data_4B18
# 
_entry.id   4B18 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4B18         
PDBE  EBI-53260    
WWPDB D_1290053260 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2BCK unspecified 'CRYSTAL STRUCTURE OF HLA-A*2402 COMPLEXED WITH A TELOMERASE PEPTIDE'                                 
PDB 2JDQ unspecified 'C-TERMINAL DOMAIN OF INFLUENZA A VIRUS POLYMERASE PB2 SUBUNIT IN COMPLEX WITH HUMAN IMPORTIN ALPHA5' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4B18 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-08 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kim, K.L.' 1 
'Yoo, J.H.' 2 
'Cho, H.S.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Akt-Mediated Phosphorylation Increases the Binding Affinity of Htert for Importin Alpha to Promote Nuclear Translocation.' 
_citation.journal_abbrev            J.Cell.Sci. 
_citation.journal_volume            128 
_citation.page_first                2287 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           0021-9533 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25999477 
_citation.pdbx_database_id_DOI      10.1242/JCS.166132 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jeong, S.A.' 1 
primary 'Kim, K.'     2 
primary 'Lee, J.H.'   3 
primary 'Cha, J.S.'   4 
primary 'Khadka, P.'  5 
primary 'Cho, H.'     6 
primary 'Chung, I.K.' 7 
# 
_cell.entry_id           4B18 
_cell.length_a           159.723 
_cell.length_b           59.916 
_cell.length_c           69.331 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.29 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4B18 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'IMPORTIN SUBUNIT ALPHA-1'         49401.328 1  ?        ? 'RESIDUES 66-512'                    ? 
2 polymer syn 'TELOMERASE REVERSE TRANSCRIPTASE' 2282.704  1  2.7.7.49 ? 'TERT NLS PEPTIDE, RESIDUES 222-240' ? 
3 water   nat water                              18.015    14 ?        ? ?                                    ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'KARYOPHERIN SUBUNIT ALPHA-1, NUCLEOPROTEIN INTERACTOR 1, NPI-1, RAG COHORT PROTEIN 2, SRP1-BETA' 
2 'HEST2, TELOMERASE CATALYTIC SUBUNIT, TELOMERASE-ASSOCIATED PROTEIN 2, TP2'                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF
ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNR
LTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL
MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPAL
ISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGI
NPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSS
;
;GFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQF
ESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNR
LTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELL
MHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPAL
ISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGI
NPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSS
;
A ? 
2 'polypeptide(L)' no no RRRGGSASRSLPLPKRPRRA RRRGGSASRSLPLPKRPRRA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PHE n 
1 3   HIS n 
1 4   GLU n 
1 5   ALA n 
1 6   GLN n 
1 7   ILE n 
1 8   SER n 
1 9   ASN n 
1 10  MET n 
1 11  GLU n 
1 12  MET n 
1 13  ALA n 
1 14  PRO n 
1 15  GLY n 
1 16  GLY n 
1 17  VAL n 
1 18  ILE n 
1 19  THR n 
1 20  SER n 
1 21  ASP n 
1 22  MET n 
1 23  ILE n 
1 24  GLU n 
1 25  MET n 
1 26  ILE n 
1 27  PHE n 
1 28  SER n 
1 29  LYS n 
1 30  SER n 
1 31  PRO n 
1 32  GLU n 
1 33  GLN n 
1 34  GLN n 
1 35  LEU n 
1 36  SER n 
1 37  ALA n 
1 38  THR n 
1 39  GLN n 
1 40  LYS n 
1 41  PHE n 
1 42  ARG n 
1 43  LYS n 
1 44  LEU n 
1 45  LEU n 
1 46  SER n 
1 47  LYS n 
1 48  GLU n 
1 49  PRO n 
1 50  ASN n 
1 51  PRO n 
1 52  PRO n 
1 53  ILE n 
1 54  ASP n 
1 55  GLU n 
1 56  VAL n 
1 57  ILE n 
1 58  SER n 
1 59  THR n 
1 60  PRO n 
1 61  GLY n 
1 62  VAL n 
1 63  VAL n 
1 64  ALA n 
1 65  ARG n 
1 66  PHE n 
1 67  VAL n 
1 68  GLU n 
1 69  PHE n 
1 70  LEU n 
1 71  LYS n 
1 72  ARG n 
1 73  LYS n 
1 74  GLU n 
1 75  ASN n 
1 76  CYS n 
1 77  THR n 
1 78  LEU n 
1 79  GLN n 
1 80  PHE n 
1 81  GLU n 
1 82  SER n 
1 83  ALA n 
1 84  TRP n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  ASN n 
1 89  ILE n 
1 90  ALA n 
1 91  SER n 
1 92  GLY n 
1 93  ASN n 
1 94  SER n 
1 95  LEU n 
1 96  GLN n 
1 97  THR n 
1 98  ARG n 
1 99  ILE n 
1 100 VAL n 
1 101 ILE n 
1 102 GLN n 
1 103 ALA n 
1 104 GLY n 
1 105 ALA n 
1 106 VAL n 
1 107 PRO n 
1 108 ILE n 
1 109 PHE n 
1 110 ILE n 
1 111 GLU n 
1 112 LEU n 
1 113 LEU n 
1 114 SER n 
1 115 SER n 
1 116 GLU n 
1 117 PHE n 
1 118 GLU n 
1 119 ASP n 
1 120 VAL n 
1 121 GLN n 
1 122 GLU n 
1 123 GLN n 
1 124 ALA n 
1 125 VAL n 
1 126 TRP n 
1 127 ALA n 
1 128 LEU n 
1 129 GLY n 
1 130 ASN n 
1 131 ILE n 
1 132 ALA n 
1 133 GLY n 
1 134 ASP n 
1 135 SER n 
1 136 THR n 
1 137 MET n 
1 138 CYS n 
1 139 ARG n 
1 140 ASP n 
1 141 TYR n 
1 142 VAL n 
1 143 LEU n 
1 144 ASP n 
1 145 CYS n 
1 146 ASN n 
1 147 ILE n 
1 148 LEU n 
1 149 PRO n 
1 150 PRO n 
1 151 LEU n 
1 152 LEU n 
1 153 GLN n 
1 154 LEU n 
1 155 PHE n 
1 156 SER n 
1 157 LYS n 
1 158 GLN n 
1 159 ASN n 
1 160 ARG n 
1 161 LEU n 
1 162 THR n 
1 163 MET n 
1 164 THR n 
1 165 ARG n 
1 166 ASN n 
1 167 ALA n 
1 168 VAL n 
1 169 TRP n 
1 170 ALA n 
1 171 LEU n 
1 172 SER n 
1 173 ASN n 
1 174 LEU n 
1 175 CYS n 
1 176 ARG n 
1 177 GLY n 
1 178 LYS n 
1 179 SER n 
1 180 PRO n 
1 181 PRO n 
1 182 PRO n 
1 183 GLU n 
1 184 PHE n 
1 185 ALA n 
1 186 LYS n 
1 187 VAL n 
1 188 SER n 
1 189 PRO n 
1 190 CYS n 
1 191 LEU n 
1 192 ASN n 
1 193 VAL n 
1 194 LEU n 
1 195 SER n 
1 196 TRP n 
1 197 LEU n 
1 198 LEU n 
1 199 PHE n 
1 200 VAL n 
1 201 SER n 
1 202 ASP n 
1 203 THR n 
1 204 ASP n 
1 205 VAL n 
1 206 LEU n 
1 207 ALA n 
1 208 ASP n 
1 209 ALA n 
1 210 CYS n 
1 211 TRP n 
1 212 ALA n 
1 213 LEU n 
1 214 SER n 
1 215 TYR n 
1 216 LEU n 
1 217 SER n 
1 218 ASP n 
1 219 GLY n 
1 220 PRO n 
1 221 ASN n 
1 222 ASP n 
1 223 LYS n 
1 224 ILE n 
1 225 GLN n 
1 226 ALA n 
1 227 VAL n 
1 228 ILE n 
1 229 ASP n 
1 230 ALA n 
1 231 GLY n 
1 232 VAL n 
1 233 CYS n 
1 234 ARG n 
1 235 ARG n 
1 236 LEU n 
1 237 VAL n 
1 238 GLU n 
1 239 LEU n 
1 240 LEU n 
1 241 MET n 
1 242 HIS n 
1 243 ASN n 
1 244 ASP n 
1 245 TYR n 
1 246 LYS n 
1 247 VAL n 
1 248 VAL n 
1 249 SER n 
1 250 PRO n 
1 251 ALA n 
1 252 LEU n 
1 253 ARG n 
1 254 ALA n 
1 255 VAL n 
1 256 GLY n 
1 257 ASN n 
1 258 ILE n 
1 259 VAL n 
1 260 THR n 
1 261 GLY n 
1 262 ASP n 
1 263 ASP n 
1 264 ILE n 
1 265 GLN n 
1 266 THR n 
1 267 GLN n 
1 268 VAL n 
1 269 ILE n 
1 270 LEU n 
1 271 ASN n 
1 272 CYS n 
1 273 SER n 
1 274 ALA n 
1 275 LEU n 
1 276 GLN n 
1 277 SER n 
1 278 LEU n 
1 279 LEU n 
1 280 HIS n 
1 281 LEU n 
1 282 LEU n 
1 283 SER n 
1 284 SER n 
1 285 PRO n 
1 286 LYS n 
1 287 GLU n 
1 288 SER n 
1 289 ILE n 
1 290 LYS n 
1 291 LYS n 
1 292 GLU n 
1 293 ALA n 
1 294 CYS n 
1 295 TRP n 
1 296 THR n 
1 297 ILE n 
1 298 SER n 
1 299 ASN n 
1 300 ILE n 
1 301 THR n 
1 302 ALA n 
1 303 GLY n 
1 304 ASN n 
1 305 ARG n 
1 306 ALA n 
1 307 GLN n 
1 308 ILE n 
1 309 GLN n 
1 310 THR n 
1 311 VAL n 
1 312 ILE n 
1 313 ASP n 
1 314 ALA n 
1 315 ASN n 
1 316 ILE n 
1 317 PHE n 
1 318 PRO n 
1 319 ALA n 
1 320 LEU n 
1 321 ILE n 
1 322 SER n 
1 323 ILE n 
1 324 LEU n 
1 325 GLN n 
1 326 THR n 
1 327 ALA n 
1 328 GLU n 
1 329 PHE n 
1 330 ARG n 
1 331 THR n 
1 332 ARG n 
1 333 LYS n 
1 334 GLU n 
1 335 ALA n 
1 336 ALA n 
1 337 TRP n 
1 338 ALA n 
1 339 ILE n 
1 340 THR n 
1 341 ASN n 
1 342 ALA n 
1 343 THR n 
1 344 SER n 
1 345 GLY n 
1 346 GLY n 
1 347 SER n 
1 348 ALA n 
1 349 GLU n 
1 350 GLN n 
1 351 ILE n 
1 352 LYS n 
1 353 TYR n 
1 354 LEU n 
1 355 VAL n 
1 356 GLU n 
1 357 LEU n 
1 358 GLY n 
1 359 CYS n 
1 360 ILE n 
1 361 LYS n 
1 362 PRO n 
1 363 LEU n 
1 364 CYS n 
1 365 ASP n 
1 366 LEU n 
1 367 LEU n 
1 368 THR n 
1 369 VAL n 
1 370 MET n 
1 371 ASP n 
1 372 SER n 
1 373 LYS n 
1 374 ILE n 
1 375 VAL n 
1 376 GLN n 
1 377 VAL n 
1 378 ALA n 
1 379 LEU n 
1 380 ASN n 
1 381 GLY n 
1 382 LEU n 
1 383 GLU n 
1 384 ASN n 
1 385 ILE n 
1 386 LEU n 
1 387 ARG n 
1 388 LEU n 
1 389 GLY n 
1 390 GLU n 
1 391 GLN n 
1 392 GLU n 
1 393 ALA n 
1 394 LYS n 
1 395 ARG n 
1 396 ASN n 
1 397 GLY n 
1 398 THR n 
1 399 GLY n 
1 400 ILE n 
1 401 ASN n 
1 402 PRO n 
1 403 TYR n 
1 404 CYS n 
1 405 ALA n 
1 406 LEU n 
1 407 ILE n 
1 408 GLU n 
1 409 GLU n 
1 410 ALA n 
1 411 TYR n 
1 412 GLY n 
1 413 LEU n 
1 414 ASP n 
1 415 LYS n 
1 416 ILE n 
1 417 GLU n 
1 418 PHE n 
1 419 LEU n 
1 420 GLN n 
1 421 SER n 
1 422 HIS n 
1 423 GLU n 
1 424 ASN n 
1 425 GLN n 
1 426 GLU n 
1 427 ILE n 
1 428 TYR n 
1 429 GLN n 
1 430 LYS n 
1 431 ALA n 
1 432 PHE n 
1 433 ASP n 
1 434 LEU n 
1 435 ILE n 
1 436 GLU n 
1 437 HIS n 
1 438 TYR n 
1 439 PHE n 
1 440 GLY n 
1 441 THR n 
1 442 GLU n 
1 443 ASP n 
1 444 GLU n 
1 445 ASP n 
1 446 SER n 
1 447 SER n 
2 1   ARG n 
2 2   ARG n 
2 3   ARG n 
2 4   GLY n 
2 5   GLY n 
2 6   SER n 
2 7   ALA n 
2 8   SER n 
2 9   ARG n 
2 10  SER n 
2 11  LEU n 
2 12  PRO n 
2 13  LEU n 
2 14  PRO n 
2 15  LYS n 
2 16  ARG n 
2 17  PRO n 
2 18  ARG n 
2 19  ARG n 
2 20  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'CODON PLUS' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET-28A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP IMA1_HUMAN 1 ? ? P52294 ? 
2 UNP TERT_HUMAN 2 ? ? O14746 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4B18 A 1 ? 447 ? P52294 66  ? 512 ? 66  512 
2 2 4B18 B 1 ? 19  ? O14746 222 ? 240 ? 222 240 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             4B18 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      20 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O14746 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            241 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4B18 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_percent_sol   61.44 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77.15 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4r' 
_diffrn_detector.pdbx_collection_date   2012-06-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4B18 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.56 
_reflns.number_obs                   21441 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.3 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.56 
_reflns_shell.d_res_low              2.56 
_reflns_shell.percent_possible_all   96.3 
_reflns_shell.Rmerge_I_obs           0.04 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        4.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4B18 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     20339 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             70.00 
_refine.ls_d_res_high                            2.52 
_refine.ls_percent_reflns_obs                    96.17 
_refine.ls_R_factor_obs                          0.20101 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19818 
_refine.ls_R_factor_R_free                       0.25270 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1101 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.B_iso_mean                               60.958 
_refine.aniso_B[1][1]                            -0.90 
_refine.aniso_B[2][2]                            3.61 
_refine.aniso_B[3][3]                            -2.95 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.13 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2JDQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.376 
_refine.pdbx_overall_ESU_R_Free                  0.271 
_refine.overall_SU_ML                            0.197 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.026 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3450 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               3464 
_refine_hist.d_res_high                       2.52 
_refine_hist.d_res_low                        70.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.019  ? 3510 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.935  1.971  ? 4762 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.794  5.000  ? 440  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.468 24.702 ? 151  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       22.755 15.000 ? 624  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       22.558 15.000 ? 23   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.128  0.200  ? 558  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.011  0.021  ? 2598 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.520 
_refine_ls_shell.d_res_low                        2.585 
_refine_ls_shell.number_reflns_R_work             1272 
_refine_ls_shell.R_factor_R_work                  0.259 
_refine_ls_shell.percent_reflns_obs               86.02 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             76 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4B18 
_struct.title                     'The crystal structure of human Importin alpha 5 with TERT NLS peptide' 
_struct.pdbx_descriptor           'IMPORTIN SUBUNIT ALPHA-1, TELOMERASE REVERSE TRANSCRIPTASE (E.C.2.7.7.49)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4B18 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN / PEPTIDE' 
_struct_keywords.text            'TRANSPORT PROTEIN - PEPTIDE COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 19  ? PHE A 27  ? THR A 84  PHE A 92  1 ? 9  
HELX_P HELX_P2  2  SER A 30  ? LYS A 47  ? SER A 95  LYS A 112 1 ? 18 
HELX_P HELX_P3  3  PRO A 52  ? SER A 58  ? PRO A 117 SER A 123 1 ? 7  
HELX_P HELX_P4  4  GLY A 61  ? LEU A 70  ? GLY A 126 LEU A 135 1 ? 10 
HELX_P HELX_P5  5  ASN A 75  ? ALA A 90  ? ASN A 140 ALA A 155 1 ? 16 
HELX_P HELX_P6  6  ASN A 93  ? ALA A 103 ? ASN A 158 ALA A 168 1 ? 11 
HELX_P HELX_P7  7  GLY A 104 ? LEU A 113 ? GLY A 169 LEU A 178 1 ? 10 
HELX_P HELX_P8  8  PHE A 117 ? GLY A 133 ? PHE A 182 GLY A 198 1 ? 17 
HELX_P HELX_P9  9  SER A 135 ? CYS A 145 ? SER A 200 CYS A 210 1 ? 11 
HELX_P HELX_P10 10 ILE A 147 ? LEU A 154 ? ILE A 212 LEU A 219 1 ? 8  
HELX_P HELX_P11 11 PHE A 155 ? LYS A 157 ? PHE A 220 LYS A 222 5 ? 3  
HELX_P HELX_P12 12 ARG A 160 ? ARG A 176 ? ARG A 225 ARG A 241 1 ? 17 
HELX_P HELX_P13 13 GLU A 183 ? SER A 188 ? GLU A 248 SER A 253 1 ? 6  
HELX_P HELX_P14 14 CYS A 190 ? LEU A 198 ? CYS A 255 LEU A 263 1 ? 9  
HELX_P HELX_P15 15 ASP A 202 ? SER A 217 ? ASP A 267 SER A 282 1 ? 16 
HELX_P HELX_P16 16 PRO A 220 ? ALA A 230 ? PRO A 285 ALA A 295 1 ? 11 
HELX_P HELX_P17 17 VAL A 232 ? LEU A 240 ? VAL A 297 LEU A 305 1 ? 9  
HELX_P HELX_P18 18 ASP A 244 ? VAL A 259 ? ASP A 309 VAL A 324 1 ? 16 
HELX_P HELX_P19 19 ASP A 262 ? CYS A 272 ? ASP A 327 CYS A 337 1 ? 11 
HELX_P HELX_P20 20 SER A 273 ? LEU A 282 ? SER A 338 LEU A 347 1 ? 10 
HELX_P HELX_P21 21 LYS A 286 ? THR A 301 ? LYS A 351 THR A 366 1 ? 16 
HELX_P HELX_P22 22 ASN A 304 ? ALA A 314 ? ASN A 369 ALA A 379 1 ? 11 
HELX_P HELX_P23 23 ASN A 315 ? ALA A 327 ? ASN A 380 ALA A 392 1 ? 13 
HELX_P HELX_P24 24 GLU A 328 ? GLY A 346 ? GLU A 393 GLY A 411 1 ? 19 
HELX_P HELX_P25 25 SER A 347 ? GLY A 358 ? SER A 412 GLY A 423 1 ? 12 
HELX_P HELX_P26 26 CYS A 359 ? LEU A 366 ? CYS A 424 LEU A 431 1 ? 8  
HELX_P HELX_P27 27 LEU A 367 ? VAL A 369 ? LEU A 432 VAL A 434 5 ? 3  
HELX_P HELX_P28 28 ASP A 371 ? ASN A 396 ? ASP A 436 ASN A 461 1 ? 26 
HELX_P HELX_P29 29 ASN A 401 ? ALA A 410 ? ASN A 466 ALA A 475 1 ? 10 
HELX_P HELX_P30 30 TYR A 411 ? LEU A 419 ? TYR A 476 LEU A 484 1 ? 9  
HELX_P HELX_P31 31 GLN A 420 ? HIS A 422 ? GLN A 485 HIS A 487 5 ? 3  
HELX_P HELX_P32 32 ASN A 424 ? PHE A 439 ? ASN A 489 PHE A 504 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 14  A . ? PRO 79  A GLY 15  A ? GLY 80  A 1 -4.29 
2 SER 179 A . ? SER 244 A PRO 180 A ? PRO 245 A 1 -6.70 
# 
_database_PDB_matrix.entry_id          4B18 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4B18 
_atom_sites.fract_transf_matrix[1][1]   0.006261 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000690 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016690 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014511 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 14  ? 13.473 -26.721 -13.614 1.00 102.57 ? 79   PRO A N   1 
ATOM   2    C CA  . PRO A 1 14  ? 13.310 -25.286 -13.269 1.00 100.17 ? 79   PRO A CA  1 
ATOM   3    C C   . PRO A 1 14  ? 12.111 -24.585 -13.970 1.00 103.10 ? 79   PRO A C   1 
ATOM   4    O O   . PRO A 1 14  ? 12.207 -24.337 -15.189 1.00 100.94 ? 79   PRO A O   1 
ATOM   5    C CB  . PRO A 1 14  ? 14.663 -24.670 -13.708 1.00 88.22  ? 79   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 14  ? 15.649 -25.840 -13.729 1.00 95.64  ? 79   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 14  ? 14.888 -27.152 -13.518 1.00 86.28  ? 79   PRO A CD  1 
ATOM   8    N N   . GLY A 1 15  ? 10.995 -24.272 -13.271 1.00 95.68  ? 80   GLY A N   1 
ATOM   9    C CA  . GLY A 1 15  ? 10.685 -24.589 -11.858 1.00 93.73  ? 80   GLY A CA  1 
ATOM   10   C C   . GLY A 1 15  ? 10.404 -26.069 -11.575 1.00 107.63 ? 80   GLY A C   1 
ATOM   11   O O   . GLY A 1 15  ? 10.026 -26.844 -12.467 1.00 103.42 ? 80   GLY A O   1 
ATOM   12   N N   . GLY A 1 16  ? 10.583 -26.456 -10.314 1.00 110.96 ? 81   GLY A N   1 
ATOM   13   C CA  . GLY A 1 16  ? 10.843 -27.864 -9.956  1.00 108.02 ? 81   GLY A CA  1 
ATOM   14   C C   . GLY A 1 16  ? 12.287 -28.193 -9.519  1.00 100.29 ? 81   GLY A C   1 
ATOM   15   O O   . GLY A 1 16  ? 12.654 -29.362 -9.494  1.00 81.04  ? 81   GLY A O   1 
ATOM   16   N N   . VAL A 1 17  ? 13.092 -27.152 -9.217  1.00 110.24 ? 82   VAL A N   1 
ATOM   17   C CA  . VAL A 1 17  ? 14.418 -27.179 -8.508  1.00 94.47  ? 82   VAL A CA  1 
ATOM   18   C C   . VAL A 1 17  ? 14.222 -27.267 -6.943  1.00 101.34 ? 82   VAL A C   1 
ATOM   19   O O   . VAL A 1 17  ? 15.188 -27.328 -6.145  1.00 84.60  ? 82   VAL A O   1 
ATOM   20   C CB  . VAL A 1 17  ? 15.243 -25.919 -8.892  1.00 91.32  ? 82   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 17  ? 16.469 -25.752 -8.000  1.00 96.89  ? 82   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 17  ? 15.623 -25.907 -10.374 1.00 82.52  ? 82   VAL A CG2 1 
ATOM   23   N N   . ILE A 1 18  ? 12.946 -27.283 -6.567  1.00 101.22 ? 83   ILE A N   1 
ATOM   24   C CA  . ILE A 1 18  ? 12.456 -27.734 -5.292  1.00 84.76  ? 83   ILE A CA  1 
ATOM   25   C C   . ILE A 1 18  ? 11.378 -28.768 -5.640  1.00 94.12  ? 83   ILE A C   1 
ATOM   26   O O   . ILE A 1 18  ? 10.580 -28.564 -6.550  1.00 86.25  ? 83   ILE A O   1 
ATOM   27   C CB  . ILE A 1 18  ? 11.794 -26.603 -4.539  1.00 90.52  ? 83   ILE A CB  1 
ATOM   28   C CG1 . ILE A 1 18  ? 10.285 -26.644 -4.766  1.00 99.24  ? 83   ILE A CG1 1 
ATOM   29   C CG2 . ILE A 1 18  ? 12.327 -25.283 -5.034  1.00 92.84  ? 83   ILE A CG2 1 
ATOM   30   C CD1 . ILE A 1 18  ? 9.861  -26.409 -6.209  1.00 86.22  ? 83   ILE A CD1 1 
ATOM   31   N N   . THR A 1 19  ? 11.349 -29.865 -4.905  1.00 91.53  ? 84   THR A N   1 
ATOM   32   C CA  . THR A 1 19  ? 10.611 -31.059 -5.272  1.00 77.87  ? 84   THR A CA  1 
ATOM   33   C C   . THR A 1 19  ? 9.143  -30.788 -5.437  1.00 79.04  ? 84   THR A C   1 
ATOM   34   O O   . THR A 1 19  ? 8.548  -30.028 -4.697  1.00 79.31  ? 84   THR A O   1 
ATOM   35   C CB  . THR A 1 19  ? 10.658 -32.066 -4.113  1.00 84.06  ? 84   THR A CB  1 
ATOM   36   O OG1 . THR A 1 19  ? 11.373 -33.233 -4.497  1.00 87.90  ? 84   THR A OG1 1 
ATOM   37   C CG2 . THR A 1 19  ? 9.242  -32.458 -3.675  1.00 87.52  ? 84   THR A CG2 1 
ATOM   38   N N   . SER A 1 20  ? 8.547  -31.445 -6.397  1.00 74.47  ? 85   SER A N   1 
ATOM   39   C CA  . SER A 1 20  ? 7.124  -31.516 -6.437  1.00 76.13  ? 85   SER A CA  1 
ATOM   40   C C   . SER A 1 20  ? 6.683  -32.260 -5.184  1.00 71.85  ? 85   SER A C   1 
ATOM   41   O O   . SER A 1 20  ? 5.639  -31.991 -4.634  1.00 76.72  ? 85   SER A O   1 
ATOM   42   C CB  . SER A 1 20  ? 6.692  -32.266 -7.685  1.00 76.56  ? 85   SER A CB  1 
ATOM   43   O OG  . SER A 1 20  ? 5.803  -33.302 -7.356  1.00 81.13  ? 85   SER A OG  1 
ATOM   44   N N   . ASP A 1 21  ? 7.483  -33.228 -4.766  1.00 75.97  ? 86   ASP A N   1 
ATOM   45   C CA  . ASP A 1 21  ? 7.181  -34.074 -3.595  1.00 72.37  ? 86   ASP A CA  1 
ATOM   46   C C   . ASP A 1 21  ? 7.359  -33.290 -2.280  1.00 72.63  ? 86   ASP A C   1 
ATOM   47   O O   . ASP A 1 21  ? 6.666  -33.545 -1.290  1.00 76.82  ? 86   ASP A O   1 
ATOM   48   C CB  . ASP A 1 21  ? 8.025  -35.390 -3.605  1.00 82.00  ? 86   ASP A CB  1 
ATOM   49   C CG  . ASP A 1 21  ? 8.263  -35.934 -5.031  1.00 87.95  ? 86   ASP A CG  1 
ATOM   50   O OD1 . ASP A 1 21  ? 8.859  -35.221 -5.875  1.00 92.52  ? 86   ASP A OD1 1 
ATOM   51   O OD2 . ASP A 1 21  ? 7.844  -37.067 -5.333  1.00 87.12  ? 86   ASP A OD2 1 
ATOM   52   N N   . MET A 1 22  ? 8.275  -32.320 -2.283  1.00 72.10  ? 87   MET A N   1 
ATOM   53   C CA  . MET A 1 22  ? 8.472  -31.445 -1.132  1.00 67.23  ? 87   MET A CA  1 
ATOM   54   C C   . MET A 1 22  ? 7.216  -30.660 -0.805  1.00 61.38  ? 87   MET A C   1 
ATOM   55   O O   . MET A 1 22  ? 6.871  -30.545 0.375   1.00 58.49  ? 87   MET A O   1 
ATOM   56   C CB  . MET A 1 22  ? 9.625  -30.479 -1.361  1.00 60.52  ? 87   MET A CB  1 
ATOM   57   C CG  . MET A 1 22  ? 11.005 -31.058 -1.069  1.00 70.71  ? 87   MET A CG  1 
ATOM   58   S SD  . MET A 1 22  ? 12.276 -30.312 -2.136  1.00 68.92  ? 87   MET A SD  1 
ATOM   59   C CE  . MET A 1 22  ? 12.333 -28.667 -1.440  1.00 58.67  ? 87   MET A CE  1 
ATOM   60   N N   . ILE A 1 23  ? 6.558  -30.094 -1.827  1.00 63.48  ? 88   ILE A N   1 
ATOM   61   C CA  . ILE A 1 23  ? 5.265  -29.405 -1.633  1.00 61.62  ? 88   ILE A CA  1 
ATOM   62   C C   . ILE A 1 23  ? 4.254  -30.421 -1.077  1.00 60.83  ? 88   ILE A C   1 
ATOM   63   O O   . ILE A 1 23  ? 3.623  -30.188 -0.040  1.00 64.51  ? 88   ILE A O   1 
ATOM   64   C CB  . ILE A 1 23  ? 4.697  -28.765 -2.923  1.00 64.50  ? 88   ILE A CB  1 
ATOM   65   C CG1 . ILE A 1 23  ? 5.621  -27.670 -3.493  1.00 61.41  ? 88   ILE A CG1 1 
ATOM   66   C CG2 . ILE A 1 23  ? 3.267  -28.262 -2.696  1.00 61.08  ? 88   ILE A CG2 1 
ATOM   67   C CD1 . ILE A 1 23  ? 6.256  -26.789 -2.449  1.00 66.68  ? 88   ILE A CD1 1 
ATOM   68   N N   . GLU A 1 24  ? 4.158  -31.566 -1.737  1.00 59.07  ? 89   GLU A N   1 
ATOM   69   C CA  . GLU A 1 24  ? 3.256  -32.638 -1.303  1.00 62.94  ? 89   GLU A CA  1 
ATOM   70   C C   . GLU A 1 24  ? 3.459  -33.047 0.166   1.00 66.24  ? 89   GLU A C   1 
ATOM   71   O O   . GLU A 1 24  ? 2.487  -33.260 0.920   1.00 69.01  ? 89   GLU A O   1 
ATOM   72   C CB  . GLU A 1 24  ? 3.376  -33.854 -2.235  1.00 61.36  ? 89   GLU A CB  1 
ATOM   73   C CG  . GLU A 1 24  ? 2.539  -35.059 -1.777  1.00 79.33  ? 89   GLU A CG  1 
ATOM   74   C CD  . GLU A 1 24  ? 2.268  -36.108 -2.868  1.00 82.06  ? 89   GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 24  ? 2.731  -35.955 -4.029  1.00 85.25  ? 89   GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 24  ? 1.584  -37.105 -2.550  1.00 80.71  ? 89   GLU A OE2 1 
ATOM   77   N N   . MET A 1 25  ? 4.717  -33.149 0.584   1.00 64.86  ? 90   MET A N   1 
ATOM   78   C CA  . MET A 1 25  ? 4.997  -33.602 1.950   1.00 65.33  ? 90   MET A CA  1 
ATOM   79   C C   . MET A 1 25  ? 4.774  -32.507 2.982   1.00 66.72  ? 90   MET A C   1 
ATOM   80   O O   . MET A 1 25  ? 4.136  -32.718 4.040   1.00 60.90  ? 90   MET A O   1 
ATOM   81   C CB  . MET A 1 25  ? 6.380  -34.207 2.025   1.00 65.22  ? 90   MET A CB  1 
ATOM   82   C CG  . MET A 1 25  ? 6.492  -35.405 1.104   1.00 69.40  ? 90   MET A CG  1 
ATOM   83   S SD  . MET A 1 25  ? 8.068  -36.271 1.230   1.00 85.57  ? 90   MET A SD  1 
ATOM   84   C CE  . MET A 1 25  ? 7.796  -37.489 -0.092  1.00 94.26  ? 90   MET A CE  1 
ATOM   85   N N   . ILE A 1 26  ? 5.265  -31.317 2.638   1.00 62.81  ? 91   ILE A N   1 
ATOM   86   C CA  . ILE A 1 26  ? 5.067  -30.136 3.453   1.00 60.96  ? 91   ILE A CA  1 
ATOM   87   C C   . ILE A 1 26  ? 3.583  -30.000 3.773   1.00 56.42  ? 91   ILE A C   1 
ATOM   88   O O   . ILE A 1 26  ? 3.186  -29.760 4.920   1.00 54.63  ? 91   ILE A O   1 
ATOM   89   C CB  . ILE A 1 26  ? 5.663  -28.917 2.715   1.00 68.16  ? 91   ILE A CB  1 
ATOM   90   C CG1 . ILE A 1 26  ? 6.936  -28.503 3.398   1.00 72.13  ? 91   ILE A CG1 1 
ATOM   91   C CG2 . ILE A 1 26  ? 4.782  -27.685 2.736   1.00 66.82  ? 91   ILE A CG2 1 
ATOM   92   C CD1 . ILE A 1 26  ? 7.309  -27.096 3.008   1.00 86.98  ? 91   ILE A CD1 1 
ATOM   93   N N   . PHE A 1 27  ? 2.748  -30.185 2.760   1.00 61.32  ? 92   PHE A N   1 
ATOM   94   C CA  . PHE A 1 27  ? 1.326  -30.013 2.979   1.00 63.79  ? 92   PHE A CA  1 
ATOM   95   C C   . PHE A 1 27  ? 0.569  -31.254 3.466   1.00 66.90  ? 92   PHE A C   1 
ATOM   96   O O   . PHE A 1 27  ? -0.654 -31.189 3.642   1.00 74.24  ? 92   PHE A O   1 
ATOM   97   C CB  . PHE A 1 27  ? 0.663  -29.391 1.755   1.00 65.08  ? 92   PHE A CB  1 
ATOM   98   C CG  . PHE A 1 27  ? 0.976  -27.945 1.590   1.00 61.82  ? 92   PHE A CG  1 
ATOM   99   C CD1 . PHE A 1 27  ? 0.369  -27.005 2.401   1.00 60.63  ? 92   PHE A CD1 1 
ATOM   100  C CD2 . PHE A 1 27  ? 1.895  -27.527 0.647   1.00 63.94  ? 92   PHE A CD2 1 
ATOM   101  C CE1 . PHE A 1 27  ? 0.654  -25.652 2.275   1.00 63.01  ? 92   PHE A CE1 1 
ATOM   102  C CE2 . PHE A 1 27  ? 2.202  -26.177 0.509   1.00 67.44  ? 92   PHE A CE2 1 
ATOM   103  C CZ  . PHE A 1 27  ? 1.579  -25.236 1.332   1.00 66.91  ? 92   PHE A CZ  1 
ATOM   104  N N   . SER A 1 28  ? 1.258  -32.367 3.717   1.00 63.87  ? 93   SER A N   1 
ATOM   105  C CA  . SER A 1 28  ? 0.512  -33.538 4.158   1.00 59.57  ? 93   SER A CA  1 
ATOM   106  C C   . SER A 1 28  ? 0.062  -33.517 5.623   1.00 66.30  ? 93   SER A C   1 
ATOM   107  O O   . SER A 1 28  ? 0.387  -32.571 6.392   1.00 62.89  ? 93   SER A O   1 
ATOM   108  C CB  . SER A 1 28  ? 1.127  -34.886 3.708   1.00 55.47  ? 93   SER A CB  1 
ATOM   109  O OG  . SER A 1 28  ? 2.462  -35.037 4.061   1.00 58.23  ? 93   SER A OG  1 
ATOM   110  N N   . LYS A 1 29  ? -0.762 -34.531 5.924   1.00 69.48  ? 94   LYS A N   1 
ATOM   111  C CA  . LYS A 1 29  ? -1.300 -34.890 7.235   1.00 78.67  ? 94   LYS A CA  1 
ATOM   112  C C   . LYS A 1 29  ? -0.185 -35.388 8.151   1.00 75.81  ? 94   LYS A C   1 
ATOM   113  O O   . LYS A 1 29  ? -0.184 -35.092 9.355   1.00 75.54  ? 94   LYS A O   1 
ATOM   114  C CB  . LYS A 1 29  ? -2.334 -36.045 7.070   1.00 88.34  ? 94   LYS A CB  1 
ATOM   115  C CG  . LYS A 1 29  ? -3.815 -35.740 7.306   1.00 87.24  ? 94   LYS A CG  1 
ATOM   116  C CD  . LYS A 1 29  ? -4.277 -36.196 8.696   1.00 101.93 ? 94   LYS A CD  1 
ATOM   117  C CE  . LYS A 1 29  ? -4.017 -35.144 9.784   1.00 101.36 ? 94   LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 29  ? -3.519 -35.707 11.076  1.00 93.41  ? 94   LYS A NZ  1 
ATOM   119  N N   . SER A 1 30  ? 0.742  -36.163 7.577   1.00 70.51  ? 95   SER A N   1 
ATOM   120  C CA  . SER A 1 30  ? 1.790  -36.880 8.343   1.00 73.59  ? 95   SER A CA  1 
ATOM   121  C C   . SER A 1 30  ? 2.938  -36.027 8.941   1.00 80.57  ? 95   SER A C   1 
ATOM   122  O O   . SER A 1 30  ? 3.641  -35.292 8.226   1.00 79.64  ? 95   SER A O   1 
ATOM   123  C CB  . SER A 1 30  ? 2.388  -37.972 7.470   1.00 68.49  ? 95   SER A CB  1 
ATOM   124  O OG  . SER A 1 30  ? 3.714  -38.255 7.863   1.00 82.48  ? 95   SER A OG  1 
ATOM   125  N N   . PRO A 1 31  ? 3.151  -36.142 10.256  1.00 84.54  ? 96   PRO A N   1 
ATOM   126  C CA  . PRO A 1 31  ? 4.258  -35.391 10.846  1.00 82.76  ? 96   PRO A CA  1 
ATOM   127  C C   . PRO A 1 31  ? 5.625  -35.781 10.259  1.00 78.90  ? 96   PRO A C   1 
ATOM   128  O O   . PRO A 1 31  ? 6.475  -34.914 10.078  1.00 78.46  ? 96   PRO A O   1 
ATOM   129  C CB  . PRO A 1 31  ? 4.165  -35.743 12.337  1.00 83.47  ? 96   PRO A CB  1 
ATOM   130  C CG  . PRO A 1 31  ? 2.725  -36.054 12.540  1.00 91.02  ? 96   PRO A CG  1 
ATOM   131  C CD  . PRO A 1 31  ? 2.286  -36.754 11.279  1.00 83.79  ? 96   PRO A CD  1 
ATOM   132  N N   . GLU A 1 32  ? 5.819  -37.057 9.938   1.00 84.61  ? 97   GLU A N   1 
ATOM   133  C CA  . GLU A 1 32  ? 7.122  -37.562 9.437   1.00 87.64  ? 97   GLU A CA  1 
ATOM   134  C C   . GLU A 1 32  ? 7.471  -36.943 8.080   1.00 81.57  ? 97   GLU A C   1 
ATOM   135  O O   . GLU A 1 32  ? 8.600  -36.499 7.852   1.00 84.92  ? 97   GLU A O   1 
ATOM   136  C CB  . GLU A 1 32  ? 7.188  -39.118 9.343   1.00 84.08  ? 97   GLU A CB  1 
ATOM   137  C CG  . GLU A 1 32  ? 6.152  -39.948 10.127  1.00 91.78  ? 97   GLU A CG  1 
ATOM   138  C CD  . GLU A 1 32  ? 5.904  -39.490 11.570  1.00 99.23  ? 97   GLU A CD  1 
ATOM   139  O OE1 . GLU A 1 32  ? 6.854  -39.072 12.262  1.00 95.39  ? 97   GLU A OE1 1 
ATOM   140  O OE2 . GLU A 1 32  ? 4.740  -39.543 12.022  1.00 99.04  ? 97   GLU A OE2 1 
ATOM   141  N N   . GLN A 1 33  ? 6.489  -36.917 7.193   1.00 71.63  ? 98   GLN A N   1 
ATOM   142  C CA  . GLN A 1 33  ? 6.665  -36.331 5.894   1.00 67.32  ? 98   GLN A CA  1 
ATOM   143  C C   . GLN A 1 33  ? 6.837  -34.831 6.004   1.00 68.13  ? 98   GLN A C   1 
ATOM   144  O O   . GLN A 1 33  ? 7.611  -34.261 5.256   1.00 60.20  ? 98   GLN A O   1 
ATOM   145  C CB  . GLN A 1 33  ? 5.461  -36.616 5.023   1.00 69.40  ? 98   GLN A CB  1 
ATOM   146  C CG  . GLN A 1 33  ? 5.191  -38.085 4.798   1.00 74.94  ? 98   GLN A CG  1 
ATOM   147  C CD  . GLN A 1 33  ? 4.652  -38.318 3.410   1.00 87.59  ? 98   GLN A CD  1 
ATOM   148  O OE1 . GLN A 1 33  ? 3.445  -38.317 3.207   1.00 83.78  ? 98   GLN A OE1 1 
ATOM   149  N NE2 . GLN A 1 33  ? 5.551  -38.467 2.428   1.00 94.88  ? 98   GLN A NE2 1 
ATOM   150  N N   . GLN A 1 34  ? 6.101  -34.187 6.911   1.00 65.34  ? 99   GLN A N   1 
ATOM   151  C CA  . GLN A 1 34  ? 6.221  -32.731 7.096   1.00 69.71  ? 99   GLN A CA  1 
ATOM   152  C C   . GLN A 1 34  ? 7.688  -32.365 7.445   1.00 73.74  ? 99   GLN A C   1 
ATOM   153  O O   . GLN A 1 34  ? 8.287  -31.438 6.877   1.00 59.55  ? 99   GLN A O   1 
ATOM   154  C CB  . GLN A 1 34  ? 5.263  -32.248 8.203   1.00 65.95  ? 99   GLN A CB  1 
ATOM   155  C CG  . GLN A 1 34  ? 3.785  -32.498 7.945   1.00 64.03  ? 99   GLN A CG  1 
ATOM   156  C CD  . GLN A 1 34  ? 2.898  -31.999 9.065   1.00 67.05  ? 99   GLN A CD  1 
ATOM   157  O OE1 . GLN A 1 34  ? 3.324  -31.922 10.217  1.00 53.34  ? 99   GLN A OE1 1 
ATOM   158  N NE2 . GLN A 1 34  ? 1.648  -31.636 8.721   1.00 65.97  ? 99   GLN A NE2 1 
ATOM   159  N N   . LEU A 1 35  ? 8.254  -33.133 8.374   1.00 65.66  ? 100  LEU A N   1 
ATOM   160  C CA  . LEU A 1 35  ? 9.609  -32.943 8.809   1.00 67.73  ? 100  LEU A CA  1 
ATOM   161  C C   . LEU A 1 35  ? 10.618 -33.286 7.709   1.00 69.41  ? 100  LEU A C   1 
ATOM   162  O O   . LEU A 1 35  ? 11.620 -32.591 7.514   1.00 68.07  ? 100  LEU A O   1 
ATOM   163  C CB  . LEU A 1 35  ? 9.859  -33.800 10.035  1.00 62.90  ? 100  LEU A CB  1 
ATOM   164  C CG  . LEU A 1 35  ? 11.256 -33.752 10.640  1.00 68.46  ? 100  LEU A CG  1 
ATOM   165  C CD1 . LEU A 1 35  ? 11.567 -32.367 11.238  1.00 63.93  ? 100  LEU A CD1 1 
ATOM   166  C CD2 . LEU A 1 35  ? 11.368 -34.878 11.666  1.00 61.77  ? 100  LEU A CD2 1 
ATOM   167  N N   . SER A 1 36  ? 10.356 -34.363 6.995   1.00 67.89  ? 101  SER A N   1 
ATOM   168  C CA  . SER A 1 36  ? 11.276 -34.811 5.981   1.00 68.72  ? 101  SER A CA  1 
ATOM   169  C C   . SER A 1 36  ? 11.459 -33.695 4.938   1.00 73.31  ? 101  SER A C   1 
ATOM   170  O O   . SER A 1 36  ? 12.578 -33.271 4.629   1.00 71.42  ? 101  SER A O   1 
ATOM   171  C CB  . SER A 1 36  ? 10.751 -36.093 5.358   1.00 69.11  ? 101  SER A CB  1 
ATOM   172  O OG  . SER A 1 36  ? 11.827 -36.908 4.981   1.00 84.81  ? 101  SER A OG  1 
ATOM   173  N N   . ALA A 1 37  ? 10.343 -33.189 4.435   1.00 74.30  ? 102  ALA A N   1 
ATOM   174  C CA  . ALA A 1 37  ? 10.356 -32.063 3.518   1.00 72.83  ? 102  ALA A CA  1 
ATOM   175  C C   . ALA A 1 37  ? 11.043 -30.839 4.137   1.00 65.63  ? 102  ALA A C   1 
ATOM   176  O O   . ALA A 1 37  ? 11.823 -30.145 3.482   1.00 68.89  ? 102  ALA A O   1 
ATOM   177  C CB  . ALA A 1 37  ? 8.933  -31.720 3.086   1.00 74.95  ? 102  ALA A CB  1 
ATOM   178  N N   . THR A 1 38  ? 10.725 -30.559 5.389   1.00 65.18  ? 103  THR A N   1 
ATOM   179  C CA  . THR A 1 38  ? 11.289 -29.405 6.048   1.00 64.27  ? 103  THR A CA  1 
ATOM   180  C C   . THR A 1 38  ? 12.792 -29.521 6.077   1.00 62.57  ? 103  THR A C   1 
ATOM   181  O O   . THR A 1 38  ? 13.493 -28.529 5.903   1.00 65.81  ? 103  THR A O   1 
ATOM   182  C CB  . THR A 1 38  ? 10.730 -29.218 7.461   1.00 63.21  ? 103  THR A CB  1 
ATOM   183  O OG1 . THR A 1 38  ? 9.311  -29.003 7.354   1.00 61.70  ? 103  THR A OG1 1 
ATOM   184  C CG2 . THR A 1 38  ? 11.384 -28.000 8.132   1.00 52.04  ? 103  THR A CG2 1 
ATOM   185  N N   . GLN A 1 39  ? 13.286 -30.737 6.237   1.00 56.16  ? 104  GLN A N   1 
ATOM   186  C CA  . GLN A 1 39  ? 14.712 -30.920 6.298   1.00 60.00  ? 104  GLN A CA  1 
ATOM   187  C C   . GLN A 1 39  ? 15.355 -30.638 4.931   1.00 64.07  ? 104  GLN A C   1 
ATOM   188  O O   . GLN A 1 39  ? 16.390 -29.943 4.849   1.00 62.54  ? 104  GLN A O   1 
ATOM   189  C CB  . GLN A 1 39  ? 15.050 -32.291 6.860   1.00 61.03  ? 104  GLN A CB  1 
ATOM   190  C CG  . GLN A 1 39  ? 14.896 -32.366 8.374   1.00 67.32  ? 104  GLN A CG  1 
ATOM   191  C CD  . GLN A 1 39  ? 14.886 -33.801 8.881   1.00 69.52  ? 104  GLN A CD  1 
ATOM   192  O OE1 . GLN A 1 39  ? 15.109 -34.052 10.052  1.00 72.11  ? 104  GLN A OE1 1 
ATOM   193  N NE2 . GLN A 1 39  ? 14.618 -34.746 7.993   1.00 75.32  ? 104  GLN A NE2 1 
ATOM   194  N N   . LYS A 1 40  ? 14.723 -31.132 3.863   1.00 64.37  ? 105  LYS A N   1 
ATOM   195  C CA  . LYS A 1 40  ? 15.201 -30.839 2.527   1.00 67.28  ? 105  LYS A CA  1 
ATOM   196  C C   . LYS A 1 40  ? 15.275 -29.320 2.360   1.00 69.39  ? 105  LYS A C   1 
ATOM   197  O O   . LYS A 1 40  ? 16.372 -28.765 2.120   1.00 71.65  ? 105  LYS A O   1 
ATOM   198  C CB  . LYS A 1 40  ? 14.353 -31.506 1.463   1.00 71.63  ? 105  LYS A CB  1 
ATOM   199  C CG  . LYS A 1 40  ? 15.116 -31.831 0.161   1.00 83.02  ? 105  LYS A CG  1 
ATOM   200  C CD  . LYS A 1 40  ? 14.948 -33.304 -0.265  1.00 83.74  ? 105  LYS A CD  1 
ATOM   201  C CE  . LYS A 1 40  ? 13.738 -33.972 0.410   1.00 83.62  ? 105  LYS A CE  1 
ATOM   202  N NZ  . LYS A 1 40  ? 13.756 -35.458 0.411   1.00 78.01  ? 105  LYS A NZ  1 
ATOM   203  N N   . PHE A 1 41  ? 14.155 -28.639 2.580   1.00 57.37  ? 106  PHE A N   1 
ATOM   204  C CA  . PHE A 1 41  ? 14.195 -27.181 2.579   1.00 61.44  ? 106  PHE A CA  1 
ATOM   205  C C   . PHE A 1 41  ? 15.359 -26.610 3.379   1.00 62.81  ? 106  PHE A C   1 
ATOM   206  O O   . PHE A 1 41  ? 16.061 -25.707 2.914   1.00 66.34  ? 106  PHE A O   1 
ATOM   207  C CB  . PHE A 1 41  ? 12.921 -26.583 3.127   1.00 55.85  ? 106  PHE A CB  1 
ATOM   208  C CG  . PHE A 1 41  ? 11.813 -26.479 2.128   1.00 49.64  ? 106  PHE A CG  1 
ATOM   209  C CD1 . PHE A 1 41  ? 11.664 -25.345 1.373   1.00 46.17  ? 106  PHE A CD1 1 
ATOM   210  C CD2 . PHE A 1 41  ? 10.883 -27.502 1.993   1.00 50.71  ? 106  PHE A CD2 1 
ATOM   211  C CE1 . PHE A 1 41  ? 10.607 -25.222 0.464   1.00 47.04  ? 106  PHE A CE1 1 
ATOM   212  C CE2 . PHE A 1 41  ? 9.823  -27.392 1.105   1.00 46.76  ? 106  PHE A CE2 1 
ATOM   213  C CZ  . PHE A 1 41  ? 9.683  -26.248 0.346   1.00 48.86  ? 106  PHE A CZ  1 
ATOM   214  N N   . ARG A 1 42  ? 15.561 -27.130 4.584   1.00 62.75  ? 107  ARG A N   1 
ATOM   215  C CA  . ARG A 1 42  ? 16.533 -26.536 5.469   1.00 57.59  ? 107  ARG A CA  1 
ATOM   216  C C   . ARG A 1 42  ? 17.941 -26.726 4.920   1.00 63.68  ? 107  ARG A C   1 
ATOM   217  O O   . ARG A 1 42  ? 18.762 -25.794 4.973   1.00 56.56  ? 107  ARG A O   1 
ATOM   218  C CB  . ARG A 1 42  ? 16.410 -27.077 6.894   1.00 61.35  ? 107  ARG A CB  1 
ATOM   219  C CG  . ARG A 1 42  ? 17.490 -26.600 7.881   1.00 61.86  ? 107  ARG A CG  1 
ATOM   220  C CD  . ARG A 1 42  ? 18.683 -27.562 7.858   1.00 61.70  ? 107  ARG A CD  1 
ATOM   221  N NE  . ARG A 1 42  ? 18.348 -28.730 8.645   1.00 73.88  ? 107  ARG A NE  1 
ATOM   222  C CZ  . ARG A 1 42  ? 19.095 -29.810 8.815   1.00 71.10  ? 107  ARG A CZ  1 
ATOM   223  N NH1 . ARG A 1 42  ? 20.276 -29.926 8.224   1.00 73.01  ? 107  ARG A NH1 1 
ATOM   224  N NH2 . ARG A 1 42  ? 18.617 -30.791 9.578   1.00 75.06  ? 107  ARG A NH2 1 
ATOM   225  N N   . LYS A 1 43  ? 18.233 -27.912 4.401   1.00 60.34  ? 108  LYS A N   1 
ATOM   226  C CA  . LYS A 1 43  ? 19.561 -28.127 3.841   1.00 61.30  ? 108  LYS A CA  1 
ATOM   227  C C   . LYS A 1 43  ? 19.749 -27.260 2.556   1.00 69.08  ? 108  LYS A C   1 
ATOM   228  O O   . LYS A 1 43  ? 20.799 -26.610 2.380   1.00 61.72  ? 108  LYS A O   1 
ATOM   229  C CB  . LYS A 1 43  ? 19.843 -29.613 3.601   1.00 60.39  ? 108  LYS A CB  1 
ATOM   230  C CG  . LYS A 1 43  ? 19.914 -30.496 4.869   1.00 71.41  ? 108  LYS A CG  1 
ATOM   231  C CD  . LYS A 1 43  ? 19.395 -31.928 4.605   1.00 70.43  ? 108  LYS A CD  1 
ATOM   232  C CE  . LYS A 1 43  ? 19.567 -32.902 5.767   1.00 78.81  ? 108  LYS A CE  1 
ATOM   233  N NZ  . LYS A 1 43  ? 20.764 -33.802 5.662   1.00 75.61  ? 108  LYS A NZ  1 
ATOM   234  N N   . LEU A 1 44  ? 18.737 -27.201 1.680   1.00 60.30  ? 109  LEU A N   1 
ATOM   235  C CA  . LEU A 1 44  ? 18.887 -26.358 0.504   1.00 56.45  ? 109  LEU A CA  1 
ATOM   236  C C   . LEU A 1 44  ? 19.119 -24.880 0.851   1.00 57.87  ? 109  LEU A C   1 
ATOM   237  O O   . LEU A 1 44  ? 19.771 -24.153 0.096   1.00 65.66  ? 109  LEU A O   1 
ATOM   238  C CB  . LEU A 1 44  ? 17.711 -26.494 -0.463  1.00 56.22  ? 109  LEU A CB  1 
ATOM   239  C CG  . LEU A 1 44  ? 17.563 -27.840 -1.188  1.00 64.97  ? 109  LEU A CG  1 
ATOM   240  C CD1 . LEU A 1 44  ? 16.227 -27.885 -1.941  1.00 62.39  ? 109  LEU A CD1 1 
ATOM   241  C CD2 . LEU A 1 44  ? 18.720 -28.137 -2.144  1.00 70.21  ? 109  LEU A CD2 1 
ATOM   242  N N   . LEU A 1 45  ? 18.568 -24.424 1.965   1.00 49.32  ? 110  LEU A N   1 
ATOM   243  C CA  . LEU A 1 45  ? 18.765 -23.051 2.359   1.00 55.72  ? 110  LEU A CA  1 
ATOM   244  C C   . LEU A 1 45  ? 20.072 -22.868 3.153   1.00 56.40  ? 110  LEU A C   1 
ATOM   245  O O   . LEU A 1 45  ? 20.478 -21.748 3.422   1.00 56.63  ? 110  LEU A O   1 
ATOM   246  C CB  . LEU A 1 45  ? 17.554 -22.547 3.142   1.00 58.68  ? 110  LEU A CB  1 
ATOM   247  C CG  . LEU A 1 45  ? 16.273 -22.438 2.330   1.00 57.89  ? 110  LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 45  ? 15.094 -22.457 3.288   1.00 55.89  ? 110  LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 45  ? 16.288 -21.156 1.518   1.00 45.55  ? 110  LEU A CD2 1 
ATOM   250  N N   . SER A 1 46  ? 20.720 -23.972 3.510   1.00 58.86  ? 111  SER A N   1 
ATOM   251  C CA  . SER A 1 46  ? 22.044 -23.958 4.162   1.00 67.95  ? 111  SER A CA  1 
ATOM   252  C C   . SER A 1 46  ? 23.177 -23.784 3.151   1.00 70.92  ? 111  SER A C   1 
ATOM   253  O O   . SER A 1 46  ? 24.300 -23.514 3.556   1.00 73.59  ? 111  SER A O   1 
ATOM   254  C CB  . SER A 1 46  ? 22.324 -25.273 4.907   1.00 67.68  ? 111  SER A CB  1 
ATOM   255  O OG  . SER A 1 46  ? 21.214 -25.750 5.634   1.00 81.85  ? 111  SER A OG  1 
ATOM   256  N N   . LYS A 1 47  ? 22.871 -23.987 1.860   1.00 79.35  ? 112  LYS A N   1 
ATOM   257  C CA  . LYS A 1 47  ? 23.826 -23.871 0.730   1.00 90.00  ? 112  LYS A CA  1 
ATOM   258  C C   . LYS A 1 47  ? 24.564 -22.542 0.725   1.00 89.45  ? 112  LYS A C   1 
ATOM   259  O O   . LYS A 1 47  ? 23.928 -21.470 0.705   1.00 75.18  ? 112  LYS A O   1 
ATOM   260  C CB  . LYS A 1 47  ? 23.102 -24.010 -0.622  1.00 90.07  ? 112  LYS A CB  1 
ATOM   261  C CG  . LYS A 1 47  ? 23.453 -25.240 -1.427  1.00 90.96  ? 112  LYS A CG  1 
ATOM   262  C CD  . LYS A 1 47  ? 22.504 -25.400 -2.612  1.00 95.45  ? 112  LYS A CD  1 
ATOM   263  C CE  . LYS A 1 47  ? 22.892 -26.591 -3.491  1.00 86.91  ? 112  LYS A CE  1 
ATOM   264  N NZ  . LYS A 1 47  ? 21.737 -27.484 -3.799  1.00 85.54  ? 112  LYS A NZ  1 
ATOM   265  N N   . GLU A 1 48  ? 25.895 -22.630 0.719   1.00 89.59  ? 113  GLU A N   1 
ATOM   266  C CA  . GLU A 1 48  ? 26.753 -21.454 0.824   1.00 94.15  ? 113  GLU A CA  1 
ATOM   267  C C   . GLU A 1 48  ? 26.614 -20.441 -0.333  1.00 95.05  ? 113  GLU A C   1 
ATOM   268  O O   . GLU A 1 48  ? 26.373 -19.233 -0.057  1.00 100.31 ? 113  GLU A O   1 
ATOM   269  C CB  . GLU A 1 48  ? 28.225 -21.863 1.051   1.00 108.68 ? 113  GLU A CB  1 
ATOM   270  C CG  . GLU A 1 48  ? 29.271 -20.888 0.479   1.00 112.67 ? 113  GLU A CG  1 
ATOM   271  C CD  . GLU A 1 48  ? 29.553 -19.676 1.379   1.00 120.48 ? 113  GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 48  ? 29.502 -19.816 2.625   1.00 125.28 ? 113  GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 48  ? 29.845 -18.579 0.843   1.00 110.88 ? 113  GLU A OE2 1 
ATOM   274  N N   . PRO A 1 49  ? 26.748 -20.907 -1.620  1.00 87.56  ? 114  PRO A N   1 
ATOM   275  C CA  . PRO A 1 49  ? 26.859 -19.903 -2.727  1.00 79.07  ? 114  PRO A CA  1 
ATOM   276  C C   . PRO A 1 49  ? 25.607 -19.057 -2.841  1.00 76.94  ? 114  PRO A C   1 
ATOM   277  O O   . PRO A 1 49  ? 25.628 -17.876 -2.502  1.00 78.84  ? 114  PRO A O   1 
ATOM   278  C CB  . PRO A 1 49  ? 27.078 -20.753 -3.990  1.00 70.09  ? 114  PRO A CB  1 
ATOM   279  C CG  . PRO A 1 49  ? 26.572 -22.127 -3.601  1.00 81.46  ? 114  PRO A CG  1 
ATOM   280  C CD  . PRO A 1 49  ? 26.822 -22.298 -2.124  1.00 68.35  ? 114  PRO A CD  1 
ATOM   281  N N   . ASN A 1 50  ? 24.524 -19.675 -3.307  1.00 79.93  ? 115  ASN A N   1 
ATOM   282  C CA  . ASN A 1 50  ? 23.218 -19.012 -3.330  1.00 96.18  ? 115  ASN A CA  1 
ATOM   283  C C   . ASN A 1 50  ? 22.077 -19.978 -2.993  1.00 93.20  ? 115  ASN A C   1 
ATOM   284  O O   . ASN A 1 50  ? 21.744 -20.878 -3.786  1.00 96.69  ? 115  ASN A O   1 
ATOM   285  C CB  . ASN A 1 50  ? 22.953 -18.234 -4.639  1.00 113.56 ? 115  ASN A CB  1 
ATOM   286  C CG  . ASN A 1 50  ? 23.527 -16.808 -4.615  1.00 118.27 ? 115  ASN A CG  1 
ATOM   287  O OD1 . ASN A 1 50  ? 23.609 -16.155 -3.551  1.00 110.44 ? 115  ASN A OD1 1 
ATOM   288  N ND2 . ASN A 1 50  ? 23.935 -16.321 -5.798  1.00 101.42 ? 115  ASN A ND2 1 
ATOM   289  N N   . PRO A 1 51  ? 21.522 -19.818 -1.775  1.00 74.98  ? 116  PRO A N   1 
ATOM   290  C CA  . PRO A 1 51  ? 20.370 -20.625 -1.393  1.00 67.01  ? 116  PRO A CA  1 
ATOM   291  C C   . PRO A 1 51  ? 19.096 -20.142 -2.117  1.00 60.16  ? 116  PRO A C   1 
ATOM   292  O O   . PRO A 1 51  ? 18.955 -18.954 -2.449  1.00 55.02  ? 116  PRO A O   1 
ATOM   293  C CB  . PRO A 1 51  ? 20.290 -20.412 0.118   1.00 59.03  ? 116  PRO A CB  1 
ATOM   294  C CG  . PRO A 1 51  ? 20.887 -19.026 0.312   1.00 61.76  ? 116  PRO A CG  1 
ATOM   295  C CD  . PRO A 1 51  ? 21.986 -18.918 -0.685  1.00 60.10  ? 116  PRO A CD  1 
ATOM   296  N N   . PRO A 1 52  ? 18.195 -21.071 -2.399  1.00 55.19  ? 117  PRO A N   1 
ATOM   297  C CA  . PRO A 1 52  ? 16.978 -20.811 -3.171  1.00 56.00  ? 117  PRO A CA  1 
ATOM   298  C C   . PRO A 1 52  ? 15.930 -19.929 -2.451  1.00 57.35  ? 117  PRO A C   1 
ATOM   299  O O   . PRO A 1 52  ? 14.766 -20.351 -2.276  1.00 59.26  ? 117  PRO A O   1 
ATOM   300  C CB  . PRO A 1 52  ? 16.418 -22.215 -3.400  1.00 56.65  ? 117  PRO A CB  1 
ATOM   301  C CG  . PRO A 1 52  ? 17.027 -23.077 -2.327  1.00 58.89  ? 117  PRO A CG  1 
ATOM   302  C CD  . PRO A 1 52  ? 18.393 -22.499 -2.098  1.00 56.59  ? 117  PRO A CD  1 
ATOM   303  N N   . ILE A 1 53  ? 16.301 -18.715 -2.052  1.00 50.43  ? 118  ILE A N   1 
ATOM   304  C CA  . ILE A 1 53  ? 15.410 -18.005 -1.158  1.00 55.07  ? 118  ILE A CA  1 
ATOM   305  C C   . ILE A 1 53  ? 14.172 -17.714 -2.012  1.00 60.15  ? 118  ILE A C   1 
ATOM   306  O O   . ILE A 1 53  ? 13.044 -18.102 -1.666  1.00 65.21  ? 118  ILE A O   1 
ATOM   307  C CB  . ILE A 1 53  ? 16.061 -16.757 -0.506  1.00 51.21  ? 118  ILE A CB  1 
ATOM   308  C CG1 . ILE A 1 53  ? 17.181 -17.164 0.458   1.00 56.15  ? 118  ILE A CG1 1 
ATOM   309  C CG2 . ILE A 1 53  ? 15.043 -16.001 0.309   1.00 58.92  ? 118  ILE A CG2 1 
ATOM   310  C CD1 . ILE A 1 53  ? 17.962 -15.977 1.006   1.00 50.39  ? 118  ILE A CD1 1 
ATOM   311  N N   . ASP A 1 54  ? 14.426 -17.115 -3.170  1.00 58.23  ? 119  ASP A N   1 
ATOM   312  C CA  . ASP A 1 54  ? 13.398 -16.664 -4.101  1.00 56.94  ? 119  ASP A CA  1 
ATOM   313  C C   . ASP A 1 54  ? 12.458 -17.740 -4.571  1.00 55.24  ? 119  ASP A C   1 
ATOM   314  O O   . ASP A 1 54  ? 11.252 -17.489 -4.614  1.00 63.31  ? 119  ASP A O   1 
ATOM   315  C CB  . ASP A 1 54  ? 14.044 -15.990 -5.308  1.00 58.91  ? 119  ASP A CB  1 
ATOM   316  C CG  . ASP A 1 54  ? 14.584 -14.600 -4.980  1.00 64.81  ? 119  ASP A CG  1 
ATOM   317  O OD1 . ASP A 1 54  ? 14.028 -13.914 -4.069  1.00 59.55  ? 119  ASP A OD1 1 
ATOM   318  O OD2 . ASP A 1 54  ? 15.568 -14.211 -5.644  1.00 59.41  ? 119  ASP A OD2 1 
ATOM   319  N N   . GLU A 1 55  ? 12.983 -18.917 -4.923  1.00 50.81  ? 120  GLU A N   1 
ATOM   320  C CA  . GLU A 1 55  ? 12.102 -20.049 -5.255  1.00 65.19  ? 120  GLU A CA  1 
ATOM   321  C C   . GLU A 1 55  ? 11.190 -20.458 -4.123  1.00 68.80  ? 120  GLU A C   1 
ATOM   322  O O   . GLU A 1 55  ? 10.021 -20.699 -4.357  1.00 77.53  ? 120  GLU A O   1 
ATOM   323  C CB  . GLU A 1 55  ? 12.850 -21.309 -5.662  1.00 75.39  ? 120  GLU A CB  1 
ATOM   324  C CG  . GLU A 1 55  ? 13.828 -21.187 -6.813  1.00 87.07  ? 120  GLU A CG  1 
ATOM   325  C CD  . GLU A 1 55  ? 14.618 -22.480 -6.989  1.00 97.27  ? 120  GLU A CD  1 
ATOM   326  O OE1 . GLU A 1 55  ? 14.043 -23.593 -6.719  1.00 85.20  ? 120  GLU A OE1 1 
ATOM   327  O OE2 . GLU A 1 55  ? 15.809 -22.362 -7.390  1.00 83.59  ? 120  GLU A OE2 1 
ATOM   328  N N   . VAL A 1 56  ? 11.729 -20.581 -2.907  1.00 71.20  ? 121  VAL A N   1 
ATOM   329  C CA  . VAL A 1 56  ? 10.913 -20.920 -1.750  1.00 58.41  ? 121  VAL A CA  1 
ATOM   330  C C   . VAL A 1 56  ? 9.805  -19.860 -1.555  1.00 59.59  ? 121  VAL A C   1 
ATOM   331  O O   . VAL A 1 56  ? 8.625  -20.180 -1.496  1.00 56.47  ? 121  VAL A O   1 
ATOM   332  C CB  . VAL A 1 56  ? 11.773 -21.032 -0.478  1.00 61.08  ? 121  VAL A CB  1 
ATOM   333  C CG1 . VAL A 1 56  ? 10.869 -21.241 0.716   1.00 56.34  ? 121  VAL A CG1 1 
ATOM   334  C CG2 . VAL A 1 56  ? 12.783 -22.187 -0.552  1.00 49.06  ? 121  VAL A CG2 1 
ATOM   335  N N   . ILE A 1 57  ? 10.186 -18.600 -1.453  1.00 55.18  ? 122  ILE A N   1 
ATOM   336  C CA  . ILE A 1 57  ? 9.225  -17.538 -1.341  1.00 64.79  ? 122  ILE A CA  1 
ATOM   337  C C   . ILE A 1 57  ? 8.169  -17.529 -2.460  1.00 69.19  ? 122  ILE A C   1 
ATOM   338  O O   . ILE A 1 57  ? 7.121  -16.913 -2.317  1.00 76.90  ? 122  ILE A O   1 
ATOM   339  C CB  . ILE A 1 57  ? 9.933  -16.185 -1.390  1.00 65.65  ? 122  ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 57  ? 10.742 -16.001 -0.144  1.00 78.58  ? 122  ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 57  ? 8.944  -15.030 -1.430  1.00 76.59  ? 122  ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 57  ? 11.493 -14.696 -0.206  1.00 85.89  ? 122  ILE A CD1 1 
ATOM   343  N N   . SER A 1 58  ? 8.445  -18.167 -3.581  1.00 65.52  ? 123  SER A N   1 
ATOM   344  C CA  . SER A 1 58  ? 7.569  -18.015 -4.737  1.00 70.81  ? 123  SER A CA  1 
ATOM   345  C C   . SER A 1 58  ? 6.484  -19.115 -4.868  1.00 68.29  ? 123  SER A C   1 
ATOM   346  O O   . SER A 1 58  ? 5.630  -19.022 -5.769  1.00 70.15  ? 123  SER A O   1 
ATOM   347  C CB  . SER A 1 58  ? 8.397  -17.830 -6.051  1.00 80.62  ? 123  SER A CB  1 
ATOM   348  O OG  . SER A 1 58  ? 8.894  -19.069 -6.590  1.00 77.85  ? 123  SER A OG  1 
ATOM   349  N N   . THR A 1 59  ? 6.516  -20.151 -4.011  1.00 55.47  ? 124  THR A N   1 
ATOM   350  C CA  . THR A 1 59  ? 5.397  -21.111 -3.937  1.00 57.35  ? 124  THR A CA  1 
ATOM   351  C C   . THR A 1 59  ? 4.387  -20.729 -2.860  1.00 59.66  ? 124  THR A C   1 
ATOM   352  O O   . THR A 1 59  ? 4.677  -20.777 -1.688  1.00 60.72  ? 124  THR A O   1 
ATOM   353  C CB  . THR A 1 59  ? 5.785  -22.571 -3.753  1.00 66.86  ? 124  THR A CB  1 
ATOM   354  O OG1 . THR A 1 59  ? 6.935  -22.894 -4.562  1.00 80.65  ? 124  THR A OG1 1 
ATOM   355  C CG2 . THR A 1 59  ? 4.591  -23.441 -4.143  1.00 59.16  ? 124  THR A CG2 1 
ATOM   356  N N   . PRO A 1 60  ? 3.167  -20.382 -3.279  1.00 67.87  ? 125  PRO A N   1 
ATOM   357  C CA  . PRO A 1 60  ? 2.610  -19.395 -2.379  1.00 59.05  ? 125  PRO A CA  1 
ATOM   358  C C   . PRO A 1 60  ? 2.080  -19.775 -1.004  1.00 60.58  ? 125  PRO A C   1 
ATOM   359  O O   . PRO A 1 60  ? 1.889  -18.880 -0.165  1.00 69.83  ? 125  PRO A O   1 
ATOM   360  C CB  . PRO A 1 60  ? 1.576  -18.680 -3.256  1.00 63.24  ? 125  PRO A CB  1 
ATOM   361  C CG  . PRO A 1 60  ? 2.197  -18.773 -4.626  1.00 57.14  ? 125  PRO A CG  1 
ATOM   362  C CD  . PRO A 1 60  ? 2.680  -20.193 -4.663  1.00 52.29  ? 125  PRO A CD  1 
ATOM   363  N N   . GLY A 1 61  ? 1.874  -21.031 -0.676  1.00 46.52  ? 126  GLY A N   1 
ATOM   364  C CA  . GLY A 1 61  ? 1.590  -21.128 0.767   1.00 48.02  ? 126  GLY A CA  1 
ATOM   365  C C   . GLY A 1 61  ? 2.692  -21.630 1.700   1.00 50.57  ? 126  GLY A C   1 
ATOM   366  O O   . GLY A 1 61  ? 2.423  -21.988 2.880   1.00 42.48  ? 126  GLY A O   1 
ATOM   367  N N   . VAL A 1 62  ? 3.917  -21.707 1.159   1.00 51.89  ? 127  VAL A N   1 
ATOM   368  C CA  . VAL A 1 62  ? 5.010  -22.498 1.762   1.00 52.08  ? 127  VAL A CA  1 
ATOM   369  C C   . VAL A 1 62  ? 5.677  -21.887 3.004   1.00 48.86  ? 127  VAL A C   1 
ATOM   370  O O   . VAL A 1 62  ? 5.898  -22.595 4.002   1.00 48.01  ? 127  VAL A O   1 
ATOM   371  C CB  . VAL A 1 62  ? 6.048  -22.913 0.705   1.00 51.18  ? 127  VAL A CB  1 
ATOM   372  C CG1 . VAL A 1 62  ? 7.459  -22.895 1.268   1.00 47.87  ? 127  VAL A CG1 1 
ATOM   373  C CG2 . VAL A 1 62  ? 5.704  -24.297 0.234   1.00 55.74  ? 127  VAL A CG2 1 
ATOM   374  N N   . VAL A 1 63  ? 5.983  -20.593 2.938   1.00 44.66  ? 128  VAL A N   1 
ATOM   375  C CA  . VAL A 1 63  ? 6.353  -19.851 4.118   1.00 52.38  ? 128  VAL A CA  1 
ATOM   376  C C   . VAL A 1 63  ? 5.323  -19.986 5.270   1.00 55.04  ? 128  VAL A C   1 
ATOM   377  O O   . VAL A 1 63  ? 5.651  -20.529 6.341   1.00 55.22  ? 128  VAL A O   1 
ATOM   378  C CB  . VAL A 1 63  ? 6.672  -18.395 3.778   1.00 55.06  ? 128  VAL A CB  1 
ATOM   379  C CG1 . VAL A 1 63  ? 6.995  -17.641 5.060   1.00 51.53  ? 128  VAL A CG1 1 
ATOM   380  C CG2 . VAL A 1 63  ? 7.851  -18.357 2.807   1.00 52.16  ? 128  VAL A CG2 1 
ATOM   381  N N   . ALA A 1 64  ? 4.081  -19.570 5.028   1.00 57.14  ? 129  ALA A N   1 
ATOM   382  C CA  . ALA A 1 64  ? 3.001  -19.734 6.017   1.00 56.20  ? 129  ALA A CA  1 
ATOM   383  C C   . ALA A 1 64  ? 2.968  -21.117 6.685   1.00 51.61  ? 129  ALA A C   1 
ATOM   384  O O   . ALA A 1 64  ? 2.699  -21.235 7.897   1.00 54.46  ? 129  ALA A O   1 
ATOM   385  C CB  . ALA A 1 64  ? 1.630  -19.370 5.436   1.00 41.99  ? 129  ALA A CB  1 
ATOM   386  N N   . ARG A 1 65  ? 3.250  -22.150 5.907   1.00 46.94  ? 130  ARG A N   1 
ATOM   387  C CA  . ARG A 1 65  ? 3.272  -23.509 6.451   1.00 52.22  ? 130  ARG A CA  1 
ATOM   388  C C   . ARG A 1 65  ? 4.358  -23.632 7.545   1.00 54.58  ? 130  ARG A C   1 
ATOM   389  O O   . ARG A 1 65  ? 4.092  -24.019 8.677   1.00 63.98  ? 130  ARG A O   1 
ATOM   390  C CB  . ARG A 1 65  ? 3.457  -24.527 5.304   1.00 49.21  ? 130  ARG A CB  1 
ATOM   391  C CG  . ARG A 1 65  ? 3.223  -25.985 5.700   1.00 64.98  ? 130  ARG A CG  1 
ATOM   392  C CD  . ARG A 1 65  ? 1.748  -26.377 5.901   1.00 64.57  ? 130  ARG A CD  1 
ATOM   393  N NE  . ARG A 1 65  ? 1.600  -27.852 5.948   1.00 72.37  ? 130  ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 65  ? 0.586  -28.487 6.541   1.00 67.28  ? 130  ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 65  ? -0.344 -27.748 7.132   1.00 60.11  ? 130  ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 65  ? 0.502  -29.833 6.563   1.00 58.59  ? 130  ARG A NH2 1 
ATOM   397  N N   . PHE A 1 66  ? 5.573  -23.237 7.203   1.00 56.71  ? 131  PHE A N   1 
ATOM   398  C CA  . PHE A 1 66  ? 6.650  -23.225 8.149   1.00 53.41  ? 131  PHE A CA  1 
ATOM   399  C C   . PHE A 1 66  ? 6.195  -22.444 9.357   1.00 48.34  ? 131  PHE A C   1 
ATOM   400  O O   . PHE A 1 66  ? 6.301  -22.955 10.452  1.00 55.89  ? 131  PHE A O   1 
ATOM   401  C CB  . PHE A 1 66  ? 7.929  -22.620 7.525   1.00 49.25  ? 131  PHE A CB  1 
ATOM   402  C CG  . PHE A 1 66  ? 8.502  -23.430 6.393   1.00 45.90  ? 131  PHE A CG  1 
ATOM   403  C CD1 . PHE A 1 66  ? 8.754  -24.802 6.546   1.00 48.16  ? 131  PHE A CD1 1 
ATOM   404  C CD2 . PHE A 1 66  ? 8.795  -22.832 5.181   1.00 46.38  ? 131  PHE A CD2 1 
ATOM   405  C CE1 . PHE A 1 66  ? 9.282  -25.551 5.512   1.00 46.47  ? 131  PHE A CE1 1 
ATOM   406  C CE2 . PHE A 1 66  ? 9.325  -23.563 4.134   1.00 42.73  ? 131  PHE A CE2 1 
ATOM   407  C CZ  . PHE A 1 66  ? 9.566  -24.924 4.298   1.00 48.39  ? 131  PHE A CZ  1 
ATOM   408  N N   . VAL A 1 67  ? 5.668  -21.234 9.175   1.00 47.40  ? 132  VAL A N   1 
ATOM   409  C CA  . VAL A 1 67  ? 5.221  -20.426 10.340  1.00 53.03  ? 132  VAL A CA  1 
ATOM   410  C C   . VAL A 1 67  ? 4.239  -21.187 11.228  1.00 56.23  ? 132  VAL A C   1 
ATOM   411  O O   . VAL A 1 67  ? 4.346  -21.117 12.451  1.00 63.88  ? 132  VAL A O   1 
ATOM   412  C CB  . VAL A 1 67  ? 4.633  -19.041 9.974   1.00 52.45  ? 132  VAL A CB  1 
ATOM   413  C CG1 . VAL A 1 67  ? 3.768  -18.484 11.107  1.00 44.63  ? 132  VAL A CG1 1 
ATOM   414  C CG2 . VAL A 1 67  ? 5.742  -18.064 9.690   1.00 49.19  ? 132  VAL A CG2 1 
ATOM   415  N N   . GLU A 1 68  ? 3.321  -21.937 10.619  1.00 54.39  ? 133  GLU A N   1 
ATOM   416  C CA  . GLU A 1 68  ? 2.425  -22.816 11.378  1.00 56.21  ? 133  GLU A CA  1 
ATOM   417  C C   . GLU A 1 68  ? 3.176  -23.973 12.055  1.00 52.52  ? 133  GLU A C   1 
ATOM   418  O O   . GLU A 1 68  ? 2.859  -24.372 13.188  1.00 55.86  ? 133  GLU A O   1 
ATOM   419  C CB  . GLU A 1 68  ? 1.217  -23.314 10.522  1.00 63.74  ? 133  GLU A CB  1 
ATOM   420  C CG  . GLU A 1 68  ? 0.215  -22.221 10.068  1.00 63.16  ? 133  GLU A CG  1 
ATOM   421  C CD  . GLU A 1 68  ? -0.353 -21.370 11.224  1.00 76.36  ? 133  GLU A CD  1 
ATOM   422  O OE1 . GLU A 1 68  ? -0.950 -22.009 12.149  1.00 69.46  ? 133  GLU A OE1 1 
ATOM   423  O OE2 . GLU A 1 68  ? -0.210 -20.083 11.216  1.00 64.26  ? 133  GLU A OE2 1 
ATOM   424  N N   . PHE A 1 69  ? 4.182  -24.516 11.401  1.00 51.47  ? 134  PHE A N   1 
ATOM   425  C CA  . PHE A 1 69  ? 4.963  -25.559 12.064  1.00 53.93  ? 134  PHE A CA  1 
ATOM   426  C C   . PHE A 1 69  ? 5.660  -25.058 13.345  1.00 55.33  ? 134  PHE A C   1 
ATOM   427  O O   . PHE A 1 69  ? 6.030  -25.872 14.171  1.00 53.48  ? 134  PHE A O   1 
ATOM   428  C CB  . PHE A 1 69  ? 6.046  -26.073 11.143  1.00 60.28  ? 134  PHE A CB  1 
ATOM   429  C CG  . PHE A 1 69  ? 5.562  -26.956 10.037  1.00 64.94  ? 134  PHE A CG  1 
ATOM   430  C CD1 . PHE A 1 69  ? 4.211  -27.250 9.877   1.00 63.00  ? 134  PHE A CD1 1 
ATOM   431  C CD2 . PHE A 1 69  ? 6.484  -27.502 9.125   1.00 60.40  ? 134  PHE A CD2 1 
ATOM   432  C CE1 . PHE A 1 69  ? 3.798  -28.105 8.842   1.00 70.41  ? 134  PHE A CE1 1 
ATOM   433  C CE2 . PHE A 1 69  ? 6.067  -28.320 8.075   1.00 62.82  ? 134  PHE A CE2 1 
ATOM   434  C CZ  . PHE A 1 69  ? 4.720  -28.630 7.935   1.00 64.80  ? 134  PHE A CZ  1 
ATOM   435  N N   . LEU A 1 70  ? 5.866  -23.741 13.504  1.00 54.23  ? 135  LEU A N   1 
ATOM   436  C CA  . LEU A 1 70  ? 6.483  -23.219 14.731  1.00 53.79  ? 135  LEU A CA  1 
ATOM   437  C C   . LEU A 1 70  ? 5.574  -23.465 15.895  1.00 62.56  ? 135  LEU A C   1 
ATOM   438  O O   . LEU A 1 70  ? 6.035  -23.490 17.019  1.00 75.21  ? 135  LEU A O   1 
ATOM   439  C CB  . LEU A 1 70  ? 6.744  -21.706 14.701  1.00 45.16  ? 135  LEU A CB  1 
ATOM   440  C CG  . LEU A 1 70  ? 7.751  -21.220 13.658  1.00 49.26  ? 135  LEU A CG  1 
ATOM   441  C CD1 . LEU A 1 70  ? 7.721  -19.696 13.515  1.00 41.11  ? 135  LEU A CD1 1 
ATOM   442  C CD2 . LEU A 1 70  ? 9.151  -21.788 13.891  1.00 43.71  ? 135  LEU A CD2 1 
ATOM   443  N N   . LYS A 1 71  ? 4.272  -23.600 15.630  1.00 68.06  ? 136  LYS A N   1 
ATOM   444  C CA  . LYS A 1 71  ? 3.275  -23.700 16.689  1.00 60.39  ? 136  LYS A CA  1 
ATOM   445  C C   . LYS A 1 71  ? 3.196  -25.120 17.266  1.00 61.03  ? 136  LYS A C   1 
ATOM   446  O O   . LYS A 1 71  ? 2.406  -25.357 18.155  1.00 72.65  ? 136  LYS A O   1 
ATOM   447  C CB  . LYS A 1 71  ? 1.901  -23.295 16.170  1.00 52.65  ? 136  LYS A CB  1 
ATOM   448  C CG  . LYS A 1 71  ? 1.700  -21.814 15.966  1.00 57.52  ? 136  LYS A CG  1 
ATOM   449  C CD  . LYS A 1 71  ? 0.332  -21.519 15.325  1.00 52.19  ? 136  LYS A CD  1 
ATOM   450  C CE  . LYS A 1 71  ? 0.417  -20.235 14.511  1.00 62.38  ? 136  LYS A CE  1 
ATOM   451  N NZ  . LYS A 1 71  ? -0.842 -19.464 14.281  1.00 63.03  ? 136  LYS A NZ  1 
ATOM   452  N N   . ARG A 1 72  ? 3.998  -26.056 16.775  1.00 56.07  ? 137  ARG A N   1 
ATOM   453  C CA  . ARG A 1 72  ? 3.801  -27.440 17.136  1.00 53.84  ? 137  ARG A CA  1 
ATOM   454  C C   . ARG A 1 72  ? 4.571  -27.814 18.377  1.00 64.28  ? 137  ARG A C   1 
ATOM   455  O O   . ARG A 1 72  ? 5.558  -28.600 18.289  1.00 64.98  ? 137  ARG A O   1 
ATOM   456  C CB  . ARG A 1 72  ? 4.150  -28.366 15.966  1.00 52.56  ? 137  ARG A CB  1 
ATOM   457  C CG  . ARG A 1 72  ? 3.269  -28.112 14.740  1.00 58.62  ? 137  ARG A CG  1 
ATOM   458  C CD  . ARG A 1 72  ? 2.125  -29.094 14.577  1.00 50.56  ? 137  ARG A CD  1 
ATOM   459  N NE  . ARG A 1 72  ? 2.644  -30.397 14.176  1.00 57.13  ? 137  ARG A NE  1 
ATOM   460  C CZ  . ARG A 1 72  ? 2.686  -30.807 12.921  1.00 53.20  ? 137  ARG A CZ  1 
ATOM   461  N NH1 . ARG A 1 72  ? 2.221  -30.010 11.956  1.00 57.21  ? 137  ARG A NH1 1 
ATOM   462  N NH2 . ARG A 1 72  ? 3.189  -31.999 12.642  1.00 50.48  ? 137  ARG A NH2 1 
ATOM   463  N N   . LYS A 1 73  ? 4.093  -27.292 19.522  1.00 59.86  ? 138  LYS A N   1 
ATOM   464  C CA  . LYS A 1 73  ? 4.730  -27.491 20.837  1.00 59.13  ? 138  LYS A CA  1 
ATOM   465  C C   . LYS A 1 73  ? 5.082  -28.941 21.189  1.00 64.39  ? 138  LYS A C   1 
ATOM   466  O O   . LYS A 1 73  ? 5.946  -29.167 22.032  1.00 74.07  ? 138  LYS A O   1 
ATOM   467  C CB  . LYS A 1 73  ? 3.897  -26.912 21.967  1.00 64.87  ? 138  LYS A CB  1 
ATOM   468  C CG  . LYS A 1 73  ? 3.485  -25.459 21.795  1.00 75.92  ? 138  LYS A CG  1 
ATOM   469  C CD  . LYS A 1 73  ? 2.601  -24.985 22.950  1.00 79.27  ? 138  LYS A CD  1 
ATOM   470  C CE  . LYS A 1 73  ? 2.867  -23.516 23.294  1.00 88.66  ? 138  LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 73  ? 1.718  -22.861 24.000  1.00 85.71  ? 138  LYS A NZ  1 
ATOM   472  N N   . GLU A 1 74  ? 4.444  -29.928 20.566  1.00 64.44  ? 139  GLU A N   1 
ATOM   473  C CA  . GLU A 1 74  ? 4.817  -31.352 20.833  1.00 68.32  ? 139  GLU A CA  1 
ATOM   474  C C   . GLU A 1 74  ? 5.990  -31.834 20.006  1.00 63.82  ? 139  GLU A C   1 
ATOM   475  O O   . GLU A 1 74  ? 6.416  -32.978 20.117  1.00 64.64  ? 139  GLU A O   1 
ATOM   476  C CB  . GLU A 1 74  ? 3.650  -32.294 20.539  1.00 67.52  ? 139  GLU A CB  1 
ATOM   477  C CG  . GLU A 1 74  ? 3.474  -32.621 19.042  1.00 64.91  ? 139  GLU A CG  1 
ATOM   478  C CD  . GLU A 1 74  ? 2.865  -31.491 18.211  1.00 67.72  ? 139  GLU A CD  1 
ATOM   479  O OE1 . GLU A 1 74  ? 2.592  -30.363 18.744  1.00 63.37  ? 139  GLU A OE1 1 
ATOM   480  O OE2 . GLU A 1 74  ? 2.664  -31.754 16.992  1.00 65.83  ? 139  GLU A OE2 1 
ATOM   481  N N   . ASN A 1 75  ? 6.461  -30.987 19.113  1.00 64.66  ? 140  ASN A N   1 
ATOM   482  C CA  . ASN A 1 75  ? 7.522  -31.410 18.235  1.00 74.74  ? 140  ASN A CA  1 
ATOM   483  C C   . ASN A 1 75  ? 8.737  -30.467 18.248  1.00 86.28  ? 140  ASN A C   1 
ATOM   484  O O   . ASN A 1 75  ? 8.684  -29.354 17.684  1.00 89.22  ? 140  ASN A O   1 
ATOM   485  C CB  . ASN A 1 75  ? 6.969  -31.614 16.834  1.00 69.40  ? 140  ASN A CB  1 
ATOM   486  C CG  . ASN A 1 75  ? 7.716  -32.668 16.090  1.00 66.18  ? 140  ASN A CG  1 
ATOM   487  O OD1 . ASN A 1 75  ? 8.902  -32.895 16.333  1.00 73.48  ? 140  ASN A OD1 1 
ATOM   488  N ND2 . ASN A 1 75  ? 7.041  -33.326 15.186  1.00 57.68  ? 140  ASN A ND2 1 
ATOM   489  N N   . CYS A 1 76  ? 9.797  -30.909 18.942  1.00 85.64  ? 141  CYS A N   1 
ATOM   490  C CA  . CYS A 1 76  ? 11.062 -30.170 19.040  1.00 82.76  ? 141  CYS A CA  1 
ATOM   491  C C   . CYS A 1 76  ? 11.685 -30.087 17.647  1.00 76.02  ? 141  CYS A C   1 
ATOM   492  O O   . CYS A 1 76  ? 11.931 -28.989 17.163  1.00 75.31  ? 141  CYS A O   1 
ATOM   493  C CB  . CYS A 1 76  ? 12.051 -30.796 20.071  1.00 80.35  ? 141  CYS A CB  1 
ATOM   494  S SG  . CYS A 1 76  ? 13.794 -30.225 20.012  1.00 84.52  ? 141  CYS A SG  1 
ATOM   495  N N   . THR A 1 77  ? 11.904 -31.230 17.000  1.00 65.48  ? 142  THR A N   1 
ATOM   496  C CA  . THR A 1 77  ? 12.641 -31.256 15.745  1.00 65.08  ? 142  THR A CA  1 
ATOM   497  C C   . THR A 1 77  ? 11.976 -30.296 14.709  1.00 65.35  ? 142  THR A C   1 
ATOM   498  O O   . THR A 1 77  ? 12.585 -29.322 14.246  1.00 58.55  ? 142  THR A O   1 
ATOM   499  C CB  . THR A 1 77  ? 12.858 -32.712 15.221  1.00 58.51  ? 142  THR A CB  1 
ATOM   500  O OG1 . THR A 1 77  ? 13.135 -33.591 16.305  1.00 61.95  ? 142  THR A OG1 1 
ATOM   501  C CG2 . THR A 1 77  ? 14.053 -32.799 14.317  1.00 66.05  ? 142  THR A CG2 1 
ATOM   502  N N   . LEU A 1 78  ? 10.710 -30.544 14.418  1.00 63.50  ? 143  LEU A N   1 
ATOM   503  C CA  . LEU A 1 78  ? 9.960  -29.762 13.453  1.00 61.88  ? 143  LEU A CA  1 
ATOM   504  C C   . LEU A 1 78  ? 9.958  -28.260 13.781  1.00 61.84  ? 143  LEU A C   1 
ATOM   505  O O   . LEU A 1 78  ? 10.134 -27.420 12.881  1.00 60.41  ? 143  LEU A O   1 
ATOM   506  C CB  . LEU A 1 78  ? 8.522  -30.313 13.309  1.00 58.14  ? 143  LEU A CB  1 
ATOM   507  C CG  . LEU A 1 78  ? 7.710  -29.808 12.087  1.00 69.42  ? 143  LEU A CG  1 
ATOM   508  C CD1 . LEU A 1 78  ? 8.146  -30.559 10.832  1.00 63.61  ? 143  LEU A CD1 1 
ATOM   509  C CD2 . LEU A 1 78  ? 6.178  -29.865 12.259  1.00 61.09  ? 143  LEU A CD2 1 
ATOM   510  N N   . GLN A 1 79  ? 9.757  -27.906 15.051  1.00 55.07  ? 144  GLN A N   1 
ATOM   511  C CA  . GLN A 1 79  ? 9.812  -26.489 15.425  1.00 55.30  ? 144  GLN A CA  1 
ATOM   512  C C   . GLN A 1 79  ? 11.183 -25.888 15.045  1.00 57.79  ? 144  GLN A C   1 
ATOM   513  O O   . GLN A 1 79  ? 11.258 -24.793 14.479  1.00 59.72  ? 144  GLN A O   1 
ATOM   514  C CB  . GLN A 1 79  ? 9.522  -26.306 16.906  1.00 48.90  ? 144  GLN A CB  1 
ATOM   515  C CG  . GLN A 1 79  ? 8.072  -25.986 17.250  1.00 53.49  ? 144  GLN A CG  1 
ATOM   516  C CD  . GLN A 1 79  ? 7.870  -25.698 18.752  1.00 56.77  ? 144  GLN A CD  1 
ATOM   517  O OE1 . GLN A 1 79  ? 8.597  -26.233 19.611  1.00 53.46  ? 144  GLN A OE1 1 
ATOM   518  N NE2 . GLN A 1 79  ? 6.904  -24.821 19.074  1.00 54.42  ? 144  GLN A NE2 1 
ATOM   519  N N   . PHE A 1 80  ? 12.238 -26.650 15.332  1.00 52.72  ? 145  PHE A N   1 
ATOM   520  C CA  . PHE A 1 80  ? 13.617 -26.253 15.152  1.00 58.14  ? 145  PHE A CA  1 
ATOM   521  C C   . PHE A 1 80  ? 14.022 -26.077 13.686  1.00 55.12  ? 145  PHE A C   1 
ATOM   522  O O   . PHE A 1 80  ? 14.530 -25.041 13.301  1.00 57.85  ? 145  PHE A O   1 
ATOM   523  C CB  . PHE A 1 80  ? 14.519 -27.293 15.789  1.00 53.89  ? 145  PHE A CB  1 
ATOM   524  C CG  . PHE A 1 80  ? 15.958 -27.109 15.466  1.00 56.21  ? 145  PHE A CG  1 
ATOM   525  C CD1 . PHE A 1 80  ? 16.671 -26.054 16.039  1.00 63.35  ? 145  PHE A CD1 1 
ATOM   526  C CD2 . PHE A 1 80  ? 16.608 -27.981 14.615  1.00 54.18  ? 145  PHE A CD2 1 
ATOM   527  C CE1 . PHE A 1 80  ? 18.014 -25.879 15.755  1.00 55.29  ? 145  PHE A CE1 1 
ATOM   528  C CE2 . PHE A 1 80  ? 17.954 -27.820 14.320  1.00 58.00  ? 145  PHE A CE2 1 
ATOM   529  C CZ  . PHE A 1 80  ? 18.652 -26.764 14.907  1.00 56.10  ? 145  PHE A CZ  1 
ATOM   530  N N   . GLU A 1 81  ? 13.793 -27.102 12.889  1.00 53.19  ? 146  GLU A N   1 
ATOM   531  C CA  . GLU A 1 81  ? 14.114 -27.076 11.473  1.00 53.48  ? 146  GLU A CA  1 
ATOM   532  C C   . GLU A 1 81  ? 13.369 -25.940 10.842  1.00 57.72  ? 146  GLU A C   1 
ATOM   533  O O   . GLU A 1 81  ? 13.936 -25.216 10.060  1.00 63.33  ? 146  GLU A O   1 
ATOM   534  C CB  . GLU A 1 81  ? 13.711 -28.386 10.859  1.00 51.93  ? 146  GLU A CB  1 
ATOM   535  C CG  . GLU A 1 81  ? 14.438 -29.559 11.519  1.00 61.93  ? 146  GLU A CG  1 
ATOM   536  C CD  . GLU A 1 81  ? 15.825 -29.794 10.928  1.00 68.05  ? 146  GLU A CD  1 
ATOM   537  O OE1 . GLU A 1 81  ? 16.208 -29.068 9.986   1.00 63.48  ? 146  GLU A OE1 1 
ATOM   538  O OE2 . GLU A 1 81  ? 16.525 -30.725 11.370  1.00 71.85  ? 146  GLU A OE2 1 
ATOM   539  N N   . SER A 1 82  ? 12.116 -25.741 11.235  1.00 56.03  ? 147  SER A N   1 
ATOM   540  C CA  . SER A 1 82  ? 11.323 -24.655 10.683  1.00 58.44  ? 147  SER A CA  1 
ATOM   541  C C   . SER A 1 82  ? 11.876 -23.309 11.032  1.00 59.88  ? 147  SER A C   1 
ATOM   542  O O   . SER A 1 82  ? 11.852 -22.405 10.186  1.00 61.71  ? 147  SER A O   1 
ATOM   543  C CB  . SER A 1 82  ? 9.892  -24.680 11.201  1.00 56.97  ? 147  SER A CB  1 
ATOM   544  O OG  . SER A 1 82  ? 9.253  -25.769 10.647  1.00 68.86  ? 147  SER A OG  1 
ATOM   545  N N   . ALA A 1 83  ? 12.290 -23.143 12.291  1.00 53.36  ? 148  ALA A N   1 
ATOM   546  C CA  . ALA A 1 83  ? 12.867 -21.878 12.694  1.00 53.83  ? 148  ALA A CA  1 
ATOM   547  C C   . ALA A 1 83  ? 14.166 -21.681 11.884  1.00 49.95  ? 148  ALA A C   1 
ATOM   548  O O   . ALA A 1 83  ? 14.469 -20.602 11.426  1.00 47.56  ? 148  ALA A O   1 
ATOM   549  C CB  . ALA A 1 83  ? 13.136 -21.866 14.177  1.00 50.61  ? 148  ALA A CB  1 
ATOM   550  N N   . TRP A 1 84  ? 14.896 -22.753 11.643  1.00 49.18  ? 149  TRP A N   1 
ATOM   551  C CA  . TRP A 1 84  ? 16.105 -22.652 10.855  1.00 49.38  ? 149  TRP A CA  1 
ATOM   552  C C   . TRP A 1 84  ? 15.836 -22.161 9.423   1.00 54.23  ? 149  TRP A C   1 
ATOM   553  O O   . TRP A 1 84  ? 16.523 -21.266 8.911   1.00 50.34  ? 149  TRP A O   1 
ATOM   554  C CB  . TRP A 1 84  ? 16.792 -23.998 10.880  1.00 43.08  ? 149  TRP A CB  1 
ATOM   555  C CG  . TRP A 1 84  ? 18.186 -24.023 10.274  1.00 55.23  ? 149  TRP A CG  1 
ATOM   556  C CD1 . TRP A 1 84  ? 18.754 -23.124 9.361   1.00 57.49  ? 149  TRP A CD1 1 
ATOM   557  C CD2 . TRP A 1 84  ? 19.215 -25.044 10.486  1.00 55.67  ? 149  TRP A CD2 1 
ATOM   558  N NE1 . TRP A 1 84  ? 20.022 -23.502 9.039   1.00 56.23  ? 149  TRP A NE1 1 
ATOM   559  C CE2 . TRP A 1 84  ? 20.355 -24.650 9.674   1.00 61.60  ? 149  TRP A CE2 1 
ATOM   560  C CE3 . TRP A 1 84  ? 19.298 -26.201 11.249  1.00 61.81  ? 149  TRP A CE3 1 
ATOM   561  C CZ2 . TRP A 1 84  ? 21.526 -25.394 9.653   1.00 73.77  ? 149  TRP A CZ2 1 
ATOM   562  C CZ3 . TRP A 1 84  ? 20.467 -26.949 11.212  1.00 67.78  ? 149  TRP A CZ3 1 
ATOM   563  C CH2 . TRP A 1 84  ? 21.560 -26.553 10.439  1.00 73.05  ? 149  TRP A CH2 1 
ATOM   564  N N   . VAL A 1 85  ? 14.826 -22.752 8.779   1.00 49.55  ? 150  VAL A N   1 
ATOM   565  C CA  . VAL A 1 85  ? 14.410 -22.384 7.440   1.00 47.05  ? 150  VAL A CA  1 
ATOM   566  C C   . VAL A 1 85  ? 14.075 -20.901 7.420   1.00 48.56  ? 150  VAL A C   1 
ATOM   567  O O   . VAL A 1 85  ? 14.565 -20.144 6.580   1.00 48.41  ? 150  VAL A O   1 
ATOM   568  C CB  . VAL A 1 85  ? 13.193 -23.233 7.011   1.00 49.12  ? 150  VAL A CB  1 
ATOM   569  C CG1 . VAL A 1 85  ? 12.358 -22.551 5.924   1.00 47.49  ? 150  VAL A CG1 1 
ATOM   570  C CG2 . VAL A 1 85  ? 13.637 -24.642 6.597   1.00 41.81  ? 150  VAL A CG2 1 
ATOM   571  N N   . LEU A 1 86  ? 13.288 -20.476 8.384   1.00 44.76  ? 151  LEU A N   1 
ATOM   572  C CA  . LEU A 1 86  ? 12.843 -19.101 8.367   1.00 46.24  ? 151  LEU A CA  1 
ATOM   573  C C   . LEU A 1 86  ? 13.980 -18.187 8.718   1.00 47.11  ? 151  LEU A C   1 
ATOM   574  O O   . LEU A 1 86  ? 13.962 -16.977 8.389   1.00 48.77  ? 151  LEU A O   1 
ATOM   575  C CB  . LEU A 1 86  ? 11.685 -18.891 9.341   1.00 46.14  ? 151  LEU A CB  1 
ATOM   576  C CG  . LEU A 1 86  ? 10.429 -19.626 8.893   1.00 50.88  ? 151  LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 86  ? 9.439  -19.713 10.028  1.00 47.73  ? 151  LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 86  ? 9.827  -18.928 7.675   1.00 47.82  ? 151  LEU A CD2 1 
ATOM   579  N N   . THR A 1 87  ? 14.972 -18.751 9.397   1.00 43.91  ? 152  THR A N   1 
ATOM   580  C CA  . THR A 1 87  ? 16.091 -17.941 9.808   1.00 47.11  ? 152  THR A CA  1 
ATOM   581  C C   . THR A 1 87  ? 16.806 -17.554 8.504   1.00 49.36  ? 152  THR A C   1 
ATOM   582  O O   . THR A 1 87  ? 17.153 -16.367 8.269   1.00 46.58  ? 152  THR A O   1 
ATOM   583  C CB  . THR A 1 87  ? 17.001 -18.685 10.822  1.00 48.17  ? 152  THR A CB  1 
ATOM   584  O OG1 . THR A 1 87  ? 16.418 -18.594 12.139  1.00 54.24  ? 152  THR A OG1 1 
ATOM   585  C CG2 . THR A 1 87  ? 18.379 -18.067 10.896  1.00 43.71  ? 152  THR A CG2 1 
ATOM   586  N N   . ASN A 1 88  ? 16.953 -18.540 7.631   1.00 45.94  ? 153  ASN A N   1 
ATOM   587  C CA  . ASN A 1 88  ? 17.679 -18.298 6.407   1.00 50.35  ? 153  ASN A CA  1 
ATOM   588  C C   . ASN A 1 88  ? 16.960 -17.416 5.398   1.00 53.96  ? 153  ASN A C   1 
ATOM   589  O O   . ASN A 1 88  ? 17.543 -16.418 4.985   1.00 57.15  ? 153  ASN A O   1 
ATOM   590  C CB  . ASN A 1 88  ? 18.252 -19.562 5.852   1.00 49.92  ? 153  ASN A CB  1 
ATOM   591  C CG  . ASN A 1 88  ? 19.434 -20.038 6.679   1.00 47.33  ? 153  ASN A CG  1 
ATOM   592  O OD1 . ASN A 1 88  ? 19.938 -19.296 7.514   1.00 54.83  ? 153  ASN A OD1 1 
ATOM   593  N ND2 . ASN A 1 88  ? 19.866 -21.262 6.471   1.00 43.92  ? 153  ASN A ND2 1 
ATOM   594  N N   . ILE A 1 89  ? 15.692 -17.703 5.090   1.00 47.35  ? 154  ILE A N   1 
ATOM   595  C CA  . ILE A 1 89  ? 14.871 -16.749 4.335   1.00 44.86  ? 154  ILE A CA  1 
ATOM   596  C C   . ILE A 1 89  ? 15.018 -15.363 4.952   1.00 44.59  ? 154  ILE A C   1 
ATOM   597  O O   . ILE A 1 89  ? 15.226 -14.350 4.251   1.00 44.51  ? 154  ILE A O   1 
ATOM   598  C CB  . ILE A 1 89  ? 13.393 -17.163 4.302   1.00 50.86  ? 154  ILE A CB  1 
ATOM   599  C CG1 . ILE A 1 89  ? 13.267 -18.551 3.735   1.00 48.41  ? 154  ILE A CG1 1 
ATOM   600  C CG2 . ILE A 1 89  ? 12.486 -16.232 3.481   1.00 46.96  ? 154  ILE A CG2 1 
ATOM   601  C CD1 . ILE A 1 89  ? 11.870 -19.046 3.973   1.00 56.69  ? 154  ILE A CD1 1 
ATOM   602  N N   . ALA A 1 90  ? 14.962 -15.278 6.264   1.00 44.76  ? 155  ALA A N   1 
ATOM   603  C CA  . ALA A 1 90  ? 15.142 -13.948 6.862   1.00 41.95  ? 155  ALA A CA  1 
ATOM   604  C C   . ALA A 1 90  ? 16.603 -13.393 6.770   1.00 43.01  ? 155  ALA A C   1 
ATOM   605  O O   . ALA A 1 90  ? 16.856 -12.234 7.121   1.00 41.12  ? 155  ALA A O   1 
ATOM   606  C CB  . ALA A 1 90  ? 14.576 -13.913 8.256   1.00 41.86  ? 155  ALA A CB  1 
ATOM   607  N N   . SER A 1 91  ? 17.540 -14.174 6.214   1.00 46.29  ? 156  SER A N   1 
ATOM   608  C CA  . SER A 1 91  ? 18.879 -13.626 5.871   1.00 47.95  ? 156  SER A CA  1 
ATOM   609  C C   . SER A 1 91  ? 18.958 -12.975 4.466   1.00 59.59  ? 156  SER A C   1 
ATOM   610  O O   . SER A 1 91  ? 18.067 -13.130 3.573   1.00 50.60  ? 156  SER A O   1 
ATOM   611  C CB  . SER A 1 91  ? 19.952 -14.671 6.006   1.00 43.82  ? 156  SER A CB  1 
ATOM   612  O OG  . SER A 1 91  ? 19.628 -15.774 5.202   1.00 48.07  ? 156  SER A OG  1 
ATOM   613  N N   . GLY A 1 92  ? 19.996 -12.184 4.247   1.00 60.74  ? 157  GLY A N   1 
ATOM   614  C CA  . GLY A 1 92  ? 19.890 -11.325 3.060   1.00 71.80  ? 157  GLY A CA  1 
ATOM   615  C C   . GLY A 1 92  ? 18.514 -10.617 2.995   1.00 61.78  ? 157  GLY A C   1 
ATOM   616  O O   . GLY A 1 92  ? 17.994 -10.220 4.031   1.00 60.45  ? 157  GLY A O   1 
ATOM   617  N N   . ASN A 1 93  ? 17.917 -10.456 1.811   1.00 58.70  ? 158  ASN A N   1 
ATOM   618  C CA  . ASN A 1 93  ? 17.350 -9.112  1.511   1.00 55.30  ? 158  ASN A CA  1 
ATOM   619  C C   . ASN A 1 93  ? 15.993 -8.796  2.076   1.00 50.42  ? 158  ASN A C   1 
ATOM   620  O O   . ASN A 1 93  ? 15.227 -9.658  2.411   1.00 48.87  ? 158  ASN A O   1 
ATOM   621  C CB  . ASN A 1 93  ? 17.353 -8.756  0.000   1.00 55.53  ? 158  ASN A CB  1 
ATOM   622  C CG  . ASN A 1 93  ? 16.212 -9.435  -0.758  1.00 56.29  ? 158  ASN A CG  1 
ATOM   623  O OD1 . ASN A 1 93  ? 15.031 -9.324  -0.398  1.00 52.08  ? 158  ASN A OD1 1 
ATOM   624  N ND2 . ASN A 1 93  ? 16.570 -10.185 -1.785  1.00 54.65  ? 158  ASN A ND2 1 
ATOM   625  N N   . SER A 1 94  ? 15.695 -7.523  2.034   1.00 46.52  ? 159  SER A N   1 
ATOM   626  C CA  . SER A 1 94  ? 14.535 -6.963  2.565   1.00 45.86  ? 159  SER A CA  1 
ATOM   627  C C   . SER A 1 94  ? 13.213 -7.463  2.054   1.00 59.92  ? 159  SER A C   1 
ATOM   628  O O   . SER A 1 94  ? 12.209 -7.477  2.791   1.00 67.20  ? 159  SER A O   1 
ATOM   629  C CB  . SER A 1 94  ? 14.631 -5.508  2.265   1.00 45.62  ? 159  SER A CB  1 
ATOM   630  O OG  . SER A 1 94  ? 14.388 -4.817  3.442   1.00 57.70  ? 159  SER A OG  1 
ATOM   631  N N   . LEU A 1 95  ? 13.185 -7.830  0.782   1.00 65.19  ? 160  LEU A N   1 
ATOM   632  C CA  . LEU A 1 95  ? 11.935 -8.222  0.155   1.00 61.62  ? 160  LEU A CA  1 
ATOM   633  C C   . LEU A 1 95  ? 11.601 -9.648  0.579   1.00 60.05  ? 160  LEU A C   1 
ATOM   634  O O   . LEU A 1 95  ? 10.428 -10.002 0.820   1.00 63.65  ? 160  LEU A O   1 
ATOM   635  C CB  . LEU A 1 95  ? 12.072 -8.109  -1.372  1.00 72.49  ? 160  LEU A CB  1 
ATOM   636  C CG  . LEU A 1 95  ? 10.838 -7.747  -2.208  1.00 82.47  ? 160  LEU A CG  1 
ATOM   637  C CD1 . LEU A 1 95  ? 9.800  -8.887  -2.265  1.00 72.58  ? 160  LEU A CD1 1 
ATOM   638  C CD2 . LEU A 1 95  ? 10.241 -6.421  -1.713  1.00 88.22  ? 160  LEU A CD2 1 
ATOM   639  N N   . GLN A 1 96  ? 12.633 -10.481 0.679   1.00 55.22  ? 161  GLN A N   1 
ATOM   640  C CA  . GLN A 1 96  ? 12.442 -11.851 1.149   1.00 50.95  ? 161  GLN A CA  1 
ATOM   641  C C   . GLN A 1 96  ? 12.169 -11.874 2.662   1.00 55.51  ? 161  GLN A C   1 
ATOM   642  O O   . GLN A 1 96  ? 11.516 -12.792 3.186   1.00 59.31  ? 161  GLN A O   1 
ATOM   643  C CB  . GLN A 1 96  ? 13.658 -12.681 0.796   1.00 50.69  ? 161  GLN A CB  1 
ATOM   644  C CG  . GLN A 1 96  ? 14.336 -12.225 -0.473  1.00 45.88  ? 161  GLN A CG  1 
ATOM   645  C CD  . GLN A 1 96  ? 15.698 -12.832 -0.661  1.00 52.94  ? 161  GLN A CD  1 
ATOM   646  O OE1 . GLN A 1 96  ? 15.961 -13.393 -1.701  1.00 61.42  ? 161  GLN A OE1 1 
ATOM   647  N NE2 . GLN A 1 96  ? 16.576 -12.723 0.342   1.00 55.30  ? 161  GLN A NE2 1 
ATOM   648  N N   . THR A 1 97  ? 12.624 -10.845 3.374   1.00 50.75  ? 162  THR A N   1 
ATOM   649  C CA  . THR A 1 97  ? 12.405 -10.819 4.805   1.00 53.72  ? 162  THR A CA  1 
ATOM   650  C C   . THR A 1 97  ? 10.944 -10.444 5.075   1.00 57.66  ? 162  THR A C   1 
ATOM   651  O O   . THR A 1 97  ? 10.286 -11.075 5.902   1.00 61.99  ? 162  THR A O   1 
ATOM   652  C CB  . THR A 1 97  ? 13.434 -9.890  5.486   1.00 57.97  ? 162  THR A CB  1 
ATOM   653  O OG1 . THR A 1 97  ? 14.753 -10.467 5.363   1.00 57.09  ? 162  THR A OG1 1 
ATOM   654  C CG2 . THR A 1 97  ? 13.106 -9.672  6.939   1.00 45.68  ? 162  THR A CG2 1 
ATOM   655  N N   . ARG A 1 98  ? 10.440 -9.451  4.340   1.00 60.91  ? 163  ARG A N   1 
ATOM   656  C CA  . ARG A 1 98  ? 9.048  -8.986  4.436   1.00 63.56  ? 163  ARG A CA  1 
ATOM   657  C C   . ARG A 1 98  ? 8.057  -10.124 4.311   1.00 60.47  ? 163  ARG A C   1 
ATOM   658  O O   . ARG A 1 98  ? 7.021  -10.078 4.950   1.00 60.42  ? 163  ARG A O   1 
ATOM   659  C CB  . ARG A 1 98  ? 8.733  -7.916  3.380   1.00 76.26  ? 163  ARG A CB  1 
ATOM   660  C CG  . ARG A 1 98  ? 7.511  -7.043  3.669   1.00 82.26  ? 163  ARG A CG  1 
ATOM   661  C CD  . ARG A 1 98  ? 7.781  -5.584  3.288   1.00 90.56  ? 163  ARG A CD  1 
ATOM   662  N NE  . ARG A 1 98  ? 8.640  -5.470  2.096   1.00 109.05 ? 163  ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 98  ? 9.525  -4.494  1.852   1.00 109.30 ? 163  ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 98  ? 9.708  -3.486  2.709   1.00 103.01 ? 163  ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 98  ? 10.244 -4.530  0.734   1.00 104.59 ? 163  ARG A NH2 1 
ATOM   666  N N   . ILE A 1 99  ? 8.362  -11.161 3.532   1.00 55.11  ? 164  ILE A N   1 
ATOM   667  C CA  . ILE A 1 99  ? 7.435  -12.293 3.480   1.00 57.12  ? 164  ILE A CA  1 
ATOM   668  C C   . ILE A 1 99  ? 7.300  -12.996 4.831   1.00 65.03  ? 164  ILE A C   1 
ATOM   669  O O   . ILE A 1 99  ? 6.209  -13.435 5.182   1.00 67.77  ? 164  ILE A O   1 
ATOM   670  C CB  . ILE A 1 99  ? 7.798  -13.296 2.379   1.00 56.79  ? 164  ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 99  ? 7.479  -12.709 0.975   1.00 73.46  ? 164  ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 99  ? 7.037  -14.591 2.565   1.00 54.07  ? 164  ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 99  ? 6.113  -12.027 0.818   1.00 67.81  ? 164  ILE A CD1 1 
ATOM   674  N N   . VAL A 1 100 ? 8.414  -13.111 5.571   1.00 62.66  ? 165  VAL A N   1 
ATOM   675  C CA  . VAL A 1 100 ? 8.419  -13.798 6.855   1.00 51.49  ? 165  VAL A CA  1 
ATOM   676  C C   . VAL A 1 100 ? 7.646  -12.976 7.907   1.00 47.00  ? 165  VAL A C   1 
ATOM   677  O O   . VAL A 1 100 ? 6.842  -13.518 8.687   1.00 45.09  ? 165  VAL A O   1 
ATOM   678  C CB  . VAL A 1 100 ? 9.857  -14.110 7.346   1.00 54.36  ? 165  VAL A CB  1 
ATOM   679  C CG1 . VAL A 1 100 ? 9.812  -14.787 8.718   1.00 51.53  ? 165  VAL A CG1 1 
ATOM   680  C CG2 . VAL A 1 100 ? 10.568 -15.020 6.374   1.00 46.55  ? 165  VAL A CG2 1 
ATOM   681  N N   . ILE A 1 101 ? 7.898  -11.676 7.937   1.00 41.15  ? 166  ILE A N   1 
ATOM   682  C CA  . ILE A 1 101 ? 7.101  -10.760 8.730   1.00 47.96  ? 166  ILE A CA  1 
ATOM   683  C C   . ILE A 1 101 ? 5.569  -10.813 8.419   1.00 55.02  ? 166  ILE A C   1 
ATOM   684  O O   . ILE A 1 101 ? 4.751  -10.904 9.333   1.00 49.09  ? 166  ILE A O   1 
ATOM   685  C CB  . ILE A 1 101 ? 7.622  -9.333  8.519   1.00 50.37  ? 166  ILE A CB  1 
ATOM   686  C CG1 . ILE A 1 101 ? 9.087  -9.269  9.009   1.00 51.22  ? 166  ILE A CG1 1 
ATOM   687  C CG2 . ILE A 1 101 ? 6.656  -8.288  9.120   1.00 44.30  ? 166  ILE A CG2 1 
ATOM   688  C CD1 . ILE A 1 101 ? 9.850  -7.995  8.627   1.00 51.66  ? 166  ILE A CD1 1 
ATOM   689  N N   . GLN A 1 102 ? 5.201  -10.794 7.130   1.00 59.39  ? 167  GLN A N   1 
ATOM   690  C CA  . GLN A 1 102 ? 3.809  -10.743 6.711   1.00 57.09  ? 167  GLN A CA  1 
ATOM   691  C C   . GLN A 1 102 ? 3.074  -12.014 7.041   1.00 53.24  ? 167  GLN A C   1 
ATOM   692  O O   . GLN A 1 102 ? 1.866  -11.976 7.190   1.00 59.69  ? 167  GLN A O   1 
ATOM   693  C CB  . GLN A 1 102 ? 3.680  -10.456 5.218   1.00 65.17  ? 167  GLN A CB  1 
ATOM   694  C CG  . GLN A 1 102 ? 3.647  -8.985  4.851   1.00 77.85  ? 167  GLN A CG  1 
ATOM   695  C CD  . GLN A 1 102 ? 3.924  -8.764  3.371   1.00 95.44  ? 167  GLN A CD  1 
ATOM   696  O OE1 . GLN A 1 102 ? 4.076  -9.719  2.583   1.00 96.99  ? 167  GLN A OE1 1 
ATOM   697  N NE2 . GLN A 1 102 ? 4.002  -7.495  2.980   1.00 114.13 ? 167  GLN A NE2 1 
ATOM   698  N N   . ALA A 1 103 ? 3.777  -13.139 7.163   1.00 49.11  ? 168  ALA A N   1 
ATOM   699  C CA  . ALA A 1 103 ? 3.125  -14.379 7.645   1.00 48.28  ? 168  ALA A CA  1 
ATOM   700  C C   . ALA A 1 103 ? 3.017  -14.444 9.172   1.00 54.96  ? 168  ALA A C   1 
ATOM   701  O O   . ALA A 1 103 ? 2.792  -15.542 9.744   1.00 51.55  ? 168  ALA A O   1 
ATOM   702  C CB  . ALA A 1 103 ? 3.886  -15.587 7.126   1.00 40.78  ? 168  ALA A CB  1 
ATOM   703  N N   . GLY A 1 104 ? 3.240  -13.284 9.821   1.00 53.35  ? 169  GLY A N   1 
ATOM   704  C CA  . GLY A 1 104 ? 3.261  -13.140 11.293  1.00 58.39  ? 169  GLY A CA  1 
ATOM   705  C C   . GLY A 1 104 ? 4.229  -14.041 12.066  1.00 58.22  ? 169  GLY A C   1 
ATOM   706  O O   . GLY A 1 104 ? 3.823  -14.692 13.021  1.00 54.42  ? 169  GLY A O   1 
ATOM   707  N N   . ALA A 1 105 ? 5.497  -14.126 11.656  1.00 56.34  ? 170  ALA A N   1 
ATOM   708  C CA  . ALA A 1 105 ? 6.398  -15.097 12.300  1.00 52.00  ? 170  ALA A CA  1 
ATOM   709  C C   . ALA A 1 105 ? 6.941  -14.507 13.588  1.00 52.57  ? 170  ALA A C   1 
ATOM   710  O O   . ALA A 1 105 ? 7.292  -15.243 14.509  1.00 58.73  ? 170  ALA A O   1 
ATOM   711  C CB  . ALA A 1 105 ? 7.548  -15.491 11.398  1.00 50.53  ? 170  ALA A CB  1 
ATOM   712  N N   . VAL A 1 106 ? 6.982  -13.182 13.661  1.00 47.24  ? 171  VAL A N   1 
ATOM   713  C CA  . VAL A 1 106 ? 7.578  -12.518 14.789  1.00 43.65  ? 171  VAL A CA  1 
ATOM   714  C C   . VAL A 1 106 ? 6.932  -12.823 16.157  1.00 51.26  ? 171  VAL A C   1 
ATOM   715  O O   . VAL A 1 106 ? 7.630  -13.376 17.027  1.00 57.75  ? 171  VAL A O   1 
ATOM   716  C CB  . VAL A 1 106 ? 7.781  -11.029 14.514  1.00 45.76  ? 171  VAL A CB  1 
ATOM   717  C CG1 . VAL A 1 106 ? 8.132  -10.290 15.779  1.00 47.29  ? 171  VAL A CG1 1 
ATOM   718  C CG2 . VAL A 1 106 ? 8.884  -10.853 13.470  1.00 46.45  ? 171  VAL A CG2 1 
ATOM   719  N N   . PRO A 1 107 ? 5.613  -12.541 16.355  1.00 52.08  ? 172  PRO A N   1 
ATOM   720  C CA  . PRO A 1 107 ? 5.043  -12.896 17.707  1.00 43.75  ? 172  PRO A CA  1 
ATOM   721  C C   . PRO A 1 107 ? 5.237  -14.369 18.042  1.00 49.90  ? 172  PRO A C   1 
ATOM   722  O O   . PRO A 1 107 ? 5.528  -14.728 19.198  1.00 48.89  ? 172  PRO A O   1 
ATOM   723  C CB  . PRO A 1 107 ? 3.560  -12.566 17.576  1.00 38.22  ? 172  PRO A CB  1 
ATOM   724  C CG  . PRO A 1 107 ? 3.519  -11.469 16.534  1.00 48.29  ? 172  PRO A CG  1 
ATOM   725  C CD  . PRO A 1 107 ? 4.677  -11.706 15.559  1.00 47.99  ? 172  PRO A CD  1 
ATOM   726  N N   . ILE A 1 108 ? 5.154  -15.226 17.031  1.00 44.20  ? 173  ILE A N   1 
ATOM   727  C CA  . ILE A 1 108 ? 5.410  -16.614 17.281  1.00 44.92  ? 173  ILE A CA  1 
ATOM   728  C C   . ILE A 1 108 ? 6.877  -16.782 17.753  1.00 57.20  ? 173  ILE A C   1 
ATOM   729  O O   . ILE A 1 108 ? 7.123  -17.413 18.787  1.00 67.22  ? 173  ILE A O   1 
ATOM   730  C CB  . ILE A 1 108 ? 5.031  -17.490 16.054  1.00 45.26  ? 173  ILE A CB  1 
ATOM   731  C CG1 . ILE A 1 108 ? 3.508  -17.506 15.737  1.00 50.94  ? 173  ILE A CG1 1 
ATOM   732  C CG2 . ILE A 1 108 ? 5.407  -18.919 16.290  1.00 40.96  ? 173  ILE A CG2 1 
ATOM   733  C CD1 . ILE A 1 108 ? 2.718  -16.173 15.718  1.00 49.71  ? 173  ILE A CD1 1 
ATOM   734  N N   . PHE A 1 109 ? 7.863  -16.209 17.046  1.00 52.90  ? 174  PHE A N   1 
ATOM   735  C CA  . PHE A 1 109 ? 9.250  -16.458 17.463  1.00 52.54  ? 174  PHE A CA  1 
ATOM   736  C C   . PHE A 1 109 ? 9.456  -15.953 18.878  1.00 46.99  ? 174  PHE A C   1 
ATOM   737  O O   . PHE A 1 109 ? 10.083 -16.606 19.682  1.00 44.27  ? 174  PHE A O   1 
ATOM   738  C CB  . PHE A 1 109 ? 10.293 -15.805 16.540  1.00 52.86  ? 174  PHE A CB  1 
ATOM   739  C CG  . PHE A 1 109 ? 10.572 -16.592 15.310  1.00 46.15  ? 174  PHE A CG  1 
ATOM   740  C CD1 . PHE A 1 109 ? 10.961 -17.929 15.406  1.00 41.58  ? 174  PHE A CD1 1 
ATOM   741  C CD2 . PHE A 1 109 ? 10.424 -16.009 14.064  1.00 38.47  ? 174  PHE A CD2 1 
ATOM   742  C CE1 . PHE A 1 109 ? 11.200 -18.680 14.266  1.00 39.19  ? 174  PHE A CE1 1 
ATOM   743  C CE2 . PHE A 1 109 ? 10.656 -16.750 12.933  1.00 39.17  ? 174  PHE A CE2 1 
ATOM   744  C CZ  . PHE A 1 109 ? 11.045 -18.083 13.029  1.00 41.47  ? 174  PHE A CZ  1 
ATOM   745  N N   . ILE A 1 110 ? 8.942  -14.769 19.154  1.00 44.09  ? 175  ILE A N   1 
ATOM   746  C CA  . ILE A 1 110 ? 8.994  -14.232 20.481  1.00 49.81  ? 175  ILE A CA  1 
ATOM   747  C C   . ILE A 1 110 ? 8.413  -15.200 21.530  1.00 54.58  ? 175  ILE A C   1 
ATOM   748  O O   . ILE A 1 110 ? 9.082  -15.511 22.518  1.00 53.70  ? 175  ILE A O   1 
ATOM   749  C CB  . ILE A 1 110 ? 8.281  -12.885 20.553  1.00 42.43  ? 175  ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 110 ? 9.128  -11.873 19.794  1.00 43.70  ? 175  ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 110 ? 8.051  -12.506 22.028  1.00 41.40  ? 175  ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 110 ? 8.506  -10.489 19.728  1.00 50.42  ? 175  ILE A CD1 1 
ATOM   753  N N   . GLU A 1 111 ? 7.205  -15.711 21.282  1.00 60.99  ? 176  GLU A N   1 
ATOM   754  C CA  . GLU A 1 111 ? 6.583  -16.659 22.224  1.00 66.46  ? 176  GLU A CA  1 
ATOM   755  C C   . GLU A 1 111 ? 7.549  -17.851 22.299  1.00 59.05  ? 176  GLU A C   1 
ATOM   756  O O   . GLU A 1 111 ? 7.747  -18.407 23.370  1.00 64.75  ? 176  GLU A O   1 
ATOM   757  C CB  . GLU A 1 111 ? 5.061  -16.957 21.931  1.00 66.50  ? 176  GLU A CB  1 
ATOM   758  C CG  . GLU A 1 111 ? 4.621  -18.383 21.472  1.00 88.74  ? 176  GLU A CG  1 
ATOM   759  C CD  . GLU A 1 111 ? 3.278  -18.467 20.644  1.00 94.86  ? 176  GLU A CD  1 
ATOM   760  O OE1 . GLU A 1 111 ? 2.497  -17.468 20.649  1.00 78.56  ? 176  GLU A OE1 1 
ATOM   761  O OE2 . GLU A 1 111 ? 3.009  -19.526 19.955  1.00 70.60  ? 176  GLU A OE2 1 
ATOM   762  N N   . LEU A 1 112 ? 8.250  -18.159 21.208  1.00 53.69  ? 177  LEU A N   1 
ATOM   763  C CA  . LEU A 1 112 ? 9.203  -19.278 21.220  1.00 52.42  ? 177  LEU A CA  1 
ATOM   764  C C   . LEU A 1 112 ? 10.512 -19.021 22.020  1.00 51.49  ? 177  LEU A C   1 
ATOM   765  O O   . LEU A 1 112 ? 11.257 -19.967 22.330  1.00 43.27  ? 177  LEU A O   1 
ATOM   766  C CB  . LEU A 1 112 ? 9.519  -19.707 19.806  1.00 52.98  ? 177  LEU A CB  1 
ATOM   767  C CG  . LEU A 1 112 ? 8.479  -20.603 19.165  1.00 55.82  ? 177  LEU A CG  1 
ATOM   768  C CD1 . LEU A 1 112 ? 9.083  -21.127 17.869  1.00 49.16  ? 177  LEU A CD1 1 
ATOM   769  C CD2 . LEU A 1 112 ? 8.150  -21.781 20.078  1.00 57.88  ? 177  LEU A CD2 1 
ATOM   770  N N   . LEU A 1 113 ? 10.770 -17.752 22.346  1.00 47.04  ? 178  LEU A N   1 
ATOM   771  C CA  . LEU A 1 113 ? 11.860 -17.357 23.252  1.00 54.37  ? 178  LEU A CA  1 
ATOM   772  C C   . LEU A 1 113 ? 11.677 -18.063 24.600  1.00 67.38  ? 178  LEU A C   1 
ATOM   773  O O   . LEU A 1 113 ? 12.650 -18.309 25.346  1.00 66.14  ? 178  LEU A O   1 
ATOM   774  C CB  . LEU A 1 113 ? 11.891 -15.813 23.450  1.00 48.03  ? 178  LEU A CB  1 
ATOM   775  C CG  . LEU A 1 113 ? 12.343 -15.051 22.190  1.00 44.79  ? 178  LEU A CG  1 
ATOM   776  C CD1 . LEU A 1 113 ? 12.411 -13.528 22.336  1.00 44.95  ? 178  LEU A CD1 1 
ATOM   777  C CD2 . LEU A 1 113 ? 13.672 -15.634 21.721  1.00 38.20  ? 178  LEU A CD2 1 
ATOM   778  N N   . SER A 1 114 ? 10.418 -18.417 24.886  1.00 64.64  ? 179  SER A N   1 
ATOM   779  C CA  . SER A 1 114 ? 10.053 -19.035 26.145  1.00 61.85  ? 179  SER A CA  1 
ATOM   780  C C   . SER A 1 114 ? 9.860  -20.559 26.036  1.00 60.45  ? 179  SER A C   1 
ATOM   781  O O   . SER A 1 114 ? 9.577  -21.221 26.995  1.00 54.91  ? 179  SER A O   1 
ATOM   782  C CB  . SER A 1 114 ? 8.855  -18.311 26.757  1.00 55.71  ? 179  SER A CB  1 
ATOM   783  O OG  . SER A 1 114 ? 8.839  -16.924 26.354  1.00 67.58  ? 179  SER A OG  1 
ATOM   784  N N   . SER A 1 115 ? 10.083 -21.150 24.890  1.00 57.32  ? 180  SER A N   1 
ATOM   785  C CA  . SER A 1 115 ? 9.841  -22.576 24.823  1.00 56.66  ? 180  SER A CA  1 
ATOM   786  C C   . SER A 1 115 ? 10.722 -23.324 25.845  1.00 68.30  ? 180  SER A C   1 
ATOM   787  O O   . SER A 1 115 ? 11.748 -22.806 26.290  1.00 66.22  ? 180  SER A O   1 
ATOM   788  C CB  . SER A 1 115 ? 10.056 -23.050 23.389  1.00 52.12  ? 180  SER A CB  1 
ATOM   789  O OG  . SER A 1 115 ? 10.899 -24.163 23.284  1.00 58.40  ? 180  SER A OG  1 
ATOM   790  N N   . GLU A 1 116 ? 10.293 -24.530 26.233  1.00 78.34  ? 181  GLU A N   1 
ATOM   791  C CA  . GLU A 1 116 ? 11.067 -25.411 27.120  1.00 78.35  ? 181  GLU A CA  1 
ATOM   792  C C   . GLU A 1 116 ? 12.252 -26.023 26.360  1.00 77.15  ? 181  GLU A C   1 
ATOM   793  O O   . GLU A 1 116 ? 13.107 -26.718 26.933  1.00 83.10  ? 181  GLU A O   1 
ATOM   794  C CB  . GLU A 1 116 ? 10.168 -26.522 27.678  1.00 79.84  ? 181  GLU A CB  1 
ATOM   795  C CG  . GLU A 1 116 ? 10.389 -27.886 27.015  1.00 82.21  ? 181  GLU A CG  1 
ATOM   796  C CD  . GLU A 1 116 ? 9.174  -28.794 27.057  1.00 87.08  ? 181  GLU A CD  1 
ATOM   797  O OE1 . GLU A 1 116 ? 8.030  -28.289 26.981  1.00 81.69  ? 181  GLU A OE1 1 
ATOM   798  O OE2 . GLU A 1 116 ? 9.375  -30.024 27.147  1.00 84.83  ? 181  GLU A OE2 1 
ATOM   799  N N   . PHE A 1 117 ? 12.275 -25.795 25.054  1.00 75.56  ? 182  PHE A N   1 
ATOM   800  C CA  . PHE A 1 117 ? 13.317 -26.340 24.230  1.00 80.61  ? 182  PHE A CA  1 
ATOM   801  C C   . PHE A 1 117 ? 14.370 -25.280 23.974  1.00 86.68  ? 182  PHE A C   1 
ATOM   802  O O   . PHE A 1 117 ? 14.084 -24.132 23.593  1.00 80.87  ? 182  PHE A O   1 
ATOM   803  C CB  . PHE A 1 117 ? 12.756 -26.877 22.940  1.00 81.37  ? 182  PHE A CB  1 
ATOM   804  C CG  . PHE A 1 117 ? 11.835 -28.038 23.121  1.00 89.52  ? 182  PHE A CG  1 
ATOM   805  C CD1 . PHE A 1 117 ? 12.208 -29.125 23.904  1.00 91.78  ? 182  PHE A CD1 1 
ATOM   806  C CD2 . PHE A 1 117 ? 10.589 -28.053 22.502  1.00 90.21  ? 182  PHE A CD2 1 
ATOM   807  C CE1 . PHE A 1 117 ? 11.360 -30.214 24.055  1.00 84.60  ? 182  PHE A CE1 1 
ATOM   808  C CE2 . PHE A 1 117 ? 9.739  -29.134 22.655  1.00 92.28  ? 182  PHE A CE2 1 
ATOM   809  C CZ  . PHE A 1 117 ? 10.129 -30.218 23.431  1.00 88.12  ? 182  PHE A CZ  1 
ATOM   810  N N   . GLU A 1 118 ? 15.593 -25.710 24.239  1.00 87.23  ? 183  GLU A N   1 
ATOM   811  C CA  . GLU A 1 118 ? 16.800 -24.916 24.192  1.00 85.82  ? 183  GLU A CA  1 
ATOM   812  C C   . GLU A 1 118 ? 17.137 -24.581 22.729  1.00 83.68  ? 183  GLU A C   1 
ATOM   813  O O   . GLU A 1 118 ? 17.348 -23.405 22.367  1.00 67.90  ? 183  GLU A O   1 
ATOM   814  C CB  . GLU A 1 118 ? 17.911 -25.776 24.807  1.00 109.23 ? 183  GLU A CB  1 
ATOM   815  C CG  . GLU A 1 118 ? 17.657 -27.296 24.646  1.00 125.50 ? 183  GLU A CG  1 
ATOM   816  C CD  . GLU A 1 118 ? 18.913 -28.170 24.708  1.00 125.05 ? 183  GLU A CD  1 
ATOM   817  O OE1 . GLU A 1 118 ? 19.629 -28.114 25.730  1.00 137.23 ? 183  GLU A OE1 1 
ATOM   818  O OE2 . GLU A 1 118 ? 19.176 -28.933 23.745  1.00 113.55 ? 183  GLU A OE2 1 
ATOM   819  N N   . ASP A 1 119 ? 17.180 -25.633 21.901  1.00 71.01  ? 184  ASP A N   1 
ATOM   820  C CA  . ASP A 1 119 ? 17.454 -25.523 20.492  1.00 65.98  ? 184  ASP A CA  1 
ATOM   821  C C   . ASP A 1 119 ? 16.446 -24.608 19.809  1.00 64.47  ? 184  ASP A C   1 
ATOM   822  O O   . ASP A 1 119 ? 16.804 -23.826 18.947  1.00 67.76  ? 184  ASP A O   1 
ATOM   823  C CB  . ASP A 1 119 ? 17.482 -26.909 19.861  1.00 62.56  ? 184  ASP A CB  1 
ATOM   824  C CG  . ASP A 1 119 ? 18.732 -27.695 20.252  1.00 75.23  ? 184  ASP A CG  1 
ATOM   825  O OD1 . ASP A 1 119 ? 19.554 -27.192 21.056  1.00 77.69  ? 184  ASP A OD1 1 
ATOM   826  O OD2 . ASP A 1 119 ? 18.908 -28.830 19.765  1.00 78.07  ? 184  ASP A OD2 1 
ATOM   827  N N   . VAL A 1 120 ? 15.194 -24.674 20.233  1.00 55.73  ? 185  VAL A N   1 
ATOM   828  C CA  . VAL A 1 120 ? 14.179 -23.866 19.622  1.00 52.15  ? 185  VAL A CA  1 
ATOM   829  C C   . VAL A 1 120 ? 14.358 -22.466 20.126  1.00 56.83  ? 185  VAL A C   1 
ATOM   830  O O   . VAL A 1 120 ? 14.312 -21.500 19.382  1.00 71.41  ? 185  VAL A O   1 
ATOM   831  C CB  . VAL A 1 120 ? 12.778 -24.371 19.985  1.00 49.18  ? 185  VAL A CB  1 
ATOM   832  C CG1 . VAL A 1 120 ? 11.731 -23.381 19.536  1.00 42.52  ? 185  VAL A CG1 1 
ATOM   833  C CG2 . VAL A 1 120 ? 12.537 -25.788 19.448  1.00 41.65  ? 185  VAL A CG2 1 
ATOM   834  N N   . GLN A 1 121 ? 14.559 -22.348 21.414  1.00 58.16  ? 186  GLN A N   1 
ATOM   835  C CA  . GLN A 1 121 ? 14.780 -21.052 21.993  1.00 57.92  ? 186  GLN A CA  1 
ATOM   836  C C   . GLN A 1 121 ? 15.904 -20.311 21.232  1.00 58.33  ? 186  GLN A C   1 
ATOM   837  O O   . GLN A 1 121 ? 15.796 -19.115 20.919  1.00 57.32  ? 186  GLN A O   1 
ATOM   838  C CB  . GLN A 1 121 ? 15.180 -21.263 23.454  1.00 56.83  ? 186  GLN A CB  1 
ATOM   839  C CG  . GLN A 1 121 ? 14.092 -21.030 24.511  1.00 56.13  ? 186  GLN A CG  1 
ATOM   840  C CD  . GLN A 1 121 ? 14.687 -21.027 25.927  1.00 50.16  ? 186  GLN A CD  1 
ATOM   841  O OE1 . GLN A 1 121 ? 15.589 -21.792 26.237  1.00 43.70  ? 186  GLN A OE1 1 
ATOM   842  N NE2 . GLN A 1 121 ? 14.219 -20.133 26.748  1.00 46.77  ? 186  GLN A NE2 1 
ATOM   843  N N   . GLU A 1 122 ? 16.976 -21.045 20.943  1.00 59.24  ? 187  GLU A N   1 
ATOM   844  C CA  . GLU A 1 122 ? 18.173 -20.495 20.326  1.00 62.83  ? 187  GLU A CA  1 
ATOM   845  C C   . GLU A 1 122 ? 17.926 -20.036 18.915  1.00 62.02  ? 187  GLU A C   1 
ATOM   846  O O   . GLU A 1 122 ? 18.264 -18.897 18.570  1.00 58.69  ? 187  GLU A O   1 
ATOM   847  C CB  . GLU A 1 122 ? 19.288 -21.531 20.276  1.00 61.56  ? 187  GLU A CB  1 
ATOM   848  C CG  . GLU A 1 122 ? 20.182 -21.502 21.483  1.00 70.87  ? 187  GLU A CG  1 
ATOM   849  C CD  . GLU A 1 122 ? 21.245 -22.566 21.399  1.00 80.34  ? 187  GLU A CD  1 
ATOM   850  O OE1 . GLU A 1 122 ? 22.011 -22.556 20.395  1.00 75.28  ? 187  GLU A OE1 1 
ATOM   851  O OE2 . GLU A 1 122 ? 21.288 -23.415 22.325  1.00 89.89  ? 187  GLU A OE2 1 
ATOM   852  N N   . GLN A 1 123 ? 17.360 -20.939 18.107  1.00 48.86  ? 188  GLN A N   1 
ATOM   853  C CA  . GLN A 1 123 ? 17.112 -20.673 16.710  1.00 46.40  ? 188  GLN A CA  1 
ATOM   854  C C   . GLN A 1 123 ? 16.142 -19.511 16.573  1.00 45.46  ? 188  GLN A C   1 
ATOM   855  O O   . GLN A 1 123 ? 16.216 -18.775 15.630  1.00 54.23  ? 188  GLN A O   1 
ATOM   856  C CB  . GLN A 1 123 ? 16.588 -21.922 16.039  1.00 49.07  ? 188  GLN A CB  1 
ATOM   857  C CG  . GLN A 1 123 ? 16.848 -22.016 14.553  1.00 53.38  ? 188  GLN A CG  1 
ATOM   858  C CD  . GLN A 1 123 ? 18.265 -21.632 14.159  1.00 63.49  ? 188  GLN A CD  1 
ATOM   859  O OE1 . GLN A 1 123 ? 19.265 -22.235 14.590  1.00 69.89  ? 188  GLN A OE1 1 
ATOM   860  N NE2 . GLN A 1 123 ? 18.358 -20.615 13.335  1.00 59.97  ? 188  GLN A NE2 1 
ATOM   861  N N   . ALA A 1 124 ? 15.268 -19.316 17.548  1.00 41.62  ? 189  ALA A N   1 
ATOM   862  C CA  . ALA A 1 124 ? 14.229 -18.344 17.411  1.00 42.60  ? 189  ALA A CA  1 
ATOM   863  C C   . ALA A 1 124 ? 14.831 -17.030 17.669  1.00 42.79  ? 189  ALA A C   1 
ATOM   864  O O   . ALA A 1 124 ? 14.302 -16.001 17.239  1.00 45.41  ? 189  ALA A O   1 
ATOM   865  C CB  . ALA A 1 124 ? 13.122 -18.593 18.422  1.00 49.38  ? 189  ALA A CB  1 
ATOM   866  N N   . VAL A 1 125 ? 15.924 -17.021 18.427  1.00 44.56  ? 190  VAL A N   1 
ATOM   867  C CA  . VAL A 1 125 ? 16.489 -15.707 18.766  1.00 46.87  ? 190  VAL A CA  1 
ATOM   868  C C   . VAL A 1 125 ? 17.306 -15.314 17.540  1.00 42.22  ? 190  VAL A C   1 
ATOM   869  O O   . VAL A 1 125 ? 17.374 -14.140 17.147  1.00 46.39  ? 190  VAL A O   1 
ATOM   870  C CB  . VAL A 1 125 ? 17.284 -15.654 20.111  1.00 47.84  ? 190  VAL A CB  1 
ATOM   871  C CG1 . VAL A 1 125 ? 18.649 -16.270 19.964  1.00 40.62  ? 190  VAL A CG1 1 
ATOM   872  C CG2 . VAL A 1 125 ? 17.463 -14.215 20.555  1.00 41.76  ? 190  VAL A CG2 1 
ATOM   873  N N   . TRP A 1 126 ? 17.850 -16.334 16.908  1.00 40.73  ? 191  TRP A N   1 
ATOM   874  C CA  . TRP A 1 126 ? 18.549 -16.174 15.649  1.00 45.71  ? 191  TRP A CA  1 
ATOM   875  C C   . TRP A 1 126 ? 17.679 -15.522 14.609  1.00 46.48  ? 191  TRP A C   1 
ATOM   876  O O   . TRP A 1 126 ? 18.010 -14.424 14.138  1.00 50.00  ? 191  TRP A O   1 
ATOM   877  C CB  . TRP A 1 126 ? 19.034 -17.513 15.143  1.00 42.51  ? 191  TRP A CB  1 
ATOM   878  C CG  . TRP A 1 126 ? 20.178 -17.326 14.210  1.00 44.53  ? 191  TRP A CG  1 
ATOM   879  C CD1 . TRP A 1 126 ? 20.435 -16.221 13.384  1.00 39.32  ? 191  TRP A CD1 1 
ATOM   880  C CD2 . TRP A 1 126 ? 21.283 -18.242 13.996  1.00 42.61  ? 191  TRP A CD2 1 
ATOM   881  N NE1 . TRP A 1 126 ? 21.572 -16.418 12.668  1.00 39.29  ? 191  TRP A NE1 1 
ATOM   882  C CE2 . TRP A 1 126 ? 22.153 -17.597 13.001  1.00 44.87  ? 191  TRP A CE2 1 
ATOM   883  C CE3 . TRP A 1 126 ? 21.660 -19.464 14.545  1.00 45.54  ? 191  TRP A CE3 1 
ATOM   884  C CZ2 . TRP A 1 126 ? 23.323 -18.192 12.557  1.00 46.71  ? 191  TRP A CZ2 1 
ATOM   885  C CZ3 . TRP A 1 126 ? 22.860 -20.051 14.119  1.00 43.51  ? 191  TRP A CZ3 1 
ATOM   886  C CH2 . TRP A 1 126 ? 23.665 -19.433 13.132  1.00 52.02  ? 191  TRP A CH2 1 
ATOM   887  N N   . ALA A 1 127 ? 16.587 -16.192 14.233  1.00 39.24  ? 192  ALA A N   1 
ATOM   888  C CA  . ALA A 1 127 ? 15.618 -15.609 13.291  1.00 40.62  ? 192  ALA A CA  1 
ATOM   889  C C   . ALA A 1 127 ? 15.209 -14.200 13.690  1.00 43.78  ? 192  ALA A C   1 
ATOM   890  O O   . ALA A 1 127 ? 15.038 -13.348 12.826  1.00 48.24  ? 192  ALA A O   1 
ATOM   891  C CB  . ALA A 1 127 ? 14.396 -16.464 13.188  1.00 37.22  ? 192  ALA A CB  1 
ATOM   892  N N   . LEU A 1 128 ? 15.034 -13.930 14.982  1.00 42.00  ? 193  LEU A N   1 
ATOM   893  C CA  . LEU A 1 128 ? 14.554 -12.591 15.337  1.00 45.93  ? 193  LEU A CA  1 
ATOM   894  C C   . LEU A 1 128 ? 15.647 -11.544 15.126  1.00 45.67  ? 193  LEU A C   1 
ATOM   895  O O   . LEU A 1 128 ? 15.367 -10.357 14.941  1.00 46.12  ? 193  LEU A O   1 
ATOM   896  C CB  . LEU A 1 128 ? 14.122 -12.552 16.784  1.00 46.72  ? 193  LEU A CB  1 
ATOM   897  C CG  . LEU A 1 128 ? 12.822 -13.257 17.116  1.00 50.58  ? 193  LEU A CG  1 
ATOM   898  C CD1 . LEU A 1 128 ? 12.786 -13.521 18.600  1.00 40.56  ? 193  LEU A CD1 1 
ATOM   899  C CD2 . LEU A 1 128 ? 11.696 -12.325 16.700  1.00 51.59  ? 193  LEU A CD2 1 
ATOM   900  N N   . GLY A 1 129 ? 16.895 -12.004 15.199  1.00 41.05  ? 194  GLY A N   1 
ATOM   901  C CA  . GLY A 1 129 ? 18.039 -11.161 15.006  1.00 44.18  ? 194  GLY A CA  1 
ATOM   902  C C   . GLY A 1 129 ? 18.162 -10.761 13.543  1.00 43.51  ? 194  GLY A C   1 
ATOM   903  O O   . GLY A 1 129 ? 18.358 -9.558  13.209  1.00 39.71  ? 194  GLY A O   1 
ATOM   904  N N   . ASN A 1 130 ? 18.029 -11.762 12.688  1.00 39.34  ? 195  ASN A N   1 
ATOM   905  C CA  . ASN A 1 130 ? 17.862 -11.501 11.248  1.00 42.73  ? 195  ASN A CA  1 
ATOM   906  C C   . ASN A 1 130 ? 16.746 -10.507 10.951  1.00 44.16  ? 195  ASN A C   1 
ATOM   907  O O   . ASN A 1 130 ? 17.007 -9.473  10.394  1.00 52.83  ? 195  ASN A O   1 
ATOM   908  C CB  . ASN A 1 130 ? 17.751 -12.781 10.463  1.00 33.98  ? 195  ASN A CB  1 
ATOM   909  C CG  . ASN A 1 130 ? 19.106 -13.388 10.207  1.00 35.51  ? 195  ASN A CG  1 
ATOM   910  O OD1 . ASN A 1 130 ? 20.111 -12.718 10.364  1.00 41.57  ? 195  ASN A OD1 1 
ATOM   911  N ND2 . ASN A 1 130 ? 19.155 -14.657 9.860   1.00 36.73  ? 195  ASN A ND2 1 
ATOM   912  N N   . ILE A 1 131 ? 15.537 -10.757 11.423  1.00 44.83  ? 196  ILE A N   1 
ATOM   913  C CA  . ILE A 1 131 ? 14.437 -9.854  11.112  1.00 43.01  ? 196  ILE A CA  1 
ATOM   914  C C   . ILE A 1 131 ? 14.702 -8.451  11.610  1.00 42.09  ? 196  ILE A C   1 
ATOM   915  O O   . ILE A 1 131 ? 14.458 -7.514  10.906  1.00 43.53  ? 196  ILE A O   1 
ATOM   916  C CB  . ILE A 1 131 ? 13.085 -10.353 11.662  1.00 41.92  ? 196  ILE A CB  1 
ATOM   917  C CG1 . ILE A 1 131 ? 12.704 -11.664 11.011  1.00 45.57  ? 196  ILE A CG1 1 
ATOM   918  C CG2 . ILE A 1 131 ? 12.031 -9.337  11.365  1.00 36.78  ? 196  ILE A CG2 1 
ATOM   919  C CD1 . ILE A 1 131 ? 11.942 -12.609 11.910  1.00 48.46  ? 196  ILE A CD1 1 
ATOM   920  N N   . ALA A 1 132 ? 15.198 -8.300  12.827  1.00 46.21  ? 197  ALA A N   1 
ATOM   921  C CA  . ALA A 1 132 ? 15.482 -6.951  13.346  1.00 46.65  ? 197  ALA A CA  1 
ATOM   922  C C   . ALA A 1 132 ? 16.634 -6.295  12.604  1.00 50.17  ? 197  ALA A C   1 
ATOM   923  O O   . ALA A 1 132 ? 16.752 -5.077  12.561  1.00 48.74  ? 197  ALA A O   1 
ATOM   924  C CB  . ALA A 1 132 ? 15.814 -7.042  14.805  1.00 49.78  ? 197  ALA A CB  1 
ATOM   925  N N   . GLY A 1 133 ? 17.517 -7.101  12.030  1.00 53.92  ? 198  GLY A N   1 
ATOM   926  C CA  . GLY A 1 133 ? 18.691 -6.520  11.396  1.00 57.52  ? 198  GLY A CA  1 
ATOM   927  C C   . GLY A 1 133 ? 18.453 -6.110  9.953   1.00 62.80  ? 198  GLY A C   1 
ATOM   928  O O   . GLY A 1 133 ? 19.384 -5.659  9.246   1.00 63.72  ? 198  GLY A O   1 
ATOM   929  N N   . ASP A 1 134 ? 17.214 -6.271  9.507   1.00 58.85  ? 199  ASP A N   1 
ATOM   930  C CA  . ASP A 1 134 ? 16.887 -6.030  8.129   1.00 56.25  ? 199  ASP A CA  1 
ATOM   931  C C   . ASP A 1 134 ? 16.727 -4.563  7.827   1.00 55.33  ? 199  ASP A C   1 
ATOM   932  O O   . ASP A 1 134 ? 17.291 -4.067  6.850   1.00 69.32  ? 199  ASP A O   1 
ATOM   933  C CB  . ASP A 1 134 ? 15.631 -6.758  7.724   1.00 62.57  ? 199  ASP A CB  1 
ATOM   934  C CG  . ASP A 1 134 ? 15.356 -6.617  6.256   1.00 61.90  ? 199  ASP A CG  1 
ATOM   935  O OD1 . ASP A 1 134 ? 16.062 -7.279  5.471   1.00 68.43  ? 199  ASP A OD1 1 
ATOM   936  O OD2 . ASP A 1 134 ? 14.473 -5.815  5.906   1.00 54.02  ? 199  ASP A OD2 1 
ATOM   937  N N   . SER A 1 135 ? 15.973 -3.861  8.649   1.00 53.81  ? 200  SER A N   1 
ATOM   938  C CA  . SER A 1 135 ? 15.812 -2.428  8.456   1.00 55.69  ? 200  SER A CA  1 
ATOM   939  C C   . SER A 1 135 ? 15.415 -1.784  9.755   1.00 51.78  ? 200  SER A C   1 
ATOM   940  O O   . SER A 1 135 ? 15.041 -2.442  10.705  1.00 50.15  ? 200  SER A O   1 
ATOM   941  C CB  . SER A 1 135 ? 14.665 -2.136  7.492   1.00 56.56  ? 200  SER A CB  1 
ATOM   942  O OG  . SER A 1 135 ? 13.453 -2.113  8.242   1.00 64.57  ? 200  SER A OG  1 
ATOM   943  N N   . THR A 1 136 ? 15.420 -0.469  9.716   1.00 50.35  ? 201  THR A N   1 
ATOM   944  C CA  . THR A 1 136 ? 14.906 0.385   10.727  1.00 49.34  ? 201  THR A CA  1 
ATOM   945  C C   . THR A 1 136 ? 13.490 0.074   11.190  1.00 56.61  ? 201  THR A C   1 
ATOM   946  O O   . THR A 1 136 ? 13.229 0.062   12.390  1.00 61.85  ? 201  THR A O   1 
ATOM   947  C CB  . THR A 1 136 ? 14.996 1.809   10.183  1.00 51.86  ? 201  THR A CB  1 
ATOM   948  O OG1 . THR A 1 136 ? 15.999 2.490   10.937  1.00 58.90  ? 201  THR A OG1 1 
ATOM   949  C CG2 . THR A 1 136 ? 13.646 2.568   10.255  1.00 52.67  ? 201  THR A CG2 1 
ATOM   950  N N   . MET A 1 137 ? 12.574 -0.168  10.255  1.00 60.64  ? 202  MET A N   1 
ATOM   951  C CA  . MET A 1 137 ? 11.154 -0.306  10.617  1.00 64.61  ? 202  MET A CA  1 
ATOM   952  C C   . MET A 1 137 ? 10.867 -1.730  11.069  1.00 59.95  ? 202  MET A C   1 
ATOM   953  O O   . MET A 1 137 ? 10.003 -1.957  11.918  1.00 62.79  ? 202  MET A O   1 
ATOM   954  C CB  . MET A 1 137 ? 10.169 0.170   9.516   1.00 67.56  ? 202  MET A CB  1 
ATOM   955  C CG  . MET A 1 137 ? 10.652 0.087   8.077   1.00 80.32  ? 202  MET A CG  1 
ATOM   956  S SD  . MET A 1 137 ? 11.577 1.525   7.466   1.00 99.37  ? 202  MET A SD  1 
ATOM   957  C CE  . MET A 1 137 ? 12.683 0.740   6.276   1.00 80.76  ? 202  MET A CE  1 
ATOM   958  N N   . CYS A 1 138 ? 11.610 -2.682  10.514  1.00 56.31  ? 203  CYS A N   1 
ATOM   959  C CA  . CYS A 1 138 ? 11.631 -4.040  11.035  1.00 49.50  ? 203  CYS A CA  1 
ATOM   960  C C   . CYS A 1 138 ? 12.220 -4.086  12.423  1.00 49.28  ? 203  CYS A C   1 
ATOM   961  O O   . CYS A 1 138 ? 11.807 -4.868  13.261  1.00 48.50  ? 203  CYS A O   1 
ATOM   962  C CB  . CYS A 1 138 ? 12.479 -4.908  10.140  1.00 55.87  ? 203  CYS A CB  1 
ATOM   963  S SG  . CYS A 1 138 ? 11.617 -5.233  8.610   1.00 59.31  ? 203  CYS A SG  1 
ATOM   964  N N   . ARG A 1 139 ? 13.202 -3.237  12.684  1.00 54.66  ? 204  ARG A N   1 
ATOM   965  C CA  . ARG A 1 139 ? 13.788 -3.223  14.007  1.00 56.05  ? 204  ARG A CA  1 
ATOM   966  C C   . ARG A 1 139 ? 12.715 -2.786  15.031  1.00 56.67  ? 204  ARG A C   1 
ATOM   967  O O   . ARG A 1 139 ? 12.418 -3.514  16.007  1.00 60.15  ? 204  ARG A O   1 
ATOM   968  C CB  . ARG A 1 139 ? 15.058 -2.353  14.018  1.00 51.78  ? 204  ARG A CB  1 
ATOM   969  C CG  . ARG A 1 139 ? 15.659 -2.084  15.384  1.00 44.05  ? 204  ARG A CG  1 
ATOM   970  C CD  . ARG A 1 139 ? 16.352 -0.746  15.353  1.00 40.22  ? 204  ARG A CD  1 
ATOM   971  N NE  . ARG A 1 139 ? 15.467 0.404   15.155  1.00 44.55  ? 204  ARG A NE  1 
ATOM   972  C CZ  . ARG A 1 139 ? 15.894 1.645   14.819  1.00 49.70  ? 204  ARG A CZ  1 
ATOM   973  N NH1 . ARG A 1 139 ? 17.197 1.931   14.621  1.00 45.95  ? 204  ARG A NH1 1 
ATOM   974  N NH2 . ARG A 1 139 ? 15.020 2.625   14.662  1.00 47.52  ? 204  ARG A NH2 1 
ATOM   975  N N   . ASP A 1 140 ? 12.118 -1.621  14.787  1.00 60.35  ? 205  ASP A N   1 
ATOM   976  C CA  . ASP A 1 140 ? 11.080 -1.094  15.661  1.00 55.69  ? 205  ASP A CA  1 
ATOM   977  C C   . ASP A 1 140 ? 9.870  -1.961  15.702  1.00 56.52  ? 205  ASP A C   1 
ATOM   978  O O   . ASP A 1 140 ? 9.201  -2.043  16.721  1.00 63.36  ? 205  ASP A O   1 
ATOM   979  C CB  . ASP A 1 140 ? 10.674 0.279   15.209  1.00 56.59  ? 205  ASP A CB  1 
ATOM   980  C CG  . ASP A 1 140 ? 11.715 1.275   15.501  1.00 60.02  ? 205  ASP A CG  1 
ATOM   981  O OD1 . ASP A 1 140 ? 12.633 0.936   16.277  1.00 63.77  ? 205  ASP A OD1 1 
ATOM   982  O OD2 . ASP A 1 140 ? 11.622 2.387   14.960  1.00 66.89  ? 205  ASP A OD2 1 
ATOM   983  N N   . TYR A 1 141 ? 9.587  -2.639  14.605  1.00 55.43  ? 206  TYR A N   1 
ATOM   984  C CA  . TYR A 1 141 ? 8.424  -3.493  14.611  1.00 54.56  ? 206  TYR A CA  1 
ATOM   985  C C   . TYR A 1 141 ? 8.686  -4.636  15.582  1.00 52.42  ? 206  TYR A C   1 
ATOM   986  O O   . TYR A 1 141 ? 7.800  -5.043  16.327  1.00 67.46  ? 206  TYR A O   1 
ATOM   987  C CB  . TYR A 1 141 ? 8.075  -3.992  13.201  1.00 46.93  ? 206  TYR A CB  1 
ATOM   988  C CG  . TYR A 1 141 ? 7.185  -5.207  13.256  1.00 46.97  ? 206  TYR A CG  1 
ATOM   989  C CD1 . TYR A 1 141 ? 5.806  -5.112  13.662  1.00 50.56  ? 206  TYR A CD1 1 
ATOM   990  C CD2 . TYR A 1 141 ? 7.693  -6.447  12.953  1.00 38.85  ? 206  TYR A CD2 1 
ATOM   991  C CE1 . TYR A 1 141 ? 4.980  -6.249  13.729  1.00 41.58  ? 206  TYR A CE1 1 
ATOM   992  C CE2 . TYR A 1 141 ? 6.890  -7.585  13.013  1.00 45.12  ? 206  TYR A CE2 1 
ATOM   993  C CZ  . TYR A 1 141 ? 5.536  -7.483  13.390  1.00 47.01  ? 206  TYR A CZ  1 
ATOM   994  O OH  . TYR A 1 141 ? 4.786  -8.652  13.436  1.00 49.49  ? 206  TYR A OH  1 
ATOM   995  N N   . VAL A 1 142 ? 9.902  -5.153  15.596  1.00 46.63  ? 207  VAL A N   1 
ATOM   996  C CA  . VAL A 1 142 ? 10.214 -6.210  16.530  1.00 46.69  ? 207  VAL A CA  1 
ATOM   997  C C   . VAL A 1 142 ? 10.294 -5.760  17.981  1.00 52.91  ? 207  VAL A C   1 
ATOM   998  O O   . VAL A 1 142 ? 9.869  -6.480  18.872  1.00 50.47  ? 207  VAL A O   1 
ATOM   999  C CB  . VAL A 1 142 ? 11.498 -6.904  16.159  1.00 48.34  ? 207  VAL A CB  1 
ATOM   1000 C CG1 . VAL A 1 142 ? 11.880 -7.845  17.285  1.00 43.13  ? 207  VAL A CG1 1 
ATOM   1001 C CG2 . VAL A 1 142 ? 11.305 -7.641  14.823  1.00 45.00  ? 207  VAL A CG2 1 
ATOM   1002 N N   . LEU A 1 143 ? 10.837 -4.576  18.238  1.00 53.69  ? 208  LEU A N   1 
ATOM   1003 C CA  . LEU A 1 143 ? 10.697 -4.004  19.583  1.00 57.11  ? 208  LEU A CA  1 
ATOM   1004 C C   . LEU A 1 143 ? 9.214  -3.867  20.046  1.00 66.31  ? 208  LEU A C   1 
ATOM   1005 O O   . LEU A 1 143 ? 8.825  -4.366  21.125  1.00 63.88  ? 208  LEU A O   1 
ATOM   1006 C CB  . LEU A 1 143 ? 11.419 -2.652  19.669  1.00 56.13  ? 208  LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 143 ? 12.924 -2.806  19.552  1.00 50.19  ? 208  LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 143 ? 13.585 -1.461  19.380  1.00 44.29  ? 208  LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 143 ? 13.423 -3.520  20.781  1.00 46.81  ? 208  LEU A CD2 1 
ATOM   1010 N N   . ASP A 1 144 ? 8.394  -3.208  19.222  1.00 61.36  ? 209  ASP A N   1 
ATOM   1011 C CA  . ASP A 1 144 ? 6.975  -3.109  19.462  1.00 58.02  ? 209  ASP A CA  1 
ATOM   1012 C C   . ASP A 1 144 ? 6.241  -4.427  19.790  1.00 60.66  ? 209  ASP A C   1 
ATOM   1013 O O   . ASP A 1 144 ? 5.268  -4.418  20.546  1.00 68.79  ? 209  ASP A O   1 
ATOM   1014 C CB  . ASP A 1 144 ? 6.323  -2.418  18.285  1.00 58.19  ? 209  ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 144 ? 6.553  -0.958  18.305  1.00 60.16  ? 209  ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 144 ? 6.866  -0.437  19.404  1.00 66.77  ? 209  ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 144 ? 6.431  -0.335  17.236  1.00 61.23  ? 209  ASP A OD2 1 
ATOM   1018 N N   . CYS A 1 145 ? 6.686  -5.552  19.245  1.00 54.48  ? 210  CYS A N   1 
ATOM   1019 C CA  . CYS A 1 145 ? 6.134  -6.837  19.659  1.00 49.97  ? 210  CYS A CA  1 
ATOM   1020 C C   . CYS A 1 145 ? 6.666  -7.386  20.973  1.00 56.36  ? 210  CYS A C   1 
ATOM   1021 O O   . CYS A 1 145 ? 6.470  -8.589  21.244  1.00 56.98  ? 210  CYS A O   1 
ATOM   1022 C CB  . CYS A 1 145 ? 6.385  -7.885  18.573  1.00 56.91  ? 210  CYS A CB  1 
ATOM   1023 S SG  . CYS A 1 145 ? 5.542  -7.523  17.022  1.00 55.27  ? 210  CYS A SG  1 
ATOM   1024 N N   . ASN A 1 146 ? 7.357  -6.552  21.769  1.00 58.16  ? 211  ASN A N   1 
ATOM   1025 C CA  . ASN A 1 146 ? 7.891  -6.956  23.101  1.00 63.86  ? 211  ASN A CA  1 
ATOM   1026 C C   . ASN A 1 146 ? 8.934  -8.053  23.066  1.00 59.55  ? 211  ASN A C   1 
ATOM   1027 O O   . ASN A 1 146 ? 8.737  -9.100  23.694  1.00 68.33  ? 211  ASN A O   1 
ATOM   1028 C CB  . ASN A 1 146 ? 6.760  -7.392  24.087  1.00 70.14  ? 211  ASN A CB  1 
ATOM   1029 C CG  . ASN A 1 146 ? 6.647  -6.484  25.310  1.00 79.95  ? 211  ASN A CG  1 
ATOM   1030 O OD1 . ASN A 1 146 ? 7.645  -6.139  25.960  1.00 79.72  ? 211  ASN A OD1 1 
ATOM   1031 N ND2 . ASN A 1 146 ? 5.424  -6.094  25.631  1.00 81.80  ? 211  ASN A ND2 1 
ATOM   1032 N N   . ILE A 1 147 ? 10.021 -7.862  22.326  1.00 60.19  ? 212  ILE A N   1 
ATOM   1033 C CA  . ILE A 1 147 ? 11.041 -8.928  22.267  1.00 57.15  ? 212  ILE A CA  1 
ATOM   1034 C C   . ILE A 1 147 ? 11.952 -8.866  23.516  1.00 52.80  ? 212  ILE A C   1 
ATOM   1035 O O   . ILE A 1 147 ? 12.391 -9.908  24.038  1.00 49.39  ? 212  ILE A O   1 
ATOM   1036 C CB  . ILE A 1 147 ? 11.886 -8.918  20.950  1.00 54.20  ? 212  ILE A CB  1 
ATOM   1037 C CG1 . ILE A 1 147 ? 12.580 -10.274 20.785  1.00 54.75  ? 212  ILE A CG1 1 
ATOM   1038 C CG2 . ILE A 1 147 ? 12.844 -7.720  20.872  1.00 57.53  ? 212  ILE A CG2 1 
ATOM   1039 C CD1 . ILE A 1 147 ? 13.802 -10.328 19.917  1.00 53.73  ? 212  ILE A CD1 1 
ATOM   1040 N N   . LEU A 1 148 ? 12.209 -7.643  23.976  1.00 42.67  ? 213  LEU A N   1 
ATOM   1041 C CA  . LEU A 1 148 ? 13.158 -7.385  25.079  1.00 48.45  ? 213  LEU A CA  1 
ATOM   1042 C C   . LEU A 1 148 ? 12.984 -8.234  26.349  1.00 51.66  ? 213  LEU A C   1 
ATOM   1043 O O   . LEU A 1 148 ? 13.869 -9.033  26.651  1.00 56.11  ? 213  LEU A O   1 
ATOM   1044 C CB  . LEU A 1 148 ? 13.188 -5.901  25.421  1.00 48.37  ? 213  LEU A CB  1 
ATOM   1045 C CG  . LEU A 1 148 ? 14.539 -5.396  25.908  1.00 49.64  ? 213  LEU A CG  1 
ATOM   1046 C CD1 . LEU A 1 148 ? 15.643 -5.655  24.876  1.00 47.33  ? 213  LEU A CD1 1 
ATOM   1047 C CD2 . LEU A 1 148 ? 14.426 -3.903  26.236  1.00 45.59  ? 213  LEU A CD2 1 
ATOM   1048 N N   . PRO A 1 149 ? 11.837 -8.128  27.053  1.00 49.35  ? 214  PRO A N   1 
ATOM   1049 C CA  . PRO A 1 149 ? 11.737 -8.897  28.291  1.00 51.67  ? 214  PRO A CA  1 
ATOM   1050 C C   . PRO A 1 149 ? 12.097 -10.349 28.130  1.00 48.57  ? 214  PRO A C   1 
ATOM   1051 O O   . PRO A 1 149 ? 12.931 -10.861 28.878  1.00 54.62  ? 214  PRO A O   1 
ATOM   1052 C CB  . PRO A 1 149 ? 10.257 -8.730  28.703  1.00 53.46  ? 214  PRO A CB  1 
ATOM   1053 C CG  . PRO A 1 149 ? 9.902  -7.359  28.201  1.00 52.19  ? 214  PRO A CG  1 
ATOM   1054 C CD  . PRO A 1 149 ? 10.655 -7.248  26.875  1.00 56.36  ? 214  PRO A CD  1 
ATOM   1055 N N   . PRO A 1 150 ? 11.477 -11.023 27.181  1.00 46.91  ? 215  PRO A N   1 
ATOM   1056 C CA  . PRO A 1 150 ? 11.827 -12.444 27.174  1.00 42.49  ? 215  PRO A CA  1 
ATOM   1057 C C   . PRO A 1 150 ? 13.207 -12.656 26.583  1.00 45.08  ? 215  PRO A C   1 
ATOM   1058 O O   . PRO A 1 150 ? 13.841 -13.668 26.854  1.00 42.92  ? 215  PRO A O   1 
ATOM   1059 C CB  . PRO A 1 150 ? 10.795 -13.075 26.217  1.00 39.87  ? 215  PRO A CB  1 
ATOM   1060 C CG  . PRO A 1 150 ? 10.020 -11.951 25.630  1.00 40.97  ? 215  PRO A CG  1 
ATOM   1061 C CD  . PRO A 1 150 ? 10.225 -10.722 26.459  1.00 44.63  ? 215  PRO A CD  1 
ATOM   1062 N N   . LEU A 1 151 ? 13.659 -11.751 25.719  1.00 46.35  ? 216  LEU A N   1 
ATOM   1063 C CA  . LEU A 1 151 ? 15.044 -11.846 25.247  1.00 47.02  ? 216  LEU A CA  1 
ATOM   1064 C C   . LEU A 1 151 ? 16.014 -11.692 26.462  1.00 48.69  ? 216  LEU A C   1 
ATOM   1065 O O   . LEU A 1 151 ? 16.890 -12.561 26.702  1.00 43.62  ? 216  LEU A O   1 
ATOM   1066 C CB  . LEU A 1 151 ? 15.340 -10.814 24.135  1.00 44.47  ? 216  LEU A CB  1 
ATOM   1067 C CG  . LEU A 1 151 ? 16.783 -10.651 23.642  1.00 44.20  ? 216  LEU A CG  1 
ATOM   1068 C CD1 . LEU A 1 151 ? 17.109 -11.974 22.980  1.00 51.65  ? 216  LEU A CD1 1 
ATOM   1069 C CD2 . LEU A 1 151 ? 16.923 -9.551  22.597  1.00 46.93  ? 216  LEU A CD2 1 
ATOM   1070 N N   . LEU A 1 152 ? 15.836 -10.613 27.233  1.00 43.23  ? 217  LEU A N   1 
ATOM   1071 C CA  . LEU A 1 152 ? 16.749 -10.316 28.359  1.00 47.11  ? 217  LEU A CA  1 
ATOM   1072 C C   . LEU A 1 152 ? 16.765 -11.455 29.333  1.00 47.06  ? 217  LEU A C   1 
ATOM   1073 O O   . LEU A 1 152 ? 17.818 -11.905 29.767  1.00 50.02  ? 217  LEU A O   1 
ATOM   1074 C CB  . LEU A 1 152 ? 16.365 -9.020  29.067  1.00 43.01  ? 217  LEU A CB  1 
ATOM   1075 C CG  . LEU A 1 152 ? 16.681 -7.768  28.227  1.00 41.56  ? 217  LEU A CG  1 
ATOM   1076 C CD1 . LEU A 1 152 ? 16.228 -6.461  28.902  1.00 39.37  ? 217  LEU A CD1 1 
ATOM   1077 C CD2 . LEU A 1 152 ? 18.155 -7.720  27.844  1.00 40.96  ? 217  LEU A CD2 1 
ATOM   1078 N N   . GLN A 1 153 ? 15.581 -11.976 29.597  1.00 49.45  ? 218  GLN A N   1 
ATOM   1079 C CA  . GLN A 1 153 ? 15.408 -13.163 30.429  1.00 56.87  ? 218  GLN A CA  1 
ATOM   1080 C C   . GLN A 1 153 ? 16.402 -14.290 30.058  1.00 51.80  ? 218  GLN A C   1 
ATOM   1081 O O   . GLN A 1 153 ? 16.804 -15.083 30.907  1.00 57.10  ? 218  GLN A O   1 
ATOM   1082 C CB  . GLN A 1 153 ? 13.937 -13.616 30.331  1.00 58.23  ? 218  GLN A CB  1 
ATOM   1083 C CG  . GLN A 1 153 ? 13.540 -14.774 31.179  1.00 66.76  ? 218  GLN A CG  1 
ATOM   1084 C CD  . GLN A 1 153 ? 13.221 -14.300 32.575  1.00 94.40  ? 218  GLN A CD  1 
ATOM   1085 O OE1 . GLN A 1 153 ? 13.175 -13.076 32.840  1.00 92.19  ? 218  GLN A OE1 1 
ATOM   1086 N NE2 . GLN A 1 153 ? 12.981 -15.255 33.486  1.00 87.14  ? 218  GLN A NE2 1 
ATOM   1087 N N   . LEU A 1 154 ? 16.826 -14.343 28.804  1.00 50.63  ? 219  LEU A N   1 
ATOM   1088 C CA  . LEU A 1 154 ? 17.604 -15.494 28.330  1.00 50.30  ? 219  LEU A CA  1 
ATOM   1089 C C   . LEU A 1 154 ? 19.003 -15.484 28.871  1.00 50.21  ? 219  LEU A C   1 
ATOM   1090 O O   . LEU A 1 154 ? 19.665 -16.498 28.811  1.00 52.57  ? 219  LEU A O   1 
ATOM   1091 C CB  . LEU A 1 154 ? 17.692 -15.523 26.794  1.00 56.41  ? 219  LEU A CB  1 
ATOM   1092 C CG  . LEU A 1 154 ? 16.484 -15.987 25.953  1.00 57.86  ? 219  LEU A CG  1 
ATOM   1093 C CD1 . LEU A 1 154 ? 16.662 -15.523 24.525  1.00 55.31  ? 219  LEU A CD1 1 
ATOM   1094 C CD2 . LEU A 1 154 ? 16.349 -17.503 25.984  1.00 53.77  ? 219  LEU A CD2 1 
ATOM   1095 N N   . PHE A 1 155 ? 19.488 -14.336 29.339  1.00 45.86  ? 220  PHE A N   1 
ATOM   1096 C CA  . PHE A 1 155 ? 20.879 -14.272 29.783  1.00 50.59  ? 220  PHE A CA  1 
ATOM   1097 C C   . PHE A 1 155 ? 21.027 -14.834 31.188  1.00 56.78  ? 220  PHE A C   1 
ATOM   1098 O O   . PHE A 1 155 ? 22.104 -15.237 31.594  1.00 58.70  ? 220  PHE A O   1 
ATOM   1099 C CB  . PHE A 1 155 ? 21.401 -12.844 29.771  1.00 57.83  ? 220  PHE A CB  1 
ATOM   1100 C CG  . PHE A 1 155 ? 21.548 -12.268 28.401  1.00 57.52  ? 220  PHE A CG  1 
ATOM   1101 C CD1 . PHE A 1 155 ? 22.573 -12.684 27.569  1.00 60.87  ? 220  PHE A CD1 1 
ATOM   1102 C CD2 . PHE A 1 155 ? 20.676 -11.300 27.954  1.00 54.13  ? 220  PHE A CD2 1 
ATOM   1103 C CE1 . PHE A 1 155 ? 22.700 -12.153 26.303  1.00 59.67  ? 220  PHE A CE1 1 
ATOM   1104 C CE2 . PHE A 1 155 ? 20.819 -10.760 26.704  1.00 54.93  ? 220  PHE A CE2 1 
ATOM   1105 C CZ  . PHE A 1 155 ? 21.824 -11.192 25.881  1.00 47.52  ? 220  PHE A CZ  1 
ATOM   1106 N N   . SER A 1 156 ? 19.922 -14.857 31.913  1.00 62.97  ? 221  SER A N   1 
ATOM   1107 C CA  . SER A 1 156 ? 19.834 -15.481 33.220  1.00 67.77  ? 221  SER A CA  1 
ATOM   1108 C C   . SER A 1 156 ? 20.201 -16.969 33.262  1.00 66.62  ? 221  SER A C   1 
ATOM   1109 O O   . SER A 1 156 ? 20.168 -17.561 34.326  1.00 74.73  ? 221  SER A O   1 
ATOM   1110 C CB  . SER A 1 156 ? 18.412 -15.364 33.745  1.00 67.12  ? 221  SER A CB  1 
ATOM   1111 O OG  . SER A 1 156 ? 17.742 -16.581 33.437  1.00 71.78  ? 221  SER A OG  1 
ATOM   1112 N N   . LYS A 1 157 ? 20.493 -17.613 32.153  1.00 67.54  ? 222  LYS A N   1 
ATOM   1113 C CA  . LYS A 1 157 ? 21.117 -18.918 32.299  1.00 82.25  ? 222  LYS A CA  1 
ATOM   1114 C C   . LYS A 1 157 ? 22.542 -18.831 31.695  1.00 87.29  ? 222  LYS A C   1 
ATOM   1115 O O   . LYS A 1 157 ? 22.707 -19.024 30.500  1.00 81.69  ? 222  LYS A O   1 
ATOM   1116 C CB  . LYS A 1 157 ? 20.215 -20.028 31.724  1.00 84.29  ? 222  LYS A CB  1 
ATOM   1117 C CG  . LYS A 1 157 ? 20.688 -21.472 31.970  1.00 101.64 ? 222  LYS A CG  1 
ATOM   1118 C CD  . LYS A 1 157 ? 21.870 -21.911 31.077  1.00 108.52 ? 222  LYS A CD  1 
ATOM   1119 C CE  . LYS A 1 157 ? 21.539 -22.018 29.575  1.00 119.00 ? 222  LYS A CE  1 
ATOM   1120 N NZ  . LYS A 1 157 ? 22.498 -21.333 28.634  1.00 94.34  ? 222  LYS A NZ  1 
ATOM   1121 N N   . GLN A 1 158 ? 23.556 -18.495 32.519  1.00 100.69 ? 223  GLN A N   1 
ATOM   1122 C CA  . GLN A 1 158 ? 24.971 -18.251 32.046  1.00 103.03 ? 223  GLN A CA  1 
ATOM   1123 C C   . GLN A 1 158 ? 25.695 -19.514 31.547  1.00 105.38 ? 223  GLN A C   1 
ATOM   1124 O O   . GLN A 1 158 ? 26.849 -19.437 31.089  1.00 101.25 ? 223  GLN A O   1 
ATOM   1125 C CB  . GLN A 1 158 ? 25.864 -17.551 33.109  1.00 90.73  ? 223  GLN A CB  1 
ATOM   1126 C CG  . GLN A 1 158 ? 25.485 -16.122 33.476  1.00 86.03  ? 223  GLN A CG  1 
ATOM   1127 C CD  . GLN A 1 158 ? 24.373 -16.059 34.531  1.00 92.27  ? 223  GLN A CD  1 
ATOM   1128 O OE1 . GLN A 1 158 ? 23.951 -14.976 34.955  1.00 76.47  ? 223  GLN A OE1 1 
ATOM   1129 N NE2 . GLN A 1 158 ? 23.900 -17.228 34.968  1.00 92.65  ? 223  GLN A NE2 1 
ATOM   1130 N N   . ASN A 1 159 ? 24.998 -20.651 31.639  1.00 101.60 ? 224  ASN A N   1 
ATOM   1131 C CA  . ASN A 1 159 ? 25.517 -21.973 31.310  1.00 105.31 ? 224  ASN A CA  1 
ATOM   1132 C C   . ASN A 1 159 ? 25.825 -22.206 29.818  1.00 102.36 ? 224  ASN A C   1 
ATOM   1133 O O   . ASN A 1 159 ? 26.875 -22.789 29.494  1.00 93.02  ? 224  ASN A O   1 
ATOM   1134 C CB  . ASN A 1 159 ? 24.550 -23.049 31.838  1.00 112.58 ? 224  ASN A CB  1 
ATOM   1135 C CG  . ASN A 1 159 ? 25.229 -24.051 32.763  1.00 125.88 ? 224  ASN A CG  1 
ATOM   1136 O OD1 . ASN A 1 159 ? 24.989 -24.063 33.977  1.00 116.53 ? 224  ASN A OD1 1 
ATOM   1137 N ND2 . ASN A 1 159 ? 26.089 -24.894 32.196  1.00 132.43 ? 224  ASN A ND2 1 
ATOM   1138 N N   . ARG A 1 160 ? 24.937 -21.755 28.920  1.00 84.77  ? 225  ARG A N   1 
ATOM   1139 C CA  . ARG A 1 160 ? 25.077 -22.109 27.499  1.00 89.88  ? 225  ARG A CA  1 
ATOM   1140 C C   . ARG A 1 160 ? 25.458 -20.983 26.525  1.00 81.60  ? 225  ARG A C   1 
ATOM   1141 O O   . ARG A 1 160 ? 24.822 -19.916 26.437  1.00 64.77  ? 225  ARG A O   1 
ATOM   1142 C CB  . ARG A 1 160 ? 23.881 -22.897 26.993  1.00 94.85  ? 225  ARG A CB  1 
ATOM   1143 C CG  . ARG A 1 160 ? 23.973 -23.312 25.533  1.00 98.06  ? 225  ARG A CG  1 
ATOM   1144 C CD  . ARG A 1 160 ? 22.555 -23.402 24.999  1.00 114.15 ? 225  ARG A CD  1 
ATOM   1145 N NE  . ARG A 1 160 ? 21.656 -23.973 26.005  1.00 117.84 ? 225  ARG A NE  1 
ATOM   1146 C CZ  . ARG A 1 160 ? 21.167 -25.209 25.959  1.00 118.02 ? 225  ARG A CZ  1 
ATOM   1147 N NH1 . ARG A 1 160 ? 21.455 -26.014 24.937  1.00 112.30 ? 225  ARG A NH1 1 
ATOM   1148 N NH2 . ARG A 1 160 ? 20.373 -25.634 26.933  1.00 119.45 ? 225  ARG A NH2 1 
ATOM   1149 N N   . LEU A 1 161 ? 26.495 -21.282 25.760  1.00 64.87  ? 226  LEU A N   1 
ATOM   1150 C CA  . LEU A 1 161 ? 27.264 -20.259 25.132  1.00 61.99  ? 226  LEU A CA  1 
ATOM   1151 C C   . LEU A 1 161 ? 26.629 -19.816 23.820  1.00 64.78  ? 226  LEU A C   1 
ATOM   1152 O O   . LEU A 1 161 ? 26.428 -18.610 23.597  1.00 61.40  ? 226  LEU A O   1 
ATOM   1153 C CB  . LEU A 1 161 ? 28.669 -20.780 24.887  1.00 55.65  ? 226  LEU A CB  1 
ATOM   1154 C CG  . LEU A 1 161 ? 29.644 -19.763 24.316  1.00 57.01  ? 226  LEU A CG  1 
ATOM   1155 C CD1 . LEU A 1 161 ? 29.749 -18.557 25.257  1.00 49.87  ? 226  LEU A CD1 1 
ATOM   1156 C CD2 . LEU A 1 161 ? 30.980 -20.449 24.056  1.00 49.32  ? 226  LEU A CD2 1 
ATOM   1157 N N   . THR A 1 162 ? 26.317 -20.788 22.959  1.00 64.88  ? 227  THR A N   1 
ATOM   1158 C CA  . THR A 1 162 ? 25.691 -20.507 21.662  1.00 64.76  ? 227  THR A CA  1 
ATOM   1159 C C   . THR A 1 162 ? 24.455 -19.645 21.887  1.00 60.33  ? 227  THR A C   1 
ATOM   1160 O O   . THR A 1 162 ? 24.288 -18.652 21.214  1.00 70.04  ? 227  THR A O   1 
ATOM   1161 C CB  . THR A 1 162 ? 25.325 -21.782 20.908  1.00 57.90  ? 227  THR A CB  1 
ATOM   1162 O OG1 . THR A 1 162 ? 24.805 -22.717 21.849  1.00 68.64  ? 227  THR A OG1 1 
ATOM   1163 C CG2 . THR A 1 162 ? 26.557 -22.406 20.227  1.00 43.52  ? 227  THR A CG2 1 
ATOM   1164 N N   . MET A 1 163 ? 23.634 -19.967 22.878  1.00 51.87  ? 228  MET A N   1 
ATOM   1165 C CA  . MET A 1 163 ? 22.462 -19.149 23.152  1.00 56.23  ? 228  MET A CA  1 
ATOM   1166 C C   . MET A 1 163 ? 22.801 -17.709 23.531  1.00 59.94  ? 228  MET A C   1 
ATOM   1167 O O   . MET A 1 163 ? 22.087 -16.762 23.178  1.00 73.30  ? 228  MET A O   1 
ATOM   1168 C CB  . MET A 1 163 ? 21.626 -19.802 24.247  1.00 63.82  ? 228  MET A CB  1 
ATOM   1169 C CG  . MET A 1 163 ? 20.726 -18.854 25.024  1.00 67.75  ? 228  MET A CG  1 
ATOM   1170 S SD  . MET A 1 163 ? 18.961 -19.087 24.752  1.00 91.24  ? 228  MET A SD  1 
ATOM   1171 C CE  . MET A 1 163 ? 18.726 -20.731 25.449  1.00 77.28  ? 228  MET A CE  1 
ATOM   1172 N N   . THR A 1 164 ? 23.887 -17.531 24.266  1.00 64.54  ? 229  THR A N   1 
ATOM   1173 C CA  . THR A 1 164 ? 24.247 -16.200 24.758  1.00 59.57  ? 229  THR A CA  1 
ATOM   1174 C C   . THR A 1 164 ? 24.786 -15.331 23.636  1.00 46.54  ? 229  THR A C   1 
ATOM   1175 O O   . THR A 1 164 ? 24.507 -14.164 23.596  1.00 42.97  ? 229  THR A O   1 
ATOM   1176 C CB  . THR A 1 164 ? 25.286 -16.257 25.896  1.00 57.42  ? 229  THR A CB  1 
ATOM   1177 O OG1 . THR A 1 164 ? 24.850 -17.225 26.859  1.00 69.20  ? 229  THR A OG1 1 
ATOM   1178 C CG2 . THR A 1 164 ? 25.423 -14.885 26.557  1.00 46.09  ? 229  THR A CG2 1 
ATOM   1179 N N   . ARG A 1 165 ? 25.596 -15.930 22.791  1.00 38.55  ? 230  ARG A N   1 
ATOM   1180 C CA  . ARG A 1 165 ? 26.079 -15.316 21.578  1.00 45.55  ? 230  ARG A CA  1 
ATOM   1181 C C   . ARG A 1 165 ? 24.890 -14.836 20.739  1.00 46.72  ? 230  ARG A C   1 
ATOM   1182 O O   . ARG A 1 165 ? 24.752 -13.609 20.511  1.00 42.70  ? 230  ARG A O   1 
ATOM   1183 C CB  . ARG A 1 165 ? 26.898 -16.330 20.761  1.00 44.20  ? 230  ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 165 ? 28.247 -16.658 21.353  1.00 47.04  ? 230  ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 165 ? 28.897 -17.807 20.602  1.00 50.62  ? 230  ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 165 ? 30.198 -18.094 21.201  1.00 54.14  ? 230  ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 165 ? 31.060 -19.011 20.769  1.00 55.82  ? 230  ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 165 ? 30.789 -19.775 19.727  1.00 49.64  ? 230  ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 165 ? 32.201 -19.173 21.411  1.00 63.23  ? 230  ARG A NH2 1 
ATOM   1190 N N   . ASN A 1 166 ? 24.009 -15.769 20.342  1.00 43.56  ? 231  ASN A N   1 
ATOM   1191 C CA  . ASN A 1 166 ? 22.814 -15.390 19.579  1.00 47.45  ? 231  ASN A CA  1 
ATOM   1192 C C   . ASN A 1 166 ? 22.107 -14.234 20.196  1.00 48.08  ? 231  ASN A C   1 
ATOM   1193 O O   . ASN A 1 166 ? 21.796 -13.258 19.503  1.00 47.55  ? 231  ASN A O   1 
ATOM   1194 C CB  . ASN A 1 166 ? 21.822 -16.531 19.396  1.00 43.99  ? 231  ASN A CB  1 
ATOM   1195 C CG  . ASN A 1 166 ? 22.381 -17.669 18.555  1.00 48.06  ? 231  ASN A CG  1 
ATOM   1196 O OD1 . ASN A 1 166 ? 23.519 -17.610 18.077  1.00 48.18  ? 231  ASN A OD1 1 
ATOM   1197 N ND2 . ASN A 1 166 ? 21.579 -18.722 18.367  1.00 52.35  ? 231  ASN A ND2 1 
ATOM   1198 N N   . ALA A 1 167 ? 21.880 -14.309 21.502  1.00 47.46  ? 232  ALA A N   1 
ATOM   1199 C CA  . ALA A 1 167 ? 21.103 -13.267 22.146  1.00 44.79  ? 232  ALA A CA  1 
ATOM   1200 C C   . ALA A 1 167 ? 21.752 -11.912 22.136  1.00 42.79  ? 232  ALA A C   1 
ATOM   1201 O O   . ALA A 1 167 ? 21.049 -10.895 22.006  1.00 37.37  ? 232  ALA A O   1 
ATOM   1202 C CB  . ALA A 1 167 ? 20.745 -13.665 23.557  1.00 57.76  ? 232  ALA A CB  1 
ATOM   1203 N N   . VAL A 1 168 ? 23.085 -11.838 22.282  1.00 47.22  ? 233  VAL A N   1 
ATOM   1204 C CA  . VAL A 1 168 ? 23.647 -10.460 22.429  1.00 46.89  ? 233  VAL A CA  1 
ATOM   1205 C C   . VAL A 1 168 ? 23.651 -9.931  21.045  1.00 43.27  ? 233  VAL A C   1 
ATOM   1206 O O   . VAL A 1 168 ? 23.388 -8.747  20.818  1.00 41.64  ? 233  VAL A O   1 
ATOM   1207 C CB  . VAL A 1 168 ? 25.143 -10.258 22.814  1.00 47.05  ? 233  VAL A CB  1 
ATOM   1208 C CG1 . VAL A 1 168 ? 25.262 -9.288  23.968  1.00 46.45  ? 233  VAL A CG1 1 
ATOM   1209 C CG2 . VAL A 1 168 ? 26.036 -11.505 22.786  1.00 41.51  ? 233  VAL A CG2 1 
ATOM   1210 N N   . TRP A 1 169 ? 24.052 -10.825 20.151  1.00 34.44  ? 234  TRP A N   1 
ATOM   1211 C CA  . TRP A 1 169 ? 23.973 -10.559 18.743  1.00 42.17  ? 234  TRP A CA  1 
ATOM   1212 C C   . TRP A 1 169 ? 22.625 -9.984  18.342  1.00 40.22  ? 234  TRP A C   1 
ATOM   1213 O O   . TRP A 1 169 ? 22.564 -8.862  17.805  1.00 41.99  ? 234  TRP A O   1 
ATOM   1214 C CB  . TRP A 1 169 ? 24.338 -11.758 17.906  1.00 37.20  ? 234  TRP A CB  1 
ATOM   1215 C CG  . TRP A 1 169 ? 24.140 -11.363 16.503  1.00 48.96  ? 234  TRP A CG  1 
ATOM   1216 C CD1 . TRP A 1 169 ? 24.873 -10.433 15.764  1.00 48.96  ? 234  TRP A CD1 1 
ATOM   1217 C CD2 . TRP A 1 169 ? 23.090 -11.809 15.625  1.00 53.98  ? 234  TRP A CD2 1 
ATOM   1218 N NE1 . TRP A 1 169 ? 24.395 -10.335 14.516  1.00 50.58  ? 234  TRP A NE1 1 
ATOM   1219 C CE2 . TRP A 1 169 ? 23.298 -11.125 14.370  1.00 51.29  ? 234  TRP A CE2 1 
ATOM   1220 C CE3 . TRP A 1 169 ? 22.045 -12.695 15.742  1.00 52.39  ? 234  TRP A CE3 1 
ATOM   1221 C CZ2 . TRP A 1 169 ? 22.464 -11.317 13.302  1.00 51.84  ? 234  TRP A CZ2 1 
ATOM   1222 C CZ3 . TRP A 1 169 ? 21.231 -12.901 14.648  1.00 56.14  ? 234  TRP A CZ3 1 
ATOM   1223 C CH2 . TRP A 1 169 ? 21.428 -12.230 13.461  1.00 47.27  ? 234  TRP A CH2 1 
ATOM   1224 N N   . ALA A 1 170 ? 21.540 -10.680 18.674  1.00 35.68  ? 235  ALA A N   1 
ATOM   1225 C CA  . ALA A 1 170 ? 20.200 -10.167 18.290  1.00 38.95  ? 235  ALA A CA  1 
ATOM   1226 C C   . ALA A 1 170 ? 19.940 -8.850  18.947  1.00 41.49  ? 235  ALA A C   1 
ATOM   1227 O O   . ALA A 1 170 ? 19.207 -7.994  18.458  1.00 50.66  ? 235  ALA A O   1 
ATOM   1228 C CB  . ALA A 1 170 ? 19.123 -11.145 18.663  1.00 33.47  ? 235  ALA A CB  1 
ATOM   1229 N N   . LEU A 1 171 ? 20.556 -8.695  20.088  1.00 37.21  ? 236  LEU A N   1 
ATOM   1230 C CA  . LEU A 1 171 ? 20.257 -7.588  20.908  1.00 40.08  ? 236  LEU A CA  1 
ATOM   1231 C C   . LEU A 1 171 ? 20.904 -6.359  20.289  1.00 37.82  ? 236  LEU A C   1 
ATOM   1232 O O   . LEU A 1 171 ? 20.385 -5.238  20.375  1.00 44.16  ? 236  LEU A O   1 
ATOM   1233 C CB  . LEU A 1 171 ? 20.808 -7.877  22.329  1.00 42.85  ? 236  LEU A CB  1 
ATOM   1234 C CG  . LEU A 1 171 ? 20.667 -6.643  23.185  1.00 46.21  ? 236  LEU A CG  1 
ATOM   1235 C CD1 . LEU A 1 171 ? 19.197 -6.556  23.522  1.00 52.96  ? 236  LEU A CD1 1 
ATOM   1236 C CD2 . LEU A 1 171 ? 21.480 -6.731  24.456  1.00 53.72  ? 236  LEU A CD2 1 
ATOM   1237 N N   . SER A 1 172 ? 22.070 -6.560  19.679  1.00 38.92  ? 237  SER A N   1 
ATOM   1238 C CA  . SER A 1 172 ? 22.802 -5.427  19.128  1.00 39.60  ? 237  SER A CA  1 
ATOM   1239 C C   . SER A 1 172 ? 22.043 -4.994  17.858  1.00 42.44  ? 237  SER A C   1 
ATOM   1240 O O   . SER A 1 172 ? 21.871 -3.768  17.582  1.00 46.46  ? 237  SER A O   1 
ATOM   1241 C CB  . SER A 1 172 ? 24.251 -5.769  18.839  1.00 34.82  ? 237  SER A CB  1 
ATOM   1242 O OG  . SER A 1 172 ? 24.326 -6.884  17.988  1.00 35.36  ? 237  SER A OG  1 
ATOM   1243 N N   . ASN A 1 173 ? 21.481 -5.969  17.152  1.00 35.78  ? 238  ASN A N   1 
ATOM   1244 C CA  . ASN A 1 173 ? 20.504 -5.547  16.136  1.00 44.07  ? 238  ASN A CA  1 
ATOM   1245 C C   . ASN A 1 173 ? 19.363 -4.676  16.621  1.00 45.43  ? 238  ASN A C   1 
ATOM   1246 O O   . ASN A 1 173 ? 19.003 -3.748  15.921  1.00 47.33  ? 238  ASN A O   1 
ATOM   1247 C CB  . ASN A 1 173 ? 20.039 -6.649  15.205  1.00 41.32  ? 238  ASN A CB  1 
ATOM   1248 C CG  . ASN A 1 173 ? 21.077 -6.985  14.182  1.00 40.67  ? 238  ASN A CG  1 
ATOM   1249 O OD1 . ASN A 1 173 ? 21.978 -6.186  13.953  1.00 45.97  ? 238  ASN A OD1 1 
ATOM   1250 N ND2 . ASN A 1 173 ? 21.017 -8.177  13.613  1.00 44.67  ? 238  ASN A ND2 1 
ATOM   1251 N N   . LEU A 1 174 ? 18.856 -4.898  17.836  1.00 45.48  ? 239  LEU A N   1 
ATOM   1252 C CA  . LEU A 1 174 ? 17.839 -3.978  18.344  1.00 43.02  ? 239  LEU A CA  1 
ATOM   1253 C C   . LEU A 1 174 ? 18.374 -2.600  18.600  1.00 44.67  ? 239  LEU A C   1 
ATOM   1254 O O   . LEU A 1 174 ? 17.603 -1.643  18.679  1.00 43.37  ? 239  LEU A O   1 
ATOM   1255 C CB  . LEU A 1 174 ? 17.161 -4.499  19.605  1.00 41.46  ? 239  LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 174 ? 16.693 -5.935  19.455  1.00 44.01  ? 239  LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 174 ? 16.349 -6.547  20.806  1.00 42.23  ? 239  LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 174 ? 15.505 -5.978  18.515  1.00 40.34  ? 239  LEU A CD2 1 
ATOM   1259 N N   . CYS A 1 175 ? 19.678 -2.461  18.811  1.00 50.29  ? 240  CYS A N   1 
ATOM   1260 C CA  . CYS A 1 175 ? 20.105 -1.123  19.271  1.00 49.21  ? 240  CYS A CA  1 
ATOM   1261 C C   . CYS A 1 175 ? 20.607 -0.338  18.100  1.00 42.01  ? 240  CYS A C   1 
ATOM   1262 O O   . CYS A 1 175 ? 20.625 0.858   18.118  1.00 42.97  ? 240  CYS A O   1 
ATOM   1263 C CB  . CYS A 1 175 ? 21.161 -1.185  20.369  1.00 50.40  ? 240  CYS A CB  1 
ATOM   1264 S SG  . CYS A 1 175 ? 20.719 -2.163  21.815  1.00 53.74  ? 240  CYS A SG  1 
ATOM   1265 N N   . ARG A 1 176 ? 20.992 -1.062  17.076  1.00 48.33  ? 241  ARG A N   1 
ATOM   1266 C CA  . ARG A 1 176 ? 21.607 -0.548  15.843  1.00 50.98  ? 241  ARG A CA  1 
ATOM   1267 C C   . ARG A 1 176 ? 20.742 0.400   15.010  1.00 52.18  ? 241  ARG A C   1 
ATOM   1268 O O   . ARG A 1 176 ? 19.526 0.249   14.953  1.00 52.95  ? 241  ARG A O   1 
ATOM   1269 C CB  . ARG A 1 176 ? 21.939 -1.783  14.984  1.00 49.71  ? 241  ARG A CB  1 
ATOM   1270 C CG  . ARG A 1 176 ? 22.567 -1.461  13.656  1.00 51.42  ? 241  ARG A CG  1 
ATOM   1271 C CD  . ARG A 1 176 ? 23.337 -2.641  13.143  1.00 52.00  ? 241  ARG A CD  1 
ATOM   1272 N NE  . ARG A 1 176 ? 24.050 -2.241  11.939  1.00 60.07  ? 241  ARG A NE  1 
ATOM   1273 C CZ  . ARG A 1 176 ? 24.872 -3.037  11.281  1.00 65.60  ? 241  ARG A CZ  1 
ATOM   1274 N NH1 . ARG A 1 176 ? 25.073 -4.268  11.734  1.00 66.06  ? 241  ARG A NH1 1 
ATOM   1275 N NH2 . ARG A 1 176 ? 25.488 -2.602  10.184  1.00 71.56  ? 241  ARG A NH2 1 
ATOM   1276 N N   . GLY A 1 177 ? 21.368 1.361   14.330  1.00 60.57  ? 242  GLY A N   1 
ATOM   1277 C CA  . GLY A 1 177 ? 20.643 2.189   13.347  1.00 56.53  ? 242  GLY A CA  1 
ATOM   1278 C C   . GLY A 1 177 ? 20.408 3.588   13.861  1.00 59.91  ? 242  GLY A C   1 
ATOM   1279 O O   . GLY A 1 177 ? 19.806 3.792   14.920  1.00 56.12  ? 242  GLY A O   1 
ATOM   1280 N N   . LYS A 1 178 ? 20.893 4.557   13.100  1.00 70.86  ? 243  LYS A N   1 
ATOM   1281 C CA  . LYS A 1 178 ? 20.803 5.955   13.496  1.00 72.52  ? 243  LYS A CA  1 
ATOM   1282 C C   . LYS A 1 178 ? 19.684 6.710   12.769  1.00 66.80  ? 243  LYS A C   1 
ATOM   1283 O O   . LYS A 1 178 ? 19.414 7.854   13.113  1.00 65.49  ? 243  LYS A O   1 
ATOM   1284 C CB  . LYS A 1 178 ? 22.162 6.659   13.311  1.00 74.05  ? 243  LYS A CB  1 
ATOM   1285 C CG  . LYS A 1 178 ? 22.785 7.126   14.615  1.00 73.32  ? 243  LYS A CG  1 
ATOM   1286 C CD  . LYS A 1 178 ? 23.836 8.219   14.404  1.00 78.85  ? 243  LYS A CD  1 
ATOM   1287 C CE  . LYS A 1 178 ? 23.802 9.217   15.561  1.00 79.59  ? 243  LYS A CE  1 
ATOM   1288 N NZ  . LYS A 1 178 ? 24.989 10.116  15.642  1.00 81.88  ? 243  LYS A NZ  1 
ATOM   1289 N N   . SER A 1 179 ? 19.011 6.062   11.808  1.00 68.89  ? 244  SER A N   1 
ATOM   1290 C CA  . SER A 1 179 ? 18.031 6.743   10.896  1.00 70.69  ? 244  SER A CA  1 
ATOM   1291 C C   . SER A 1 179 ? 16.621 6.133   10.732  1.00 59.46  ? 244  SER A C   1 
ATOM   1292 O O   . SER A 1 179 ? 16.376 5.442   9.762   1.00 59.61  ? 244  SER A O   1 
ATOM   1293 C CB  . SER A 1 179 ? 18.649 6.889   9.493   1.00 70.14  ? 244  SER A CB  1 
ATOM   1294 O OG  . SER A 1 179 ? 19.511 8.022   9.475   1.00 77.61  ? 244  SER A OG  1 
ATOM   1295 N N   . PRO A 1 180 ? 15.714 6.328   11.703  1.00 58.07  ? 245  PRO A N   1 
ATOM   1296 C CA  . PRO A 1 180 ? 15.878 6.951   13.024  1.00 59.45  ? 245  PRO A CA  1 
ATOM   1297 C C   . PRO A 1 180 ? 16.436 5.960   14.120  1.00 62.82  ? 245  PRO A C   1 
ATOM   1298 O O   . PRO A 1 180 ? 16.441 4.710   13.969  1.00 49.26  ? 245  PRO A O   1 
ATOM   1299 C CB  . PRO A 1 180 ? 14.442 7.346   13.369  1.00 54.63  ? 245  PRO A CB  1 
ATOM   1300 C CG  . PRO A 1 180 ? 13.647 6.155   12.859  1.00 49.84  ? 245  PRO A CG  1 
ATOM   1301 C CD  . PRO A 1 180 ? 14.398 5.658   11.614  1.00 54.72  ? 245  PRO A CD  1 
ATOM   1302 N N   . PRO A 1 181 ? 16.908 6.525   15.230  1.00 62.43  ? 246  PRO A N   1 
ATOM   1303 C CA  . PRO A 1 181 ? 17.397 5.630   16.266  1.00 60.21  ? 246  PRO A CA  1 
ATOM   1304 C C   . PRO A 1 181 ? 16.175 4.927   16.874  1.00 61.33  ? 246  PRO A C   1 
ATOM   1305 O O   . PRO A 1 181 ? 15.075 5.483   16.781  1.00 63.43  ? 246  PRO A O   1 
ATOM   1306 C CB  . PRO A 1 181 ? 18.057 6.594   17.261  1.00 56.94  ? 246  PRO A CB  1 
ATOM   1307 C CG  . PRO A 1 181 ? 18.069 7.963   16.608  1.00 55.01  ? 246  PRO A CG  1 
ATOM   1308 C CD  . PRO A 1 181 ? 16.974 7.950   15.609  1.00 59.90  ? 246  PRO A CD  1 
ATOM   1309 N N   . PRO A 1 182 ? 16.343 3.743   17.509  1.00 57.94  ? 247  PRO A N   1 
ATOM   1310 C CA  . PRO A 1 182 ? 15.152 3.172   18.169  1.00 55.08  ? 247  PRO A CA  1 
ATOM   1311 C C   . PRO A 1 182 ? 14.705 4.114   19.267  1.00 57.73  ? 247  PRO A C   1 
ATOM   1312 O O   . PRO A 1 182 ? 15.466 4.991   19.669  1.00 60.56  ? 247  PRO A O   1 
ATOM   1313 C CB  . PRO A 1 182 ? 15.670 1.878   18.802  1.00 51.62  ? 247  PRO A CB  1 
ATOM   1314 C CG  . PRO A 1 182 ? 17.105 2.153   19.045  1.00 51.17  ? 247  PRO A CG  1 
ATOM   1315 C CD  . PRO A 1 182 ? 17.574 3.045   17.908  1.00 54.38  ? 247  PRO A CD  1 
ATOM   1316 N N   . GLU A 1 183 ? 13.475 3.949   19.743  1.00 67.52  ? 248  GLU A N   1 
ATOM   1317 C CA  . GLU A 1 183 ? 13.020 4.714   20.885  1.00 66.00  ? 248  GLU A CA  1 
ATOM   1318 C C   . GLU A 1 183 ? 13.885 4.233   22.045  1.00 58.75  ? 248  GLU A C   1 
ATOM   1319 O O   . GLU A 1 183 ? 13.876 3.021   22.394  1.00 50.73  ? 248  GLU A O   1 
ATOM   1320 C CB  . GLU A 1 183 ? 11.529 4.477   21.139  1.00 76.57  ? 248  GLU A CB  1 
ATOM   1321 C CG  . GLU A 1 183 ? 10.779 5.770   21.443  1.00 91.51  ? 248  GLU A CG  1 
ATOM   1322 C CD  . GLU A 1 183 ? 9.653  5.598   22.458  1.00 105.47 ? 248  GLU A CD  1 
ATOM   1323 O OE1 . GLU A 1 183 ? 9.764  4.763   23.384  1.00 102.79 ? 248  GLU A OE1 1 
ATOM   1324 O OE2 . GLU A 1 183 ? 8.642  6.317   22.340  1.00 119.65 ? 248  GLU A OE2 1 
ATOM   1325 N N   . PHE A 1 184 ? 14.655 5.161   22.610  1.00 49.51  ? 249  PHE A N   1 
ATOM   1326 C CA  . PHE A 1 184 ? 15.676 4.787   23.588  1.00 52.77  ? 249  PHE A CA  1 
ATOM   1327 C C   . PHE A 1 184 ? 15.084 4.016   24.733  1.00 58.35  ? 249  PHE A C   1 
ATOM   1328 O O   . PHE A 1 184 ? 15.587 2.946   25.098  1.00 62.84  ? 249  PHE A O   1 
ATOM   1329 C CB  . PHE A 1 184 ? 16.352 5.990   24.175  1.00 53.80  ? 249  PHE A CB  1 
ATOM   1330 C CG  . PHE A 1 184 ? 17.659 5.675   24.884  1.00 61.14  ? 249  PHE A CG  1 
ATOM   1331 C CD1 . PHE A 1 184 ? 18.774 5.213   24.162  1.00 53.93  ? 249  PHE A CD1 1 
ATOM   1332 C CD2 . PHE A 1 184 ? 17.810 5.912   26.268  1.00 58.98  ? 249  PHE A CD2 1 
ATOM   1333 C CE1 . PHE A 1 184 ? 19.987 4.970   24.799  1.00 54.03  ? 249  PHE A CE1 1 
ATOM   1334 C CE2 . PHE A 1 184 ? 19.033 5.665   26.908  1.00 55.24  ? 249  PHE A CE2 1 
ATOM   1335 C CZ  . PHE A 1 184 ? 20.121 5.206   26.179  1.00 54.65  ? 249  PHE A CZ  1 
ATOM   1336 N N   . ALA A 1 185 ? 14.022 4.571   25.302  1.00 57.71  ? 250  ALA A N   1 
ATOM   1337 C CA  . ALA A 1 185 ? 13.295 3.888   26.377  1.00 60.88  ? 250  ALA A CA  1 
ATOM   1338 C C   . ALA A 1 185 ? 12.910 2.451   26.034  1.00 59.53  ? 250  ALA A C   1 
ATOM   1339 O O   . ALA A 1 185 ? 12.799 1.639   26.938  1.00 69.65  ? 250  ALA A O   1 
ATOM   1340 C CB  . ALA A 1 185 ? 12.082 4.703   26.868  1.00 49.52  ? 250  ALA A CB  1 
ATOM   1341 N N   . LYS A 1 186 ? 12.748 2.122   24.751  1.00 55.97  ? 251  LYS A N   1 
ATOM   1342 C CA  . LYS A 1 186 ? 12.372 0.750   24.360  1.00 58.53  ? 251  LYS A CA  1 
ATOM   1343 C C   . LYS A 1 186 ? 13.587 -0.154  24.346  1.00 51.82  ? 251  LYS A C   1 
ATOM   1344 O O   . LYS A 1 186 ? 13.471 -1.374  24.343  1.00 52.32  ? 251  LYS A O   1 
ATOM   1345 C CB  . LYS A 1 186 ? 11.657 0.713   22.985  1.00 61.37  ? 251  LYS A CB  1 
ATOM   1346 C CG  . LYS A 1 186 ? 10.270 1.367   22.968  1.00 63.71  ? 251  LYS A CG  1 
ATOM   1347 C CD  . LYS A 1 186 ? 9.362  0.759   21.895  1.00 68.65  ? 251  LYS A CD  1 
ATOM   1348 C CE  . LYS A 1 186 ? 8.020  1.462   21.744  1.00 65.01  ? 251  LYS A CE  1 
ATOM   1349 N NZ  . LYS A 1 186 ? 8.164  2.704   20.914  1.00 74.68  ? 251  LYS A NZ  1 
ATOM   1350 N N   . VAL A 1 187 ? 14.758 0.459   24.378  1.00 49.28  ? 252  VAL A N   1 
ATOM   1351 C CA  . VAL A 1 187 ? 16.016 -0.266  24.210  1.00 51.61  ? 252  VAL A CA  1 
ATOM   1352 C C   . VAL A 1 187 ? 16.966 -0.170  25.438  1.00 49.96  ? 252  VAL A C   1 
ATOM   1353 O O   . VAL A 1 187 ? 17.689 -1.099  25.752  1.00 54.30  ? 252  VAL A O   1 
ATOM   1354 C CB  . VAL A 1 187 ? 16.634 0.210   22.870  1.00 49.29  ? 252  VAL A CB  1 
ATOM   1355 C CG1 . VAL A 1 187 ? 17.760 1.223   23.025  1.00 51.50  ? 252  VAL A CG1 1 
ATOM   1356 C CG2 . VAL A 1 187 ? 16.981 -0.949  21.991  1.00 48.48  ? 252  VAL A CG2 1 
ATOM   1357 N N   . SER A 1 188 ? 16.908 0.938   26.154  1.00 49.18  ? 253  SER A N   1 
ATOM   1358 C CA  . SER A 1 188 ? 17.730 1.161   27.355  1.00 55.84  ? 253  SER A CA  1 
ATOM   1359 C C   . SER A 1 188 ? 17.536 0.197   28.530  1.00 54.36  ? 253  SER A C   1 
ATOM   1360 O O   . SER A 1 188 ? 18.370 0.168   29.420  1.00 58.04  ? 253  SER A O   1 
ATOM   1361 C CB  . SER A 1 188 ? 17.561 2.603   27.878  1.00 53.50  ? 253  SER A CB  1 
ATOM   1362 O OG  . SER A 1 188 ? 16.248 2.792   28.402  1.00 51.52  ? 253  SER A OG  1 
ATOM   1363 N N   . PRO A 1 189 ? 16.433 -0.557  28.573  1.00 55.62  ? 254  PRO A N   1 
ATOM   1364 C CA  . PRO A 1 189 ? 16.412 -1.624  29.582  1.00 51.90  ? 254  PRO A CA  1 
ATOM   1365 C C   . PRO A 1 189 ? 17.488 -2.669  29.455  1.00 48.02  ? 254  PRO A C   1 
ATOM   1366 O O   . PRO A 1 189 ? 17.780 -3.356  30.415  1.00 56.02  ? 254  PRO A O   1 
ATOM   1367 C CB  . PRO A 1 189 ? 15.028 -2.242  29.395  1.00 54.88  ? 254  PRO A CB  1 
ATOM   1368 C CG  . PRO A 1 189 ? 14.197 -1.020  29.132  1.00 59.12  ? 254  PRO A CG  1 
ATOM   1369 C CD  . PRO A 1 189 ? 15.061 -0.136  28.233  1.00 53.48  ? 254  PRO A CD  1 
ATOM   1370 N N   . CYS A 1 190 ? 18.106 -2.825  28.299  1.00 52.47  ? 255  CYS A N   1 
ATOM   1371 C CA  . CYS A 1 190 ? 19.178 -3.849  28.223  1.00 49.70  ? 255  CYS A CA  1 
ATOM   1372 C C   . CYS A 1 190 ? 20.530 -3.428  28.852  1.00 46.97  ? 255  CYS A C   1 
ATOM   1373 O O   . CYS A 1 190 ? 21.470 -4.222  28.864  1.00 45.69  ? 255  CYS A O   1 
ATOM   1374 C CB  . CYS A 1 190 ? 19.399 -4.296  26.769  1.00 53.71  ? 255  CYS A CB  1 
ATOM   1375 S SG  . CYS A 1 190 ? 20.332 -3.083  25.802  1.00 46.21  ? 255  CYS A SG  1 
ATOM   1376 N N   . LEU A 1 191 ? 20.656 -2.197  29.351  1.00 47.60  ? 256  LEU A N   1 
ATOM   1377 C CA  . LEU A 1 191 ? 21.980 -1.732  29.840  1.00 54.72  ? 256  LEU A CA  1 
ATOM   1378 C C   . LEU A 1 191 ? 22.592 -2.596  30.964  1.00 59.16  ? 256  LEU A C   1 
ATOM   1379 O O   . LEU A 1 191 ? 23.805 -2.886  30.956  1.00 66.19  ? 256  LEU A O   1 
ATOM   1380 C CB  . LEU A 1 191 ? 21.980 -0.212  30.159  1.00 50.13  ? 256  LEU A CB  1 
ATOM   1381 C CG  . LEU A 1 191 ? 22.122 0.658   28.874  1.00 45.74  ? 256  LEU A CG  1 
ATOM   1382 C CD1 . LEU A 1 191 ? 21.609 2.078   28.990  1.00 44.28  ? 256  LEU A CD1 1 
ATOM   1383 C CD2 . LEU A 1 191 ? 23.558 0.704   28.360  1.00 41.26  ? 256  LEU A CD2 1 
ATOM   1384 N N   . ASN A 1 192 ? 21.752 -3.075  31.879  1.00 55.11  ? 257  ASN A N   1 
ATOM   1385 C CA  . ASN A 1 192 ? 22.210 -3.981  32.930  1.00 56.81  ? 257  ASN A CA  1 
ATOM   1386 C C   . ASN A 1 192 ? 22.840 -5.217  32.425  1.00 57.50  ? 257  ASN A C   1 
ATOM   1387 O O   . ASN A 1 192 ? 24.004 -5.491  32.669  1.00 62.13  ? 257  ASN A O   1 
ATOM   1388 C CB  . ASN A 1 192 ? 21.067 -4.373  33.841  1.00 64.71  ? 257  ASN A CB  1 
ATOM   1389 C CG  . ASN A 1 192 ? 20.945 -3.439  34.998  1.00 76.07  ? 257  ASN A CG  1 
ATOM   1390 O OD1 . ASN A 1 192 ? 20.925 -2.203  34.825  1.00 82.59  ? 257  ASN A OD1 1 
ATOM   1391 N ND2 . ASN A 1 192 ? 20.916 -4.001  36.193  1.00 79.18  ? 257  ASN A ND2 1 
ATOM   1392 N N   . VAL A 1 193 ? 22.066 -5.999  31.709  1.00 57.67  ? 258  VAL A N   1 
ATOM   1393 C CA  . VAL A 1 193 ? 22.634 -7.192  31.168  1.00 58.80  ? 258  VAL A CA  1 
ATOM   1394 C C   . VAL A 1 193 ? 23.958 -6.867  30.471  1.00 70.17  ? 258  VAL A C   1 
ATOM   1395 O O   . VAL A 1 193 ? 24.936 -7.643  30.559  1.00 67.99  ? 258  VAL A O   1 
ATOM   1396 C CB  . VAL A 1 193 ? 21.676 -7.783  30.169  1.00 54.51  ? 258  VAL A CB  1 
ATOM   1397 C CG1 . VAL A 1 193 ? 22.319 -8.969  29.469  1.00 47.03  ? 258  VAL A CG1 1 
ATOM   1398 C CG2 . VAL A 1 193 ? 20.410 -8.144  30.918  1.00 53.91  ? 258  VAL A CG2 1 
ATOM   1399 N N   . LEU A 1 194 ? 23.986 -5.704  29.804  1.00 65.20  ? 259  LEU A N   1 
ATOM   1400 C CA  . LEU A 1 194 ? 25.009 -5.424  28.806  1.00 60.41  ? 259  LEU A CA  1 
ATOM   1401 C C   . LEU A 1 194 ? 26.315 -5.147  29.534  1.00 63.05  ? 259  LEU A C   1 
ATOM   1402 O O   . LEU A 1 194 ? 27.370 -5.731  29.201  1.00 55.35  ? 259  LEU A O   1 
ATOM   1403 C CB  . LEU A 1 194 ? 24.568 -4.256  27.937  1.00 55.20  ? 259  LEU A CB  1 
ATOM   1404 C CG  . LEU A 1 194 ? 24.802 -4.408  26.465  1.00 49.23  ? 259  LEU A CG  1 
ATOM   1405 C CD1 . LEU A 1 194 ? 24.587 -5.824  26.035  1.00 52.15  ? 259  LEU A CD1 1 
ATOM   1406 C CD2 . LEU A 1 194 ? 23.901 -3.468  25.728  1.00 47.84  ? 259  LEU A CD2 1 
ATOM   1407 N N   . SER A 1 195 ? 26.204 -4.317  30.577  1.00 57.63  ? 260  SER A N   1 
ATOM   1408 C CA  . SER A 1 195 ? 27.332 -3.951  31.455  1.00 57.34  ? 260  SER A CA  1 
ATOM   1409 C C   . SER A 1 195 ? 27.991 -5.185  32.083  1.00 61.45  ? 260  SER A C   1 
ATOM   1410 O O   . SER A 1 195 ? 29.237 -5.265  32.220  1.00 59.15  ? 260  SER A O   1 
ATOM   1411 C CB  . SER A 1 195 ? 26.845 -3.055  32.587  1.00 57.88  ? 260  SER A CB  1 
ATOM   1412 O OG  . SER A 1 195 ? 26.455 -3.878  33.670  1.00 70.70  ? 260  SER A OG  1 
ATOM   1413 N N   . TRP A 1 196 ? 27.174 -6.146  32.487  1.00 58.72  ? 261  TRP A N   1 
ATOM   1414 C CA  . TRP A 1 196 ? 27.797 -7.276  33.100  1.00 61.78  ? 261  TRP A CA  1 
ATOM   1415 C C   . TRP A 1 196 ? 28.199 -8.329  32.108  1.00 57.58  ? 261  TRP A C   1 
ATOM   1416 O O   . TRP A 1 196 ? 29.031 -9.153  32.418  1.00 61.70  ? 261  TRP A O   1 
ATOM   1417 C CB  . TRP A 1 196 ? 27.098 -7.728  34.418  1.00 60.70  ? 261  TRP A CB  1 
ATOM   1418 C CG  . TRP A 1 196 ? 25.762 -8.375  34.265  1.00 53.46  ? 261  TRP A CG  1 
ATOM   1419 C CD1 . TRP A 1 196 ? 24.525 -7.890  34.705  1.00 53.15  ? 261  TRP A CD1 1 
ATOM   1420 C CD2 . TRP A 1 196 ? 25.483 -9.676  33.608  1.00 47.46  ? 261  TRP A CD2 1 
ATOM   1421 N NE1 . TRP A 1 196 ? 23.510 -8.765  34.346  1.00 53.39  ? 261  TRP A NE1 1 
ATOM   1422 C CE2 . TRP A 1 196 ? 24.028 -9.870  33.688  1.00 49.71  ? 261  TRP A CE2 1 
ATOM   1423 C CE3 . TRP A 1 196 ? 26.282 -10.686 32.984  1.00 55.00  ? 261  TRP A CE3 1 
ATOM   1424 C CZ2 . TRP A 1 196 ? 23.407 -11.043 33.172  1.00 55.13  ? 261  TRP A CZ2 1 
ATOM   1425 C CZ3 . TRP A 1 196 ? 25.648 -11.872 32.470  1.00 53.82  ? 261  TRP A CZ3 1 
ATOM   1426 C CH2 . TRP A 1 196 ? 24.248 -12.041 32.564  1.00 52.37  ? 261  TRP A CH2 1 
ATOM   1427 N N   . LEU A 1 197 ? 27.720 -8.283  30.864  1.00 61.22  ? 262  LEU A N   1 
ATOM   1428 C CA  . LEU A 1 197 ? 28.254 -9.251  29.880  1.00 50.24  ? 262  LEU A CA  1 
ATOM   1429 C C   . LEU A 1 197 ? 29.687 -8.914  29.481  1.00 52.12  ? 262  LEU A C   1 
ATOM   1430 O O   . LEU A 1 197 ? 30.435 -9.764  28.990  1.00 54.63  ? 262  LEU A O   1 
ATOM   1431 C CB  . LEU A 1 197 ? 27.406 -9.312  28.664  1.00 53.00  ? 262  LEU A CB  1 
ATOM   1432 C CG  . LEU A 1 197 ? 26.116 -10.100 28.654  1.00 59.17  ? 262  LEU A CG  1 
ATOM   1433 C CD1 . LEU A 1 197 ? 25.478 -9.559  27.367  1.00 52.55  ? 262  LEU A CD1 1 
ATOM   1434 C CD2 . LEU A 1 197 ? 26.303 -11.625 28.570  1.00 47.53  ? 262  LEU A CD2 1 
ATOM   1435 N N   . LEU A 1 198 ? 30.082 -7.667  29.724  1.00 43.75  ? 263  LEU A N   1 
ATOM   1436 C CA  . LEU A 1 198 ? 31.451 -7.246  29.568  1.00 44.75  ? 263  LEU A CA  1 
ATOM   1437 C C   . LEU A 1 198 ? 32.477 -8.033  30.374  1.00 48.55  ? 263  LEU A C   1 
ATOM   1438 O O   . LEU A 1 198 ? 33.645 -8.024  30.026  1.00 54.07  ? 263  LEU A O   1 
ATOM   1439 C CB  . LEU A 1 198 ? 31.554 -5.748  29.909  1.00 44.28  ? 263  LEU A CB  1 
ATOM   1440 C CG  . LEU A 1 198 ? 30.933 -4.826  28.860  1.00 41.34  ? 263  LEU A CG  1 
ATOM   1441 C CD1 . LEU A 1 198 ? 31.311 -3.394  29.159  1.00 43.66  ? 263  LEU A CD1 1 
ATOM   1442 C CD2 . LEU A 1 198 ? 31.481 -5.251  27.488  1.00 41.33  ? 263  LEU A CD2 1 
ATOM   1443 N N   . PHE A 1 199 ? 32.060 -8.691  31.465  1.00 46.56  ? 264  PHE A N   1 
ATOM   1444 C CA  . PHE A 1 199 ? 33.007 -9.447  32.289  1.00 45.52  ? 264  PHE A CA  1 
ATOM   1445 C C   . PHE A 1 199 ? 33.054 -10.897 31.965  1.00 41.77  ? 264  PHE A C   1 
ATOM   1446 O O   . PHE A 1 199 ? 33.729 -11.656 32.650  1.00 48.41  ? 264  PHE A O   1 
ATOM   1447 C CB  . PHE A 1 199 ? 32.701 -9.341  33.759  1.00 39.97  ? 264  PHE A CB  1 
ATOM   1448 C CG  . PHE A 1 199 ? 32.797 -7.965  34.303  1.00 38.69  ? 264  PHE A CG  1 
ATOM   1449 C CD1 . PHE A 1 199 ? 31.685 -7.119  34.290  1.00 35.40  ? 264  PHE A CD1 1 
ATOM   1450 C CD2 . PHE A 1 199 ? 33.977 -7.537  34.930  1.00 38.23  ? 264  PHE A CD2 1 
ATOM   1451 C CE1 . PHE A 1 199 ? 31.713 -5.836  34.890  1.00 33.32  ? 264  PHE A CE1 1 
ATOM   1452 C CE2 . PHE A 1 199 ? 34.035 -6.239  35.511  1.00 40.65  ? 264  PHE A CE2 1 
ATOM   1453 C CZ  . PHE A 1 199 ? 32.910 -5.373  35.464  1.00 38.40  ? 264  PHE A CZ  1 
ATOM   1454 N N   . VAL A 1 200 ? 32.337 -11.276 30.933  1.00 40.22  ? 265  VAL A N   1 
ATOM   1455 C CA  . VAL A 1 200 ? 32.180 -12.683 30.556  1.00 43.90  ? 265  VAL A CA  1 
ATOM   1456 C C   . VAL A 1 200 ? 33.483 -12.986 29.855  1.00 41.78  ? 265  VAL A C   1 
ATOM   1457 O O   . VAL A 1 200 ? 34.305 -12.104 29.657  1.00 50.84  ? 265  VAL A O   1 
ATOM   1458 C CB  . VAL A 1 200 ? 30.867 -12.902 29.657  1.00 41.51  ? 265  VAL A CB  1 
ATOM   1459 C CG1 . VAL A 1 200 ? 31.085 -12.405 28.255  1.00 36.45  ? 265  VAL A CG1 1 
ATOM   1460 C CG2 . VAL A 1 200 ? 30.469 -14.348 29.534  1.00 51.54  ? 265  VAL A CG2 1 
ATOM   1461 N N   . SER A 1 201 ? 33.666 -14.198 29.405  1.00 48.99  ? 266  SER A N   1 
ATOM   1462 C CA  . SER A 1 201 ? 34.963 -14.575 28.882  1.00 53.43  ? 266  SER A CA  1 
ATOM   1463 C C   . SER A 1 201 ? 35.010 -14.731 27.359  1.00 59.66  ? 266  SER A C   1 
ATOM   1464 O O   . SER A 1 201 ? 36.076 -14.570 26.733  1.00 63.48  ? 266  SER A O   1 
ATOM   1465 C CB  . SER A 1 201 ? 35.339 -15.885 29.581  1.00 60.58  ? 266  SER A CB  1 
ATOM   1466 O OG  . SER A 1 201 ? 36.028 -16.701 28.683  1.00 76.98  ? 266  SER A OG  1 
ATOM   1467 N N   . ASP A 1 202 ? 33.862 -15.057 26.753  1.00 60.91  ? 267  ASP A N   1 
ATOM   1468 C CA  . ASP A 1 202 ? 33.822 -15.381 25.310  1.00 57.78  ? 267  ASP A CA  1 
ATOM   1469 C C   . ASP A 1 202 ? 34.005 -14.187 24.408  1.00 56.15  ? 267  ASP A C   1 
ATOM   1470 O O   . ASP A 1 202 ? 33.419 -13.122 24.631  1.00 59.55  ? 267  ASP A O   1 
ATOM   1471 C CB  . ASP A 1 202 ? 32.518 -16.082 24.919  1.00 62.36  ? 267  ASP A CB  1 
ATOM   1472 C CG  . ASP A 1 202 ? 32.499 -16.473 23.471  1.00 60.35  ? 267  ASP A CG  1 
ATOM   1473 O OD1 . ASP A 1 202 ? 33.430 -17.162 23.041  1.00 62.86  ? 267  ASP A OD1 1 
ATOM   1474 O OD2 . ASP A 1 202 ? 31.587 -16.041 22.746  1.00 66.80  ? 267  ASP A OD2 1 
ATOM   1475 N N   . THR A 1 203 ? 34.809 -14.382 23.375  1.00 54.54  ? 268  THR A N   1 
ATOM   1476 C CA  . THR A 1 203 ? 35.180 -13.320 22.475  1.00 49.72  ? 268  THR A CA  1 
ATOM   1477 C C   . THR A 1 203 ? 33.907 -12.759 21.732  1.00 55.43  ? 268  THR A C   1 
ATOM   1478 O O   . THR A 1 203 ? 33.573 -11.546 21.808  1.00 51.91  ? 268  THR A O   1 
ATOM   1479 C CB  . THR A 1 203 ? 36.335 -13.869 21.630  1.00 56.17  ? 268  THR A CB  1 
ATOM   1480 O OG1 . THR A 1 203 ? 37.551 -13.669 22.357  1.00 62.29  ? 268  THR A OG1 1 
ATOM   1481 C CG2 . THR A 1 203 ? 36.437 -13.271 20.205  1.00 64.14  ? 268  THR A CG2 1 
ATOM   1482 N N   . ASP A 1 204 ? 33.143 -13.650 21.114  1.00 54.05  ? 269  ASP A N   1 
ATOM   1483 C CA  . ASP A 1 204 ? 31.940 -13.226 20.398  1.00 52.45  ? 269  ASP A CA  1 
ATOM   1484 C C   . ASP A 1 204 ? 30.971 -12.492 21.303  1.00 52.23  ? 269  ASP A C   1 
ATOM   1485 O O   . ASP A 1 204 ? 30.394 -11.457 20.908  1.00 50.51  ? 269  ASP A O   1 
ATOM   1486 C CB  . ASP A 1 204 ? 31.272 -14.391 19.664  1.00 52.44  ? 269  ASP A CB  1 
ATOM   1487 C CG  . ASP A 1 204 ? 32.141 -14.931 18.504  1.00 55.26  ? 269  ASP A CG  1 
ATOM   1488 O OD1 . ASP A 1 204 ? 33.110 -14.258 18.140  1.00 58.49  ? 269  ASP A OD1 1 
ATOM   1489 O OD2 . ASP A 1 204 ? 31.882 -16.033 17.961  1.00 60.37  ? 269  ASP A OD2 1 
ATOM   1490 N N   . VAL A 1 205 ? 30.823 -12.965 22.534  1.00 47.35  ? 270  VAL A N   1 
ATOM   1491 C CA  . VAL A 1 205 ? 29.870 -12.328 23.411  1.00 42.39  ? 270  VAL A CA  1 
ATOM   1492 C C   . VAL A 1 205 ? 30.372 -10.942 23.757  1.00 47.88  ? 270  VAL A C   1 
ATOM   1493 O O   . VAL A 1 205 ? 29.612 -9.985  23.745  1.00 48.43  ? 270  VAL A O   1 
ATOM   1494 C CB  . VAL A 1 205 ? 29.581 -13.200 24.649  1.00 49.01  ? 270  VAL A CB  1 
ATOM   1495 C CG1 . VAL A 1 205 ? 28.778 -12.449 25.704  1.00 39.46  ? 270  VAL A CG1 1 
ATOM   1496 C CG2 . VAL A 1 205 ? 28.888 -14.495 24.205  1.00 49.15  ? 270  VAL A CG2 1 
ATOM   1497 N N   . LEU A 1 206 ? 31.669 -10.806 24.010  1.00 52.50  ? 271  LEU A N   1 
ATOM   1498 C CA  . LEU A 1 206 ? 32.213 -9.502  24.355  1.00 47.72  ? 271  LEU A CA  1 
ATOM   1499 C C   . LEU A 1 206 ? 32.090 -8.571  23.167  1.00 47.01  ? 271  LEU A C   1 
ATOM   1500 O O   . LEU A 1 206 ? 31.791 -7.365  23.287  1.00 43.63  ? 271  LEU A O   1 
ATOM   1501 C CB  . LEU A 1 206 ? 33.673 -9.633  24.771  1.00 47.88  ? 271  LEU A CB  1 
ATOM   1502 C CG  . LEU A 1 206 ? 33.964 -10.231 26.166  1.00 47.27  ? 271  LEU A CG  1 
ATOM   1503 C CD1 . LEU A 1 206 ? 35.392 -10.767 26.254  1.00 41.27  ? 271  LEU A CD1 1 
ATOM   1504 C CD2 . LEU A 1 206 ? 33.663 -9.196  27.225  1.00 43.55  ? 271  LEU A CD2 1 
ATOM   1505 N N   . ALA A 1 207 ? 32.356 -9.123  22.001  1.00 44.55  ? 272  ALA A N   1 
ATOM   1506 C CA  . ALA A 1 207 ? 32.298 -8.289  20.803  1.00 45.13  ? 272  ALA A CA  1 
ATOM   1507 C C   . ALA A 1 207 ? 30.910 -7.652  20.598  1.00 44.63  ? 272  ALA A C   1 
ATOM   1508 O O   . ALA A 1 207 ? 30.769 -6.406  20.420  1.00 42.04  ? 272  ALA A O   1 
ATOM   1509 C CB  . ALA A 1 207 ? 32.706 -9.107  19.605  1.00 44.52  ? 272  ALA A CB  1 
ATOM   1510 N N   . ASP A 1 208 ? 29.874 -8.485  20.687  1.00 36.36  ? 273  ASP A N   1 
ATOM   1511 C CA  . ASP A 1 208 ? 28.555 -7.989  20.359  1.00 37.87  ? 273  ASP A CA  1 
ATOM   1512 C C   . ASP A 1 208 ? 28.076 -7.062  21.442  1.00 45.88  ? 273  ASP A C   1 
ATOM   1513 O O   . ASP A 1 208 ? 27.268 -6.105  21.181  1.00 45.80  ? 273  ASP A O   1 
ATOM   1514 C CB  . ASP A 1 208 ? 27.586 -9.129  20.062  1.00 44.43  ? 273  ASP A CB  1 
ATOM   1515 C CG  . ASP A 1 208 ? 27.876 -9.790  18.715  1.00 45.27  ? 273  ASP A CG  1 
ATOM   1516 O OD1 . ASP A 1 208 ? 28.296 -9.030  17.808  1.00 44.98  ? 273  ASP A OD1 1 
ATOM   1517 O OD2 . ASP A 1 208 ? 27.778 -11.036 18.578  1.00 44.80  ? 273  ASP A OD2 1 
ATOM   1518 N N   . ALA A 1 209 ? 28.598 -7.269  22.657  1.00 42.12  ? 274  ALA A N   1 
ATOM   1519 C CA  . ALA A 1 209 ? 28.080 -6.446  23.711  1.00 39.53  ? 274  ALA A CA  1 
ATOM   1520 C C   . ALA A 1 209 ? 28.726 -5.093  23.552  1.00 40.57  ? 274  ALA A C   1 
ATOM   1521 O O   . ALA A 1 209 ? 28.087 -4.066  23.876  1.00 44.17  ? 274  ALA A O   1 
ATOM   1522 C CB  . ALA A 1 209 ? 28.302 -7.047  25.056  1.00 36.95  ? 274  ALA A CB  1 
ATOM   1523 N N   . CYS A 1 210 ? 29.942 -5.061  22.991  1.00 37.02  ? 275  CYS A N   1 
ATOM   1524 C CA  . CYS A 1 210 ? 30.553 -3.762  22.657  1.00 40.28  ? 275  CYS A CA  1 
ATOM   1525 C C   . CYS A 1 210 ? 29.878 -3.093  21.439  1.00 43.31  ? 275  CYS A C   1 
ATOM   1526 O O   . CYS A 1 210 ? 29.572 -1.874  21.454  1.00 44.97  ? 275  CYS A O   1 
ATOM   1527 C CB  . CYS A 1 210 ? 32.058 -3.861  22.460  1.00 45.25  ? 275  CYS A CB  1 
ATOM   1528 S SG  . CYS A 1 210 ? 32.948 -4.305  23.972  1.00 47.52  ? 275  CYS A SG  1 
ATOM   1529 N N   . TRP A 1 211 ? 29.614 -3.859  20.388  1.00 38.12  ? 276  TRP A N   1 
ATOM   1530 C CA  . TRP A 1 211 ? 28.749 -3.294  19.337  1.00 39.20  ? 276  TRP A CA  1 
ATOM   1531 C C   . TRP A 1 211 ? 27.522 -2.668  19.917  1.00 40.17  ? 276  TRP A C   1 
ATOM   1532 O O   . TRP A 1 211 ? 27.257 -1.457  19.735  1.00 45.62  ? 276  TRP A O   1 
ATOM   1533 C CB  . TRP A 1 211 ? 28.403 -4.344  18.287  1.00 40.69  ? 276  TRP A CB  1 
ATOM   1534 C CG  . TRP A 1 211 ? 29.606 -4.565  17.374  1.00 44.22  ? 276  TRP A CG  1 
ATOM   1535 C CD1 . TRP A 1 211 ? 30.362 -5.715  17.224  1.00 42.38  ? 276  TRP A CD1 1 
ATOM   1536 C CD2 . TRP A 1 211 ? 30.272 -3.562  16.522  1.00 39.79  ? 276  TRP A CD2 1 
ATOM   1537 N NE1 . TRP A 1 211 ? 31.394 -5.518  16.338  1.00 43.58  ? 276  TRP A NE1 1 
ATOM   1538 C CE2 . TRP A 1 211 ? 31.415 -4.246  15.901  1.00 43.51  ? 276  TRP A CE2 1 
ATOM   1539 C CE3 . TRP A 1 211 ? 30.056 -2.201  16.255  1.00 38.51  ? 276  TRP A CE3 1 
ATOM   1540 C CZ2 . TRP A 1 211 ? 32.287 -3.594  15.026  1.00 42.29  ? 276  TRP A CZ2 1 
ATOM   1541 C CZ3 . TRP A 1 211 ? 30.914 -1.557  15.373  1.00 39.22  ? 276  TRP A CZ3 1 
ATOM   1542 C CH2 . TRP A 1 211 ? 31.985 -2.242  14.746  1.00 45.83  ? 276  TRP A CH2 1 
ATOM   1543 N N   . ALA A 1 212 ? 26.774 -3.459  20.685  1.00 37.48  ? 277  ALA A N   1 
ATOM   1544 C CA  . ALA A 1 212 ? 25.521 -2.952  21.201  1.00 34.70  ? 277  ALA A CA  1 
ATOM   1545 C C   . ALA A 1 212 ? 25.793 -1.710  21.999  1.00 35.20  ? 277  ALA A C   1 
ATOM   1546 O O   . ALA A 1 212 ? 25.033 -0.752  21.917  1.00 42.31  ? 277  ALA A O   1 
ATOM   1547 C CB  . ALA A 1 212 ? 24.819 -3.999  22.049  1.00 34.72  ? 277  ALA A CB  1 
ATOM   1548 N N   . LEU A 1 213 ? 26.865 -1.706  22.793  1.00 36.95  ? 278  LEU A N   1 
ATOM   1549 C CA  . LEU A 1 213 ? 27.075 -0.552  23.652  1.00 42.38  ? 278  LEU A CA  1 
ATOM   1550 C C   . LEU A 1 213 ? 27.525 0.609   22.814  1.00 42.30  ? 278  LEU A C   1 
ATOM   1551 O O   . LEU A 1 213 ? 27.318 1.751   23.201  1.00 45.43  ? 278  LEU A O   1 
ATOM   1552 C CB  . LEU A 1 213 ? 28.051 -0.846  24.786  1.00 45.14  ? 278  LEU A CB  1 
ATOM   1553 C CG  . LEU A 1 213 ? 27.496 -1.595  25.997  1.00 44.51  ? 278  LEU A CG  1 
ATOM   1554 C CD1 . LEU A 1 213 ? 28.695 -2.124  26.745  1.00 48.48  ? 278  LEU A CD1 1 
ATOM   1555 C CD2 . LEU A 1 213 ? 26.744 -0.618  26.849  1.00 38.07  ? 278  LEU A CD2 1 
ATOM   1556 N N   . SER A 1 214 ? 28.113 0.340   21.650  1.00 40.18  ? 279  SER A N   1 
ATOM   1557 C CA  . SER A 1 214 ? 28.511 1.478   20.794  1.00 45.14  ? 279  SER A CA  1 
ATOM   1558 C C   . SER A 1 214 ? 27.298 2.073   20.100  1.00 46.05  ? 279  SER A C   1 
ATOM   1559 O O   . SER A 1 214 ? 27.217 3.288   19.877  1.00 47.81  ? 279  SER A O   1 
ATOM   1560 C CB  . SER A 1 214 ? 29.574 1.094   19.751  1.00 42.26  ? 279  SER A CB  1 
ATOM   1561 O OG  . SER A 1 214 ? 29.018 0.226   18.792  1.00 48.26  ? 279  SER A OG  1 
ATOM   1562 N N   . TYR A 1 215 ? 26.343 1.230   19.747  1.00 41.16  ? 280  TYR A N   1 
ATOM   1563 C CA  . TYR A 1 215 ? 25.174 1.779   19.081  1.00 41.50  ? 280  TYR A CA  1 
ATOM   1564 C C   . TYR A 1 215 ? 24.426 2.623   20.044  1.00 45.78  ? 280  TYR A C   1 
ATOM   1565 O O   . TYR A 1 215 ? 23.919 3.664   19.657  1.00 44.42  ? 280  TYR A O   1 
ATOM   1566 C CB  . TYR A 1 215 ? 24.257 0.677   18.601  1.00 38.60  ? 280  TYR A CB  1 
ATOM   1567 C CG  . TYR A 1 215 ? 24.951 -0.274  17.645  1.00 37.05  ? 280  TYR A CG  1 
ATOM   1568 C CD1 . TYR A 1 215 ? 25.890 0.172   16.701  1.00 32.54  ? 280  TYR A CD1 1 
ATOM   1569 C CD2 . TYR A 1 215 ? 24.630 -1.589  17.668  1.00 35.00  ? 280  TYR A CD2 1 
ATOM   1570 C CE1 . TYR A 1 215 ? 26.491 -0.736  15.844  1.00 38.22  ? 280  TYR A CE1 1 
ATOM   1571 C CE2 . TYR A 1 215 ? 25.172 -2.496  16.787  1.00 35.81  ? 280  TYR A CE2 1 
ATOM   1572 C CZ  . TYR A 1 215 ? 26.121 -2.101  15.905  1.00 41.11  ? 280  TYR A CZ  1 
ATOM   1573 O OH  . TYR A 1 215 ? 26.641 -3.129  15.111  1.00 38.91  ? 280  TYR A OH  1 
ATOM   1574 N N   . LEU A 1 216 ? 24.376 2.196   21.315  1.00 47.08  ? 281  LEU A N   1 
ATOM   1575 C CA  . LEU A 1 216 ? 23.623 2.951   22.332  1.00 42.40  ? 281  LEU A CA  1 
ATOM   1576 C C   . LEU A 1 216 ? 24.332 4.227   22.739  1.00 44.23  ? 281  LEU A C   1 
ATOM   1577 O O   . LEU A 1 216 ? 23.691 5.181   23.119  1.00 51.21  ? 281  LEU A O   1 
ATOM   1578 C CB  . LEU A 1 216 ? 23.365 2.102   23.560  1.00 45.56  ? 281  LEU A CB  1 
ATOM   1579 C CG  . LEU A 1 216 ? 22.551 0.836   23.293  1.00 51.20  ? 281  LEU A CG  1 
ATOM   1580 C CD1 . LEU A 1 216 ? 22.787 -0.240  24.336  1.00 41.09  ? 281  LEU A CD1 1 
ATOM   1581 C CD2 . LEU A 1 216 ? 21.084 1.226   23.229  1.00 52.00  ? 281  LEU A CD2 1 
ATOM   1582 N N   . SER A 1 217 ? 25.649 4.273   22.652  1.00 44.23  ? 282  SER A N   1 
ATOM   1583 C CA  . SER A 1 217 ? 26.363 5.492   22.997  1.00 47.52  ? 282  SER A CA  1 
ATOM   1584 C C   . SER A 1 217 ? 26.405 6.480   21.846  1.00 50.78  ? 282  SER A C   1 
ATOM   1585 O O   . SER A 1 217 ? 26.985 7.579   21.965  1.00 54.72  ? 282  SER A O   1 
ATOM   1586 C CB  . SER A 1 217 ? 27.803 5.160   23.390  1.00 46.40  ? 282  SER A CB  1 
ATOM   1587 O OG  . SER A 1 217 ? 28.415 4.392   22.379  1.00 52.17  ? 282  SER A OG  1 
ATOM   1588 N N   . ASP A 1 218 ? 25.865 6.065   20.708  1.00 50.63  ? 283  ASP A N   1 
ATOM   1589 C CA  . ASP A 1 218 ? 25.980 6.851   19.485  1.00 52.62  ? 283  ASP A CA  1 
ATOM   1590 C C   . ASP A 1 218 ? 24.814 7.820   19.399  1.00 51.51  ? 283  ASP A C   1 
ATOM   1591 O O   . ASP A 1 218 ? 23.870 7.598   18.657  1.00 65.95  ? 283  ASP A O   1 
ATOM   1592 C CB  . ASP A 1 218 ? 26.014 5.932   18.249  1.00 56.25  ? 283  ASP A CB  1 
ATOM   1593 C CG  . ASP A 1 218 ? 26.510 6.648   16.972  1.00 57.06  ? 283  ASP A CG  1 
ATOM   1594 O OD1 . ASP A 1 218 ? 26.660 7.901   16.925  1.00 52.94  ? 283  ASP A OD1 1 
ATOM   1595 O OD2 . ASP A 1 218 ? 26.735 5.911   16.000  1.00 58.70  ? 283  ASP A OD2 1 
ATOM   1596 N N   . GLY A 1 219 ? 24.878 8.893   20.169  1.00 50.90  ? 284  GLY A N   1 
ATOM   1597 C CA  . GLY A 1 219 ? 23.835 9.892   20.190  1.00 45.67  ? 284  GLY A CA  1 
ATOM   1598 C C   . GLY A 1 219 ? 24.100 11.084  21.090  1.00 49.40  ? 284  GLY A C   1 
ATOM   1599 O O   . GLY A 1 219 ? 25.249 11.447  21.353  1.00 50.38  ? 284  GLY A O   1 
ATOM   1600 N N   . PRO A 1 220 ? 23.022 11.718  21.563  1.00 53.37  ? 285  PRO A N   1 
ATOM   1601 C CA  . PRO A 1 220 ? 23.142 12.925  22.373  1.00 50.95  ? 285  PRO A CA  1 
ATOM   1602 C C   . PRO A 1 220 ? 23.686 12.563  23.764  1.00 50.66  ? 285  PRO A C   1 
ATOM   1603 O O   . PRO A 1 220 ? 23.722 11.375  24.118  1.00 48.52  ? 285  PRO A O   1 
ATOM   1604 C CB  . PRO A 1 220 ? 21.690 13.444  22.439  1.00 51.32  ? 285  PRO A CB  1 
ATOM   1605 C CG  . PRO A 1 220 ? 20.985 12.759  21.299  1.00 55.64  ? 285  PRO A CG  1 
ATOM   1606 C CD  . PRO A 1 220 ? 21.613 11.391  21.272  1.00 51.04  ? 285  PRO A CD  1 
ATOM   1607 N N   . ASN A 1 221 ? 24.101 13.582  24.517  1.00 49.69  ? 286  ASN A N   1 
ATOM   1608 C CA  . ASN A 1 221 ? 24.787 13.424  25.781  1.00 50.21  ? 286  ASN A CA  1 
ATOM   1609 C C   . ASN A 1 221 ? 24.025 12.664  26.837  1.00 52.13  ? 286  ASN A C   1 
ATOM   1610 O O   . ASN A 1 221 ? 24.640 11.922  27.623  1.00 62.14  ? 286  ASN A O   1 
ATOM   1611 C CB  . ASN A 1 221 ? 25.275 14.769  26.309  1.00 50.52  ? 286  ASN A CB  1 
ATOM   1612 C CG  . ASN A 1 221 ? 26.471 15.274  25.545  1.00 54.36  ? 286  ASN A CG  1 
ATOM   1613 O OD1 . ASN A 1 221 ? 27.021 14.573  24.711  1.00 60.83  ? 286  ASN A OD1 1 
ATOM   1614 N ND2 . ASN A 1 221 ? 26.888 16.481  25.826  1.00 54.73  ? 286  ASN A ND2 1 
ATOM   1615 N N   . ASP A 1 222 ? 22.702 12.775  26.838  1.00 50.74  ? 287  ASP A N   1 
ATOM   1616 C CA  . ASP A 1 222 ? 21.889 12.031  27.844  1.00 53.66  ? 287  ASP A CA  1 
ATOM   1617 C C   . ASP A 1 222 ? 21.872 10.540  27.530  1.00 54.77  ? 287  ASP A C   1 
ATOM   1618 O O   . ASP A 1 222 ? 21.756 9.726   28.434  1.00 53.04  ? 287  ASP A O   1 
ATOM   1619 C CB  . ASP A 1 222 ? 20.455 12.549  27.916  1.00 50.61  ? 287  ASP A CB  1 
ATOM   1620 C CG  . ASP A 1 222 ? 19.804 12.621  26.525  1.00 62.75  ? 287  ASP A CG  1 
ATOM   1621 O OD1 . ASP A 1 222 ? 20.536 12.929  25.539  1.00 73.75  ? 287  ASP A OD1 1 
ATOM   1622 O OD2 . ASP A 1 222 ? 18.581 12.377  26.401  1.00 55.85  ? 287  ASP A OD2 1 
ATOM   1623 N N   . LYS A 1 223 ? 21.948 10.172  26.249  1.00 53.36  ? 288  LYS A N   1 
ATOM   1624 C CA  . LYS A 1 223 ? 22.064 8.750   25.928  1.00 53.25  ? 288  LYS A CA  1 
ATOM   1625 C C   . LYS A 1 223 ? 23.440 8.203   26.386  1.00 52.77  ? 288  LYS A C   1 
ATOM   1626 O O   . LYS A 1 223 ? 23.537 7.049   26.924  1.00 48.01  ? 288  LYS A O   1 
ATOM   1627 C CB  . LYS A 1 223 ? 21.842 8.491   24.449  1.00 51.75  ? 288  LYS A CB  1 
ATOM   1628 C CG  . LYS A 1 223 ? 20.428 8.667   23.970  1.00 54.70  ? 288  LYS A CG  1 
ATOM   1629 C CD  . LYS A 1 223 ? 20.288 8.040   22.590  1.00 54.84  ? 288  LYS A CD  1 
ATOM   1630 C CE  . LYS A 1 223 ? 18.992 8.471   21.904  1.00 61.45  ? 288  LYS A CE  1 
ATOM   1631 N NZ  . LYS A 1 223 ? 18.459 7.455   20.951  1.00 63.09  ? 288  LYS A NZ  1 
ATOM   1632 N N   . ILE A 1 224 ? 24.481 9.037   26.200  1.00 44.22  ? 289  ILE A N   1 
ATOM   1633 C CA  . ILE A 1 224 ? 25.820 8.701   26.668  1.00 45.27  ? 289  ILE A CA  1 
ATOM   1634 C C   . ILE A 1 224 ? 25.745 8.556   28.212  1.00 50.44  ? 289  ILE A C   1 
ATOM   1635 O O   . ILE A 1 224 ? 26.201 7.545   28.816  1.00 47.15  ? 289  ILE A O   1 
ATOM   1636 C CB  . ILE A 1 224 ? 26.847 9.747   26.194  1.00 47.19  ? 289  ILE A CB  1 
ATOM   1637 C CG1 . ILE A 1 224 ? 27.101 9.600   24.670  1.00 49.79  ? 289  ILE A CG1 1 
ATOM   1638 C CG2 . ILE A 1 224 ? 28.172 9.608   26.920  1.00 40.99  ? 289  ILE A CG2 1 
ATOM   1639 C CD1 . ILE A 1 224 ? 27.716 10.821  23.991  1.00 41.02  ? 289  ILE A CD1 1 
ATOM   1640 N N   . GLN A 1 225 ? 25.090 9.527   28.847  1.00 47.28  ? 290  GLN A N   1 
ATOM   1641 C CA  . GLN A 1 225 ? 24.937 9.472   30.275  1.00 44.04  ? 290  GLN A CA  1 
ATOM   1642 C C   . GLN A 1 225 ? 24.378 8.128   30.711  1.00 44.02  ? 290  GLN A C   1 
ATOM   1643 O O   . GLN A 1 225 ? 24.913 7.455   31.609  1.00 43.24  ? 290  GLN A O   1 
ATOM   1644 C CB  . GLN A 1 225 ? 24.118 10.661  30.809  1.00 42.90  ? 290  GLN A CB  1 
ATOM   1645 C CG  . GLN A 1 225 ? 24.318 10.881  32.323  1.00 43.28  ? 290  GLN A CG  1 
ATOM   1646 C CD  . GLN A 1 225 ? 25.823 11.085  32.756  1.00 49.18  ? 290  GLN A CD  1 
ATOM   1647 O OE1 . GLN A 1 225 ? 26.506 11.963  32.243  1.00 44.67  ? 290  GLN A OE1 1 
ATOM   1648 N NE2 . GLN A 1 225 ? 26.327 10.234  33.690  1.00 49.23  ? 290  GLN A NE2 1 
ATOM   1649 N N   . ALA A 1 226 ? 23.351 7.689   30.013  1.00 43.06  ? 291  ALA A N   1 
ATOM   1650 C CA  . ALA A 1 226 ? 22.724 6.447   30.382  1.00 45.74  ? 291  ALA A CA  1 
ATOM   1651 C C   . ALA A 1 226 ? 23.716 5.282   30.331  1.00 47.47  ? 291  ALA A C   1 
ATOM   1652 O O   . ALA A 1 226 ? 23.719 4.434   31.245  1.00 53.74  ? 291  ALA A O   1 
ATOM   1653 C CB  . ALA A 1 226 ? 21.503 6.207   29.518  1.00 44.82  ? 291  ALA A CB  1 
ATOM   1654 N N   . VAL A 1 227 ? 24.575 5.269   29.296  1.00 44.63  ? 292  VAL A N   1 
ATOM   1655 C CA  . VAL A 1 227 ? 25.607 4.228   29.149  1.00 40.99  ? 292  VAL A CA  1 
ATOM   1656 C C   . VAL A 1 227 ? 26.663 4.338   30.260  1.00 51.86  ? 292  VAL A C   1 
ATOM   1657 O O   . VAL A 1 227 ? 27.169 3.326   30.793  1.00 49.04  ? 292  VAL A O   1 
ATOM   1658 C CB  . VAL A 1 227 ? 26.265 4.300   27.762  1.00 39.53  ? 292  VAL A CB  1 
ATOM   1659 C CG1 . VAL A 1 227 ? 27.450 3.331   27.625  1.00 38.08  ? 292  VAL A CG1 1 
ATOM   1660 C CG2 . VAL A 1 227 ? 25.245 3.889   26.707  1.00 38.57  ? 292  VAL A CG2 1 
ATOM   1661 N N   . ILE A 1 228 ? 26.976 5.579   30.622  1.00 53.90  ? 293  ILE A N   1 
ATOM   1662 C CA  . ILE A 1 228 ? 27.933 5.851   31.676  1.00 50.87  ? 293  ILE A CA  1 
ATOM   1663 C C   . ILE A 1 228 ? 27.390 5.286   33.005  1.00 52.95  ? 293  ILE A C   1 
ATOM   1664 O O   . ILE A 1 228 ? 28.091 4.545   33.701  1.00 59.14  ? 293  ILE A O   1 
ATOM   1665 C CB  . ILE A 1 228 ? 28.290 7.369   31.666  1.00 51.89  ? 293  ILE A CB  1 
ATOM   1666 C CG1 . ILE A 1 228 ? 29.384 7.641   30.614  1.00 45.13  ? 293  ILE A CG1 1 
ATOM   1667 C CG2 . ILE A 1 228 ? 28.738 7.892   33.040  1.00 49.29  ? 293  ILE A CG2 1 
ATOM   1668 C CD1 . ILE A 1 228 ? 29.715 9.105   30.451  1.00 50.12  ? 293  ILE A CD1 1 
ATOM   1669 N N   . ASP A 1 229 ? 26.112 5.560   33.294  1.00 54.00  ? 294  ASP A N   1 
ATOM   1670 C CA  . ASP A 1 229 ? 25.435 5.134   34.542  1.00 47.01  ? 294  ASP A CA  1 
ATOM   1671 C C   . ASP A 1 229 ? 25.277 3.617   34.665  1.00 50.49  ? 294  ASP A C   1 
ATOM   1672 O O   . ASP A 1 229 ? 25.104 3.108   35.758  1.00 57.70  ? 294  ASP A O   1 
ATOM   1673 C CB  . ASP A 1 229 ? 24.074 5.837   34.700  1.00 42.61  ? 294  ASP A CB  1 
ATOM   1674 C CG  . ASP A 1 229 ? 24.214 7.354   34.820  1.00 49.32  ? 294  ASP A CG  1 
ATOM   1675 O OD1 . ASP A 1 229 ? 25.335 7.816   35.117  1.00 56.06  ? 294  ASP A OD1 1 
ATOM   1676 O OD2 . ASP A 1 229 ? 23.242 8.111   34.586  1.00 53.46  ? 294  ASP A OD2 1 
ATOM   1677 N N   . ALA A 1 230 ? 25.385 2.863   33.581  1.00 47.44  ? 295  ALA A N   1 
ATOM   1678 C CA  . ALA A 1 230 ? 25.399 1.408   33.755  1.00 42.38  ? 295  ALA A CA  1 
ATOM   1679 C C   . ALA A 1 230 ? 26.775 0.935   34.110  1.00 44.09  ? 295  ALA A C   1 
ATOM   1680 O O   . ALA A 1 230 ? 26.985 -0.312  34.236  1.00 44.77  ? 295  ALA A O   1 
ATOM   1681 C CB  . ALA A 1 230 ? 24.945 0.725   32.492  1.00 43.34  ? 295  ALA A CB  1 
ATOM   1682 N N   . GLY A 1 231 ? 27.712 1.906   34.205  1.00 41.22  ? 296  GLY A N   1 
ATOM   1683 C CA  . GLY A 1 231 ? 29.117 1.666   34.682  1.00 46.94  ? 296  GLY A CA  1 
ATOM   1684 C C   . GLY A 1 231 ? 30.030 0.789   33.818  1.00 51.24  ? 296  GLY A C   1 
ATOM   1685 O O   . GLY A 1 231 ? 30.939 0.112   34.312  1.00 57.96  ? 296  GLY A O   1 
ATOM   1686 N N   . VAL A 1 232 ? 29.837 0.813   32.509  1.00 46.18  ? 297  VAL A N   1 
ATOM   1687 C CA  . VAL A 1 232 ? 30.640 -0.015  31.596  1.00 40.18  ? 297  VAL A CA  1 
ATOM   1688 C C   . VAL A 1 232 ? 32.009 0.575   31.244  1.00 38.27  ? 297  VAL A C   1 
ATOM   1689 O O   . VAL A 1 232 ? 32.843 -0.096  30.653  1.00 42.04  ? 297  VAL A O   1 
ATOM   1690 C CB  . VAL A 1 232 ? 29.880 -0.233  30.265  1.00 44.64  ? 297  VAL A CB  1 
ATOM   1691 C CG1 . VAL A 1 232 ? 28.689 -1.139  30.492  1.00 41.80  ? 297  VAL A CG1 1 
ATOM   1692 C CG2 . VAL A 1 232 ? 29.450 1.112   29.639  1.00 39.70  ? 297  VAL A CG2 1 
ATOM   1693 N N   . CYS A 1 233 ? 32.232 1.834   31.564  1.00 39.17  ? 298  CYS A N   1 
ATOM   1694 C CA  . CYS A 1 233 ? 33.429 2.516   31.130  1.00 41.23  ? 298  CYS A CA  1 
ATOM   1695 C C   . CYS A 1 233 ? 34.694 1.783   31.448  1.00 50.66  ? 298  CYS A C   1 
ATOM   1696 O O   . CYS A 1 233 ? 35.534 1.585   30.568  1.00 59.36  ? 298  CYS A O   1 
ATOM   1697 C CB  . CYS A 1 233 ? 33.509 3.890   31.756  1.00 49.94  ? 298  CYS A CB  1 
ATOM   1698 S SG  . CYS A 1 233 ? 32.437 5.080   30.911  1.00 51.86  ? 298  CYS A SG  1 
ATOM   1699 N N   . ARG A 1 234 ? 34.861 1.386   32.706  1.00 58.18  ? 299  ARG A N   1 
ATOM   1700 C CA  . ARG A 1 234 ? 36.078 0.686   33.090  1.00 55.96  ? 299  ARG A CA  1 
ATOM   1701 C C   . ARG A 1 234 ? 36.234 -0.622  32.288  1.00 49.92  ? 299  ARG A C   1 
ATOM   1702 O O   . ARG A 1 234 ? 37.316 -0.927  31.744  1.00 55.98  ? 299  ARG A O   1 
ATOM   1703 C CB  . ARG A 1 234 ? 36.160 0.489   34.617  1.00 59.96  ? 299  ARG A CB  1 
ATOM   1704 C CG  . ARG A 1 234 ? 37.460 -0.172  35.103  1.00 59.89  ? 299  ARG A CG  1 
ATOM   1705 C CD  . ARG A 1 234 ? 37.644 -0.042  36.614  1.00 66.13  ? 299  ARG A CD  1 
ATOM   1706 N NE  . ARG A 1 234 ? 37.867 1.356   37.024  1.00 76.48  ? 299  ARG A NE  1 
ATOM   1707 C CZ  . ARG A 1 234 ? 38.984 2.055   36.774  1.00 75.31  ? 299  ARG A CZ  1 
ATOM   1708 N NH1 . ARG A 1 234 ? 39.996 1.497   36.090  1.00 76.87  ? 299  ARG A NH1 1 
ATOM   1709 N NH2 . ARG A 1 234 ? 39.091 3.315   37.196  1.00 63.32  ? 299  ARG A NH2 1 
ATOM   1710 N N   . ARG A 1 235 ? 35.180 -1.400  32.153  1.00 49.63  ? 300  ARG A N   1 
ATOM   1711 C CA  . ARG A 1 235 ? 35.389 -2.645  31.382  1.00 54.03  ? 300  ARG A CA  1 
ATOM   1712 C C   . ARG A 1 235 ? 35.767 -2.297  29.959  1.00 50.27  ? 300  ARG A C   1 
ATOM   1713 O O   . ARG A 1 235 ? 36.686 -2.857  29.370  1.00 51.00  ? 300  ARG A O   1 
ATOM   1714 C CB  . ARG A 1 235 ? 34.184 -3.576  31.430  1.00 53.24  ? 300  ARG A CB  1 
ATOM   1715 C CG  . ARG A 1 235 ? 34.388 -4.806  32.302  1.00 53.96  ? 300  ARG A CG  1 
ATOM   1716 C CD  . ARG A 1 235 ? 35.823 -5.294  32.178  1.00 48.92  ? 300  ARG A CD  1 
ATOM   1717 N NE  . ARG A 1 235 ? 35.926 -6.637  31.649  1.00 41.59  ? 300  ARG A NE  1 
ATOM   1718 C CZ  . ARG A 1 235 ? 37.078 -7.219  31.321  1.00 50.51  ? 300  ARG A CZ  1 
ATOM   1719 N NH1 . ARG A 1 235 ? 38.227 -6.584  31.482  1.00 59.73  ? 300  ARG A NH1 1 
ATOM   1720 N NH2 . ARG A 1 235 ? 37.107 -8.445  30.830  1.00 56.65  ? 300  ARG A NH2 1 
ATOM   1721 N N   . LEU A 1 236 ? 35.088 -1.283  29.452  1.00 45.66  ? 301  LEU A N   1 
ATOM   1722 C CA  . LEU A 1 236 ? 35.245 -0.884  28.091  1.00 45.21  ? 301  LEU A CA  1 
ATOM   1723 C C   . LEU A 1 236 ? 36.692 -0.427  27.838  1.00 46.15  ? 301  LEU A C   1 
ATOM   1724 O O   . LEU A 1 236 ? 37.334 -0.881  26.854  1.00 41.51  ? 301  LEU A O   1 
ATOM   1725 C CB  . LEU A 1 236 ? 34.242 0.222   27.810  1.00 41.13  ? 301  LEU A CB  1 
ATOM   1726 C CG  . LEU A 1 236 ? 33.211 0.171   26.713  1.00 43.70  ? 301  LEU A CG  1 
ATOM   1727 C CD1 . LEU A 1 236 ? 32.829 -1.200  26.154  1.00 37.06  ? 301  LEU A CD1 1 
ATOM   1728 C CD2 . LEU A 1 236 ? 32.021 0.890   27.298  1.00 35.00  ? 301  LEU A CD2 1 
ATOM   1729 N N   . VAL A 1 237 ? 37.210 0.455   28.707  1.00 37.98  ? 302  VAL A N   1 
ATOM   1730 C CA  . VAL A 1 237 ? 38.622 0.845   28.587  1.00 41.73  ? 302  VAL A CA  1 
ATOM   1731 C C   . VAL A 1 237 ? 39.533 -0.392  28.730  1.00 45.79  ? 302  VAL A C   1 
ATOM   1732 O O   . VAL A 1 237 ? 40.538 -0.514  28.036  1.00 48.35  ? 302  VAL A O   1 
ATOM   1733 C CB  . VAL A 1 237 ? 39.032 1.945   29.604  1.00 43.08  ? 302  VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 237 ? 40.544 2.188   29.582  1.00 37.93  ? 302  VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 237 ? 38.288 3.275   29.343  1.00 38.13  ? 302  VAL A CG2 1 
ATOM   1736 N N   . GLU A 1 238 ? 39.181 -1.341  29.592  1.00 46.54  ? 303  GLU A N   1 
ATOM   1737 C CA  . GLU A 1 238 ? 40.123 -2.454  29.770  1.00 50.22  ? 303  GLU A CA  1 
ATOM   1738 C C   . GLU A 1 238 ? 40.125 -3.329  28.550  1.00 48.50  ? 303  GLU A C   1 
ATOM   1739 O O   . GLU A 1 238 ? 41.153 -3.928  28.210  1.00 52.46  ? 303  GLU A O   1 
ATOM   1740 C CB  . GLU A 1 238 ? 39.808 -3.297  31.005  1.00 53.04  ? 303  GLU A CB  1 
ATOM   1741 C CG  . GLU A 1 238 ? 40.040 -2.631  32.362  1.00 56.83  ? 303  GLU A CG  1 
ATOM   1742 C CD  . GLU A 1 238 ? 39.420 -3.432  33.523  1.00 61.76  ? 303  GLU A CD  1 
ATOM   1743 O OE1 . GLU A 1 238 ? 39.110 -4.625  33.316  1.00 64.89  ? 303  GLU A OE1 1 
ATOM   1744 O OE2 . GLU A 1 238 ? 39.230 -2.879  34.639  1.00 63.27  ? 303  GLU A OE2 1 
ATOM   1745 N N   . LEU A 1 239 ? 38.969 -3.419  27.888  1.00 49.29  ? 304  LEU A N   1 
ATOM   1746 C CA  . LEU A 1 239 ? 38.851 -4.232  26.647  1.00 44.47  ? 304  LEU A CA  1 
ATOM   1747 C C   . LEU A 1 239 ? 39.597 -3.613  25.467  1.00 41.55  ? 304  LEU A C   1 
ATOM   1748 O O   . LEU A 1 239 ? 39.836 -4.314  24.475  1.00 35.57  ? 304  LEU A O   1 
ATOM   1749 C CB  . LEU A 1 239 ? 37.400 -4.489  26.275  1.00 43.28  ? 304  LEU A CB  1 
ATOM   1750 C CG  . LEU A 1 239 ? 36.770 -5.446  27.289  1.00 46.00  ? 304  LEU A CG  1 
ATOM   1751 C CD1 . LEU A 1 239 ? 35.268 -5.459  27.124  1.00 45.43  ? 304  LEU A CD1 1 
ATOM   1752 C CD2 . LEU A 1 239 ? 37.332 -6.850  27.137  1.00 45.21  ? 304  LEU A CD2 1 
ATOM   1753 N N   . LEU A 1 240 ? 40.002 -2.328  25.569  1.00 39.40  ? 305  LEU A N   1 
ATOM   1754 C CA  . LEU A 1 240 ? 40.933 -1.774  24.544  1.00 41.62  ? 305  LEU A CA  1 
ATOM   1755 C C   . LEU A 1 240 ? 42.247 -2.587  24.386  1.00 43.06  ? 305  LEU A C   1 
ATOM   1756 O O   . LEU A 1 240 ? 42.913 -2.471  23.359  1.00 47.47  ? 305  LEU A O   1 
ATOM   1757 C CB  . LEU A 1 240 ? 41.253 -0.302  24.798  1.00 39.25  ? 305  LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 240 ? 40.076 0.662   24.771  1.00 38.75  ? 305  LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 240 ? 40.546 2.041   25.094  1.00 36.78  ? 305  LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 240 ? 39.387 0.693   23.438  1.00 42.68  ? 305  LEU A CD2 1 
ATOM   1761 N N   . MET A 1 241 ? 42.576 -3.427  25.380  1.00 44.38  ? 306  MET A N   1 
ATOM   1762 C CA  . MET A 1 241 ? 43.838 -4.177  25.437  1.00 50.30  ? 306  MET A CA  1 
ATOM   1763 C C   . MET A 1 241 ? 43.606 -5.603  25.024  1.00 53.58  ? 306  MET A C   1 
ATOM   1764 O O   . MET A 1 241 ? 44.514 -6.409  25.026  1.00 57.91  ? 306  MET A O   1 
ATOM   1765 C CB  . MET A 1 241 ? 44.428 -4.131  26.883  1.00 56.04  ? 306  MET A CB  1 
ATOM   1766 C CG  . MET A 1 241 ? 45.181 -2.828  27.225  1.00 51.69  ? 306  MET A CG  1 
ATOM   1767 S SD  . MET A 1 241 ? 46.216 -2.372  25.772  1.00 63.35  ? 306  MET A SD  1 
ATOM   1768 C CE  . MET A 1 241 ? 46.377 -0.659  26.089  1.00 63.71  ? 306  MET A CE  1 
ATOM   1769 N N   . HIS A 1 242 ? 42.364 -5.938  24.711  1.00 53.24  ? 307  HIS A N   1 
ATOM   1770 C CA  . HIS A 1 242 ? 42.060 -7.302  24.318  1.00 48.47  ? 307  HIS A CA  1 
ATOM   1771 C C   . HIS A 1 242 ? 42.948 -7.712  23.159  1.00 51.38  ? 307  HIS A C   1 
ATOM   1772 O O   . HIS A 1 242 ? 43.425 -6.888  22.339  1.00 48.53  ? 307  HIS A O   1 
ATOM   1773 C CB  . HIS A 1 242 ? 40.575 -7.438  24.011  1.00 42.57  ? 307  HIS A CB  1 
ATOM   1774 C CG  . HIS A 1 242 ? 40.074 -8.860  23.962  1.00 45.83  ? 307  HIS A CG  1 
ATOM   1775 N ND1 . HIS A 1 242 ? 40.334 -9.687  22.930  1.00 49.45  ? 307  HIS A ND1 1 
ATOM   1776 C CD2 . HIS A 1 242 ? 39.247 -9.572  24.841  1.00 43.45  ? 307  HIS A CD2 1 
ATOM   1777 C CE1 . HIS A 1 242 ? 39.749 -10.888 23.156  1.00 44.92  ? 307  HIS A CE1 1 
ATOM   1778 N NE2 . HIS A 1 242 ? 39.073 -10.806 24.326  1.00 43.45  ? 307  HIS A NE2 1 
ATOM   1779 N N   . ASN A 1 243 ? 43.216 -9.003  23.103  1.00 56.97  ? 308  ASN A N   1 
ATOM   1780 C CA  . ASN A 1 243 ? 44.143 -9.542  22.121  1.00 62.25  ? 308  ASN A CA  1 
ATOM   1781 C C   . ASN A 1 243 ? 43.426 -9.720  20.799  1.00 60.10  ? 308  ASN A C   1 
ATOM   1782 O O   . ASN A 1 243 ? 44.060 -9.704  19.760  1.00 61.75  ? 308  ASN A O   1 
ATOM   1783 C CB  . ASN A 1 243 ? 44.737 -10.851 22.639  1.00 73.48  ? 308  ASN A CB  1 
ATOM   1784 C CG  . ASN A 1 243 ? 43.778 -11.576 23.584  1.00 90.35  ? 308  ASN A CG  1 
ATOM   1785 O OD1 . ASN A 1 243 ? 43.325 -11.012 24.606  1.00 94.21  ? 308  ASN A OD1 1 
ATOM   1786 N ND2 . ASN A 1 243 ? 43.420 -12.809 23.230  1.00 83.80  ? 308  ASN A ND2 1 
ATOM   1787 N N   . ASP A 1 244 ? 42.097 -9.835  20.815  1.00 55.21  ? 309  ASP A N   1 
ATOM   1788 C CA  . ASP A 1 244 ? 41.371 -10.070 19.561  1.00 53.95  ? 309  ASP A CA  1 
ATOM   1789 C C   . ASP A 1 244 ? 40.780 -8.758  18.991  1.00 53.06  ? 309  ASP A C   1 
ATOM   1790 O O   . ASP A 1 244 ? 40.028 -8.074  19.641  1.00 56.03  ? 309  ASP A O   1 
ATOM   1791 C CB  . ASP A 1 244 ? 40.346 -11.210 19.753  1.00 51.83  ? 309  ASP A CB  1 
ATOM   1792 C CG  . ASP A 1 244 ? 39.793 -11.772 18.430  1.00 63.71  ? 309  ASP A CG  1 
ATOM   1793 O OD1 . ASP A 1 244 ? 39.497 -10.975 17.506  1.00 70.47  ? 309  ASP A OD1 1 
ATOM   1794 O OD2 . ASP A 1 244 ? 39.600 -13.021 18.314  1.00 67.12  ? 309  ASP A OD2 1 
ATOM   1795 N N   . TYR A 1 245 ? 41.140 -8.412  17.766  1.00 55.75  ? 310  TYR A N   1 
ATOM   1796 C CA  . TYR A 1 245 ? 40.564 -7.252  17.089  1.00 58.10  ? 310  TYR A CA  1 
ATOM   1797 C C   . TYR A 1 245 ? 39.055 -7.173  17.129  1.00 57.82  ? 310  TYR A C   1 
ATOM   1798 O O   . TYR A 1 245 ? 38.509 -6.076  17.198  1.00 60.45  ? 310  TYR A O   1 
ATOM   1799 C CB  . TYR A 1 245 ? 41.018 -7.177  15.634  1.00 58.39  ? 310  TYR A CB  1 
ATOM   1800 C CG  . TYR A 1 245 ? 42.440 -6.687  15.494  1.00 72.24  ? 310  TYR A CG  1 
ATOM   1801 C CD1 . TYR A 1 245 ? 42.844 -5.480  16.106  1.00 69.88  ? 310  TYR A CD1 1 
ATOM   1802 C CD2 . TYR A 1 245 ? 43.397 -7.419  14.756  1.00 70.27  ? 310  TYR A CD2 1 
ATOM   1803 C CE1 . TYR A 1 245 ? 44.142 -5.017  15.992  1.00 70.89  ? 310  TYR A CE1 1 
ATOM   1804 C CE2 . TYR A 1 245 ? 44.701 -6.955  14.636  1.00 75.58  ? 310  TYR A CE2 1 
ATOM   1805 C CZ  . TYR A 1 245 ? 45.064 -5.752  15.251  1.00 80.81  ? 310  TYR A CZ  1 
ATOM   1806 O OH  . TYR A 1 245 ? 46.352 -5.270  15.143  1.00 97.76  ? 310  TYR A OH  1 
ATOM   1807 N N   . LYS A 1 246 ? 38.405 -8.337  17.085  1.00 56.31  ? 311  LYS A N   1 
ATOM   1808 C CA  . LYS A 1 246 ? 36.944 -8.461  17.145  1.00 52.76  ? 311  LYS A CA  1 
ATOM   1809 C C   . LYS A 1 246 ? 36.336 -7.661  18.287  1.00 44.54  ? 311  LYS A C   1 
ATOM   1810 O O   . LYS A 1 246 ? 35.305 -7.058  18.117  1.00 50.20  ? 311  LYS A O   1 
ATOM   1811 C CB  . LYS A 1 246 ? 36.513 -9.950  17.228  1.00 55.72  ? 311  LYS A CB  1 
ATOM   1812 C CG  . LYS A 1 246 ? 36.402 -10.615 15.846  1.00 65.23  ? 311  LYS A CG  1 
ATOM   1813 C CD  . LYS A 1 246 ? 36.111 -12.113 15.882  1.00 72.05  ? 311  LYS A CD  1 
ATOM   1814 C CE  . LYS A 1 246 ? 36.730 -12.770 14.647  1.00 73.29  ? 311  LYS A CE  1 
ATOM   1815 N NZ  . LYS A 1 246 ? 36.276 -14.178 14.441  1.00 77.99  ? 311  LYS A NZ  1 
ATOM   1816 N N   . VAL A 1 247 ? 37.006 -7.662  19.438  1.00 44.28  ? 312  VAL A N   1 
ATOM   1817 C CA  . VAL A 1 247 ? 36.574 -6.980  20.646  1.00 40.48  ? 312  VAL A CA  1 
ATOM   1818 C C   . VAL A 1 247 ? 37.071 -5.519  20.630  1.00 43.78  ? 312  VAL A C   1 
ATOM   1819 O O   . VAL A 1 247 ? 36.367 -4.592  21.104  1.00 39.62  ? 312  VAL A O   1 
ATOM   1820 C CB  . VAL A 1 247 ? 37.169 -7.724  21.881  1.00 46.26  ? 312  VAL A CB  1 
ATOM   1821 C CG1 . VAL A 1 247 ? 36.633 -7.206  23.207  1.00 44.98  ? 312  VAL A CG1 1 
ATOM   1822 C CG2 . VAL A 1 247 ? 36.925 -9.230  21.795  1.00 51.72  ? 312  VAL A CG2 1 
ATOM   1823 N N   . VAL A 1 248 ? 38.285 -5.310  20.094  1.00 41.95  ? 313  VAL A N   1 
ATOM   1824 C CA  . VAL A 1 248 ? 38.946 -4.014  20.265  1.00 41.18  ? 313  VAL A CA  1 
ATOM   1825 C C   . VAL A 1 248 ? 38.175 -2.997  19.441  1.00 44.55  ? 313  VAL A C   1 
ATOM   1826 O O   . VAL A 1 248 ? 37.786 -1.971  19.973  1.00 46.25  ? 313  VAL A O   1 
ATOM   1827 C CB  . VAL A 1 248 ? 40.467 -4.056  19.928  1.00 44.41  ? 313  VAL A CB  1 
ATOM   1828 C CG1 . VAL A 1 248 ? 41.099 -2.669  19.878  1.00 36.76  ? 313  VAL A CG1 1 
ATOM   1829 C CG2 . VAL A 1 248 ? 41.224 -4.957  20.900  1.00 39.46  ? 313  VAL A CG2 1 
ATOM   1830 N N   . SER A 1 249 ? 37.865 -3.300  18.178  1.00 44.19  ? 314  SER A N   1 
ATOM   1831 C CA  . SER A 1 249 ? 37.167 -2.284  17.347  1.00 44.86  ? 314  SER A CA  1 
ATOM   1832 C C   . SER A 1 249 ? 35.903 -1.739  17.962  1.00 43.32  ? 314  SER A C   1 
ATOM   1833 O O   . SER A 1 249 ? 35.765 -0.529  18.033  1.00 51.60  ? 314  SER A O   1 
ATOM   1834 C CB  . SER A 1 249 ? 36.857 -2.802  15.941  1.00 43.77  ? 314  SER A CB  1 
ATOM   1835 O OG  . SER A 1 249 ? 38.035 -3.447  15.507  1.00 57.26  ? 314  SER A OG  1 
ATOM   1836 N N   . PRO A 1 250 ? 34.950 -2.636  18.345  1.00 40.91  ? 315  PRO A N   1 
ATOM   1837 C CA  . PRO A 1 250 ? 33.703 -2.118  18.905  1.00 35.83  ? 315  PRO A CA  1 
ATOM   1838 C C   . PRO A 1 250 ? 33.932 -1.419  20.236  1.00 39.58  ? 315  PRO A C   1 
ATOM   1839 O O   . PRO A 1 250 ? 33.342 -0.346  20.506  1.00 42.15  ? 315  PRO A O   1 
ATOM   1840 C CB  . PRO A 1 250 ? 32.824 -3.362  19.049  1.00 30.63  ? 315  PRO A CB  1 
ATOM   1841 C CG  . PRO A 1 250 ? 33.754 -4.497  19.006  1.00 31.18  ? 315  PRO A CG  1 
ATOM   1842 C CD  . PRO A 1 250 ? 34.923 -4.108  18.159  1.00 31.32  ? 315  PRO A CD  1 
ATOM   1843 N N   . ALA A 1 251 ? 34.839 -1.952  21.042  1.00 36.94  ? 316  ALA A N   1 
ATOM   1844 C CA  . ALA A 1 251 ? 35.153 -1.274  22.328  1.00 38.19  ? 316  ALA A CA  1 
ATOM   1845 C C   . ALA A 1 251 ? 35.732 0.121   22.071  1.00 37.04  ? 316  ALA A C   1 
ATOM   1846 O O   . ALA A 1 251 ? 35.435 1.111   22.762  1.00 43.52  ? 316  ALA A O   1 
ATOM   1847 C CB  . ALA A 1 251 ? 36.107 -2.123  23.156  1.00 36.57  ? 316  ALA A CB  1 
ATOM   1848 N N   . LEU A 1 252 ? 36.503 0.210   21.008  1.00 34.03  ? 317  LEU A N   1 
ATOM   1849 C CA  . LEU A 1 252 ? 37.130 1.417   20.686  1.00 33.54  ? 317  LEU A CA  1 
ATOM   1850 C C   . LEU A 1 252 ? 36.066 2.384   20.242  1.00 35.91  ? 317  LEU A C   1 
ATOM   1851 O O   . LEU A 1 252 ? 36.085 3.529   20.678  1.00 41.29  ? 317  LEU A O   1 
ATOM   1852 C CB  . LEU A 1 252 ? 38.288 1.215   19.702  1.00 34.83  ? 317  LEU A CB  1 
ATOM   1853 C CG  . LEU A 1 252 ? 38.959 2.519   19.232  1.00 36.61  ? 317  LEU A CG  1 
ATOM   1854 C CD1 . LEU A 1 252 ? 39.382 3.396   20.411  1.00 38.08  ? 317  LEU A CD1 1 
ATOM   1855 C CD2 . LEU A 1 252 ? 40.143 2.227   18.304  1.00 34.02  ? 317  LEU A CD2 1 
ATOM   1856 N N   . ARG A 1 253 ? 35.088 1.912   19.490  1.00 35.87  ? 318  ARG A N   1 
ATOM   1857 C CA  . ARG A 1 253 ? 33.970 2.717   19.109  1.00 40.40  ? 318  ARG A CA  1 
ATOM   1858 C C   . ARG A 1 253 ? 33.210 3.204   20.298  1.00 45.12  ? 318  ARG A C   1 
ATOM   1859 O O   . ARG A 1 253 ? 32.878 4.405   20.395  1.00 45.60  ? 318  ARG A O   1 
ATOM   1860 C CB  . ARG A 1 253 ? 32.946 1.888   18.328  1.00 51.06  ? 318  ARG A CB  1 
ATOM   1861 C CG  . ARG A 1 253 ? 33.207 1.792   16.863  1.00 55.66  ? 318  ARG A CG  1 
ATOM   1862 C CD  . ARG A 1 253 ? 32.978 3.082   16.088  1.00 58.96  ? 318  ARG A CD  1 
ATOM   1863 N NE  . ARG A 1 253 ? 32.262 2.645   14.893  1.00 72.72  ? 318  ARG A NE  1 
ATOM   1864 C CZ  . ARG A 1 253 ? 32.810 1.902   13.937  1.00 69.55  ? 318  ARG A CZ  1 
ATOM   1865 N NH1 . ARG A 1 253 ? 34.096 1.571   13.981  1.00 60.93  ? 318  ARG A NH1 1 
ATOM   1866 N NH2 . ARG A 1 253 ? 32.075 1.500   12.918  1.00 83.36  ? 318  ARG A NH2 1 
ATOM   1867 N N   . ALA A 1 254 ? 32.861 2.272   21.186  1.00 38.09  ? 319  ALA A N   1 
ATOM   1868 C CA  . ALA A 1 254 ? 32.078 2.685   22.357  1.00 35.78  ? 319  ALA A CA  1 
ATOM   1869 C C   . ALA A 1 254 ? 32.826 3.784   23.176  1.00 37.26  ? 319  ALA A C   1 
ATOM   1870 O O   . ALA A 1 254 ? 32.271 4.851   23.429  1.00 36.20  ? 319  ALA A O   1 
ATOM   1871 C CB  . ALA A 1 254 ? 31.712 1.457   23.184  1.00 32.16  ? 319  ALA A CB  1 
ATOM   1872 N N   . VAL A 1 255 ? 34.087 3.532   23.555  1.00 36.66  ? 320  VAL A N   1 
ATOM   1873 C CA  . VAL A 1 255 ? 34.862 4.542   24.262  1.00 34.61  ? 320  VAL A CA  1 
ATOM   1874 C C   . VAL A 1 255 ? 34.924 5.792   23.379  1.00 38.95  ? 320  VAL A C   1 
ATOM   1875 O O   . VAL A 1 255 ? 34.838 6.932   23.859  1.00 39.54  ? 320  VAL A O   1 
ATOM   1876 C CB  . VAL A 1 255 ? 36.312 4.046   24.519  1.00 36.02  ? 320  VAL A CB  1 
ATOM   1877 C CG1 . VAL A 1 255 ? 37.179 5.146   25.126  1.00 36.55  ? 320  VAL A CG1 1 
ATOM   1878 C CG2 . VAL A 1 255 ? 36.377 2.767   25.344  1.00 34.44  ? 320  VAL A CG2 1 
ATOM   1879 N N   . GLY A 1 256 ? 35.105 5.584   22.068  1.00 45.45  ? 321  GLY A N   1 
ATOM   1880 C CA  . GLY A 1 256 ? 35.171 6.695   21.086  1.00 36.72  ? 321  GLY A CA  1 
ATOM   1881 C C   . GLY A 1 256 ? 33.901 7.524   21.128  1.00 38.25  ? 321  GLY A C   1 
ATOM   1882 O O   . GLY A 1 256 ? 33.945 8.765   21.107  1.00 42.32  ? 321  GLY A O   1 
ATOM   1883 N N   . ASN A 1 257 ? 32.763 6.848   21.254  1.00 41.15  ? 322  ASN A N   1 
ATOM   1884 C CA  . ASN A 1 257 ? 31.451 7.513   21.285  1.00 39.92  ? 322  ASN A CA  1 
ATOM   1885 C C   . ASN A 1 257 ? 31.219 8.255   22.555  1.00 43.24  ? 322  ASN A C   1 
ATOM   1886 O O   . ASN A 1 257 ? 30.787 9.381   22.508  1.00 48.46  ? 322  ASN A O   1 
ATOM   1887 C CB  . ASN A 1 257 ? 30.332 6.493   21.078  1.00 44.91  ? 322  ASN A CB  1 
ATOM   1888 C CG  . ASN A 1 257 ? 30.218 6.042   19.629  1.00 42.86  ? 322  ASN A CG  1 
ATOM   1889 O OD1 . ASN A 1 257 ? 30.711 6.716   18.724  1.00 42.55  ? 322  ASN A OD1 1 
ATOM   1890 N ND2 . ASN A 1 257 ? 29.550 4.914   19.402  1.00 43.67  ? 322  ASN A ND2 1 
ATOM   1891 N N   . ILE A 1 258 ? 31.529 7.628   23.692  1.00 42.87  ? 323  ILE A N   1 
ATOM   1892 C CA  . ILE A 1 258 ? 31.372 8.247   24.994  1.00 41.18  ? 323  ILE A CA  1 
ATOM   1893 C C   . ILE A 1 258 ? 32.149 9.533   25.066  1.00 42.86  ? 323  ILE A C   1 
ATOM   1894 O O   . ILE A 1 258 ? 31.632 10.525  25.579  1.00 45.26  ? 323  ILE A O   1 
ATOM   1895 C CB  . ILE A 1 258 ? 31.808 7.287   26.115  1.00 45.44  ? 323  ILE A CB  1 
ATOM   1896 C CG1 . ILE A 1 258 ? 30.828 6.123   26.158  1.00 41.99  ? 323  ILE A CG1 1 
ATOM   1897 C CG2 . ILE A 1 258 ? 31.876 7.993   27.473  1.00 41.85  ? 323  ILE A CG2 1 
ATOM   1898 C CD1 . ILE A 1 258 ? 31.415 4.900   26.830  1.00 43.48  ? 323  ILE A CD1 1 
ATOM   1899 N N   . VAL A 1 259 ? 33.375 9.565   24.534  1.00 44.19  ? 324  VAL A N   1 
ATOM   1900 C CA  . VAL A 1 259 ? 34.137 10.864  24.584  1.00 46.19  ? 324  VAL A CA  1 
ATOM   1901 C C   . VAL A 1 259 ? 33.670 11.950  23.629  1.00 46.63  ? 324  VAL A C   1 
ATOM   1902 O O   . VAL A 1 259 ? 34.279 13.027  23.586  1.00 48.81  ? 324  VAL A O   1 
ATOM   1903 C CB  . VAL A 1 259 ? 35.685 10.746  24.554  1.00 45.82  ? 324  VAL A CB  1 
ATOM   1904 C CG1 . VAL A 1 259 ? 36.151 9.998   25.807  1.00 44.45  ? 324  VAL A CG1 1 
ATOM   1905 C CG2 . VAL A 1 259 ? 36.202 10.113  23.249  1.00 39.99  ? 324  VAL A CG2 1 
ATOM   1906 N N   . THR A 1 260 ? 32.567 11.699  22.914  1.00 44.17  ? 325  THR A N   1 
ATOM   1907 C CA  . THR A 1 260 ? 31.932 12.800  22.186  1.00 45.81  ? 325  THR A CA  1 
ATOM   1908 C C   . THR A 1 260 ? 31.116 13.650  23.120  1.00 48.11  ? 325  THR A C   1 
ATOM   1909 O O   . THR A 1 260 ? 30.729 14.729  22.755  1.00 50.31  ? 325  THR A O   1 
ATOM   1910 C CB  . THR A 1 260 ? 31.080 12.353  20.983  1.00 45.19  ? 325  THR A CB  1 
ATOM   1911 O OG1 . THR A 1 260 ? 30.201 11.306  21.377  1.00 48.28  ? 325  THR A OG1 1 
ATOM   1912 C CG2 . THR A 1 260 ? 31.983 11.845  19.893  1.00 43.43  ? 325  THR A CG2 1 
ATOM   1913 N N   . GLY A 1 261 ? 30.871 13.178  24.343  1.00 55.20  ? 326  GLY A N   1 
ATOM   1914 C CA  . GLY A 1 261 ? 30.125 13.979  25.314  1.00 53.82  ? 326  GLY A CA  1 
ATOM   1915 C C   . GLY A 1 261 ? 30.862 15.200  25.828  1.00 55.66  ? 326  GLY A C   1 
ATOM   1916 O O   . GLY A 1 261 ? 31.994 15.480  25.388  1.00 58.07  ? 326  GLY A O   1 
ATOM   1917 N N   . ASP A 1 262 ? 30.230 15.917  26.763  1.00 51.98  ? 327  ASP A N   1 
ATOM   1918 C CA  . ASP A 1 262 ? 30.864 17.046  27.467  1.00 50.21  ? 327  ASP A CA  1 
ATOM   1919 C C   . ASP A 1 262 ? 32.147 16.637  28.260  1.00 46.47  ? 327  ASP A C   1 
ATOM   1920 O O   . ASP A 1 262 ? 32.439 15.440  28.411  1.00 42.00  ? 327  ASP A O   1 
ATOM   1921 C CB  . ASP A 1 262 ? 29.812 17.729  28.375  1.00 51.11  ? 327  ASP A CB  1 
ATOM   1922 C CG  . ASP A 1 262 ? 29.243 16.808  29.480  1.00 58.70  ? 327  ASP A CG  1 
ATOM   1923 O OD1 . ASP A 1 262 ? 29.929 15.856  29.937  1.00 60.57  ? 327  ASP A OD1 1 
ATOM   1924 O OD2 . ASP A 1 262 ? 28.089 17.052  29.930  1.00 67.08  ? 327  ASP A OD2 1 
ATOM   1925 N N   . ASP A 1 263 ? 32.885 17.605  28.798  1.00 47.88  ? 328  ASP A N   1 
ATOM   1926 C CA  . ASP A 1 263 ? 34.134 17.328  29.559  1.00 51.93  ? 328  ASP A CA  1 
ATOM   1927 C C   . ASP A 1 263 ? 34.017 16.335  30.747  1.00 53.77  ? 328  ASP A C   1 
ATOM   1928 O O   . ASP A 1 263 ? 34.859 15.405  30.909  1.00 48.20  ? 328  ASP A O   1 
ATOM   1929 C CB  . ASP A 1 263 ? 34.736 18.625  30.065  1.00 57.79  ? 328  ASP A CB  1 
ATOM   1930 C CG  . ASP A 1 263 ? 35.079 19.609  28.938  1.00 67.14  ? 328  ASP A CG  1 
ATOM   1931 O OD1 . ASP A 1 263 ? 35.173 19.204  27.738  1.00 69.96  ? 328  ASP A OD1 1 
ATOM   1932 O OD2 . ASP A 1 263 ? 35.287 20.800  29.282  1.00 63.92  ? 328  ASP A OD2 1 
ATOM   1933 N N   . ILE A 1 264 ? 32.959 16.514  31.547  1.00 47.69  ? 329  ILE A N   1 
ATOM   1934 C CA  . ILE A 1 264 ? 32.635 15.608  32.653  1.00 45.30  ? 329  ILE A CA  1 
ATOM   1935 C C   . ILE A 1 264 ? 32.527 14.158  32.179  1.00 53.48  ? 329  ILE A C   1 
ATOM   1936 O O   . ILE A 1 264 ? 33.195 13.280  32.730  1.00 55.48  ? 329  ILE A O   1 
ATOM   1937 C CB  . ILE A 1 264 ? 31.344 16.043  33.385  1.00 56.10  ? 329  ILE A CB  1 
ATOM   1938 C CG1 . ILE A 1 264 ? 31.282 17.595  33.445  1.00 62.56  ? 329  ILE A CG1 1 
ATOM   1939 C CG2 . ILE A 1 264 ? 31.175 15.305  34.718  1.00 53.70  ? 329  ILE A CG2 1 
ATOM   1940 C CD1 . ILE A 1 264 ? 30.665 18.193  34.673  1.00 51.66  ? 329  ILE A CD1 1 
ATOM   1941 N N   . GLN A 1 265 ? 31.700 13.904  31.155  1.00 57.61  ? 330  GLN A N   1 
ATOM   1942 C CA  . GLN A 1 265 ? 31.517 12.546  30.626  1.00 52.69  ? 330  GLN A CA  1 
ATOM   1943 C C   . GLN A 1 265 ? 32.835 11.995  30.088  1.00 51.59  ? 330  GLN A C   1 
ATOM   1944 O O   . GLN A 1 265 ? 33.255 10.850  30.389  1.00 48.19  ? 330  GLN A O   1 
ATOM   1945 C CB  . GLN A 1 265 ? 30.450 12.553  29.548  1.00 59.56  ? 330  GLN A CB  1 
ATOM   1946 C CG  . GLN A 1 265 ? 29.099 13.058  30.039  1.00 51.09  ? 330  GLN A CG  1 
ATOM   1947 C CD  . GLN A 1 265 ? 28.060 13.081  28.923  1.00 52.87  ? 330  GLN A CD  1 
ATOM   1948 O OE1 . GLN A 1 265 ? 28.277 13.680  27.864  1.00 46.22  ? 330  GLN A OE1 1 
ATOM   1949 N NE2 . GLN A 1 265 ? 26.913 12.448  29.166  1.00 54.94  ? 330  GLN A NE2 1 
ATOM   1950 N N   . THR A 1 266 ? 33.539 12.828  29.339  1.00 48.58  ? 331  THR A N   1 
ATOM   1951 C CA  . THR A 1 266 ? 34.835 12.378  28.902  1.00 48.65  ? 331  THR A CA  1 
ATOM   1952 C C   . THR A 1 266 ? 35.837 12.105  30.064  1.00 48.09  ? 331  THR A C   1 
ATOM   1953 O O   . THR A 1 266 ? 36.620 11.100  30.018  1.00 46.09  ? 331  THR A O   1 
ATOM   1954 C CB  . THR A 1 266 ? 35.388 13.181  27.679  1.00 51.30  ? 331  THR A CB  1 
ATOM   1955 O OG1 . THR A 1 266 ? 36.807 13.287  27.781  1.00 52.25  ? 331  THR A OG1 1 
ATOM   1956 C CG2 . THR A 1 266 ? 34.820 14.526  27.588  1.00 53.34  ? 331  THR A CG2 1 
ATOM   1957 N N   . GLN A 1 267 ? 35.747 12.912  31.129  1.00 48.14  ? 332  GLN A N   1 
ATOM   1958 C CA  . GLN A 1 267 ? 36.577 12.679  32.316  1.00 44.29  ? 332  GLN A CA  1 
ATOM   1959 C C   . GLN A 1 267 ? 36.425 11.269  32.875  1.00 47.25  ? 332  GLN A C   1 
ATOM   1960 O O   . GLN A 1 267 ? 37.416 10.592  33.266  1.00 48.27  ? 332  GLN A O   1 
ATOM   1961 C CB  . GLN A 1 267 ? 36.391 13.738  33.399  1.00 45.78  ? 332  GLN A CB  1 
ATOM   1962 C CG  . GLN A 1 267 ? 37.591 13.813  34.355  1.00 48.20  ? 332  GLN A CG  1 
ATOM   1963 C CD  . GLN A 1 267 ? 38.898 14.253  33.675  1.00 48.22  ? 332  GLN A CD  1 
ATOM   1964 O OE1 . GLN A 1 267 ? 38.940 15.254  32.966  1.00 50.50  ? 332  GLN A OE1 1 
ATOM   1965 N NE2 . GLN A 1 267 ? 39.950 13.504  33.896  1.00 40.61  ? 332  GLN A NE2 1 
ATOM   1966 N N   . VAL A 1 268 ? 35.204 10.776  32.834  1.00 42.75  ? 333  VAL A N   1 
ATOM   1967 C CA  . VAL A 1 268 ? 34.966 9.438   33.287  1.00 43.99  ? 333  VAL A CA  1 
ATOM   1968 C C   . VAL A 1 268 ? 35.806 8.432   32.508  1.00 49.12  ? 333  VAL A C   1 
ATOM   1969 O O   . VAL A 1 268 ? 36.340 7.462   33.053  1.00 54.40  ? 333  VAL A O   1 
ATOM   1970 C CB  . VAL A 1 268 ? 33.482 9.121   33.152  1.00 49.69  ? 333  VAL A CB  1 
ATOM   1971 C CG1 . VAL A 1 268 ? 33.189 7.695   33.638  1.00 50.92  ? 333  VAL A CG1 1 
ATOM   1972 C CG2 . VAL A 1 268 ? 32.690 10.136  33.959  1.00 44.79  ? 333  VAL A CG2 1 
ATOM   1973 N N   . ILE A 1 269 ? 35.934 8.643   31.210  1.00 54.55  ? 334  ILE A N   1 
ATOM   1974 C CA  . ILE A 1 269 ? 36.770 7.736   30.454  1.00 47.73  ? 334  ILE A CA  1 
ATOM   1975 C C   . ILE A 1 269 ? 38.235 7.943   30.892  1.00 48.24  ? 334  ILE A C   1 
ATOM   1976 O O   . ILE A 1 269 ? 38.977 6.986   31.089  1.00 42.69  ? 334  ILE A O   1 
ATOM   1977 C CB  . ILE A 1 269 ? 36.557 7.945   28.935  1.00 43.35  ? 334  ILE A CB  1 
ATOM   1978 C CG1 . ILE A 1 269 ? 35.234 7.312   28.512  1.00 40.67  ? 334  ILE A CG1 1 
ATOM   1979 C CG2 . ILE A 1 269 ? 37.690 7.322   28.124  1.00 38.36  ? 334  ILE A CG2 1 
ATOM   1980 C CD1 . ILE A 1 269 ? 35.208 5.795   28.676  1.00 39.75  ? 334  ILE A CD1 1 
ATOM   1981 N N   . LEU A 1 270 ? 38.656 9.202   31.012  1.00 46.23  ? 335  LEU A N   1 
ATOM   1982 C CA  . LEU A 1 270 ? 40.042 9.510   31.364  1.00 42.46  ? 335  LEU A CA  1 
ATOM   1983 C C   . LEU A 1 270 ? 40.392 8.926   32.749  1.00 45.82  ? 335  LEU A C   1 
ATOM   1984 O O   . LEU A 1 270 ? 41.502 8.405   32.948  1.00 39.11  ? 335  LEU A O   1 
ATOM   1985 C CB  . LEU A 1 270 ? 40.228 11.015  31.385  1.00 40.26  ? 335  LEU A CB  1 
ATOM   1986 C CG  . LEU A 1 270 ? 40.789 11.756  30.148  1.00 46.31  ? 335  LEU A CG  1 
ATOM   1987 C CD1 . LEU A 1 270 ? 40.645 11.022  28.826  1.00 38.30  ? 335  LEU A CD1 1 
ATOM   1988 C CD2 . LEU A 1 270 ? 40.341 13.214  30.024  1.00 39.98  ? 335  LEU A CD2 1 
ATOM   1989 N N   . ASN A 1 271 ? 39.438 8.990   33.689  1.00 42.79  ? 336  ASN A N   1 
ATOM   1990 C CA  . ASN A 1 271 ? 39.606 8.376   35.025  1.00 44.95  ? 336  ASN A CA  1 
ATOM   1991 C C   . ASN A 1 271 ? 39.799 6.847   35.014  1.00 48.62  ? 336  ASN A C   1 
ATOM   1992 O O   . ASN A 1 271 ? 40.273 6.231   35.986  1.00 48.29  ? 336  ASN A O   1 
ATOM   1993 C CB  . ASN A 1 271 ? 38.502 8.834   35.976  1.00 40.96  ? 336  ASN A CB  1 
ATOM   1994 C CG  . ASN A 1 271 ? 38.599 10.349  36.308  1.00 47.75  ? 336  ASN A CG  1 
ATOM   1995 O OD1 . ASN A 1 271 ? 39.648 10.966  36.160  1.00 51.86  ? 336  ASN A OD1 1 
ATOM   1996 N ND2 . ASN A 1 271 ? 37.499 10.943  36.739  1.00 43.44  ? 336  ASN A ND2 1 
ATOM   1997 N N   . CYS A 1 272 ? 39.491 6.233   33.886  1.00 42.36  ? 337  CYS A N   1 
ATOM   1998 C CA  . CYS A 1 272 ? 39.778 4.811   33.737  1.00 42.99  ? 337  CYS A CA  1 
ATOM   1999 C C   . CYS A 1 272 ? 41.160 4.555   33.119  1.00 44.58  ? 337  CYS A C   1 
ATOM   2000 O O   . CYS A 1 272 ? 41.500 3.398   32.866  1.00 40.57  ? 337  CYS A O   1 
ATOM   2001 C CB  . CYS A 1 272 ? 38.676 4.106   32.933  1.00 46.94  ? 337  CYS A CB  1 
ATOM   2002 S SG  . CYS A 1 272 ? 36.968 4.366   33.501  1.00 49.65  ? 337  CYS A SG  1 
ATOM   2003 N N   . SER A 1 273 ? 41.973 5.619   32.933  1.00 45.71  ? 338  SER A N   1 
ATOM   2004 C CA  . SER A 1 273 ? 43.343 5.489   32.417  1.00 49.44  ? 338  SER A CA  1 
ATOM   2005 C C   . SER A 1 273 ? 43.294 5.011   30.970  1.00 49.71  ? 338  SER A C   1 
ATOM   2006 O O   . SER A 1 273 ? 44.094 4.182   30.555  1.00 52.37  ? 338  SER A O   1 
ATOM   2007 C CB  . SER A 1 273 ? 44.160 4.454   33.229  1.00 49.91  ? 338  SER A CB  1 
ATOM   2008 O OG  . SER A 1 273 ? 44.092 4.674   34.621  1.00 68.18  ? 338  SER A OG  1 
ATOM   2009 N N   . ALA A 1 274 ? 42.338 5.502   30.203  1.00 50.05  ? 339  ALA A N   1 
ATOM   2010 C CA  . ALA A 1 274 ? 42.240 5.086   28.818  1.00 47.88  ? 339  ALA A CA  1 
ATOM   2011 C C   . ALA A 1 274 ? 43.482 5.525   27.981  1.00 49.79  ? 339  ALA A C   1 
ATOM   2012 O O   . ALA A 1 274 ? 43.924 4.800   27.102  1.00 48.52  ? 339  ALA A O   1 
ATOM   2013 C CB  . ALA A 1 274 ? 40.964 5.619   28.227  1.00 40.96  ? 339  ALA A CB  1 
ATOM   2014 N N   . LEU A 1 275 ? 44.044 6.691   28.269  1.00 46.92  ? 340  LEU A N   1 
ATOM   2015 C CA  . LEU A 1 275 ? 45.010 7.270   27.362  1.00 47.78  ? 340  LEU A CA  1 
ATOM   2016 C C   . LEU A 1 275 ? 46.172 6.305   27.159  1.00 47.64  ? 340  LEU A C   1 
ATOM   2017 O O   . LEU A 1 275 ? 46.748 6.188   26.061  1.00 44.62  ? 340  LEU A O   1 
ATOM   2018 C CB  . LEU A 1 275 ? 45.490 8.627   27.874  1.00 38.32  ? 340  LEU A CB  1 
ATOM   2019 C CG  . LEU A 1 275 ? 44.429 9.680   27.717  1.00 39.60  ? 340  LEU A CG  1 
ATOM   2020 C CD1 . LEU A 1 275 ? 44.956 10.915  28.398  1.00 39.81  ? 340  LEU A CD1 1 
ATOM   2021 C CD2 . LEU A 1 275 ? 44.179 9.970   26.250  1.00 38.07  ? 340  LEU A CD2 1 
ATOM   2022 N N   . GLN A 1 276 ? 46.506 5.587   28.211  1.00 49.87  ? 341  GLN A N   1 
ATOM   2023 C CA  . GLN A 1 276 ? 47.690 4.720   28.144  1.00 56.27  ? 341  GLN A CA  1 
ATOM   2024 C C   . GLN A 1 276 ? 47.420 3.594   27.153  1.00 55.39  ? 341  GLN A C   1 
ATOM   2025 O O   . GLN A 1 276 ? 48.306 3.206   26.387  1.00 57.44  ? 341  GLN A O   1 
ATOM   2026 C CB  . GLN A 1 276 ? 48.167 4.294   29.542  1.00 54.58  ? 341  GLN A CB  1 
ATOM   2027 C CG  . GLN A 1 276 ? 48.311 2.808   29.793  1.00 69.85  ? 341  GLN A CG  1 
ATOM   2028 C CD  . GLN A 1 276 ? 47.960 2.466   31.251  1.00 96.90  ? 341  GLN A CD  1 
ATOM   2029 O OE1 . GLN A 1 276 ? 46.787 2.257   31.593  1.00 111.47 ? 341  GLN A OE1 1 
ATOM   2030 N NE2 . GLN A 1 276 ? 48.972 2.426   32.115  1.00 82.97  ? 341  GLN A NE2 1 
ATOM   2031 N N   . SER A 1 277 ? 46.171 3.137   27.127  1.00 50.11  ? 342  SER A N   1 
ATOM   2032 C CA  . SER A 1 277 ? 45.708 2.154   26.150  1.00 50.21  ? 342  SER A CA  1 
ATOM   2033 C C   . SER A 1 277 ? 45.527 2.692   24.707  1.00 49.27  ? 342  SER A C   1 
ATOM   2034 O O   . SER A 1 277 ? 45.784 2.002   23.683  1.00 49.21  ? 342  SER A O   1 
ATOM   2035 C CB  . SER A 1 277 ? 44.384 1.618   26.631  1.00 52.61  ? 342  SER A CB  1 
ATOM   2036 O OG  . SER A 1 277 ? 44.604 0.500   27.436  1.00 59.84  ? 342  SER A OG  1 
ATOM   2037 N N   . LEU A 1 278 ? 45.039 3.915   24.630  1.00 42.41  ? 343  LEU A N   1 
ATOM   2038 C CA  . LEU A 1 278 ? 44.919 4.584   23.340  1.00 46.44  ? 343  LEU A CA  1 
ATOM   2039 C C   . LEU A 1 278 ? 46.315 4.755   22.724  1.00 45.79  ? 343  LEU A C   1 
ATOM   2040 O O   . LEU A 1 278 ? 46.498 4.438   21.565  1.00 44.88  ? 343  LEU A O   1 
ATOM   2041 C CB  . LEU A 1 278 ? 44.148 5.912   23.458  1.00 39.28  ? 343  LEU A CB  1 
ATOM   2042 C CG  . LEU A 1 278 ? 42.678 5.786   23.878  1.00 38.89  ? 343  LEU A CG  1 
ATOM   2043 C CD1 . LEU A 1 278 ? 42.081 7.113   24.316  1.00 35.60  ? 343  LEU A CD1 1 
ATOM   2044 C CD2 . LEU A 1 278 ? 41.876 5.204   22.729  1.00 37.10  ? 343  LEU A CD2 1 
ATOM   2045 N N   . LEU A 1 279 ? 47.280 5.240   23.504  1.00 45.43  ? 344  LEU A N   1 
ATOM   2046 C CA  . LEU A 1 279 ? 48.681 5.312   23.053  1.00 48.25  ? 344  LEU A CA  1 
ATOM   2047 C C   . LEU A 1 279 ? 49.147 4.000   22.443  1.00 43.13  ? 344  LEU A C   1 
ATOM   2048 O O   . LEU A 1 279 ? 49.774 3.984   21.397  1.00 44.09  ? 344  LEU A O   1 
ATOM   2049 C CB  . LEU A 1 279 ? 49.665 5.671   24.205  1.00 48.35  ? 344  LEU A CB  1 
ATOM   2050 C CG  . LEU A 1 279 ? 51.124 5.542   23.727  1.00 44.02  ? 344  LEU A CG  1 
ATOM   2051 C CD1 . LEU A 1 279 ? 51.428 6.509   22.556  1.00 37.68  ? 344  LEU A CD1 1 
ATOM   2052 C CD2 . LEU A 1 279 ? 52.081 5.709   24.883  1.00 38.81  ? 344  LEU A CD2 1 
ATOM   2053 N N   . HIS A 1 280 ? 48.886 2.905   23.130  1.00 42.72  ? 345  HIS A N   1 
ATOM   2054 C CA  . HIS A 1 280 ? 49.260 1.593   22.624  1.00 44.30  ? 345  HIS A CA  1 
ATOM   2055 C C   . HIS A 1 280 ? 48.605 1.406   21.273  1.00 47.80  ? 345  HIS A C   1 
ATOM   2056 O O   . HIS A 1 280 ? 49.278 1.073   20.309  1.00 49.55  ? 345  HIS A O   1 
ATOM   2057 C CB  . HIS A 1 280 ? 48.814 0.519   23.620  1.00 44.68  ? 345  HIS A CB  1 
ATOM   2058 C CG  . HIS A 1 280 ? 48.875 -0.888  23.089  1.00 49.77  ? 345  HIS A CG  1 
ATOM   2059 N ND1 . HIS A 1 280 ? 50.046 -1.520  22.841  1.00 48.48  ? 345  HIS A ND1 1 
ATOM   2060 C CD2 . HIS A 1 280 ? 47.847 -1.818  22.805  1.00 50.67  ? 345  HIS A CD2 1 
ATOM   2061 C CE1 . HIS A 1 280 ? 49.797 -2.782  22.407  1.00 50.79  ? 345  HIS A CE1 1 
ATOM   2062 N NE2 . HIS A 1 280 ? 48.442 -2.970  22.391  1.00 50.77  ? 345  HIS A NE2 1 
ATOM   2063 N N   . LEU A 1 281 ? 47.301 1.681   21.181  1.00 42.26  ? 346  LEU A N   1 
ATOM   2064 C CA  . LEU A 1 281 ? 46.574 1.445   19.954  1.00 45.09  ? 346  LEU A CA  1 
ATOM   2065 C C   . LEU A 1 281 ? 47.082 2.267   18.795  1.00 47.90  ? 346  LEU A C   1 
ATOM   2066 O O   . LEU A 1 281 ? 46.983 1.835   17.653  1.00 49.83  ? 346  LEU A O   1 
ATOM   2067 C CB  . LEU A 1 281 ? 45.067 1.646   20.163  1.00 44.40  ? 346  LEU A CB  1 
ATOM   2068 C CG  . LEU A 1 281 ? 44.455 0.552   21.056  1.00 41.11  ? 346  LEU A CG  1 
ATOM   2069 C CD1 . LEU A 1 281 ? 42.950 0.805   21.167  1.00 40.51  ? 346  LEU A CD1 1 
ATOM   2070 C CD2 . LEU A 1 281 ? 44.799 -0.872  20.548  1.00 33.51  ? 346  LEU A CD2 1 
ATOM   2071 N N   . LEU A 1 282 ? 47.659 3.435   19.080  1.00 47.15  ? 347  LEU A N   1 
ATOM   2072 C CA  . LEU A 1 282 ? 48.281 4.256   18.025  1.00 44.00  ? 347  LEU A CA  1 
ATOM   2073 C C   . LEU A 1 282 ? 49.396 3.534   17.196  1.00 45.12  ? 347  LEU A C   1 
ATOM   2074 O O   . LEU A 1 282 ? 49.798 4.034   16.128  1.00 44.63  ? 347  LEU A O   1 
ATOM   2075 C CB  . LEU A 1 282 ? 48.816 5.527   18.637  1.00 37.21  ? 347  LEU A CB  1 
ATOM   2076 C CG  . LEU A 1 282 ? 47.793 6.595   18.994  1.00 37.18  ? 347  LEU A CG  1 
ATOM   2077 C CD1 . LEU A 1 282 ? 48.602 7.767   19.484  1.00 30.78  ? 347  LEU A CD1 1 
ATOM   2078 C CD2 . LEU A 1 282 ? 47.001 7.055   17.795  1.00 30.40  ? 347  LEU A CD2 1 
ATOM   2079 N N   . SER A 1 283 ? 49.866 2.381   17.684  1.00 41.09  ? 348  SER A N   1 
ATOM   2080 C CA  . SER A 1 283 ? 50.837 1.530   16.955  1.00 53.41  ? 348  SER A CA  1 
ATOM   2081 C C   . SER A 1 283 ? 50.150 0.299   16.360  1.00 54.30  ? 348  SER A C   1 
ATOM   2082 O O   . SER A 1 283 ? 50.826 -0.639  15.941  1.00 57.15  ? 348  SER A O   1 
ATOM   2083 C CB  . SER A 1 283 ? 51.993 1.000   17.848  1.00 48.06  ? 348  SER A CB  1 
ATOM   2084 O OG  . SER A 1 283 ? 52.622 2.016   18.623  1.00 55.31  ? 348  SER A OG  1 
ATOM   2085 N N   . SER A 1 284 ? 48.826 0.245   16.334  1.00 50.10  ? 349  SER A N   1 
ATOM   2086 C CA  . SER A 1 284 ? 48.248 -0.957  15.742  1.00 50.51  ? 349  SER A CA  1 
ATOM   2087 C C   . SER A 1 284 ? 48.711 -1.269  14.304  1.00 51.15  ? 349  SER A C   1 
ATOM   2088 O O   . SER A 1 284 ? 48.822 -0.379  13.433  1.00 43.14  ? 349  SER A O   1 
ATOM   2089 C CB  . SER A 1 284 ? 46.747 -0.951  15.750  1.00 48.04  ? 349  SER A CB  1 
ATOM   2090 O OG  . SER A 1 284 ? 46.318 -2.262  16.071  1.00 57.48  ? 349  SER A OG  1 
ATOM   2091 N N   . PRO A 1 285 ? 48.989 -2.554  14.054  1.00 57.22  ? 350  PRO A N   1 
ATOM   2092 C CA  . PRO A 1 285 ? 49.137 -2.994  12.662  1.00 56.52  ? 350  PRO A CA  1 
ATOM   2093 C C   . PRO A 1 285 ? 47.927 -2.519  11.851  1.00 62.93  ? 350  PRO A C   1 
ATOM   2094 O O   . PRO A 1 285 ? 48.082 -2.102  10.700  1.00 56.31  ? 350  PRO A O   1 
ATOM   2095 C CB  . PRO A 1 285 ? 49.130 -4.518  12.775  1.00 52.72  ? 350  PRO A CB  1 
ATOM   2096 C CG  . PRO A 1 285 ? 49.658 -4.820  14.173  1.00 52.79  ? 350  PRO A CG  1 
ATOM   2097 C CD  . PRO A 1 285 ? 49.347 -3.606  15.036  1.00 54.19  ? 350  PRO A CD  1 
ATOM   2098 N N   . LYS A 1 286 ? 46.742 -2.542  12.474  1.00 62.58  ? 351  LYS A N   1 
ATOM   2099 C CA  . LYS A 1 286 ? 45.502 -2.239  11.783  1.00 56.90  ? 351  LYS A CA  1 
ATOM   2100 C C   . LYS A 1 286 ? 45.168 -0.738  11.680  1.00 58.43  ? 351  LYS A C   1 
ATOM   2101 O O   . LYS A 1 286 ? 44.829 -0.099  12.669  1.00 68.52  ? 351  LYS A O   1 
ATOM   2102 C CB  . LYS A 1 286 ? 44.364 -3.040  12.411  1.00 59.25  ? 351  LYS A CB  1 
ATOM   2103 C CG  . LYS A 1 286 ? 43.239 -3.346  11.435  1.00 75.35  ? 351  LYS A CG  1 
ATOM   2104 C CD  . LYS A 1 286 ? 42.142 -4.197  12.067  1.00 79.71  ? 351  LYS A CD  1 
ATOM   2105 C CE  . LYS A 1 286 ? 41.783 -5.363  11.150  1.00 82.19  ? 351  LYS A CE  1 
ATOM   2106 N NZ  . LYS A 1 286 ? 40.316 -5.399  10.910  1.00 94.40  ? 351  LYS A NZ  1 
ATOM   2107 N N   . GLU A 1 287 ? 45.224 -0.202  10.466  1.00 53.35  ? 352  GLU A N   1 
ATOM   2108 C CA  . GLU A 1 287 ? 44.991 1.208   10.182  1.00 54.61  ? 352  GLU A CA  1 
ATOM   2109 C C   . GLU A 1 287 ? 43.654 1.807   10.711  1.00 52.63  ? 352  GLU A C   1 
ATOM   2110 O O   . GLU A 1 287 ? 43.564 2.991   11.116  1.00 52.33  ? 352  GLU A O   1 
ATOM   2111 C CB  . GLU A 1 287 ? 45.116 1.422   8.662   1.00 50.50  ? 352  GLU A CB  1 
ATOM   2112 C CG  . GLU A 1 287 ? 45.362 2.867   8.211   1.00 53.09  ? 352  GLU A CG  1 
ATOM   2113 C CD  . GLU A 1 287 ? 46.825 3.300   8.357   1.00 59.96  ? 352  GLU A CD  1 
ATOM   2114 O OE1 . GLU A 1 287 ? 47.681 2.427   8.490   1.00 64.66  ? 352  GLU A OE1 1 
ATOM   2115 O OE2 . GLU A 1 287 ? 47.146 4.506   8.325   1.00 62.89  ? 352  GLU A OE2 1 
ATOM   2116 N N   . SER A 1 288 ? 42.606 1.005   10.694  1.00 51.72  ? 353  SER A N   1 
ATOM   2117 C CA  . SER A 1 288 ? 41.300 1.505   11.152  1.00 51.31  ? 353  SER A CA  1 
ATOM   2118 C C   . SER A 1 288 ? 41.336 1.714   12.657  1.00 50.66  ? 353  SER A C   1 
ATOM   2119 O O   . SER A 1 288 ? 40.852 2.700   13.125  1.00 50.04  ? 353  SER A O   1 
ATOM   2120 C CB  . SER A 1 288 ? 40.194 0.545   10.761  1.00 43.27  ? 353  SER A CB  1 
ATOM   2121 O OG  . SER A 1 288 ? 40.614 -0.769  11.062  1.00 53.68  ? 353  SER A OG  1 
ATOM   2122 N N   . ILE A 1 289 ? 41.967 0.794   13.394  1.00 51.81  ? 354  ILE A N   1 
ATOM   2123 C CA  . ILE A 1 289 ? 42.288 1.012   14.802  1.00 50.32  ? 354  ILE A CA  1 
ATOM   2124 C C   . ILE A 1 289 ? 43.076 2.288   15.109  1.00 50.21  ? 354  ILE A C   1 
ATOM   2125 O O   . ILE A 1 289 ? 42.704 3.006   16.023  1.00 49.00  ? 354  ILE A O   1 
ATOM   2126 C CB  . ILE A 1 289 ? 43.048 -0.185  15.356  1.00 54.48  ? 354  ILE A CB  1 
ATOM   2127 C CG1 . ILE A 1 289 ? 42.242 -1.454  15.084  1.00 50.63  ? 354  ILE A CG1 1 
ATOM   2128 C CG2 . ILE A 1 289 ? 43.329 -0.015  16.848  1.00 47.03  ? 354  ILE A CG2 1 
ATOM   2129 C CD1 . ILE A 1 289 ? 41.114 -1.621  16.057  1.00 52.64  ? 354  ILE A CD1 1 
ATOM   2130 N N   . LYS A 1 290 ? 44.142 2.579   14.353  1.00 50.63  ? 355  LYS A N   1 
ATOM   2131 C CA  . LYS A 1 290 ? 44.940 3.766   14.614  1.00 43.40  ? 355  LYS A CA  1 
ATOM   2132 C C   . LYS A 1 290 ? 44.069 4.944   14.334  1.00 44.44  ? 355  LYS A C   1 
ATOM   2133 O O   . LYS A 1 290 ? 44.091 5.944   15.082  1.00 48.53  ? 355  LYS A O   1 
ATOM   2134 C CB  . LYS A 1 290 ? 46.165 3.897   13.698  1.00 50.13  ? 355  LYS A CB  1 
ATOM   2135 C CG  . LYS A 1 290 ? 47.372 2.990   13.868  1.00 48.18  ? 355  LYS A CG  1 
ATOM   2136 C CD  . LYS A 1 290 ? 48.477 3.478   12.936  1.00 54.54  ? 355  LYS A CD  1 
ATOM   2137 C CE  . LYS A 1 290 ? 49.413 2.363   12.486  1.00 62.66  ? 355  LYS A CE  1 
ATOM   2138 N NZ  . LYS A 1 290 ? 49.968 2.693   11.141  1.00 64.56  ? 355  LYS A NZ  1 
ATOM   2139 N N   . LYS A 1 291 ? 43.316 4.849   13.239  1.00 43.81  ? 356  LYS A N   1 
ATOM   2140 C CA  . LYS A 1 291 ? 42.454 5.956   12.830  1.00 43.55  ? 356  LYS A CA  1 
ATOM   2141 C C   . LYS A 1 291 ? 41.426 6.274   13.915  1.00 42.57  ? 356  LYS A C   1 
ATOM   2142 O O   . LYS A 1 291 ? 41.203 7.443   14.287  1.00 41.25  ? 356  LYS A O   1 
ATOM   2143 C CB  . LYS A 1 291 ? 41.707 5.645   11.537  1.00 42.25  ? 356  LYS A CB  1 
ATOM   2144 C CG  . LYS A 1 291 ? 40.973 6.871   10.943  1.00 43.22  ? 356  LYS A CG  1 
ATOM   2145 C CD  . LYS A 1 291 ? 39.835 6.502   10.011  1.00 44.79  ? 356  LYS A CD  1 
ATOM   2146 C CE  . LYS A 1 291 ? 38.922 5.549   10.785  1.00 63.20  ? 356  LYS A CE  1 
ATOM   2147 N NZ  . LYS A 1 291 ? 38.281 4.451   10.016  1.00 66.57  ? 356  LYS A NZ  1 
ATOM   2148 N N   . GLU A 1 292 ? 40.802 5.224   14.404  1.00 39.19  ? 357  GLU A N   1 
ATOM   2149 C CA  . GLU A 1 292 ? 39.786 5.351   15.452  1.00 47.00  ? 357  GLU A CA  1 
ATOM   2150 C C   . GLU A 1 292 ? 40.377 5.868   16.794  1.00 43.63  ? 357  GLU A C   1 
ATOM   2151 O O   . GLU A 1 292 ? 39.774 6.679   17.520  1.00 43.38  ? 357  GLU A O   1 
ATOM   2152 C CB  . GLU A 1 292 ? 39.160 4.005   15.689  1.00 48.61  ? 357  GLU A CB  1 
ATOM   2153 C CG  . GLU A 1 292 ? 37.669 4.098   15.854  1.00 75.35  ? 357  GLU A CG  1 
ATOM   2154 C CD  . GLU A 1 292 ? 36.984 4.088   14.528  1.00 70.97  ? 357  GLU A CD  1 
ATOM   2155 O OE1 . GLU A 1 292 ? 37.078 3.040   13.857  1.00 78.48  ? 357  GLU A OE1 1 
ATOM   2156 O OE2 . GLU A 1 292 ? 36.377 5.116   14.172  1.00 81.80  ? 357  GLU A OE2 1 
ATOM   2157 N N   . ALA A 1 293 ? 41.576 5.421   17.096  1.00 37.09  ? 358  ALA A N   1 
ATOM   2158 C CA  . ALA A 1 293 ? 42.205 5.887   18.284  1.00 43.41  ? 358  ALA A CA  1 
ATOM   2159 C C   . ALA A 1 293 ? 42.555 7.373   18.128  1.00 38.96  ? 358  ALA A C   1 
ATOM   2160 O O   . ALA A 1 293 ? 42.459 8.154   19.086  1.00 41.41  ? 358  ALA A O   1 
ATOM   2161 C CB  . ALA A 1 293 ? 43.422 5.047   18.591  1.00 39.93  ? 358  ALA A CB  1 
ATOM   2162 N N   . CYS A 1 294 ? 42.911 7.773   16.926  1.00 40.39  ? 359  CYS A N   1 
ATOM   2163 C CA  . CYS A 1 294 ? 43.232 9.196   16.699  1.00 45.21  ? 359  CYS A CA  1 
ATOM   2164 C C   . CYS A 1 294 ? 42.001 10.035  16.864  1.00 42.22  ? 359  CYS A C   1 
ATOM   2165 O O   . CYS A 1 294 ? 42.028 11.102  17.441  1.00 50.12  ? 359  CYS A O   1 
ATOM   2166 C CB  . CYS A 1 294 ? 43.788 9.438   15.307  1.00 43.17  ? 359  CYS A CB  1 
ATOM   2167 S SG  . CYS A 1 294 ? 45.505 8.959   15.190  1.00 41.98  ? 359  CYS A SG  1 
ATOM   2168 N N   . TRP A 1 295 ? 40.906 9.550   16.335  1.00 40.94  ? 360  TRP A N   1 
ATOM   2169 C CA  . TRP A 1 295 ? 39.689 10.295  16.434  1.00 43.93  ? 360  TRP A CA  1 
ATOM   2170 C C   . TRP A 1 295 ? 39.217 10.393  17.898  1.00 40.06  ? 360  TRP A C   1 
ATOM   2171 O O   . TRP A 1 295 ? 38.817 11.451  18.371  1.00 32.08  ? 360  TRP A O   1 
ATOM   2172 C CB  . TRP A 1 295 ? 38.656 9.638   15.544  1.00 41.52  ? 360  TRP A CB  1 
ATOM   2173 C CG  . TRP A 1 295 ? 37.246 10.068  15.842  1.00 45.04  ? 360  TRP A CG  1 
ATOM   2174 C CD1 . TRP A 1 295 ? 36.639 11.319  15.591  1.00 44.15  ? 360  TRP A CD1 1 
ATOM   2175 C CD2 . TRP A 1 295 ? 36.221 9.259   16.453  1.00 37.30  ? 360  TRP A CD2 1 
ATOM   2176 N NE1 . TRP A 1 295 ? 35.325 11.310  15.984  1.00 38.51  ? 360  TRP A NE1 1 
ATOM   2177 C CE2 . TRP A 1 295 ? 35.024 10.091  16.521  1.00 39.97  ? 360  TRP A CE2 1 
ATOM   2178 C CE3 . TRP A 1 295 ? 36.174 7.983   16.908  1.00 46.39  ? 360  TRP A CE3 1 
ATOM   2179 C CZ2 . TRP A 1 295 ? 33.864 9.634   17.067  1.00 44.14  ? 360  TRP A CZ2 1 
ATOM   2180 C CZ3 . TRP A 1 295 ? 34.979 7.495   17.445  1.00 51.33  ? 360  TRP A CZ3 1 
ATOM   2181 C CH2 . TRP A 1 295 ? 33.854 8.307   17.529  1.00 46.83  ? 360  TRP A CH2 1 
ATOM   2182 N N   . THR A 1 296 ? 39.266 9.278   18.618  1.00 41.06  ? 361  THR A N   1 
ATOM   2183 C CA  . THR A 1 296 ? 38.974 9.308   20.040  1.00 37.81  ? 361  THR A CA  1 
ATOM   2184 C C   . THR A 1 296 ? 39.845 10.337  20.737  1.00 43.08  ? 361  THR A C   1 
ATOM   2185 O O   . THR A 1 296 ? 39.326 11.166  21.497  1.00 46.64  ? 361  THR A O   1 
ATOM   2186 C CB  . THR A 1 296 ? 39.240 7.978   20.700  1.00 36.08  ? 361  THR A CB  1 
ATOM   2187 O OG1 . THR A 1 296 ? 38.451 6.924   20.106  1.00 39.96  ? 361  THR A OG1 1 
ATOM   2188 C CG2 . THR A 1 296 ? 38.936 8.076   22.118  1.00 33.15  ? 361  THR A CG2 1 
ATOM   2189 N N   . ILE A 1 297 ? 41.163 10.310  20.487  1.00 41.23  ? 362  ILE A N   1 
ATOM   2190 C CA  . ILE A 1 297 ? 42.034 11.321  21.077  1.00 34.93  ? 362  ILE A CA  1 
ATOM   2191 C C   . ILE A 1 297 ? 41.622 12.750  20.725  1.00 39.38  ? 362  ILE A C   1 
ATOM   2192 O O   . ILE A 1 297 ? 41.643 13.634  21.598  1.00 43.15  ? 362  ILE A O   1 
ATOM   2193 C CB  . ILE A 1 297 ? 43.509 11.066  20.772  1.00 34.85  ? 362  ILE A CB  1 
ATOM   2194 C CG1 . ILE A 1 297 ? 43.977 9.839   21.534  1.00 35.50  ? 362  ILE A CG1 1 
ATOM   2195 C CG2 . ILE A 1 297 ? 44.376 12.242  21.220  1.00 33.67  ? 362  ILE A CG2 1 
ATOM   2196 C CD1 . ILE A 1 297 ? 45.259 9.281   21.000  1.00 37.54  ? 362  ILE A CD1 1 
ATOM   2197 N N   . SER A 1 298 ? 41.203 12.990  19.484  1.00 36.72  ? 363  SER A N   1 
ATOM   2198 C CA  . SER A 1 298 ? 40.919 14.372  19.081  1.00 39.66  ? 363  SER A CA  1 
ATOM   2199 C C   . SER A 1 298 ? 39.787 14.891  19.912  1.00 38.29  ? 363  SER A C   1 
ATOM   2200 O O   . SER A 1 298 ? 39.759 16.092  20.230  1.00 35.19  ? 363  SER A O   1 
ATOM   2201 C CB  . SER A 1 298 ? 40.552 14.511  17.590  1.00 39.73  ? 363  SER A CB  1 
ATOM   2202 O OG  . SER A 1 298 ? 39.415 13.684  17.295  1.00 42.03  ? 363  SER A OG  1 
ATOM   2203 N N   . ASN A 1 299 ? 38.866 13.997  20.275  1.00 37.02  ? 364  ASN A N   1 
ATOM   2204 C CA  . ASN A 1 299 ? 37.745 14.430  21.128  1.00 43.46  ? 364  ASN A CA  1 
ATOM   2205 C C   . ASN A 1 299 ? 38.088 14.608  22.593  1.00 47.62  ? 364  ASN A C   1 
ATOM   2206 O O   . ASN A 1 299 ? 37.331 15.241  23.325  1.00 45.08  ? 364  ASN A O   1 
ATOM   2207 C CB  . ASN A 1 299 ? 36.558 13.513  21.013  1.00 42.58  ? 364  ASN A CB  1 
ATOM   2208 C CG  . ASN A 1 299 ? 35.799 13.735  19.724  1.00 48.91  ? 364  ASN A CG  1 
ATOM   2209 O OD1 . ASN A 1 299 ? 35.697 14.868  19.256  1.00 47.47  ? 364  ASN A OD1 1 
ATOM   2210 N ND2 . ASN A 1 299 ? 35.300 12.646  19.119  1.00 49.50  ? 364  ASN A ND2 1 
ATOM   2211 N N   . ILE A 1 300 ? 39.203 14.007  23.024  1.00 47.12  ? 365  ILE A N   1 
ATOM   2212 C CA  . ILE A 1 300 ? 39.755 14.301  24.330  1.00 38.39  ? 365  ILE A CA  1 
ATOM   2213 C C   . ILE A 1 300 ? 40.564 15.605  24.251  1.00 45.62  ? 365  ILE A C   1 
ATOM   2214 O O   . ILE A 1 300 ? 40.495 16.419  25.174  1.00 43.15  ? 365  ILE A O   1 
ATOM   2215 C CB  . ILE A 1 300 ? 40.553 13.130  24.876  1.00 35.26  ? 365  ILE A CB  1 
ATOM   2216 C CG1 . ILE A 1 300 ? 39.650 11.897  25.108  1.00 32.69  ? 365  ILE A CG1 1 
ATOM   2217 C CG2 . ILE A 1 300 ? 41.253 13.474  26.174  1.00 36.13  ? 365  ILE A CG2 1 
ATOM   2218 C CD1 . ILE A 1 300 ? 40.481 10.631  25.313  1.00 28.00  ? 365  ILE A CD1 1 
ATOM   2219 N N   . THR A 1 301 ? 41.272 15.878  23.154  1.00 45.07  ? 366  THR A N   1 
ATOM   2220 C CA  . THR A 1 301 ? 42.033 17.136  23.172  1.00 45.18  ? 366  THR A CA  1 
ATOM   2221 C C   . THR A 1 301 ? 41.221 18.358  22.766  1.00 44.11  ? 366  THR A C   1 
ATOM   2222 O O   . THR A 1 301 ? 41.776 19.466  22.650  1.00 46.25  ? 366  THR A O   1 
ATOM   2223 C CB  . THR A 1 301 ? 43.299 17.130  22.328  1.00 43.86  ? 366  THR A CB  1 
ATOM   2224 O OG1 . THR A 1 301 ? 42.926 17.094  20.947  1.00 51.39  ? 366  THR A OG1 1 
ATOM   2225 C CG2 . THR A 1 301 ? 44.159 15.983  22.671  1.00 42.60  ? 366  THR A CG2 1 
ATOM   2226 N N   . ALA A 1 302 ? 39.933 18.144  22.539  1.00 42.54  ? 367  ALA A N   1 
ATOM   2227 C CA  . ALA A 1 302 ? 38.986 19.238  22.360  1.00 47.03  ? 367  ALA A CA  1 
ATOM   2228 C C   . ALA A 1 302 ? 38.331 19.639  23.704  1.00 52.68  ? 367  ALA A C   1 
ATOM   2229 O O   . ALA A 1 302 ? 37.508 20.571  23.735  1.00 43.78  ? 367  ALA A O   1 
ATOM   2230 C CB  . ALA A 1 302 ? 37.901 18.838  21.372  1.00 46.30  ? 367  ALA A CB  1 
ATOM   2231 N N   . GLY A 1 303 ? 38.691 18.937  24.791  1.00 48.78  ? 368  GLY A N   1 
ATOM   2232 C CA  . GLY A 1 303 ? 38.296 19.338  26.141  1.00 50.84  ? 368  GLY A CA  1 
ATOM   2233 C C   . GLY A 1 303 ? 39.067 20.446  26.880  1.00 51.04  ? 368  GLY A C   1 
ATOM   2234 O O   . GLY A 1 303 ? 39.646 21.344  26.285  1.00 43.91  ? 368  GLY A O   1 
ATOM   2235 N N   . ASN A 1 304 ? 39.060 20.388  28.212  1.00 50.14  ? 369  ASN A N   1 
ATOM   2236 C CA  . ASN A 1 304 ? 39.567 21.494  28.992  1.00 45.83  ? 369  ASN A CA  1 
ATOM   2237 C C   . ASN A 1 304 ? 41.087 21.356  29.177  1.00 50.92  ? 369  ASN A C   1 
ATOM   2238 O O   . ASN A 1 304 ? 41.673 20.270  28.925  1.00 51.88  ? 369  ASN A O   1 
ATOM   2239 C CB  . ASN A 1 304 ? 38.854 21.478  30.326  1.00 42.33  ? 369  ASN A CB  1 
ATOM   2240 C CG  . ASN A 1 304 ? 39.282 20.308  31.192  1.00 45.97  ? 369  ASN A CG  1 
ATOM   2241 O OD1 . ASN A 1 304 ? 40.494 20.027  31.366  1.00 49.67  ? 369  ASN A OD1 1 
ATOM   2242 N ND2 . ASN A 1 304 ? 38.288 19.607  31.761  1.00 41.75  ? 369  ASN A ND2 1 
ATOM   2243 N N   . ARG A 1 305 ? 41.730 22.427  29.635  1.00 49.88  ? 370  ARG A N   1 
ATOM   2244 C CA  . ARG A 1 305 ? 43.204 22.439  29.827  1.00 47.38  ? 370  ARG A CA  1 
ATOM   2245 C C   . ARG A 1 305 ? 43.768 21.166  30.518  1.00 49.49  ? 370  ARG A C   1 
ATOM   2246 O O   . ARG A 1 305 ? 44.893 20.735  30.224  1.00 47.70  ? 370  ARG A O   1 
ATOM   2247 C CB  . ARG A 1 305 ? 43.592 23.652  30.672  1.00 47.21  ? 370  ARG A CB  1 
ATOM   2248 C CG  . ARG A 1 305 ? 43.100 25.012  30.149  1.00 53.07  ? 370  ARG A CG  1 
ATOM   2249 C CD  . ARG A 1 305 ? 44.255 25.690  29.434  1.00 54.86  ? 370  ARG A CD  1 
ATOM   2250 N NE  . ARG A 1 305 ? 43.863 26.791  28.567  1.00 65.55  ? 370  ARG A NE  1 
ATOM   2251 C CZ  . ARG A 1 305 ? 44.305 28.046  28.689  1.00 72.72  ? 370  ARG A CZ  1 
ATOM   2252 N NH1 . ARG A 1 305 ? 45.156 28.380  29.672  1.00 76.09  ? 370  ARG A NH1 1 
ATOM   2253 N NH2 . ARG A 1 305 ? 43.885 28.977  27.836  1.00 63.82  ? 370  ARG A NH2 1 
ATOM   2254 N N   . ALA A 1 306 ? 43.010 20.562  31.436  1.00 38.01  ? 371  ALA A N   1 
ATOM   2255 C CA  . ALA A 1 306 ? 43.587 19.497  32.206  1.00 45.01  ? 371  ALA A CA  1 
ATOM   2256 C C   . ALA A 1 306 ? 43.628 18.220  31.402  1.00 49.60  ? 371  ALA A C   1 
ATOM   2257 O O   . ALA A 1 306 ? 44.506 17.357  31.628  1.00 50.04  ? 371  ALA A O   1 
ATOM   2258 C CB  . ALA A 1 306 ? 42.796 19.256  33.503  1.00 46.92  ? 371  ALA A CB  1 
ATOM   2259 N N   . GLN A 1 307 ? 42.626 18.081  30.529  1.00 45.70  ? 372  GLN A N   1 
ATOM   2260 C CA  . GLN A 1 307 ? 42.490 16.914  29.663  1.00 46.69  ? 372  GLN A CA  1 
ATOM   2261 C C   . GLN A 1 307 ? 43.570 16.971  28.588  1.00 44.05  ? 372  GLN A C   1 
ATOM   2262 O O   . GLN A 1 307 ? 44.310 15.983  28.351  1.00 41.81  ? 372  GLN A O   1 
ATOM   2263 C CB  . GLN A 1 307 ? 41.098 16.866  29.074  1.00 48.32  ? 372  GLN A CB  1 
ATOM   2264 C CG  . GLN A 1 307 ? 40.093 16.859  30.202  1.00 45.45  ? 372  GLN A CG  1 
ATOM   2265 C CD  . GLN A 1 307 ? 38.688 16.949  29.714  1.00 48.62  ? 372  GLN A CD  1 
ATOM   2266 O OE1 . GLN A 1 307 ? 38.383 17.784  28.795  1.00 44.26  ? 372  GLN A OE1 1 
ATOM   2267 N NE2 . GLN A 1 307 ? 37.779 16.141  30.359  1.00 39.88  ? 372  GLN A NE2 1 
ATOM   2268 N N   . ILE A 1 308 ? 43.718 18.136  27.990  1.00 36.44  ? 373  ILE A N   1 
ATOM   2269 C CA  . ILE A 1 308 ? 44.806 18.288  27.079  1.00 41.38  ? 373  ILE A CA  1 
ATOM   2270 C C   . ILE A 1 308 ? 46.103 17.802  27.780  1.00 49.44  ? 373  ILE A C   1 
ATOM   2271 O O   . ILE A 1 308 ? 46.831 16.859  27.282  1.00 43.62  ? 373  ILE A O   1 
ATOM   2272 C CB  . ILE A 1 308 ? 44.901 19.727  26.618  1.00 42.26  ? 373  ILE A CB  1 
ATOM   2273 C CG1 . ILE A 1 308 ? 43.615 20.153  25.871  1.00 43.05  ? 373  ILE A CG1 1 
ATOM   2274 C CG2 . ILE A 1 308 ? 46.111 19.885  25.755  1.00 46.65  ? 373  ILE A CG2 1 
ATOM   2275 C CD1 . ILE A 1 308 ? 43.591 21.577  25.328  1.00 32.54  ? 373  ILE A CD1 1 
ATOM   2276 N N   . GLN A 1 309 ? 46.342 18.393  28.962  1.00 43.75  ? 374  GLN A N   1 
ATOM   2277 C CA  . GLN A 1 309 ? 47.526 18.069  29.784  1.00 41.44  ? 374  GLN A CA  1 
ATOM   2278 C C   . GLN A 1 309 ? 47.654 16.604  30.163  1.00 40.54  ? 374  GLN A C   1 
ATOM   2279 O O   . GLN A 1 309 ? 48.759 16.028  30.116  1.00 43.29  ? 374  GLN A O   1 
ATOM   2280 C CB  . GLN A 1 309 ? 47.601 18.943  31.043  1.00 48.65  ? 374  GLN A CB  1 
ATOM   2281 C CG  . GLN A 1 309 ? 48.832 18.689  31.879  1.00 40.20  ? 374  GLN A CG  1 
ATOM   2282 C CD  . GLN A 1 309 ? 50.068 19.146  31.140  1.00 45.86  ? 374  GLN A CD  1 
ATOM   2283 O OE1 . GLN A 1 309 ? 50.028 20.164  30.404  1.00 41.44  ? 374  GLN A OE1 1 
ATOM   2284 N NE2 . GLN A 1 309 ? 51.187 18.386  31.313  1.00 34.41  ? 374  GLN A NE2 1 
ATOM   2285 N N   . THR A 1 310 ? 46.547 15.965  30.497  1.00 37.82  ? 375  THR A N   1 
ATOM   2286 C CA  . THR A 1 310 ? 46.612 14.505  30.621  1.00 37.58  ? 375  THR A CA  1 
ATOM   2287 C C   . THR A 1 310 ? 47.014 13.783  29.294  1.00 42.30  ? 375  THR A C   1 
ATOM   2288 O O   . THR A 1 310 ? 47.680 12.757  29.359  1.00 41.85  ? 375  THR A O   1 
ATOM   2289 C CB  . THR A 1 310 ? 45.470 13.919  31.525  1.00 45.45  ? 375  THR A CB  1 
ATOM   2290 O OG1 . THR A 1 310 ? 45.070 12.586  31.147  1.00 46.88  ? 375  THR A OG1 1 
ATOM   2291 C CG2 . THR A 1 310 ? 44.268 14.913  31.703  1.00 41.38  ? 375  THR A CG2 1 
ATOM   2292 N N   . VAL A 1 311 ? 46.750 14.380  28.115  1.00 38.66  ? 376  VAL A N   1 
ATOM   2293 C CA  . VAL A 1 311 ? 47.136 13.747  26.871  1.00 38.20  ? 376  VAL A CA  1 
ATOM   2294 C C   . VAL A 1 311 ? 48.648 13.995  26.684  1.00 43.28  ? 376  VAL A C   1 
ATOM   2295 O O   . VAL A 1 311 ? 49.419 13.076  26.293  1.00 43.72  ? 376  VAL A O   1 
ATOM   2296 C CB  . VAL A 1 311 ? 46.327 14.285  25.665  1.00 41.59  ? 376  VAL A CB  1 
ATOM   2297 C CG1 . VAL A 1 311 ? 46.963 13.897  24.346  1.00 38.33  ? 376  VAL A CG1 1 
ATOM   2298 C CG2 . VAL A 1 311 ? 44.896 13.785  25.695  1.00 38.00  ? 376  VAL A CG2 1 
ATOM   2299 N N   . ILE A 1 312 ? 49.097 15.211  26.985  1.00 41.38  ? 377  ILE A N   1 
ATOM   2300 C CA  . ILE A 1 312 ? 50.532 15.467  27.013  1.00 38.66  ? 377  ILE A CA  1 
ATOM   2301 C C   . ILE A 1 312 ? 51.271 14.453  27.908  1.00 43.57  ? 377  ILE A C   1 
ATOM   2302 O O   . ILE A 1 312 ? 52.202 13.789  27.479  1.00 41.31  ? 377  ILE A O   1 
ATOM   2303 C CB  . ILE A 1 312 ? 50.822 16.854  27.528  1.00 41.29  ? 377  ILE A CB  1 
ATOM   2304 C CG1 . ILE A 1 312 ? 50.193 17.889  26.589  1.00 37.28  ? 377  ILE A CG1 1 
ATOM   2305 C CG2 . ILE A 1 312 ? 52.331 17.038  27.675  1.00 39.94  ? 377  ILE A CG2 1 
ATOM   2306 C CD1 . ILE A 1 312 ? 50.614 19.304  26.915  1.00 37.93  ? 377  ILE A CD1 1 
ATOM   2307 N N   . ASP A 1 313 ? 50.828 14.289  29.146  1.00 46.84  ? 378  ASP A N   1 
ATOM   2308 C CA  . ASP A 1 313 ? 51.565 13.424  30.069  1.00 45.61  ? 378  ASP A CA  1 
ATOM   2309 C C   . ASP A 1 313 ? 51.496 11.946  29.706  1.00 51.14  ? 378  ASP A C   1 
ATOM   2310 O O   . ASP A 1 313 ? 52.387 11.186  30.125  1.00 51.20  ? 378  ASP A O   1 
ATOM   2311 C CB  . ASP A 1 313 ? 51.090 13.643  31.511  1.00 48.73  ? 378  ASP A CB  1 
ATOM   2312 C CG  . ASP A 1 313 ? 51.402 15.062  32.013  1.00 52.67  ? 378  ASP A CG  1 
ATOM   2313 O OD1 . ASP A 1 313 ? 52.465 15.584  31.617  1.00 50.13  ? 378  ASP A OD1 1 
ATOM   2314 O OD2 . ASP A 1 313 ? 50.589 15.670  32.761  1.00 59.86  ? 378  ASP A OD2 1 
ATOM   2315 N N   . ALA A 1 314 ? 50.473 11.507  28.944  1.00 44.99  ? 379  ALA A N   1 
ATOM   2316 C CA  . ALA A 1 314 ? 50.491 10.088  28.486  1.00 40.05  ? 379  ALA A CA  1 
ATOM   2317 C C   . ALA A 1 314 ? 51.483 9.919   27.357  1.00 40.37  ? 379  ALA A C   1 
ATOM   2318 O O   . ALA A 1 314 ? 51.641 8.818   26.857  1.00 45.94  ? 379  ALA A O   1 
ATOM   2319 C CB  . ALA A 1 314 ? 49.122 9.564   28.070  1.00 33.67  ? 379  ALA A CB  1 
ATOM   2320 N N   . ASN A 1 315 ? 52.195 10.991  26.997  1.00 40.38  ? 380  ASN A N   1 
ATOM   2321 C CA  . ASN A 1 315 ? 53.133 10.942  25.900  1.00 45.12  ? 380  ASN A CA  1 
ATOM   2322 C C   . ASN A 1 315 ? 52.512 10.675  24.538  1.00 45.93  ? 380  ASN A C   1 
ATOM   2323 O O   . ASN A 1 315 ? 53.214 10.182  23.668  1.00 43.22  ? 380  ASN A O   1 
ATOM   2324 C CB  . ASN A 1 315 ? 54.211 9.906   26.146  1.00 52.24  ? 380  ASN A CB  1 
ATOM   2325 C CG  . ASN A 1 315 ? 55.534 10.547  26.352  1.00 76.19  ? 380  ASN A CG  1 
ATOM   2326 O OD1 . ASN A 1 315 ? 56.265 10.803  25.372  1.00 71.51  ? 380  ASN A OD1 1 
ATOM   2327 N ND2 . ASN A 1 315 ? 55.834 10.905  27.627  1.00 78.28  ? 380  ASN A ND2 1 
ATOM   2328 N N   . ILE A 1 316 ? 51.219 10.981  24.374  1.00 40.54  ? 381  ILE A N   1 
ATOM   2329 C CA  . ILE A 1 316 ? 50.486 10.712  23.155  1.00 41.49  ? 381  ILE A CA  1 
ATOM   2330 C C   . ILE A 1 316 ? 51.045 11.487  21.929  1.00 44.92  ? 381  ILE A C   1 
ATOM   2331 O O   . ILE A 1 316 ? 51.048 10.943  20.806  1.00 42.98  ? 381  ILE A O   1 
ATOM   2332 C CB  . ILE A 1 316 ? 48.981 11.084  23.342  1.00 45.51  ? 381  ILE A CB  1 
ATOM   2333 C CG1 . ILE A 1 316 ? 48.269 10.124  24.307  1.00 43.37  ? 381  ILE A CG1 1 
ATOM   2334 C CG2 . ILE A 1 316 ? 48.248 11.254  22.010  1.00 41.94  ? 381  ILE A CG2 1 
ATOM   2335 C CD1 . ILE A 1 316 ? 47.889 8.795   23.741  1.00 52.74  ? 381  ILE A CD1 1 
ATOM   2336 N N   . PHE A 1 317 ? 51.511 12.725  22.144  1.00 41.65  ? 382  PHE A N   1 
ATOM   2337 C CA  . PHE A 1 317 ? 51.772 13.647  21.052  1.00 42.33  ? 382  PHE A CA  1 
ATOM   2338 C C   . PHE A 1 317 ? 52.932 13.229  20.147  1.00 46.08  ? 382  PHE A C   1 
ATOM   2339 O O   . PHE A 1 317 ? 52.921 13.441  18.929  1.00 47.46  ? 382  PHE A O   1 
ATOM   2340 C CB  . PHE A 1 317 ? 51.916 15.093  21.535  1.00 39.11  ? 382  PHE A CB  1 
ATOM   2341 C CG  . PHE A 1 317 ? 50.585 15.769  21.836  1.00 42.95  ? 382  PHE A CG  1 
ATOM   2342 C CD1 . PHE A 1 317 ? 49.813 16.336  20.818  1.00 41.06  ? 382  PHE A CD1 1 
ATOM   2343 C CD2 . PHE A 1 317 ? 50.079 15.809  23.121  1.00 44.52  ? 382  PHE A CD2 1 
ATOM   2344 C CE1 . PHE A 1 317 ? 48.588 16.933  21.080  1.00 38.74  ? 382  PHE A CE1 1 
ATOM   2345 C CE2 . PHE A 1 317 ? 48.836 16.413  23.387  1.00 45.90  ? 382  PHE A CE2 1 
ATOM   2346 C CZ  . PHE A 1 317 ? 48.101 16.970  22.374  1.00 42.56  ? 382  PHE A CZ  1 
ATOM   2347 N N   . PRO A 1 318 ? 53.938 12.625  20.718  1.00 42.05  ? 383  PRO A N   1 
ATOM   2348 C CA  . PRO A 1 318 ? 54.902 12.223  19.683  1.00 43.65  ? 383  PRO A CA  1 
ATOM   2349 C C   . PRO A 1 318 ? 54.330 11.180  18.742  1.00 41.21  ? 383  PRO A C   1 
ATOM   2350 O O   . PRO A 1 318 ? 54.698 11.188  17.602  1.00 48.84  ? 383  PRO A O   1 
ATOM   2351 C CB  . PRO A 1 318 ? 56.093 11.664  20.502  1.00 42.00  ? 383  PRO A CB  1 
ATOM   2352 C CG  . PRO A 1 318 ? 56.043 12.522  21.750  1.00 45.47  ? 383  PRO A CG  1 
ATOM   2353 C CD  . PRO A 1 318 ? 54.547 12.710  22.053  1.00 42.11  ? 383  PRO A CD  1 
ATOM   2354 N N   . ALA A 1 319 ? 53.418 10.323  19.189  1.00 40.59  ? 384  ALA A N   1 
ATOM   2355 C CA  . ALA A 1 319 ? 52.793 9.317   18.304  1.00 40.76  ? 384  ALA A CA  1 
ATOM   2356 C C   . ALA A 1 319 ? 51.847 9.918   17.257  1.00 44.50  ? 384  ALA A C   1 
ATOM   2357 O O   . ALA A 1 319 ? 51.796 9.467   16.115  1.00 49.56  ? 384  ALA A O   1 
ATOM   2358 C CB  . ALA A 1 319 ? 52.060 8.296   19.118  1.00 37.24  ? 384  ALA A CB  1 
ATOM   2359 N N   . LEU A 1 320 ? 51.082 10.920  17.664  1.00 42.77  ? 385  LEU A N   1 
ATOM   2360 C CA  . LEU A 1 320 ? 50.285 11.674  16.726  1.00 42.17  ? 385  LEU A CA  1 
ATOM   2361 C C   . LEU A 1 320 ? 51.167 12.298  15.641  1.00 45.02  ? 385  LEU A C   1 
ATOM   2362 O O   . LEU A 1 320 ? 50.845 12.206  14.466  1.00 42.97  ? 385  LEU A O   1 
ATOM   2363 C CB  . LEU A 1 320 ? 49.499 12.776  17.418  1.00 37.25  ? 385  LEU A CB  1 
ATOM   2364 C CG  . LEU A 1 320 ? 48.375 12.291  18.313  1.00 40.19  ? 385  LEU A CG  1 
ATOM   2365 C CD1 . LEU A 1 320 ? 47.617 13.444  18.964  1.00 38.31  ? 385  LEU A CD1 1 
ATOM   2366 C CD2 . LEU A 1 320 ? 47.444 11.400  17.514  1.00 38.02  ? 385  LEU A CD2 1 
ATOM   2367 N N   . ILE A 1 321 ? 52.272 12.927  16.018  1.00 40.42  ? 386  ILE A N   1 
ATOM   2368 C CA  . ILE A 1 321 ? 53.132 13.547  15.028  1.00 43.33  ? 386  ILE A CA  1 
ATOM   2369 C C   . ILE A 1 321 ? 53.684 12.461  14.092  1.00 44.67  ? 386  ILE A C   1 
ATOM   2370 O O   . ILE A 1 321 ? 53.660 12.602  12.889  1.00 39.03  ? 386  ILE A O   1 
ATOM   2371 C CB  . ILE A 1 321 ? 54.246 14.349  15.725  1.00 55.58  ? 386  ILE A CB  1 
ATOM   2372 C CG1 . ILE A 1 321 ? 53.680 15.661  16.268  1.00 53.70  ? 386  ILE A CG1 1 
ATOM   2373 C CG2 . ILE A 1 321 ? 55.385 14.691  14.777  1.00 63.16  ? 386  ILE A CG2 1 
ATOM   2374 C CD1 . ILE A 1 321 ? 54.451 16.147  17.467  1.00 53.68  ? 386  ILE A CD1 1 
ATOM   2375 N N   . SER A 1 322 ? 54.106 11.335  14.648  1.00 42.16  ? 387  SER A N   1 
ATOM   2376 C CA  . SER A 1 322 ? 54.683 10.312  13.851  1.00 39.79  ? 387  SER A CA  1 
ATOM   2377 C C   . SER A 1 322 ? 53.602 9.775   12.905  1.00 46.16  ? 387  SER A C   1 
ATOM   2378 O O   . SER A 1 322 ? 53.888 9.439   11.732  1.00 46.78  ? 387  SER A O   1 
ATOM   2379 C CB  . SER A 1 322 ? 55.287 9.228   14.756  1.00 46.33  ? 387  SER A CB  1 
ATOM   2380 O OG  . SER A 1 322 ? 55.107 7.943   14.196  1.00 54.19  ? 387  SER A OG  1 
ATOM   2381 N N   . ILE A 1 323 ? 52.361 9.712   13.390  1.00 43.38  ? 388  ILE A N   1 
ATOM   2382 C CA  . ILE A 1 323 ? 51.225 9.349   12.530  1.00 41.01  ? 388  ILE A CA  1 
ATOM   2383 C C   . ILE A 1 323 ? 51.009 10.348  11.375  1.00 50.67  ? 388  ILE A C   1 
ATOM   2384 O O   . ILE A 1 323 ? 50.730 9.937   10.224  1.00 50.84  ? 388  ILE A O   1 
ATOM   2385 C CB  . ILE A 1 323 ? 49.954 9.203   13.376  1.00 46.28  ? 388  ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 323 ? 50.148 8.000   14.303  1.00 47.20  ? 388  ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 323 ? 48.660 9.169   12.528  1.00 39.87  ? 388  ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 323 ? 48.894 7.262   14.637  1.00 52.00  ? 388  ILE A CD1 1 
ATOM   2389 N N   . LEU A 1 324 ? 51.178 11.649  11.650  1.00 47.47  ? 389  LEU A N   1 
ATOM   2390 C CA  . LEU A 1 324 ? 50.964 12.659  10.638  1.00 45.93  ? 389  LEU A CA  1 
ATOM   2391 C C   . LEU A 1 324 ? 51.978 12.531  9.522   1.00 54.99  ? 389  LEU A C   1 
ATOM   2392 O O   . LEU A 1 324 ? 51.682 12.805  8.367   1.00 54.33  ? 389  LEU A O   1 
ATOM   2393 C CB  . LEU A 1 324 ? 51.084 14.059  11.222  1.00 48.46  ? 389  LEU A CB  1 
ATOM   2394 C CG  . LEU A 1 324 ? 49.805 14.777  11.583  1.00 47.76  ? 389  LEU A CG  1 
ATOM   2395 C CD1 . LEU A 1 324 ? 49.991 16.276  11.521  1.00 45.20  ? 389  LEU A CD1 1 
ATOM   2396 C CD2 . LEU A 1 324 ? 48.708 14.390  10.612  1.00 47.86  ? 389  LEU A CD2 1 
ATOM   2397 N N   . GLN A 1 325 ? 53.176 12.117  9.895   1.00 55.72  ? 390  GLN A N   1 
ATOM   2398 C CA  . GLN A 1 325 ? 54.231 11.865  8.963   1.00 57.23  ? 390  GLN A CA  1 
ATOM   2399 C C   . GLN A 1 325 ? 54.123 10.525  8.233   1.00 62.22  ? 390  GLN A C   1 
ATOM   2400 O O   . GLN A 1 325 ? 54.656 10.412  7.147   1.00 72.60  ? 390  GLN A O   1 
ATOM   2401 C CB  . GLN A 1 325 ? 55.588 11.936  9.671   1.00 59.45  ? 390  GLN A CB  1 
ATOM   2402 C CG  . GLN A 1 325 ? 56.110 13.363  9.811   1.00 63.86  ? 390  GLN A CG  1 
ATOM   2403 C CD  . GLN A 1 325 ? 57.011 13.533  11.032  1.00 69.70  ? 390  GLN A CD  1 
ATOM   2404 O OE1 . GLN A 1 325 ? 57.175 12.612  11.849  1.00 62.18  ? 390  GLN A OE1 1 
ATOM   2405 N NE2 . GLN A 1 325 ? 57.615 14.720  11.154  1.00 73.27  ? 390  GLN A NE2 1 
ATOM   2406 N N   . THR A 1 326 ? 53.464 9.506   8.763   1.00 48.92  ? 391  THR A N   1 
ATOM   2407 C CA  . THR A 1 326 ? 53.745 8.202   8.174   1.00 47.60  ? 391  THR A CA  1 
ATOM   2408 C C   . THR A 1 326 ? 52.540 7.389   7.673   1.00 55.62  ? 391  THR A C   1 
ATOM   2409 O O   . THR A 1 326 ? 52.706 6.274   7.168   1.00 65.11  ? 391  THR A O   1 
ATOM   2410 C CB  . THR A 1 326 ? 54.473 7.311   9.192   1.00 52.43  ? 391  THR A CB  1 
ATOM   2411 O OG1 . THR A 1 326 ? 53.561 6.969   10.263  1.00 55.13  ? 391  THR A OG1 1 
ATOM   2412 C CG2 . THR A 1 326 ? 55.725 8.008   9.725   1.00 48.44  ? 391  THR A CG2 1 
ATOM   2413 N N   . ALA A 1 327 ? 51.322 7.894   7.845   1.00 53.25  ? 392  ALA A N   1 
ATOM   2414 C CA  . ALA A 1 327 ? 50.157 7.001   7.789   1.00 51.48  ? 392  ALA A CA  1 
ATOM   2415 C C   . ALA A 1 327 ? 49.238 7.375   6.641   1.00 48.79  ? 392  ALA A C   1 
ATOM   2416 O O   . ALA A 1 327 ? 49.517 8.324   5.923   1.00 48.07  ? 392  ALA A O   1 
ATOM   2417 C CB  . ALA A 1 327 ? 49.398 7.006   9.127   1.00 45.95  ? 392  ALA A CB  1 
ATOM   2418 N N   . GLU A 1 328 ? 48.166 6.604   6.474   1.00 45.98  ? 393  GLU A N   1 
ATOM   2419 C CA  . GLU A 1 328 ? 47.175 6.840   5.459   1.00 48.12  ? 393  GLU A CA  1 
ATOM   2420 C C   . GLU A 1 328 ? 46.494 8.139   5.732   1.00 56.07  ? 393  GLU A C   1 
ATOM   2421 O O   . GLU A 1 328 ? 46.464 8.619   6.898   1.00 57.96  ? 393  GLU A O   1 
ATOM   2422 C CB  . GLU A 1 328 ? 46.143 5.713   5.458   1.00 53.11  ? 393  GLU A CB  1 
ATOM   2423 C CG  . GLU A 1 328 ? 46.754 4.388   5.019   1.00 62.05  ? 393  GLU A CG  1 
ATOM   2424 C CD  . GLU A 1 328 ? 45.749 3.282   4.753   1.00 68.17  ? 393  GLU A CD  1 
ATOM   2425 O OE1 . GLU A 1 328 ? 44.494 3.521   4.800   1.00 64.11  ? 393  GLU A OE1 1 
ATOM   2426 O OE2 . GLU A 1 328 ? 46.255 2.157   4.496   1.00 71.09  ? 393  GLU A OE2 1 
ATOM   2427 N N   . PHE A 1 329 ? 45.935 8.701   4.662   1.00 57.22  ? 394  PHE A N   1 
ATOM   2428 C CA  . PHE A 1 329 ? 45.356 10.021  4.725   1.00 54.94  ? 394  PHE A CA  1 
ATOM   2429 C C   . PHE A 1 329 ? 44.140 9.994   5.673   1.00 51.47  ? 394  PHE A C   1 
ATOM   2430 O O   . PHE A 1 329 ? 43.963 10.920  6.477   1.00 53.69  ? 394  PHE A O   1 
ATOM   2431 C CB  . PHE A 1 329 ? 45.067 10.648  3.311   1.00 52.44  ? 394  PHE A CB  1 
ATOM   2432 C CG  . PHE A 1 329 ? 44.611 12.075  3.409   1.00 57.54  ? 394  PHE A CG  1 
ATOM   2433 C CD1 . PHE A 1 329 ? 45.514 13.084  3.778   1.00 55.37  ? 394  PHE A CD1 1 
ATOM   2434 C CD2 . PHE A 1 329 ? 43.241 12.406  3.311   1.00 60.83  ? 394  PHE A CD2 1 
ATOM   2435 C CE1 . PHE A 1 329 ? 45.078 14.418  3.982   1.00 65.05  ? 394  PHE A CE1 1 
ATOM   2436 C CE2 . PHE A 1 329 ? 42.805 13.733  3.509   1.00 66.42  ? 394  PHE A CE2 1 
ATOM   2437 C CZ  . PHE A 1 329 ? 43.726 14.751  3.841   1.00 65.64  ? 394  PHE A CZ  1 
ATOM   2438 N N   . ARG A 1 330 ? 43.335 8.923   5.613   1.00 55.07  ? 395  ARG A N   1 
ATOM   2439 C CA  . ARG A 1 330 ? 42.218 8.742   6.588   1.00 60.35  ? 395  ARG A CA  1 
ATOM   2440 C C   . ARG A 1 330 ? 42.756 8.913   8.020   1.00 54.03  ? 395  ARG A C   1 
ATOM   2441 O O   . ARG A 1 330 ? 42.313 9.800   8.721   1.00 52.54  ? 395  ARG A O   1 
ATOM   2442 C CB  . ARG A 1 330 ? 41.481 7.396   6.452   1.00 64.66  ? 395  ARG A CB  1 
ATOM   2443 C CG  . ARG A 1 330 ? 40.112 7.435   5.756   1.00 74.66  ? 395  ARG A CG  1 
ATOM   2444 C CD  . ARG A 1 330 ? 40.034 6.350   4.674   1.00 78.91  ? 395  ARG A CD  1 
ATOM   2445 N NE  . ARG A 1 330 ? 39.158 5.189   4.925   1.00 87.15  ? 395  ARG A NE  1 
ATOM   2446 C CZ  . ARG A 1 330 ? 39.499 3.909   4.680   1.00 95.84  ? 395  ARG A CZ  1 
ATOM   2447 N NH1 . ARG A 1 330 ? 40.719 3.606   4.231   1.00 94.15  ? 395  ARG A NH1 1 
ATOM   2448 N NH2 . ARG A 1 330 ? 38.630 2.913   4.900   1.00 84.12  ? 395  ARG A NH2 1 
ATOM   2449 N N   . THR A 1 331 ? 43.740 8.101   8.403   1.00 44.02  ? 396  THR A N   1 
ATOM   2450 C CA  . THR A 1 331 ? 44.387 8.198   9.691   1.00 43.62  ? 396  THR A CA  1 
ATOM   2451 C C   . THR A 1 331 ? 44.951 9.588   10.000  1.00 46.38  ? 396  THR A C   1 
ATOM   2452 O O   . THR A 1 331 ? 44.633 10.166  11.033  1.00 46.01  ? 396  THR A O   1 
ATOM   2453 C CB  . THR A 1 331 ? 45.411 7.112   9.809   1.00 43.53  ? 396  THR A CB  1 
ATOM   2454 O OG1 . THR A 1 331 ? 44.806 5.893   9.383   1.00 43.63  ? 396  THR A OG1 1 
ATOM   2455 C CG2 . THR A 1 331 ? 45.853 6.971   11.214  1.00 44.38  ? 396  THR A CG2 1 
ATOM   2456 N N   . ARG A 1 332 ? 45.660 10.189  9.059   1.00 51.31  ? 397  ARG A N   1 
ATOM   2457 C CA  . ARG A 1 332 ? 46.343 11.461  9.323   1.00 45.51  ? 397  ARG A CA  1 
ATOM   2458 C C   . ARG A 1 332 ? 45.338 12.551  9.524   1.00 47.98  ? 397  ARG A C   1 
ATOM   2459 O O   . ARG A 1 332 ? 45.613 13.521  10.194  1.00 56.78  ? 397  ARG A O   1 
ATOM   2460 C CB  . ARG A 1 332 ? 47.259 11.847  8.161   1.00 44.77  ? 397  ARG A CB  1 
ATOM   2461 C CG  . ARG A 1 332 ? 48.448 10.917  7.948   1.00 58.58  ? 397  ARG A CG  1 
ATOM   2462 C CD  . ARG A 1 332 ? 49.218 11.102  6.618   1.00 54.85  ? 397  ARG A CD  1 
ATOM   2463 N NE  . ARG A 1 332 ? 49.675 12.479  6.431   1.00 65.12  ? 397  ARG A NE  1 
ATOM   2464 C CZ  . ARG A 1 332 ? 49.730 13.069  5.246   1.00 63.69  ? 397  ARG A CZ  1 
ATOM   2465 N NH1 . ARG A 1 332 ? 49.345 12.372  4.182   1.00 68.32  ? 397  ARG A NH1 1 
ATOM   2466 N NH2 . ARG A 1 332 ? 50.170 14.319  5.130   1.00 52.19  ? 397  ARG A NH2 1 
ATOM   2467 N N   . LYS A 1 333 ? 44.188 12.449  8.886   1.00 53.49  ? 398  LYS A N   1 
ATOM   2468 C CA  . LYS A 1 333 ? 43.149 13.480  9.062   1.00 51.13  ? 398  LYS A CA  1 
ATOM   2469 C C   . LYS A 1 333 ? 42.889 13.594  10.570  1.00 48.21  ? 398  LYS A C   1 
ATOM   2470 O O   . LYS A 1 333 ? 42.922 14.703  11.147  1.00 42.63  ? 398  LYS A O   1 
ATOM   2471 C CB  . LYS A 1 333 ? 41.852 13.027  8.401   1.00 51.21  ? 398  LYS A CB  1 
ATOM   2472 C CG  . LYS A 1 333 ? 41.278 13.970  7.361   1.00 70.16  ? 398  LYS A CG  1 
ATOM   2473 C CD  . LYS A 1 333 ? 40.544 13.216  6.235   1.00 84.94  ? 398  LYS A CD  1 
ATOM   2474 C CE  . LYS A 1 333 ? 39.165 12.668  6.626   1.00 93.39  ? 398  LYS A CE  1 
ATOM   2475 N NZ  . LYS A 1 333 ? 38.048 13.621  6.355   1.00 85.74  ? 398  LYS A NZ  1 
ATOM   2476 N N   . GLU A 1 334 ? 42.694 12.429  11.205  1.00 42.99  ? 399  GLU A N   1 
ATOM   2477 C CA  . GLU A 1 334 ? 42.282 12.379  12.599  1.00 45.73  ? 399  GLU A CA  1 
ATOM   2478 C C   . GLU A 1 334 ? 43.411 12.891  13.521  1.00 48.47  ? 399  GLU A C   1 
ATOM   2479 O O   . GLU A 1 334 ? 43.153 13.757  14.377  1.00 39.57  ? 399  GLU A O   1 
ATOM   2480 C CB  . GLU A 1 334 ? 41.812 10.990  12.980  1.00 44.55  ? 399  GLU A CB  1 
ATOM   2481 C CG  . GLU A 1 334 ? 40.574 10.489  12.221  1.00 41.82  ? 399  GLU A CG  1 
ATOM   2482 C CD  . GLU A 1 334 ? 39.405 11.486  12.229  1.00 49.07  ? 399  GLU A CD  1 
ATOM   2483 O OE1 . GLU A 1 334 ? 39.326 12.331  13.163  1.00 59.74  ? 399  GLU A OE1 1 
ATOM   2484 O OE2 . GLU A 1 334 ? 38.546 11.429  11.298  1.00 52.93  ? 399  GLU A OE2 1 
ATOM   2485 N N   . ALA A 1 335 ? 44.651 12.427  13.303  1.00 38.80  ? 400  ALA A N   1 
ATOM   2486 C CA  . ALA A 1 335 ? 45.778 13.001  14.031  1.00 44.58  ? 400  ALA A CA  1 
ATOM   2487 C C   . ALA A 1 335 ? 45.832 14.493  13.903  1.00 40.71  ? 400  ALA A C   1 
ATOM   2488 O O   . ALA A 1 335 ? 46.093 15.211  14.870  1.00 44.49  ? 400  ALA A O   1 
ATOM   2489 C CB  . ALA A 1 335 ? 47.106 12.368  13.652  1.00 44.76  ? 400  ALA A CB  1 
ATOM   2490 N N   . ALA A 1 336 ? 45.520 14.980  12.727  1.00 44.45  ? 401  ALA A N   1 
ATOM   2491 C CA  . ALA A 1 336 ? 45.639 16.428  12.475  1.00 46.22  ? 401  ALA A CA  1 
ATOM   2492 C C   . ALA A 1 336 ? 44.652 17.217  13.304  1.00 45.03  ? 401  ALA A C   1 
ATOM   2493 O O   . ALA A 1 336 ? 44.945 18.327  13.742  1.00 45.84  ? 401  ALA A O   1 
ATOM   2494 C CB  . ALA A 1 336 ? 45.431 16.718  11.004  1.00 45.41  ? 401  ALA A CB  1 
ATOM   2495 N N   . TRP A 1 337 ? 43.457 16.647  13.491  1.00 47.18  ? 402  TRP A N   1 
ATOM   2496 C CA  . TRP A 1 337 ? 42.391 17.269  14.293  1.00 43.50  ? 402  TRP A CA  1 
ATOM   2497 C C   . TRP A 1 337 ? 42.798 17.175  15.757  1.00 52.62  ? 402  TRP A C   1 
ATOM   2498 O O   . TRP A 1 337 ? 42.685 18.136  16.557  1.00 48.01  ? 402  TRP A O   1 
ATOM   2499 C CB  . TRP A 1 337 ? 41.094 16.508  14.081  1.00 42.38  ? 402  TRP A CB  1 
ATOM   2500 C CG  . TRP A 1 337 ? 40.188 17.027  12.978  1.00 55.27  ? 402  TRP A CG  1 
ATOM   2501 C CD1 . TRP A 1 337 ? 39.945 16.458  11.710  1.00 46.86  ? 402  TRP A CD1 1 
ATOM   2502 C CD2 . TRP A 1 337 ? 39.318 18.213  13.026  1.00 55.55  ? 402  TRP A CD2 1 
ATOM   2503 N NE1 . TRP A 1 337 ? 39.026 17.189  11.028  1.00 50.64  ? 402  TRP A NE1 1 
ATOM   2504 C CE2 . TRP A 1 337 ? 38.603 18.245  11.740  1.00 55.81  ? 402  TRP A CE2 1 
ATOM   2505 C CE3 . TRP A 1 337 ? 39.051 19.219  13.983  1.00 59.85  ? 402  TRP A CE3 1 
ATOM   2506 C CZ2 . TRP A 1 337 ? 37.668 19.254  11.436  1.00 61.88  ? 402  TRP A CZ2 1 
ATOM   2507 C CZ3 . TRP A 1 337 ? 38.123 20.260  13.653  1.00 60.17  ? 402  TRP A CZ3 1 
ATOM   2508 C CH2 . TRP A 1 337 ? 37.448 20.271  12.414  1.00 56.66  ? 402  TRP A CH2 1 
ATOM   2509 N N   . ALA A 1 338 ? 43.307 16.007  16.128  1.00 44.40  ? 403  ALA A N   1 
ATOM   2510 C CA  . ALA A 1 338 ? 43.769 15.876  17.453  1.00 44.48  ? 403  ALA A CA  1 
ATOM   2511 C C   . ALA A 1 338 ? 44.756 16.968  17.795  1.00 41.89  ? 403  ALA A C   1 
ATOM   2512 O O   . ALA A 1 338 ? 44.599 17.567  18.839  1.00 43.60  ? 403  ALA A O   1 
ATOM   2513 C CB  . ALA A 1 338 ? 44.339 14.497  17.700  1.00 43.89  ? 403  ALA A CB  1 
ATOM   2514 N N   . ILE A 1 339 ? 45.742 17.251  16.940  1.00 39.61  ? 404  ILE A N   1 
ATOM   2515 C CA  . ILE A 1 339 ? 46.736 18.262  17.269  1.00 38.63  ? 404  ILE A CA  1 
ATOM   2516 C C   . ILE A 1 339 ? 46.188 19.682  17.231  1.00 42.88  ? 404  ILE A C   1 
ATOM   2517 O O   . ILE A 1 339 ? 46.568 20.495  18.063  1.00 45.50  ? 404  ILE A O   1 
ATOM   2518 C CB  . ILE A 1 339 ? 47.956 18.202  16.347  1.00 45.77  ? 404  ILE A CB  1 
ATOM   2519 C CG1 . ILE A 1 339 ? 48.812 17.013  16.713  1.00 46.16  ? 404  ILE A CG1 1 
ATOM   2520 C CG2 . ILE A 1 339 ? 48.803 19.461  16.465  1.00 40.51  ? 404  ILE A CG2 1 
ATOM   2521 C CD1 . ILE A 1 339 ? 49.405 16.337  15.503  1.00 48.32  ? 404  ILE A CD1 1 
ATOM   2522 N N   . THR A 1 340 ? 45.330 20.013  16.273  1.00 41.05  ? 405  THR A N   1 
ATOM   2523 C CA  . THR A 1 340 ? 44.895 21.404  16.157  1.00 49.87  ? 405  THR A CA  1 
ATOM   2524 C C   . THR A 1 340 ? 43.942 21.749  17.324  1.00 49.41  ? 405  THR A C   1 
ATOM   2525 O O   . THR A 1 340 ? 44.056 22.826  17.911  1.00 52.08  ? 405  THR A O   1 
ATOM   2526 C CB  . THR A 1 340 ? 44.253 21.722  14.772  1.00 55.45  ? 405  THR A CB  1 
ATOM   2527 O OG1 . THR A 1 340 ? 43.791 20.501  14.188  1.00 72.28  ? 405  THR A OG1 1 
ATOM   2528 C CG2 . THR A 1 340 ? 45.275 22.220  13.821  1.00 50.16  ? 405  THR A CG2 1 
ATOM   2529 N N   . ASN A 1 341 ? 43.018 20.839  17.654  1.00 39.19  ? 406  ASN A N   1 
ATOM   2530 C CA  . ASN A 1 341 ? 42.149 20.997  18.837  1.00 43.45  ? 406  ASN A CA  1 
ATOM   2531 C C   . ASN A 1 341 ? 43.018 21.357  20.085  1.00 48.70  ? 406  ASN A C   1 
ATOM   2532 O O   . ASN A 1 341 ? 42.692 22.303  20.826  1.00 44.21  ? 406  ASN A O   1 
ATOM   2533 C CB  . ASN A 1 341 ? 41.316 19.717  19.115  1.00 40.79  ? 406  ASN A CB  1 
ATOM   2534 C CG  . ASN A 1 341 ? 40.169 19.499  18.108  1.00 44.29  ? 406  ASN A CG  1 
ATOM   2535 O OD1 . ASN A 1 341 ? 39.739 20.406  17.408  1.00 42.81  ? 406  ASN A OD1 1 
ATOM   2536 N ND2 . ASN A 1 341 ? 39.648 18.280  18.076  1.00 44.96  ? 406  ASN A ND2 1 
ATOM   2537 N N   . ALA A 1 342 ? 44.139 20.641  20.290  1.00 45.04  ? 407  ALA A N   1 
ATOM   2538 C CA  . ALA A 1 342 ? 45.025 21.000  21.401  1.00 47.34  ? 407  ALA A CA  1 
ATOM   2539 C C   . ALA A 1 342 ? 45.540 22.429  21.290  1.00 47.54  ? 407  ALA A C   1 
ATOM   2540 O O   . ALA A 1 342 ? 45.596 23.126  22.296  1.00 49.56  ? 407  ALA A O   1 
ATOM   2541 C CB  . ALA A 1 342 ? 46.167 20.016  21.583  1.00 40.74  ? 407  ALA A CB  1 
ATOM   2542 N N   . THR A 1 343 ? 45.843 22.900  20.085  1.00 47.24  ? 408  THR A N   1 
ATOM   2543 C CA  . THR A 1 343 ? 46.373 24.277  19.942  1.00 51.46  ? 408  THR A CA  1 
ATOM   2544 C C   . THR A 1 343 ? 45.305 25.319  20.157  1.00 49.25  ? 408  THR A C   1 
ATOM   2545 O O   . THR A 1 343 ? 45.571 26.454  20.504  1.00 56.13  ? 408  THR A O   1 
ATOM   2546 C CB  . THR A 1 343 ? 46.934 24.527  18.549  1.00 48.97  ? 408  THR A CB  1 
ATOM   2547 O OG1 . THR A 1 343 ? 45.852 24.735  17.655  1.00 57.92  ? 408  THR A OG1 1 
ATOM   2548 C CG2 . THR A 1 343 ? 47.687 23.350  18.097  1.00 50.84  ? 408  THR A CG2 1 
ATOM   2549 N N   . SER A 1 344 ? 44.079 24.899  19.930  1.00 57.29  ? 409  SER A N   1 
ATOM   2550 C CA  . SER A 1 344 ? 42.927 25.726  20.135  1.00 55.41  ? 409  SER A CA  1 
ATOM   2551 C C   . SER A 1 344 ? 42.547 25.878  21.648  1.00 54.75  ? 409  SER A C   1 
ATOM   2552 O O   . SER A 1 344 ? 42.256 26.989  22.120  1.00 51.98  ? 409  SER A O   1 
ATOM   2553 C CB  . SER A 1 344 ? 41.798 25.171  19.305  1.00 47.64  ? 409  SER A CB  1 
ATOM   2554 O OG  . SER A 1 344 ? 40.644 25.743  19.807  1.00 63.14  ? 409  SER A OG  1 
ATOM   2555 N N   . GLY A 1 345 ? 42.608 24.795  22.420  1.00 51.86  ? 410  GLY A N   1 
ATOM   2556 C CA  . GLY A 1 345 ? 42.238 24.877  23.833  1.00 49.63  ? 410  GLY A CA  1 
ATOM   2557 C C   . GLY A 1 345 ? 43.400 24.917  24.820  1.00 59.01  ? 410  GLY A C   1 
ATOM   2558 O O   . GLY A 1 345 ? 43.183 24.819  26.018  1.00 57.97  ? 410  GLY A O   1 
ATOM   2559 N N   . GLY A 1 346 ? 44.630 25.092  24.336  1.00 60.47  ? 411  GLY A N   1 
ATOM   2560 C CA  . GLY A 1 346 ? 45.796 24.997  25.208  1.00 58.21  ? 411  GLY A CA  1 
ATOM   2561 C C   . GLY A 1 346 ? 46.295 26.270  25.869  1.00 62.80  ? 411  GLY A C   1 
ATOM   2562 O O   . GLY A 1 346 ? 46.024 27.370  25.411  1.00 59.12  ? 411  GLY A O   1 
ATOM   2563 N N   . SER A 1 347 ? 47.035 26.094  26.963  1.00 62.25  ? 412  SER A N   1 
ATOM   2564 C CA  . SER A 1 347 ? 47.810 27.168  27.583  1.00 56.55  ? 412  SER A CA  1 
ATOM   2565 C C   . SER A 1 347 ? 49.049 27.443  26.746  1.00 60.25  ? 412  SER A C   1 
ATOM   2566 O O   . SER A 1 347 ? 49.513 26.598  25.998  1.00 63.73  ? 412  SER A O   1 
ATOM   2567 C CB  . SER A 1 347 ? 48.237 26.788  29.034  1.00 57.98  ? 412  SER A CB  1 
ATOM   2568 O OG  . SER A 1 347 ? 49.319 25.831  29.129  1.00 55.67  ? 412  SER A OG  1 
ATOM   2569 N N   . ALA A 1 348 ? 49.631 28.609  26.907  1.00 61.68  ? 413  ALA A N   1 
ATOM   2570 C CA  . ALA A 1 348 ? 50.878 28.877  26.245  1.00 61.09  ? 413  ALA A CA  1 
ATOM   2571 C C   . ALA A 1 348 ? 51.955 27.770  26.456  1.00 59.48  ? 413  ALA A C   1 
ATOM   2572 O O   . ALA A 1 348 ? 52.613 27.357  25.506  1.00 56.96  ? 413  ALA A O   1 
ATOM   2573 C CB  . ALA A 1 348 ? 51.395 30.235  26.688  1.00 59.85  ? 413  ALA A CB  1 
ATOM   2574 N N   . GLU A 1 349 ? 52.136 27.307  27.692  1.00 58.86  ? 414  GLU A N   1 
ATOM   2575 C CA  . GLU A 1 349 ? 53.187 26.325  27.990  1.00 62.59  ? 414  GLU A CA  1 
ATOM   2576 C C   . GLU A 1 349 ? 52.940 25.083  27.142  1.00 59.31  ? 414  GLU A C   1 
ATOM   2577 O O   . GLU A 1 349 ? 53.885 24.423  26.702  1.00 53.82  ? 414  GLU A O   1 
ATOM   2578 C CB  . GLU A 1 349 ? 53.208 25.897  29.482  1.00 63.59  ? 414  GLU A CB  1 
ATOM   2579 C CG  . GLU A 1 349 ? 53.931 26.784  30.481  1.00 66.21  ? 414  GLU A CG  1 
ATOM   2580 C CD  . GLU A 1 349 ? 53.193 28.101  30.765  1.00 81.02  ? 414  GLU A CD  1 
ATOM   2581 O OE1 . GLU A 1 349 ? 51.924 28.146  30.782  1.00 78.41  ? 414  GLU A OE1 1 
ATOM   2582 O OE2 . GLU A 1 349 ? 53.896 29.114  30.981  1.00 86.82  ? 414  GLU A OE2 1 
ATOM   2583 N N   . GLN A 1 350 ? 51.650 24.793  26.932  1.00 60.83  ? 415  GLN A N   1 
ATOM   2584 C CA  . GLN A 1 350 ? 51.175 23.611  26.211  1.00 59.16  ? 415  GLN A CA  1 
ATOM   2585 C C   . GLN A 1 350 ? 51.460 23.664  24.716  1.00 58.29  ? 415  GLN A C   1 
ATOM   2586 O O   . GLN A 1 350 ? 51.834 22.666  24.112  1.00 61.37  ? 415  GLN A O   1 
ATOM   2587 C CB  . GLN A 1 350 ? 49.690 23.365  26.509  1.00 55.39  ? 415  GLN A CB  1 
ATOM   2588 C CG  . GLN A 1 350 ? 49.516 22.570  27.800  1.00 53.92  ? 415  GLN A CG  1 
ATOM   2589 C CD  . GLN A 1 350 ? 48.103 22.517  28.289  1.00 51.54  ? 415  GLN A CD  1 
ATOM   2590 O OE1 . GLN A 1 350 ? 47.226 23.238  27.767  1.00 52.87  ? 415  GLN A OE1 1 
ATOM   2591 N NE2 . GLN A 1 350 ? 47.862 21.698  29.340  1.00 41.54  ? 415  GLN A NE2 1 
ATOM   2592 N N   . ILE A 1 351 ? 51.318 24.837  24.129  1.00 56.27  ? 416  ILE A N   1 
ATOM   2593 C CA  . ILE A 1 351 ? 51.564 24.975  22.716  1.00 59.30  ? 416  ILE A CA  1 
ATOM   2594 C C   . ILE A 1 351 ? 53.061 25.022  22.444  1.00 59.53  ? 416  ILE A C   1 
ATOM   2595 O O   . ILE A 1 351 ? 53.536 24.400  21.491  1.00 54.27  ? 416  ILE A O   1 
ATOM   2596 C CB  . ILE A 1 351 ? 50.798 26.164  22.146  1.00 60.41  ? 416  ILE A CB  1 
ATOM   2597 C CG1 . ILE A 1 351 ? 49.289 25.852  22.165  1.00 52.22  ? 416  ILE A CG1 1 
ATOM   2598 C CG2 . ILE A 1 351 ? 51.284 26.507  20.750  1.00 61.89  ? 416  ILE A CG2 1 
ATOM   2599 C CD1 . ILE A 1 351 ? 48.452 27.120  22.269  1.00 61.29  ? 416  ILE A CD1 1 
ATOM   2600 N N   . LYS A 1 352 ? 53.789 25.713  23.323  1.00 61.98  ? 417  LYS A N   1 
ATOM   2601 C CA  . LYS A 1 352 ? 55.262 25.668  23.357  1.00 62.40  ? 417  LYS A CA  1 
ATOM   2602 C C   . LYS A 1 352 ? 55.711 24.204  23.356  1.00 56.10  ? 417  LYS A C   1 
ATOM   2603 O O   . LYS A 1 352 ? 56.541 23.823  22.528  1.00 57.81  ? 417  LYS A O   1 
ATOM   2604 C CB  . LYS A 1 352 ? 55.831 26.400  24.594  1.00 65.18  ? 417  LYS A CB  1 
ATOM   2605 C CG  . LYS A 1 352 ? 57.096 27.244  24.384  1.00 80.98  ? 417  LYS A CG  1 
ATOM   2606 C CD  . LYS A 1 352 ? 57.267 28.356  25.454  1.00 89.00  ? 417  LYS A CD  1 
ATOM   2607 C CE  . LYS A 1 352 ? 56.107 29.380  25.519  1.00 93.10  ? 417  LYS A CE  1 
ATOM   2608 N NZ  . LYS A 1 352 ? 56.128 30.360  26.655  1.00 84.31  ? 417  LYS A NZ  1 
ATOM   2609 N N   . TYR A 1 353 ? 55.155 23.386  24.249  1.00 41.36  ? 418  TYR A N   1 
ATOM   2610 C CA  . TYR A 1 353 ? 55.457 21.958  24.190  1.00 50.19  ? 418  TYR A CA  1 
ATOM   2611 C C   . TYR A 1 353 ? 55.184 21.318  22.793  1.00 53.85  ? 418  TYR A C   1 
ATOM   2612 O O   . TYR A 1 353 ? 55.986 20.473  22.313  1.00 60.12  ? 418  TYR A O   1 
ATOM   2613 C CB  . TYR A 1 353 ? 54.709 21.162  25.274  1.00 45.57  ? 418  TYR A CB  1 
ATOM   2614 C CG  . TYR A 1 353 ? 54.899 19.672  25.117  1.00 51.14  ? 418  TYR A CG  1 
ATOM   2615 C CD1 . TYR A 1 353 ? 56.105 19.055  25.495  1.00 52.34  ? 418  TYR A CD1 1 
ATOM   2616 C CD2 . TYR A 1 353 ? 53.883 18.863  24.580  1.00 55.41  ? 418  TYR A CD2 1 
ATOM   2617 C CE1 . TYR A 1 353 ? 56.290 17.677  25.371  1.00 55.77  ? 418  TYR A CE1 1 
ATOM   2618 C CE2 . TYR A 1 353 ? 54.056 17.470  24.449  1.00 53.99  ? 418  TYR A CE2 1 
ATOM   2619 C CZ  . TYR A 1 353 ? 55.255 16.886  24.839  1.00 58.31  ? 418  TYR A CZ  1 
ATOM   2620 O OH  . TYR A 1 353 ? 55.436 15.530  24.704  1.00 57.30  ? 418  TYR A OH  1 
ATOM   2621 N N   . LEU A 1 354 ? 54.073 21.696  22.149  1.00 46.33  ? 419  LEU A N   1 
ATOM   2622 C CA  . LEU A 1 354 ? 53.775 21.118  20.841  1.00 47.56  ? 419  LEU A CA  1 
ATOM   2623 C C   . LEU A 1 354 ? 54.801 21.583  19.811  1.00 50.42  ? 419  LEU A C   1 
ATOM   2624 O O   . LEU A 1 354 ? 55.342 20.763  19.066  1.00 48.16  ? 419  LEU A O   1 
ATOM   2625 C CB  . LEU A 1 354 ? 52.327 21.373  20.391  1.00 46.14  ? 419  LEU A CB  1 
ATOM   2626 C CG  . LEU A 1 354 ? 51.155 20.832  21.254  1.00 46.55  ? 419  LEU A CG  1 
ATOM   2627 C CD1 . LEU A 1 354 ? 49.826 21.373  20.784  1.00 46.32  ? 419  LEU A CD1 1 
ATOM   2628 C CD2 . LEU A 1 354 ? 51.086 19.329  21.298  1.00 39.88  ? 419  LEU A CD2 1 
ATOM   2629 N N   . VAL A 1 355 ? 55.078 22.889  19.782  1.00 51.19  ? 420  VAL A N   1 
ATOM   2630 C CA  . VAL A 1 355 ? 56.127 23.400  18.918  1.00 51.05  ? 420  VAL A CA  1 
ATOM   2631 C C   . VAL A 1 355 ? 57.456 22.711  19.216  1.00 50.12  ? 420  VAL A C   1 
ATOM   2632 O O   . VAL A 1 355 ? 58.064 22.167  18.333  1.00 50.65  ? 420  VAL A O   1 
ATOM   2633 C CB  . VAL A 1 355 ? 56.307 24.900  19.040  1.00 55.92  ? 420  VAL A CB  1 
ATOM   2634 C CG1 . VAL A 1 355 ? 57.524 25.313  18.234  1.00 57.40  ? 420  VAL A CG1 1 
ATOM   2635 C CG2 . VAL A 1 355 ? 55.061 25.600  18.519  1.00 54.30  ? 420  VAL A CG2 1 
ATOM   2636 N N   . GLU A 1 356 ? 57.891 22.695  20.464  1.00 55.12  ? 421  GLU A N   1 
ATOM   2637 C CA  . GLU A 1 356 ? 59.145 22.026  20.770  1.00 58.84  ? 421  GLU A CA  1 
ATOM   2638 C C   . GLU A 1 356 ? 59.160 20.566  20.256  1.00 62.16  ? 421  GLU A C   1 
ATOM   2639 O O   . GLU A 1 356 ? 60.190 20.078  19.786  1.00 68.12  ? 421  GLU A O   1 
ATOM   2640 C CB  . GLU A 1 356 ? 59.515 22.154  22.261  1.00 66.73  ? 421  GLU A CB  1 
ATOM   2641 C CG  . GLU A 1 356 ? 60.548 23.263  22.511  1.00 83.99  ? 421  GLU A CG  1 
ATOM   2642 C CD  . GLU A 1 356 ? 60.146 24.275  23.585  1.00 87.11  ? 421  GLU A CD  1 
ATOM   2643 O OE1 . GLU A 1 356 ? 59.968 23.872  24.753  1.00 86.94  ? 421  GLU A OE1 1 
ATOM   2644 O OE2 . GLU A 1 356 ? 60.021 25.487  23.272  1.00 96.17  ? 421  GLU A OE2 1 
ATOM   2645 N N   . LEU A 1 357 ? 58.021 19.884  20.292  1.00 58.26  ? 422  LEU A N   1 
ATOM   2646 C CA  . LEU A 1 357 ? 57.940 18.548  19.704  1.00 54.17  ? 422  LEU A CA  1 
ATOM   2647 C C   . LEU A 1 357 ? 58.090 18.524  18.194  1.00 56.19  ? 422  LEU A C   1 
ATOM   2648 O O   . LEU A 1 357 ? 58.351 17.470  17.639  1.00 50.25  ? 422  LEU A O   1 
ATOM   2649 C CB  . LEU A 1 357 ? 56.594 17.934  19.982  1.00 54.30  ? 422  LEU A CB  1 
ATOM   2650 C CG  . LEU A 1 357 ? 56.518 17.217  21.278  1.00 58.50  ? 422  LEU A CG  1 
ATOM   2651 C CD1 . LEU A 1 357 ? 55.221 16.452  21.119  1.00 55.40  ? 422  LEU A CD1 1 
ATOM   2652 C CD2 . LEU A 1 357 ? 57.749 16.310  21.473  1.00 54.65  ? 422  LEU A CD2 1 
ATOM   2653 N N   . GLY A 1 358 ? 57.871 19.647  17.514  1.00 45.71  ? 423  GLY A N   1 
ATOM   2654 C CA  . GLY A 1 358 ? 58.004 19.648  16.061  1.00 49.61  ? 423  GLY A CA  1 
ATOM   2655 C C   . GLY A 1 358 ? 56.700 19.445  15.304  1.00 50.74  ? 423  GLY A C   1 
ATOM   2656 O O   . GLY A 1 358 ? 56.689 18.914  14.208  1.00 54.03  ? 423  GLY A O   1 
ATOM   2657 N N   . CYS A 1 359 ? 55.597 19.919  15.854  1.00 51.63  ? 424  CYS A N   1 
ATOM   2658 C CA  . CYS A 1 359 ? 54.303 19.812  15.176  1.00 57.00  ? 424  CYS A CA  1 
ATOM   2659 C C   . CYS A 1 359 ? 54.157 20.827  14.004  1.00 55.75  ? 424  CYS A C   1 
ATOM   2660 O O   . CYS A 1 359 ? 53.227 20.722  13.192  1.00 56.13  ? 424  CYS A O   1 
ATOM   2661 C CB  . CYS A 1 359 ? 53.147 19.967  16.190  1.00 53.92  ? 424  CYS A CB  1 
ATOM   2662 S SG  . CYS A 1 359 ? 52.957 21.721  16.641  1.00 68.12  ? 424  CYS A SG  1 
ATOM   2663 N N   . ILE A 1 360 ? 55.069 21.790  13.900  1.00 48.74  ? 425  ILE A N   1 
ATOM   2664 C CA  . ILE A 1 360 ? 54.897 22.845  12.900  1.00 52.19  ? 425  ILE A CA  1 
ATOM   2665 C C   . ILE A 1 360 ? 55.005 22.287  11.436  1.00 62.38  ? 425  ILE A C   1 
ATOM   2666 O O   . ILE A 1 360 ? 54.050 22.436  10.646  1.00 58.75  ? 425  ILE A O   1 
ATOM   2667 C CB  . ILE A 1 360 ? 55.883 24.012  13.115  1.00 47.19  ? 425  ILE A CB  1 
ATOM   2668 C CG1 . ILE A 1 360 ? 55.590 24.783  14.399  1.00 52.77  ? 425  ILE A CG1 1 
ATOM   2669 C CG2 . ILE A 1 360 ? 55.841 24.941  11.918  1.00 44.75  ? 425  ILE A CG2 1 
ATOM   2670 C CD1 . ILE A 1 360 ? 56.640 25.844  14.705  1.00 61.22  ? 425  ILE A CD1 1 
ATOM   2671 N N   . LYS A 1 361 ? 56.139 21.640  11.089  1.00 54.64  ? 426  LYS A N   1 
ATOM   2672 C CA  . LYS A 1 361 ? 56.293 21.017  9.768   1.00 64.98  ? 426  LYS A CA  1 
ATOM   2673 C C   . LYS A 1 361 ? 55.108 20.121  9.368   1.00 65.26  ? 426  LYS A C   1 
ATOM   2674 O O   . LYS A 1 361 ? 54.581 20.296  8.264   1.00 76.52  ? 426  LYS A O   1 
ATOM   2675 C CB  . LYS A 1 361 ? 57.654 20.293  9.570   1.00 71.49  ? 426  LYS A CB  1 
ATOM   2676 C CG  . LYS A 1 361 ? 58.104 20.141  8.101   1.00 75.10  ? 426  LYS A CG  1 
ATOM   2677 C CD  . LYS A 1 361 ? 59.141 19.016  7.884   1.00 82.12  ? 426  LYS A CD  1 
ATOM   2678 C CE  . LYS A 1 361 ? 58.552 17.594  7.985   1.00 88.38  ? 426  LYS A CE  1 
ATOM   2679 N NZ  . LYS A 1 361 ? 59.539 16.464  7.897   1.00 73.33  ? 426  LYS A NZ  1 
ATOM   2680 N N   . PRO A 1 362 ? 54.688 19.159  10.235  1.00 58.69  ? 427  PRO A N   1 
ATOM   2681 C CA  . PRO A 1 362 ? 53.597 18.254  9.837   1.00 53.07  ? 427  PRO A CA  1 
ATOM   2682 C C   . PRO A 1 362 ? 52.284 18.969  9.528   1.00 54.72  ? 427  PRO A C   1 
ATOM   2683 O O   . PRO A 1 362 ? 51.572 18.553  8.618   1.00 52.22  ? 427  PRO A O   1 
ATOM   2684 C CB  . PRO A 1 362 ? 53.465 17.358  11.047  1.00 50.42  ? 427  PRO A CB  1 
ATOM   2685 C CG  . PRO A 1 362 ? 54.874 17.231  11.493  1.00 51.36  ? 427  PRO A CG  1 
ATOM   2686 C CD  . PRO A 1 362 ? 55.307 18.671  11.479  1.00 53.81  ? 427  PRO A CD  1 
ATOM   2687 N N   . LEU A 1 363 ? 52.008 20.071  10.223  1.00 54.99  ? 428  LEU A N   1 
ATOM   2688 C CA  . LEU A 1 363 ? 50.891 20.937  9.853   1.00 56.39  ? 428  LEU A CA  1 
ATOM   2689 C C   . LEU A 1 363 ? 51.107 21.640  8.507   1.00 57.60  ? 428  LEU A C   1 
ATOM   2690 O O   . LEU A 1 363 ? 50.207 21.654  7.645   1.00 55.17  ? 428  LEU A O   1 
ATOM   2691 C CB  . LEU A 1 363 ? 50.642 21.963  10.942  1.00 54.52  ? 428  LEU A CB  1 
ATOM   2692 C CG  . LEU A 1 363 ? 49.515 21.758  11.960  1.00 57.94  ? 428  LEU A CG  1 
ATOM   2693 C CD1 . LEU A 1 363 ? 49.043 20.323  12.126  1.00 55.77  ? 428  LEU A CD1 1 
ATOM   2694 C CD2 . LEU A 1 363 ? 49.941 22.359  13.291  1.00 59.00  ? 428  LEU A CD2 1 
ATOM   2695 N N   . CYS A 1 364 ? 52.294 22.210  8.320   1.00 54.33  ? 429  CYS A N   1 
ATOM   2696 C CA  . CYS A 1 364 ? 52.609 22.892  7.060   1.00 55.41  ? 429  CYS A CA  1 
ATOM   2697 C C   . CYS A 1 364 ? 52.553 21.955  5.837   1.00 54.15  ? 429  CYS A C   1 
ATOM   2698 O O   . CYS A 1 364 ? 52.188 22.390  4.765   1.00 58.83  ? 429  CYS A O   1 
ATOM   2699 C CB  . CYS A 1 364 ? 53.970 23.578  7.135   1.00 55.99  ? 429  CYS A CB  1 
ATOM   2700 S SG  . CYS A 1 364 ? 54.024 25.046  8.192   1.00 69.32  ? 429  CYS A SG  1 
ATOM   2701 N N   . ASP A 1 365 ? 52.889 20.679  6.005   1.00 52.95  ? 430  ASP A N   1 
ATOM   2702 C CA  . ASP A 1 365 ? 52.842 19.725  4.890   1.00 59.72  ? 430  ASP A CA  1 
ATOM   2703 C C   . ASP A 1 365 ? 51.425 19.458  4.468   1.00 55.98  ? 430  ASP A C   1 
ATOM   2704 O O   . ASP A 1 365 ? 51.166 19.160  3.329   1.00 67.43  ? 430  ASP A O   1 
ATOM   2705 C CB  . ASP A 1 365 ? 53.637 18.429  5.172   1.00 51.09  ? 430  ASP A CB  1 
ATOM   2706 C CG  . ASP A 1 365 ? 55.126 18.719  5.417   1.00 58.08  ? 430  ASP A CG  1 
ATOM   2707 O OD1 . ASP A 1 365 ? 55.600 19.805  4.986   1.00 57.37  ? 430  ASP A OD1 1 
ATOM   2708 O OD2 . ASP A 1 365 ? 55.833 17.895  6.052   1.00 66.87  ? 430  ASP A OD2 1 
ATOM   2709 N N   . LEU A 1 366 ? 50.496 19.607  5.385   1.00 60.65  ? 431  LEU A N   1 
ATOM   2710 C CA  . LEU A 1 366 ? 49.117 19.355  5.064   1.00 60.72  ? 431  LEU A CA  1 
ATOM   2711 C C   . LEU A 1 366 ? 48.583 20.431  4.121   1.00 63.68  ? 431  LEU A C   1 
ATOM   2712 O O   . LEU A 1 366 ? 47.540 20.262  3.508   1.00 75.68  ? 431  LEU A O   1 
ATOM   2713 C CB  . LEU A 1 366 ? 48.273 19.286  6.344   1.00 53.20  ? 431  LEU A CB  1 
ATOM   2714 C CG  . LEU A 1 366 ? 48.467 17.985  7.122   1.00 56.32  ? 431  LEU A CG  1 
ATOM   2715 C CD1 . LEU A 1 366 ? 47.807 18.173  8.461   1.00 56.95  ? 431  LEU A CD1 1 
ATOM   2716 C CD2 . LEU A 1 366 ? 47.909 16.741  6.417   1.00 53.75  ? 431  LEU A CD2 1 
ATOM   2717 N N   . LEU A 1 367 ? 49.294 21.537  3.985   1.00 55.82  ? 432  LEU A N   1 
ATOM   2718 C CA  . LEU A 1 367 ? 48.631 22.706  3.452   1.00 60.86  ? 432  LEU A CA  1 
ATOM   2719 C C   . LEU A 1 367 ? 48.287 22.538  1.971   1.00 65.61  ? 432  LEU A C   1 
ATOM   2720 O O   . LEU A 1 367 ? 47.442 23.252  1.452   1.00 78.65  ? 432  LEU A O   1 
ATOM   2721 C CB  . LEU A 1 367 ? 49.470 23.944  3.698   1.00 54.99  ? 432  LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 367 ? 49.621 24.455  5.132   1.00 51.45  ? 432  LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 367 ? 50.762 25.463  5.230   1.00 57.19  ? 432  LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 367 ? 48.346 25.092  5.635   1.00 49.01  ? 432  LEU A CD2 1 
ATOM   2725 N N   . THR A 1 368 ? 48.897 21.544  1.330   1.00 72.72  ? 433  THR A N   1 
ATOM   2726 C CA  . THR A 1 368 ? 48.839 21.357  -0.128  1.00 80.34  ? 433  THR A CA  1 
ATOM   2727 C C   . THR A 1 368 ? 48.076 20.107  -0.555  1.00 74.58  ? 433  THR A C   1 
ATOM   2728 O O   . THR A 1 368 ? 48.258 19.645  -1.680  1.00 70.88  ? 433  THR A O   1 
ATOM   2729 C CB  . THR A 1 368 ? 50.260 21.220  -0.769  1.00 83.74  ? 433  THR A CB  1 
ATOM   2730 O OG1 . THR A 1 368 ? 51.072 20.343  0.027   1.00 81.37  ? 433  THR A OG1 1 
ATOM   2731 C CG2 . THR A 1 368 ? 50.958 22.580  -0.957  1.00 78.12  ? 433  THR A CG2 1 
ATOM   2732 N N   . VAL A 1 369 ? 47.271 19.544  0.341   1.00 76.50  ? 434  VAL A N   1 
ATOM   2733 C CA  . VAL A 1 369 ? 46.448 18.349  0.034   1.00 82.39  ? 434  VAL A CA  1 
ATOM   2734 C C   . VAL A 1 369 ? 45.088 18.763  -0.583  1.00 78.55  ? 434  VAL A C   1 
ATOM   2735 O O   . VAL A 1 369 ? 44.726 19.934  -0.523  1.00 69.33  ? 434  VAL A O   1 
ATOM   2736 C CB  . VAL A 1 369 ? 46.194 17.480  1.292   1.00 82.03  ? 434  VAL A CB  1 
ATOM   2737 C CG1 . VAL A 1 369 ? 47.501 17.140  2.009   1.00 77.05  ? 434  VAL A CG1 1 
ATOM   2738 C CG2 . VAL A 1 369 ? 45.199 18.168  2.230   1.00 78.98  ? 434  VAL A CG2 1 
ATOM   2739 N N   . MET A 1 370 ? 44.330 17.821  -1.151  1.00 86.53  ? 435  MET A N   1 
ATOM   2740 C CA  . MET A 1 370 ? 43.052 18.181  -1.822  1.00 82.71  ? 435  MET A CA  1 
ATOM   2741 C C   . MET A 1 370 ? 41.921 18.550  -0.864  1.00 80.87  ? 435  MET A C   1 
ATOM   2742 O O   . MET A 1 370 ? 41.221 19.550  -1.057  1.00 75.03  ? 435  MET A O   1 
ATOM   2743 C CB  . MET A 1 370 ? 42.611 17.109  -2.827  1.00 88.03  ? 435  MET A CB  1 
ATOM   2744 C CG  . MET A 1 370 ? 43.616 16.890  -3.972  1.00 104.61 ? 435  MET A CG  1 
ATOM   2745 S SD  . MET A 1 370 ? 44.295 18.399  -4.740  1.00 116.81 ? 435  MET A SD  1 
ATOM   2746 C CE  . MET A 1 370 ? 46.056 18.019  -4.885  1.00 91.78  ? 435  MET A CE  1 
ATOM   2747 N N   . ASP A 1 371 ? 41.761 17.757  0.192   1.00 91.27  ? 436  ASP A N   1 
ATOM   2748 C CA  . ASP A 1 371 ? 40.701 18.002  1.165   1.00 77.76  ? 436  ASP A CA  1 
ATOM   2749 C C   . ASP A 1 371 ? 40.843 19.384  1.828   1.00 74.85  ? 436  ASP A C   1 
ATOM   2750 O O   . ASP A 1 371 ? 41.790 19.668  2.580   1.00 71.12  ? 436  ASP A O   1 
ATOM   2751 C CB  . ASP A 1 371 ? 40.628 16.865  2.178   1.00 69.99  ? 436  ASP A CB  1 
ATOM   2752 C CG  . ASP A 1 371 ? 39.492 17.028  3.136   1.00 78.05  ? 436  ASP A CG  1 
ATOM   2753 O OD1 . ASP A 1 371 ? 38.800 18.093  3.121   1.00 71.28  ? 436  ASP A OD1 1 
ATOM   2754 O OD2 . ASP A 1 371 ? 39.298 16.066  3.906   1.00 88.41  ? 436  ASP A OD2 1 
ATOM   2755 N N   . SER A 1 372 ? 39.890 20.243  1.504   1.00 75.58  ? 437  SER A N   1 
ATOM   2756 C CA  . SER A 1 372 ? 39.926 21.622  1.910   1.00 69.04  ? 437  SER A CA  1 
ATOM   2757 C C   . SER A 1 372 ? 39.821 21.830  3.392   1.00 69.96  ? 437  SER A C   1 
ATOM   2758 O O   . SER A 1 372 ? 40.390 22.820  3.902   1.00 64.89  ? 437  SER A O   1 
ATOM   2759 C CB  . SER A 1 372 ? 38.826 22.412  1.220   1.00 68.56  ? 437  SER A CB  1 
ATOM   2760 O OG  . SER A 1 372 ? 39.433 23.408  0.431   1.00 75.95  ? 437  SER A OG  1 
ATOM   2761 N N   . LYS A 1 373 ? 39.086 20.929  4.067   1.00 68.80  ? 438  LYS A N   1 
ATOM   2762 C CA  . LYS A 1 373 ? 38.863 21.022  5.543   1.00 74.75  ? 438  LYS A CA  1 
ATOM   2763 C C   . LYS A 1 373 ? 40.181 20.856  6.300   1.00 63.80  ? 438  LYS A C   1 
ATOM   2764 O O   . LYS A 1 373 ? 40.517 21.630  7.181   1.00 59.25  ? 438  LYS A O   1 
ATOM   2765 C CB  . LYS A 1 373 ? 37.835 20.002  6.102   1.00 72.18  ? 438  LYS A CB  1 
ATOM   2766 C CG  . LYS A 1 373 ? 36.846 19.402  5.120   1.00 84.94  ? 438  LYS A CG  1 
ATOM   2767 C CD  . LYS A 1 373 ? 35.677 20.323  4.801   1.00 98.17  ? 438  LYS A CD  1 
ATOM   2768 C CE  . LYS A 1 373 ? 34.732 19.642  3.812   1.00 96.25  ? 438  LYS A CE  1 
ATOM   2769 N NZ  . LYS A 1 373 ? 34.038 18.517  4.500   1.00 104.94 ? 438  LYS A NZ  1 
ATOM   2770 N N   . ILE A 1 374 ? 40.912 19.828  5.924   1.00 59.59  ? 439  ILE A N   1 
ATOM   2771 C CA  . ILE A 1 374 ? 42.223 19.573  6.474   1.00 65.38  ? 439  ILE A CA  1 
ATOM   2772 C C   . ILE A 1 374 ? 43.140 20.765  6.330   1.00 66.36  ? 439  ILE A C   1 
ATOM   2773 O O   . ILE A 1 374 ? 43.890 21.117  7.266   1.00 64.47  ? 439  ILE A O   1 
ATOM   2774 C CB  . ILE A 1 374 ? 42.892 18.391  5.780   1.00 58.64  ? 439  ILE A CB  1 
ATOM   2775 C CG1 . ILE A 1 374 ? 41.868 17.302  5.511   1.00 66.20  ? 439  ILE A CG1 1 
ATOM   2776 C CG2 . ILE A 1 374 ? 43.960 17.846  6.685   1.00 62.56  ? 439  ILE A CG2 1 
ATOM   2777 C CD1 . ILE A 1 374 ? 40.798 17.213  6.582   1.00 70.00  ? 439  ILE A CD1 1 
ATOM   2778 N N   . VAL A 1 375 ? 43.094 21.376  5.153   1.00 61.14  ? 440  VAL A N   1 
ATOM   2779 C CA  . VAL A 1 375 ? 43.878 22.578  4.944   1.00 67.88  ? 440  VAL A CA  1 
ATOM   2780 C C   . VAL A 1 375 ? 43.441 23.606  5.967   1.00 63.06  ? 440  VAL A C   1 
ATOM   2781 O O   . VAL A 1 375 ? 44.289 24.227  6.572   1.00 56.19  ? 440  VAL A O   1 
ATOM   2782 C CB  . VAL A 1 375 ? 43.717 23.171  3.517   1.00 72.50  ? 440  VAL A CB  1 
ATOM   2783 C CG1 . VAL A 1 375 ? 44.500 24.495  3.379   1.00 60.91  ? 440  VAL A CG1 1 
ATOM   2784 C CG2 . VAL A 1 375 ? 44.132 22.143  2.463   1.00 63.72  ? 440  VAL A CG2 1 
ATOM   2785 N N   . GLN A 1 376 ? 42.118 23.771  6.132   1.00 64.58  ? 441  GLN A N   1 
ATOM   2786 C CA  . GLN A 1 376 ? 41.579 24.730  7.084   1.00 72.15  ? 441  GLN A CA  1 
ATOM   2787 C C   . GLN A 1 376 ? 42.094 24.368  8.487   1.00 72.07  ? 441  GLN A C   1 
ATOM   2788 O O   . GLN A 1 376 ? 42.630 25.243  9.208   1.00 68.07  ? 441  GLN A O   1 
ATOM   2789 C CB  . GLN A 1 376 ? 40.030 24.849  7.023   1.00 68.08  ? 441  GLN A CB  1 
ATOM   2790 C CG  . GLN A 1 376 ? 39.510 25.752  5.891   1.00 78.17  ? 441  GLN A CG  1 
ATOM   2791 C CD  . GLN A 1 376 ? 37.977 25.862  5.791   1.00 83.36  ? 441  GLN A CD  1 
ATOM   2792 O OE1 . GLN A 1 376 ? 37.301 25.033  5.152   1.00 80.47  ? 441  GLN A OE1 1 
ATOM   2793 N NE2 . GLN A 1 376 ? 37.428 26.917  6.387   1.00 82.29  ? 441  GLN A NE2 1 
ATOM   2794 N N   . VAL A 1 377 ? 41.979 23.082  8.834   1.00 59.39  ? 442  VAL A N   1 
ATOM   2795 C CA  . VAL A 1 377 ? 42.373 22.586  10.151  1.00 62.80  ? 442  VAL A CA  1 
ATOM   2796 C C   . VAL A 1 377 ? 43.832 22.993  10.472  1.00 61.41  ? 442  VAL A C   1 
ATOM   2797 O O   . VAL A 1 377 ? 44.111 23.637  11.499  1.00 56.38  ? 442  VAL A O   1 
ATOM   2798 C CB  . VAL A 1 377 ? 42.185 21.059  10.241  1.00 63.06  ? 442  VAL A CB  1 
ATOM   2799 C CG1 . VAL A 1 377 ? 42.831 20.538  11.507  1.00 58.82  ? 442  VAL A CG1 1 
ATOM   2800 C CG2 . VAL A 1 377 ? 40.712 20.708  10.245  1.00 57.06  ? 442  VAL A CG2 1 
ATOM   2801 N N   . ALA A 1 378 ? 44.726 22.662  9.535   1.00 58.40  ? 443  ALA A N   1 
ATOM   2802 C CA  . ALA A 1 378 ? 46.130 23.006  9.576   1.00 51.93  ? 443  ALA A CA  1 
ATOM   2803 C C   . ALA A 1 378 ? 46.407 24.510  9.672   1.00 54.24  ? 443  ALA A C   1 
ATOM   2804 O O   . ALA A 1 378 ? 47.240 24.950  10.455  1.00 55.25  ? 443  ALA A O   1 
ATOM   2805 C CB  . ALA A 1 378 ? 46.812 22.399  8.380   1.00 54.91  ? 443  ALA A CB  1 
ATOM   2806 N N   . LEU A 1 379 ? 45.687 25.301  8.904   1.00 56.22  ? 444  LEU A N   1 
ATOM   2807 C CA  . LEU A 1 379 ? 45.775 26.748  9.033   1.00 60.61  ? 444  LEU A CA  1 
ATOM   2808 C C   . LEU A 1 379 ? 45.339 27.268  10.406  1.00 58.44  ? 444  LEU A C   1 
ATOM   2809 O O   . LEU A 1 379 ? 45.977 28.184  10.947  1.00 51.77  ? 444  LEU A O   1 
ATOM   2810 C CB  . LEU A 1 379 ? 44.937 27.428  7.953   1.00 64.91  ? 444  LEU A CB  1 
ATOM   2811 C CG  . LEU A 1 379 ? 45.584 27.564  6.577   1.00 69.56  ? 444  LEU A CG  1 
ATOM   2812 C CD1 . LEU A 1 379 ? 44.480 27.852  5.569   1.00 70.61  ? 444  LEU A CD1 1 
ATOM   2813 C CD2 . LEU A 1 379 ? 46.672 28.642  6.545   1.00 63.18  ? 444  LEU A CD2 1 
ATOM   2814 N N   . ASN A 1 380 ? 44.251 26.684  10.931  1.00 60.16  ? 445  ASN A N   1 
ATOM   2815 C CA  . ASN A 1 380 ? 43.688 26.990  12.256  1.00 58.59  ? 445  ASN A CA  1 
ATOM   2816 C C   . ASN A 1 380 ? 44.739 26.805  13.340  1.00 64.36  ? 445  ASN A C   1 
ATOM   2817 O O   . ASN A 1 380 ? 44.939 27.696  14.180  1.00 55.26  ? 445  ASN A O   1 
ATOM   2818 C CB  . ASN A 1 380 ? 42.486 26.072  12.554  1.00 68.00  ? 445  ASN A CB  1 
ATOM   2819 C CG  . ASN A 1 380 ? 41.295 26.323  11.623  1.00 82.12  ? 445  ASN A CG  1 
ATOM   2820 O OD1 . ASN A 1 380 ? 40.642 27.373  11.695  1.00 78.84  ? 445  ASN A OD1 1 
ATOM   2821 N ND2 . ASN A 1 380 ? 40.997 25.352  10.753  1.00 76.52  ? 445  ASN A ND2 1 
ATOM   2822 N N   . GLY A 1 381 ? 45.414 25.642  13.292  1.00 62.01  ? 446  GLY A N   1 
ATOM   2823 C CA  . GLY A 1 381 ? 46.475 25.313  14.238  1.00 55.80  ? 446  GLY A CA  1 
ATOM   2824 C C   . GLY A 1 381 ? 47.680 26.211  14.100  1.00 56.22  ? 446  GLY A C   1 
ATOM   2825 O O   . GLY A 1 381 ? 48.298 26.586  15.089  1.00 58.56  ? 446  GLY A O   1 
ATOM   2826 N N   . LEU A 1 382 ? 48.036 26.563  12.873  1.00 59.41  ? 447  LEU A N   1 
ATOM   2827 C CA  . LEU A 1 382 ? 49.187 27.452  12.683  1.00 60.82  ? 447  LEU A CA  1 
ATOM   2828 C C   . LEU A 1 382 ? 48.808 28.846  13.148  1.00 60.99  ? 447  LEU A C   1 
ATOM   2829 O O   . LEU A 1 382 ? 49.641 29.581  13.650  1.00 54.26  ? 447  LEU A O   1 
ATOM   2830 C CB  . LEU A 1 382 ? 49.659 27.486  11.229  1.00 61.59  ? 447  LEU A CB  1 
ATOM   2831 C CG  . LEU A 1 382 ? 50.128 26.184  10.558  1.00 60.92  ? 447  LEU A CG  1 
ATOM   2832 C CD1 . LEU A 1 382 ? 50.147 26.336  9.033   1.00 59.26  ? 447  LEU A CD1 1 
ATOM   2833 C CD2 . LEU A 1 382 ? 51.493 25.771  11.074  1.00 60.76  ? 447  LEU A CD2 1 
ATOM   2834 N N   . GLU A 1 383 ? 47.543 29.203  12.997  1.00 57.55  ? 448  GLU A N   1 
ATOM   2835 C CA  . GLU A 1 383 ? 47.132 30.486  13.473  1.00 61.26  ? 448  GLU A CA  1 
ATOM   2836 C C   . GLU A 1 383 ? 47.321 30.547  14.980  1.00 69.67  ? 448  GLU A C   1 
ATOM   2837 O O   . GLU A 1 383 ? 47.947 31.479  15.513  1.00 67.91  ? 448  GLU A O   1 
ATOM   2838 C CB  . GLU A 1 383 ? 45.683 30.740  13.174  1.00 57.82  ? 448  GLU A CB  1 
ATOM   2839 C CG  . GLU A 1 383 ? 45.367 32.217  13.388  1.00 69.58  ? 448  GLU A CG  1 
ATOM   2840 C CD  . GLU A 1 383 ? 44.049 32.631  12.773  1.00 75.61  ? 448  GLU A CD  1 
ATOM   2841 O OE1 . GLU A 1 383 ? 43.336 31.731  12.270  1.00 80.92  ? 448  GLU A OE1 1 
ATOM   2842 O OE2 . GLU A 1 383 ? 43.725 33.842  12.789  1.00 79.66  ? 448  GLU A OE2 1 
ATOM   2843 N N   . ASN A 1 384 ? 46.752 29.555  15.653  1.00 63.25  ? 449  ASN A N   1 
ATOM   2844 C CA  . ASN A 1 384 ? 46.799 29.473  17.092  1.00 63.60  ? 449  ASN A CA  1 
ATOM   2845 C C   . ASN A 1 384 ? 48.244 29.625  17.623  1.00 70.35  ? 449  ASN A C   1 
ATOM   2846 O O   . ASN A 1 384 ? 48.488 30.304  18.658  1.00 64.76  ? 449  ASN A O   1 
ATOM   2847 C CB  . ASN A 1 384 ? 46.211 28.139  17.556  1.00 62.25  ? 449  ASN A CB  1 
ATOM   2848 C CG  . ASN A 1 384 ? 44.698 28.095  17.470  1.00 62.92  ? 449  ASN A CG  1 
ATOM   2849 O OD1 . ASN A 1 384 ? 44.050 29.127  17.483  1.00 61.70  ? 449  ASN A OD1 1 
ATOM   2850 N ND2 . ASN A 1 384 ? 44.134 26.890  17.402  1.00 61.28  ? 449  ASN A ND2 1 
ATOM   2851 N N   . ILE A 1 385 ? 49.181 28.992  16.911  1.00 57.11  ? 450  ILE A N   1 
ATOM   2852 C CA  . ILE A 1 385 ? 50.558 29.002  17.318  1.00 59.04  ? 450  ILE A CA  1 
ATOM   2853 C C   . ILE A 1 385 ? 51.122 30.408  17.105  1.00 62.91  ? 450  ILE A C   1 
ATOM   2854 O O   . ILE A 1 385 ? 51.763 30.957  17.993  1.00 68.36  ? 450  ILE A O   1 
ATOM   2855 C CB  . ILE A 1 385 ? 51.385 27.951  16.554  1.00 58.34  ? 450  ILE A CB  1 
ATOM   2856 C CG1 . ILE A 1 385 ? 51.094 26.560  17.109  1.00 60.20  ? 450  ILE A CG1 1 
ATOM   2857 C CG2 . ILE A 1 385 ? 52.881 28.267  16.628  1.00 52.27  ? 450  ILE A CG2 1 
ATOM   2858 C CD1 . ILE A 1 385 ? 51.635 25.438  16.237  1.00 58.53  ? 450  ILE A CD1 1 
ATOM   2859 N N   . LEU A 1 386 ? 50.878 30.991  15.935  1.00 67.72  ? 451  LEU A N   1 
ATOM   2860 C CA  . LEU A 1 386 ? 51.299 32.369  15.650  1.00 71.80  ? 451  LEU A CA  1 
ATOM   2861 C C   . LEU A 1 386 ? 50.740 33.332  16.681  1.00 66.90  ? 451  LEU A C   1 
ATOM   2862 O O   . LEU A 1 386 ? 51.435 34.237  17.101  1.00 62.12  ? 451  LEU A O   1 
ATOM   2863 C CB  . LEU A 1 386 ? 50.849 32.796  14.252  1.00 75.27  ? 451  LEU A CB  1 
ATOM   2864 C CG  . LEU A 1 386 ? 51.851 32.730  13.097  1.00 76.94  ? 451  LEU A CG  1 
ATOM   2865 C CD1 . LEU A 1 386 ? 53.236 32.229  13.491  1.00 75.29  ? 451  LEU A CD1 1 
ATOM   2866 C CD2 . LEU A 1 386 ? 51.235 31.940  11.954  1.00 74.02  ? 451  LEU A CD2 1 
ATOM   2867 N N   . ARG A 1 387 ? 49.493 33.111  17.094  1.00 68.08  ? 452  ARG A N   1 
ATOM   2868 C CA  . ARG A 1 387 ? 48.869 33.970  18.074  1.00 72.77  ? 452  ARG A CA  1 
ATOM   2869 C C   . ARG A 1 387 ? 49.577 33.955  19.411  1.00 71.50  ? 452  ARG A C   1 
ATOM   2870 O O   . ARG A 1 387 ? 49.952 35.024  19.891  1.00 72.63  ? 452  ARG A O   1 
ATOM   2871 C CB  . ARG A 1 387 ? 47.371 33.731  18.205  1.00 76.83  ? 452  ARG A CB  1 
ATOM   2872 C CG  . ARG A 1 387 ? 46.541 34.772  17.448  1.00 80.65  ? 452  ARG A CG  1 
ATOM   2873 C CD  . ARG A 1 387 ? 45.234 35.026  18.173  1.00 81.60  ? 452  ARG A CD  1 
ATOM   2874 N NE  . ARG A 1 387 ? 44.927 33.772  18.823  1.00 75.26  ? 452  ARG A NE  1 
ATOM   2875 C CZ  . ARG A 1 387 ? 44.179 32.815  18.294  1.00 77.75  ? 452  ARG A CZ  1 
ATOM   2876 N NH1 . ARG A 1 387 ? 43.572 32.984  17.121  1.00 75.68  ? 452  ARG A NH1 1 
ATOM   2877 N NH2 . ARG A 1 387 ? 44.025 31.687  18.968  1.00 78.82  ? 452  ARG A NH2 1 
ATOM   2878 N N   . LEU A 1 388 ? 49.804 32.769  19.986  1.00 77.83  ? 453  LEU A N   1 
ATOM   2879 C CA  . LEU A 1 388 ? 50.638 32.653  21.209  1.00 79.54  ? 453  LEU A CA  1 
ATOM   2880 C C   . LEU A 1 388 ? 52.016 33.341  21.056  1.00 87.19  ? 453  LEU A C   1 
ATOM   2881 O O   . LEU A 1 388 ? 52.486 34.011  21.980  1.00 90.99  ? 453  LEU A O   1 
ATOM   2882 C CB  . LEU A 1 388 ? 50.788 31.192  21.710  1.00 78.80  ? 453  LEU A CB  1 
ATOM   2883 C CG  . LEU A 1 388 ? 51.984 30.722  22.614  1.00 91.23  ? 453  LEU A CG  1 
ATOM   2884 C CD1 . LEU A 1 388 ? 52.256 31.592  23.837  1.00 93.81  ? 453  LEU A CD1 1 
ATOM   2885 C CD2 . LEU A 1 388 ? 51.897 29.274  23.081  1.00 87.92  ? 453  LEU A CD2 1 
ATOM   2886 N N   . GLY A 1 389 ? 52.651 33.186  19.896  1.00 82.18  ? 454  GLY A N   1 
ATOM   2887 C CA  . GLY A 1 389 ? 53.985 33.735  19.677  1.00 86.79  ? 454  GLY A CA  1 
ATOM   2888 C C   . GLY A 1 389 ? 53.970 35.249  19.623  1.00 96.97  ? 454  GLY A C   1 
ATOM   2889 O O   . GLY A 1 389 ? 54.935 35.898  20.036  1.00 104.84 ? 454  GLY A O   1 
ATOM   2890 N N   . GLU A 1 390 ? 52.874 35.799  19.101  1.00 88.66  ? 455  GLU A N   1 
ATOM   2891 C CA  . GLU A 1 390 ? 52.638 37.220  19.114  1.00 88.11  ? 455  GLU A CA  1 
ATOM   2892 C C   . GLU A 1 390 ? 52.452 37.720  20.546  1.00 98.23  ? 455  GLU A C   1 
ATOM   2893 O O   . GLU A 1 390 ? 52.999 38.763  20.914  1.00 99.09  ? 455  GLU A O   1 
ATOM   2894 C CB  . GLU A 1 390 ? 51.404 37.528  18.302  1.00 84.23  ? 455  GLU A CB  1 
ATOM   2895 C CG  . GLU A 1 390 ? 50.730 38.812  18.719  1.00 84.11  ? 455  GLU A CG  1 
ATOM   2896 C CD  . GLU A 1 390 ? 49.563 39.126  17.827  1.00 91.14  ? 455  GLU A CD  1 
ATOM   2897 O OE1 . GLU A 1 390 ? 48.471 38.519  18.014  1.00 89.33  ? 455  GLU A OE1 1 
ATOM   2898 O OE2 . GLU A 1 390 ? 49.764 39.979  16.937  1.00 87.29  ? 455  GLU A OE2 1 
ATOM   2899 N N   . GLN A 1 391 ? 51.675 36.968  21.333  1.00 99.41  ? 456  GLN A N   1 
ATOM   2900 C CA  . GLN A 1 391 ? 51.460 37.233  22.766  1.00 102.27 ? 456  GLN A CA  1 
ATOM   2901 C C   . GLN A 1 391 ? 52.756 37.207  23.588  1.00 103.59 ? 456  GLN A C   1 
ATOM   2902 O O   . GLN A 1 391 ? 52.850 37.881  24.614  1.00 97.34  ? 456  GLN A O   1 
ATOM   2903 C CB  . GLN A 1 391 ? 50.445 36.237  23.359  1.00 111.81 ? 456  GLN A CB  1 
ATOM   2904 C CG  . GLN A 1 391 ? 48.985 36.502  23.001  1.00 121.83 ? 456  GLN A CG  1 
ATOM   2905 C CD  . GLN A 1 391 ? 48.344 37.570  23.873  1.00 126.44 ? 456  GLN A CD  1 
ATOM   2906 O OE1 . GLN A 1 391 ? 47.447 37.280  24.667  1.00 130.54 ? 456  GLN A OE1 1 
ATOM   2907 N NE2 . GLN A 1 391 ? 48.801 38.813  23.733  1.00 120.59 ? 456  GLN A NE2 1 
ATOM   2908 N N   . GLU A 1 392 ? 53.739 36.434  23.113  1.00 109.17 ? 457  GLU A N   1 
ATOM   2909 C CA  . GLU A 1 392 ? 55.058 36.292  23.736  1.00 101.86 ? 457  GLU A CA  1 
ATOM   2910 C C   . GLU A 1 392 ? 56.028 37.438  23.462  1.00 106.55 ? 457  GLU A C   1 
ATOM   2911 O O   . GLU A 1 392 ? 56.789 37.828  24.362  1.00 109.72 ? 457  GLU A O   1 
ATOM   2912 C CB  . GLU A 1 392 ? 55.704 34.984  23.310  1.00 94.72  ? 457  GLU A CB  1 
ATOM   2913 C CG  . GLU A 1 392 ? 55.668 33.941  24.401  1.00 105.22 ? 457  GLU A CG  1 
ATOM   2914 C CD  . GLU A 1 392 ? 56.623 32.796  24.148  1.00 109.29 ? 457  GLU A CD  1 
ATOM   2915 O OE1 . GLU A 1 392 ? 56.598 32.239  23.021  1.00 98.18  ? 457  GLU A OE1 1 
ATOM   2916 O OE2 . GLU A 1 392 ? 57.396 32.463  25.080  1.00 108.20 ? 457  GLU A OE2 1 
ATOM   2917 N N   . ALA A 1 393 ? 56.003 37.959  22.230  1.00 105.03 ? 458  ALA A N   1 
ATOM   2918 C CA  . ALA A 1 393 ? 56.868 39.073  21.806  1.00 102.36 ? 458  ALA A CA  1 
ATOM   2919 C C   . ALA A 1 393 ? 56.626 40.357  22.628  1.00 104.13 ? 458  ALA A C   1 
ATOM   2920 O O   . ALA A 1 393 ? 57.457 41.261  22.642  1.00 112.09 ? 458  ALA A O   1 
ATOM   2921 C CB  . ALA A 1 393 ? 56.729 39.336  20.301  1.00 88.91  ? 458  ALA A CB  1 
ATOM   2922 N N   . LYS A 1 394 ? 55.503 40.419  23.335  1.00 102.37 ? 459  LYS A N   1 
ATOM   2923 C CA  . LYS A 1 394 ? 55.229 41.548  24.196  1.00 106.12 ? 459  LYS A CA  1 
ATOM   2924 C C   . LYS A 1 394 ? 55.482 41.293  25.698  1.00 115.72 ? 459  LYS A C   1 
ATOM   2925 O O   . LYS A 1 394 ? 55.913 42.212  26.384  1.00 123.16 ? 459  LYS A O   1 
ATOM   2926 C CB  . LYS A 1 394 ? 53.827 42.080  23.910  1.00 103.48 ? 459  LYS A CB  1 
ATOM   2927 C CG  . LYS A 1 394 ? 53.703 42.690  22.500  1.00 104.25 ? 459  LYS A CG  1 
ATOM   2928 C CD  . LYS A 1 394 ? 52.294 42.581  21.918  1.00 112.89 ? 459  LYS A CD  1 
ATOM   2929 C CE  . LYS A 1 394 ? 51.242 43.267  22.791  1.00 124.16 ? 459  LYS A CE  1 
ATOM   2930 N NZ  . LYS A 1 394 ? 51.015 42.595  24.116  1.00 122.56 ? 459  LYS A NZ  1 
ATOM   2931 N N   . ARG A 1 395 ? 55.230 40.070  26.203  1.00 120.34 ? 460  ARG A N   1 
ATOM   2932 C CA  . ARG A 1 395 ? 55.599 39.669  27.604  1.00 120.95 ? 460  ARG A CA  1 
ATOM   2933 C C   . ARG A 1 395 ? 57.108 39.803  27.856  1.00 126.12 ? 460  ARG A C   1 
ATOM   2934 O O   . ARG A 1 395 ? 57.534 40.383  28.859  1.00 132.17 ? 460  ARG A O   1 
ATOM   2935 C CB  . ARG A 1 395 ? 55.247 38.210  27.926  1.00 116.23 ? 460  ARG A CB  1 
ATOM   2936 C CG  . ARG A 1 395 ? 53.809 37.777  27.755  1.00 114.35 ? 460  ARG A CG  1 
ATOM   2937 C CD  . ARG A 1 395 ? 53.829 36.385  27.131  1.00 110.95 ? 460  ARG A CD  1 
ATOM   2938 N NE  . ARG A 1 395 ? 53.338 35.320  27.998  1.00 111.62 ? 460  ARG A NE  1 
ATOM   2939 C CZ  . ARG A 1 395 ? 53.739 34.048  27.950  1.00 108.93 ? 460  ARG A CZ  1 
ATOM   2940 N NH1 . ARG A 1 395 ? 54.686 33.668  27.100  1.00 99.23  ? 460  ARG A NH1 1 
ATOM   2941 N NH2 . ARG A 1 395 ? 53.209 33.155  28.783  1.00 95.81  ? 460  ARG A NH2 1 
ATOM   2942 N N   . ASN A 1 396 ? 57.898 39.208  26.960  1.00 115.93 ? 461  ASN A N   1 
ATOM   2943 C CA  . ASN A 1 396 ? 59.338 39.414  26.899  1.00 103.42 ? 461  ASN A CA  1 
ATOM   2944 C C   . ASN A 1 396 ? 59.597 40.742  26.132  1.00 111.17 ? 461  ASN A C   1 
ATOM   2945 O O   . ASN A 1 396 ? 58.647 41.359  25.607  1.00 109.88 ? 461  ASN A O   1 
ATOM   2946 C CB  . ASN A 1 396 ? 60.007 38.173  26.250  1.00 96.80  ? 461  ASN A CB  1 
ATOM   2947 C CG  . ASN A 1 396 ? 60.440 38.403  24.798  1.00 100.15 ? 461  ASN A CG  1 
ATOM   2948 O OD1 . ASN A 1 396 ? 59.713 38.082  23.833  1.00 93.84  ? 461  ASN A OD1 1 
ATOM   2949 N ND2 . ASN A 1 396 ? 61.645 38.957  24.632  1.00 99.83  ? 461  ASN A ND2 1 
ATOM   2950 N N   . GLY A 1 397 ? 60.856 41.191  26.068  1.00 107.36 ? 462  GLY A N   1 
ATOM   2951 C CA  . GLY A 1 397 ? 61.212 42.437  25.361  1.00 111.54 ? 462  GLY A CA  1 
ATOM   2952 C C   . GLY A 1 397 ? 61.024 42.473  23.842  1.00 114.58 ? 462  GLY A C   1 
ATOM   2953 O O   . GLY A 1 397 ? 60.256 43.319  23.329  1.00 104.72 ? 462  GLY A O   1 
ATOM   2954 N N   . THR A 1 398 ? 61.719 41.550  23.147  1.00 115.47 ? 463  THR A N   1 
ATOM   2955 C CA  . THR A 1 398 ? 61.741 41.388  21.664  1.00 107.87 ? 463  THR A CA  1 
ATOM   2956 C C   . THR A 1 398 ? 60.382 41.436  20.976  1.00 115.93 ? 463  THR A C   1 
ATOM   2957 O O   . THR A 1 398 ? 59.446 40.754  21.407  1.00 115.08 ? 463  THR A O   1 
ATOM   2958 C CB  . THR A 1 398 ? 62.330 40.016  21.269  1.00 104.94 ? 463  THR A CB  1 
ATOM   2959 O OG1 . THR A 1 398 ? 63.735 40.007  21.488  1.00 99.25  ? 463  THR A OG1 1 
ATOM   2960 C CG2 . THR A 1 398 ? 62.103 39.737  19.844  1.00 106.14 ? 463  THR A CG2 1 
ATOM   2961 N N   . GLY A 1 399 ? 60.299 42.208  19.885  1.00 124.03 ? 464  GLY A N   1 
ATOM   2962 C CA  . GLY A 1 399 ? 59.066 42.355  19.102  1.00 118.42 ? 464  GLY A CA  1 
ATOM   2963 C C   . GLY A 1 399 ? 58.955 41.389  17.931  1.00 118.65 ? 464  GLY A C   1 
ATOM   2964 O O   . GLY A 1 399 ? 58.094 41.571  17.071  1.00 117.06 ? 464  GLY A O   1 
ATOM   2965 N N   . ILE A 1 400 ? 59.823 40.364  17.898  1.00 114.28 ? 465  ILE A N   1 
ATOM   2966 C CA  . ILE A 1 400 ? 59.799 39.291  16.870  1.00 109.22 ? 465  ILE A CA  1 
ATOM   2967 C C   . ILE A 1 400 ? 59.112 38.011  17.320  1.00 102.74 ? 465  ILE A C   1 
ATOM   2968 O O   . ILE A 1 400 ? 59.413 37.476  18.392  1.00 99.24  ? 465  ILE A O   1 
ATOM   2969 C CB  . ILE A 1 400 ? 61.196 38.883  16.338  1.00 102.58 ? 465  ILE A CB  1 
ATOM   2970 C CG1 . ILE A 1 400 ? 62.342 39.417  17.235  1.00 107.08 ? 465  ILE A CG1 1 
ATOM   2971 C CG2 . ILE A 1 400 ? 61.328 39.258  14.863  1.00 102.21 ? 465  ILE A CG2 1 
ATOM   2972 C CD1 . ILE A 1 400 ? 62.602 40.921  17.203  1.00 106.20 ? 465  ILE A CD1 1 
ATOM   2973 N N   . ASN A 1 401 ? 58.190 37.538  16.472  1.00 100.52 ? 466  ASN A N   1 
ATOM   2974 C CA  . ASN A 1 401 ? 57.459 36.278  16.654  1.00 84.06  ? 466  ASN A CA  1 
ATOM   2975 C C   . ASN A 1 401 ? 58.382 35.057  16.452  1.00 74.50  ? 466  ASN A C   1 
ATOM   2976 O O   . ASN A 1 401 ? 58.895 34.817  15.336  1.00 69.53  ? 466  ASN A O   1 
ATOM   2977 C CB  . ASN A 1 401 ? 56.239 36.224  15.721  1.00 72.21  ? 466  ASN A CB  1 
ATOM   2978 C CG  . ASN A 1 401 ? 55.256 35.146  16.114  1.00 70.79  ? 466  ASN A CG  1 
ATOM   2979 O OD1 . ASN A 1 401 ? 55.644 34.065  16.575  1.00 72.08  ? 466  ASN A OD1 1 
ATOM   2980 N ND2 . ASN A 1 401 ? 53.974 35.432  15.943  1.00 60.08  ? 466  ASN A ND2 1 
ATOM   2981 N N   . PRO A 1 402 ? 58.614 34.290  17.542  1.00 74.54  ? 467  PRO A N   1 
ATOM   2982 C CA  . PRO A 1 402 ? 59.543 33.140  17.443  1.00 74.35  ? 467  PRO A CA  1 
ATOM   2983 C C   . PRO A 1 402 ? 59.063 32.120  16.400  1.00 75.54  ? 467  PRO A C   1 
ATOM   2984 O O   . PRO A 1 402 ? 59.892 31.409  15.833  1.00 82.30  ? 467  PRO A O   1 
ATOM   2985 C CB  . PRO A 1 402 ? 59.531 32.520  18.859  1.00 65.31  ? 467  PRO A CB  1 
ATOM   2986 C CG  . PRO A 1 402 ? 58.325 33.088  19.541  1.00 69.60  ? 467  PRO A CG  1 
ATOM   2987 C CD  . PRO A 1 402 ? 57.973 34.394  18.872  1.00 67.55  ? 467  PRO A CD  1 
ATOM   2988 N N   . TYR A 1 403 ? 57.746 32.075  16.148  1.00 64.78  ? 468  TYR A N   1 
ATOM   2989 C CA  . TYR A 1 403 ? 57.168 31.031  15.316  1.00 78.72  ? 468  TYR A CA  1 
ATOM   2990 C C   . TYR A 1 403 ? 57.092 31.420  13.832  1.00 83.50  ? 468  TYR A C   1 
ATOM   2991 O O   . TYR A 1 403 ? 56.839 30.564  12.965  1.00 77.17  ? 468  TYR A O   1 
ATOM   2992 C CB  . TYR A 1 403 ? 55.819 30.529  15.869  1.00 71.49  ? 468  TYR A CB  1 
ATOM   2993 C CG  . TYR A 1 403 ? 55.853 30.147  17.334  1.00 72.17  ? 468  TYR A CG  1 
ATOM   2994 C CD1 . TYR A 1 403 ? 56.823 29.273  17.856  1.00 79.98  ? 468  TYR A CD1 1 
ATOM   2995 C CD2 . TYR A 1 403 ? 54.931 30.677  18.206  1.00 75.94  ? 468  TYR A CD2 1 
ATOM   2996 C CE1 . TYR A 1 403 ? 56.848 28.947  19.216  1.00 75.38  ? 468  TYR A CE1 1 
ATOM   2997 C CE2 . TYR A 1 403 ? 54.942 30.368  19.559  1.00 76.63  ? 468  TYR A CE2 1 
ATOM   2998 C CZ  . TYR A 1 403 ? 55.891 29.504  20.066  1.00 82.19  ? 468  TYR A CZ  1 
ATOM   2999 O OH  . TYR A 1 403 ? 55.837 29.231  21.431  1.00 87.25  ? 468  TYR A OH  1 
ATOM   3000 N N   . CYS A 1 404 ? 57.353 32.696  13.547  1.00 73.03  ? 469  CYS A N   1 
ATOM   3001 C CA  . CYS A 1 404 ? 57.412 33.156  12.175  1.00 71.40  ? 469  CYS A CA  1 
ATOM   3002 C C   . CYS A 1 404 ? 58.572 32.503  11.459  1.00 71.85  ? 469  CYS A C   1 
ATOM   3003 O O   . CYS A 1 404 ? 58.403 31.907  10.390  1.00 72.79  ? 469  CYS A O   1 
ATOM   3004 C CB  . CYS A 1 404 ? 57.527 34.682  12.099  1.00 67.15  ? 469  CYS A CB  1 
ATOM   3005 S SG  . CYS A 1 404 ? 56.050 35.560  12.695  1.00 75.74  ? 469  CYS A SG  1 
ATOM   3006 N N   . ALA A 1 405 ? 59.755 32.599  12.054  1.00 79.80  ? 470  ALA A N   1 
ATOM   3007 C CA  . ALA A 1 405 ? 60.973 32.071  11.410  1.00 82.96  ? 470  ALA A CA  1 
ATOM   3008 C C   . ALA A 1 405 ? 60.902 30.525  11.241  1.00 82.04  ? 470  ALA A C   1 
ATOM   3009 O O   . ALA A 1 405 ? 61.309 29.983  10.190  1.00 72.21  ? 470  ALA A O   1 
ATOM   3010 C CB  . ALA A 1 405 ? 62.231 32.512  12.180  1.00 72.94  ? 470  ALA A CB  1 
ATOM   3011 N N   . LEU A 1 406 ? 60.372 29.864  12.287  1.00 73.78  ? 471  LEU A N   1 
ATOM   3012 C CA  . LEU A 1 406 ? 60.108 28.436  12.351  1.00 64.20  ? 471  LEU A CA  1 
ATOM   3013 C C   . LEU A 1 406 ? 59.074 27.957  11.313  1.00 62.96  ? 471  LEU A C   1 
ATOM   3014 O O   . LEU A 1 406 ? 59.285 26.926  10.666  1.00 56.76  ? 471  LEU A O   1 
ATOM   3015 C CB  . LEU A 1 406 ? 59.674 28.060  13.767  1.00 68.66  ? 471  LEU A CB  1 
ATOM   3016 C CG  . LEU A 1 406 ? 60.585 27.193  14.659  1.00 68.55  ? 471  LEU A CG  1 
ATOM   3017 C CD1 . LEU A 1 406 ? 62.070 27.466  14.604  1.00 54.71  ? 471  LEU A CD1 1 
ATOM   3018 C CD2 . LEU A 1 406 ? 60.117 27.258  16.100  1.00 70.22  ? 471  LEU A CD2 1 
ATOM   3019 N N   . ILE A 1 407 ? 57.988 28.703  11.118  1.00 57.29  ? 472  ILE A N   1 
ATOM   3020 C CA  . ILE A 1 407 ? 57.022 28.375  10.055  1.00 58.98  ? 472  ILE A CA  1 
ATOM   3021 C C   . ILE A 1 407 ? 57.602 28.576  8.650   1.00 68.14  ? 472  ILE A C   1 
ATOM   3022 O O   . ILE A 1 407 ? 57.297 27.820  7.718   1.00 69.40  ? 472  ILE A O   1 
ATOM   3023 C CB  . ILE A 1 407 ? 55.759 29.225  10.170  1.00 58.70  ? 472  ILE A CB  1 
ATOM   3024 C CG1 . ILE A 1 407 ? 54.899 28.735  11.340  1.00 57.47  ? 472  ILE A CG1 1 
ATOM   3025 C CG2 . ILE A 1 407 ? 54.988 29.231  8.861   1.00 52.60  ? 472  ILE A CG2 1 
ATOM   3026 C CD1 . ILE A 1 407 ? 53.560 29.439  11.436  1.00 57.30  ? 472  ILE A CD1 1 
ATOM   3027 N N   . GLU A 1 408 ? 58.433 29.605  8.504   1.00 67.47  ? 473  GLU A N   1 
ATOM   3028 C CA  . GLU A 1 408 ? 59.114 29.860  7.251   1.00 71.34  ? 473  GLU A CA  1 
ATOM   3029 C C   . GLU A 1 408 ? 60.063 28.702  6.945   1.00 66.61  ? 473  GLU A C   1 
ATOM   3030 O O   . GLU A 1 408 ? 60.067 28.156  5.844   1.00 60.68  ? 473  GLU A O   1 
ATOM   3031 C CB  . GLU A 1 408 ? 59.873 31.195  7.310   1.00 84.31  ? 473  GLU A CB  1 
ATOM   3032 C CG  . GLU A 1 408 ? 60.394 31.682  5.948   1.00 101.84 ? 473  GLU A CG  1 
ATOM   3033 C CD  . GLU A 1 408 ? 60.983 33.101  5.946   1.00 109.15 ? 473  GLU A CD  1 
ATOM   3034 O OE1 . GLU A 1 408 ? 61.037 33.765  7.011   1.00 117.05 ? 473  GLU A OE1 1 
ATOM   3035 O OE2 . GLU A 1 408 ? 61.394 33.559  4.854   1.00 106.99 ? 473  GLU A OE2 1 
ATOM   3036 N N   . GLU A 1 409 ? 60.832 28.321  7.954   1.00 67.93  ? 474  GLU A N   1 
ATOM   3037 C CA  . GLU A 1 409 ? 61.852 27.306  7.811   1.00 69.80  ? 474  GLU A CA  1 
ATOM   3038 C C   . GLU A 1 409 ? 61.258 25.945  7.423   1.00 67.29  ? 474  GLU A C   1 
ATOM   3039 O O   . GLU A 1 409 ? 61.889 25.186  6.716   1.00 68.82  ? 474  GLU A O   1 
ATOM   3040 C CB  . GLU A 1 409 ? 62.722 27.237  9.080   1.00 73.78  ? 474  GLU A CB  1 
ATOM   3041 C CG  . GLU A 1 409 ? 63.529 28.524  9.341   1.00 82.07  ? 474  GLU A CG  1 
ATOM   3042 C CD  . GLU A 1 409 ? 64.300 28.548  10.674  1.00 80.10  ? 474  GLU A CD  1 
ATOM   3043 O OE1 . GLU A 1 409 ? 64.335 27.526  11.409  1.00 74.06  ? 474  GLU A OE1 1 
ATOM   3044 O OE2 . GLU A 1 409 ? 64.881 29.614  10.983  1.00 73.26  ? 474  GLU A OE2 1 
ATOM   3045 N N   . ALA A 1 410 ? 60.031 25.652  7.841   1.00 67.57  ? 475  ALA A N   1 
ATOM   3046 C CA  . ALA A 1 410 ? 59.369 24.436  7.374   1.00 64.88  ? 475  ALA A CA  1 
ATOM   3047 C C   . ALA A 1 410 ? 58.642 24.554  5.986   1.00 59.83  ? 475  ALA A C   1 
ATOM   3048 O O   . ALA A 1 410 ? 57.874 23.679  5.597   1.00 54.50  ? 475  ALA A O   1 
ATOM   3049 C CB  . ALA A 1 410 ? 58.451 23.902  8.457   1.00 62.89  ? 475  ALA A CB  1 
ATOM   3050 N N   . TYR A 1 411 ? 58.929 25.622  5.245   1.00 57.02  ? 476  TYR A N   1 
ATOM   3051 C CA  . TYR A 1 411 ? 58.405 25.831  3.863   1.00 65.41  ? 476  TYR A CA  1 
ATOM   3052 C C   . TYR A 1 411 ? 56.950 26.061  4.024   1.00 63.72  ? 476  TYR A C   1 
ATOM   3053 O O   . TYR A 1 411 ? 56.178 25.962  3.073   1.00 63.94  ? 476  TYR A O   1 
ATOM   3054 C CB  . TYR A 1 411 ? 58.682 24.659  2.882   1.00 60.29  ? 476  TYR A CB  1 
ATOM   3055 C CG  . TYR A 1 411 ? 60.163 24.441  2.657   1.00 63.31  ? 476  TYR A CG  1 
ATOM   3056 C CD1 . TYR A 1 411 ? 60.866 25.178  1.679   1.00 56.14  ? 476  TYR A CD1 1 
ATOM   3057 C CD2 . TYR A 1 411 ? 60.894 23.543  3.480   1.00 66.15  ? 476  TYR A CD2 1 
ATOM   3058 C CE1 . TYR A 1 411 ? 62.256 25.010  1.500   1.00 53.67  ? 476  TYR A CE1 1 
ATOM   3059 C CE2 . TYR A 1 411 ? 62.266 23.365  3.308   1.00 64.92  ? 476  TYR A CE2 1 
ATOM   3060 C CZ  . TYR A 1 411 ? 62.944 24.108  2.318   1.00 63.96  ? 476  TYR A CZ  1 
ATOM   3061 O OH  . TYR A 1 411 ? 64.303 23.915  2.149   1.00 70.94  ? 476  TYR A OH  1 
ATOM   3062 N N   . GLY A 1 412 ? 56.586 26.377  5.265   1.00 59.23  ? 477  GLY A N   1 
ATOM   3063 C CA  . GLY A 1 412 ? 55.220 26.739  5.594   1.00 63.72  ? 477  GLY A CA  1 
ATOM   3064 C C   . GLY A 1 412 ? 54.820 28.078  5.027   1.00 65.89  ? 477  GLY A C   1 
ATOM   3065 O O   . GLY A 1 412 ? 53.699 28.237  4.495   1.00 64.81  ? 477  GLY A O   1 
ATOM   3066 N N   . LEU A 1 413 ? 55.744 29.030  5.131   1.00 66.97  ? 478  LEU A N   1 
ATOM   3067 C CA  . LEU A 1 413 ? 55.556 30.327  4.497   1.00 77.01  ? 478  LEU A CA  1 
ATOM   3068 C C   . LEU A 1 413 ? 55.226 30.176  3.002   1.00 77.27  ? 478  LEU A C   1 
ATOM   3069 O O   . LEU A 1 413 ? 54.257 30.803  2.533   1.00 77.98  ? 478  LEU A O   1 
ATOM   3070 C CB  . LEU A 1 413 ? 56.771 31.247  4.705   1.00 83.67  ? 478  LEU A CB  1 
ATOM   3071 C CG  . LEU A 1 413 ? 56.719 32.651  4.073   1.00 86.89  ? 478  LEU A CG  1 
ATOM   3072 C CD1 . LEU A 1 413 ? 55.728 33.615  4.740   1.00 85.03  ? 478  LEU A CD1 1 
ATOM   3073 C CD2 . LEU A 1 413 ? 58.114 33.262  3.999   1.00 93.81  ? 478  LEU A CD2 1 
ATOM   3074 N N   . ASP A 1 414 ? 55.998 29.363  2.259   1.00 73.87  ? 479  ASP A N   1 
ATOM   3075 C CA  . ASP A 1 414 ? 55.695 29.175  0.812   1.00 76.87  ? 479  ASP A CA  1 
ATOM   3076 C C   . ASP A 1 414 ? 54.265 28.678  0.619   1.00 72.28  ? 479  ASP A C   1 
ATOM   3077 O O   . ASP A 1 414 ? 53.489 29.308  -0.120  1.00 62.97  ? 479  ASP A O   1 
ATOM   3078 C CB  . ASP A 1 414 ? 56.730 28.314  0.051   1.00 79.36  ? 479  ASP A CB  1 
ATOM   3079 C CG  . ASP A 1 414 ? 58.156 28.906  0.111   1.00 98.95  ? 479  ASP A CG  1 
ATOM   3080 O OD1 . ASP A 1 414 ? 58.326 30.163  0.098   1.00 89.24  ? 479  ASP A OD1 1 
ATOM   3081 O OD2 . ASP A 1 414 ? 59.119 28.098  0.176   1.00 108.63 ? 479  ASP A OD2 1 
ATOM   3082 N N   . LYS A 1 415 ? 53.906 27.613  1.359   1.00 66.90  ? 480  LYS A N   1 
ATOM   3083 C CA  . LYS A 1 415 ? 52.615 26.968  1.207   1.00 64.01  ? 480  LYS A CA  1 
ATOM   3084 C C   . LYS A 1 415 ? 51.485 27.926  1.461   1.00 66.26  ? 480  LYS A C   1 
ATOM   3085 O O   . LYS A 1 415 ? 50.457 27.905  0.750   1.00 63.98  ? 480  LYS A O   1 
ATOM   3086 C CB  . LYS A 1 415 ? 52.474 25.743  2.096   1.00 62.96  ? 480  LYS A CB  1 
ATOM   3087 C CG  . LYS A 1 415 ? 52.904 24.446  1.421   1.00 70.28  ? 480  LYS A CG  1 
ATOM   3088 C CD  . LYS A 1 415 ? 54.298 23.936  1.808   1.00 59.72  ? 480  LYS A CD  1 
ATOM   3089 C CE  . LYS A 1 415 ? 54.412 22.464  1.391   1.00 54.42  ? 480  LYS A CE  1 
ATOM   3090 N NZ  . LYS A 1 415 ? 55.822 22.021  1.388   1.00 44.15  ? 480  LYS A NZ  1 
ATOM   3091 N N   . ILE A 1 416 ? 51.667 28.781  2.459   1.00 66.18  ? 481  ILE A N   1 
ATOM   3092 C CA  . ILE A 1 416 ? 50.598 29.716  2.800   1.00 73.72  ? 481  ILE A CA  1 
ATOM   3093 C C   . ILE A 1 416 ? 50.368 30.778  1.692   1.00 75.61  ? 481  ILE A C   1 
ATOM   3094 O O   . ILE A 1 416 ? 49.206 31.103  1.397   1.00 71.76  ? 481  ILE A O   1 
ATOM   3095 C CB  . ILE A 1 416 ? 50.806 30.353  4.183   1.00 66.91  ? 481  ILE A CB  1 
ATOM   3096 C CG1 . ILE A 1 416 ? 50.723 29.268  5.253   1.00 71.56  ? 481  ILE A CG1 1 
ATOM   3097 C CG2 . ILE A 1 416 ? 49.766 31.439  4.434   1.00 66.12  ? 481  ILE A CG2 1 
ATOM   3098 C CD1 . ILE A 1 416 ? 51.210 29.722  6.615   1.00 71.52  ? 481  ILE A CD1 1 
ATOM   3099 N N   . GLU A 1 417 ? 51.452 31.289  1.084   1.00 67.27  ? 482  GLU A N   1 
ATOM   3100 C CA  . GLU A 1 417 ? 51.325 32.225  -0.056  1.00 78.13  ? 482  GLU A CA  1 
ATOM   3101 C C   . GLU A 1 417 ? 50.684 31.487  -1.251  1.00 76.47  ? 482  GLU A C   1 
ATOM   3102 O O   . GLU A 1 417 ? 49.724 31.987  -1.835  1.00 76.11  ? 482  GLU A O   1 
ATOM   3103 C CB  . GLU A 1 417 ? 52.659 32.851  -0.517  1.00 72.69  ? 482  GLU A CB  1 
ATOM   3104 C CG  . GLU A 1 417 ? 53.616 33.420  0.513   1.00 81.99  ? 482  GLU A CG  1 
ATOM   3105 C CD  . GLU A 1 417 ? 55.004 33.692  -0.098  1.00 104.52 ? 482  GLU A CD  1 
ATOM   3106 O OE1 . GLU A 1 417 ? 55.174 33.558  -1.337  1.00 110.91 ? 482  GLU A OE1 1 
ATOM   3107 O OE2 . GLU A 1 417 ? 55.950 34.043  0.647   1.00 106.07 ? 482  GLU A OE2 1 
ATOM   3108 N N   . PHE A 1 418 ? 51.215 30.308  -1.597  1.00 65.95  ? 483  PHE A N   1 
ATOM   3109 C CA  . PHE A 1 418 ? 50.612 29.451  -2.622  1.00 77.44  ? 483  PHE A CA  1 
ATOM   3110 C C   . PHE A 1 418 ? 49.088 29.325  -2.393  1.00 77.34  ? 483  PHE A C   1 
ATOM   3111 O O   . PHE A 1 418 ? 48.282 29.276  -3.345  1.00 73.68  ? 483  PHE A O   1 
ATOM   3112 C CB  . PHE A 1 418 ? 51.286 28.064  -2.664  1.00 75.36  ? 483  PHE A CB  1 
ATOM   3113 C CG  . PHE A 1 418 ? 50.613 27.111  -3.614  1.00 83.35  ? 483  PHE A CG  1 
ATOM   3114 C CD1 . PHE A 1 418 ? 49.546 26.304  -3.189  1.00 85.26  ? 483  PHE A CD1 1 
ATOM   3115 C CD2 . PHE A 1 418 ? 51.007 27.040  -4.950  1.00 87.40  ? 483  PHE A CD2 1 
ATOM   3116 C CE1 . PHE A 1 418 ? 48.893 25.442  -4.071  1.00 79.94  ? 483  PHE A CE1 1 
ATOM   3117 C CE2 . PHE A 1 418 ? 50.360 26.175  -5.836  1.00 89.07  ? 483  PHE A CE2 1 
ATOM   3118 C CZ  . PHE A 1 418 ? 49.298 25.377  -5.397  1.00 78.72  ? 483  PHE A CZ  1 
ATOM   3119 N N   . LEU A 1 419 ? 48.712 29.309  -1.115  1.00 73.98  ? 484  LEU A N   1 
ATOM   3120 C CA  . LEU A 1 419 ? 47.317 29.158  -0.720  1.00 74.63  ? 484  LEU A CA  1 
ATOM   3121 C C   . LEU A 1 419 ? 46.449 30.372  -1.002  1.00 70.86  ? 484  LEU A C   1 
ATOM   3122 O O   . LEU A 1 419 ? 45.246 30.239  -0.959  1.00 59.77  ? 484  LEU A O   1 
ATOM   3123 C CB  . LEU A 1 419 ? 47.184 28.757  0.752   1.00 72.77  ? 484  LEU A CB  1 
ATOM   3124 C CG  . LEU A 1 419 ? 47.275 27.244  1.018   1.00 77.24  ? 484  LEU A CG  1 
ATOM   3125 C CD1 . LEU A 1 419 ? 47.350 26.989  2.527   1.00 65.15  ? 484  LEU A CD1 1 
ATOM   3126 C CD2 . LEU A 1 419 ? 46.140 26.437  0.356   1.00 65.88  ? 484  LEU A CD2 1 
ATOM   3127 N N   . GLN A 1 420 ? 47.057 31.533  -1.291  1.00 78.73  ? 485  GLN A N   1 
ATOM   3128 C CA  . GLN A 1 420 ? 46.319 32.761  -1.672  1.00 72.58  ? 485  GLN A CA  1 
ATOM   3129 C C   . GLN A 1 420 ? 45.629 32.654  -3.014  1.00 75.04  ? 485  GLN A C   1 
ATOM   3130 O O   . GLN A 1 420 ? 44.701 33.418  -3.289  1.00 78.18  ? 485  GLN A O   1 
ATOM   3131 C CB  . GLN A 1 420 ? 47.226 33.967  -1.708  1.00 61.27  ? 485  GLN A CB  1 
ATOM   3132 C CG  . GLN A 1 420 ? 47.403 34.610  -0.368  1.00 61.66  ? 485  GLN A CG  1 
ATOM   3133 C CD  . GLN A 1 420 ? 48.658 35.466  -0.310  1.00 74.90  ? 485  GLN A CD  1 
ATOM   3134 O OE1 . GLN A 1 420 ? 48.619 36.639  0.112   1.00 67.61  ? 485  GLN A OE1 1 
ATOM   3135 N NE2 . GLN A 1 420 ? 49.801 34.869  -0.705  1.00 68.24  ? 485  GLN A NE2 1 
ATOM   3136 N N   . SER A 1 421 ? 46.085 31.692  -3.821  1.00 77.41  ? 486  SER A N   1 
ATOM   3137 C CA  . SER A 1 421 ? 45.567 31.416  -5.168  1.00 73.22  ? 486  SER A CA  1 
ATOM   3138 C C   . SER A 1 421 ? 44.875 30.079  -5.164  1.00 74.92  ? 486  SER A C   1 
ATOM   3139 O O   . SER A 1 421 ? 44.806 29.386  -6.179  1.00 81.63  ? 486  SER A O   1 
ATOM   3140 C CB  . SER A 1 421 ? 46.726 31.310  -6.130  1.00 71.43  ? 486  SER A CB  1 
ATOM   3141 O OG  . SER A 1 421 ? 47.930 31.773  -5.525  1.00 96.21  ? 486  SER A OG  1 
ATOM   3142 N N   . HIS A 1 422 ? 44.436 29.670  -3.993  1.00 67.10  ? 487  HIS A N   1 
ATOM   3143 C CA  . HIS A 1 422 ? 43.695 28.449  -3.884  1.00 69.27  ? 487  HIS A CA  1 
ATOM   3144 C C   . HIS A 1 422 ? 42.331 28.898  -4.254  1.00 72.21  ? 487  HIS A C   1 
ATOM   3145 O O   . HIS A 1 422 ? 42.020 30.098  -4.144  1.00 79.38  ? 487  HIS A O   1 
ATOM   3146 C CB  . HIS A 1 422 ? 43.765 27.945  -2.451  1.00 70.55  ? 487  HIS A CB  1 
ATOM   3147 C CG  . HIS A 1 422 ? 43.042 26.650  -2.206  1.00 66.27  ? 487  HIS A CG  1 
ATOM   3148 N ND1 . HIS A 1 422 ? 41.701 26.579  -2.074  1.00 68.24  ? 487  HIS A ND1 1 
ATOM   3149 C CD2 . HIS A 1 422 ? 43.525 25.359  -2.003  1.00 70.63  ? 487  HIS A CD2 1 
ATOM   3150 C CE1 . HIS A 1 422 ? 41.334 25.301  -1.842  1.00 67.84  ? 487  HIS A CE1 1 
ATOM   3151 N NE2 . HIS A 1 422 ? 42.450 24.555  -1.785  1.00 67.90  ? 487  HIS A NE2 1 
ATOM   3152 N N   . GLU A 1 423 ? 41.515 27.964  -4.730  1.00 74.49  ? 488  GLU A N   1 
ATOM   3153 C CA  . GLU A 1 423 ? 40.172 28.294  -5.205  1.00 73.06  ? 488  GLU A CA  1 
ATOM   3154 C C   . GLU A 1 423 ? 39.211 28.638  -4.058  1.00 67.05  ? 488  GLU A C   1 
ATOM   3155 O O   . GLU A 1 423 ? 38.358 29.508  -4.196  1.00 53.58  ? 488  GLU A O   1 
ATOM   3156 C CB  . GLU A 1 423 ? 39.589 27.190  -6.117  1.00 75.17  ? 488  GLU A CB  1 
ATOM   3157 C CG  . GLU A 1 423 ? 40.165 25.792  -5.903  1.00 91.23  ? 488  GLU A CG  1 
ATOM   3158 C CD  . GLU A 1 423 ? 39.099 24.694  -5.889  1.00 100.63 ? 488  GLU A CD  1 
ATOM   3159 O OE1 . GLU A 1 423 ? 37.901 25.018  -5.739  1.00 107.85 ? 488  GLU A OE1 1 
ATOM   3160 O OE2 . GLU A 1 423 ? 39.452 23.496  -5.998  1.00 96.79  ? 488  GLU A OE2 1 
ATOM   3161 N N   . ASN A 1 424 ? 39.338 27.946  -2.934  1.00 73.64  ? 489  ASN A N   1 
ATOM   3162 C CA  . ASN A 1 424 ? 38.422 28.138  -1.798  1.00 75.60  ? 489  ASN A CA  1 
ATOM   3163 C C   . ASN A 1 424 ? 38.586 29.534  -1.129  1.00 80.95  ? 489  ASN A C   1 
ATOM   3164 O O   . ASN A 1 424 ? 39.708 30.030  -0.883  1.00 75.31  ? 489  ASN A O   1 
ATOM   3165 C CB  . ASN A 1 424 ? 38.526 26.949  -0.822  1.00 74.84  ? 489  ASN A CB  1 
ATOM   3166 C CG  . ASN A 1 424 ? 37.471 26.967  0.275   1.00 75.34  ? 489  ASN A CG  1 
ATOM   3167 O OD1 . ASN A 1 424 ? 37.517 27.777  1.218   1.00 76.28  ? 489  ASN A OD1 1 
ATOM   3168 N ND2 . ASN A 1 424 ? 36.544 26.031  0.191   1.00 70.35  ? 489  ASN A ND2 1 
ATOM   3169 N N   . GLN A 1 425 ? 37.428 30.152  -0.887  1.00 87.65  ? 490  GLN A N   1 
ATOM   3170 C CA  . GLN A 1 425 ? 37.272 31.520  -0.407  1.00 90.33  ? 490  GLN A CA  1 
ATOM   3171 C C   . GLN A 1 425 ? 37.916 31.746  0.980   1.00 88.48  ? 490  GLN A C   1 
ATOM   3172 O O   . GLN A 1 425 ? 38.775 32.638  1.158   1.00 75.30  ? 490  GLN A O   1 
ATOM   3173 C CB  . GLN A 1 425 ? 35.764 31.846  -0.385  1.00 94.08  ? 490  GLN A CB  1 
ATOM   3174 C CG  . GLN A 1 425 ? 35.364 33.065  0.439   1.00 105.07 ? 490  GLN A CG  1 
ATOM   3175 C CD  . GLN A 1 425 ? 35.616 34.376  -0.285  1.00 108.54 ? 490  GLN A CD  1 
ATOM   3176 O OE1 . GLN A 1 425 ? 34.953 34.678  -1.278  1.00 102.23 ? 490  GLN A OE1 1 
ATOM   3177 N NE2 . GLN A 1 425 ? 36.565 35.171  0.219   1.00 107.54 ? 490  GLN A NE2 1 
ATOM   3178 N N   . GLU A 1 426 ? 37.488 30.932  1.950   1.00 93.83  ? 491  GLU A N   1 
ATOM   3179 C CA  . GLU A 1 426 ? 37.986 30.997  3.337   1.00 87.40  ? 491  GLU A CA  1 
ATOM   3180 C C   . GLU A 1 426 ? 39.499 30.659  3.418   1.00 76.44  ? 491  GLU A C   1 
ATOM   3181 O O   . GLU A 1 426 ? 40.268 31.363  4.087   1.00 67.62  ? 491  GLU A O   1 
ATOM   3182 C CB  . GLU A 1 426 ? 37.119 30.120  4.256   1.00 90.21  ? 491  GLU A CB  1 
ATOM   3183 C CG  . GLU A 1 426 ? 35.613 30.356  4.106   1.00 86.85  ? 491  GLU A CG  1 
ATOM   3184 C CD  . GLU A 1 426 ? 34.775 29.336  4.873   1.00 96.23  ? 491  GLU A CD  1 
ATOM   3185 O OE1 . GLU A 1 426 ? 34.652 29.480  6.107   1.00 96.32  ? 491  GLU A OE1 1 
ATOM   3186 O OE2 . GLU A 1 426 ? 34.239 28.383  4.255   1.00 91.51  ? 491  GLU A OE2 1 
ATOM   3187 N N   . ILE A 1 427 ? 39.931 29.639  2.674   1.00 68.39  ? 492  ILE A N   1 
ATOM   3188 C CA  . ILE A 1 427 ? 41.360 29.357  2.542   1.00 65.65  ? 492  ILE A CA  1 
ATOM   3189 C C   . ILE A 1 427 ? 42.146 30.579  2.092   1.00 65.71  ? 492  ILE A C   1 
ATOM   3190 O O   . ILE A 1 427 ? 43.040 30.991  2.811   1.00 59.01  ? 492  ILE A O   1 
ATOM   3191 C CB  . ILE A 1 427 ? 41.653 28.230  1.550   1.00 69.22  ? 492  ILE A CB  1 
ATOM   3192 C CG1 . ILE A 1 427 ? 40.679 27.057  1.759   1.00 68.43  ? 492  ILE A CG1 1 
ATOM   3193 C CG2 . ILE A 1 427 ? 43.143 27.896  1.572   1.00 58.02  ? 492  ILE A CG2 1 
ATOM   3194 C CD1 . ILE A 1 427 ? 41.179 25.934  2.621   1.00 74.06  ? 492  ILE A CD1 1 
ATOM   3195 N N   . TYR A 1 428 ? 41.814 31.171  0.927   1.00 71.92  ? 493  TYR A N   1 
ATOM   3196 C CA  . TYR A 1 428 ? 42.606 32.303  0.391   1.00 66.98  ? 493  TYR A CA  1 
ATOM   3197 C C   . TYR A 1 428 ? 42.587 33.498  1.376   1.00 65.83  ? 493  TYR A C   1 
ATOM   3198 O O   . TYR A 1 428 ? 43.612 34.207  1.558   1.00 58.56  ? 493  TYR A O   1 
ATOM   3199 C CB  . TYR A 1 428 ? 42.165 32.711  -1.048  1.00 80.17  ? 493  TYR A CB  1 
ATOM   3200 C CG  . TYR A 1 428 ? 41.626 34.154  -1.197  1.00 90.06  ? 493  TYR A CG  1 
ATOM   3201 C CD1 . TYR A 1 428 ? 42.508 35.271  -1.255  1.00 96.97  ? 493  TYR A CD1 1 
ATOM   3202 C CD2 . TYR A 1 428 ? 40.239 34.404  -1.283  1.00 88.54  ? 493  TYR A CD2 1 
ATOM   3203 C CE1 . TYR A 1 428 ? 42.016 36.579  -1.371  1.00 106.76 ? 493  TYR A CE1 1 
ATOM   3204 C CE2 . TYR A 1 428 ? 39.737 35.704  -1.393  1.00 90.80  ? 493  TYR A CE2 1 
ATOM   3205 C CZ  . TYR A 1 428 ? 40.621 36.786  -1.438  1.00 106.09 ? 493  TYR A CZ  1 
ATOM   3206 O OH  . TYR A 1 428 ? 40.112 38.060  -1.562  1.00 97.50  ? 493  TYR A OH  1 
ATOM   3207 N N   . GLN A 1 429 ? 41.415 33.702  1.997   1.00 61.97  ? 494  GLN A N   1 
ATOM   3208 C CA  . GLN A 1 429 ? 41.210 34.785  2.956   1.00 71.26  ? 494  GLN A CA  1 
ATOM   3209 C C   . GLN A 1 429 ? 42.116 34.595  4.147   1.00 70.18  ? 494  GLN A C   1 
ATOM   3210 O O   . GLN A 1 429 ? 42.855 35.511  4.512   1.00 63.11  ? 494  GLN A O   1 
ATOM   3211 C CB  . GLN A 1 429 ? 39.752 34.894  3.436   1.00 70.80  ? 494  GLN A CB  1 
ATOM   3212 C CG  . GLN A 1 429 ? 38.950 36.074  2.894   1.00 81.85  ? 494  GLN A CG  1 
ATOM   3213 C CD  . GLN A 1 429 ? 39.580 37.457  3.092   1.00 87.60  ? 494  GLN A CD  1 
ATOM   3214 O OE1 . GLN A 1 429 ? 39.193 38.406  2.410   1.00 97.82  ? 494  GLN A OE1 1 
ATOM   3215 N NE2 . GLN A 1 429 ? 40.537 37.577  4.006   1.00 89.12  ? 494  GLN A NE2 1 
ATOM   3216 N N   . LYS A 1 430 ? 42.061 33.398  4.733   1.00 66.20  ? 495  LYS A N   1 
ATOM   3217 C CA  . LYS A 1 430 ? 42.870 33.072  5.906   1.00 67.85  ? 495  LYS A CA  1 
ATOM   3218 C C   . LYS A 1 430 ? 44.353 33.298  5.589   1.00 65.54  ? 495  LYS A C   1 
ATOM   3219 O O   . LYS A 1 430 ? 45.055 34.048  6.272   1.00 67.69  ? 495  LYS A O   1 
ATOM   3220 C CB  . LYS A 1 430 ? 42.618 31.620  6.347   1.00 67.73  ? 495  LYS A CB  1 
ATOM   3221 C CG  . LYS A 1 430 ? 42.985 31.333  7.788   1.00 70.30  ? 495  LYS A CG  1 
ATOM   3222 C CD  . LYS A 1 430 ? 41.753 31.194  8.662   1.00 71.90  ? 495  LYS A CD  1 
ATOM   3223 C CE  . LYS A 1 430 ? 41.926 32.082  9.875   1.00 62.97  ? 495  LYS A CE  1 
ATOM   3224 N NZ  . LYS A 1 430 ? 40.630 32.636  10.352  1.00 70.39  ? 495  LYS A NZ  1 
ATOM   3225 N N   . ALA A 1 431 ? 44.808 32.668  4.522   1.00 63.56  ? 496  ALA A N   1 
ATOM   3226 C CA  . ALA A 1 431 ? 46.164 32.837  4.087   1.00 71.10  ? 496  ALA A CA  1 
ATOM   3227 C C   . ALA A 1 431 ? 46.462 34.323  3.953   1.00 71.77  ? 496  ALA A C   1 
ATOM   3228 O O   . ALA A 1 431 ? 47.523 34.780  4.394   1.00 67.23  ? 496  ALA A O   1 
ATOM   3229 C CB  . ALA A 1 431 ? 46.409 32.109  2.777   1.00 64.06  ? 496  ALA A CB  1 
ATOM   3230 N N   . PHE A 1 432 ? 45.541 35.088  3.379   1.00 63.11  ? 497  PHE A N   1 
ATOM   3231 C CA  . PHE A 1 432 ? 45.834 36.508  3.215   1.00 78.28  ? 497  PHE A CA  1 
ATOM   3232 C C   . PHE A 1 432 ? 45.978 37.259  4.580   1.00 74.79  ? 497  PHE A C   1 
ATOM   3233 O O   . PHE A 1 432 ? 46.983 37.950  4.801   1.00 68.30  ? 497  PHE A O   1 
ATOM   3234 C CB  . PHE A 1 432 ? 44.834 37.153  2.241   1.00 90.36  ? 497  PHE A CB  1 
ATOM   3235 C CG  . PHE A 1 432 ? 45.121 38.598  1.926   1.00 100.93 ? 497  PHE A CG  1 
ATOM   3236 C CD1 . PHE A 1 432 ? 45.988 38.938  0.880   1.00 100.71 ? 497  PHE A CD1 1 
ATOM   3237 C CD2 . PHE A 1 432 ? 44.495 39.629  2.659   1.00 98.09  ? 497  PHE A CD2 1 
ATOM   3238 C CE1 . PHE A 1 432 ? 46.242 40.268  0.579   1.00 103.18 ? 497  PHE A CE1 1 
ATOM   3239 C CE2 . PHE A 1 432 ? 44.744 40.961  2.362   1.00 97.75  ? 497  PHE A CE2 1 
ATOM   3240 C CZ  . PHE A 1 432 ? 45.620 41.277  1.323   1.00 109.66 ? 497  PHE A CZ  1 
ATOM   3241 N N   . ASP A 1 433 ? 45.010 37.084  5.492   1.00 71.35  ? 498  ASP A N   1 
ATOM   3242 C CA  . ASP A 1 433 ? 45.012 37.744  6.820   1.00 70.58  ? 498  ASP A CA  1 
ATOM   3243 C C   . ASP A 1 433 ? 46.237 37.382  7.637   1.00 72.59  ? 498  ASP A C   1 
ATOM   3244 O O   . ASP A 1 433 ? 46.773 38.245  8.349   1.00 66.56  ? 498  ASP A O   1 
ATOM   3245 C CB  . ASP A 1 433 ? 43.789 37.371  7.664   1.00 70.55  ? 498  ASP A CB  1 
ATOM   3246 C CG  . ASP A 1 433 ? 42.458 37.594  6.948   1.00 76.84  ? 498  ASP A CG  1 
ATOM   3247 O OD1 . ASP A 1 433 ? 42.407 38.213  5.856   1.00 77.62  ? 498  ASP A OD1 1 
ATOM   3248 O OD2 . ASP A 1 433 ? 41.437 37.139  7.509   1.00 84.23  ? 498  ASP A OD2 1 
ATOM   3249 N N   . LEU A 1 434 ? 46.668 36.114  7.532   1.00 72.95  ? 499  LEU A N   1 
ATOM   3250 C CA  . LEU A 1 434 ? 47.869 35.620  8.237   1.00 74.67  ? 499  LEU A CA  1 
ATOM   3251 C C   . LEU A 1 434 ? 49.192 36.197  7.747   1.00 76.29  ? 499  LEU A C   1 
ATOM   3252 O O   . LEU A 1 434 ? 50.042 36.618  8.555   1.00 80.04  ? 499  LEU A O   1 
ATOM   3253 C CB  . LEU A 1 434 ? 47.930 34.085  8.274   1.00 78.17  ? 499  LEU A CB  1 
ATOM   3254 C CG  . LEU A 1 434 ? 46.847 33.319  9.057   1.00 82.12  ? 499  LEU A CG  1 
ATOM   3255 C CD1 . LEU A 1 434 ? 47.316 31.895  9.264   1.00 84.40  ? 499  LEU A CD1 1 
ATOM   3256 C CD2 . LEU A 1 434 ? 46.463 33.956  10.390  1.00 72.40  ? 499  LEU A CD2 1 
ATOM   3257 N N   . ILE A 1 435 ? 49.370 36.226  6.431   1.00 77.39  ? 500  ILE A N   1 
ATOM   3258 C CA  . ILE A 1 435 ? 50.513 36.896  5.839   1.00 74.37  ? 500  ILE A CA  1 
ATOM   3259 C C   . ILE A 1 435 ? 50.572 38.315  6.362   1.00 88.26  ? 500  ILE A C   1 
ATOM   3260 O O   . ILE A 1 435 ? 51.638 38.778  6.801   1.00 95.58  ? 500  ILE A O   1 
ATOM   3261 C CB  . ILE A 1 435 ? 50.390 36.938  4.321   1.00 67.47  ? 500  ILE A CB  1 
ATOM   3262 C CG1 . ILE A 1 435 ? 51.126 35.749  3.744   1.00 66.87  ? 500  ILE A CG1 1 
ATOM   3263 C CG2 . ILE A 1 435 ? 51.018 38.198  3.756   1.00 64.47  ? 500  ILE A CG2 1 
ATOM   3264 C CD1 . ILE A 1 435 ? 50.350 35.089  2.634   1.00 64.15  ? 500  ILE A CD1 1 
ATOM   3265 N N   . GLU A 1 436 ? 49.408 38.977  6.340   1.00 82.74  ? 501  GLU A N   1 
ATOM   3266 C CA  . GLU A 1 436 ? 49.299 40.387  6.695   1.00 83.32  ? 501  GLU A CA  1 
ATOM   3267 C C   . GLU A 1 436 ? 49.495 40.610  8.191   1.00 80.61  ? 501  GLU A C   1 
ATOM   3268 O O   . GLU A 1 436 ? 50.161 41.549  8.597   1.00 81.18  ? 501  GLU A O   1 
ATOM   3269 C CB  . GLU A 1 436 ? 47.965 40.983  6.211   1.00 86.95  ? 501  GLU A CB  1 
ATOM   3270 C CG  . GLU A 1 436 ? 47.886 42.503  6.308   1.00 89.60  ? 501  GLU A CG  1 
ATOM   3271 C CD  . GLU A 1 436 ? 46.587 43.054  5.737   1.00 96.74  ? 501  GLU A CD  1 
ATOM   3272 O OE1 . GLU A 1 436 ? 45.501 42.757  6.293   1.00 89.70  ? 501  GLU A OE1 1 
ATOM   3273 O OE2 . GLU A 1 436 ? 46.650 43.785  4.721   1.00 91.99  ? 501  GLU A OE2 1 
ATOM   3274 N N   . HIS A 1 437 ? 48.932 39.728  9.000   1.00 81.23  ? 502  HIS A N   1 
ATOM   3275 C CA  . HIS A 1 437 ? 49.034 39.835  10.444  1.00 79.28  ? 502  HIS A CA  1 
ATOM   3276 C C   . HIS A 1 437 ? 50.392 39.430  10.999  1.00 83.18  ? 502  HIS A C   1 
ATOM   3277 O O   . HIS A 1 437 ? 50.841 40.010  11.988  1.00 85.89  ? 502  HIS A O   1 
ATOM   3278 C CB  . HIS A 1 437 ? 47.911 39.019  11.052  1.00 83.73  ? 502  HIS A CB  1 
ATOM   3279 C CG  . HIS A 1 437 ? 47.622 39.322  12.493  1.00 96.22  ? 502  HIS A CG  1 
ATOM   3280 N ND1 . HIS A 1 437 ? 46.412 39.085  13.043  1.00 107.24 ? 502  HIS A ND1 1 
ATOM   3281 C CD2 . HIS A 1 437 ? 48.423 39.830  13.511  1.00 100.74 ? 502  HIS A CD2 1 
ATOM   3282 C CE1 . HIS A 1 437 ? 46.434 39.424  14.345  1.00 107.11 ? 502  HIS A CE1 1 
ATOM   3283 N NE2 . HIS A 1 437 ? 47.665 39.886  14.631  1.00 110.67 ? 502  HIS A NE2 1 
ATOM   3284 N N   . TYR A 1 438 ? 51.082 38.459  10.394  1.00 75.95  ? 503  TYR A N   1 
ATOM   3285 C CA  . TYR A 1 438 ? 52.291 37.928  11.050  1.00 69.90  ? 503  TYR A CA  1 
ATOM   3286 C C   . TYR A 1 438 ? 53.561 37.932  10.212  1.00 76.74  ? 503  TYR A C   1 
ATOM   3287 O O   . TYR A 1 438 ? 54.645 37.666  10.734  1.00 76.96  ? 503  TYR A O   1 
ATOM   3288 C CB  . TYR A 1 438 ? 52.079 36.499  11.555  1.00 73.43  ? 503  TYR A CB  1 
ATOM   3289 C CG  . TYR A 1 438 ? 50.948 36.317  12.534  1.00 73.86  ? 503  TYR A CG  1 
ATOM   3290 C CD1 . TYR A 1 438 ? 51.126 36.558  13.896  1.00 76.93  ? 503  TYR A CD1 1 
ATOM   3291 C CD2 . TYR A 1 438 ? 49.702 35.881  12.103  1.00 69.84  ? 503  TYR A CD2 1 
ATOM   3292 C CE1 . TYR A 1 438 ? 50.079 36.388  14.795  1.00 76.26  ? 503  TYR A CE1 1 
ATOM   3293 C CE2 . TYR A 1 438 ? 48.661 35.691  12.992  1.00 71.32  ? 503  TYR A CE2 1 
ATOM   3294 C CZ  . TYR A 1 438 ? 48.847 35.947  14.335  1.00 75.18  ? 503  TYR A CZ  1 
ATOM   3295 O OH  . TYR A 1 438 ? 47.787 35.758  15.213  1.00 80.40  ? 503  TYR A OH  1 
ATOM   3296 N N   . PHE A 1 439 ? 53.452 38.217  8.920   1.00 81.27  ? 504  PHE A N   1 
ATOM   3297 C CA  . PHE A 1 439 ? 54.648 38.207  8.086   1.00 74.16  ? 504  PHE A CA  1 
ATOM   3298 C C   . PHE A 1 439 ? 54.937 39.589  7.466   1.00 84.75  ? 504  PHE A C   1 
ATOM   3299 O O   . PHE A 1 439 ? 54.414 39.940  6.400   1.00 78.23  ? 504  PHE A O   1 
ATOM   3300 C CB  . PHE A 1 439 ? 54.618 37.024  7.093   1.00 69.58  ? 504  PHE A CB  1 
ATOM   3301 C CG  . PHE A 1 439 ? 54.579 35.651  7.778   1.00 73.90  ? 504  PHE A CG  1 
ATOM   3302 C CD1 . PHE A 1 439 ? 53.366 35.070  8.173   1.00 73.87  ? 504  PHE A CD1 1 
ATOM   3303 C CD2 . PHE A 1 439 ? 55.757 34.951  8.071   1.00 71.28  ? 504  PHE A CD2 1 
ATOM   3304 C CE1 . PHE A 1 439 ? 53.333 33.837  8.817   1.00 66.53  ? 504  PHE A CE1 1 
ATOM   3305 C CE2 . PHE A 1 439 ? 55.718 33.704  8.710   1.00 66.55  ? 504  PHE A CE2 1 
ATOM   3306 C CZ  . PHE A 1 439 ? 54.510 33.149  9.079   1.00 64.09  ? 504  PHE A CZ  1 
ATOM   3307 N N   . GLY A 1 440 ? 55.741 40.366  8.214   1.00 98.95  ? 505  GLY A N   1 
ATOM   3308 C CA  . GLY A 1 440 ? 56.394 41.629  7.791   1.00 90.18  ? 505  GLY A CA  1 
ATOM   3309 C C   . GLY A 1 440 ? 55.477 42.728  7.306   1.00 91.89  ? 505  GLY A C   1 
ATOM   3310 O O   . GLY A 1 440 ? 55.209 42.822  6.106   1.00 96.27  ? 505  GLY A O   1 
ATOM   3311 N N   . ARG B 2 1   ? 32.702 17.789  18.439  1.00 91.55  ? 222  ARG B N   1 
ATOM   3312 C CA  . ARG B 2 1   ? 32.829 17.137  17.106  1.00 96.72  ? 222  ARG B CA  1 
ATOM   3313 C C   . ARG B 2 1   ? 32.410 15.642  17.177  1.00 106.66 ? 222  ARG B C   1 
ATOM   3314 O O   . ARG B 2 1   ? 32.571 15.012  18.225  1.00 104.02 ? 222  ARG B O   1 
ATOM   3315 C CB  . ARG B 2 1   ? 34.261 17.305  16.586  1.00 92.99  ? 222  ARG B CB  1 
ATOM   3316 C CG  . ARG B 2 1   ? 34.471 16.935  15.112  1.00 85.08  ? 222  ARG B CG  1 
ATOM   3317 C CD  . ARG B 2 1   ? 35.944 17.077  14.716  1.00 85.80  ? 222  ARG B CD  1 
ATOM   3318 N NE  . ARG B 2 1   ? 36.275 16.374  13.473  1.00 82.86  ? 222  ARG B NE  1 
ATOM   3319 C CZ  . ARG B 2 1   ? 37.121 15.351  13.351  1.00 75.58  ? 222  ARG B CZ  1 
ATOM   3320 N NH1 . ARG B 2 1   ? 37.780 14.868  14.403  1.00 64.08  ? 222  ARG B NH1 1 
ATOM   3321 N NH2 . ARG B 2 1   ? 37.302 14.807  12.148  1.00 76.88  ? 222  ARG B NH2 1 
ATOM   3322 N N   . ARG B 2 2   ? 31.841 15.104  16.083  1.00 108.85 ? 223  ARG B N   1 
ATOM   3323 C CA  . ARG B 2 2   ? 31.408 13.677  15.967  1.00 111.66 ? 223  ARG B CA  1 
ATOM   3324 C C   . ARG B 2 2   ? 31.722 13.135  14.562  1.00 122.38 ? 223  ARG B C   1 
ATOM   3325 O O   . ARG B 2 2   ? 32.030 13.908  13.650  1.00 129.56 ? 223  ARG B O   1 
ATOM   3326 C CB  . ARG B 2 2   ? 29.888 13.486  16.232  1.00 100.19 ? 223  ARG B CB  1 
ATOM   3327 C CG  . ARG B 2 2   ? 29.343 14.127  17.501  1.00 99.23  ? 223  ARG B CG  1 
ATOM   3328 C CD  . ARG B 2 2   ? 27.884 13.788  17.805  1.00 102.96 ? 223  ARG B CD  1 
ATOM   3329 N NE  . ARG B 2 2   ? 27.548 14.169  19.191  1.00 108.92 ? 223  ARG B NE  1 
ATOM   3330 C CZ  . ARG B 2 2   ? 27.566 13.334  20.243  1.00 105.02 ? 223  ARG B CZ  1 
ATOM   3331 N NH1 . ARG B 2 2   ? 27.865 12.051  20.067  1.00 98.07  ? 223  ARG B NH1 1 
ATOM   3332 N NH2 . ARG B 2 2   ? 27.272 13.766  21.479  1.00 81.23  ? 223  ARG B NH2 1 
ATOM   3333 N N   . ARG B 2 3   ? 31.637 11.816  14.378  1.00 128.93 ? 224  ARG B N   1 
ATOM   3334 C CA  . ARG B 2 3   ? 31.549 11.248  13.023  1.00 126.15 ? 224  ARG B CA  1 
ATOM   3335 C C   . ARG B 2 3   ? 30.284 10.385  12.906  1.00 120.62 ? 224  ARG B C   1 
ATOM   3336 O O   . ARG B 2 3   ? 29.677 10.280  11.840  1.00 107.65 ? 224  ARG B O   1 
ATOM   3337 C CB  . ARG B 2 3   ? 32.816 10.461  12.629  1.00 118.66 ? 224  ARG B CB  1 
ATOM   3338 C CG  . ARG B 2 3   ? 33.981 11.304  12.098  1.00 108.06 ? 224  ARG B CG  1 
ATOM   3339 C CD  . ARG B 2 3   ? 35.051 10.454  11.409  1.00 101.41 ? 224  ARG B CD  1 
ATOM   3340 N NE  . ARG B 2 3   ? 35.513 9.324   12.238  1.00 103.57 ? 224  ARG B NE  1 
ATOM   3341 C CZ  . ARG B 2 3   ? 36.376 8.374   11.854  1.00 97.64  ? 224  ARG B CZ  1 
ATOM   3342 N NH1 . ARG B 2 3   ? 36.908 8.373   10.636  1.00 106.03 ? 224  ARG B NH1 1 
ATOM   3343 N NH2 . ARG B 2 3   ? 36.708 7.405   12.691  1.00 80.52  ? 224  ARG B NH2 1 
ATOM   3344 N N   . SER B 2 8   ? 35.296 6.770   7.307   1.00 95.67  ? 229  SER B N   1 
ATOM   3345 C CA  . SER B 2 8   ? 34.882 5.363   7.292   1.00 110.98 ? 229  SER B CA  1 
ATOM   3346 C C   . SER B 2 8   ? 33.694 5.039   8.206   1.00 115.59 ? 229  SER B C   1 
ATOM   3347 O O   . SER B 2 8   ? 32.530 5.149   7.793   1.00 113.97 ? 229  SER B O   1 
ATOM   3348 C CB  . SER B 2 8   ? 36.060 4.454   7.672   1.00 109.61 ? 229  SER B CB  1 
ATOM   3349 O OG  . SER B 2 8   ? 36.616 3.806   6.543   1.00 117.79 ? 229  SER B OG  1 
ATOM   3350 N N   . ARG B 2 9   ? 34.035 4.643   9.441   1.00 119.10 ? 230  ARG B N   1 
ATOM   3351 C CA  . ARG B 2 9   ? 33.131 4.114   10.486  1.00 107.85 ? 230  ARG B CA  1 
ATOM   3352 C C   . ARG B 2 9   ? 31.940 3.237   10.026  1.00 107.10 ? 230  ARG B C   1 
ATOM   3353 O O   . ARG B 2 9   ? 30.754 3.640   10.072  1.00 104.68 ? 230  ARG B O   1 
ATOM   3354 C CB  . ARG B 2 9   ? 32.752 5.209   11.509  1.00 102.52 ? 230  ARG B CB  1 
ATOM   3355 C CG  . ARG B 2 9   ? 33.866 5.477   12.531  1.00 102.19 ? 230  ARG B CG  1 
ATOM   3356 C CD  . ARG B 2 9   ? 33.534 6.565   13.559  1.00 101.66 ? 230  ARG B CD  1 
ATOM   3357 N NE  . ARG B 2 9   ? 32.530 6.147   14.550  1.00 109.82 ? 230  ARG B NE  1 
ATOM   3358 C CZ  . ARG B 2 9   ? 31.513 6.912   14.964  1.00 102.43 ? 230  ARG B CZ  1 
ATOM   3359 N NH1 . ARG B 2 9   ? 31.360 8.141   14.474  1.00 96.35  ? 230  ARG B NH1 1 
ATOM   3360 N NH2 . ARG B 2 9   ? 30.637 6.447   15.854  1.00 82.63  ? 230  ARG B NH2 1 
ATOM   3361 N N   . SER B 2 10  ? 32.285 2.019   9.598   1.00 92.54  ? 231  SER B N   1 
ATOM   3362 C CA  . SER B 2 10  ? 31.266 1.014   9.275   1.00 97.05  ? 231  SER B CA  1 
ATOM   3363 C C   . SER B 2 10  ? 31.292 -0.191  10.199  1.00 82.91  ? 231  SER B C   1 
ATOM   3364 O O   . SER B 2 10  ? 32.204 -0.406  11.005  1.00 78.86  ? 231  SER B O   1 
ATOM   3365 C CB  . SER B 2 10  ? 31.326 0.526   7.812   1.00 104.40 ? 231  SER B CB  1 
ATOM   3366 O OG  . SER B 2 10  ? 30.140 -0.171  7.423   1.00 88.92  ? 231  SER B OG  1 
ATOM   3367 N N   . LEU B 2 11  ? 30.282 -1.006  9.986   1.00 64.85  ? 232  LEU B N   1 
ATOM   3368 C CA  . LEU B 2 11  ? 29.782 -1.907  10.962  1.00 58.46  ? 232  LEU B CA  1 
ATOM   3369 C C   . LEU B 2 11  ? 29.837 -3.286  10.381  1.00 47.15  ? 232  LEU B C   1 
ATOM   3370 O O   . LEU B 2 11  ? 30.117 -3.471  9.220   1.00 53.11  ? 232  LEU B O   1 
ATOM   3371 C CB  . LEU B 2 11  ? 28.343 -1.506  11.303  1.00 47.69  ? 232  LEU B CB  1 
ATOM   3372 C CG  . LEU B 2 11  ? 28.199 0.002   11.565  1.00 47.03  ? 232  LEU B CG  1 
ATOM   3373 C CD1 . LEU B 2 11  ? 26.746 0.537   11.510  1.00 40.19  ? 232  LEU B CD1 1 
ATOM   3374 C CD2 . LEU B 2 11  ? 28.861 0.347   12.906  1.00 48.80  ? 232  LEU B CD2 1 
ATOM   3375 N N   . PRO B 2 12  ? 29.612 -4.270  11.215  1.00 50.58  ? 233  PRO B N   1 
ATOM   3376 C CA  . PRO B 2 12  ? 29.377 -5.653  10.767  1.00 50.17  ? 233  PRO B CA  1 
ATOM   3377 C C   . PRO B 2 12  ? 28.122 -5.764  9.866   1.00 53.16  ? 233  PRO B C   1 
ATOM   3378 O O   . PRO B 2 12  ? 27.145 -4.997  10.039  1.00 55.20  ? 233  PRO B O   1 
ATOM   3379 C CB  . PRO B 2 12  ? 29.196 -6.408  12.087  1.00 40.90  ? 233  PRO B CB  1 
ATOM   3380 C CG  . PRO B 2 12  ? 28.890 -5.356  13.109  1.00 44.26  ? 233  PRO B CG  1 
ATOM   3381 C CD  . PRO B 2 12  ? 29.706 -4.164  12.677  1.00 46.65  ? 233  PRO B CD  1 
ATOM   3382 N N   . LEU B 2 13  ? 28.170 -6.653  8.878   1.00 49.48  ? 234  LEU B N   1 
ATOM   3383 C CA  . LEU B 2 13  ? 26.949 -7.025  8.157   1.00 55.78  ? 234  LEU B CA  1 
ATOM   3384 C C   . LEU B 2 13  ? 25.895 -7.468  9.184   1.00 52.02  ? 234  LEU B C   1 
ATOM   3385 O O   . LEU B 2 13  ? 26.159 -8.391  9.949   1.00 54.04  ? 234  LEU B O   1 
ATOM   3386 C CB  . LEU B 2 13  ? 27.221 -8.182  7.169   1.00 59.30  ? 234  LEU B CB  1 
ATOM   3387 C CG  . LEU B 2 13  ? 28.229 -7.945  6.040   1.00 57.25  ? 234  LEU B CG  1 
ATOM   3388 C CD1 . LEU B 2 13  ? 28.337 -9.218  5.240   1.00 48.84  ? 234  LEU B CD1 1 
ATOM   3389 C CD2 . LEU B 2 13  ? 27.748 -6.800  5.171   1.00 62.03  ? 234  LEU B CD2 1 
ATOM   3390 N N   . PRO B 2 14  ? 24.701 -6.831  9.189   1.00 53.35  ? 235  PRO B N   1 
ATOM   3391 C CA  . PRO B 2 14  ? 23.666 -7.118  10.205  1.00 45.93  ? 235  PRO B CA  1 
ATOM   3392 C C   . PRO B 2 14  ? 23.023 -8.510  10.144  1.00 48.52  ? 235  PRO B C   1 
ATOM   3393 O O   . PRO B 2 14  ? 22.573 -8.981  11.177  1.00 59.08  ? 235  PRO B O   1 
ATOM   3394 C CB  . PRO B 2 14  ? 22.605 -6.055  9.945   1.00 49.20  ? 235  PRO B CB  1 
ATOM   3395 C CG  . PRO B 2 14  ? 22.799 -5.648  8.516   1.00 47.28  ? 235  PRO B CG  1 
ATOM   3396 C CD  . PRO B 2 14  ? 24.283 -5.757  8.265   1.00 47.00  ? 235  PRO B CD  1 
ATOM   3397 N N   . LYS B 2 15  ? 22.971 -9.186  9.008   1.00 45.94  ? 236  LYS B N   1 
ATOM   3398 C CA  . LYS B 2 15  ? 22.309 -10.525 8.973   1.00 46.58  ? 236  LYS B CA  1 
ATOM   3399 C C   . LYS B 2 15  ? 23.306 -11.644 8.933   1.00 50.39  ? 236  LYS B C   1 
ATOM   3400 O O   . LYS B 2 15  ? 24.412 -11.448 8.466   1.00 57.38  ? 236  LYS B O   1 
ATOM   3401 C CB  . LYS B 2 15  ? 21.381 -10.689 7.758   1.00 45.67  ? 236  LYS B CB  1 
ATOM   3402 C CG  . LYS B 2 15  ? 20.545 -9.458  7.429   1.00 51.19  ? 236  LYS B CG  1 
ATOM   3403 C CD  . LYS B 2 15  ? 19.157 -9.935  7.148   1.00 55.98  ? 236  LYS B CD  1 
ATOM   3404 C CE  . LYS B 2 15  ? 18.167 -8.798  7.113   1.00 57.49  ? 236  LYS B CE  1 
ATOM   3405 N NZ  . LYS B 2 15  ? 16.962 -9.325  6.385   1.00 58.86  ? 236  LYS B NZ  1 
ATOM   3406 N N   . ARG B 2 16  ? 22.897 -12.833 9.363   1.00 48.45  ? 237  ARG B N   1 
ATOM   3407 C CA  . ARG B 2 16  ? 23.764 -13.977 9.425   1.00 48.55  ? 237  ARG B CA  1 
ATOM   3408 C C   . ARG B 2 16  ? 22.922 -15.192 9.153   1.00 45.62  ? 237  ARG B C   1 
ATOM   3409 O O   . ARG B 2 16  ? 21.970 -15.450 9.871   1.00 47.58  ? 237  ARG B O   1 
ATOM   3410 C CB  . ARG B 2 16  ? 24.346 -14.151 10.850  1.00 62.04  ? 237  ARG B CB  1 
ATOM   3411 C CG  . ARG B 2 16  ? 25.577 -13.330 11.168  1.00 63.33  ? 237  ARG B CG  1 
ATOM   3412 C CD  . ARG B 2 16  ? 26.004 -13.465 12.623  1.00 68.11  ? 237  ARG B CD  1 
ATOM   3413 N NE  . ARG B 2 16  ? 26.631 -12.199 12.985  1.00 77.58  ? 237  ARG B NE  1 
ATOM   3414 C CZ  . ARG B 2 16  ? 27.413 -11.973 14.035  1.00 79.53  ? 237  ARG B CZ  1 
ATOM   3415 N NH1 . ARG B 2 16  ? 27.686 -12.955 14.891  1.00 73.21  ? 237  ARG B NH1 1 
ATOM   3416 N NH2 . ARG B 2 16  ? 27.911 -10.740 14.221  1.00 68.17  ? 237  ARG B NH2 1 
ATOM   3417 N N   . PRO B 2 17  ? 23.272 -15.953 8.124   1.00 47.74  ? 238  PRO B N   1 
ATOM   3418 C CA  . PRO B 2 17  ? 22.594 -17.210 7.867   1.00 45.40  ? 238  PRO B CA  1 
ATOM   3419 C C   . PRO B 2 17  ? 23.172 -18.367 8.678   1.00 50.06  ? 238  PRO B C   1 
ATOM   3420 O O   . PRO B 2 17  ? 24.383 -18.492 8.851   1.00 57.03  ? 238  PRO B O   1 
ATOM   3421 C CB  . PRO B 2 17  ? 22.905 -17.474 6.369   1.00 51.35  ? 238  PRO B CB  1 
ATOM   3422 C CG  . PRO B 2 17  ? 24.216 -16.779 6.125   1.00 48.78  ? 238  PRO B CG  1 
ATOM   3423 C CD  . PRO B 2 17  ? 24.222 -15.571 7.037   1.00 49.67  ? 238  PRO B CD  1 
ATOM   3424 N N   . ARG B 2 18  ? 22.340 -19.288 9.097   1.00 56.83  ? 239  ARG B N   1 
ATOM   3425 C CA  . ARG B 2 18  ? 22.895 -20.480 9.687   1.00 57.63  ? 239  ARG B CA  1 
ATOM   3426 C C   . ARG B 2 18  ? 23.321 -21.465 8.597   1.00 55.39  ? 239  ARG B C   1 
ATOM   3427 O O   . ARG B 2 18  ? 22.511 -21.922 7.806   1.00 50.49  ? 239  ARG B O   1 
ATOM   3428 C CB  . ARG B 2 18  ? 21.952 -21.101 10.685  1.00 49.05  ? 239  ARG B CB  1 
ATOM   3429 C CG  . ARG B 2 18  ? 22.480 -22.436 11.120  1.00 52.25  ? 239  ARG B CG  1 
ATOM   3430 C CD  . ARG B 2 18  ? 22.043 -22.723 12.545  1.00 57.78  ? 239  ARG B CD  1 
ATOM   3431 N NE  . ARG B 2 18  ? 22.464 -24.061 12.927  1.00 61.02  ? 239  ARG B NE  1 
ATOM   3432 C CZ  . ARG B 2 18  ? 22.161 -24.665 14.075  1.00 63.02  ? 239  ARG B CZ  1 
ATOM   3433 N NH1 . ARG B 2 18  ? 21.381 -24.079 15.009  1.00 50.11  ? 239  ARG B NH1 1 
ATOM   3434 N NH2 . ARG B 2 18  ? 22.628 -25.898 14.267  1.00 57.61  ? 239  ARG B NH2 1 
ATOM   3435 N N   . ARG B 2 19  ? 24.621 -21.744 8.540   1.00 64.88  ? 240  ARG B N   1 
ATOM   3436 C CA  . ARG B 2 19  ? 25.160 -22.645 7.532   1.00 72.27  ? 240  ARG B CA  1 
ATOM   3437 C C   . ARG B 2 19  ? 25.406 -24.029 8.122   1.00 76.91  ? 240  ARG B C   1 
ATOM   3438 O O   . ARG B 2 19  ? 25.521 -24.179 9.351   1.00 88.83  ? 240  ARG B O   1 
ATOM   3439 C CB  . ARG B 2 19  ? 26.429 -22.047 6.881   1.00 73.67  ? 240  ARG B CB  1 
ATOM   3440 C CG  . ARG B 2 19  ? 26.193 -21.571 5.452   1.00 80.45  ? 240  ARG B CG  1 
ATOM   3441 C CD  . ARG B 2 19  ? 27.046 -20.391 5.013   1.00 75.54  ? 240  ARG B CD  1 
ATOM   3442 N NE  . ARG B 2 19  ? 26.277 -19.556 4.069   1.00 88.21  ? 240  ARG B NE  1 
ATOM   3443 C CZ  . ARG B 2 19  ? 26.459 -18.239 3.863   1.00 83.02  ? 240  ARG B CZ  1 
ATOM   3444 N NH1 . ARG B 2 19  ? 27.388 -17.578 4.537   1.00 73.70  ? 240  ARG B NH1 1 
ATOM   3445 N NH2 . ARG B 2 19  ? 25.704 -17.567 2.991   1.00 81.51  ? 240  ARG B NH2 1 
ATOM   3446 N N   . ALA B 2 20  ? 25.438 -25.034 7.243   1.00 78.31  ? 241  ALA B N   1 
ATOM   3447 C CA  . ALA B 2 20  ? 25.944 -26.386 7.548   1.00 84.65  ? 241  ALA B CA  1 
ATOM   3448 C C   . ALA B 2 20  ? 24.968 -27.190 8.384   1.00 91.57  ? 241  ALA B C   1 
ATOM   3449 O O   . ALA B 2 20  ? 25.210 -28.357 8.671   1.00 99.22  ? 241  ALA B O   1 
ATOM   3450 C CB  . ALA B 2 20  ? 27.318 -26.322 8.222   1.00 77.40  ? 241  ALA B CB  1 
HETATM 3451 O O   . HOH C 3 .   ? 17.011 -16.637 -3.787  1.00 45.93  ? 2001 HOH A O   1 
HETATM 3452 O O   . HOH C 3 .   ? 5.253  -19.506 0.591   1.00 52.35  ? 2002 HOH A O   1 
HETATM 3453 O O   . HOH C 3 .   ? 2.091  -16.599 1.612   1.00 51.42  ? 2003 HOH A O   1 
HETATM 3454 O O   . HOH C 3 .   ? -0.356 -17.718 12.014  1.00 67.83  ? 2004 HOH A O   1 
HETATM 3455 O O   . HOH C 3 .   ? 24.133 2.817   14.894  1.00 57.41  ? 2005 HOH A O   1 
HETATM 3456 O O   . HOH C 3 .   ? 17.831 12.485  23.611  1.00 61.20  ? 2006 HOH A O   1 
HETATM 3457 O O   . HOH C 3 .   ? 33.335 2.148   35.186  1.00 42.38  ? 2007 HOH A O   1 
HETATM 3458 O O   . HOH C 3 .   ? 34.904 15.393  24.667  1.00 28.02  ? 2008 HOH A O   1 
HETATM 3459 O O   . HOH C 3 .   ? 38.024 17.526  33.259  1.00 52.57  ? 2009 HOH A O   1 
HETATM 3460 O O   . HOH C 3 .   ? 51.947 4.849   14.556  1.00 61.89  ? 2010 HOH A O   1 
HETATM 3461 O O   . HOH C 3 .   ? 42.410 -0.925  8.491   1.00 52.57  ? 2011 HOH A O   1 
HETATM 3462 O O   . HOH C 3 .   ? 51.546 5.634   11.414  1.00 55.26  ? 2012 HOH A O   1 
HETATM 3463 O O   . HOH C 3 .   ? 46.046 30.611  30.984  1.00 54.51  ? 2013 HOH A O   1 
HETATM 3464 O O   . HOH C 3 .   ? 57.170 12.212  16.860  1.00 49.29  ? 2014 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   66  ?   ?   ?   A . n 
A 1 2   PHE 2   67  ?   ?   ?   A . n 
A 1 3   HIS 3   68  ?   ?   ?   A . n 
A 1 4   GLU 4   69  ?   ?   ?   A . n 
A 1 5   ALA 5   70  ?   ?   ?   A . n 
A 1 6   GLN 6   71  ?   ?   ?   A . n 
A 1 7   ILE 7   72  ?   ?   ?   A . n 
A 1 8   SER 8   73  ?   ?   ?   A . n 
A 1 9   ASN 9   74  ?   ?   ?   A . n 
A 1 10  MET 10  75  ?   ?   ?   A . n 
A 1 11  GLU 11  76  ?   ?   ?   A . n 
A 1 12  MET 12  77  ?   ?   ?   A . n 
A 1 13  ALA 13  78  ?   ?   ?   A . n 
A 1 14  PRO 14  79  79  PRO PRO A . n 
A 1 15  GLY 15  80  80  GLY GLY A . n 
A 1 16  GLY 16  81  81  GLY GLY A . n 
A 1 17  VAL 17  82  82  VAL VAL A . n 
A 1 18  ILE 18  83  83  ILE ILE A . n 
A 1 19  THR 19  84  84  THR THR A . n 
A 1 20  SER 20  85  85  SER SER A . n 
A 1 21  ASP 21  86  86  ASP ASP A . n 
A 1 22  MET 22  87  87  MET MET A . n 
A 1 23  ILE 23  88  88  ILE ILE A . n 
A 1 24  GLU 24  89  89  GLU GLU A . n 
A 1 25  MET 25  90  90  MET MET A . n 
A 1 26  ILE 26  91  91  ILE ILE A . n 
A 1 27  PHE 27  92  92  PHE PHE A . n 
A 1 28  SER 28  93  93  SER SER A . n 
A 1 29  LYS 29  94  94  LYS LYS A . n 
A 1 30  SER 30  95  95  SER SER A . n 
A 1 31  PRO 31  96  96  PRO PRO A . n 
A 1 32  GLU 32  97  97  GLU GLU A . n 
A 1 33  GLN 33  98  98  GLN GLN A . n 
A 1 34  GLN 34  99  99  GLN GLN A . n 
A 1 35  LEU 35  100 100 LEU LEU A . n 
A 1 36  SER 36  101 101 SER SER A . n 
A 1 37  ALA 37  102 102 ALA ALA A . n 
A 1 38  THR 38  103 103 THR THR A . n 
A 1 39  GLN 39  104 104 GLN GLN A . n 
A 1 40  LYS 40  105 105 LYS LYS A . n 
A 1 41  PHE 41  106 106 PHE PHE A . n 
A 1 42  ARG 42  107 107 ARG ARG A . n 
A 1 43  LYS 43  108 108 LYS LYS A . n 
A 1 44  LEU 44  109 109 LEU LEU A . n 
A 1 45  LEU 45  110 110 LEU LEU A . n 
A 1 46  SER 46  111 111 SER SER A . n 
A 1 47  LYS 47  112 112 LYS LYS A . n 
A 1 48  GLU 48  113 113 GLU GLU A . n 
A 1 49  PRO 49  114 114 PRO PRO A . n 
A 1 50  ASN 50  115 115 ASN ASN A . n 
A 1 51  PRO 51  116 116 PRO PRO A . n 
A 1 52  PRO 52  117 117 PRO PRO A . n 
A 1 53  ILE 53  118 118 ILE ILE A . n 
A 1 54  ASP 54  119 119 ASP ASP A . n 
A 1 55  GLU 55  120 120 GLU GLU A . n 
A 1 56  VAL 56  121 121 VAL VAL A . n 
A 1 57  ILE 57  122 122 ILE ILE A . n 
A 1 58  SER 58  123 123 SER SER A . n 
A 1 59  THR 59  124 124 THR THR A . n 
A 1 60  PRO 60  125 125 PRO PRO A . n 
A 1 61  GLY 61  126 126 GLY GLY A . n 
A 1 62  VAL 62  127 127 VAL VAL A . n 
A 1 63  VAL 63  128 128 VAL VAL A . n 
A 1 64  ALA 64  129 129 ALA ALA A . n 
A 1 65  ARG 65  130 130 ARG ARG A . n 
A 1 66  PHE 66  131 131 PHE PHE A . n 
A 1 67  VAL 67  132 132 VAL VAL A . n 
A 1 68  GLU 68  133 133 GLU GLU A . n 
A 1 69  PHE 69  134 134 PHE PHE A . n 
A 1 70  LEU 70  135 135 LEU LEU A . n 
A 1 71  LYS 71  136 136 LYS LYS A . n 
A 1 72  ARG 72  137 137 ARG ARG A . n 
A 1 73  LYS 73  138 138 LYS LYS A . n 
A 1 74  GLU 74  139 139 GLU GLU A . n 
A 1 75  ASN 75  140 140 ASN ASN A . n 
A 1 76  CYS 76  141 141 CYS CYS A . n 
A 1 77  THR 77  142 142 THR THR A . n 
A 1 78  LEU 78  143 143 LEU LEU A . n 
A 1 79  GLN 79  144 144 GLN GLN A . n 
A 1 80  PHE 80  145 145 PHE PHE A . n 
A 1 81  GLU 81  146 146 GLU GLU A . n 
A 1 82  SER 82  147 147 SER SER A . n 
A 1 83  ALA 83  148 148 ALA ALA A . n 
A 1 84  TRP 84  149 149 TRP TRP A . n 
A 1 85  VAL 85  150 150 VAL VAL A . n 
A 1 86  LEU 86  151 151 LEU LEU A . n 
A 1 87  THR 87  152 152 THR THR A . n 
A 1 88  ASN 88  153 153 ASN ASN A . n 
A 1 89  ILE 89  154 154 ILE ILE A . n 
A 1 90  ALA 90  155 155 ALA ALA A . n 
A 1 91  SER 91  156 156 SER SER A . n 
A 1 92  GLY 92  157 157 GLY GLY A . n 
A 1 93  ASN 93  158 158 ASN ASN A . n 
A 1 94  SER 94  159 159 SER SER A . n 
A 1 95  LEU 95  160 160 LEU LEU A . n 
A 1 96  GLN 96  161 161 GLN GLN A . n 
A 1 97  THR 97  162 162 THR THR A . n 
A 1 98  ARG 98  163 163 ARG ARG A . n 
A 1 99  ILE 99  164 164 ILE ILE A . n 
A 1 100 VAL 100 165 165 VAL VAL A . n 
A 1 101 ILE 101 166 166 ILE ILE A . n 
A 1 102 GLN 102 167 167 GLN GLN A . n 
A 1 103 ALA 103 168 168 ALA ALA A . n 
A 1 104 GLY 104 169 169 GLY GLY A . n 
A 1 105 ALA 105 170 170 ALA ALA A . n 
A 1 106 VAL 106 171 171 VAL VAL A . n 
A 1 107 PRO 107 172 172 PRO PRO A . n 
A 1 108 ILE 108 173 173 ILE ILE A . n 
A 1 109 PHE 109 174 174 PHE PHE A . n 
A 1 110 ILE 110 175 175 ILE ILE A . n 
A 1 111 GLU 111 176 176 GLU GLU A . n 
A 1 112 LEU 112 177 177 LEU LEU A . n 
A 1 113 LEU 113 178 178 LEU LEU A . n 
A 1 114 SER 114 179 179 SER SER A . n 
A 1 115 SER 115 180 180 SER SER A . n 
A 1 116 GLU 116 181 181 GLU GLU A . n 
A 1 117 PHE 117 182 182 PHE PHE A . n 
A 1 118 GLU 118 183 183 GLU GLU A . n 
A 1 119 ASP 119 184 184 ASP ASP A . n 
A 1 120 VAL 120 185 185 VAL VAL A . n 
A 1 121 GLN 121 186 186 GLN GLN A . n 
A 1 122 GLU 122 187 187 GLU GLU A . n 
A 1 123 GLN 123 188 188 GLN GLN A . n 
A 1 124 ALA 124 189 189 ALA ALA A . n 
A 1 125 VAL 125 190 190 VAL VAL A . n 
A 1 126 TRP 126 191 191 TRP TRP A . n 
A 1 127 ALA 127 192 192 ALA ALA A . n 
A 1 128 LEU 128 193 193 LEU LEU A . n 
A 1 129 GLY 129 194 194 GLY GLY A . n 
A 1 130 ASN 130 195 195 ASN ASN A . n 
A 1 131 ILE 131 196 196 ILE ILE A . n 
A 1 132 ALA 132 197 197 ALA ALA A . n 
A 1 133 GLY 133 198 198 GLY GLY A . n 
A 1 134 ASP 134 199 199 ASP ASP A . n 
A 1 135 SER 135 200 200 SER SER A . n 
A 1 136 THR 136 201 201 THR THR A . n 
A 1 137 MET 137 202 202 MET MET A . n 
A 1 138 CYS 138 203 203 CYS CYS A . n 
A 1 139 ARG 139 204 204 ARG ARG A . n 
A 1 140 ASP 140 205 205 ASP ASP A . n 
A 1 141 TYR 141 206 206 TYR TYR A . n 
A 1 142 VAL 142 207 207 VAL VAL A . n 
A 1 143 LEU 143 208 208 LEU LEU A . n 
A 1 144 ASP 144 209 209 ASP ASP A . n 
A 1 145 CYS 145 210 210 CYS CYS A . n 
A 1 146 ASN 146 211 211 ASN ASN A . n 
A 1 147 ILE 147 212 212 ILE ILE A . n 
A 1 148 LEU 148 213 213 LEU LEU A . n 
A 1 149 PRO 149 214 214 PRO PRO A . n 
A 1 150 PRO 150 215 215 PRO PRO A . n 
A 1 151 LEU 151 216 216 LEU LEU A . n 
A 1 152 LEU 152 217 217 LEU LEU A . n 
A 1 153 GLN 153 218 218 GLN GLN A . n 
A 1 154 LEU 154 219 219 LEU LEU A . n 
A 1 155 PHE 155 220 220 PHE PHE A . n 
A 1 156 SER 156 221 221 SER SER A . n 
A 1 157 LYS 157 222 222 LYS LYS A . n 
A 1 158 GLN 158 223 223 GLN GLN A . n 
A 1 159 ASN 159 224 224 ASN ASN A . n 
A 1 160 ARG 160 225 225 ARG ARG A . n 
A 1 161 LEU 161 226 226 LEU LEU A . n 
A 1 162 THR 162 227 227 THR THR A . n 
A 1 163 MET 163 228 228 MET MET A . n 
A 1 164 THR 164 229 229 THR THR A . n 
A 1 165 ARG 165 230 230 ARG ARG A . n 
A 1 166 ASN 166 231 231 ASN ASN A . n 
A 1 167 ALA 167 232 232 ALA ALA A . n 
A 1 168 VAL 168 233 233 VAL VAL A . n 
A 1 169 TRP 169 234 234 TRP TRP A . n 
A 1 170 ALA 170 235 235 ALA ALA A . n 
A 1 171 LEU 171 236 236 LEU LEU A . n 
A 1 172 SER 172 237 237 SER SER A . n 
A 1 173 ASN 173 238 238 ASN ASN A . n 
A 1 174 LEU 174 239 239 LEU LEU A . n 
A 1 175 CYS 175 240 240 CYS CYS A . n 
A 1 176 ARG 176 241 241 ARG ARG A . n 
A 1 177 GLY 177 242 242 GLY GLY A . n 
A 1 178 LYS 178 243 243 LYS LYS A . n 
A 1 179 SER 179 244 244 SER SER A . n 
A 1 180 PRO 180 245 245 PRO PRO A . n 
A 1 181 PRO 181 246 246 PRO PRO A . n 
A 1 182 PRO 182 247 247 PRO PRO A . n 
A 1 183 GLU 183 248 248 GLU GLU A . n 
A 1 184 PHE 184 249 249 PHE PHE A . n 
A 1 185 ALA 185 250 250 ALA ALA A . n 
A 1 186 LYS 186 251 251 LYS LYS A . n 
A 1 187 VAL 187 252 252 VAL VAL A . n 
A 1 188 SER 188 253 253 SER SER A . n 
A 1 189 PRO 189 254 254 PRO PRO A . n 
A 1 190 CYS 190 255 255 CYS CYS A . n 
A 1 191 LEU 191 256 256 LEU LEU A . n 
A 1 192 ASN 192 257 257 ASN ASN A . n 
A 1 193 VAL 193 258 258 VAL VAL A . n 
A 1 194 LEU 194 259 259 LEU LEU A . n 
A 1 195 SER 195 260 260 SER SER A . n 
A 1 196 TRP 196 261 261 TRP TRP A . n 
A 1 197 LEU 197 262 262 LEU LEU A . n 
A 1 198 LEU 198 263 263 LEU LEU A . n 
A 1 199 PHE 199 264 264 PHE PHE A . n 
A 1 200 VAL 200 265 265 VAL VAL A . n 
A 1 201 SER 201 266 266 SER SER A . n 
A 1 202 ASP 202 267 267 ASP ASP A . n 
A 1 203 THR 203 268 268 THR THR A . n 
A 1 204 ASP 204 269 269 ASP ASP A . n 
A 1 205 VAL 205 270 270 VAL VAL A . n 
A 1 206 LEU 206 271 271 LEU LEU A . n 
A 1 207 ALA 207 272 272 ALA ALA A . n 
A 1 208 ASP 208 273 273 ASP ASP A . n 
A 1 209 ALA 209 274 274 ALA ALA A . n 
A 1 210 CYS 210 275 275 CYS CYS A . n 
A 1 211 TRP 211 276 276 TRP TRP A . n 
A 1 212 ALA 212 277 277 ALA ALA A . n 
A 1 213 LEU 213 278 278 LEU LEU A . n 
A 1 214 SER 214 279 279 SER SER A . n 
A 1 215 TYR 215 280 280 TYR TYR A . n 
A 1 216 LEU 216 281 281 LEU LEU A . n 
A 1 217 SER 217 282 282 SER SER A . n 
A 1 218 ASP 218 283 283 ASP ASP A . n 
A 1 219 GLY 219 284 284 GLY GLY A . n 
A 1 220 PRO 220 285 285 PRO PRO A . n 
A 1 221 ASN 221 286 286 ASN ASN A . n 
A 1 222 ASP 222 287 287 ASP ASP A . n 
A 1 223 LYS 223 288 288 LYS LYS A . n 
A 1 224 ILE 224 289 289 ILE ILE A . n 
A 1 225 GLN 225 290 290 GLN GLN A . n 
A 1 226 ALA 226 291 291 ALA ALA A . n 
A 1 227 VAL 227 292 292 VAL VAL A . n 
A 1 228 ILE 228 293 293 ILE ILE A . n 
A 1 229 ASP 229 294 294 ASP ASP A . n 
A 1 230 ALA 230 295 295 ALA ALA A . n 
A 1 231 GLY 231 296 296 GLY GLY A . n 
A 1 232 VAL 232 297 297 VAL VAL A . n 
A 1 233 CYS 233 298 298 CYS CYS A . n 
A 1 234 ARG 234 299 299 ARG ARG A . n 
A 1 235 ARG 235 300 300 ARG ARG A . n 
A 1 236 LEU 236 301 301 LEU LEU A . n 
A 1 237 VAL 237 302 302 VAL VAL A . n 
A 1 238 GLU 238 303 303 GLU GLU A . n 
A 1 239 LEU 239 304 304 LEU LEU A . n 
A 1 240 LEU 240 305 305 LEU LEU A . n 
A 1 241 MET 241 306 306 MET MET A . n 
A 1 242 HIS 242 307 307 HIS HIS A . n 
A 1 243 ASN 243 308 308 ASN ASN A . n 
A 1 244 ASP 244 309 309 ASP ASP A . n 
A 1 245 TYR 245 310 310 TYR TYR A . n 
A 1 246 LYS 246 311 311 LYS LYS A . n 
A 1 247 VAL 247 312 312 VAL VAL A . n 
A 1 248 VAL 248 313 313 VAL VAL A . n 
A 1 249 SER 249 314 314 SER SER A . n 
A 1 250 PRO 250 315 315 PRO PRO A . n 
A 1 251 ALA 251 316 316 ALA ALA A . n 
A 1 252 LEU 252 317 317 LEU LEU A . n 
A 1 253 ARG 253 318 318 ARG ARG A . n 
A 1 254 ALA 254 319 319 ALA ALA A . n 
A 1 255 VAL 255 320 320 VAL VAL A . n 
A 1 256 GLY 256 321 321 GLY GLY A . n 
A 1 257 ASN 257 322 322 ASN ASN A . n 
A 1 258 ILE 258 323 323 ILE ILE A . n 
A 1 259 VAL 259 324 324 VAL VAL A . n 
A 1 260 THR 260 325 325 THR THR A . n 
A 1 261 GLY 261 326 326 GLY GLY A . n 
A 1 262 ASP 262 327 327 ASP ASP A . n 
A 1 263 ASP 263 328 328 ASP ASP A . n 
A 1 264 ILE 264 329 329 ILE ILE A . n 
A 1 265 GLN 265 330 330 GLN GLN A . n 
A 1 266 THR 266 331 331 THR THR A . n 
A 1 267 GLN 267 332 332 GLN GLN A . n 
A 1 268 VAL 268 333 333 VAL VAL A . n 
A 1 269 ILE 269 334 334 ILE ILE A . n 
A 1 270 LEU 270 335 335 LEU LEU A . n 
A 1 271 ASN 271 336 336 ASN ASN A . n 
A 1 272 CYS 272 337 337 CYS CYS A . n 
A 1 273 SER 273 338 338 SER SER A . n 
A 1 274 ALA 274 339 339 ALA ALA A . n 
A 1 275 LEU 275 340 340 LEU LEU A . n 
A 1 276 GLN 276 341 341 GLN GLN A . n 
A 1 277 SER 277 342 342 SER SER A . n 
A 1 278 LEU 278 343 343 LEU LEU A . n 
A 1 279 LEU 279 344 344 LEU LEU A . n 
A 1 280 HIS 280 345 345 HIS HIS A . n 
A 1 281 LEU 281 346 346 LEU LEU A . n 
A 1 282 LEU 282 347 347 LEU LEU A . n 
A 1 283 SER 283 348 348 SER SER A . n 
A 1 284 SER 284 349 349 SER SER A . n 
A 1 285 PRO 285 350 350 PRO PRO A . n 
A 1 286 LYS 286 351 351 LYS LYS A . n 
A 1 287 GLU 287 352 352 GLU GLU A . n 
A 1 288 SER 288 353 353 SER SER A . n 
A 1 289 ILE 289 354 354 ILE ILE A . n 
A 1 290 LYS 290 355 355 LYS LYS A . n 
A 1 291 LYS 291 356 356 LYS LYS A . n 
A 1 292 GLU 292 357 357 GLU GLU A . n 
A 1 293 ALA 293 358 358 ALA ALA A . n 
A 1 294 CYS 294 359 359 CYS CYS A . n 
A 1 295 TRP 295 360 360 TRP TRP A . n 
A 1 296 THR 296 361 361 THR THR A . n 
A 1 297 ILE 297 362 362 ILE ILE A . n 
A 1 298 SER 298 363 363 SER SER A . n 
A 1 299 ASN 299 364 364 ASN ASN A . n 
A 1 300 ILE 300 365 365 ILE ILE A . n 
A 1 301 THR 301 366 366 THR THR A . n 
A 1 302 ALA 302 367 367 ALA ALA A . n 
A 1 303 GLY 303 368 368 GLY GLY A . n 
A 1 304 ASN 304 369 369 ASN ASN A . n 
A 1 305 ARG 305 370 370 ARG ARG A . n 
A 1 306 ALA 306 371 371 ALA ALA A . n 
A 1 307 GLN 307 372 372 GLN GLN A . n 
A 1 308 ILE 308 373 373 ILE ILE A . n 
A 1 309 GLN 309 374 374 GLN GLN A . n 
A 1 310 THR 310 375 375 THR THR A . n 
A 1 311 VAL 311 376 376 VAL VAL A . n 
A 1 312 ILE 312 377 377 ILE ILE A . n 
A 1 313 ASP 313 378 378 ASP ASP A . n 
A 1 314 ALA 314 379 379 ALA ALA A . n 
A 1 315 ASN 315 380 380 ASN ASN A . n 
A 1 316 ILE 316 381 381 ILE ILE A . n 
A 1 317 PHE 317 382 382 PHE PHE A . n 
A 1 318 PRO 318 383 383 PRO PRO A . n 
A 1 319 ALA 319 384 384 ALA ALA A . n 
A 1 320 LEU 320 385 385 LEU LEU A . n 
A 1 321 ILE 321 386 386 ILE ILE A . n 
A 1 322 SER 322 387 387 SER SER A . n 
A 1 323 ILE 323 388 388 ILE ILE A . n 
A 1 324 LEU 324 389 389 LEU LEU A . n 
A 1 325 GLN 325 390 390 GLN GLN A . n 
A 1 326 THR 326 391 391 THR THR A . n 
A 1 327 ALA 327 392 392 ALA ALA A . n 
A 1 328 GLU 328 393 393 GLU GLU A . n 
A 1 329 PHE 329 394 394 PHE PHE A . n 
A 1 330 ARG 330 395 395 ARG ARG A . n 
A 1 331 THR 331 396 396 THR THR A . n 
A 1 332 ARG 332 397 397 ARG ARG A . n 
A 1 333 LYS 333 398 398 LYS LYS A . n 
A 1 334 GLU 334 399 399 GLU GLU A . n 
A 1 335 ALA 335 400 400 ALA ALA A . n 
A 1 336 ALA 336 401 401 ALA ALA A . n 
A 1 337 TRP 337 402 402 TRP TRP A . n 
A 1 338 ALA 338 403 403 ALA ALA A . n 
A 1 339 ILE 339 404 404 ILE ILE A . n 
A 1 340 THR 340 405 405 THR THR A . n 
A 1 341 ASN 341 406 406 ASN ASN A . n 
A 1 342 ALA 342 407 407 ALA ALA A . n 
A 1 343 THR 343 408 408 THR THR A . n 
A 1 344 SER 344 409 409 SER SER A . n 
A 1 345 GLY 345 410 410 GLY GLY A . n 
A 1 346 GLY 346 411 411 GLY GLY A . n 
A 1 347 SER 347 412 412 SER SER A . n 
A 1 348 ALA 348 413 413 ALA ALA A . n 
A 1 349 GLU 349 414 414 GLU GLU A . n 
A 1 350 GLN 350 415 415 GLN GLN A . n 
A 1 351 ILE 351 416 416 ILE ILE A . n 
A 1 352 LYS 352 417 417 LYS LYS A . n 
A 1 353 TYR 353 418 418 TYR TYR A . n 
A 1 354 LEU 354 419 419 LEU LEU A . n 
A 1 355 VAL 355 420 420 VAL VAL A . n 
A 1 356 GLU 356 421 421 GLU GLU A . n 
A 1 357 LEU 357 422 422 LEU LEU A . n 
A 1 358 GLY 358 423 423 GLY GLY A . n 
A 1 359 CYS 359 424 424 CYS CYS A . n 
A 1 360 ILE 360 425 425 ILE ILE A . n 
A 1 361 LYS 361 426 426 LYS LYS A . n 
A 1 362 PRO 362 427 427 PRO PRO A . n 
A 1 363 LEU 363 428 428 LEU LEU A . n 
A 1 364 CYS 364 429 429 CYS CYS A . n 
A 1 365 ASP 365 430 430 ASP ASP A . n 
A 1 366 LEU 366 431 431 LEU LEU A . n 
A 1 367 LEU 367 432 432 LEU LEU A . n 
A 1 368 THR 368 433 433 THR THR A . n 
A 1 369 VAL 369 434 434 VAL VAL A . n 
A 1 370 MET 370 435 435 MET MET A . n 
A 1 371 ASP 371 436 436 ASP ASP A . n 
A 1 372 SER 372 437 437 SER SER A . n 
A 1 373 LYS 373 438 438 LYS LYS A . n 
A 1 374 ILE 374 439 439 ILE ILE A . n 
A 1 375 VAL 375 440 440 VAL VAL A . n 
A 1 376 GLN 376 441 441 GLN GLN A . n 
A 1 377 VAL 377 442 442 VAL VAL A . n 
A 1 378 ALA 378 443 443 ALA ALA A . n 
A 1 379 LEU 379 444 444 LEU LEU A . n 
A 1 380 ASN 380 445 445 ASN ASN A . n 
A 1 381 GLY 381 446 446 GLY GLY A . n 
A 1 382 LEU 382 447 447 LEU LEU A . n 
A 1 383 GLU 383 448 448 GLU GLU A . n 
A 1 384 ASN 384 449 449 ASN ASN A . n 
A 1 385 ILE 385 450 450 ILE ILE A . n 
A 1 386 LEU 386 451 451 LEU LEU A . n 
A 1 387 ARG 387 452 452 ARG ARG A . n 
A 1 388 LEU 388 453 453 LEU LEU A . n 
A 1 389 GLY 389 454 454 GLY GLY A . n 
A 1 390 GLU 390 455 455 GLU GLU A . n 
A 1 391 GLN 391 456 456 GLN GLN A . n 
A 1 392 GLU 392 457 457 GLU GLU A . n 
A 1 393 ALA 393 458 458 ALA ALA A . n 
A 1 394 LYS 394 459 459 LYS LYS A . n 
A 1 395 ARG 395 460 460 ARG ARG A . n 
A 1 396 ASN 396 461 461 ASN ASN A . n 
A 1 397 GLY 397 462 462 GLY GLY A . n 
A 1 398 THR 398 463 463 THR THR A . n 
A 1 399 GLY 399 464 464 GLY GLY A . n 
A 1 400 ILE 400 465 465 ILE ILE A . n 
A 1 401 ASN 401 466 466 ASN ASN A . n 
A 1 402 PRO 402 467 467 PRO PRO A . n 
A 1 403 TYR 403 468 468 TYR TYR A . n 
A 1 404 CYS 404 469 469 CYS CYS A . n 
A 1 405 ALA 405 470 470 ALA ALA A . n 
A 1 406 LEU 406 471 471 LEU LEU A . n 
A 1 407 ILE 407 472 472 ILE ILE A . n 
A 1 408 GLU 408 473 473 GLU GLU A . n 
A 1 409 GLU 409 474 474 GLU GLU A . n 
A 1 410 ALA 410 475 475 ALA ALA A . n 
A 1 411 TYR 411 476 476 TYR TYR A . n 
A 1 412 GLY 412 477 477 GLY GLY A . n 
A 1 413 LEU 413 478 478 LEU LEU A . n 
A 1 414 ASP 414 479 479 ASP ASP A . n 
A 1 415 LYS 415 480 480 LYS LYS A . n 
A 1 416 ILE 416 481 481 ILE ILE A . n 
A 1 417 GLU 417 482 482 GLU GLU A . n 
A 1 418 PHE 418 483 483 PHE PHE A . n 
A 1 419 LEU 419 484 484 LEU LEU A . n 
A 1 420 GLN 420 485 485 GLN GLN A . n 
A 1 421 SER 421 486 486 SER SER A . n 
A 1 422 HIS 422 487 487 HIS HIS A . n 
A 1 423 GLU 423 488 488 GLU GLU A . n 
A 1 424 ASN 424 489 489 ASN ASN A . n 
A 1 425 GLN 425 490 490 GLN GLN A . n 
A 1 426 GLU 426 491 491 GLU GLU A . n 
A 1 427 ILE 427 492 492 ILE ILE A . n 
A 1 428 TYR 428 493 493 TYR TYR A . n 
A 1 429 GLN 429 494 494 GLN GLN A . n 
A 1 430 LYS 430 495 495 LYS LYS A . n 
A 1 431 ALA 431 496 496 ALA ALA A . n 
A 1 432 PHE 432 497 497 PHE PHE A . n 
A 1 433 ASP 433 498 498 ASP ASP A . n 
A 1 434 LEU 434 499 499 LEU LEU A . n 
A 1 435 ILE 435 500 500 ILE ILE A . n 
A 1 436 GLU 436 501 501 GLU GLU A . n 
A 1 437 HIS 437 502 502 HIS HIS A . n 
A 1 438 TYR 438 503 503 TYR TYR A . n 
A 1 439 PHE 439 504 504 PHE PHE A . n 
A 1 440 GLY 440 505 505 GLY GLY A . n 
A 1 441 THR 441 506 ?   ?   ?   A . n 
A 1 442 GLU 442 507 ?   ?   ?   A . n 
A 1 443 ASP 443 508 ?   ?   ?   A . n 
A 1 444 GLU 444 509 ?   ?   ?   A . n 
A 1 445 ASP 445 510 ?   ?   ?   A . n 
A 1 446 SER 446 511 ?   ?   ?   A . n 
A 1 447 SER 447 512 ?   ?   ?   A . n 
B 2 1   ARG 1   222 222 ARG ARG B . n 
B 2 2   ARG 2   223 223 ARG ARG B . n 
B 2 3   ARG 3   224 224 ARG ARG B . n 
B 2 4   GLY 4   225 ?   ?   ?   B . n 
B 2 5   GLY 5   226 ?   ?   ?   B . n 
B 2 6   SER 6   227 ?   ?   ?   B . n 
B 2 7   ALA 7   228 ?   ?   ?   B . n 
B 2 8   SER 8   229 229 SER SER B . n 
B 2 9   ARG 9   230 230 ARG ARG B . n 
B 2 10  SER 10  231 231 SER SER B . n 
B 2 11  LEU 11  232 232 LEU LEU B . n 
B 2 12  PRO 12  233 233 PRO PRO B . n 
B 2 13  LEU 13  234 234 LEU LEU B . n 
B 2 14  PRO 14  235 235 PRO PRO B . n 
B 2 15  LYS 15  236 236 LYS LYS B . n 
B 2 16  ARG 16  237 237 ARG ARG B . n 
B 2 17  PRO 17  238 238 PRO PRO B . n 
B 2 18  ARG 18  239 239 ARG ARG B . n 
B 2 19  ARG 19  240 240 ARG ARG B . n 
B 2 20  ALA 20  241 241 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  2001 2001 HOH HOH A . 
C 3 HOH 2  2002 2002 HOH HOH A . 
C 3 HOH 3  2003 2003 HOH HOH A . 
C 3 HOH 4  2004 2004 HOH HOH A . 
C 3 HOH 5  2005 2005 HOH HOH A . 
C 3 HOH 6  2006 2006 HOH HOH A . 
C 3 HOH 7  2007 2007 HOH HOH A . 
C 3 HOH 8  2008 2008 HOH HOH A . 
C 3 HOH 9  2009 2009 HOH HOH A . 
C 3 HOH 10 2010 2010 HOH HOH A . 
C 3 HOH 11 2011 2011 HOH HOH A . 
C 3 HOH 12 2012 2012 HOH HOH A . 
C 3 HOH 13 2013 2013 HOH HOH A . 
C 3 HOH 14 2014 2014 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-09-04 
2 'Structure model' 1 1 2015-04-22 
3 'Structure model' 1 2 2015-04-29 
4 'Structure model' 1 3 2015-06-24 
5 'Structure model' 1 4 2015-07-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Derived calculations' 
3 3 'Structure model' 'Source and taxonomy'  
4 4 'Structure model' 'Database references'  
5 5 'Structure model' 'Database references'  
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.6.0117 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CG2 A THR 84  ? ? N  A MET 87  ? ? 1.70 
2 1 O   A ASN 153 ? ? OG A SER 156 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             345 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CD2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            HIS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             345 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.415 
_pdbx_validate_rmsd_bond.bond_target_value         1.354 
_pdbx_validate_rmsd_bond.bond_deviation            0.061 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.009 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A THR 124 ? ? N  A PRO 125 ? ? CA  A PRO 125 ? ? 109.49 119.30 -9.81  1.50 Y 
2 1 CB A LEU 262 ? ? CG A LEU 262 ? ? CD1 A LEU 262 ? ? 100.17 111.00 -10.83 1.70 N 
3 1 C  A PHE 382 ? ? N  A PRO 383 ? ? CA  A PRO 383 ? ? 108.90 119.30 -10.40 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 114 ? ? -62.94 -70.81 
2 1 PRO A 117 ? ? -69.12 57.98  
3 1 SER A 221 ? ? -57.56 -3.77  
4 1 ASP A 327 ? ? -59.89 172.09 
5 1 ARG B 230 ? ? 35.15  72.05  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 THR A 124 ? ? PRO A 125 ? ? -148.09 
2 1 GLY A 157 ? ? ASN A 158 ? ? -133.66 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 66  ? A GLY 1   
2  1 Y 1 A PHE 67  ? A PHE 2   
3  1 Y 1 A HIS 68  ? A HIS 3   
4  1 Y 1 A GLU 69  ? A GLU 4   
5  1 Y 1 A ALA 70  ? A ALA 5   
6  1 Y 1 A GLN 71  ? A GLN 6   
7  1 Y 1 A ILE 72  ? A ILE 7   
8  1 Y 1 A SER 73  ? A SER 8   
9  1 Y 1 A ASN 74  ? A ASN 9   
10 1 Y 1 A MET 75  ? A MET 10  
11 1 Y 1 A GLU 76  ? A GLU 11  
12 1 Y 1 A MET 77  ? A MET 12  
13 1 Y 1 A ALA 78  ? A ALA 13  
14 1 Y 1 A THR 506 ? A THR 441 
15 1 Y 1 A GLU 507 ? A GLU 442 
16 1 Y 1 A ASP 508 ? A ASP 443 
17 1 Y 1 A GLU 509 ? A GLU 444 
18 1 Y 1 A ASP 510 ? A ASP 445 
19 1 Y 1 A SER 511 ? A SER 446 
20 1 Y 1 A SER 512 ? A SER 447 
21 1 Y 1 B GLY 225 ? B GLY 4   
22 1 Y 1 B GLY 226 ? B GLY 5   
23 1 Y 1 B SER 227 ? B SER 6   
24 1 Y 1 B ALA 228 ? B ALA 7   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#