . HOH H .   ? 0.3339 0.3572 0.3663 -0.0207 0.0412  -0.0821 2455 HOH A O   
5494 O O   . HOH H .   ? 0.4580 0.4140 0.5017 -0.0328 0.1162  -0.0916 2456 HOH A O   
5495 O O   . HOH H .   ? 0.4556 0.4105 0.4813 -0.0102 0.0962  -0.0372 2457 HOH A O   
5496 O O   . HOH H .   ? 0.2686 0.2356 0.2760 0.0013  0.0526  -0.0064 2458 HOH A O   
5497 O O   . HOH H .   ? 0.4163 0.3927 0.3959 -0.0118 0.0666  -0.0419 2459 HOH A O   
5498 O O   . HOH H .   ? 0.5821 0.5671 0.5449 -0.0112 0.0573  -0.0399 2460 HOH A O   
5499 O O   . HOH H .   ? 0.4667 0.4894 0.4074 -0.0131 0.0236  -0.0553 2461 HOH A O   
5500 O O   . HOH H .   ? 0.3911 0.3902 0.3414 0.0026  0.0115  -0.0231 2462 HOH A O   
5501 O O   . HOH H .   ? 0.4967 0.5131 0.4704 -0.0089 0.0192  -0.0580 2463 HOH A O   
5502 O O   . HOH H .   ? 0.6862 0.7215 0.6353 -0.0022 -0.0004 -0.0475 2464 HOH A O   
5503 O O   . HOH H .   ? 0.3876 0.4134 0.3442 0.0038  -0.0039 -0.0406 2465 HOH A O   
5504 O O   . HOH H .   ? 0.3672 0.4141 0.3437 -0.0120 0.0071  -0.0702 2466 HOH A O   
5505 O O   . HOH H .   ? 0.3628 0.4052 0.3567 -0.0020 0.0040  -0.0612 2467 HOH A O   
5506 O O   . HOH H .   ? 0.3742 0.4215 0.3828 -0.0251 0.0252  -0.0908 2468 HOH A O   
5507 O O   . HOH H .   ? 0.5546 0.6387 0.5619 -0.0234 0.0061  -0.0917 2469 HOH A O   
5508 O O   . HOH H .   ? 0.4031 0.4678 0.4450 -0.0195 0.0225  -0.0871 2470 HOH A O   
5509 O O   . HOH H .   ? 0.4906 0.5833 0.4984 -0.0005 -0.0113 -0.0670 2471 HOH A O   
5510 O O   . HOH H .   ? 0.5542 0.6295 0.5425 0.0121  -0.0188 -0.0502 2472 HOH A O   
5511 O O   . HOH H .   ? 0.3077 0.4008 0.3286 -0.0028 -0.0058 -0.0709 2473 HOH A O   
5512 O O   . HOH H .   ? 0.4213 0.4987 0.4715 -0.0017 0.0127  -0.0698 2474 HOH A O   
5513 O O   . HOH H .   ? 0.4700 0.5655 0.4793 0.0109  -0.0173 -0.0562 2475 HOH A O   
5514 O O   . HOH H .   ? 0.4057 0.5057 0.4272 0.0047  -0.0115 -0.0639 2476 HOH A O   
5515 O O   . HOH H .   ? 0.3220 0.4282 0.3661 0.0064  -0.0048 -0.0646 2477 HOH A O   
5516 O O   . HOH H .   ? 0.4262 0.4924 0.4406 0.0315  -0.0101 -0.0417 2478 HOH A O   
5517 O O   . HOH H .   ? 0.3519 0.4076 0.3751 0.0378  0.0046  -0.0383 2479 HOH A O   
5518 O O   . HOH H .   ? 0.5728 0.5966 0.5581 0.0484  -0.0165 -0.0285 2480 HOH A O   
5519 O O   . HOH H .   ? 0.4119 0.4621 0.4129 0.0425  -0.0146 -0.0335 2481 HOH A O   
5520 O O   . HOH H .   ? 0.4670 0.4742 0.4407 0.0431  -0.0184 -0.0271 2482 HOH A O   
5521 O O   . HOH H .   ? 0.5837 0.5942 0.5628 0.0508  -0.0156 -0.0284 2483 HOH A O   
5522 O O   . HOH H .   ? 0.3846 0.3725 0.3420 0.0476  -0.0094 -0.0368 2484 HOH A O   
5523 O O   . HOH H .   ? 0.4569 0.4388 0.4236 0.0536  -0.0134 -0.0317 2485 HOH A O   
5524 O O   . HOH H .   ? 0.5985 0.5583 0.5448 0.0413  -0.0154 -0.0405 2486 HOH A O   
5525 O O   . HOH H .   ? 0.4136 0.3829 0.3537 0.0349  -0.0175 -0.0394 2487 HOH A O   
5526 O O   . HOH H .   ? 0.2574 0.2405 0.2029 0.0321  -0.0179 -0.0306 2488 HOH A O   
5527 O O   . HOH H .   ? 0.3105 0.2887 0.2358 0.0375  -0.0089 -0.0511 2489 HOH A O   
5528 O O   . HOH H .   ? 0.4679 0.4578 0.3930 0.0395  -0.0056 -0.0482 2490 HOH A O   
5529 O O   . HOH H .   ? 0.6494 0.6568 0.5951 0.0426  -0.0020 -0.0339 2491 HOH A O   
5530 O O   . HOH H .   ? 0.6304 0.5904 0.5667 0.0358  -0.0156 -0.0462 2492 HOH A O   
5531 O O   . HOH H .   ? 0.5430 0.4911 0.4739 0.0323  -0.0149 -0.0546 2493 HOH A O   
5534 O O   . HOH H .   ? 0.4810 0.5196 0.5501 0.0250  0.0491  -0.0169 2496 HOH A O   
5536 O O   . HOH H .   ? 0.4925 0.4238 0.5860 -0.0140 0.1400  -0.0494 2498 HOH A O   
5537 O O   . HOH H .   ? 0.4311 0.4128 0.4541 0.0113  0.0201  0.0217  2499 HOH A O   
5538 O O   . HOH I .   ? 0.3603 0.3641 0.3894 0.0204  0.0233  0.0162  2001 HOH P O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   17  17  ALA ALA A . n 
A 1 2   LEU 2   18  18  LEU LEU A . n 
A 1 3   VAL 3   19  19  VAL VAL A . n 
A 1 4   LYS 4   20  20  LYS LYS A . n 
A 1 5   GLU 5   21  21  GLU GLU A . n 
A 1 6   GLU 6   22  22  GLU GLU A . n 
A 1 7   ILE 7   23  23  ILE ILE A . n 
A 1 8   GLN 8   24  24  GLN GLN A . n 
A 1 9   ALA 9   25  25  ALA ALA A . n 
A 1 10  LYS 10  26  26  LYS LYS A . n 
A 1 11  GLU 11  27  27  GLU GLU A . n 
A 1 12  TYR 12  28  28  TYR TYR A . n 
A 1 13  LEU 13  29  29  LEU LEU A . n 
A 1 14  GLU 14  30  30  GLU GLU A . n 
A 1 15  ASN 15  31  31  ASN ASN A . n 
A 1 16  LEU 16  32  32  LEU LEU A . n 
A 1 17  ASN 17  33  33  ASN ASN A . n 
A 1 18  LYS 18  34  34  LYS LYS A . n 
A 1 19  GLU 19  35  35  GLU GLU A . n 
A 1 20  LEU 20  36  36  LEU LEU A . n 
A 1 21  ALA 21  37  37  ALA ALA A . n 
A 1 22  LYS 22  38  38  LYS LYS A . n 
A 1 23  ARG 23  39  39  ARG ARG A . n 
A 1 24  THR 24  40  40  THR THR A . n 
A 1 25  ASN 25  41  41  ASN ASN A . n 
A 1 26  VAL 26  42  42  VAL VAL A . n 
A 1 27  GLU 27  43  43  GLU GLU A . n 
A 1 28  THR 28  44  44  THR THR A . n 
A 1 29  GLU 29  45  45  GLU GLU A . n 
A 1 30  ALA 30  46  46  ALA ALA A . n 
A 1 31  ALA 31  47  47  ALA ALA A . n 
A 1 32  TRP 32  48  48  TRP TRP A . n 
A 1 33  ALA 33  49  49  ALA ALA A . n 
A 1 34  TYR 34  50  50  TYR TYR A . n 
A 1 35  GLY 35  51  51  GLY GLY A . n 
A 1 36  SER 36  52  52  SER SER A . n 
A 1 37  ASN 37  53  53  ASN ASN A . n 
A 1 38  ILE 38  54  54  ILE ILE A . n 
A 1 39  THR 39  55  55  THR THR A . n 
A 1 40  ASP 40  56  56  ASP ASP A . n 
A 1 41  GLU 41  57  57  GLU GLU A . n 
A 1 42  ASN 42  58  58  ASN ASN A . n 
A 1 43  GLU 43  59  59  GLU GLU A . n 
A 1 44  LYS 44  60  60  LYS LYS A . n 
A 1 45  LYS 45  61  61  LYS LYS A . n 
A 1 46  LYS 46  62  62  LYS LYS A . n 
A 1 47  ASN 47  63  63  ASN ASN A . n 
A 1 48  GLU 48  64  64  GLU GLU A . n 
A 1 49  ILE 49  65  65  ILE ILE A . n 
A 1 50  SER 50  66  66  SER SER A . n 
A 1 51  ALA 51  67  67  ALA ALA A . n 
A 1 52  GLU 52  68  68  GLU GLU A . n 
A 1 53  LEU 53  69  69  LEU LEU A . n 
A 1 54  ALA 54  70  70  ALA ALA A . n 
A 1 55  LYS 55  71  71  LYS LYS A . n 
A 1 56  PHE 56  72  72  PHE PHE A . n 
A 1 57  MET 57  73  73  MET MET A . n 
A 1 58  LYS 58  74  74  LYS LYS A . n 
A 1 59  GLU 59  75  75  GLU GLU A . n 
A 1 60  VAL 60  76  76  VAL VAL A . n 
A 1 61  ALA 61  77  77  ALA ALA A . n 
A 1 62  SER 62  78  78  SER SER A . n 
A 1 63  ASP 63  79  79  ASP ASP A . n 
A 1 64  THR 64  80  80  THR THR A . n 
A 1 65  THR 65  81  81  THR THR A . n 
A 1 66  LYS 66  82  82  LYS LYS A . n 
A 1 67  PHE 67  83  83  PHE PHE A . n 
A 1 68  GLN 68  84  84  GLN GLN A . n 
A 1 69  TRP 69  85  85  TRP TRP A . n 
A 1 70  ARG 70  86  86  ARG ARG A . n 
A 1 71  SER 71  87  87  SER SER A . n 
A 1 72  TYR 72  88  88  TYR TYR A . n 
A 1 73  GLN 73  89  89  GLN GLN A . n 
A 1 74  SER 74  90  90  SER SER A . n 
A 1 75  GLU 75  91  91  GLU GLU A . n 
A 1 76  ASP 76  92  92  ASP ASP A . n 
A 1 77  LEU 77  93  93  LEU LEU A . n 
A 1 78  LYS 78  94  94  LYS LYS A . n 
A 1 79  ARG 79  95  95  ARG ARG A . n 
A 1 80  GLN 80  96  96  GLN GLN A . n 
A 1 81  PHE 81  97  97  PHE PHE A . n 
A 1 82  LYS 82  98  98  LYS LYS A . n 
A 1 83  ALA 83  99  99  ALA ALA A . n 
A 1 84  LEU 84  100 100 LEU LEU A . n 
A 1 85  THR 85  101 101 THR THR A . n 
A 1 86  LYS 86  102 102 LYS LYS A . n 
A 1 87  LEU 87  103 103 LEU LEU A . n 
A 1 88  GLY 88  104 104 GLY GLY A . n 
A 1 89  TYR 89  105 105 TYR TYR A . n 
A 1 90  ALA 90  106 106 ALA ALA A . n 
A 1 91  ALA 91  107 107 ALA ALA A . n 
A 1 92  LEU 92  108 108 LEU LEU A . n 
A 1 93  PRO 93  109 109 PRO PRO A . n 
A 1 94  GLU 94  110 110 GLU GLU A . n 
A 1 95  ASP 95  111 111 ASP ASP A . n 
A 1 96  ASP 96  112 112 ASP ASP A . n 
A 1 97  TYR 97  113 113 TYR TYR A . n 
A 1 98  ALA 98  114 114 ALA ALA A . n 
A 1 99  GLU 99  115 115 GLU GLU A . n 
A 1 100 LEU 100 116 116 LEU LEU A . n 
A 1 101 LEU 101 117 117 LEU LEU A . n 
A 1 102 ASP 102 118 118 ASP ASP A . n 
A 1 103 THR 103 119 119 THR THR A . n 
A 1 104 LEU 104 120 120 LEU LEU A . n 
A 1 105 SER 105 121 121 SER SER A . n 
A 1 106 ALA 106 122 122 ALA ALA A . n 
A 1 107 MET 107 123 123 MET MET A . n 
A 1 108 GLU 108 124 124 GLU GLU A . n 
A 1 109 SER 109 125 125 SER SER A . n 
A 1 110 ASN 110 126 126 ASN ASN A . n 
A 1 111 PHE 111 127 127 PHE PHE A . n 
A 1 112 ALA 112 128 128 ALA ALA A . n 
A 1 113 LYS 113 129 129 LYS LYS A . n 
A 1 114 VAL 114 130 130 VAL VAL A . n 
A 1 115 LYS 115 131 131 LYS LYS A . n 
A 1 116 VAL 116 132 132 VAL VAL A . n 
A 1 117 CYS 117 133 133 CYS CYS A . n 
A 1 118 ASP 118 134 134 ASP ASP A . n 
A 1 119 TYR 119 135 135 TYR TYR A . n 
A 1 120 LYS 120 136 136 LYS LYS A . n 
A 1 121 ASP 121 137 137 ASP ASP A . n 
A 1 122 SER 122 138 138 SER SER A . n 
A 1 123 THR 123 139 139 THR THR A . n 
A 1 124 LYS 124 140 140 LYS LYS A . n 
A 1 125 CYS 125 141 141 CYS CYS A . n 
A 1 126 ASP 126 142 142 ASP ASP A . n 
A 1 127 LEU 127 143 143 LEU LEU A . n 
A 1 128 ALA 128 144 144 ALA ALA A . n 
A 1 129 LEU 129 145 145 LEU LEU A . n 
A 1 130 ASP 130 146 146 ASP ASP A . n 
A 1 131 PRO 131 147 147 PRO PRO A . n 
A 1 132 GLU 132 148 148 GLU GLU A . n 
A 1 133 ILE 133 149 149 ILE ILE A . n 
A 1 134 GLU 134 150 150 GLU GLU A . n 
A 1 135 GLU 135 151 151 GLU GLU A . n 
A 1 136 VAL 136 152 152 VAL VAL A . n 
A 1 137 ILE 137 153 153 ILE ILE A . n 
A 1 138 SER 138 154 154 SER SER A . n 
A 1 139 LYS 139 155 155 LYS LYS A . n 
A 1 140 SER 140 156 156 SER SER A . n 
A 1 141 ARG 141 157 157 ARG ARG A . n 
A 1 142 ASP 142 158 158 ASP ASP A . n 
A 1 143 HIS 143 159 159 HIS HIS A . n 
A 1 144 GLU 144 160 160 GLU GLU A . n 
A 1 145 GLU 145 161 161 GLU GLU A . n 
A 1 146 LEU 146 162 162 LEU LEU A . n 
A 1 147 ALA 147 163 163 ALA ALA A . n 
A 1 148 TYR 148 164 164 TYR TYR A . n 
A 1 149 TYR 149 165 165 TYR TYR A . n 
A 1 150 TRP 150 166 166 TRP TRP A . n 
A 1 151 ARG 151 167 167 ARG ARG A . n 
A 1 152 GLU 152 168 168 GLU GLU A . n 
A 1 153 PHE 153 169 169 PHE PHE A . n 
A 1 154 TYR 154 170 170 TYR TYR A . n 
A 1 155 ASP 155 171 171 ASP ASP A . n 
A 1 156 LYS 156 172 172 LYS LYS A . n 
A 1 157 ALA 157 173 173 ALA ALA A . n 
A 1 158 GLY 158 174 174 GLY GLY A . n 
A 1 159 THR 159 175 175 THR THR A . n 
A 1 160 ALA 160 176 176 ALA ALA A . n 
A 1 161 VAL 161 177 177 VAL VAL A . n 
A 1 162 ARG 162 178 178 ARG ARG A . n 
A 1 163 SER 163 179 179 SER SER A . n 
A 1 164 GLN 164 180 180 GLN GLN A . n 
A 1 165 PHE 165 181 181 PHE PHE A . n 
A 1 166 GLU 166 182 182 GLU GLU A . n 
A 1 167 ARG 167 183 183 ARG ARG A . n 
A 1 168 TYR 168 184 184 TYR TYR A . n 
A 1 169 VAL 169 185 185 VAL VAL A . n 
A 1 170 GLU 170 186 186 GLU GLU A . n 
A 1 171 LEU 171 187 187 LEU LEU A . n 
A 1 172 ASN 172 188 188 ASN ASN A . n 
A 1 173 THR 173 189 189 THR THR A . n 
A 1 174 LYS 174 190 190 LYS LYS A . n 
A 1 175 ALA 175 191 191 ALA ALA A . n 
A 1 176 ALA 176 192 192 ALA ALA A . n 
A 1 177 LYS 177 193 193 LYS LYS A . n 
A 1 178 LEU 178 194 194 LEU LEU A . n 
A 1 179 ASN 179 195 195 ASN ASN A . n 
A 1 180 ASN 180 196 196 ASN ASN A . n 
A 1 181 PHE 181 197 197 PHE PHE A . n 
A 1 182 THR 182 198 198 THR THR A . n 
A 1 183 SER 183 199 199 SER SER A . n 
A 1 184 GLY 184 200 200 GLY GLY A . n 
A 1 185 ALA 185 201 201 ALA ALA A . n 
A 1 186 GLU 186 202 202 GLU GLU A . n 
A 1 187 ALA 187 203 203 ALA ALA A . n 
A 1 188 TRP 188 204 204 TRP TRP A . n 
A 1 189 LEU 189 205 205 LEU LEU A . n 
A 1 190 ASP 190 206 206 ASP ASP A . n 
A 1 191 GLU 191 207 207 GLU GLU A . n 
A 1 192 TYR 192 208 208 TYR TYR A . n 
A 1 193 GLU 193 209 209 GLU GLU A . n 
A 1 194 ASP 194 210 210 ASP ASP A . n 
A 1 195 ASP 195 211 211 ASP ASP A . n 
A 1 196 THR 196 212 212 THR THR A . n 
A 1 197 PHE 197 213 213 PHE PHE A . n 
A 1 198 GLU 198 214 214 GLU GLU A . n 
A 1 199 GLN 199 215 215 GLN GLN A . n 
A 1 200 GLN 200 216 216 GLN GLN A . n 
A 1 201 LEU 201 217 217 LEU LEU A . n 
A 1 202 GLU 202 218 218 GLU GLU A . n 
A 1 203 ASP 203 219 219 ASP ASP A . n 
A 1 204 ILE 204 220 220 ILE ILE A . n 
A 1 205 PHE 205 221 221 PHE PHE A . n 
A 1 206 ALA 206 222 222 ALA ALA A . n 
A 1 207 ASP 207 223 223 ASP ASP A . n 
A 1 208 ILE 208 224 224 ILE ILE A . n 
A 1 209 ARG 209 225 225 ARG ARG A . n 
A 1 210 PRO 210 226 226 PRO PRO A . n 
A 1 211 LEU 211 227 227 LEU LEU A . n 
A 1 212 TYR 212 228 228 TYR TYR A . n 
A 1 213 GLN 213 229 229 GLN GLN A . n 
A 1 214 GLN 214 230 230 GLN GLN A . n 
A 1 215 ILE 215 231 231 ILE ILE A . n 
A 1 216 HIS 216 232 232 HIS HIS A . n 
A 1 217 GLY 217 233 233 GLY GLY A . n 
A 1 218 TYR 218 234 234 TYR TYR A . n 
A 1 219 VAL 219 235 235 VAL VAL A . n 
A 1 220 ARG 220 236 236 ARG ARG A . n 
A 1 221 PHE 221 237 237 PHE PHE A . n 
A 1 222 ARG 222 238 238 ARG ARG A . n 
A 1 223 LEU 223 239 239 LEU LEU A . n 
A 1 224 ARG 224 240 240 ARG ARG A . n 
A 1 225 LYS 225 241 241 LYS LYS A . n 
A 1 226 HIS 226 242 242 HIS HIS A . n 
A 1 227 TYR 227 243 243 TYR TYR A . n 
A 1 228 GLY 228 244 244 GLY GLY A . n 
A 1 229 ASP 229 245 245 ASP ASP A . n 
A 1 230 ALA 230 246 246 ALA ALA A . n 
A 1 231 VAL 231 247 247 VAL VAL A . n 
A 1 232 VAL 232 248 248 VAL VAL A . n 
A 1 233 SER 233 249 249 SER SER A . n 
A 1 234 GLU 234 250 250 GLU GLU A . n 
A 1 235 THR 235 251 251 THR THR A . n 
A 1 236 GLY 236 252 252 GLY GLY A . n 
A 1 237 PRO 237 253 253 PRO PRO A . n 
A 1 238 ILE 238 254 254 ILE ILE A . n 
A 1 239 PRO 239 255 255 PRO PRO A . n 
A 1 240 MET 240 256 256 MET MET A . n 
A 1 241 HIS 241 257 257 HIS HIS A . n 
A 1 242 LEU 242 258 258 LEU LEU A . n 
A 1 243 LEU 243 259 259 LEU LEU A . n 
A 1 244 GLY 244 260 260 GLY GLY A . n 
A 1 245 ASN 245 261 261 ASN ASN A . n 
A 1 246 MET 246 262 262 MET MET A . n 
A 1 247 TRP 247 263 263 TRP TRP A . n 
A 1 248 ALA 248 264 264 ALA ALA A . n 
A 1 249 GLN 249 265 265 GLN GLN A . n 
A 1 250 GLN 250 266 266 GLN GLN A . n 
A 1 251 TRP 251 267 267 TRP TRP A . n 
A 1 252 SER 252 268 268 SER SER A . n 
A 1 253 GLU 253 269 269 GLU GLU A . n 
A 1 254 ILE 254 270 270 ILE ILE A . n 
A 1 255 ALA 255 271 271 ALA ALA A . n 
A 1 256 ASP 256 272 272 ASP ASP A . n 
A 1 257 ILE 257 273 273 ILE ILE A . n 
A 1 258 VAL 258 274 274 VAL VAL A . n 
A 1 259 SER 259 275 275 SER SER A . n 
A 1 260 PRO 260 276 276 PRO PRO A . n 
A 1 261 PHE 261 277 277 PHE PHE A . n 
A 1 262 PRO 262 278 278 PRO PRO A . n 
A 1 263 GLU 263 279 279 GLU GLU A . n 
A 1 264 LYS 264 280 280 LYS LYS A . n 
A 1 265 PRO 265 281 281 PRO PRO A . n 
A 1 266 LEU 266 282 282 LEU LEU A . n 
A 1 267 VAL 267 283 283 VAL VAL A . n 
A 1 268 ASP 268 284 284 ASP ASP A . n 
A 1 269 VAL 269 285 285 VAL VAL A . n 
A 1 270 SER 270 286 286 SER SER A . n 
A 1 271 ALA 271 287 287 ALA ALA A . n 
A 1 272 GLU 272 288 288 GLU GLU A . n 
A 1 273 MET 273 289 289 MET MET A . n 
A 1 274 GLU 274 290 290 GLU GLU A . n 
A 1 275 LYS 275 291 291 LYS LYS A . n 
A 1 276 GLN 276 292 292 GLN GLN A . n 
A 1 277 GLY 277 293 293 GLY GLY A . n 
A 1 278 TYR 278 294 294 TYR TYR A . n 
A 1 279 THR 279 295 295 THR THR A . n 
A 1 280 PRO 280 296 296 PRO PRO A . n 
A 1 281 LEU 281 297 297 LEU LEU A . n 
A 1 282 LYS 282 298 298 LYS LYS A . n 
A 1 283 MET 283 299 299 MET MET A . n 
A 1 284 PHE 284 300 300 PHE PHE A . n 
A 1 285 GLN 285 301 301 GLN GLN A . n 
A 1 286 MET 286 302 302 MET MET A . n 
A 1 287 GLY 287 303 303 GLY GLY A . n 
A 1 288 ASP 288 304 304 ASP ASP A . n 
A 1 289 ASP 289 305 305 ASP ASP A . n 
A 1 290 PHE 290 306 306 PHE PHE A . n 
A 1 291 PHE 291 307 307 PHE PHE A . n 
A 1 292 THR 292 308 308 THR THR A . n 
A 1 293 SER 293 309 309 SER SER A . n 
A 1 294 MET 294 310 310 MET MET A . n 
A 1 295 ASN 295 311 311 ASN ASN A . n 
A 1 296 LEU 296 312 312 LEU LEU A . n 
A 1 297 THR 297 313 313 THR THR A . n 
A 1 298 LYS 298 314 314 LYS LYS A . n 
A 1 299 LEU 299 315 315 LEU LEU A . n 
A 1 300 PRO 300 316 316 PRO PRO A . n 
A 1 301 GLN 301 317 317 GLN GLN A . n 
A 1 302 ASP 302 318 318 ASP ASP A . n 
A 1 303 PHE 303 319 319 PHE PHE A . n 
A 1 304 TRP 304 320 320 TRP TRP A . n 
A 1 305 ASP 305 321 321 ASP ASP A . n 
A 1 306 LYS 306 322 322 LYS LYS A . n 
A 1 307 SER 307 323 323 SER SER A . n 
A 1 308 ILE 308 324 324 ILE ILE A . n 
A 1 309 ILE 309 325 325 ILE ILE A . n 
A 1 310 GLU 310 326 326 GLU GLU A . n 
A 1 311 LYS 311 327 327 LYS LYS A . n 
A 1 312 PRO 312 328 328 PRO PRO A . n 
A 1 313 THR 313 329 329 THR THR A . n 
A 1 314 ASP 314 330 330 ASP ASP A . n 
A 1 315 GLY 315 331 331 GLY GLY A . n 
A 1 316 ARG 316 332 332 ARG ARG A . n 
A 1 317 ASP 317 333 333 ASP ASP A . n 
A 1 318 LEU 318 334 334 LEU LEU A . n 
A 1 319 VAL 319 335 335 VAL VAL A . n 
A 1 320 CYS 320 336 336 CYS CYS A . n 
A 1 321 HIS 321 337 337 HIS HIS A . n 
A 1 322 ALA 322 338 338 ALA ALA A . n 
A 1 323 SER 323 339 339 SER SER A . n 
A 1 324 ALA 324 340 340 ALA ALA A . n 
A 1 325 TRP 325 341 341 TRP TRP A . n 
A 1 326 ASP 326 342 342 ASP ASP A . n 
A 1 327 PHE 327 343 343 PHE PHE A . n 
A 1 328 TYR 328 344 344 TYR TYR A . n 
A 1 329 LEU 329 345 345 LEU LEU A . n 
A 1 330 THR 330 346 346 THR THR A . n 
A 1 331 ASP 331 347 347 ASP ASP A . n 
A 1 332 ASP 332 348 348 ASP ASP A . n 
A 1 333 VAL 333 349 349 VAL VAL A . n 
A 1 334 ARG 334 350 350 ARG ARG A . n 
A 1 335 ILE 335 351 351 ILE ILE A . n 
A 1 336 LYS 336 352 352 LYS LYS A . n 
A 1 337 GLN 337 353 353 GLN GLN A . n 
A 1 338 CYS 338 354 354 CYS CYS A . n 
A 1 339 THR 339 355 355 THR THR A . n 
A 1 340 ARG 340 356 356 ARG ARG A . n 
A 1 341 VAL 341 357 357 VAL VAL A . n 
A 1 342 THR 342 358 358 THR THR A . n 
A 1 343 GLN 343 359 359 GLN GLN A . n 
A 1 344 ASP 344 360 360 ASP ASP A . n 
A 1 345 GLN 345 361 361 GLN GLN A . n 
A 1 346 LEU 346 362 362 LEU LEU A . n 
A 1 347 PHE 347 363 363 PHE PHE A . n 
A 1 348 THR 348 364 364 THR THR A . n 
A 1 349 VAL 349 365 365 VAL VAL A . n 
A 1 350 HIS 350 366 366 HIS HIS A . n 
A 1 351 HIS 351 367 367 HIS HIS A . n 
A 1 352 GLU 352 368 368 GLU GLU A . n 
A 1 353 LEU 353 369 369 LEU LEU A . n 
A 1 354 GLY 354 370 370 GLY GLY A . n 
A 1 355 HIS 355 371 371 HIS HIS A . n 
A 1 356 ILE 356 372 372 ILE ILE A . n 
A 1 357 GLN 357 373 373 GLN GLN A . n 
A 1 358 TYR 358 374 374 TYR TYR A . n 
A 1 359 PHE 359 375 375 PHE PHE A . n 
A 1 360 LEU 360 376 376 LEU LEU A . n 
A 1 361 GLN 361 377 377 GLN GLN A . n 
A 1 362 TYR 362 378 378 TYR TYR A . n 
A 1 363 GLN 363 379 379 GLN GLN A . n 
A 1 364 HIS 364 380 380 HIS HIS A . n 
A 1 365 GLN 365 381 381 GLN GLN A . n 
A 1 366 PRO 366 382 382 PRO PRO A . n 
A 1 367 PHE 367 383 383 PHE PHE A . n 
A 1 368 VAL 368 384 384 VAL VAL A . n 
A 1 369 TYR 369 385 385 TYR TYR A . n 
A 1 370 ARG 370 386 386 ARG ARG A . n 
A 1 371 THR 371 387 387 THR THR A . n 
A 1 372 GLY 372 388 388 GLY GLY A . n 
A 1 373 ALA 373 389 389 ALA ALA A . n 
A 1 374 ASN 374 390 390 ASN ASN A . n 
A 1 375 PRO 375 391 391 PRO PRO A . n 
A 1 376 GLY 376 392 392 GLY GLY A . n 
A 1 377 PHE 377 393 393 PHE PHE A . n 
A 1 378 HIS 378 394 394 HIS HIS A . n 
A 1 379 GLU 379 395 395 GLU GLU A . n 
A 1 380 ALA 380 396 396 ALA ALA A . n 
A 1 381 VAL 381 397 397 VAL VAL A . n 
A 1 382 GLY 382 398 398 GLY GLY A . n 
A 1 383 ASP 383 399 399 ASP ASP A . n 
A 1 384 VAL 384 400 400 VAL VAL A . n 
A 1 385 LEU 385 401 401 LEU LEU A . n 
A 1 386 SER 386 402 402 SER SER A . n 
A 1 387 LEU 387 403 403 LEU LEU A . n 
A 1 388 SER 388 404 404 SER SER A . n 
A 1 389 VAL 389 405 405 VAL VAL A . n 
A 1 390 SER 390 406 406 SER SER A . n 
A 1 391 THR 391 407 407 THR THR A . n 
A 1 392 PRO 392 408 408 PRO PRO A . n 
A 1 393 LYS 393 409 409 LYS LYS A . n 
A 1 394 HIS 394 410 410 HIS HIS A . n 
A 1 395 LEU 395 411 411 LEU LEU A . n 
A 1 396 GLU 396 412 412 GLU GLU A . n 
A 1 397 LYS 397 413 413 LYS LYS A . n 
A 1 398 ILE 398 414 414 ILE ILE A . n 
A 1 399 GLY 399 415 415 GLY GLY A . n 
A 1 400 LEU 400 416 416 LEU LEU A . n 
A 1 401 LEU 401 417 417 LEU LEU A . n 
A 1 402 LYS 402 418 418 LYS LYS A . n 
A 1 403 ASP 403 419 419 ASP ASP A . n 
A 1 404 TYR 404 420 420 TYR TYR A . n 
A 1 405 VAL 405 421 421 VAL VAL A . n 
A 1 406 ARG 406 422 422 ARG ARG A . n 
A 1 407 ASP 407 423 423 ASP ASP A . n 
A 1 408 ASP 408 424 424 ASP ASP A . n 
A 1 409 GLU 409 425 425 GLU GLU A . n 
A 1 410 ALA 410 426 426 ALA ALA A . n 
A 1 411 ARG 411 427 427 ARG ARG A . n 
A 1 412 ILE 412 428 428 ILE ILE A . n 
A 1 413 ASN 413 429 429 ASN ASN A . n 
A 1 414 GLN 414 430 430 GLN GLN A . n 
A 1 415 LEU 415 431 431 LEU LEU A . n 
A 1 416 PHE 416 432 432 PHE PHE A . n 
A 1 417 LEU 417 433 433 LEU LEU A . n 
A 1 418 THR 418 434 434 THR THR A . n 
A 1 419 ALA 419 435 435 ALA ALA A . n 
A 1 420 LEU 420 436 436 LEU LEU A . n 
A 1 421 ASP 421 437 437 ASP ASP A . n 
A 1 422 LYS 422 438 438 LYS LYS A . n 
A 1 423 ILE 423 439 439 ILE ILE A . n 
A 1 424 VAL 424 440 440 VAL VAL A . n 
A 1 425 PHE 425 441 441 PHE PHE A . n 
A 1 426 LEU 426 442 442 LEU LEU A . n 
A 1 427 PRO 427 443 443 PRO PRO A . n 
A 1 428 PHE 428 444 444 PHE PHE A . n 
A 1 429 ALA 429 445 445 ALA ALA A . n 
A 1 430 PHE 430 446 446 PHE PHE A . n 
A 1 431 THR 431 447 447 THR THR A . n 
A 1 432 MET 432 448 448 MET MET A . n 
A 1 433 ASP 433 449 449 ASP ASP A . n 
A 1 434 LYS 434 450 450 LYS LYS A . n 
A 1 435 TYR 435 451 451 TYR TYR A . n 
A 1 436 ARG 436 452 452 ARG ARG A . n 
A 1 437 TRP 437 453 453 TRP TRP A . n 
A 1 438 SER 438 454 454 SER SER A . n 
A 1 439 LEU 439 455 455 LEU LEU A . n 
A 1 440 PHE 440 456 456 PHE PHE A . n 
A 1 441 ARG 441 457 457 ARG ARG A . n 
A 1 442 GLY 442 458 458 GLY GLY A . n 
A 1 443 GLU 443 459 459 GLU GLU A . n 
A 1 444 VAL 444 460 460 VAL VAL A . n 
A 1 445 ASP 445 461 461 ASP ASP A . n 
A 1 446 LYS 446 462 462 LYS LYS A . n 
A 1 447 ALA 447 463 463 ALA ALA A . n 
A 1 448 ASN 448 464 464 ASN ASN A . n 
A 1 449 TRP 449 465 465 TRP TRP A . n 
A 1 450 ASN 450 466 466 ASN ASN A . n 
A 1 451 CYS 451 467 467 CYS CYS A . n 
A 1 452 ALA 452 468 468 ALA ALA A . n 
A 1 453 PHE 453 469 469 PHE PHE A . n 
A 1 454 TRP 454 470 470 TRP TRP A . n 
A 1 455 LYS 455 471 471 LYS LYS A . n 
A 1 456 LEU 456 472 472 LEU LEU A . n 
A 1 457 ARG 457 473 473 ARG ARG A . n 
A 1 458 ASP 458 474 474 ASP ASP A . n 
A 1 459 GLU 459 475 475 GLU GLU A . n 
A 1 460 TYR 460 476 476 TYR TYR A . n 
A 1 461 SER 461 477 477 SER SER A . n 
A 1 462 GLY 462 478 478 GLY GLY A . n 
A 1 463 ILE 463 479 479 ILE ILE A . n 
A 1 464 GLU 464 480 480 GLU GLU A . n 
A 1 465 PRO 465 481 481 PRO PRO A . n 
A 1 466 PRO 466 482 482 PRO PRO A . n 
A 1 467 VAL 467 483 483 VAL VAL A . n 
A 1 468 VAL 468 484 484 VAL VAL A . n 
A 1 469 ARG 469 485 485 ARG ARG A . n 
A 1 470 SER 470 486 486 SER SER A . n 
A 1 471 GLU 471 487 487 GLU GLU A . n 
A 1 472 LYS 472 488 488 LYS LYS A . n 
A 1 473 ASP 473 489 489 ASP ASP A . n 
A 1 474 PHE 474 490 490 PHE PHE A . n 
A 1 475 ASP 475 491 491 ASP ASP A . n 
A 1 476 ALA 476 492 492 ALA ALA A . n 
A 1 477 PRO 477 493 493 PRO PRO A . n 
A 1 478 ALA 478 494 494 ALA ALA A . n 
A 1 479 LYS 479 495 495 LYS LYS A . n 
A 1 480 TYR 480 496 496 TYR TYR A . n 
A 1 481 HIS 481 497 497 HIS HIS A . n 
A 1 482 ILE 482 498 498 ILE ILE A . n 
A 1 483 SER 483 499 499 SER SER A . n 
A 1 484 ALA 484 500 500 ALA ALA A . n 
A 1 485 ASP 485 501 501 ASP ASP A . n 
A 1 486 VAL 486 502 502 VAL VAL A . n 
A 1 487 GLU 487 503 503 GLU GLU A . n 
A 1 488 TYR 488 504 504 TYR TYR A . n 
A 1 489 LEU 489 505 505 LEU LEU A . n 
A 1 490 ARG 490 506 506 ARG ARG A . n 
A 1 491 TYR 491 507 507 TYR TYR A . n 
A 1 492 LEU 492 508 508 LEU LEU A . n 
A 1 493 VAL 493 509 509 VAL VAL A . n 
A 1 494 SER 494 510 510 SER SER A . n 
A 1 495 PHE 495 511 511 PHE PHE A . n 
A 1 496 ILE 496 512 512 ILE ILE A . n 
A 1 497 ILE 497 513 513 ILE ILE A . n 
A 1 498 GLN 498 514 514 GLN GLN A . n 
A 1 499 PHE 499 515 515 PHE PHE A . n 
A 1 500 GLN 500 516 516 GLN GLN A . n 
A 1 501 PHE 501 517 517 PHE PHE A . n 
A 1 502 TYR 502 518 518 TYR TYR A . n 
A 1 503 LYS 503 519 519 LYS LYS A . n 
A 1 504 SER 504 520 520 SER SER A . n 
A 1 505 ALA 505 521 521 ALA ALA A . n 
A 1 506 CYS 506 522 522 CYS CYS A . n 
A 1 507 ILE 507 523 523 ILE ILE A . n 
A 1 508 LYS 508 524 524 LYS LYS A . n 
A 1 509 ALA 509 525 525 ALA ALA A . n 
A 1 510 GLY 510 526 526 GLY GLY A . n 
A 1 511 GLN 511 527 527 GLN GLN A . n 
A 1 512 TYR 512 528 528 TYR TYR A . n 
A 1 513 ASP 513 529 529 ASP ASP A . n 
A 1 514 PRO 514 530 530 PRO PRO A . n 
A 1 515 ASP 515 531 531 ASP ASP A . n 
A 1 516 ASN 516 532 532 ASN ASN A . n 
A 1 517 VAL 517 533 533 VAL VAL A . n 
A 1 518 GLU 518 534 534 GLU GLU A . n 
A 1 519 LEU 519 535 535 LEU LEU A . n 
A 1 520 PRO 520 536 536 PRO PRO A . n 
A 1 521 LEU 521 537 537 LEU LEU A . n 
A 1 522 ASP 522 538 538 ASP ASP A . n 
A 1 523 ASN 523 539 539 ASN ASN A . n 
A 1 524 CYS 524 540 540 CYS CYS A . n 
A 1 525 ASP 525 541 541 ASP ASP A . n 
A 1 526 ILE 526 542 542 ILE ILE A . n 
A 1 527 TYR 527 543 543 TYR TYR A . n 
A 1 528 GLY 528 544 544 GLY GLY A . n 
A 1 529 SER 529 545 545 SER SER A . n 
A 1 530 ALA 530 546 546 ALA ALA A . n 
A 1 531 ALA 531 547 547 ALA ALA A . n 
A 1 532 ALA 532 548 548 ALA ALA A . n 
A 1 533 GLY 533 549 549 GLY GLY A . n 
A 1 534 ALA 534 550 550 ALA ALA A . n 
A 1 535 ALA 535 551 551 ALA ALA A . n 
A 1 536 PHE 536 552 552 PHE PHE A . n 
A 1 537 HIS 537 553 553 HIS HIS A . n 
A 1 538 ASN 538 554 554 ASN ASN A . n 
A 1 539 MET 539 555 555 MET MET A . n 
A 1 540 LEU 540 556 556 LEU LEU A . n 
A 1 541 SER 541 557 557 SER SER A . n 
A 1 542 MET 542 558 558 MET MET A . n 
A 1 543 GLY 543 559 559 GLY GLY A . n 
A 1 544 ALA 544 560 560 ALA ALA A . n 
A 1 545 SER 545 561 561 SER SER A . n 
A 1 546 LYS 546 562 562 LYS LYS A . n 
A 1 547 PRO 547 563 563 PRO PRO A . n 
A 1 548 TRP 548 564 564 TRP TRP A . n 
A 1 549 PRO 549 565 565 PRO PRO A . n 
A 1 550 ASP 550 566 566 ASP ASP A . n 
A 1 551 ALA 551 567 567 ALA ALA A . n 
A 1 552 LEU 552 568 568 LEU LEU A . n 
A 1 553 GLU 553 569 569 GLU GLU A . n 
A 1 554 ALA 554 570 570 ALA ALA A . n 
A 1 555 PHE 555 571 571 PHE PHE A . n 
A 1 556 ASN 556 572 572 ASN ASN A . n 
A 1 557 GLY 557 573 573 GLY GLY A . n 
A 1 558 GLU 558 574 574 GLU GLU A . n 
A 1 559 ARG 559 575 575 ARG ARG A . n 
A 1 560 ILE 560 576 576 ILE ILE A . n 
A 1 561 MET 561 577 577 MET MET A . n 
A 1 562 SER 562 578 578 SER SER A . n 
A 1 563 GLY 563 579 579 GLY GLY A . n 
A 1 564 LYS 564 580 580 LYS LYS A . n 
A 1 565 ALA 565 581 581 ALA ALA A . n 
A 1 566 ILE 566 582 582 ILE ILE A . n 
A 1 567 ALA 567 583 583 ALA ALA A . n 
A 1 568 GLU 568 584 584 GLU GLU A . n 
A 1 569 TYR 569 585 585 TYR TYR A . n 
A 1 570 PHE 570 586 586 PHE PHE A . n 
A 1 571 GLU 571 587 587 GLU GLU A . n 
A 1 572 PRO 572 588 588 PRO PRO A . n 
A 1 573 LEU 573 589 589 LEU LEU A . n 
A 1 574 ARG 574 590 590 ARG ARG A . n 
A 1 575 VAL 575 591 591 VAL VAL A . n 
A 1 576 TRP 576 592 592 TRP TRP A . n 
A 1 577 LEU 577 593 593 LEU LEU A . n 
A 1 578 GLU 578 594 594 GLU GLU A . n 
A 1 579 ALA 579 595 595 ALA ALA A . n 
A 1 580 GLU 580 596 596 GLU GLU A . n 
A 1 581 ASN 581 597 597 ASN ASN A . n 
A 1 582 ILE 582 598 598 ILE ILE A . n 
A 1 583 LYS 583 599 599 LYS LYS A . n 
A 1 584 ASN 584 600 600 ASN ASN A . n 
A 1 585 ASN 585 601 601 ASN ASN A . n 
A 1 586 VAL 586 602 602 VAL VAL A . n 
A 1 587 HIS 587 603 603 HIS HIS A . n 
A 1 588 ILE 588 604 604 ILE ILE A . n 
A 1 589 GLY 589 605 605 GLY GLY A . n 
A 1 590 TRP 590 606 606 TRP TRP A . n 
A 1 591 THR 591 607 607 THR THR A . n 
A 1 592 THR 592 608 608 THR THR A . n 
A 1 593 SER 593 609 609 SER SER A . n 
A 1 594 ASN 594 610 610 ASN ASN A . n 
A 1 595 LYS 595 611 611 LYS LYS A . n 
A 1 596 CYS 596 612 612 CYS CYS A . n 
A 1 597 VAL 597 613 613 VAL VAL A . n 
A 1 598 SER 598 614 614 SER SER A . n 
B 2 1   ARG 1   1   1   ARG ARG P . n 
B 2 2   PRO 2   2   2   PRO PRO P . n 
B 2 3   PRO 3   3   3   PRO PRO P . n 
B 2 4   GLY 4   4   4   GLY GLY P . n 
B 2 5   PHE 5   5   ?   ?   ?   P . n 
B 2 6   SER 6   6   ?   ?   ?   P . n 
B 2 7   PRO 7   7   ?   ?   ?   P . n 
B 2 8   PHE 8   8   ?   ?   ?   P . n 
B 2 9   ARG 9   9   ?   ?   ?   P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   1615 1615 ZN  ZN  A . 
E 5 NAG 1   1622 1622 NAG NAG A . 
F 5 NAG 1   1623 1623 NAG NAG A . 
G 6 FLC 1   1624 1624 FLC FLC A . 
H 7 HOH 1   2001 2001 HOH HOH A . 
H 7 HOH 2   2002 2002 HOH HOH A . 
H 7 HOH 3   2003 2003 HOH HOH A . 
H 7 HOH 4   2004 2004 HOH HOH A . 
H 7 HOH 5   2005 2005 HOH HOH A . 
H 7 HOH 6   2006 2006 HOH HOH A . 
H 7 HOH 7   2007 2007 HOH HOH A . 
H 7 HOH 8   2008 2008 HOH HOH A . 
H 7 HOH 9   2009 2009 HOH HOH A . 
H 7 HOH 10  2010 2010 HOH HOH A . 
H 7 HOH 11  2011 2011 HOH HOH A . 
H 7 HOH 12  2012 2012 HOH HOH A . 
H 7 HOH 13  2013 2013 HOH HOH A . 
H 7 HOH 14  2014 2014 HOH HOH A . 
H 7 HOH 15  2015 2015 HOH HOH A . 
H 7 HOH 16  2016 2016 HOH HOH A . 
H 7 HOH 17  2017 2017 HOH HOH A . 
H 7 HOH 18  2018 2018 HOH HOH A . 
H 7 HOH 19  2019 2019 HOH HOH A . 
H 7 HOH 20  2020 2020 HOH HOH A . 
H 7 HOH 21  2021 2021 HOH HOH A . 
H 7 HOH 22  2022 2022 HOH HOH A . 
H 7 HOH 23  2023 2023 HOH HOH A . 
H 7 HOH 24  2024 2024 HOH HOH A . 
H 7 HOH 25  2025 2025 HOH HOH A . 
H 7 HOH 26  2026 2026 HOH HOH A . 
H 7 HOH 27  2027 2027 HOH HOH A . 
H 7 HOH 28  2028 2028 HOH HOH A . 
H 7 HOH 29  2029 2029 HOH HOH A . 
H 7 HOH 30  2030 2030 HOH HOH A . 
H 7 HOH 31  2031 2031 HOH HOH A . 
H 7 HOH 32  2032 2032 HOH HOH A . 
H 7 HOH 33  2033 2033 HOH HOH A . 
H 7 HOH 34  2034 2034 HOH HOH A . 
H 7 HOH 35  2035 2035 HOH HOH A . 
H 7 HOH 36  2036 2036 HOH HOH A . 
H 7 HOH 37  2037 2037 HOH HOH A . 
H 7 HOH 38  2038 2038 HOH HOH A . 
H 7 HOH 39  2039 2039 HOH HOH A . 
H 7 HOH 40  2040 2040 HOH HOH A . 
H 7 HOH 41  2041 2041 HOH HOH A . 
H 7 HOH 42  2042 2042 HOH HOH A . 
H 7 HOH 43  2043 2043 HOH HOH A . 
H 7 HOH 44  2044 2044 HOH HOH A . 
H 7 HOH 45  2045 2045 HOH HOH A . 
H 7 HOH 46  2046 2046 HOH HOH A . 
H 7 HOH 47  2047 2047 HOH HOH A . 
H 7 HOH 48  2048 2048 HOH HOH A . 
H 7 HOH 49  2049 2049 HOH HOH A . 
H 7 HOH 50  2050 2050 HOH HOH A . 
H 7 HOH 51  2051 2051 HOH HOH A . 
H 7 HOH 52  2052 2052 HOH HOH A . 
H 7 HOH 53  2053 2053 HOH HOH A . 
H 7 HOH 54  2054 2054 HOH HOH A . 
H 7 HOH 55  2055 2055 HOH HOH A . 
H 7 HOH 56  2056 2056 HOH HOH A . 
H 7 HOH 57  2057 2057 HOH HOH A . 
H 7 HOH 58  2058 2058 HOH HOH A . 
H 7 HOH 59  2059 2059 HOH HOH A . 
H 7 HOH 60  2060 2060 HOH HOH A . 
H 7 HOH 61  2061 2061 HOH HOH A . 
H 7 HOH 62  2062 2062 HOH HOH A . 
H 7 HOH 63  2063 2063 HOH HOH A . 
H 7 HOH 64  2064 2064 HOH HOH A . 
H 7 HOH 65  2065 2065 HOH HOH A . 
H 7 HOH 66  2066 2066 HOH HOH A . 
H 7 HOH 67  2067 2067 HOH HOH A . 
H 7 HOH 68  2068 2068 HOH HOH A . 
H 7 HOH 69  2069 2069 HOH HOH A . 
H 7 HOH 70  2070 2070 HOH HOH A . 
H 7 HOH 71  2071 2071 HOH HOH A . 
H 7 HOH 72  2072 2072 HOH HOH A . 
H 7 HOH 73  2073 2073 HOH HOH A . 
H 7 HOH 74  2074 2074 HOH HOH A . 
H 7 HOH 75  2075 2075 HOH HOH A . 
H 7 HOH 76  2076 2076 HOH HOH A . 
H 7 HOH 77  2077 2077 HOH HOH A . 
H 7 HOH 78  2078 2078 HOH HOH A . 
H 7 HOH 79  2079 2079 HOH HOH A . 
H 7 HOH 80  2080 2080 HOH HOH A . 
H 7 HOH 81  2081 2081 HOH HOH A . 
H 7 HOH 82  2082 2082 HOH HOH A . 
H 7 HOH 83  2083 2083 HOH HOH A . 
H 7 HOH 84  2084 2084 HOH HOH A . 
H 7 HOH 85  2085 2085 HOH HOH A . 
H 7 HOH 86  2086 2086 HOH HOH A . 
H 7 HOH 87  2087 2087 HOH HOH A . 
H 7 HOH 88  2088 2088 HOH HOH A . 
H 7 HOH 89  2089 2089 HOH HOH A . 
H 7 HOH 90  2090 2090 HOH HOH A . 
H 7 HOH 91  2091 2091 HOH HOH A . 
H 7 HOH 92  2092 2092 HOH HOH A . 
H 7 HOH 93  2093 2093 HOH HOH A . 
H 7 HOH 94  2094 2094 HOH HOH A . 
H 7 HOH 95  2095 2095 HOH HOH A . 
H 7 HOH 96  2096 2096 HOH HOH A . 
H 7 HOH 97  2097 2097 HOH HOH A . 
H 7 HOH 98  2098 2098 HOH HOH A . 
H 7 HOH 99  2099 2099 HOH HOH A . 
H 7 HOH 100 2100 2100 HOH HOH A . 
H 7 HOH 101 2101 2101 HOH HOH A . 
H 7 HOH 102 2102 2102 HOH HOH A . 
H 7 HOH 103 2103 2103 HOH HOH A . 
H 7 HOH 104 2104 2104 HOH HOH A . 
H 7 HOH 105 2105 2105 HOH HOH A . 
H 7 HOH 106 2106 2106 HOH HOH A . 
H 7 HOH 107 2107 2107 HOH HOH A . 
H 7 HOH 108 2108 2108 HOH HOH A . 
H 7 HOH 109 2109 2109 HOH HOH A . 
H 7 HOH 110 2110 2110 HOH HOH A . 
H 7 HOH 111 2111 2111 HOH HOH A . 
H 7 HOH 112 2112 2112 HOH HOH A . 
H 7 HOH 113 2113 2113 HOH HOH A . 
H 7 HOH 114 2114 2114 HOH HOH A . 
H 7 HOH 115 2115 2115 HOH HOH A . 
H 7 HOH 116 2116 2116 HOH HOH A . 
H 7 HOH 117 2117 2117 HOH HOH A . 
H 7 HOH 118 2118 2118 HOH HOH A . 
H 7 HOH 119 2119 2119 HOH HOH A . 
H 7 HOH 120 2120 2120 HOH HOH A . 
H 7 HOH 121 2121 2121 HOH HOH A . 
H 7 HOH 122 2122 2122 HOH HOH A . 
H 7 HOH 123 2123 2123 HOH HOH A . 
H 7 HOH 124 2124 2124 HOH HOH A . 
H 7 HOH 125 2125 2125 HOH HOH A . 
H 7 HOH 126 2126 2126 HOH HOH A . 
H 7 HOH 127 2127 2127 HOH HOH A . 
H 7 HOH 128 2128 2128 HOH HOH A . 
H 7 HOH 129 2129 2129 HOH HOH A . 
H 7 HOH 130 2130 2130 HOH HOH A . 
H 7 HOH 131 2131 2131 HOH HOH A . 
H 7 HOH 132 2132 2132 HOH HOH A . 
H 7 HOH 133 2133 2133 HOH HOH A . 
H 7 HOH 134 2134 2134 HOH HOH A . 
H 7 HOH 135 2135 2135 HOH HOH A . 
H 7 HOH 136 2136 2136 HOH HOH A . 
H 7 HOH 137 2137 2137 HOH HOH A . 
H 7 HOH 138 2138 2138 HOH HOH A . 
H 7 HOH 139 2139 2139 HOH HOH A . 
H 7 HOH 140 2140 2140 HOH HOH A . 
H 7 HOH 141 2141 2141 HOH HOH A . 
H 7 HOH 142 2142 2142 HOH HOH A . 
H 7 HOH 143 2143 2143 HOH HOH A . 
H 7 HOH 144 2144 2144 HOH HOH A . 
H 7 HOH 145 2145 2145 HOH HOH A . 
H 7 HOH 146 2146 2146 HOH HOH A . 
H 7 HOH 147 2147 2147 HOH HOH A . 
H 7 HOH 148 2148 2148 HOH HOH A . 
H 7 HOH 149 2149 2149 HOH HOH A . 
H 7 HOH 150 2150 2150 HOH HOH A . 
H 7 HOH 151 2151 2151 HOH HOH A . 
H 7 HOH 152 2152 2152 HOH HOH A . 
H 7 HOH 153 2153 2153 HOH HOH A . 
H 7 HOH 154 2154 2154 HOH HOH A . 
H 7 HOH 155 2155 2155 HOH HOH A . 
H 7 HOH 156 2156 2156 HOH HOH A . 
H 7 HOH 157 2157 2157 HOH HOH A . 
H 7 HOH 158 2158 2158 HOH HOH A . 
H 7 HOH 159 2159 2159 HOH HOH A . 
H 7 HOH 160 2160 2160 HOH HOH A . 
H 7 HOH 161 2161 2161 HOH HOH A . 
H 7 HOH 162 2162 2162 HOH HOH A . 
H 7 HOH 163 2163 2163 HOH HOH A . 
H 7 HOH 164 2164 2164 HOH HOH A . 
H 7 HOH 165 2165 2165 HOH HOH A . 
H 7 HOH 166 2166 2166 HOH HOH A . 
H 7 HOH 167 2167 2167 HOH HOH A . 
H 7 HOH 168 2168 2168 HOH HOH A . 
H 7 HOH 169 2169 2169 HOH HOH A . 
H 7 HOH 170 2170 2170 HOH HOH A . 
H 7 HOH 171 2171 2171 HOH HOH A . 
H 7 HOH 172 2172 2172 HOH HOH A . 
H 7 HOH 173 2173 2173 HOH HOH A . 
H 7 HOH 174 2174 2174 HOH HOH A . 
H 7 HOH 175 2175 2175 HOH HOH A . 
H 7 HOH 176 2176 2176 HOH HOH A . 
H 7 HOH 177 2177 2177 HOH HOH A . 
H 7 HOH 178 2178 2178 HOH HOH A . 
H 7 HOH 179 2179 2179 HOH HOH A . 
H 7 HOH 180 2180 2180 HOH HOH A . 
H 7 HOH 181 2181 2181 HOH HOH A . 
H 7 HOH 182 2182 2182 HOH HOH A . 
H 7 HOH 183 2183 2183 HOH HOH A . 
H 7 HOH 184 2184 2184 HOH HOH A . 
H 7 HOH 185 2185 2185 HOH HOH A . 
H 7 HOH 186 2186 2186 HOH HOH A . 
H 7 HOH 187 2187 2187 HOH HOH A . 
H 7 HOH 188 2188 2188 HOH HOH A . 
H 7 HOH 189 2189 2189 HOH HOH A . 
H 7 HOH 190 2190 2190 HOH HOH A . 
H 7 HOH 191 2191 2191 HOH HOH A . 
H 7 HOH 192 2192 2192 HOH HOH A . 
H 7 HOH 193 2193 2193 HOH HOH A . 
H 7 HOH 194 2194 2194 HOH HOH A . 
H 7 HOH 195 2195 2195 HOH HOH A . 
H 7 HOH 196 2196 2196 HOH HOH A . 
H 7 HOH 197 2197 2197 HOH HOH A . 
H 7 HOH 198 2198 2198 HOH HOH A . 
H 7 HOH 199 2199 2199 HOH HOH A . 
H 7 HOH 200 2200 2200 HOH HOH A . 
H 7 HOH 201 2201 2201 HOH HOH A . 
H 7 HOH 202 2202 2202 HOH HOH A . 
H 7 HOH 203 2203 2203 HOH HOH A . 
H 7 HOH 204 2204 2204 HOH HOH A . 
H 7 HOH 205 2205 2205 HOH HOH A . 
H 7 HOH 206 2206 2206 HOH HOH A . 
H 7 HOH 207 2207 2207 HOH HOH A . 
H 7 HOH 208 2208 2208 HOH HOH A . 
H 7 HOH 209 2209 2209 HOH HOH A . 
H 7 HOH 210 2210 2210 HOH HOH A . 
H 7 HOH 211 2211 2211 HOH HOH A . 
H 7 HOH 212 2212 2212 HOH HOH A . 
H 7 HOH 213 2213 2213 HOH HOH A . 
H 7 HOH 214 2214 2214 HOH HOH A . 
H 7 HOH 215 2215 2215 HOH HOH A . 
H 7 HOH 216 2216 2216 HOH HOH A . 
H 7 HOH 217 2217 2217 HOH HOH A . 
H 7 HOH 218 2218 2218 HOH HOH A . 
H 7 HOH 219 2219 2219 HOH HOH A . 
H 7 HOH 220 2220 2220 HOH HOH A . 
H 7 HOH 221 2221 2221 HOH HOH A . 
H 7 HOH 222 2222 2222 HOH HOH A . 
H 7 HOH 223 2223 2223 HOH HOH A . 
H 7 HOH 224 2224 2224 HOH HOH A . 
H 7 HOH 225 2225 2225 HOH HOH A . 
H 7 HOH 226 2226 2226 HOH HOH A . 
H 7 HOH 227 2227 2227 HOH HOH A . 
H 7 HOH 228 2228 2228 HOH HOH A . 
H 7 HOH 229 2229 2229 HOH HOH A . 
H 7 HOH 230 2230 2230 HOH HOH A . 
H 7 HOH 231 2231 2231 HOH HOH A . 
H 7 HOH 232 2232 2232 HOH HOH A . 
H 7 HOH 233 2233 2233 HOH HOH A . 
H 7 HOH 234 2234 2234 HOH HOH A . 
H 7 HOH 235 2235 2235 HOH HOH A . 
H 7 HOH 236 2236 2236 HOH HOH A . 
H 7 HOH 237 2237 2237 HOH HOH A . 
H 7 HOH 238 2238 2238 HOH HOH A . 
H 7 HOH 239 2239 2239 HOH HOH A . 
H 7 HOH 240 2240 2240 HOH HOH A . 
H 7 HOH 241 2241 2241 HOH HOH A . 
H 7 HOH 242 2242 2242 HOH HOH A . 
H 7 HOH 243 2243 2243 HOH HOH A . 
H 7 HOH 244 2244 2244 HOH HOH A . 
H 7 HOH 245 2245 2245 HOH HOH A . 
H 7 HOH 246 2246 2246 HOH HOH A . 
H 7 HOH 247 2247 2247 HOH HOH A . 
H 7 HOH 248 2248 2248 HOH HOH A . 
H 7 HOH 249 2249 2249 HOH HOH A . 
H 7 HOH 250 2250 2250 HOH HOH A . 
H 7 HOH 251 2251 2251 HOH HOH A . 
H 7 HOH 252 2252 2252 HOH HOH A . 
H 7 HOH 253 2253 2253 HOH HOH A . 
H 7 HOH 254 2254 2254 HOH HOH A . 
H 7 HOH 255 2255 2255 HOH HOH A . 
H 7 HOH 256 2256 2256 HOH HOH A . 
H 7 HOH 257 2257 2257 HOH HOH A . 
H 7 HOH 258 2258 2258 HOH HOH A . 
H 7 HOH 259 2259 2259 HOH HOH A . 
H 7 HOH 260 2260 2260 HOH HOH A . 
H 7 HOH 261 2261 2261 HOH HOH A . 
H 7 HOH 262 2262 2262 HOH HOH A . 
H 7 HOH 263 2263 2263 HOH HOH A . 
H 7 HOH 264 2264 2264 HOH HOH A . 
H 7 HOH 265 2265 2265 HOH HOH A . 
H 7 HOH 266 2266 2266 HOH HOH A . 
H 7 HOH 267 2267 2267 HOH HOH A . 
H 7 HOH 268 2268 2268 HOH HOH A . 
H 7 HOH 269 2269 2269 HOH HOH A . 
H 7 HOH 270 2270 2270 HOH HOH A . 
H 7 HOH 271 2271 2271 HOH HOH A . 
H 7 HOH 272 2272 2272 HOH HOH A . 
H 7 HOH 273 2273 2273 HOH HOH A . 
H 7 HOH 274 2274 2274 HOH HOH A . 
H 7 HOH 275 2275 2275 HOH HOH A . 
H 7 HOH 276 2276 2276 HOH HOH A . 
H 7 HOH 277 2277 2277 HOH HOH A . 
H 7 HOH 278 2278 2278 HOH HOH A . 
H 7 HOH 279 2279 2279 HOH HOH A . 
H 7 HOH 280 2280 2280 HOH HOH A . 
H 7 HOH 281 2281 2281 HOH HOH A . 
H 7 HOH 282 2282 2282 HOH HOH A . 
H 7 HOH 283 2283 2283 HOH HOH A . 
H 7 HOH 284 2284 2284 HOH HOH A . 
H 7 HOH 285 2285 2285 HOH HOH A . 
H 7 HOH 286 2286 2286 HOH HOH A . 
H 7 HOH 287 2287 2287 HOH HOH A . 
H 7 HOH 288 2288 2288 HOH HOH A . 
H 7 HOH 289 2289 2289 HOH HOH A . 
H 7 HOH 290 2290 2290 HOH HOH A . 
H 7 HOH 291 2291 2291 HOH HOH A . 
H 7 HOH 292 2292 2292 HOH HOH A . 
H 7 HOH 293 2293 2293 HOH HOH A . 
H 7 HOH 294 2294 2294 HOH HOH A . 
H 7 HOH 295 2295 2295 HOH HOH A . 
H 7 HOH 296 2296 2296 HOH HOH A . 
H 7 HOH 297 2297 2297 HOH HOH A . 
H 7 HOH 298 2298 2298 HOH HOH A . 
H 7 HOH 299 2299 2299 HOH HOH A . 
H 7 HOH 300 2300 2300 HOH HOH A . 
H 7 HOH 301 2301 2301 HOH HOH A . 
H 7 HOH 302 2302 2302 HOH HOH A . 
H 7 HOH 303 2303 2303 HOH HOH A . 
H 7 HOH 304 2304 2304 HOH HOH A . 
H 7 HOH 305 2305 2305 HOH HOH A . 
H 7 HOH 306 2306 2306 HOH HOH A . 
H 7 HOH 307 2307 2307 HOH HOH A . 
H 7 HOH 308 2308 2308 HOH HOH A . 
H 7 HOH 309 2309 2309 HOH HOH A . 
H 7 HOH 310 2310 2310 HOH HOH A . 
H 7 HOH 311 2311 2311 HOH HOH A . 
H 7 HOH 312 2312 2312 HOH HOH A . 
H 7 HOH 313 2313 2313 HOH HOH A . 
H 7 HOH 314 2314 2314 HOH HOH A . 
H 7 HOH 315 2315 2315 HOH HOH A . 
H 7 HOH 316 2316 2316 HOH HOH A . 
H 7 HOH 317 2317 2317 HOH HOH A . 
H 7 HOH 318 2318 2318 HOH HOH A . 
H 7 HOH 319 2319 2319 HOH HOH A . 
H 7 HOH 320 2320 2320 HOH HOH A . 
H 7 HOH 321 2321 2321 HOH HOH A . 
H 7 HOH 322 2322 2322 HOH HOH A . 
H 7 HOH 323 2323 2323 HOH HOH A . 
H 7 HOH 324 2324 2324 HOH HOH A . 
H 7 HOH 325 2325 2325 HOH HOH A . 
H 7 HOH 326 2326 2326 HOH HOH A . 
H 7 HOH 327 2327 2327 HOH HOH A . 
H 7 HOH 328 2328 2328 HOH HOH A . 
H 7 HOH 329 2329 2329 HOH HOH A . 
H 7 HOH 330 2330 2330 HOH HOH A . 
H 7 HOH 331 2331 2331 HOH HOH A . 
H 7 HOH 332 2332 2332 HOH HOH A . 
H 7 HOH 333 2333 2333 HOH HOH A . 
H 7 HOH 334 2334 2334 HOH HOH A . 
H 7 HOH 335 2335 2335 HOH HOH A . 
H 7 HOH 336 2336 2336 HOH HOH A . 
H 7 HOH 337 2337 2337 HOH HOH A . 
H 7 HOH 338 2338 2338 HOH HOH A . 
H 7 HOH 339 2339 2339 HOH HOH A . 
H 7 HOH 340 2340 2340 HOH HOH A . 
H 7 HOH 341 2341 2341 HOH HOH A . 
H 7 HOH 342 2342 2342 HOH HOH A . 
H 7 HOH 343 2343 2343 HOH HOH A . 
H 7 HOH 344 2344 2344 HOH HOH A . 
H 7 HOH 345 2345 2345 HOH HOH A . 
H 7 HOH 346 2346 2346 HOH HOH A . 
H 7 HOH 347 2347 2347 HOH HOH A . 
H 7 HOH 348 2348 2348 HOH HOH A . 
H 7 HOH 349 2349 2349 HOH HOH A . 
H 7 HOH 350 2350 2350 HOH HOH A . 
H 7 HOH 351 2351 2351 HOH HOH A . 
H 7 HOH 352 2352 2352 HOH HOH A . 
H 7 HOH 353 2353 2353 HOH HOH A . 
H 7 HOH 354 2354 2354 HOH HOH A . 
H 7 HOH 355 2355 2355 HOH HOH A . 
H 7 HOH 356 2356 2356 HOH HOH A . 
H 7 HOH 357 2357 2357 HOH HOH A . 
H 7 HOH 358 2358 2358 HOH HOH A . 
H 7 HOH 359 2359 2359 HOH HOH A . 
H 7 HOH 360 2360 2360 HOH HOH A . 
H 7 HOH 361 2361 2361 HOH HOH A . 
H 7 HOH 362 2362 2362 HOH HOH A . 
H 7 HOH 363 2363 2363 HOH HOH A . 
H 7 HOH 364 2364 2364 HOH HOH A . 
H 7 HOH 365 2365 2365 HOH HOH A . 
H 7 HOH 366 2366 2366 HOH HOH A . 
H 7 HOH 367 2367 2367 HOH HOH A . 
H 7 HOH 368 2368 2368 HOH HOH A . 
H 7 HOH 369 2369 2369 HOH HOH A . 
H 7 HOH 370 2370 2370 HOH HOH A . 
H 7 HOH 371 2371 2371 HOH HOH A . 
H 7 HOH 372 2372 2372 HOH HOH A . 
H 7 HOH 373 2373 2373 HOH HOH A . 
H 7 HOH 374 2374 2374 HOH HOH A . 
H 7 HOH 375 2375 2375 HOH HOH A . 
H 7 HOH 376 2376 2376 HOH HOH A . 
H 7 HOH 377 2377 2377 HOH HOH A . 
H 7 HOH 378 2378 2378 HOH HOH A . 
H 7 HOH 379 2379 2379 HOH HOH A . 
H 7 HOH 380 2380 2380 HOH HOH A . 
H 7 HOH 381 2381 2381 HOH HOH A . 
H 7 HOH 382 2382 2382 HOH HOH A . 
H 7 HOH 383 2383 2383 HOH HOH A . 
H 7 HOH 384 2384 2384 HOH HOH A . 
H 7 HOH 385 2385 2385 HOH HOH A . 
H 7 HOH 386 2386 2386 HOH HOH A . 
H 7 HOH 387 2387 2387 HOH HOH A . 
H 7 HOH 388 2388 2388 HOH HOH A . 
H 7 HOH 389 2389 2389 HOH HOH A . 
H 7 HOH 390 2390 2390 HOH HOH A . 
H 7 HOH 391 2391 2391 HOH HOH A . 
H 7 HOH 392 2392 2392 HOH HOH A . 
H 7 HOH 393 2393 2393 HOH HOH A . 
H 7 HOH 394 2394 2394 HOH HOH A . 
H 7 HOH 395 2395 2395 HOH HOH A . 
H 7 HOH 396 2396 2396 HOH HOH A . 
H 7 HOH 397 2397 2397 HOH HOH A . 
H 7 HOH 398 2398 2398 HOH HOH A . 
H 7 HOH 399 2399 2399 HOH HOH A . 
H 7 HOH 400 2400 2400 HOH HOH A . 
H 7 HOH 401 2401 2401 HOH HOH A . 
H 7 HOH 402 2402 2402 HOH HOH A . 
H 7 HOH 403 2403 2403 HOH HOH A . 
H 7 HOH 404 2404 2404 HOH HOH A . 
H 7 HOH 405 2405 2405 HOH HOH A . 
H 7 HOH 406 2406 2406 HOH HOH A . 
H 7 HOH 407 2407 2407 HOH HOH A . 
H 7 HOH 408 2408 2408 HOH HOH A . 
H 7 HOH 409 2409 2409 HOH HOH A . 
H 7 HOH 410 2410 2410 HOH HOH A . 
H 7 HOH 411 2411 2411 HOH HOH A . 
H 7 HOH 412 2412 2412 HOH HOH A . 
H 7 HOH 413 2413 2413 HOH HOH A . 
H 7 HOH 414 2414 2414 HOH HOH A . 
H 7 HOH 415 2415 2415 HOH HOH A . 
H 7 HOH 416 2416 2416 HOH HOH A . 
H 7 HOH 417 2417 2417 HOH HOH A . 
H 7 HOH 418 2418 2418 HOH HOH A . 
H 7 HOH 419 2419 2419 HOH HOH A . 
H 7 HOH 420 2420 2420 HOH HOH A . 
H 7 HOH 421 2421 2421 HOH HOH A . 
H 7 HOH 422 2422 2422 HOH HOH A . 
H 7 HOH 423 2423 2423 HOH HOH A . 
H 7 HOH 424 2424 2424 HOH HOH A . 
H 7 HOH 425 2425 2425 HOH HOH A . 
H 7 HOH 426 2426 2426 HOH HOH A . 
H 7 HOH 427 2427 2427 HOH HOH A . 
H 7 HOH 428 2428 2428 HOH HOH A . 
H 7 HOH 429 2429 2429 HOH HOH A . 
H 7 HOH 430 2430 2430 HOH HOH A . 
H 7 HOH 431 2431 2431 HOH HOH A . 
H 7 HOH 432 2432 2432 HOH HOH A . 
H 7 HOH 433 2433 2433 HOH HOH A . 
H 7 HOH 434 2434 2434 HOH HOH A . 
H 7 HOH 435 2435 2435 HOH HOH A . 
H 7 HOH 436 2436 2436 HOH HOH A . 
H 7 HOH 437 2437 2437 HOH HOH A . 
H 7 HOH 438 2438 2438 HOH HOH A . 
H 7 HOH 439 2439 2439 HOH HOH A . 
H 7 HOH 440 2440 2440 HOH HOH A . 
H 7 HOH 441 2441 2441 HOH HOH A . 
H 7 HOH 442 2442 2442 HOH HOH A . 
H 7 HOH 443 2443 2443 HOH HOH A . 
H 7 HOH 444 2444 2444 HOH HOH A . 
H 7 HOH 445 2445 2445 HOH HOH A . 
H 7 HOH 446 2446 2446 HOH HOH A . 
H 7 HOH 447 2447 2447 HOH HOH A . 
H 7 HOH 448 2448 2448 HOH HOH A . 
H 7 HOH 449 2449 2449 HOH HOH A . 
H 7 HOH 450 2450 2450 HOH HOH A . 
H 7 HOH 451 2451 2451 HOH HOH A . 
H 7 HOH 452 2452 2452 HOH HOH A . 
H 7 HOH 453 2453 2453 HOH HOH A . 
H 7 HOH 454 2454 2454 HOH HOH A . 
H 7 HOH 455 2455 2455 HOH HOH A . 
H 7 HOH 456 2456 2456 HOH HOH A . 
H 7 HOH 457 2457 2457 HOH HOH A . 
H 7 HOH 458 2458 2458 HOH HOH A . 
H 7 HOH 459 2459 2459 HOH HOH A . 
H 7 HOH 460 2460 2460 HOH HOH A . 
H 7 HOH 461 2461 2461 HOH HOH A . 
H 7 HOH 462 2462 2462 HOH HOH A . 
H 7 HOH 463 2463 2463 HOH HOH A . 
H 7 HOH 464 2464 2464 HOH HOH A . 
H 7 HOH 465 2465 2465 HOH HOH A . 
H 7 HOH 466 2466 2466 HOH HOH A . 
H 7 HOH 467 2467 2467 HOH HOH A . 
H 7 HOH 468 2468 2468 HOH HOH A . 
H 7 HOH 469 2469 2469 HOH HOH A . 
H 7 HOH 470 2470 2470 HOH HOH A . 
H 7 HOH 471 2471 2471 HOH HOH A . 
H 7 HOH 472 2472 2472 HOH HOH A . 
H 7 HOH 473 2473 2473 HOH HOH A . 
H 7 HOH 474 2474 2474 HOH HOH A . 
H 7 HOH 475 2475 2475 HOH HOH A . 
H 7 HOH 476 2476 2476 HOH HOH A . 
H 7 HOH 477 2477 2477 HOH HOH A . 
H 7 HOH 478 2478 2478 HOH HOH A . 
H 7 HOH 479 2479 2479 HOH HOH A . 
H 7 HOH 480 2480 2480 HOH HOH A . 
H 7 HOH 481 2481 2481 HOH HOH A . 
H 7 HOH 482 2482 2482 HOH HOH A . 
H 7 HOH 483 2483 2483 HOH HOH A . 
H 7 HOH 484 2484 2484 HOH HOH A . 
H 7 HOH 485 2485 2485 HOH HOH A . 
H 7 HOH 486 2486 2486 HOH HOH A . 
H 7 HOH 487 2487 2487 HOH HOH A . 
H 7 HOH 488 2488 2488 HOH HOH A . 
H 7 HOH 489 2489 2489 HOH HOH A . 
H 7 HOH 490 2490 2490 HOH HOH A . 
H 7 HOH 491 2491 2491 HOH HOH A . 
H 7 HOH 492 2492 2492 HOH HOH A . 
H 7 HOH 493 2493 2493 HOH HOH A . 
H 7 HOH 494 2494 2494 HOH HOH A . 
H 7 HOH 495 2495 2495 HOH HOH A . 
H 7 HOH 496 2496 2496 HOH HOH A . 
H 7 HOH 497 2497 2497 HOH HOH A . 
H 7 HOH 498 2498 2498 HOH HOH A . 
H 7 HOH 499 2499 2499 HOH HOH A . 
I 7 HOH 1   2001 2001 HOH HOH P . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     180 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      196 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2810  ? 
1 MORE         -20.9 ? 
1 'SSA (A^2)'  25030 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 351 ? A HIS 367 ? 1_555 ZN ? D ZN . ? A ZN 1615 ? 1_555 NE2 ? A HIS 355 ? A HIS 371 ? 1_555 102.6 ? 
2 NE2 ? A HIS 351 ? A HIS 367 ? 1_555 ZN ? D ZN . ? A ZN 1615 ? 1_555 OE1 ? A GLU 379 ? A GLU 395 ? 1_555 94.4  ? 
3 NE2 ? A HIS 355 ? A HIS 371 ? 1_555 ZN ?